4Y4HC

Crystal structure of the mcd1d/gck152/inktcr ternary complex
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
203
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural modifications of alphaGalCer in both lipid and carbohydrate moiety influence activation of murine and human iNKT cells
rcsb
source organism Mus musculus
total genus 44
structure length 202
sequence length 203
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y4hC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y4hC02
3U6RB 3VWKD 4KY1H 1CD8A 1CDHA 4NUJA 4S1SL 1MCLA 3VXPB 4UOW0 1MJUH 1Y6MR 3UC0H 5C71A 4GG6A 5JA8B 3VDBA 5DO2D 4W70A 4OZIA 1OARH 4X98B 5HYJB 1JPGB 4YGAB 2L7JA 2YPVL 5C92A 1V7NH 4F9LC 3LKRA 5DR5L 1MREL 2PO6B 3OKKB 1IKNC 4LGRB 3VFSA 5IVZB 4KHXH 2VIRA 2V7HA 1BJ1H 4ODUA 1RJCA 1GC1C 3BRGC 3SDDD 1QNZH 4NBZB 5LBSH 2DMBA 1ZLSH 4M1GH 5B21A 1JZ5A 2ARJA 2J8UB 5ACZB 5BZWB 1F90H 2VLRB 4HWZA 4M3KB 3MACL 1MRFL 2A73B 4HC1L 1R3IH 4G42B 4JG0L 3THMH 5EU5B 2YKLL 3GJEB 4OZGE 3QPXH 1BVZA 4JO3L 5D7JA 5IESH 1XCTB 1FDLL 2FEDD 2FH6A 1NDGA 2ZCHL 3F6IA 1D5IH 5E6IC 2A77L 2X9XA 4ORZC 1QBBA 4AIZA 5BO1H 4Y2DC 5JIHA 5J89A 2BSED 5GS0H 1J8HE 1ZLUK 1J0JA 1H15A 2XOTA 3MRFA 2IFFL 3OJDA 5KVMC 3VFNA 5CUSL 2JB5H 3KXFA 3OAYK 1RFDL 2NXZC 5GRUL 3BZFB 1NCNA 3O0RL 4JVUA 4WWKC 4FQHA 4YR6B 2P45B 1A3RL 4YHYB 5BXFB 3C60A 1LO3L 1OQXA 3PWLB 2BVPA 1PQZB 1G7PB 1JL8A 3DROB 4XNYH 2C3GA 2V2XB 4JZOA 1HH9B 3NFNA 4M61A 3SQBA 3U36B 3QEQB 4XCFL 4YO0B 4G80A 4HW6A 2EKJA 5GGUA 3NCEB 4K3HA 3STZB 2DKMA 3IDJA 3CCHB 4LLMA 1AFVH 2CD0A 3DV4B 2NY5C 3U0PA 1WFTA 4KAQH 3HG1A 2F9BT 2FGZA 2OJZL 3BOVA 3FB6A 6CGTA 2HFTA 3RDTD 1PW3A 1F4WH 3FAXA 2XXMB 5KSVB 1SVCP 2Q86A 2YD7A 3S98A 2AJVL 4DFIA 4HS6B 5AEAA 2R1YB 4QXWA 1U8KB 2JJVA 4UTBH 4XCNA 5CD5C 1NAKH 5FYJD 4G9FE 4Y1AE 3X12A 4PB9L 1I9IH 3MJ9H 1H3VA 3H9YA 2BSRB 5IF0A 3MUJA 1ZT1A 3LQZA 4GKZB 4HV8A 3VXSA 4L4TE 5J4MA 3MNWA 2LTQC 4Q2ZB 5HHXH 2ATPA 3VG9B 1JRHL 1MNUH 4C57C 1RJYB 5CMAA 4LSSH 4JANA 1IEHA 4R90H 1NAMH 3M17B 4NZJA 5T5FL 4QO1A 3IFNL 5LXGH 1U3HA 2NY3B 3NFPB 4NJAH 1KLUB 3C5ZB 2PTTB 5F1NB 4X7TA 5BRZE 2NX5D 5I1LB 1A6ZB 5DHXB 3IXTB 5B38A 5D1ZB 5C09E 2R1XA 4KV5E 2DBLH 1VFAB 4HWBL 3CMOH 3HAEG 4LARL 5EZIH 3SE9H 3S37X 2B5IB 3BDYL 3B8SA 4HXAH 1NGZB 3G6DL 5MENE 4PJ8A 4G6AC 3IB4A 2ZUQB 2M26A 4MNQB 4YWGL 3TT3L 3HI5L 1G9NC 2J8UF 3QUYD 5JQ6H 1WF5A 3VXTB 2W60A 3O3DA 1DP0A 2Z91A 3EO9L 1S7WB 4HJJL 1IZKA 5IQ9A 4LCIH 2Y23A 3QJFB 3E8UH 5DVMA 4JFZH 4LASH 3KPMA 3STLB 2BVOB 3K3QA 1J05B 3TJHD 2P5EB 3P9WB 5I6XB 2FH8A 5LG1A 5HHPA 4DAGL 1KPUA 2H6PA 4Y0GA 3VFMB 3DVGA 5C0ND 4O4YL 3V5DA 1T04B 5D2NA 3S34H 2D31B 4KMLB 1KC5H 3MUGA 1KBGL 1CFNB 3RWDB 3QUZB 3ARDC 4BA8A 5GIRB 2J4WH 2RBLA 4H26A 4PJ7A 1OLLA 2FZ3A 5FGRA 4RFOL 2QSTA 5AAWA 5I1JH 1EERB 1K8DB 1HHIA 3EOTH 4LDLB 2F19L 5IMOA 2IG2H 2XXCB 3P4OA 1FSKB 2EE3A 3T2NH 2YD2A 2ZOLB 2EXYC 3Q48A 1XFPA 4JVWA 1FNAA 3CC5B 3ARFD 3GMPA 1SM3L 3MNVB 2E8ZA 3R4DA 3QEQD 3WYRA 5D7IB 1PD6A 5F7EL 3E3QE 1JHKH 2OP4H 4PRHB 4Z8FL 3IGAA 4RMWA 3VFWB 3T04D 3RWCA 4BFIB 4LPVA 1KPVB 2FSEB 1CDGA 3D6GA 4GRMB 4M7KL 4OCMC 4ZYKA 1RIHL 4IMKA 1FNSL 3NIFE 1DE4B 5HI5C 4I3RH 2IANB 4U1MB 2ICEB 4NQXB 2X4OA 1HIMH 2ZUYA 1IMHC 1LK3L 2X4RA 4P46C 5I1GH 4XMPH 5DC4B 1F2QA 3H9HB 1RURL 4P23D 4XPGL 1CIUA 4G7VH 1CDIA 1TVDA 5EH1A 4KQ3H 3L3GA 2QADD 2B1HL 1VGKA 2YN5A 3QQ3A 4V2BA 4TTDD 1EEYA 4NUGL 2FR4B 2QEJA 1GGBL 2DQUH 3VI4E 1FL6B 4YK4B 4ODWB 1Q72H 5MEQA 1X4YA 3LB6D 4X6CE 4PJFA 4Z7WE 2EEDA 4C4KT 2X6MA 4L3CB 4WU5B 3FN9A 3EOAA 1JNHA 1G6RB 1ADQA 3ESVF 4LLWA 1CBVH 2ED7A 3GSWB 3MUHL 2XZCH 4M3JA 4YGVB 4ONGL 3HR6A 4GH7B 1NGPH 2ARWA 2NY3D 1SJVA 4QHNB 3V8OA 5D8JL 5CJQL 4O2FB 3O6LL 1FV1A 1JUFB 5FYLE 1SYVB 5H37H 1J8HD 1TJIH 5J3HC 2DWDA 2FGWL 2DIJA 4PLOB 3C5SB 1Z6JT 1AJ7H 2VE6B 3JWOC 4R3SA 4MNQD 5I74C 2MJWA 4A2MA 3EZJB 1HH6A 3QRFM 4OD2B 3IAGC 2X4UA 5E7BA 4UIKH 2HJFB 4U05A 4WHYG 1E6JL 3BZDA 1E27B 3QJHB 1BIIB 2P49B 4OIAA 1Q0XL 2W65B 1FE8L 4X9GA 3F7VB 5FA4B 4GRWH 4JQIH 5DJXB 4K3JL 4XVSL 2V2TB 3VCLB 2W0FA 2NTFB 4NKOA 2IGFH 2XPGB 2F8VA 4M6MH 1PEWA 3GRWA 4G8IA 1NUGA 5IMLA 4ZFGL 3JUYA 1DSFH 5HVHB 4LRIA 3ZKND 5CS7A 4FQJH 2LU3A 1LWRA 1CVRA 3VRJA 5HI3D 1S9KC 4G9FD 3C2AL 4Y1AD 1SHMA 1W0WA 5FGCB 1XIWA 4N8VB 4GKNB 4ZUWA 3QIWA 4ZOCA 2AJZA 4X9BA 1YYLH 3KPOA 4HUVB 5B4MD 4J3WA 5HYSG 5CZKA 3UZQA 3ZTNL 5GZND 3EYFB 1RMFL 4XP6L 5JW4N 1YY8A 4CGTA 2XNAB 5IK3A 1V8HA 4PP1C 5J1AA 1RJZA 3KWWA 4KKCC 4K71B 3TV3L 5IB1A 5IROC 4TNVF 1OF2B 2IPUK 1LEIB 3E0GA 1HSBB 2OTWB 4N9GB 5BRZD 4FQIL 2F74A 1Q9OB 4JPKH 2IAND 1SMOA 5C09D 5IBLC 3OF6A 3WXWL 4QRPB 4MXVE 3DX9B 4R4BB 2QLVB 5D72H 2CUIA 1CG9B 5F1IB 5IR1A 5C3LD 3MLRL 5MEND 2K7QA 1QSFA 2QHLA 4LLDA 1IE5A 3U7YL 4PS4L 3OB0H 4I0PB 1CTNA 1I1AB 3REWA 5CP7B 3VA6A 5J9PB 3G5ZA 1DUYA 1BZ9B 5B22A 5DQ9B 5DO2C 5AG8A 1FFQA 2EDOA 4FQLH 1G0XA 2G75A 2XN9E 3ULVE 1IC7H 1N5YH 1WFOA 4YEFA 2Z92A 2JK5B 2VZ3A 4P9HL 4YZFE 3MREA 3BN9D 2R29L 4QY8A 3MRRA 2XKNA 3SJVA 1T20A 1JRHI 1ZA3A 2C3HA 4GLRI 4K94C 4GG6E 4OKVB 5CKAA 1IL1A 4FNLH 4OZIE 4U1KA 1G9MC 3SDDC 4NN5C 4L9LB 3NZ8A 3T0WA 2PTVA 4FTVA 2VN7A 5CEYA 1OW0C 1RHFA 