4KOCA

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95i/y108f)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95I/Y108F)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kocA00
4HHWA 2Y69B 2VM4A 1JZJA 1QLEB 3EH5B 4GY4A 5TK2A 4DP8X 1E5YA 2IWEA 3PAUA 2VW6A 1ZPUA 1XMEB 3HEIB 2YAHA 3NSYA 1PY0A 4BWWA 3IBOA 4G7QB 1OCCB 1NIDA 3EF4A 3ASNB 1J5CA 2H47C 3T6ZA 2PP7A 2J57A 4PCYA 2YXVA 3PLYA 1CC3A 1PZAA 3JT2A 3EH4B 2GSMB 2WO2B 1ET5A 3FS9A 3DIVA 3NSDA 1L9RA 3ERXA 3OD3A 1SJMA 4DP7X 3NP3A 1KCBA 6PAZA 2IH8A 4GYBA 1ZIBA 3UAAA 3CDZA 1NPNA 1RKRA 2FNWA 5FC9A 4E9TA 2VM3A 3T9WA 1NWOA 4Q89A 4GXFA 4KOCA 1OE1A 1L9PA 4MFHA 4JHVA 4E9RA 2XXGA 4N8UA 1SNRA 1W6WA 4YSEA 1AANA 3X1BA 2CALA 5AKRA 2AFNA 2XYBA 4KNSA 4TXVB 3UADA 1X9UA 2X87A 4KO9A 7PAZA 4AKQA 3FT0A 5I6NA 1KGYE 1X9RA 3WKQA 1NTDA 1AR1B 1KCWA 2VW7A 2P80D 2YQBA 3EH3B 2VMJA 4GP8B 1EZLA 1SFHA 3NJMA 4DPCX 3G5WA 4DPAX 5B7MA 3OMIB 2PPAA 2XU9A 1JVLA 2I7SA 2JFCA 3N55A 3WIAA 2QT6A 1CYWA 1MDAA 5B1KA 1XB8A 2PP8A 2UXGA 4E9SA 5B1BB 2GB2A 3H56A 2BP8B 3ZDWA 1PZCA 2W88A 1A4AA 1EHKB 2EIJB 2PPDA 3FPXA 3X1FA 4NERA 3CZUB 1SHWA 1J5DA 2XX1A 1ZDQA 1RCYA 2VSKB 3AW5A 2A3TA 4AKPA 1KBWA 1OF0A 1PLCA 3FSVA 4Q8BA 1RZPA 1KV7A 1NWPA 5LDUA 3X2QB 1GS6X 1OV8A 1KBVA 2BO0A 1PZBA 3QQXA 3DKHA 1SF3A 3X1NA 2IDQA 4QLWA 4HCFA 4A2EA 1SF5A 2XV0A 3NJGA 1BYOA 1PNDA 2RACA 4BK5C 3UACA 4YSAA 4AI7A 3ZBMA 1B3IA 5EHFA 2ZONA 2BWIA 4E9YA 2BP8A 2GI0A 2FQFA 1BQ5A 1BAWA 2MRYA 4JKNA 3H4HA 3WG7B 1ZDSA 7PCYA 1A3ZA 1WAEA 1JZEA 2R7EB 3FPYA 1HAUA 3NJFA 2I85A 5I5IA 2AVFA 1J9SA 3CDZB 1AS8A 4YSCA 2AANA 4YSUA 1GS8A 1V54B 3WKPA 5PCYA 3V9CA 4YSSA 2FT8A 1UATA 2J56A 3CVBA 2DWTA 2UXVA 3UABA 2DWSA 2DYSB 3NJNA 1OCOB 3PXLA 4YVNA 1CURA 3PPSA 1ET7A 3AG1B 3ZX1A 1OE2A 2H3XC 5I28A 4F2EA 4KNTA 1JZHA 1BXVA 2J55A 2IWFA 3IN2A 2UX7A 2ZXWB 2PCFA 3PAVA 3CVDA 1RZQA 3T6WA 1CUOA 1W6LA 3KW7A 1ET8A 4W1TA 4YVUA 4DP6X 1ILSA 2R7EA 1E65A 4JHUA 1NIFA 4BWUA 4ZK8A 1QNIA 1SDDB 4BDVB 4E9QA 2YARA 3PAZA 2BWDA 2XWZA 2E86A 3NSFA 4DP0X 5I6LA 2FTAA 5B1JA 3FYIB 4L0PB 3QJUB 2XXFA 1YLBB 3FSAA 1ASPA 3SBRA 1NINA 3OQRA 1AS7A 1AZNA 3BVDB 3FSZA 1L9QA 2WO3B 3NSCA 4BXVA 5B7EA 9PCYA 2I7OA 1ASOA 5I26A 2H5UA 1JOIA 1PF3A 3SBQA 2CCWA 2IH9A 2XX0A 3QJRB 1GSKA 4A67A 4HIPA 3QJSB 5B7FA 1TEGA 2HX9A 1N68A 2FQEA 2AZAA 2PPCA 5B3SB 2XUWA 4AKOA 1IBZA 2IAAC 5A7EA 3QJQB 1SFDA 5I6PA 1PCSA 1T5KA 4KNUA 1M9WA 1PNCA 2Y1AA 2CJ3A 2OCCB 2IDTA 2PP9A 4HALA 1SDDA 4BDVA 1JXGA 1GS7A 1QHQA 1NDTA 1XB6A 4G71B 1NIAA 2DYRB 1AZUA 4HZ1A 4NB7A 2MTAA 1I53A 3NJIA 1L9SA 1AG6A 4HAKA 1JXFA 4WKXA 1AOZA 1JERA 5D4JA 5B1AB 3MBWB 2YXWA 1V55B 2FT7A 1E5ZA 4DP2X 2EILB 1J9RA 3V9EA 3OMNB 3ABLB 3NJLA 1WS7A 3QJTB 2QDVA 4X4KA 3HB3B 1TU2A 3JTBA 4AX3A 2QDWA 3UAEA 3NYKA 2GC4C 2IDSA 3FU8A 3KW8A 3FSWA 4FAAB 2PPFA 1JZGA 1MZZA 2FQDA 3FYEB 5PAZA 4HCGA 1WA1X 1BEXA 1BYPA 1A8ZA 2LLNA 1J9TA 1BQRA 2OJ1A 3NJKA 1M57B 2BP0B 3T6XA 5I6MA 1MG3C 4YSRA 5E9NA 4G72B 3NJHA 2YAMA 3ABGA 1R1CA 3OMAB 1GW0A 2B3IA 1PMYA 5AZUA 2FWLB 2QPDB 4PAZA 4G7RB 3GDCA 1FA4A 3OM3B 1KDIA 2EIKB 4A2DA 1FFTB 1OCZB 2PCYA 3UGEA 4DP9X 2ZOOA 1ASQA 1ILUA 1AACA 2EIMB 1ID2A 4P5RA 4UAHA 4KO7A 2VW4A 3TU6A 2FJSA 1AZRA 1L9TA 1PLBA 5I6KA 2PLTA 3AG2B 3L45A 4UF7C 2OV0A 1ETJA 1A4CA 1TEFA 3IEAA 4W9ZA 4N4YB 2YAOA 2BP0A 2IDFA 1FWXA 2HXAA 3GYRA 1PAZA 1JVOA 4E9VA 5I5MA 4YSPA 3S3DB 3RYMA 2BHFA 4DPBX 2GIMA 2UXTA 1AAJA 2QPEB 2BW4A 4DP1X 1W8EA 1JZIA 4F7KA 1GR7A 1M56B 2HX8A 2YAQA 2HLEB 2YAPA 1JXDA 3U25A 2X88A 3S3BB 4AZUA 1JZFA 3FU7B 2UX6A 3WNJA 4BWTA 1AIZA 2UXFA 2Q9OA 3SBPA 1KYAA 2GBAA 3NJJA 1A65A 1J9QA 2Q5BA 4G7SB 3SQRA 1IC0A 1AG0A 3WI9A 3GXUB 1IUZA 4K9JA 1CYXA 3MX0B 1XB3A 3X1GA 1E67A 4GP5B 4FA7B 1URIA 3CG8A 4KOBA 2CAKA 3ZIYA 1NIEA 