1T4KA 2LVEA 1WK0A 3SE8L 5FUOH 1WBXB 5FDWA 1LP9A 4LLUA 1GHFH 2FEDC 5I1DA 5IUSA 3V4VL 4UTAL 4LLVA 1KCSH 5FKAB 3UTZB 3ZL4L 1MWAL 4OD3L 4DKEL 4F7PB 2VSDA 1MCQA 4IMLA 4XCEB 4KJQC 4LF3A 1JGDA 3K1KC 1UKQA 5GS2H 3MLSL 1BWMA 4NQUA 3RI5F 1QSEA 5TQ2L 5DJYB 3AREC 2PW1B 3QO0B 4QRTB 2MPAH 4MD5B 1KJMA 1P9MC 3HZMB 3VFRB 2IADA 4G7YL 1J8KA 3I2CH 4PRDA 5D7LA 4M43H 5KVEH 1T0NB 3KXFE 2YR3A 2VABB 5BS0A 5IM7A 1J0KA 1U6AH 5E2JA 2YEZB 5DUPH 2O5ZL 1X5FA 4HFWA 1PLGL 4P57B 5A2FA 1NGQL 1OAKH 1UWXH 3MV7B 1XR9A 3MRDA 1U95B 4G9DB 4Y5YC 4NO5A 3OL2A 2E9WA 3VI4F 4BZ2L 1Y18B 4XPAH 3QFJB 4HMEA 3RDTC 2ICES 4LAQL 3OJVC 1TETL 4X6CF 5H2BA 3X13A 4KQ4H 3MCKA 4RQQB 2N4IA 3S88L 4CW1B 5JORA 1NCWH 4YUEL 4JHZA 5ALCL 2WINA 4J3OC 3HG1E 3S5LA 1TQCB 5JW4Q 4F15B 4FFZH 4K23H 1PZ5B 4W68A 4PY8I 1WEJL 1X5AA 3NCBB 3RVVD 1MJ8L 1KCRH 2EKSA 4Q0XL 3V95A 4MNGA 4WI5A 5F88B 3OKKA 5CEZL 1NPUA 4ODHH 5IVZA 3DMMA 5IB3A 4FQCL 3WS6A 5T1LA 4MB5A 4O51A 1IAIM 1B9ZA 3AU1A 2X42A 3B5GA 4QRPD 3D9AH 4RAUA 1IT9L 3S3PA 2R2HB 2DBJA 3WS3A 5BZWA 2HFGL 1RHHB 5HPMB 4PJGA 3VXSE 2A73A 5E0QA 1GOGA 1IC4L 2FL5B 1CFQA 2XA8H 1VA9A 3DYMA 1D5BB 1A6AB 4AEHL 1N0XL 5EU7C 1VFOA 3E6FB 1DQLL 4ZFZB 3B2UD 1P5VA 3MBEA 2IF7A 3BI9X 4LKCB 1XT5A 3GSNH 3AM8C 3MLVH 2PO6C 2ZZUT 2B7DT 3V6BR 4PIRF 5D7SL 3WJJA 3VG0L 2ZSVA 4UDUA 2AP2A 1JNLL 2AJUL 1I7TA 4MHHI 3QUML 3RZCD 1IAIL 1GGUA 3TJHC 3NCFB 1AY1H 2Z31B 1TFHA 4GXVH 4K8RH 2BSSB 1RD6A 5EOCJ 2VDQH 4RGNB 5GSVA 1RZJH 3WHE0 1U8HA 3H6JA 1I3UA 4JQXC 3H7BB 4YPGA 4HDIB 2DOCA 3PWJB 4CMMA 4TOYH 3S6CA 1Y0LA 1T1ZB 5EB9A 4YO0A 4OD1L 1FP5A 2KZ1B 3CCHA 4WUKH 2AABL 2ED9A 2UY7A 4KU1A 1N6UA 5IVXB 2DQCL 2AVGA 4HGWA 4TVPH 3BWAB 4WFEE 3ILQC 5F72S 5C0GA 4EZMA 3VGFA 1RUPL 3MCLL 1C12B 2XT1B 4NC2B 4YHYC 2X44D 5KANI 5D2NE 3CFIC 3BN3B 1A6VL 4OIBA 3L5XL 4P9ML 4TUKH 3KGRA 1M1SA 2VDLH 5JO5B 4KDTC 3AAZA 2KPNA 3IDGB 5ICYA 4PJ7E 3DSFL 2M8XA 4NRZB 2OR9L 3OPZL 5GXBB 2BSRA 4J6RL 3GK8H 1YN6B 1NFIA 1MOEA 4X4YB 5I76B 4C83B 5KSAA 3ULVF 1VKXA 4WNQB 5B3JE 1VPOH 4UILH 4BH8A 1BX2A 3QFJD 2WP3O 4B5EA 1CGSL 2YSSB 3TA3B 3CAFA 4GBXA 1Q9WA 4GOSA 1NSNH 4L8BA 4NP4L 1EO8H 3ARPA 2PTTA 4AG4H 3P73B 3G5YB 3WFBL 2ITDB 3GB7A 3P30L 3ULVD 2QADC 4MXWH 1CD1A 1JPTH 3SQOH 4KDVA 1VFAA 2RB8A 4TTDC 3EJJX 5F9JA 1I3GH 1NAMB 3VMNA 4U2ZA 4J23A 2D0GA 1QKZL 3QG6B 3RWIB 1QLRB 2IH1A 2WANA 1QFUL 4G6FD 3LB6C 1BZQK 4UT6L 3U4AA 2SEBA 3VG9C 1OLZA 2GTWB 4JO2H 4AY0A 5IFHH 2YK1H 5IB4B 1E4XL 2JJSC 2W9EL 5I16A 3MV9B 1NBYA 4FQ2L 1IAMA 3FQWB 2NY3C 4UB0H 1UEYA 2FJGB 4DKFL 3HA0A 3C5ZC 1UXWA 4XHJD 3RVUD 2VR5A 3LH2L 5CGYD 1HHGA 3KYKL 5D1ZC 1UKSA 4WW2B 5ABDE 3P11H 2QSCH 4P2QB 1KN2L 4KPHH 4PJFE 3IU4L 3OKEA 3F12A 3MV8A 1U8QB 2VLKB 4HBCH 1K2DA 3MLYH 3UX9B 4NHCL 2B5IC 1NL0L 5CJXC 3VXNA 5B38G 4QOKA 3ET9F 4ZTPL 5IT2L 1MAML 4OCRL 3VFOB 3TM6A 2ZUQC 3SKUD 1FPTH 3VXUB 4Z5RA 4OGYL 3BT2L 1RZFL 3RWDA 3QUZA 1RZ7L 3PQYB 1MJJB 4IOFD 3VXQA 1OAYH 4I18B 2P48B 3KXFD 1YUHB 3VXMB 2AXHA 1N26A 1AGBB 5DA0B 2Z31D 2BXYA 2GYSA 2BERA 2VLME 5GS0D 1RV6X 1IARB 2OJEB 5I6XC 1C5DB 3BD3A 4JJ5B 4W6WB 1M7IB 5IVXF 1IZJA 4TULL 3U2SA 3MMEB 5D7IA 1NUFA 2EDNA 2D3VA 3TNNA 4PRHA 2OBGA 4HKBB 4NQDA 3QUKB 4JRXA 1UB6B 4CVXB 1VEOA 5FA3A 2D9QB 1H5BB 3GHBH 4H1LA 4R4FL 3V6ZA 1NCBL 3T0DA 1AKJB 3RKDD 2X5PA 5HDOA 4ONFL 1TTFA 4KJPD 4XBEH 5HI3C 3F5WA 4RGMB 4ZQKA 2BRRH 2CKNA 1KJ2L 2AK4B 4LMQI 3IJHA 1FSKC 1MCWW 3CK0L 3KPLA 1R6VA 5GZNC 5D70H 5L8LB 1CLZL 3LD8B 1HXMB 1PAMA 4M62H 1N7MH 2YRLA 4FFYL 1Z9SA 4DGVH 5DJ2A 5JIPA 4ODVL 1GOFA 1NBZA 2ADIA 3PWNB 1A4KB 5IB5A 4XTRD 4H8WL 1LGVA 4WI7A 1G84A 1RU9H 4ZSOB 4Q58C 4DKDC 4Y4FA 2HTKC 4ALAL 4PGCA 1WIPA 3ZE2E 1BAFL 2CUHA 1QBAA 1A1OB 2FX9L 3T77B 4LRNH 3OKOB 2X1OA 3RTQB 5EA0L 1U3HD 1TZGL 1S8DA 1EHLH 1JJUA 1ZHKB 5HYIA 5D93B 4JDTH 1XEDA 2BHYA 1BVLA 2N56A 3C09B 4P48A 4OLWH 5KG9B 3QDMB 2GTZB 3JWDH 4WO4A 5T5NG 5E8NB 4YK4C 5BQ7B 2P8MA 5EBMA 4ZFFB 5K9KB 4XAKE 1QSFE 3BN9C 2NR6D 4XPHL 3W0WA 2ARJQ 5CJOL 1X5HA 5BW7A 3BX7C 4OD2A 5ALBL 5HI4C 1NLDH 1N3NA 5I1IL 1RVFL 4WW2F 2PNDA 3KPRB 1MHCB 4UV7H 5I8CB 4O5LL 3VI3E 2Z35B 2HH0H 2CDGB 5F6HI 2HWZH 1A0QL 2JB6B 3WN5A 1P4IH 3BKCL 3D5OF 2W65A 3MV9D 4MA7H 5E6ZA 1RAMA 5DUML 2O5YL 1L4IA 2IC2A 3ARBB 1N2RA 3IFLH 2V2TA 4PG9B 4NGHH 4LLYA 4P2QD 3RPKA 3X3GH 3SJVE 1R24A 4POZD 3MFFB 3O11A 4F37F 1FIGH 3PP3H 3O2WL 3HI6L 1P7KB 2A6KB 4WFED 1ZANH 3FQXB 4FTVE 1KN4H 4GT7A 5I0ZA 4GRWB 1LHZA 4NYLA 1LP9E 4PP2A 4UT7L 1FQ9C 1MPAH 3RX5A 4YDVB 4PBVC 3PQYD 5L9DH 1GSMA 2QJDA 2ZCLL 3QBTB 3VRIB 3QHZH 2R1WA 2CK2A 3U4BL 3ES6A 3VXMD 5ITBH 1JTPA 3QXVA 3HS0B 1YEGH 4ZOEA 1N0LA 2B4CC 1Z5LB 2E9JA 3UBXA 1QQDB 2X9YA 2QSQA 1ZVHA 1N64H 4PV9A 3HZKB 5FO7B 2KKQA 3ULUL 4ZO6A 4C56B 3WE6A 1J1XL 4FZ8L 4HIIA 4M7JL 4WCYH 1DN0A 5HVHC 4U49A 2LVCA 1YEFL 1AKJD 4EEEA 4LEOB 1Q9OA 3MA9L 5TDNB 3W81A 5D7LE 4CDGC 4MAUL 3B9EA 4N90E 1P7QB 3A67L 5DYOB 5BS0E 4ZAKA 4YHNB 2DJUA 3QDGB 3WIIH 1JI2A 1NCUA 2AK4D 2R0ZH 2WMPA 4Y4KA 1CLOL 1L7IL 3BKMH 3P9LB 2DQTL 1E6OH 1I1AA 2QKIA 3D48R 5DQ9A 2NMSA 1EHXA 4K7FB 4OT1H 1WV7T 4K71C 4E41B 5JIIA 3KYAA 2DM2A 1RZKH 1OAQL 1V7ML 1LDSA 2DLGA 4HUUB 3HRPA 2YHGA 1EAPA 4OKVA 4HCRL 5DZOA 2J1KA 4LSUH 8FABA 