3D12B 2XV2A 1HAWA 1BXUA 4F2FA 4A2GA 1MG2C 2B08A 4ENZA 1DZ0A 3DTUB 1BXAA 1OOWA 4YSQA 3EHBB 5F7AA 1OCRB 5F7BA 3NP4A 3FU7A 4KO5A 5IY5B 2P80A 4HHGA 5I6OA 1GY2A 3S8GB 2BZCA 2BW5A 4WTQA 4YSOA 4KO6A 2FQGA 3BQVA 2GHZA 3T71A 4A66A 4M4RB 4YL4A 1SHXA 3T6VA 4UANA 2XVBA 1DYZA 5D4HA 4CSZA 2HX7A 2PPEA 4G70B 1GY1A 1NPJA 3FQ1A 4A68A 3S8FB 2XV3A 1KDJA 3FQYA 1ZV2A 4NAJA 8PAZA 1AQ8A 1GYCA 3AZUA 2HZHA 2FT6A 3QPKA 3TA4D 2AZUA 4BXSV 2IWKA 2JXMA 2WSDA 1F56A 3TBBA 4RH4A 4A2FA 4DP4X 4QKTA 2IDUA 3QJVB 3X1EA 2N0MA 2JKWA 4YSTA 3C75A 1ZIAA 3H4FA 2CUAA 1PLAA 3TASA 1WS8A 3N2JA 5B1JC 3WNIA 1BQKA 3AG4B 3IN0A 4EF3A 1MZYA 1TKWA 6PCYA 3ABMB 1AZCA 1HFUA 2ZWNA 3ABKB 1WA0X 1AZBA 4DP5X 4P5SA 1N70A 4M3HA 1NIBA 1A4BA 1NZRA 2DY2A 2YAEA 1L9OA 1VLXA 2DV6A 2J5WA 4E9WA 1ADWA 2TSBA 2HRGA 3NT0A 3AG3B 3TBCA 2HRHA 3PCYA 2EINB 3S3CB 1IBYA 4HCIA 2TSAA 1IKOP 4YSDA 3CVCA 5D4IA 2CBPA 1OE3A 2GC7C 3FU9A 2W8CA 3IE9A 4A2HA 2BZ7A 2VSMB 2YAFA 4CSPA 3ASOB 2NRDA 5ANHA 3AY2A 4E9XA 2VN3A 1NICA 5TK4A 1WA2X 5AFAA 4GP4B 2XLLA 1AS6A 3FQ2A 1E30A 5I5JA 1V10A
chains in the Genus database with same CATH superfamily
2VABA 4YHNB 4AGNA 2NR6C 4CMMB 3EH5B 1MFDL 4QNPE 4ZO9A 1LEGA 5TK2A 2WLYA 2IWEA 1SOQA 4UIMA 4DP8X 3B56A 3Q1EA 2N1TE 5HYJB 3NPSC 1VZGA 3GSOA 2VDQH 5KUKA 4DVRH 4X7TB 2E9GA 4ZAKD 1FH2A 1N4XH 3BVTA 4IMKC 5BNXD 4LCIH 5J56B 4A55A 3QNFA 4BSJA 5DA0B 3W0WA 2APSA 1BM7A 3B2VL 5DJXA 5E23A 1OK0A 3S3SA 1PZAA 5AG9A 1S3KL 2OR7A 3ARDC 4WWKD 3LXUX 4JZNA 1TFHA 4DKAA 1R3IL 3EO1A 1JBJA 5K1VA 4JBSA 4XVUC 4NENB 1F13A 3MLZL 4Q6IC 5DQ9B 4DGIH 6PAZA 2FD6L 3UTQB 2VISA 1ZIBA 3IU3A 1A9BB 3CDZA 5IQLA 2E7BA 2VQ1B 5CHNA 5GHWH 1YEDB 5ECGA 5CD3B 5D71H 1A6ZA 3MQIA 2VMEA 3VWJA 4GMSL 2XCMC 4YFDB 4D0CA 5FUCC 2XWTB 2PNDA 5TQ0H 2WB7A 3MRHB 2WXLA 5D8JL 5FYJE 1KBGL 3FUNA 1KN4H 3N0AA 4HS6B 5F9JB 1G6RL 2NNCA 1A02N 3ULUE 4U1HB 5DZVA 1ODUA 4MNQB 1K3ZA 1OPGH 5IMMB 3UGXA 3OLGA 5FM5O 3KJ6L 3KGTA 4K7FA 4ZAKC 3F7VA 1OAYL 4WQOA 4DESA 3PABB 1T2QL 4AGPA 3H42H 3QGVA 3LS4L 3H3BC 3O3AA 4HSCX 4F3FB 1I1AA 3GD1C 3N43F 3ESVF 4XB8A 1ULVA 2B1HL 3D39D 2RQEA 2Y6TE 3O8XB 2JCCE 1EZVX 3WIIL 2TAAA 3MFFB 5EBWB 1GGIH 3SGKA 2OK0L 3DO4A 1BIHA 5JXEA 1OLLA 5E6RB 4LNRA 1NC2B 5JPNC 1KB9J 3PV6A 4RFNB 5ICUA 1JPFA 1ZSDA 3OR6B 2PPAA 5ALCH 2V33A 2WANA 4PRIE 4BHUA 1K2DA 3BGAA 2OR9H 2VR3A 3PDOB 3PWPE 4FXKB 1CYWA 4EBQH 2HUEA 2VLRB 2WBJB 3MOBH 1AQKL 5B1BB 2GB2A 1V5JA 4MXWH 4QHUA 3RB5A 1PZCA 4XX5A 3T4AA 2W88A 2J4WL 1U8QA 3AT9A 4PRAB 1MRFL 2QTVA 2W0LA 1GAFH 3MRPB 2EYTA 2WLIA 2K1MA 2I5YH 3A5VA 1JI2A 1UQSA 1EPFA 3AW5A 1S9XA 4LE8A 4TVSa 5A1AA 3FSVA 5FHAH 5LDUA 5LG6A 1LEGB 3C5JA 3BRFA 4DN4H 4YHZL 3HI5H 2VDLB 4TNVF 2ZAHA 3ZKQD 3U4EA 5DO2D 5C0BE 3U36B 1S5IL 4YPJA 2X6UA 3WTSA 1YEEL 4IKKA 3TBYA 1R3KA 4HJ0D 5D7SL 1F6AB 1QPXA 4QHMA 1B0RA 3LH2L 1DJGA 4J7RA 1DVSA 1MN4A 3LKSB 3CIAA 3P73B 4KJYA 4ELDA 4DKEH 4JKMA 2UZIH 3ASWA 4L4VD 4PI2A 5DS8A 1EIBA 1UVQA 3GMRB 3CC1A 4TNWF 3E3QE 3ILDA 3PHAA 4DFHA 2AXGA 5F7EL 2R7EB 3BC9A 4G8IA 5BXFB 1QBLH 1R3HB 1J9SA 2DQJL 3CDZB 1SYSB 1IGTA 2YD6A 2DWDA 3QQDA 5D2NA 5D1QD 1PZ3A 1OHZA 1GS8A 3GT6A 2P43B 4LCWD 1WK0A 3MUGA 1KLGA 1JF1B 1YMHA 3B2PA 2JCWA 5DDHA 5FV2A 2GY5A 1UATA 4FNPA 3ZE1B 1RZJL 2UXVA 2CIIA 2B7DT 1OCOB 4S1SL 1J1PL 3ILQD 4K0OA 3PQYA 3MXVL 2JJTA 3CUPB 4NQCA 5DO2C 2C3XA 1CBVL 3GBLA 3K8KA 4MB5A 2ADJB 5B8CC 2V3EA 3ZL4L 4HJ0C 5B3JE 1AD0B 4JFFD 4QHNA 5K1NA 5FEBA 1Z66A 4YIQB 3PAVA 5KBPA 3QDHA 2WXQA 4PPTA 5IQOA 4Q9QL 1DBKH 4N0CC 1ET8A 4W1TA 2YO3A 3B9KC 3HHMA 4NN6B 4OLWL 4P2OA 3OR7A 3WNNA 4WHTA 4LEOB 1H3TA 4PJHB 2OJEA 1QNIA 5IVNA 5AVWB 3EGXB 1KGCE 3BH4A 4ERSL 1JF5A 1KLUB 3ALWA 4NCC1 4Q6KA 1NFKA 4DP0X 4FZ8H 4W9DC 2HJLA 3VCLB 3FYIB 5J6HB 2O5XL 5K9JL 1QG3A 3EDFA 1GOHA 