5GHWH 1RIUL 4FABH 4OLYH 1BFVH 3HZVA 4JRWA 4NQCB 1JTTA 1MFBH 5FDYA 1AR1D 4MNGE 1OCWL 1K4DB 1LK2A 1K85A 4JPWH 4JJHA 3RTQD 3MRCA 4I0PC 1U8NB 1AO7B 2BXZA 3IDYB 3B2UC 1ZT4A 3BGAA 3TIDA 1LO0L 2WIIA 1JGLL 1QVOA 3QDMD 1ZLUH 5EDXA 3NZHH 4P3WA 1B3JA 1H3TA 4PJGE 4QTHB 1IKFL 1T2QL 5JLZA 3OAYH 3NFSH 2XRAH 3KPRD 1C1EH 2BVEA 2HT3D 4KVCL 4M6NH 1EK3A 3IDNB 3RZCC 5HVFB 1E4XI 5FF6B 3O8XB 3SHSA 4L9LC 3O2DL 3CLEH 4K7PL 3MRKB 5E5MA 1BZ7B 5FK9B 1DQJB 5GGTA 4V1DA 2X4QA 4GRWF 3FO0L 4PJBB 2GK0B 2R23B 4D9LH 4J3TA 2YEZA 3GJFA 3DJ9A 4NO3A 3WXVH 4FQPA 1LE9A 2B1AH 3KPSA 1KTLA 2C1OA 1U95A 4AL8H 4G9DA 4KRMB 1INDL 2EDHA 1ZHBA 4F9PA 2HT4D 1DLHB 1W2KT 4NQVB 3IFPA 4IOIB 2C3WA 3TN0A 3C8DA 4RQQA 5F6IB 2B8OT 1G7JB 2AJSH 4EQ3A 5IVNA 1YNTA 1HQRB 3WIFB 4TPRH 4XMLH 3NCCB 4JPVH 1GPOL 4OQ1A 3TBSA 2DDQL 12E8L 3QIWD 3NABL 5ESQA 3S8WA 1YN7A 2BVQA 5MHSE 3BP7B 2NY1B 1JPST 3FT3B 3CX5J 4U1JB 4C56D 1EGJA 1I8KB 2AXJA 1BEYL 2RCSH 4R26H 5DHYA 1GVIA 4TSCL 3L5IA 4AMKH 2DQHH 3IVKB 5I1KL 2VWEE 1ZLVK 4YIQA 1WAAA 5EWIH 1RHHA 4HUNB 4OLVL 2MQCA 3ULVC 1MF2L 5HHVL 2FL5A 2WIMA 4F80A 5E8OB 3TH4T 4MCYB 4XAKD 1WQVT 5DQDL 1TQCC 2B2XH 5MEOA 4B7LA 1BFSA 3N1GC 4P2YA 1UJ3A 5SWSB 1MIMH 1NDMB 3S5LG 4D3CH 4O00A 4L29A 1CK0H 1TPXC 3HI1B 1B0RA 1WCBB 2E8YA 2H3NA 2CRYA 4OAWB 3QNYA 2UZIL 1YPZA 2VISB 4D9RE 1SJEA 3ESUF 4NM8L 4HFUH 7CGTA 3PHSA 4U0QB 1CLYH 5GSRA 4NQCD 4RWYL 1T0MB 3QIBB 2R2BA 1BOGB 4JY5H 5JNYB 1EDQA 3U0WH 4PRBB 4CVZB 3ZSTA 4FQQB 3BJLA 2XZAL 4PRPA 4F7CB 4HF5L 4G8FB 4NO2B 4OSUL 1Z0NA 1KB9J 1C08B 3KJ6L 4KKLD 4QCIB 5IEKB 1R5VA 2EC9T 3FMGH 5HGBB 2ZUWA 3LKNA 3KPTA 3TO4A 4JO4L 2C3VB 3Q2CA 2ICWI 3DHMA 3KNBA 1S7VB 5CJ5A 3CXDL 3MV8E 1IGTB 1YEEH 1XF5B 4IOFC 1D5XA 3U9UA 4PJBF 4YX2L 5FYKH 1NCCH 4QOKE 1AD9B 2ZPKH 1PJ9A 1GGCL 4LNRB 4Z0BL 2Z31C 3BRFA 5GS0C 1H9VA 2AXGB 2JELL 1TVHA 3GNML 4RGNC 4U3XA 5GS2D 3SDXA 1P4LA 2DI7A 2EH8H 4HS3A 5GJSL 1XGQA 3D0VB 1K5NB 1MI5A 4NRZA 3R1GL 1UCBL 1A14H 3OKDA 2X1XR 1XAUA 2YD3A 1MJ7L 3KPPA 4S1RL 3SE4C 4E9LA 5LCVH 4N90D 1VSCA 4O58L 5BS0D 4JY6A 1TLKA 3L1OL 2FX8H 5I76A 3RKDC 5DHVA 4FHBD 1HYSC 4OCYL 4D0BA 4RFEB 5ICXB 2MHAB 4QXTB 2ZG2A 5TF1H 5LQBH 4LCCB 2YSSA 5T3XE 5F7YC 4L3EA 4PRHE 1VDGA 3MTRA 3P73A 3VFUA 4NQDE 2NTSP 1EJOL 4JRXE 4XXDB 2AXFA 1TNMA 4W4NA 4F7EB 1MFCH 3I6KB 4LBEB 3FN3A 1OT1A 5ERWA 1RUQH 5E9DB 3RWIA 1QLRA 1KFAL 3S36H 1W72L 4MQSB 2FCBA 3GMMB 2VSCA 3RA7L 3U48A 4O9HH 5GJTL 3OAUL 2E27L 4I4WA 5IB4A 1MFNA 4PJGF 4UT9H 3UEZA 4NPYA 2A9NL 1N4XH 2IJ0C 3TA3C 3FFDB 4KTEL 5T1LD 4FN0A 2D7TH 2OL3L 1I1FA 4U6VL 4EXPX 2HG5A 1MEXH 4G5ZH 3QUXB 5EU3B 4XBGA 4WHDA 5E03A 3NIGF 3QXTA 4WVRA 1FZMB 2E7CA 3QXUA 3QEGL 4P5KA 4RZCA 1VB9A 3GSXB 3PDOB 1NMCB 4QHKI 3MJ7A 3PIQA 1QO3B 4RISH 1RUKH 3LKPA 3MBED 3RNKB 4NO0B 5LGHL 2V2WB 2YA1A 4FZEH 2R69L 4YHML 4IDJL 4YXKL 1KJ3L 4I18A 3QIUD 3D1MC 3TCLB 2AJXL 1HEZB 3S7GA 3TEUA 1TDQA 3O3EB 3ALPA 2XQBH 4DUXA 4GW1A 3W0WE 1C5DA 3PWPB 4UNVA 1CFVH 4WW2C 4XGZA 3TYFA 1HCVA 4POZC 1KF9B 3BH9A 5GRZA 4AM0B 3UYRL 3MMEA 3QB7C 5HHME 1YYMH 2BK8A 3LIZH 4JKMA 1JNNH 3ZE1F 1KEMH 2F5BH 5KJRH 3DLQR 4G8GB 4P49A 2YUWA 5KS9B 2FO1A 4X5XA 1U93B 4CVXA 4I5BB 4HKZA 4K8RD 2GITA 1PY4A 1P4BH 2IH3A 3OTTA 2FX7L 4OQTH 1FL5A 3PG2A 1DBML 1CGUA 2HJKA 4JCMA 4JVPA 1YNLL 4K9EL 5C6TH 4Y8DC 1MRFH 2DL2A 3PL6A 4K55A 3F7YB 1RIVH 3BP4B 2J12B 4KRNA 3V7MA 2R4RH 2Q76A 3EJZD 4L1DA 4ZDHB 1BLNA 4RMTA 2A77H 5FCUL 4HC1A 1OAZL 1FGNH 2DAVA 1A4JB 4ZXBA 3RY6A 1MCEA 4OZFA 1H5BC 5CSGA 5D4QA 4WJ5A 4YDKL 3RIFF 4X6EB 2L4OA 1A3RH 1ZHLB 2R4SH 4U6YB 5KSAD 5JXAH 1FG2B 3EW3B 5BVPH 4H1LG 2VXQL 3LKQB 3OG6B 4WFGE 4YHKL 1G7QB 3CSBA 4GBXD 2IFGA 4DW2H 3QFDA 2FLBT 4OZ4B 3TGXA 4JN1L 4N0RA 3HNVL 4ODTL 4QHLA 2VH5H 3WV0A 3Q6GL 3WNLA 4XX1G 5C9JA 2IAMB 3LD8C 1X7QA 3SGEH 3FB5A 2GTZA 3CUPB 3LV3A 4HKJA 2V9QA 4U7KA 5LJYH 4D9RD 4JFEB 1W8NA 3NCMA 4CU7A 4PJCB 1CDCA 3IJYB 3NTCL 4PGDB 1Z9LA 3BP6B 1A02N 2MWCA 3WBDA 2DD8L 3BUTA 4PY7A 1JGUL 1M6OA 4NJ9L 1DBKL 1EO5A 2JB6A 4JR9L 4XP5H 3FO2A 2Q8AH 4X8JA 2WUCL 4Z7OF 1KXTB 2YN3A 1CYGA 1C5CH 2BDNH 4YLQT 8CGTA 3VGBA 3RTQC 3FO1B 4A2LA 1I7RA 3MFFA 1KCUL 2NY4B 4HGKC 5GGVL 4JO1H 3LPWA 4P59H 3EYOA 2CRIA 3C09C 5DGQA 1LILA 3DO7B 3MV8D 1B2WL 3FQXA 2I60L 4GLRH 5ADOL 3MPCA 3CFDB 3HMWL 4PGEB 1VACB 5DXWA 5I30H 2MTPA 3HE6B 1OM3L 1FZJA 2D4FA 1ZGLP 4HUWB 4DGIH 4I1NB 3MRHB 3C6SB 3EJYC 4HIJB 1ZEAL 2J3SA 4YBLB 2AQ1A 3RWFA 1WJ3A 1PX4A 5KS9F 1Z5LA 4GW4B 3ARBC 4DOHB 3KPNA 2FD6L 2P7TA 2VLJA 2Y06L 4J4PD 5EPMB 4BSVB 3HZKA 3O9WA 2Q7NA 1IQWL 1OPGH 2ZKHH 3SKMA 5GRYA 1YC7A 4G8GD 3HFML 4HWBA 3MA7A 3WLBB 2HRLA 5ESVB 3G04A 3ARQA 5D5MB 5T3XD 3TP4A 4PLJD 3DVNA 3SPVA 4OCWL 3DV6B 5IHUL 4HHAA 4JRXD 5EBWB 3MLUH 4V1DE 4M4PA 2FWOA 5I1AA 2NY5L 1MHHA 5I15L 4XWOD 2ITCB 4N5EC 5KZCD 3MR9B 2JIXA 2ENYA 4DN4H 3OQ3B 4EDWH 5DS8B 3PHOA 3KPSE 2V5MA 4LQFH 5DMGC 1S78C 3P9LA 4CVWA 2I5YH 1KIPB 5TE6L 1OTSD 2CJUL 1TTGA 1Q9LB 5ENWB 4JQVC 5ANMB 3UBXG 3L5JA 1F8TH 4O02H 4UINH 5EZJA 3ZDYE 4JZNB 3K74B 3WSQH 5AZ2H 2AGJH 3LRSB 7FABL 4Q9QH 2YUZA 3GSVB 1A1NA 3R8BB 4NQEA 4NNXA 2IPKB 5CEXA 3HCVA 5JW5B 1SEQH 4Y4FD 1W0VA 3A6OA 5C0IA 1K4DA 5JW3L 1QUNA 2H1PL 5TPWH 1S7QB 3C8HA 5EBLB 3SDCB 1UWEH 3BRDA 2RAMA 1U8NA 3B2VL 1CICB 2DQJL 5E08L 3L5WB 3ORJA 3QXDB 4M7KH 3EGSB 1WAAE 3LQAH 5J7CC 4JFED 2GIYA 2XQYG 4Q74A 3WO4B 1MLBB 1E28B 3GMLB 5AUMA 3P3YA 1G9NL 3QISA 1MCOH 3TBTB 3G6JE 1TITA 3IDNA 4OFYD 1NGYB 3O8XA 4ZPTA 2EE2A 3B9KA 4PD4J 2HJLB 4MA8L 1JYVA 2UYLA 3LSOA 5C8JB 4X5WA 3MNZA 2JJWA 4K2UH 3GI9L 1YMMB 2BC4A 4KHTH 5FK9A 1CZ8H 4OV5A 1QYGH 5D2LB 1JN6A 2B0SL 5DK0B 3IDYC 5CLWA 2ADJB 1YPZE 2X89A 3FTGB 5F44A 3HUJB 5D1XA 4KKLC 3ZYOA 2DIBA 4U1NB 4C58B 3LEYL 4YNYB 3EYQD 5E8PA 5TQ0H 3I02B 5HHOA 3FCTA 2BY0A 4XCCL 3BHBB 4QRQB 1ES0A 2CIIB 3RL2B 4IOIA 2KL6A 1FGVH 4PRPE 3KLAA 1FLTX 1G7JA 2Z4QA 1NMBL 4ELKA 4N0YL 3OHXB 5J56B 2HAZA 1NJ9B 1JWUB 4LVOB 1QLEL 1QA9B 2LV4A 4NNPL 1S7UA 1AP2B 1II4E 5D5MF 5DC0A 3CPLB 3DXAA 1EIBA 1I1CA 1QFWH 4GRLB 2ICCA 3T8XB 4EN3B 3BWUC 1ORQB 3N1QC 3R8QA 1MH5B 1YZZA 3DVFA 2DQGL 4X6FB 4OLZL 4U6TA 3SE3C 4JFDB 1CWVA 4MWFB 1UWGL 3DTXB 3PUCA 1HSAA 3O2VH 4WFGD 1HKFA 3SDXE 1E6JH 1KCVL 3T4AB 4N1CA 1MI5E 3CVHH 5EU4A 2E7LC 3CFEA 1KLGB 1GAFL 4ZAKD 4XNXH 2YOCA 5AWNL 2CLVA 3L3DB 4MCYA 4APQB 4Y4KD 1A3QA 5CJ8A 1MUJB 1E4WL 4NM4L 1DVFD 5EUOA 2NY1C 3STBA 4XP1L 1RQ5A 1K9TA 4XC1H 4TUJB 4K3EH 4L3EE 4X7CC 4RX4A 1XGPA 5TGBA 4JRYB 4Z77B 5FGBA 5ICZB 2DRUA 1HXYB 1IILE 3DX8A 1G7HB 3K8LA 3KDMA 4N9OB 1BQUA 1ZS8A 1L0XA 3CU7A 3QZWA 4TN9A 4DJMA 1HKLL 4FQXB 3PGFL 4GMSH 3MJ8A 4FG6D 2YD6A 4F33A 5I9QB 3WEXB 4FFVD 3A6CL 4YEEA 2ZCKL 5EZLA 5F7NC 2K9UA 4PJIA 3U0TA 3EIFA 3G9VA 2W9DL 3B8YA 1VGEL 1HILB 3FT2A 3U1SL 4OFVA 3B3IB 5AD0A 4U33A 5DJ8A 5T1KB 4J1UA 1CU4L 3K1DA 4QCIA 2FRGP 3UO1L 5HGBA 2UY6A 2G2RA 1AQDA 4FQIH 3L95A 3BESR 5KVDL 3SGKC 5DA4A 1S7VA 5CHNA 1M7XA 2OSLB 4LDEB 5CBEB 1I1YB 1XGYH 1UCTA 4IOSD 4LGPB 4LSPH 2CR6A 4U0RB 1NBVH 3N85L 5D2LF 4CNIA 3C5JA 3T1FA 3QIUC 2A74B 1AD9A 3W2DL 3HRZA 4Y19B 2IBZY 3BIBX 4OIIH 5DEFB 3MXWH 3QIBC 4QYOB 3O45B 3ZE0E 4BKLB 2I07B 4GS7B 2VDPL 4L8DB 1EHAA 3L3JB 5D71H 1ITBB 5K93A 3ZSSA 5EUKB 4D9QD 2OTUB 5I1CH 4KMTL 4OZHA 3V4UL 3FOLB 4K8RC 1T66D 2Y36H 4OM1L 3BPLC 3MRIB 4KJYA 3ARUA 5DMKA 2IPTL 1RZJC 2VDRH 3QDHA 4W6XB 5FAAA 2MHAA 1B0GA 5F1KC 43CAB 3B9VA 3PDGA 1GIGH 2UVEA 3PNWA 4XVJH 5L6YL 3IJSB 4PB0L 2XWJA 3CFBA 3MGAA 3TN0D 4TSAL 3CD4A 1VADB 5GRJH 1PVHA 2WLZA 1TXKA 4F7EA 3EJZC 2R0KH 3D3VB 3ZL4H 5JHDA 4OD3H 3BSZH 3MGTB 1YNKL 1BGXL 3HLAB 4MB3A 4EN3D 5E9DA 2J6EH 3FFCB 1A6TB 3E6HB 4NRYA 3NBNA 4MS8D 3GMOB 3DUHA 2PN5A 1KT2B 3U4EA 1MWAA 4QHUB 4M93B 4KZEH 4LCCC 4WDIB 4JFFB 5ID1B 3OKNA 1XGUB 3FFDA 4IHOB 4JLRA 5A16B 1FFNA 1MQKH 4HT1H 4MQ7B 3QUXA 3G6JF 3P9MB 1IAKB 5EU3A 5F9WB 2CIKA 4APQD 1P2CA 5SWZA 4X4ZA 3DRTA 2L0DA 3RNQB 4BK5A 4P2CG 4E5XB 1NGQH 2EYSB 4OGXL 4Z7UB 2XFXA 1T21B 2G60L 1MCJA 1ZT7B 1U8LB 2VZOA 3ETBF 5ADPH 2V2WA 1G1CA 2BVTA 5AYUH 1YDPA 1YECL 1RK0B 2HFEA 4NQSA 3VWJB 4F7TA 1S7RB 4RMQA 1UYWH 4K94L 4Z7QF 6FABH 3TFKD 3O3EA 2WBKA 1M05B 1G9ML 3NIDF 1KJVA 3FB8B 3OV6A 3H7LA 4G43B 1ZVSB 1EEZA 1KTKE 3T2QA 1G7IA 5DI8B 3W82A 4JFOB 2FHCA 1TQBB 2WWMC 3DECA 3SKNB 2VDML 1I8MA 3IYLW 1T83C 3P0YH 4PRPD 2ZUSA 3LEXA 4PRIA 4TQEH 4X7DC 1NMCC 3T65B 3GUTA 4ONOA 2AI0L 2YRZA 1F6AA 3VA2C 3MJGX 1T3FA 2I9LA 3MODH 5D6DA 3RWGA 5FB8B 4GQ9H 4N0UA 4YHPB 1A6UL 4ORGB 3NMEA 2VQTA 1KTDA 5EO9A 3HMXL 5T3ZL 5DMIH 4Q6YA 5DK2A 5HYQB 1ZAGA 3L9RB 2VAAA 5FO9A 4ETQA 2VJXA 3D39A 4J4PC 3D2UB 5EOCL 4QXGH 5A2KH 5KN5B 2NY0B 1ODAA 5FYKD 4LIQH 5HSFA 1XF4A 4NN6B 4DQOH 3H0TB 4MDIB 3AS0A 3VG0H 5EN2A 3GMNA 4YAQA 1T89C 5F7DB 2YA0A 4U6YA 2RQ8A 3SY0B 2VLJE 4U31A 4M1CD 4XWOC 3W5NA 1FORL 1TENA 5BMFH 5GGQL 1EVTC 4F3FB 4QHMB 1WFNA 4ODSH 4NWUL 3MRQB 3QUMA 4PJ5A 4QTIH 4WENB 4GMTH 3MRGA 5DLML 3EFDL 2FJHA 3D3VD 1L7TL 1BVKA 4X80L 3N9GL 3FRUA 3FFCD 1FO0L 3BPCB 2ZOKA 1RZGA 5ISZA 1N6QH 4OF5A 3T4YB 5DJ6B 5CIPA 1R3HB 1C16A 1MCKA 1MFEL 5ESAA 1T7XA 3RWJB 4XH2B 2NYYD 3O41B 4OZFG 2R9HD 5DD1H 4L4VD 4PJ9B 1JGEB 5MI0B 3UTSE 3S3SA 1A3LL 3CZFB 2NXYB 1AI1L 2HKFH 4R96B 2W92A 1BD2A 4QRSB 4NQEE 4LPTA 2GI7A 2IAMC 5J57B 3ZE0F 4IRSA 4M7LH 4IIQA 3GMRB 3I3EA 4WV1B 3MLPA 3BPOB 1G7LA 2YD5A 3GKWH 3HE6A 4KZDH 4Y5VA 5E2VL 3UZEA 3BQUB 4GAJL 3I3DA 4UUJB 2APVA 2X1QA 2D03H 2YBRB 4HIJA 3ZMRA 4Z7NE 1OTUC 4D8PA 3VWJD 1S9YB 3JWDC 3CH1B 5H37G 1NMAL 5J13B 1D6VH 2HRPL 2AJYH 1HDMB 2DF3A 1D9KB 3IS0X 5L88H 2V5SA 5DRNA 4XMKL 1GZQB 2OS7A 2NY4C 5GGSY 2AQ2A 3SGDI 1UZ6E 2WW8A 3WLBA 4XZUB 3EYQC 3ARYA 1QOKA 1QHPA 5F9DC 5D9SA 5EBWA 4PJHB 2GJZB 2ADGB 2QR0B 4R7NB 3WUWA 4M6AA 2CH8A 5HHNB 4D94A 3K4AA 2R0WH 1H3PL 2HVKA 2ITCA 3MR9A 4ACPA 3PP4H 3MYJA 5EU6B 3K7UA 2P47B 5DS8A 3GBML 4YBLC 3QCVL 4PRAB 5HGAA 1IM9B 5JDSB 4JAMB 4LLAA 5HHOE 2CSPA 1KIPA 3PL6D 3V0VB 2F5AH 4R8WH 1AD0A 4XP9L 3S4SB 2BCKB 2APFA 1MAMH 5GGSB 2HMID 4YQXL 1PBYA 4BK4A 4C55A 1JHTB 2NY0D 5IVOA 3SDYL 4NZTL 1A7OH 3W5MA 4JPIB 4GG8B 1ONQA 1Z9OA 4AEIH 5I18L 4BJLA 4DVBB 2ID5A 2Y4SA 5CILL 3VDAA 5ACMA 4ZXBD 3INUH 4AENA 1EFQA 1WTGT 3EFFB 3FQTA 4F58H 3GSVA 2K7PA 3DXAE 4WU7B 3C9NB 4ETYA 3BH8B 1CXKA 2P8LB 4LSDA 3N50A 1I7UA 1UH3A 1DBJL 1GH7A 3UJTL 5DJAB 2CLZB 1S9WB 4MNHA 3PWVA 3RWEA 4EUPA 2KQMA 3G9AB 2HKHH 1JWSA 4EI5A 1QACA 5C0RH 4BFEA 4MQXD 4HKXB 1DVFC 3O6KH 1F58H 4UBDD 3L5WA 1EFXA 4CKVX 