3HPJA 1ASPA 5E00A 3V4UL 2EE9A 3L9BA 3OAUH 4KMQA 2C9QA 2H5UA 2R4SH 2XZQH 3N9GH 3BZFB 3OJMB 3KYNA 3L81A 3LKOB 2CXGA 2HX9A 3L2NA 1RK0A 4L8SA 4QGYA 1MCLA 3RNQB 2VM9A 2W94A 3ILQC 5DFVD 5B3SB 5MEQB 4IGBA 1OAUH 1ZEAL 4GT0A 1Z9SA 3VFNB 1ZGLA 4FNUA 4X80L 1L5GA 1M9WA 4ZJ9A 2Y1AA 3SQOH 2V8MA 4R97B 3SKMB 3ZTCC 5DC9B 5J6GB 3CVHH 3EOYG 3VRLF 4L1LA 1FFNA 1CD1A 1R3KB 3OKYA 2NPLX 3L7EA 3R7QA 1AIFA 5FXCH 2V7HA 5D1XB 4O2FB 1LMIA 2P8PA 4C4KO 4WKXA 1PD1A 2P5EB 2AMGA 2F0CA 1HSBA 2V3DA 1JD7A 4G7YL 4MMZB 3UYRH 2WV3A 4W70A 1ORQB 3GJEB 3L4CA 3U4AA 3LCYA 1CGXA 3AY4C 5FF6A 5I0YA 1I1FB 2QDWA 3SDYL 3NYKA 2IDSA 3FQTB 4LKXA 4R26H 4H8HA 2ITCB 4ZQKB 3T0XA 4OGYL 1HILA 4O51A 3VXSD 4R5TA 2CDGB 5D2NB 3AROA 1WA1X 5CJQH 5D7HA 1B4TA 1HH9B 1BQRA 4HUXB 1MG3C 4JRYA 5DFVC 2WXPA 2DTML 3DMMB 5F97E 1QFWL 3UBFA 4YL9A 1IJNA 4S1QL 5J57B 2RTTA 3A4FA 2B3IA 2C5DC 2Z8WC 3AAZA 1RHHB 2FWLB 3PWUB 3GB7A 1QATA 1ZANH 5DWUH 3WEBA 2OMTA 4DQAA 4P5TB 1SOXA 5E8EA 1C12B 3DX4A 3MBWA 2OKMA 4I8DA 2WLNA 5I1EH 3U46B 3ETBJ 2HPOA 2YSSB 4D0DA 4NQXB 5MEPA 4FQJL 4FTDA 1YNLH 5A2LH 4DP9X 1NGQL 2D2CC 5IG7A 2GSGA 1JGUH 2E7HA 1OW0A 2BX5A 2WWNA 4P5RA 1M7DB 1WBYB 4Y1TA 2OM5A 2OYPA 5DYFA 2QQNL 3N41F 2FJSA 3LV3B 1XGQA 2WQUA 1RZ7L 1E42A 1ZK5A 4NI3A 2JIXB 3CXHJ 3CPUA 2QELA 2Z6FA 5BZZA 4W9ZA 2V5SA 5KSBA 4U6TA 2D9CA 4PWFA 2DH2A 2G5RA 5F7UA 5K39A 1T2XA 2MPVA 4YSPA 1R0AH 2YD3A 1ZXKA 2X4UA 3CXDH 3FFDB 1YNTA 4KVNL 4P3DA 3RYMA 3O3BB 1N3NA 1YNTF 3HNVL 2ATKA 3HFML 4U1NA 1HQRA 1KIRB 1K3IA 3TIEB 3WN5C 4MCYA 3DIFB 1GR7A 3VH8B 4XCCL 1AFVL 2E9WA 4RAVB 4UV7L 1RK0B 4FYSA 4POZC 3ARFB 4QHKJ 1VFOA 5C6TL 4AENA 3SCMA 1C16B 3GSNB 3HAEH 5FFOA 2GEQA 3QXAA 4WI9A 1BM3L 1TJHL 5D7IB 4J3WA 4DZBA 2QHLA 2BNRD 5D96B 2XWJA 5DC2A 3VGAB 4FABH 2XHNA 1M7IA 3I9GH 1FNSL 1SYVA 2JELH 3ZE0F 1CGWA 3TT3H 1GOFA 3CFJB 5I6XC 1QX1A 4XPBL 1MI5D 1TTAA 2AV7A 4FJZA 4WSGA 3DX7B 1GIGL 4JO4L 5HHPB 1LILA 4YO0B 5CINH 3REWA 1JPTH 3BKYH 1UFGA 1WFNA 2P48B 2Q8AH 5C0IA 4URKA 2H6PA 4WENB 3R0MA 1U8HA 1K4DB 3PDDA 4LLMA 4J3BA 4LKXB 4Y2DB 3HG5A 4RSYA 1IKNC 3CDYA 4H7VA 5DJ6A 2SEBB 1R5WA 2OZ4L 5EOCH 4EXPX 3QZMA 4KV5F 2HJKB 3FRUB 3POCA 1P5UC 2BHZA 4H2AA 4PR5A 4JO8A 3FU7A 4KI5E 2P80A 1PS3A 1E27B 5FS5A 5BZXA 1OTSD 4EKJA 4B9ZA 4E41E 4PP1D 3US0A 4XAKD 4PRPD 4OD2B 2A9ML 2GHZA 4IOFC 3GBNL 4FYQA 4ZUSB 4AT6B 4JM2D 3UAJA 1XT5A 3F85A 1FFOB 4XN9A 2BIPA 1JV5B 4GRWF 3KVQA 4LESA 3TH3T 2PWFA 5GISL 1BECA 4WW2B 4APQA 4GJTB 4P9MH 4BUHA 1NPJA 3LKQA 7FABL 3QNZA 4A68A 3GMQA 4FMKA 1BOGB 3D51A 2EQDA 4TVPL 5CKGA 5MEOB 3EAKA 2ICEB 3MV7D 1B9ZA 3PHQB 1JHKH 1UZ8A 5JW4N 2APWA 4FYRA 3TA4D 1FNAA 2DQCH 3ZYZA 1LVEA 4LOUD 3RWCB 1R33A 3KZ8A 4P3DB 1NEZG 1U9KA 4NN7B 3GZKA 1PLAA 1G84A 2AK4D 3MZGB 1LK3L 5JOPE 1MJ7L 1AXTL 1UXWA 1GMIA 4H5SA 1LO3H 3U9UB 3IN0A 6PCYA 1MZYA 4KFZC 1OTSC 3KBFA 4OQTL 5A2IH 2ZWNA 2V9TA 3BUQA 5F1SA 1ID5I 4PP1C 3P0GB 1NAMA 3V0WH 1QFWI 1PDKB 1IEAA 3HBPA 1L9OA 2DV6A 1PZUB 4RGNE 1I9IL 4H25A 4JM2C 5HJDA 3AUWB 3QCVH 4DZBB 3K6DA 2CO2A 1CDIA 3RU8L 3P11H 3NFPB 2XN9A 4S1RL 4QXUH 2V4LA 3EOBB 3U48A 4HIJA 3IF1B 2XA8L 3OB0K 2AV1B 3QDGB 3BQUD 4OCRH 1TTUA 3UJJL 1CG9A 1X5IA 4DKDC 2YAFA 1XBRA 4MXVE 3JSSA 2J2ZA 4B9PA 1ZE3C 2EH8H 5J06A 1GC1C 5AAWC 2AQRA 4ELKA 4MGXA 4WO4B 5C07B 2DYPD 2GY7B 3IDNB 3TX4A 1DBML 1FL5B 4LOUC 3HNSH 4I1RA 3NCEB 4G6KH 5JHMA 4JHBA 1MCPL 5CLTA 2GJ6B 4OZHF 3WUWA 2H8PA 2HLFC 4Y5XC 4ODXA 3DSFL 5FYJD 3NIFE 4FNQA 2FJGA 5ADPL 4PI0A 3ULUD 1LGVA 1TETH 4AG4L 2Z7WA 1OAKH 3RWJA 1EAJA 3HTLX 1OCCB 1Q9OB 3LRKA 3OX8A 2NSXA 3C5ZD 4IRSD 1RHFA 3H3PL 1FL6B 5E9DB 4NPKA 1S7WB 3KS0J 4G6AD 5KSVB 2ZUVA 2ESVB 1RUMH 3FB6A 4FC3E 3LDBB 4WI2A 5CJOL 2F5BL 4GEJA 4BEIA 1NAKL 2Q10A 4XO9A 1U8LA 3KLKA 1KENH 4ZUTA 3OTTA 5H35B 3VXQA 4M5SA 