1A7QH 3L6FB 3L3OA 5E56A 2E9IA 1S5HB 1TJHH 4G6MH 4KK6D 1N59A 2VDOL 1VFBB 3MRLB 1J88A 4NRXB 5LAXA 2PYEE 5IG7B 2XKSA 1A9EA 3DI3B 3GMLA 2AEPL 4OCSL 4U6HB 3DSNA 1KEGH 3DGGB 3TBTA 5EUOE 2OMNA 3AXLB 4LPCA 3CK0H 3QCTL 4KK9D 2Q6WB 4PD4K 4PJXB 3HC4L 4KVNH 1BQSA 1KJ2A 2D7NA 1RZKC 1YMMA 3P0VL 1Y6KR 1CLZH 3SDCC 3DIFA 2DYPA 1JFQL 1NEUA 3U7WH 1CICC 2ADJA 1OB1B 3FTGA 4U1SB 3ZYIA 2DQFB 4XWGL 5IFAL 1D3CA 1ZTXL 3NN8A 2JE8A 4XNUL 1ZLWK 1ZSDA 4MD4B 4ERSL 3I02A 4DZBA 3SBWC 4PJIE 3WO4C 1AC0A 1BAFH 3RL2A 1IEBB 3EHBC 4H20H 43C9B 4PBXA 3HE7B 4M5YL 4JY4A 3WJLC 1ZHNA 4N8CL 2YD9A 1NJ9A 2CKBH 4B0MM 3PABA 5FYJH 3I6GA 4NNYB 2H32H 1OL0A 1D9KD 4GSDL 3VJ6A 4GRLA 1LO2H 4PJHF 1ORQA 3AROA 3QDJA 3FZUD 3UTOA 5E2UH 1X6NA 2VXVH 2W59A 3ZZ1A 2E6JA 3I75A 2Y5TB 3O9WD 5IBUG 1X5KA 3E1F1 1P84J 1CD9B 1T66C 4E42B 3VMPA 4I77L 1IGFL 1X44A 2E5EA 3KLHD 1ZMYA 3T4AA 1MIEH 4YFLI 1T1XB 4I3SH 4BZ1L 4UI2A 3BP5B 3EOBB 4HPYL 3BKCH 4NDMB 1U91B 1A5FL 5EU6D 4G3YL 5D1QA 4OZHE 4LKXB 4PPTA 4LVOC 2C5DC 1MUJA 5DJZA 5HGDB 1YJDH 5DJCB 2KUTA 3LKOB 3N1MC 4EN3C 3CVHB 1YY9D 2R56L 2EDJA 4GKSA 3S96B 4MS8C 2CPCA 3I50L 1IBGH 2HN7B 1U92A 2YMXL 3FN0H 3P0GB 2P1YA 3OZ9L 1A7RH 2DM7A 3BO8B 5CZXD 4Y4HA 5ICZA 4YXLH 3UTSD 2C1PA 4IRJB 1FNEB 5JHDE 4ZG1A 3U4BH 1I3VA 3I9GL 1CXEA 2MMXA 2NCMA 3RJQB 2ZSWA 5E9DE 1T1WA 3WEXA 4NQED 2NNAA 3SN6N 5KTEL 3WDHA 4ZO9A 1RUAL 3LZFH 3ULSB 4APQC 1HILA 2DQIL 1XGRB 3RGVA 1FFOB 1U0QA 1QFHA 3RVWD 3EDDA 4NWTL 2WAHA 1HNFA 1YEFH 4JFXA 5BZDA 1ORSA 4PJXF 1D5ZB 5I17B 4DZ8A 4LSTH 4MLSA 4XP4L 4I0CC 4HIHB 1S7XB 5SWZE 1CF8H 2YPLB 2VXTL 4AZ8A 4M48H 4EI6A 4FQXC 1JTOA 1HOCB 5I9QC 1G6RL 5J0BA 1PDKA 1MCNA 3QRGH 4ZFOB 1R3KB 1KIQB 2Y7QB 4N0CD 3O45A 1JK8A 3JVGA 3B9KD 2ZUXA 2A0LD 2CUMA 1T1YB 3WIHH 2XYCA 2XTJE 1NC4A 3GBNL 2JJUA 5IOPA 3BYYA 3MO1A 4ODBD 2VXSH 1CE1L 5T33L 4TUOA 2XWTB 1UH4A 3MRJB 4ZPVA 4RNRB 1TVBB 2J8HA 3MXVH 3CFJB 4LVEA 3UYOD 3CSYB 1SY6H 4S1QL 5D1XD 1NANH 5DQJA 4IRZH 1BBDH 1S3KL 4NZRH 3V0WL 4U0RC 2E3VA 4MAYA 1N5AA 5HDBE 3QQ4A 1U8PB 1P69B 3IJSA 4YXHH 2C7UA 4HCRA 4PRIE 4Z78A 2Z8VC 5I8EB 3HAEH 2D4DA 3X14A 5DF0A 3MLWH 2DQEL 3T0EA 1QP1A 4GS7C 5CEZE 2V17H 2B4CL 3O81A 4N0UE 3TWCL 4GXUN 1CGXA 4XPTH 3DXAD 1A6TA 2XI9A 2X70B 1F3DH 3PWUB 5ETUB 2DLTA 5FV2A 4QHUA 4Y16A 2PXYB 4JEGB 1H3XA 5E94B 1FL3B 3QNZA 3D39E 3NAAH 4KKNA 4RWHA 5DFTA 5DRWB 3X11B 3PXHA 1QRNE 1QFPA 5HY9A 4K7PH 3MZTA 3WD5L 5B8CB 3VFTB 5DSCB 3JTTA 4IJ3B 5DRZB 1MHPH 4LU5L 2VITB 1H3WM 4M7LT 2Z9TA 1OTTD 2A6JA 3BIKB 3O2DA 2X7LA 4LPXA 4DK3A 1AXTH 1ROWA 2GAZB 2PYED 4Q9BA 4R0LA 2I27N 4O2CA 5AZEL 3QWOB 3NA9H 1T21A 1MLCB 3VXRD 15C8H 4QNPE 3RHWK 2WV3A 1DZBA 1DBBL 1Q1JL 3CLFH 4AT6A 4ZS7L 4PJ5E 1RULL 4QRRA 25C8H 3W39A 4M93C 3WDIA 4U1LB 1JHLH 4IRJD 4WHTA 3VE0B 4PRNA 4JFQB 2H9GB 1IFHH 2NYYC 3MLXH 4X8XA 4MB4A 2HVJA 5E2TL 1MCPH 3BISA 4PJDE 3SCMA 5FUZL 4NC1C 4HIEB 5IW1A 5IJKC 3SOBL 5ISZE 1FVDB 5BVJB 2JKXA 1ZVSA 1UQSB 4BSWA 3TPUB 1KIRB 5EORL 4N8PA 2VOTA 3D69A 3LN5A 3SKNA 2H8PB 3NCJH 5IHBA 1GGIH 5TDPB 4DFHA 1DLFH 1RK1A 5HXMA 5A3ID 1CN4A 3TZVA 5KVFL 5FECA 3OKMB 4HJGA 3O3BB 2P5WA 2PW2A 2IBZX 2EIZA 4DTGH 1TZIB 2ZUUA 3QWRA 1I8IB 1J1PH 5KSBB 1BD2E 1UH2A 2WWKT 1J12A 1EMTH 1XH3B 4ORGA 2YPLD 2FYYB 4ELME 3UTQA 3VWJC 4H88H 3L3KA 3BEVA 5HHVH 3C6LB 5C0BA 4XNQA 5HYQA 5K9JL 3C08L 4CU6A 1LO4L 4ZUVA 3HNTL 3TBWB 1AGEA 3ARGB 2OK0H 3M8OH 2HFFA 2BOBB 3GSQA 2DLIA 4OZHF 1DBAL 3D2UA 2I25N 1TQBC 1FVCB 1E0OB 5KN5A 5JUEH 2XWBA 4Z76A 4O2EB 5I1EL 1QBMH 2G9HA 3MLZH 2BNRA 3CVIL 5ID0B 4P4RB 4P5MB 4NKIH 5IMKB 2V9TA 1AGDA 4PJEA 2QQKL 1DQML 5F7DA 2BFVL 5I8KL 2OX5A 1JZ8A 4P2RB 4M00A 2AKRB 3L3HB 3NPSC 4QF1B 4PG2C 5DRXB 1T5XB 2J2ZA 1XGTA 4M5ZL 4HMDA 1DQQA 3DWTA 1MVUB 1W0YT 1LDPL 2GJJA 4ZTOH 3Q6FA 3W11C 2A6IA 2AK1L 3B4NA 3MV01 4G6KH 2J88H 1NC2D 1M71A 5IV2B 3X3FL 3MRPB 4TRPL 1F4YH 4V2CB 1YMHA 3AFLA 5L2KB 5E8DH 5JHDD 2NY0C 3QH3A 4D0CA 1NFDA 5EZOL 4NN6C 3TT1H 5F7KC 5HBBA 4JN2B 1C5BL 4WHYH 4WHCA 3WUZA 9CGTA 3HPJB 1E4KC 1YEJL 4YHOL 2DWEB 2QHRH 5E4IA 2D2OA 1I9JH 1GGCH 1OSPL 1A2YA 2DLFH 2H26B 2BSTA 4JG1L 5IMMB 3CZFA 4KK5D 4OJFL 4GW5B 4FXGB 1EEUA 4KTDL 3D18A 1FJ1A 4BQBA 4S1RH 4QRSA 4UBDC 3ECBA 2AV1B 3O6FA 1CD0A 4RRPA 1UACL 4Q6IA 4JM2A 1DDHB 2A9MH 5DFWH 3GMRA 4KK6C 3RQ3A 3GFUA 4R7DA 1UJTA 4UQ3A 1CL7L 2LFGA 5DUBB 4F2MA 2NW2A 4LCWA 4NZUL 3BQUA 4LLQB 5FUCE 2CMRH 4KY1L 3UDWA 3W9EB 2XTJD 1CGVA 5F21B 1MJUL 3HR5B 5F89A 4PJ9C 1ETZB 1OARL 5MI0C 1WWWX 5HDBF 1KPRB 4RDQG 2NXYC 2COQA 4NHUA 3DPBA 1KIUA 4XPBH 5KSBF 5MEPB 4KHXL 4G6JH 1I7ZA 1U2CA 1QHOA 3QT2A 5FHAH 5IWLC 1IGMH 3JV4B 3QXAA 5ITFA 1XF2A 1OP3K 4BQ8A 4WV1C 5FCSH 3BPOC 1YMME 1FYTA 1Q0YL 2Q3AA 1YQVH 1QNZL 3BVNA 1XR8A 1ZLSL 4M1GL 1W72A 3UJIH 1F90L 2OL3H 3BUYB 2XIDA 1D6EB 3ARRA 3THML 4F7MA 5CEZD 3DI2B 3DX7B 4MJIA 3I6LE 3QPXL 1KNOA 5IESL 1EAJA 1OGAA 1OGTA 2EDXA 4Z7VA 3BZEA 2W9LA 3P40A 4LPWA 1D5IL 1D9KC 5IJVB 3ISWA 3O4LB 2BCKA 1CE6A 3BGMB 5GS0L 3FZUC 3QAZB 4NC0B 5KVGH 4QKXB 4LGSB 4I48B 2OXGA 5LGHH 4CVUA 2JB5L 3Q3GB 3QG7H 4GAFB 4GO6B 3VWKB 1QRND 2MSPA 4IDJH 2F54B 2FJFB 3E2HB 1LVEA 3KLHC 4IS6B 1S9VA 4QNPF 5FYLH 1XZ0B 5C7XH 1D7FA 4P2RD 5CSZA 4BH7A 1S5IH 3QDJE 1OP9A 4XNYL 5DJAA 3EOYG 5BCAA 2VDNH 4BELD 3GIZH 3WUWG 3VW3H 1RUMH 3HC0A 4PTUB 4JZJA 4PJDF 2G5BA 5DD6A 2MKWA 1AFVL 1YY9C 1Q9KB 5L2KD 5F3BB 3L6FA 2XKUA 4DUVA 3QEUA 1F4WL 2F8OA 1VFBA 2FX7H 1X5IA 1O7SA 5CZXC 2ADFH 5SWQA 4W4OA 5K9QG 3ILPB 5GRXG 1KB5H 1NAKL 3IFOB 5HGHB 4MMZC 3BMWA 5C0CA 4I9WD 4JFYB 5C07A 3B6SB 4P4KA 3D0LA 1I9IL 2Q6WA 4NN7B 2VO5A 3MJ9L 1KGCD 4KTYA 1FFPB 3DBXB 3OB8A 4ELMF 3MCG1 2E9BA 5H94A 1U8OB 3TH2T 4EUPG 3FQRB 1KACB 1N8ZA 2X9WA 5HHXL 2VL5A 4ZUTB 1MNUL 1G0DA 4PR5B 4DWHA 1BD2D 3UBXI 4XBPA 4LSSL 3UTTB 1ZOXA 4R90L 1NAML 3GSRB 1KXQE 3FT4B 5LXGL 5JHLL 3IU3B 4NJAL 5FO8A 1DUZA 2JJTA 1UZ8B 1YA5A 3BW9A 3HE7A 3RU8H 1MCBA 4OLEA 5C0JB 2DBLL 3CMOL 3V6OA 4PGJA 3LQAC 2GSGA 5EZIL 3VRLF 4HXAL 1QR1A 3ULUE 1LNUB 2A83B 4HEME 2O5XL 2A0LC 3Q6GH 4JE4B 2ZJSH 3P4MA 5LGJB 3RPIB 1WT5A 3V0AC 2DI9A 4QEGA 5DDHA 2VR9A 5JQ6L 5E00B 3KAAA 4MX7A 4KK8D 2GJ6A 2CKBB 1QSZA 1GOHA 3EYVA 1P84K 4E42A 1NEZA 3D85B 4I2XB 4LCIL 3E8UL 5DT1H 2H32B 4JFZL 4LASL 4FP8H 1WUNT 4NJ9H 1JF5A 1DBKH 1T1XA 4CADB 1IGJB 3H42H 4X5LA 2R2CA 5FHBH 1ULVA 4F9LA 5CINH 2CK0H 1FN4B 4EQ2A 1IKNA 3TVMB 5KOMC 4OM0H 3OR6B 2CLRA 3QULA 4LKXA 1H3UA 1K6QH 2D9CA 2GSIA 3ARZA 5JR1H 1KCUH 1WBZA 5C0FB 1ZXQA 3S34L 1P5UA 5HGDA 3OXRB 1B2WH 1KC5L 4MXQD 4Y5XB 4JDVA 3VD3A 5B3NA 4ODXB 1FBIL 1HHKB 2XQYK 2J4WL 5JOFB 4YDJB 1ND0A 2YUVA 4KI5F 2HN7A 3HZYA 2W91A 5I1JL 4MJ5B 1B6DA 3EOTL 4ZUSB 1JF1B 2F54D 2AEQH 3L7FB 5GGRY 4HK3N 3T0EE 1SMAA 1XCQA 1JZ7A 3T2NL 5E6IA 1YEHL 3JTSB 1NCTA 4LCYB 3V5KA 4KI5D 3ZKMD 4Y2DA 4X4ME 1PKQB 2O26U 3QUYB 3MRMA 3DUUA 1CS6A 2PR4H 4OUUB 1OTTC 2OP4L 3ULSA 2UVFA 2H2SC 4EI5D 4WWKA 3GIVA 2EC9U 1URLA 3TPKA 4I3RL 3GSOA 1HIML 1Y6NR 3JV5A 3AC0A 5LKNA 1JP5A 3FQNB 5I1GL 4XMPL 2BNUA 2VQ1A 3H9SB 1D5ZA 4PY8J 3WFHB 32C2A 4UQ2B 2VYRE 4IRJC 3G08B 1DN2A 4G7VL 4KQ3L 1HOCA 1G1YA 2EDFA 2I24N 2YWYA 1MCDA 2Y7QA 1KYOK 1DFBH 5F8RC 1JMZA 3I3BA 2CR3A 2EC8A 4QRRE 4X83A 1LO5B 1Q72L 2GCYA 2EH7H 2XWTA 1MHEA 2DYPD 3RUGB 2UWEB 4H5SA 1F3JB 4NCC2 2HA1A 5A3IC 1CBVL 4LHUA 3EO0B 3UTTD 3GJFK 3EDJA 4KRLB 2XZCL 1SJHB 3I6LD 3ARFB 1SBBA 3JV0A 1CL7I 3C2SA 1NGPL 4X99B 3WHXB 1Z0MA 3BEWA 1PYWB 3OGOE 4GUPB 4IBLT 4MSWA 1TCRA 3ROOA 2JCCB 5DGRA 1U8PA 4C54A 1HHJB 2H1PH 1TJIL 2VN4A 4M6OH 3WL9B 4MGXA 1AJ7L 5BJTB 2FIKA 2P5WE 3DX6A 3V8CA 1FG9C 5C0AB 4KUZH 1MY7A 2WBJB 4FXLA 4RMVA 4PJAA 1F11A 1FVEA 2VDKH 3KYMB 4K7PY 4P23B 3PGCB 4UIKL 3QDJD 2P24A 5C0BE 3NCYS 4WUUA 3HAEB 4E0RB 2QADB 3WKMH 4H0IA 3D85D 2Z93B 4XC3H 1EUUA 4EDXB 3D87B 4DN3H 3T3PE 5TFSH 5TH2A 2X4NB 3X11A 1RZ8B 4JQIL 3GO1H 3TIEB 1L0YA 5F1SA 4WTWA 2FECL 4ZD3H 2CDEB 2C26A 2BNRE 4RMUA 3TVMD 4ONHB 3EAKA 2IGFL 2ATKA 4YDLC 4M6ML 2KH2B 2OQJA 2B0SH 1O7VA 2IQAA 1G7MA 4PJEE 1L0QA 1DSFL 3REVB 3MBXH 4OZGB 4MD0A 2EYTA 3QEHB 4FQJL 3QWOA 3VGEA 1HQ4A 3VD5A 5E1HB 5KSUB 3PGDA 1J8HB 3VFVB 4X4XB 2PXYC 4S11A 4FMFA 1JPFB 3LCYA 1YYLL 3ZT7A 4HLZG 4Y4HD 1T2JA 5E8EA 4JCLA 4S0TD 1QLEH 5B39A 1K8IB 4ZUUA 5B8CC 4XRCB 1DL7H 4IJ3C 1NFDE 4LOUD 3ARDA 4KK5C 4P2OD 5BVJA 3TH3T 1UQSA 2GHWB 3SGJC 2EZ0D 4PV8A 4KGJA 3IKCA 2Y9RT 3G5XB 4HQQH 3CFKA 5E6YA 4PREA 3U30B 4JPKL 3DVIA 3RGVD 2V7NB 3OKMA 3P4LA 4NKDB 5D72L 3W9DA 3TO2B 3H9SD 5SX4H 4MDJB 35C8H 3OX8A 1I8IA 2EDBA 1OP5H 2N7AA 3GGWB 4RIRA 1X4ZA 4MCZA 4HUXA 2HLFD 3RUGF 2UWEF 3OKLA 3LS4H 1IEAB 3RWHB 1X5ZA 3P2TA 3CDFA 4FQLL 1J0HA 4NBXB 1IC7L 4LCWE 4G9FB 4P46A 1J1OH 4Y1AB 5DTFB 4MQTB 5ACLA 2VUOA 4W6YB 3ZT6A 1UB5B 2JCCF 3FQUB 5EFIA 4FNLL 4AQ1B 2EICA 2MFNA 4L4TB 3OSKA 4N0FB 5JZ7D 1WITA 2Y07H 2D7MA 3V6FA 4NFCA 2ESVA 4PGBA 4QF1A 3ZYZA 2R8SL 5FUOL 1A64A 3V79C 5DD3H 2EE9A 1JYXA 3C6LC 1Q94B 1GHFL 3UJJH 2W9DH 2DM4A 4U1HB 1VGEH 5BRZB 4X6DA 3DRQB 1KCSL 5C08A 1FYTE 3ARGC 4YHIA 5C0AD 2WBJD 5C09B 4M8QB 4UOJA 1WZMA 1U8IA 5F7WC 3T0ED 5MENB 5GISH 1AE6H 4MJIE 1CXIA 3TNMB 3QDAA 5CD3B 4MA3A 1D5MA 1OGAE 4JN2A 4Z7VE 1IQDA 2F53A 2MPAL 1J86A 5EOTB 4HXBH 3IAPA 1DEEA 4JHWH 4Y16D 4GXUM 1ADQH 2YZ1A 4OZGF 1LE5B 4M43L 5KVEL 1DTUA 2K3TA 1M7DA 1AXSB 4C4KO 3V5HB 1U6AL 2C9AA 5DUPL 1MFAH 3CDGB 1JCKA 1WBYB 2I9TA 5HDQH 1C7SA 4HJ0D 5E7FA 3MUZ1 5ECJE 4XPAL 1QBLH 4U6XB 2IPTH 2X4PA 1R5WB 5IFJB 1AHWB 1EEQA 2VAJA 4AH2A 4LK4A 3OAZH 4KQ4L 5A2IH 3NACH 4X7SH 5EC1B 4Y89A 3QA3B 1NCWL 3UPAA 1CT8B 3O6MH 4RAVB 1DQDH 4QRRD 3LN9A 3HR5A 3WFDH 1CFTB 1UVQA 4FFZL 4K23L 3EO1B 4MZ3A 4WI8A 3MOBH 1KSRA 1HINH 1KCRL 1YC8A 2UZYB 4GFTB 4JDZB 3U9PL 1TJGH 3KYOB 4ODHL 1S9XB 2X41A 2OZ4A 5DMYA 3LOWA 3BKYH 4OB5H 3FOMA 5C0CE 1HE7A 1ZLWH 4OFIA 5HYSB 5C07E 2FB4H 1U58B 3EYSH 3GRWH 5JPMB 5CFHA 4ZNCD 1DEDA 3FRPA 3D9AL 1CGWA 2LAGB 1IGCH 4RRPG 2KDGA 2P5WD 3BUYA 4P3DA 2PYFA 2XA8L 3QWRD 5IROA 3IF1A 1R5IA 3T3PF 1JV5A 3U7AA 1A1MB 1ITCA 2BNQA 1J7VR 5KBNC 4OFDA 5HHQB 5C0BD 4LEXH 5F6HJ 3KYNA 3MLVL 1CR9H 1F4XH 2G60H 3P77A 1RJLB 3D25A 3G6AA 4U1IA 2GUOB 3Q3GA 3J7HA 3IS1X 3V6OE 1P1ZB 1EXUB 1MRDH 4HK0B 2FJFA 2P8PB 4L4TD 1AY1L 1B6UA 4X6CB 4Z7WB 3KPQB 3FB7A 4UIMB 5E99H 4GXVL 2A6DB 4K8RL 1NGWA 2VDQL 4CBPA 4KV5F 4HEPG 5FM8A 2O61B 5INDA 1J18A 2YS4A 4YBQC 4XNMA 1MRCH 3OXSB 1OAXH 2GJ6E 4UAOB 5FXCH 1BF2A 5EC2A 5EIIA 4KDWA 3U46B 4P5TB 4WUKL 4AQOA 5MP6H 3SDDA 4KGLA 3QAZC 