3BQUC 1A6TA 4RETB 4YHYB 4R9HA 3C6LA 3FTUA 2C4FT 3UAAA 1XIWB 5GQBA 1HEJC 1A7BA 1YPZB 3PWPD 4J3VA 3SKOA 2VDQL 4DVRL 4JG5A 5KEZA 1JZ3A 3I6KA 3T9WA 5DI8B 3KXFA 1D6EB 2X9WA 4LCIL 5E2JA 2AQ3A 2X10A 4F5CA 4F80A 3Q5TA 3I75A 2DBLH 1SNRA 3W9DB 3ULUC 3WKYA 3BEWB 2W07A 5HY9A 2CD0A 4PJ5E 4Y4KB 3C5ZC 4IRSC 4OZFB 2ZCHH 3B7RL 4DGIL 4HS3A 4G6AC 1NEPA 4KO9A 5C0BD 1U2HA 1CTOA 1V3MA 5GHWL 1IEAB 7PAZA 5GS0D 1H3VA 1OOAA 5D71L 3P77A 1KY7A 1QBBA 5GGRA 1YHPA 3KCWA 3VDBA 3FXIC 2ZSVA 2VL4A 5HHME 5EC1A 5TQ0L 1BEYH 3EH3B 5F1NA 4ZO7A 2BS9A 1LLAA 1NDGB 3MACH 4O02B 1KN4L 5EU6B 3DURB 3L16A 5HGAA 2I7SA 3V5DB 1G6RA 1OPGL 3KPLA 2ZNXA 3QS3A 2X70A 3R06A 4QRRE 4DF9A 5LN4A 2BHYA 5F7NC 1E7UA 4B3EA 1A4AA 4BKTC 4YMPA 4PTUA 4EN3B 3OPZH 3KBHE 2ZOLA 3JZ7A 3H42L 5I0ZA 3HW7A 3PP4H 2ZYSA 3MUJA 2ZF9A 4G6FB 3T0WA 4NRYA 1RSFA 3OXSB 4BUGA 2DQIH 4PVMA 4CVZA 3DXAB 1GGIL 4I0PA 1IGYA 4MD0A 4FADA 1TJMA 3IGAA 1BJ8A 5ALCL 1VIWA 5EUOB 1ZHLA 2KBGA 2OR9L 3OX8B 3SDDA 4EBQL 3MOBL 2Q2LA 2WBWB 2ZXAA 4I18A 2EDEA 4OUOA 5DMKA 3M88A 4MXWL 3UACA 4C4BA 5GGSA 2CDFB 3K3QA 4UQ3A 5F9WC 1C9SA 3DV4A 4K71B 1GAFL 4OB5H 4F7TA 2I5YL 1PIFA 3TO4D 2JKRM 3UTTA 2VLJB 2FQFA 4GG6B 2APXA 4GSXA 1EWHA 5L8LB 3MNZB 5GSRA 2GPZA 3M7OA 4WEEA 5FHAL 4DIXA 5BOPA 3IE4A 1KGCD 2EDLA 5HBBA 1U3YA 2B59B 1LXMA 2DLFH 4MXQD 3BLPX 3HI5L 4P3WA 4PJ9D 2R69H 4N8PA 5FGCE 3SKJH 2OQJA 2RFXA 5T1MA 1K8IA 4LF3B 5CJXC 4ZSOE 1JCVA 3D4GA 2H41A 4GSQA 4HSQA 4YAQB 4NPJA 3B9EA 1ED3A 2CR6A 1I7ZB 4G82A 4P4KA 4DKEL 4DQOH 4YVNA 1GA2A 2UZIL 3GM0A 3HG0A 5IQMA 2JK5A 1W8OA 3KH3A 3COOA 5ITFA 2AAAA 2H9GA 4F2EA 5D6DC 3PGDA 2VH5H 5FGRA 5T3XD 1HL9A 4JK0D 5BOJA 1G7QA 2UX7A 3QIBD 1QBLL 2DLEA 4HS3B 1D2PA 5T8IA 5C0EB 4DP6X 5DJCA 2F8OA 3TPUB 3P77B 5T3ZE 1MLBB 3K72B 5JO5A 2WWMC 3CFEA 3VRIA 4M8QB 3QZNA 4IOIB 1TVHA 5GPRA 5DGRA 3ARGD 4PG9A 3FB7A 1PKQB 1PY9A 1F1DA 1E9QB 4M6OH 4MXQC 2XWDA 4Z7OE 2CBMA 4PJ9C 5F3FA 5IW6A 5IEKA 2ZWKA 1FHGA 3KPLB 3OGCB 4G6MH 4MD5A 1S6NA 2EADA 3GZQA 3K46A 4WIQA 5CEXB 1F8TH 4FG2A 4Z7NE 5IFJB 5TGBB 2R29H 2VLKE 1TU2B 1SLVA 3MA7A 2K3TA 3NSXA 3ZLQC 1DBKL 1MCRA 3DX8B 3WJLA 5IVXF 2VLLB 4LPCA 1M2VB 1Q38A 4X4YA 3E0GA 5I74C 3S2CA 4NT6A 5DJ2A 1NGWB 3CX5K 5BRPA 4WFFE 1N8ZB 1MCSA 2QGEA 2AMUA 1SFDA 3KWVA 3T3PB 1UH3A 5F1IA 2YMXH 4FZ8L 3QIBC 1MCKA 3WL9A 4L3EB 4F9LA 1JXGA 1XF5B 2Y06H 1ZHLB 2DTSA 1NIAA 1OF2A 4PJXB 1ZLWK 2PYEA 4M6NH 4N2MA 1FZOB 4X99A 1I3GH 1W15A 2DM4A 5H94B 1XCXA 3OAUL 3JT0A 2XZQL 2R4SL 1JERA 1MREH 3N9GL 3UFIA 1CK0H 2Z91A 3RWEB 1DSYA 1HCYA 1JNLH 1MVUB 1AQMA 3ARGC 3QE5A 4I0KA 4LLDA 2K6ZA 1JG9A 3OAYK 1P2CA 1BQUA 1MEXH 4AV4A 2B15A 2Y9RT 5L4MA 4BBWA 3RWDA 3EO0A 3JTBA 1HHHB 1RJYA 3ZE2F 4YR6A 3HI6H 4ZO6A 1IGFH 1N12A 2E9BA 1FVCA 2PW2B 2MTPA 1A64A 3GGWA 4HMEA 3SQOL 5IQ9B 4M48H 4ELMF 3CVHL 1A8ZA 1J9TA 1F1GA 3RIFF 5FECA 3QJOA 3PJLA 3H9HA 4KWUA 4OFQA 3ABGA 4MMXB 3OMAB 1X44A 3BAIA 2XC8A 3UYRL 3N40P 3WS3A 5IMKA 5ITFB 1P84K 1Z9OA 1V3JA 4P4RA 4QYAA 4K9EC 5TH2A 3WTVA 4BK8A 3FQRB 1UOKA 4UDTA 2QQQA 2NXYB 2EVIA 4HEPG 4X9YA 4CILA 3MV8E 5C7XH 2FO4A 4R26L 3FTYA 4OY9A 3RVTD 1GZQA 3BWUF 4L3CA 3MR9B 3INOA 5L9DH 2IOMA 5CJQL 5DEFA 5HDBB 3WMSA 2QMJA 1SUHA 4ANVA 1AZRA 2CO1A 3SKUD 5B38A 1MHHB 4ALAC 1N67A 3S98A 3L45A 4Y2LA 1OTTC 3A4EA 4FTVB 3VXNB 4HJEA 3MU3A 5ICYB 1ZANL 5DWUL 4E9VA 4V33A 1T7VA 4M8UA 3S3DB 4XE0A 4TUOA 5E1HB 5I1EL 1P53A 4XXWA 2R2EB 4L1DA 4WFGE 4F7KA 4R96B 1JZIA 1DUYB 3K91A 1YNLL 1ZA3A 3IJSA 4RNRB 2CGYA 3RQ3A 1JGUL 2VDKH 3IPFA 5C1MB 1HKLH 4KI5D 1JXDA 4JKKA 5GRJH 2AJVH 4WVRA 1O6SB 4HGWB 1N6QH 4LPVA 1U3HD 4E41D 5E4EB 3B5HA 5C0JB 5EZLA 4NUQA 2PN5A 3LKNB 4BCYA 3TNMA 4G7SB 3D5OF 1R0AL 1B9KA 2YPLE 3CXDL 5MI0B 4TNFA 2A4EA 2YD1A 1KWKA 3GXUB 1FVDB 3T65B 3SZKC 3JXAA 4APXA 1QO3B 