2AJ3B 4TTGA 4TVPL 4NT6A 1SQ2N 1J11A 1NQBA 1IGIH 2BMKA 4XCYB 1PSKH 1OW0A 5FYKU 1A7NH 4IDLA 4Z95H 2YPKA 2AQ3A 1ZA6A 3VWKC 1S7TA 3PJSA 5BOZG 3E2HC 3RL1B 4TUKL 3RAJH 1OT2A 2VDLL 4HSQA 4KMQA 4KI5C 3ZKMC 2C4FU 4NKMA 4U1GB 1H0DA 5J6GA 3OWEA 3DBXA 4G8EB 3MRNB 3BZ4A 3HMXA 1T22B 1U9KA 3GK8L 3MFGB 1BBJA 1U8OA 4U7MA 1U42A 3PHQA 1KB5B 5IHZB 3AREA 1F45A 3C8KB 4M03A 3RZCB 4ENED 4ZMAT 1BFOA 1P9MA 1VPOL 2FO4A 4UILL 4Q9RH 3O3AA 3RVXD 3GMQA 1B90A 1DCLA 2DQDH 1NSNL 1EO8L 1SYSB 4AG4L 3TBYA 4WFHE 2RFXB 2WUBH 3TBVB 4MXWL 2VLLA 1JPTL 3SQOL 5C0JA 4S1DD 1X3DA 5IW6A 4NN7C 4Y5YA 1ZWIB 1I3GL 2X4SB 1PG7W 3OGCB 4MJ6B 3UPRB 1LNUA 5MERB 3ROLB 1KG0B 3RDTA 2MCPH 1NKRA 4Z0XA 5F3HA 3NIFF 2WNGA 3BXNB 1HHHB 3QI9B 1V3LA 5IB2A 1VENA 5IFHL 2YK1L 4TSBH 5TDOA 4J3VA 5JW4R 4I13B 5CWSB 4HGMA 5DJDB 3DURB 2VZTA 1FO0A 4UB0L 1SEBA 1FYTD 5FOBB 4OCXH 2GT9A 4Z7VF 1KENH 2QSCL 3P11L 3SDAB 4KPHL 5A1AA 2DM3A 4DCQB 4HBCL 1AI1H 3MLYL 3VH8B 1QFOA 2NY7H 1A21A 3LAFA 2P44B 4WTXA 4MJID 2O93L 4KJWD 1MAJA 5CP3A 1U8JA 3OXRA 1FPTL 1FZKB 5F7LB 4Z7WF 5IKCA 1ED3A 5E1AA 1T5WB 2EDEA 5JOFA 2NX5A 1NCDH 4LCUA 2XN9B 3U6RA 4MJ5A 1OAYL 1EO7A 1V3JA 3VXPA 4AIOA 1MCIA 4L8SB 3IETB 4ZODA 4NUJB 4PJAE 4X98A 5HYJA 2DTMH 1JPGA 5DD0H 1UXSB 4OLUH 1NEZG 3CGTA 4OZIB 3EKCA 3AM8A 2PO6A 3TVMC 4G6FB 4WUUE 4EOWL 1TPXB 3LKRB 1MCFA 3VFSB 2Q8BH 1VFUA 4P5TD 5FYLD 2VIRB 3GHBL 4Y5XC 3MOQA 4ODUB 2J8UA 2Z8WC 1UEMA 5ACZA 2VLRA 3DUSB 4XBEL 2QTEA 3S35L 2BRRL 4N68A 3JZ7A 4G42A 2ARJB 4JQXA 5EU5A 1BHGA 3GJEA 4HWZB 1JZ6A 1XCTA 1KXVC 1AQKH 1YJDC 5E5RB 4AJ0A 3LS5H 3GBMH 4CJ0A 3TJEH 3G5VB 1NDGB 5D70L 5A2JH 2Y6SD 4JKKA 2A2QT 4M62L 4POUB 3QUYC 4P2OC 4AIZB 2EEAA 1N7ML 5C07D 2BX5A 4DGVL 3MRFB 3BZFA 5F9AC 3OJDB 3VFNB 4YR6A 3SDYH 4F8QA 5BXFA 3KXFB 2E7HA 4U7SA 3UROR 1F3JA 1RU9L 3ZTJG 2BY2A 4FQHB 3PWLA 4KDTA 1PQZA 3C60B 1FNLA 1G7PA 3DROA 3V4PH 1QEWB 2V2XA 3WHXA 1HH9A 4L4JA 5HD8D 4PLKD 3U36A 3QEQA 3MOAH 4LRNL 5JXED 5C0NC 2FIRT 3SO3C 1BFTA 4M61B 3STZA 3KJ4B 1EHLL 1HHJA 3UMTA 4G80B 5GGUB 3DV4A 3WL9A 4JDTL 3BKJH 2PTUA 4OLWL 4LLMB 3JWDL 1V3KA 3U0PB 3T0AA 3UXFA 3HG1B 4U2YA 5KSVA 4BUGA 3FB6B 4HS6A 2R1YA 4QGYA 1U8KA 2X4TB 3VD9A 1NLDL 3PGCA 3QI9D 5L7XL 1H8SA 1YEIH 4WI3A 4UV7L 3N0PB 3EYUH 4MXVF 1J0YA 4HPOH 5DEGB 2HH0L 2GEEA 2HWZL 3ARFC 1P4IL 3NH7H 4MA7L 4NCDA 3IT8D 2IBGA 3X12B 4LHUG 2R15A 1F6LL 3H3PL 4NGHL 3SDAD 3X3GL 4GKZA 2CDEA 5EOQL 2ICWJ 5IF0B 1FIGL 4Q2ZA 3WFZA 1ZT1B 5CCKH 3LQZB 4HV8B 3ZLQC 4KRPD 4NSKB 5D96B 3VXSB 1RJYA 1BOYA 1ZANL 2WBJC 3MNWB 4YZFF 2ATPB 1KN4L 1FAIH 5IFAH 2JJSA 3M17A 2ESVE 3EUUA 3ZDZE 4JANB 3NFPA 2ZP0T 1KLUA 3C5ZA 4P23C 4EIZC 5F1NA 4GG6F 5I1LA 2LABA 1A6ZA 3IXTA 3MRBB 5D1ZA 4OZIF 1MPAL 4OFPA 1U3HB 2XN9D 1B88A 3CMGA 4AK1A 5L9DL 1U41A 1J8HA 4X6DE 5C08E 5KAQG 3WNMA 5ITBL 1JPFA 1YEGL 5CJXA 1NGZA 2DL9A 4GAGH 4MNQA 4WRLA 1N64L 2JLLA 3GI8H 1HZHL 1JPSH 4M1DH 3VXTA 4FQ1H 1JE6A 4Y2DD 4BM7A 2F53E 1S7WA 5I75B 3G5XA 4WCYL 3QJFA 3ZHDA 3O3DB 1EH9A 3STLA 2BVOA 2Z91B 2NY6D 2NXZD 4HJ0C 1J05A 5IQ9B 2R0LH 2P5EA 4WWKD 3KPMB 4HIXH 5LWYL 3T3ME 4LSRH 3RFZC 3FHQA 3WIIL 2R0ZL 2V5YA 3Q1SH 5HHPB 3VFMA 4YHLH 1KPUB 5DURD 3BKML 1T04A 2H6PB 1E6OL 5D7JD 2D31A 3RP1A 3ARTA 3MZGB 4DEPB 3DVGB 4L9DA 4JKPH 2OR7A 3V5DB 3OBAA 5D2NB 3RWHA 1CFNA 5GIRA 4OT1L 2IQ9H 1ERNA 2EDLA 4X7FC 4Y1AA 5B39G 4HWEH 4PJ7B 1K8DA 2VQUA 4H26B 5FV1L 1DJSA 3BDXA 2FZ3B 2KQNA 5J1TC 4OTXH 4OGAD 1Z3GH 1OP3H 3U30C 5T3XH 5IMOB 1GYAA 1NH6A 4LSUL 1A9BB 2ZOLA 2NZIA 3C60D 5GHWL 4FABL 3CC5A 3P4OB 4OLYL 1BFVL 4H1LH 3MNVA 3QCUH 1MFBL 4EBQL 3GMPB 4JPWL 4QHKJ 2A1WH 3VFWA 4BFIA 1KPVA 1YEDB 2FSEA 4GRMA 5I19H 1J10A 4K7PX 1MSPA 3ZKNC 3IGAB 5BRZA 1DE4A 3GM0A 2IANA 3QQNA 2ICEA 4U1MA 4NQXA 4ZYKB 2ORBH 4Q9CA 5DWUH 4J3SA 3HG1D 3GHEH 3AY4C 3H9HA 2X4OB 3LMJH 5MENA 3NFSL 2X4RB 1CXFA 1BM3H 4XAWL 2XRAL 3TNMA 3HNSH 1C1EL 2BNQE 5B4MC 4M6NL 2F58H 3L3GB 4HBQA 4WUUD 2AERT 3CLEL 2FR4A 1VGKB 4ESKA 1EEYB 1FL6A 4ODWA 1FC2D 1F3DJ 2NY2B 4G6AD 4D9LL 2LU4A 3V5HA 2PETA 3CDGA 4L3CA 3VXSD 2BRQA 4WU5A 1G6RA 2B1AL 1WBYA 5T33H 1YQ2A 4PJFB 4AL8L 1I8LC 1I4FB 3GSWA 3I85A 4YGVA 3EOAB 1JNHB 4LLWB 4U6XA 2EDWA 2VXUH 4QHNA 3F65A 4O2FA 1JUFA 1SYVA 1J5OH 3V0WH 4LNVA 2QQLH 3QA3A 1FV1B 1F3RB 3CIQA 4XMLL 3C5SA 2VE6A 4JPVL 1VHPA 2DWDB 4L5FL 3EO1A 4PJ8D 5ILTH 4R3SB 2MKLC 1WTLA 1MFDH 3VGAC 5H35B 2HJFA 1E27A 3QJHA 1BIIA 4ENEC 4XPFH 4R26L 2RCSL 4DGYH 4MYWB 3RVXC 5DJ0B 3F7VA 4AMKL 1AHWC 2DQHL 5FA4A 1YEKH 5DJXA 4PFEA 3VCLA 2NTFA 2QSVA 5T3ZE 2EXYD 5EWIL 2XPGA 3IDMB 2W0FB 3KS0J 1RZIB 3BPNC 1HCFX 1H3GA 4NKOB 2BVUA 2VC2L 4PJ7F 4LU5H 4UV4H 3QO1B 1FC1A 2B2XL 1C7TA 4G8IB 1FYHB 4EJ1C 5IMLB 3UP1A 4Z9KB 4AIXA 2RHEA 3JV6B 1MIML 2YWZA 3LHPH 4D3CL 4N8VA 4GKNA 3QP3A 5B3JF 1IAII 1W0WB 3E3QC 1XIWB 4HUVA 3ZDZF 4HK0A 3B9DA 4JGUA 4ZUWB 4YE4L 3QIWB 1WZ1H 4HFUL 5C2BH 2AJZB 3DARA 1CLYL 3EYFA 1WZLA 3KPOB 4UIMA 2YXMA 1QSEE 1XF1A 2XNAA 4JY5L 4KFZC 1HNGA 3OKYA 1YY8B 3FRPG 3U0WL 2E6PA 3R0MA 1A8JH 1OF2A 5IK3B 5J1AB 1RJZB 3KWWB 1LEIA 1HSBA 4UMGA 2OTWA 4N9GA 4XVTH 1JBJA 3NPZB 2ED8A 4QRPA 3DX9A 4R4BA 2F74B 5T5NF 4CRPA 5C08D 1CG9A 5F1IA 1CFSB 4XCYA 4QXUH 4NOFA 4PUBH 1YEEL 1NKOA 1T80A 5IR1B 