2GITA 4KRLB 5L2KB 1DVXA 2ORBH 4TPRH 4N0FA 5AOIA 3RZCA 1CXEA 2YWZA 2CAKA 2FO1A 1VESA 5T1LA 4HK0B 5E4OA 1P4UA 2HAZA 1RJYB 2YUVA 4Z3JA 3WTXA 1U91B 5EFIB 5D70H 4M1CD 4HBQA 2XN2A 3LMJH 2D31A 2XG4A 3QQNA 5JOEA 4FABL 3FULA 1BWWA 1K8DA 3QA3B 4J12A 3FAXA 1IAIH 1XMWA 1O9ZA 1D7BA 2KERA 3I9GL 1I8MA 1TQBC 2JELL 3HUJE 5AL8A 5CILH 2CKBH 4Z0BH 3TT3L 4EVNA 3MNWA 4ISVB 1I3VA 2YXFA 4HHGA 4ZDHA 5KAQG 5JOPD 4KI5C 4HZLA 4WFHD 4QRBA 3HC3H 4WK0B 5F1OB 1NFIB 2V7NA 3QULA 5AB1A 2P52A 5CINL 1JPTL 3BKYL 2Q8AL 2CJSA 5IMKB 2E7LC 1WWBX 3PF2A 2ARJB 4K7PH 5AAPA 4FYTA 3AM8A 5EOCL 1CCZA 4WJ5B 2OZ4A 1B6DA 2NYYC 3UP1A 5IUSA 1G0XA 3S7GA 3X13A 2X7LB 3GS0A 3B2DC 1UT2A 1ZSHA 1BZEA 3CFDB 2ZYRA 4M1CC 1JZ6A 4U0QB 3TBSA 3ZHLA 3EGDB 1YC7A 2P1YA 1QW9A 3X1EA 3LNGA 4YGVB 3M17B 4W81A 1KTKE 1AQHA 3T8VA 1ZPLA 4JPKH 1IZKA 4A39A 2NCMA 2D3JA 2GUOB 4EF3A 1TKWA 2F7IA 1R5IA 4GQRA 2YD8A 4P9ML 5C0DB 4E9LA 1BX2B 4JDVA 1AZBA 4WDIA 3BXNB 4DP5X 3NBNA 1A4BA 2PWHA 3HG1E 5JIHA 3UBXI 5G5DB 1JHKL 3WFCH 1H0DA 2DQCL 4KY2A 1WFIA 5D7JD 4BFBD 1E2WA 2VT0A 1I9RH 4HCIA 2Y22A 4YHLH 5FYKE 1PTZA 3QUKA 4DGYH 3O6LH 1SJHA 1SDYA 3VA6A 4M56A 2BSED 1E3FA 2XI9A 1BSIA 4OUUB 4WHYG 4C47A 3RY6C 4Y4HD 2VSMB 4E0RB 1LO3L 1BJ1H 2V5RA 4J8RB 5GJSH 1QI5A 2C3HA 3B83A 2GITB 1JMZA 1HH6A 2V2WA 2UWEF 5TDNA 3V0WL 1N59A 3QORC 1UJ3B 3STLB 1FGNH 3DLQR 5SWZA 4F57H 1RIUH 3QCVL 1CE1H 5F8QC 3WHE0 2GEEA 4ZMYA 3P11L 4HPHA 5D4QA 3C60A 4KRNA 2V3FA 4QXUL 1E9OB 1TVBB 3F62A 3EJPA 4Z7UF 5F1KC 3S5LB 3MNWB 3JWDH 3P4NA 1CFVH 4OCRL 4OFVA 4MJIE 4RMVA 2DLGA 1NDMB 4PJ5D 4WNJA 3ARQA 4G11A 1IAKA 1VSCA 2EH8L 1U21A 3C8DA 3Q2WA 1S7SB 4Y2OB 3NDYE 2R1YA 1OKEA 3ZKXC 2W59A 5D7JC 1H9VA 2GTWA 4P99A 4ZXBC 3HNSL 2J5LC 4H8WC 4G6KL 4MJ6A 4PJDE 4XO8A 3V5KB 4BFNA 1SJMA 2QADD 3V6OC 3O9WA 4Y4HC 4GYBA 2AEIT 2UZXA 3Q2VA 4XMXA 5J11C 3CH1A 1FYTB 1TETL 5JQIB 1OAKL 1UD5A 4LPXA 4LT7A 1UA6H 2C7UA 3FL7A 1KLFB 2K78A 5E8OB 3PWNA 5ERWA 4GKSA 4HKJB 3A6BH 2F53E 3GSUB 5BUAA 1RUML 4BYHA 3G9VA 4YHPA 2WUCH 2UZPA 3FQNA 5IR1A 2EYRA 2MH4A 3BW9B 2BVOB 4JRXE 3ENEA 1JPST 1IFRA 1KENL 1D9KB 4Z95H 3W11C 4X5XA 1DQVA 4MX7A 3P4OB 2ED9A 4PBDA 1CLCA 4N28A 3VNZA 2ARJQ 1X9UA 3GC3A 1T21B 2QV2A 4HUCA 5D55A 3ULVE 3ARBA 3BHBB 2G2NA 4KQ4H 3QIWD 4FZEH 4IYKA 1KGYE 2FLBT 1AGDA 2YGOA 4NWTH 2AQSA 3L3DA 2BK8A 5E2TH 4ONHA 3FT1A 4DPCX 3KDPB 3D0LA 1ACZA 1SBBA 2DBLL 1MHPH 4ZX3A 2MSPA 2NX5E 5D1ZI 1LNUA 3KWWB 1AD9B 5INCB 2B14A 3RGVA 1CLZH 7CGTA 2EDYA 4LASH 2ZCHL 3D2UA 1WUZA 4P2CG 1M3JA 3V6ZA 5BW7A 1DR9A 1JNJA 2VITA 2ZG3A 3M1BA 2Q6WA 2Q86B 4OZIA 4J28A 4LRIA 1NWPA 4X8JA 2X9ZA 1BEYL 3T0EA 3MACL 1PZBA 4ZMXA 2ADIA 2WQRA 4Y19B 5EV7A 2B39A 3HKZA 2IDQA 3QZLA 5HTSA 2LVEA 3V7AE 3LN4B 3CDCA 4G1EA 4KRPB 2OR8A 1KOAA 4CVXA 1UTDA 1C1EH 4NQDD 3ZDXE 1IAKB 4ZFOL 2M26A 4LHUB 1KC5H 1NLBH 1S7XB 4X4XA 2GQHA 3OPZL 3PP4L 1CF8H 4OCSH 3F65A 5T3ZD 5C0CE 1AHWB 1DBAH 4G8FA 1YECH 1S7QB 1AGFA 3TO2A 1G9EA 2DQIL 3RHWK 1MAMH 1TUPA 5HYFA 3IFLH 3FCSB 5DZNA 1XVSA 3VM5A 3VSVA 1AS8A 4YSCA 3LZQA 2FEEL 4WO0A 1E6JH 2ADFH 4X5RA 5HDLA 4J4PA 1UWYA 3NCCB 3LB6D 3PWNB 2EH7H 4H0LC 4UDUA 4YHPB 3VX1A 4NBZB 2DWSA 3N1QC 3NJNA 4OB5L 5GZOC 2WZAA 4J39A 4KKCD 2NY6C 4L5FE 4EO5A 1XAUA 3GMOA 4GW4B 2WGNB 3DX2A 2DLFL 3VWKA 2C9SA 4R8WH 2R69L 2PCFA 4XNBA 3SKJL 4HG4K 4YNYA 1E8YA 2MOQA 3VX0A 4QXGH 4X6DE 1HEZA 5I1LB 4YVUA 3ARPA 3WGVB 5FCUH 2XZZA 3MRJB 4JJ5B 1LO2H 1J05A 3QDJE 4R4BB 5CSZA 2YARA 4PJXF 2H2SC 1DJSA 5HI5D 1LE5A 1PZ2A 4DQOL 2EZ0D 5K59F 2PR9A 3LAFA 4BQBA 3U6RB 1G7LB 2AKRA 3WTTA 2E0PA 5E6IC 4WSJA 1DO5A 3HMXH 5LB1A 1BZDA 1AZNA 2VH5L 2QLVB 3IDIA 1QUPA 3HR6A 4GS7C 3LB6C 3V7AG 4AL8H 3KPPB 2EICA 5CBEB 4UQIM 5ESQA 4A67A 1AGBB 3HIZA 3REVB 3KPTA 4JLRB 4ZFZA 2QHRH 3UROR 1T0MA 2ZX7A 4KKCC 4YX2H 3RVVD 5ENWB 1Y6KR 4GAJH 3Q9QA 4AMXA 4M6OL 1P7QB 4GBXA 5GIRB 4S0HA 1HYSD 3ATEA 1PNCA 2BIOA 3DK0A 4HV8A 4HZAA 2B3RA 4AM0A 1NEUA 5FKAA 4JY6B 1AZUA 3NIDE 4G6ML 4G1EB 4JCWA 4LGSB 1F8TL 3MV8D 1KCRH 4MLIA 2R29L 3PWLA 3QFJA 4U3SB 4G83A 1SXNA 2B20A 4NRZA 4CGUB 1T5WA 5HI5C 1QQDA 5JA9A 4PJCE 5C09A 4KITB 4M6AA 1J9RA 2EZ0C 2P5WE 5BO1H 4G8FB 4L2YA 4AX3A 3TO2B 1QRNE 3HB3B 4P48A 4AQ1B 2Y2WA 3FTSA 3UAEA 4PJFE 5EF1A 1WSST 1UGKA 1FZKB 1DO6A 4G9FB 2A9BA 2BSSA 3HHSA 4L9LA 2YMXL 4IIQC 3L08A 3UEZA 2EO7A 5C08A 1F41A 3OXRA 2ADGA 3VTMA 2Y06L 3L3HA 5FUZH 3JVFC 4FX5A 4M6NL 2KPNA 1I3GL 2F54E 4WFGD 3SDCD 5C86A 2WTRA 1MREL 2VDMH 3A67H 1CK0L 3SPVB 3NH7H 1JNLL 1EEZB 3KDMB 5TE7H 3RVVC 4P2QA 3CZEA 5LNEA 2P24B 3X17A 1MEXL 2BNQE 2E46A 1KDIA 3T77A 4F15C 4M9OA 3HR5A 4JQIH 1IGJA 1TPXB 4AITA 3HI6L 5JOFA 4PV9A 1IGFL 5EU7C 4J2XA 5F9OH 2PCYA 4N0UE 2W65A 3FO2B 3VFVA 4MB1A 1HSAB 1JPGB 4M48L 4Y1AE 3NZUA 4Z7WB 1ID2A 3D06A 2YPLD 3NPZB 1UH4A 2VW4A 4H13C 3W9EB 3CVHA 1CQKA 3WKMH 3WJMB 3RKDC 5KZCD 1OM3H 5GRUH 4PJ8B 3APNA 5JPMB 1A4CA 5IB4B 4P0DA 5DJDB 3VGFA 1YC8A 3RDTB 4F9LC 2K9FB 5DVOA 4YWGH 4KX9A 4X6CB 3EG9B 2QPEB 4GQZA 5K5YA 5C7XL 4WI3A 2FEEI 3DX6B 43C9B 3AS1A 2AQTA 4NAMA 3RJQB 5DHVH 5JW3H 2Y7NA 1PSKH 2OLDA 5FFLA 5L9DL 2W60B 1I3RA 5F6IC 1KPRA 5ISZA 4TQPA 4MNQE 1H3PH 4ZFZB 2XSKA 1BIIB 2YAPA 1O9VA 4OF5A 5EOTA 3EJCA 4P9HH 3EOTH 2EIZA 3RI5K 3ESMA 4FF9A 1AIZA 3OKOA 4GSDH 1FCCA 4V1DE 2IXQB 3ABZA 1KYAA 4ATTA 1AGEA 5DVPA 4TSCH 4CL7A 3LZLA 3QRGH 3VQ1C 4GRLB 1T0OA 1VACB 1LJMA 2J25A 3P0YH 1CYXA 3GTNA 5J12C 4PG2A 3SE4A 3CFNA 4JFDE 2X89A 5IJKC 3Q2CA 5B39G 2XV6B 4I5BA 1HKLL 5KYYB 3VFMA 1XF4A 1XTLA 2AJVL 5GRJL 3RY5A 3PFUA 2OI9B 1N6QL 4OI7A 4F2MA 2B08A 3BWUC 4QI3A 4AIXA 4BA8A 4N6RA 4TL4A 4P06A 2V5TA 4BK5A 3K1DA 2JXMB 5F7AA 3WXWH 5I24A 1BF5A 1D5RA 1QABA 3VFTA 5EDXA 3B7SA 1I8AA 4PJGA 4PJHF 1JDAA 2LTQC 4GKZA 4IK7A 4IIZA 5KTEH 3UX9B 3WLWD 2ODHA 1MVYA 1I9EA 1T0NA 1X5LA 3MV9B 4YSOA 4ZFFB 2X4PA 2ORBL 4TPRL 1NFDB 2B1OA 4MA3A 5EEUA 5EF0A 3OHMB 3E8VA 4LSSH 1J0YA 5CLZA 2DMKA 3T6VA 1UZ6F 5D70L 3SYOA 5EEZA 3LMJL 5E4AA 5FA3A 4KTDH 2R0LH 3W0WE 2W95A 3KL5A 2XBZA 2G0LA 2ICWI 3U2SB 3KPNB 1IAIL 4LLWB 4TM9A 2AXFB 5CILL 4MAYB 2CKBL 4Z0BL 1WZLA 1I85A 3ZSTA 1QSEA 5CMAB 4R3SA 1HN1A 2HFFA 4TSBH 1HHGA 4OD1H 4XNUH 3HC3L 5K9OB 3OBAA 1QPKA 3BCFA 4HLZG 3NFSH 4KAQH 3UBXB 4RGMC 4YSTA 4QYOA 2Z9TA 4YLBA 1ECYA 1N0XH 2AK1H 4K7PL 4FQHB 3GSWA 5I0VA 4QOKB 3V52H 3LQZB 1B88A 1TYRA 2VNCA 3RL2A 2D03H 3ZE1E 1PU0A 4YDZA 3WGUB 3FRPB 3WLWC 1NIBA 5D1ZA 2GCYA 2N4IA 4MJID 1IIIA 5EBMB 5EOTB 4JN2B 1VEPA 3MVSA 3QRBA 1XGUB 4OM0H 1RULH 4WHCA 4YFLI 3S3CB 2BXYA 2BMKA 1MAKA 5EZJB 5JA8B 2CBPA 2WW8A 3TV3H 2GC7C 1WYJA 5DQJB 1LD9B 4J3OG 4JPKL 4M93C 5E8NB 2WCGA 4XR8C 1J11A 4LKCA 2GK0B 1XSJA 2KS0A 1VA9A 4J3XA 1P7KA 1AKJB 3B9VA 5TK4A 1WA2X 2VZUA 3HMWH 3WHE1 4BFRA 2ZQKA 3CPLA 3QUMB 3RVUC 2RH0A 1N10A 3WFCL 2XXCB 2Y69B 3V0VB 2ZIDA 3EO9H 2F53D 4HT1H 4AE0A 2L7EA 2XJKA 5HJ3A 1I9RL 4MD4B 5KSAD 3SE9H 4YHLL 3CN4A 1RZ8A 2NZ9D 4AW7A 4DGYL 3O6LL 2VN5A 5AVYB 1PZ5A 4BGDA 3CFIC 1WG3A 3T08A 1L3WA 2VC2H 3EKCA 3DUSA 2XNAA 4AM0Q 2J1WA 3AFLA 1PD6A 5GJSL 4HKBB 4PCYA 1YEHH 2R0WH 3GJFH 5CGYD 1S8DB 1VRSA 3H55A 3ULVD 2WO2B 2B5IC 3GSXA 5E1GA 1FGNL 1R24A 4F57L 1RIUL 2F74B 2PR4H 3Q44A 4FFZH 2HH0H 4K94H 1SXBA 5F0PB 3WDJA 3IVKB 1CE1L 3HAEB 1EXUA 3CN1A 4X98B 1A4KB 1UT9A 5EO1B 1ETB1 1ORSB 2NX5D 5FC9A 3JWDL 1CFVL 4LPWA 1E28A 2UVFA 2YR3A 3Q9PA 1LE9A 1KJVA 2NTFB 3LZPA 3FDWA 4W4NA 2W0FA 5D7IF 5D2NE 3G5YA 4ZBJA 1OK8A 2ZAIA 1G0DA 1QLFB 5JW4Q 1CYGA 4CBZA 3TF7C 5BS0A 4MWFB 1HINH 4FEMA 1NGPH 3JWOH 5AKTA 3N06B 1JD9A 3AS3A 3MN8A 5IJDC 5KSAC 1KGXA 3MLTA 2NZ9C 3MBEA 1NC4D 3Q6GH 3VMOA 4RRPM 5AVUB 4AEIH 