3ME0A 4I0PA 5FYKL 5CP7A 1QSFB 1NCCL 5J9PA 4LLDB 1BZ9A 1ZV5A 5GS1C 3G5ZB 1DUYB 5HDLA 5J3HD 4PJFF 3RVVC 1AC6A 2EH8L 2NX5E 2JK5A 1UG9A 3TYGH 4UAOC 2G75B 2NY2D 1LQSR 3VDCA 2Z92B 3RKPA 1ZK9A 3PV7A 4XXCC 3MREB 3T08A 1PG7H 1MELA 2UZXB 5EU7E 4P5TC 3MRRB 2FX8L 3SJVB 1T20B 1EX0A 5HYJE 3RZCA 3RIAK 4L9LA 1IL1B 4YC2C 5E2WH 4U1KB 1NUNB 5TF1L 1XF3B 3NZ8B 4FTVB 1WBXA 2YRPA 3VFGH 1T4KB 4YHZH 3S9DB 1U3ZA 2OTPA 5FDWB 2RFXA 5FKAA 3UTZA 1LP9B 4WY7L 4F7PA 5I1DB 4YDIH 4U1GC 4XCEA 2J8UE 1CLCA 4LLVB 1MFCL 2VLRE 2Y6SC 3PP3K 2CO7B 3K2UH 3FJTA 2LU7A 4MJ6A 3UPRA 4LSVH 5I0DA 4IMLB 1RUQL 2VLMD 1JGDB 5DJYA 3S36L 5EIVA 5GGTH 2PW1A 3QO0A 4QRTA 2IALB 4MD5A 4R2GD 3BIAX 4O9HL 1R3LB 3GJFH 3HZMA 3VFRA 4UT9L 5DJDA 1T0NA 2D7TL 5HD8C 2VABA 5K9QI 2IADB 1MCWM 5IBTH 5JXEC 1WCQA 4PRDB 4G5ZL 5D7LB 1GL4B 2Z8SA 4P57A 5BS0B 5L8KB 1I85C 3MV7A 5E5UB 5IM7B 2BHZA 4PP1D 4KTDH 2FBJH 4JHAH 1GGTA 3BE1H 4BZYA 1IM3B 1Y18A 3VXOB 1XR9B 3MRDB 3QFJA 3VU2A 1H8OA 4OI9A 4A6YH 4NO5B 3SKOB 4CU8A 3QEQE 1RUKL 1A6WH 4PTTB 5IBLD 3QI9C 4CW1A 2R2EB 3NGBB 4FZEL 1VCAA 5H2BB 3X13B 3ZE2F 3ABZA 3MCKB 2FNBA 1XIWD 4NZUH 5JORB 1EGJH 3IETA 1PZ5A 2WINB 2XQBL 3S5LB 1UXSA 2N7BA 1CFVL 2OI9B 4JB9H 3SDAC 4HS8H 4AYFA 4F57H 3BGFB 5F88A 3QHFH 1TZHB 1SBSH 1YYML 2Y1VA 3LIZL 4YFDB 1JNNL 4B7IA 2EKSB 1KEML 2F5BL 3AB0B 4KRPC 4MNGB 5KJRL 3BAEL 4KH2A 3DMMB 5IB3B 1OAUH 5T1LB 4O51B 1P4BL 5TE4H 5LGKA 3AU1B 2R2HA 3OF6D 4OQTL 5HPMA 3DUSA 1Q0YH 4RAUB 1W8OA 2IMNA 3VI3F 1JWMB 3WS3B 4YFLF 3SKJH 3SO5A 1D5BA 5C6TL 4PJGB 1QSFD 1A6AA 2QQNH 2C4XA 4L8SC 1CFQB 1RIVL 3E6FA 4ZFZA 3B9AA 2E7MA 1JGVH 1T03H 5F96H 4LKCA 2R4RL 3G5VA 4LAJH 4PYHA 3MBEB 1LEGB 3SEPA 2HYMA 1FGNL 4KJQD 4OBSA 5HVWA 2RIKA 2IWGA 3QIUB 3FONB 3SJVD 5T3ZD 2NY6C 2ZSVB 4X9FA 3LY6A 4UDUB 2Z31A 1LP9F 4MNQE 1I7TB 3ARED 3GSNB 4XHJC 2BSSA 5CGYC 2R4SL 3RVUC 5J06A 5JXAL 1QEWA 5BVPL 4FTVD 2CXKA 4OV6F 2FBOJ 3JXAA 3H7BA 4HDIA 2AW2A 3PWJA 5GSVB 1B4JL 1U8HB 2GY5A 1T1ZA 3SE4A 4DW2L 3V9FA 4YPGB 1FLRH 5D7JC 4CMMB 3F7PC 3DYOA 1Y0LB 2P5EE 3BDBA 2VH5L 2EIDA 1UM6H 3KHQA 3BPLB 3K46A 5IVXA 1NGXB 5F71A 5T1DH 3BWAA 2C3XA 4RGOH 4HGWB 1C12A 4OLXH 2X4TA 3VGGA 1UM5H 1QSED 5C0GB 4OGAC 5JO5A 3U79A 2WZPD 5DEGA 3C60C 3HKFA 3IDGA 4XP5L 5IGXH 2Q8AL 3AAZB 5DHVH 1A7PL 3LN4B 4OUOA 5ICYB 1C5CL 2BDNL 5D7LD 5K9OB 5DMJB 3KR3H 1YN6A 3KJ4C 4X4YA 4JO1L 2J5LB 4C83A 3B43A 4P59L 1NFIB 4NSKA 4WNQA 4KJPC 3MJ9A 3T2PA 5KSAB 3OJ2C 5TE7H 1VKXB 3TA3A 1T7WA 3M1BB 4BH8B 5D7IE 1BX2B 5I30L 3DO3A 4B53A 3G5YA 2ITDA 3MRBA 4GBXB 4OF3A 5D6CB 1Q9WB 4L8BB 4DGIL 5JHLH 3ARVA 3GB7B 2IANE 4GJTB 4UU9B 5F9OH 1CD1B 1NAMA 5CBAB 3F8UB 3DETD 3QG6A 3A6BH 5F9JB 2HP4A 4KC3B 1BQLH 5HYJD 4XX1E 2O5XH 5I2IB 4XTRC 5M7QA 3DGCR 2GTWA 1NCAH 1OPGL 2IH1B 2ZKHL 2PO6D 5D96C 4HUKB 2SEBB 1X5YA 5BV7H 1EVUA 1UM4H 3DMMD 5EO0B 1DANT 3MV9A 1ZVYA 3FQWA 1EPFA 2FJGA 3MLUL 3R0NA 2PCPB 5I16B 4WW2A 3RHWF 1NBYB 1U3HC 4P2QA 1FRGH 4DN4L 1UXWB 4YPJA 2VLRD 1HHGB 4EDWL 5IEHB 1KULA 1U8QA 2VLKA 4QGTA 1TMCB 4LQFL 3KLSA 3OKEB 3F12B 1VESA 3MV8B 2I5YL 1K2DB 3VFOA 3VXUA 3VXNB 4QOKB 2NR6C 4PJ8C 2YA2A 5A2LH 4Z5RB 1VEPA 2QBWA 1F8TL 4O02L 4UINL 3PQYA 1UA6H 1FBIH 5I75C 1MJJA 3WSQL 5I1HH 5AZ2L 3DHJA 2AGJL 1YUHA 3ILQD 4UDTB 3VXMA 4DVRH 1AGBA 4Q9QL 3VXQB 4S1SH 4ZOAA 1HYRC 1CIDA 1BREA 1KTRL 2OJEA 1A9BA 4LP5A 4JJ5A 1M7IA 3Q5OA 2A38A 1SEQL 2YPVH 1YEHH 2CRMA 5DR5H 5TPWL 1MREH 3UAJD 3U2SB 1UWEL 4HKBA 1YEDA 3QUKA 1UB6A 4DEPC 5JMOC 1H5BA 3TNNB 1AKJA 5D2NC 3CSGA 4NQDB 4JRXB 4JM4L 5FA3B 5L8JB 4H1LB 3V6ZB 3LQAL 4ISVB 5KZCB 2AK4A 5MHSD 3MACH 3F5WB 4ZQKB 3ZO0A 4HC1H 2PF6A 4JG0H 2YKLH 1MCOL 4JO3H 3IJHB 1FDLH 4MA1B 3K8MA 4OZFH 4QT5B 2ZCHH 3KPLB 1HXMA 3T09A 4K2UL 1QFWM 3N1FC 4KHTL 1CZ8L 5FGCE 4LVHB 2IFFH 1AGFB 1QYGL 3PWNA 1A4KA 5CUSH 3T0XA 1RFDH 5DJ2B 3T0VA 5GRUH 1CGYA 1NBZB 2ADIB 4ZSOA 3O0RH 5IB5B 2AS5M 5DZLA 1LO3H 4IMKC 1I4FA 5TQ0L 4PYGA 1HN1A 3UPCA 1A1OA 1GRWA 3T77A 4Y4FB 4PGCB 3OKOA 3RTQA 1FGVL 2CXGA 1LEKB 3C5ZD 2IBBA 4XCFH 5FYJU 5D1ZD 1ZHKA 1S8DB 4QRPE 5KG9A 3QDMA 5E8NA 5BQ7A 4ZFFA 5K9KA 1BVLB 1EHNA 1QFWL 2OJZH 3H2WA 2NY2C 4WO4B 3MQIA 2P8MB 5EBMB 1GGYA 5H35A 3W0WB 2AJVH 3KPRA 3EZ8A 1MHCA 5I8CA 1N3NB 4LQ1A 1QLFB 2Z35A 2CDGA 2NQCA 4XNZB 3O2VL 5HHMB 1AR1C 1GC1L 5DJ0A 4FRWA 3ARBA 2FATL 2BJML 4PB9H 3WN5B 3FKUS 3CVHL 2P5ED 4PG9A 3QYCA 1EA9C 4BQ6A 1N2RB 4XT1C 4XNXL 1P7KA 4LLYB 3IDMA 2A6KA 1R24B 1RZIA 2YXFA 3O11B 3VMOA 3QO1A 1JRHH 1CDBA 4QOKD 4LDOB 1I75A 2DTSA 4XC1L 4K3EL 5T5FH 3JV6A 3IFNH 4YDVA 3QUZD 1BWWA 2HT3C 4NYLB 3VRIA 3RBSA 4PP2B 4R2GC 2CQVA 3HS0A 2R1WB 4XI5D 3ES6B 4HWBH 5D7IF 4LARH 1QQDA 4MLIA 4GMSL 3BDYH 3G6DH 3UBXB 4NKQB 5FO7A 1K3ZA 4JQVA 4YWGH 1G6VK 2Q7YB 3TT3H 4C56A 1FH5L 4PV9B 3HI5H 3NVQA 1CDJA 4QRUB 3WE6B 3MC0A 4HIIB 4PRHD 3EO9H 4OI7A 4HJJH 4LEOA 2HT4C 4NQDD 1T0PB 5TDNA 1DN0B 3SGEI 4F8TA 4LRIC 1P7QA 5DYOA 4YHNA 3Q5TA 4ZFOL 3QDGA 4DUWA 2HTKD 1CFSA 4P99A 3S37L 4ZAKB 3MV7E 1XGYL 2W38A 4LSPL 2ZUTA 4DAGH 1NBVL 4JHBA 1XIWC 4MMXC 2XZQL 1OQOA 2OM5A 4Y4KB 5E24E 3QIWC 1DVFB 3QFJE 4O4YH 4N8VG 2N1KA 1CDUA 4OIIL 2QKIB 3B5TA 1VERA 3MXWL 4K7FA 1KBGH 4E41A 1G0YR 3T1WA 5D71L 4HUUA 1VFMA 4RFOH 2HT2D 5I1CL 2F19H <