3RWGB 3EXLA 2HFEA 2AFNA 3N42B 5E2WH 2XRAH 1RP9A 3PQYE 1PCXA 3QWOB 3MJ8B 3OAWA 3PUUA 3D09A 3K71B 3U79A 4ANUA 3NRQA 3ULVC 2DBJA 1UA6L 2Y07H 1F02I 3N3EA 1HYRC 4WTXA 1V7NH 4LPUA 3A6BL 2VZSA 1AXSB 4WCYH 2WUCL 2RHEA 3CFKA 3HZYB 3TA3B 2IBGA 4M02A 4IKLA 4A63A 4DPAX 5SV4A 3WEXA 1CVRA 3GSQA 3G5XB 3KLAB 1RY7B 3F7QA 5DA4A 4WW1B 4Z95L 1IAII 1XB8A 3PGFH 2HTKC 2N3JA 2C34A 1U8OA 3RP1A 1S9VB 1EHKB 4TNVK 5DRWA 3RPIB 3O3DA 1E4XI 5CWSB 3X1FA 5J8OA 4NERA 3CZUB 2BOCA 3DUHA 5AWNH 1OP5H 1LP9A 3FU5A 1LP9F 4KQ4L 4FZEL 4F7MB 1RCYA 4XBEH 1UURA 4F7EB 2A3TA 4NWTL 3A6CH 2WZ5A 4L3FA 1UD8A 5HHOA 2X44D 2FIKB 5E2TL 5HJ3B 2X1OA 3DI3B 4LVOB 5FYJU 1PZ5B 3X1NA 4B9KC 1MHPL 3IRZA 4QLWA 3G5ZA 4HWBH 4QO1A 3SJVA 2X4QA 3QZWB 4PJBA 1CLZL 5HYSA 1BYOA 2RACA 5EG6C 4L37A 1BQHB 4LASL 4H1LB 4IQHA 4F33B 5CEZE 4GAYB 1W0WB 5JORA 2W9LA 6TAAA 3GXFA 4LLVB 1XCWA 3OKEA 5BV7C 7PCYA 1L9MA 1EXUB 2BFGA 1N6UA 5DJZA 2X41A 5D2LA 3QG7H 1Q9WA 3QZOA 1OSYA 3DROA 4HDIB 4M3KB 4XZUA 4P46B 2LAGB 4ZS6D 3ARBC 2YUWA 4M7KH 4NBXB 1C1EL 2R23A 2NW3B 3OL2A 3RKPA 1W0VA 1OO2A 3WU1A 2W0FB 4PLKD 4GSUA 1KC5L 1NLBL 3K4DA 3D18A 5AALA 3J7HA 5J1TC 4UM9D 1CF8L 4OCSL 3TYFB 1ZGLM 3IDYB 3DRQA 2K7PA 1YECL 3HRZC 4JRYE 1NKOA 1KB5B 1MAML 4NKOB 3S37H 4BFEA 3IFLL 3Q2NA 2MHAB 4G7VH 2P5PA 2DQDH 1NCIA 4RWYH 1MLCA 4Y9EA 3RA7L 3WJJA 4IJ3C 1U93A 4ZTOL 3T6WA 3T3MB 4E42A 5LXVA 2FCBA 1E6JL 2ADFL 1UD4A 1FNEB 2X38A 4MA1C 1VKXB 3HE6B 2X6AA 1NOAA 1CWVA 2EH7L 3PAZA 5BZDA 1KZYA 2XWZA 1G7IA 1VCBC 2E86A 1NL0H 1HHKB 4BSWB 3JZYA 3WNMA 1XO8A 2P5WD 3MXWH 4YUEH 3GRWL 4PGBA 5CEYB 1U2CA 2C4XA 1QRND 1ZLVK 2NQDA 2ALAA 4ZS6C 5IK3A 4LLQB 1O5DT 3BLKA 3CAFA 3D0VB 5I26A 1JZ4A 1PX4A 4GOSA 4JFEB 5J9PB 5KSBE 4R8WL 3O3DB 4U3HA 2CCWA 4U6HB 4ZTEA 3ZQXA 4PLKC 2QSVA 1CFNA 2WZ6A 4QXGL 1FNFA 1LQSR 2R69A 5ANMA 1ZAGA 2FQEA 5FCUL 4WUUB 1LO2L 4D8PA 1U92A 4R4FH 4XP9H 2F54D 5A7EA 2C1OA 3CSBA 3NZ8A 3HS0A 1T20B 2OMZA 3AQYA 4MAUH 2OCCB 4HALA 3AMKA 5HYJD 5I16B 3TEYA 2BNQD 1HWHB 4A7GA 3HMXL 1YPZF 4PJBB 4HAKA 1NMCB 2BVPB 4F7CA 5J13B 5J9PA 1OHQA 4L4VB 3VFPA 4BH7A 1LM8V 4AL8L 5HHNA 1OT4A 1CGYA 4UQCA 1EH9A 4PVNA 2COVD 3FU0A 3QDGE 5IP4A 4J5VA 2DRUA 2QHRL 1PIGA 1R9FA 2R83A 4LLAA 4PCTA 1WIUA 4YX2L 3FSWA 4GAJL 2QJDA 3UZVA 4YN3A 3FO1B 1TQTA 4XZUB 2FVNA 3R8BB 5C07E 5HHQB 4N90E 4LIQE 2WXMA 3A3YB 2YZ1A 5SWSB 3HPLB 3T8MA 3UZQA 3SO5A 2ENYA 1SVZA 3VFUB 2X4SB 1KCRL 3GSVB 5K9QI 1WF5A 1ZS8B 3Q06A 4OI9A 4L8CA 5FDWB 2R29A 4Z76A 1OEZW 4L4TA 1XX9C 4PRBA 3VXOB 3U1QA 1O0VA 5DHYB 3IAGC 4MNQD 1Z6JT 5BO1L 1TXKA 2EVJA 3V55A 3TNNB 4JFFB 3G04A 2YZ8A 4P2RA 4CMHB 1SXCA 3IT8D 2IH1B 4J1UB 3QIUB 4DN3H 3ULSB 1RJCA 3AUVA 5FUZL 4CC0A 2AERT 3O8XD 4Y9CA 2PO6B 2VDML 3A67L 5F88A 4C56A 3TFKC 5IIEB 1JV2A 2M2DA 3NH7L 1NC2D 1CFQA 5TE7L 3HFFA 4XWGH 4YZFF 3LZOA 1VFMA 2J6WA 3A47A 1CE6B 4A6YH 2WGXA 1T3FA 1SJVA 2VLRD 2WBJD 5AW9B 2PTUA 1JTOA 4JQIL 2BHFA 2ZCLH 4HWNA 4LBEA 5EUOF 2VRQA 5JTWA 2UXTA 3GIVA 5IHWA 2VERN 5F9OL 1ZJAA 2VDOH 4S0SD 1EANA 1ETZB 2O4EA 4BKSC 2A74B 1C7SA 2YC1A 5AKVA 3KCPA 5MERB 2WINA 1SDAB 1Q0EA 2X88A 3PIQA 3WKML 2AGJH 2ITEA 1QBMH 4HJ1A 5IV2A 1OM3L 5GRUL 4Y5YA 2XIIA 4LGRB 4U3CA 5C0AA 5C0ND 2UX6A 1YA5A 3IKKA 1M2OA 5F7YC 1VGKB 2WIIA 1WH0A 4YWGL 2H0PA 3HZVA 3SQRA 4CUCA 2YA1A 1WAAA 3D2TA 1I7TA 2LT9A 4KQ3H 4AYID 1AG0A 2CZNA 3HS8A 4FKEA 4Z6AT 1ROCA 1S9WA 4RZCA 1X4ZA 3O8XC 4PS4H 2Z0UA 5JLZA 2QPSA 5JW3L 1F3RB 1PSKL 1URIA 1E3XA 4KOBA 2DKMA 4RFNC 1H3PL 2D9QB 2YRPA 3GXNA 5AG8A 3RILA 5KVDE 1XF2B 1S3RA 4FXKC 1VCAA 3VXSB 3TN0B 4PD4J 1BVOA 4HUNB 4P9HL 2WBJC 3EOTL 2UY7B 4MNHB 5FA4B 3BE1H 5ICXB 4GSDL 3ZVVA 4JUSA 2V0AA 3RWFB 2UUDK 2YGPA 3G6JA 4HUKB 1VFBA 1X9LA 4TSCL 3QRGL 4FQ1H 3BWAB 4NO2A 1I1YA 5FOBB 4I2XA 2ICWB 1CXHA 2OULB 4KK8D 3P0YL 3JUYA 4KX7A 1F0LA 4UM8B 4PW4A 5GRVL 5C0NC 1Z32X 4R7NB 2XPZA 5AVRB 1RZGA 3QHFH 2B4CC 1FNGB 4M6MH 2KH2B 1UOVA 5KN5B 4U7MA 3BPLB 1S9YB 5EU4A 3HE7B 5KANI 1QTSA 3DX9B 3FQ1A 4MJ5A 5CCGE 3S8FB 4MCMA 2VE6A 1NUFA 1T83C 2F61A 3B4NA 2EDWA 3ROLB 3EZJB 3P9MB 4JDEB 3WXWL 4GG6E 3FOLA 1LYQA 1UWXH 3HN8A 3DHPA 5EU3A 1F4XH 3HLAA 2FE0A 2FT6A 1Q9LA 5T5NG 4D0BA 5JIDA 5KTEL 3HBQA 3DYMA 4KGJA 1XBDA 2JMRA 2ZD0A 4J3SA 3RUGB 3T3PF 1G7MA 4N2HA 1N6VA 1UXSA 1D3CA 3PS6A 5F6HJ 3B37A 3CFUA 3H2PA 1WFTA 2FSEA 2X9YA 4LSSL 3E7JA 4PRHB 4U1LA 3KXFE 1WS8A 3JVGA 2EXYC 4XRCB 5B1JC 1V27A 3J2PA 1N0LA 4KTDL 2R0LL 1H3UA 4F5CE 4D9QE 1S5HA 4KK8C 4FLSA 1WGVA 2Y3AA 5IVZB 1WA0X 2YC1B 2MCAA 1Z5HA 3PIQB 4CC1A 1ADWA 4TSBL 3UIZA 4NNPH 1BGXH 1DQJA 3N1MC 3I3DA 2VUKA 4OD1L 4XNUL 2A2QT 3PCYA 1KJMB 3DPBA 3NFNA 3PWVA 4M61A 3NFSL 3NN8A 1A2YA 4KAQL 4HOWA 2WIIB 4JCMA 1FAKT 1IKOP 3DJZA 3HZVB 1N0XL 2AK1L 5ECJE 4NN6C 5D1XD 4QRPB 2OMYA 2P5ED 4H40A 4ILDA 3RTQA 2RQ8A 5CLXA 3V52L 3S88H 1A6AB 2VXUH 2D03L 1TTCA 3BPCB 3UMNA 3WUWG 5AFAA 1PX8A 2JJSA 3O11A 3SO3B 5M94B 2F8XC 4YXKH 3WE6A 4GW5A 3B2UD 4NFCA 3N44B 5AAMC 1DANU 1QLEB 2A77H 2TRYA 1BQSA 1RULL 2R15A 4OM0L 1L6XA 5DZ9A 3CMOH 4RBPK 1Y0LB 1ZHKA 3LKRB 3PAUA 2W0KA 3OAZK 3PUCA 1RXLA 3A23A 1G5GA 1BLNA 4BWWA 4ZMLA 1TQSA 1CQYA 2X28A 3LVEA 3N0PB 4PREA 1TJXA 4UQ9A 4XH2B 5HDBF 3TV3L 1UB5A 3KEDA 3DMMD 2C3GA 4GNKB 4CN1A 1Q0XH 4FI8A 4KKAD 1CT8B 5F9DC 5KYWB 1RZIB 1JNHA 3BH8B 2ZKXA 5FKPA 3HMWL 4R97C 1A6VH 1SLUA 4P5TD 3NA4A 2VDKB 5LBVA 2G5BB 4W9HC 2KYIA 5CZRA 5IEHA 3OD3A 4C54A 1XF3B 5D1XC 2J21A 3EO9L 1M9SA 4HT1L 2A6IB 5BOZG 2NLJA 4XNYH 3SE9L 4LL1A 1XCTA 3MV7B 4MMZC 3NOIA 4P2OD 5HD8C 1TLMA 2A9DA 1P5VA 4PV8B 5TDOA 3ZQ9A 2ERJB 3VGGA 3HLAB 1DQTA 1AYRA 1Q9LB 2VC2L 3SGJA 2JIXD 4EIGB 3B2UC 3CFTA 1QFUH 1J1OH 3FT4B 4Q89A 1AO7A 3VJ6B 1YEHL 2R0WL 5IM7A 1QPPA 1R3LB 1D5XA 1UXSB 3NIGB 3ROOB 2VZ1A 4XVOA 7TAAA 1FL3A 2CKNA 3FB8A 1IARB 3D85A 2PR4L 4RX4D 1AANA 2DH3A 2HH0L 4FFZL 3CX2A 4K94L 4D2NA 1SN2A 1S5HB 3ELQA 1WQVT 3DMMC 2RR3A 4EUPA 5FGSA 2WHVA 4WTZG 4KKAC 4GKNA 3ARFD 1TSHA 4AH2B 1RLBA 1EAQA 5I6NA 4R0LB 2CKBB 2WP3T 4P5TC 5FX3A 3ZTJH 2N59A 4XNDA 4M61B 1J48A 1AQDA 2Z4QB 4X9IA 3IJHB 4GXVH 5DJ8A 5CEZD 1ZTMA 3NN8B 2QFPA 2EEDA 3QEHA 3ZYOA 1H3GA 1JYXA 1T89A 1HINL 1NGPL 3JWOL 3LZFH 4GINA 1AYOA 5E7BA 3Q6GL 3DVGB 4AEIL 4KKZA 5J1SC 2Z8VC 4M5YH 3A21A 3L7FA 5SWQA 5EO0A 5E2WL 2XRAL 1G1CA 1MCWW 1UWFA 1QSZA 2R51A 2XACC 5D6CB 5DZLA 4WSKA 4HD5A 1AH1A 3FUJA 2K4WA 2OMXB 2Y07L 3S3PA 4PLOB 1BVNP 1INQA 1V7NL 3L3OC 1OTUC 1P4LA 1QACA 3N5AA 3VO0A 1YY8A 3BYTA 5HGHB 4WCYL 5I8KH 2IANA 1H9DA 3QQXA 4F37F 2HMID 4M5ZH 3BAYA 3AT0A 5TE4H 4HCFA 5KYNA 4G8EA 3PDGA 4RMSA 3PGFL 3BD3A 4FNLH 1IE5A 2PYFA 4F8NA 1H15A 2NY0B 1JFQH 3GLZA 5LGHH 5D96C 3VGAC 2CIKB 2G0KA 5AWNL 2ZONA 5AW0B 2V5YA 3GMNA 3QG6B 1Q94A 2BP8A 4XBEL 4D7BA 2JCCB 3EJRA 3LX9A 1BAWA 1D5BA 2J88H 3A6CL 1WAEA 2Z7UA 2FJFA 2XQYA 3P4MB 5EF2A 3RBSA 4PRIB 5CU5A 3A22A 2OMVA 3LSOA 1SM3H 2AANA 3DETC 4N2KA 5I8EA 5F71A 4HWBL 2E47A 3BYYA 4YBQD 1XR9A 5AW4B 1T1ZA 3CBKB 5GGRY 5LBGA 5G2NA 3IETB 4Y2DC 2JKNA 1IQDB 1XR8B 2XBTA 1MW1A 1GHFH 4Y5VA 1ZE3H 3BP6A 4X6FA 3MRNB 4AQZA 3WBDA 4H8PA 1MHEA 5CP3H 4EI5B 2HMIC 3NCJH 4HOXA 3MTRA 3EDJA 5HVGB 3PPEA 2XA3A 3JTSB 4U1IA 1ZJBA 3LYRA 1WFOA 1E2ZA 3DOSA 5EN2A 3QG7L 4ZPTA 4QRQB 4XB3A 4M7KL 4DWHA 4ABWA 1ZVSB 4MA7H 4P57B 3ZZLA 2QR0A 4EIZC 4PH8A 4U6XB 4ODBD 1HZLA 3TZVB 4OVVA 2WCSA 8FABB 1KXVA 3VI4A 3MO1B 4OIIH 3QDGD 1M1XA 1AR1C 2PXYB 3PXHA 1NINA 5JR1H 3FSZA 2ICEC 4NUGH 2GTQA 3S37L 1RP8A 5E94B 1LO5B 4OGXH 4XTRD 4G7VL 5GS2D 2DQDL 3U83A 4RWYL 4ZI8A 2IH9A 1KN2H 3FAWA 5DJAA 5F7DB 3CNKA 4HIPA 3QJSB 4WO4D 4N90D 5GGSY 5C07D 4FXGB 2D7PA 4HK3J 5CBAB 3FT9A 1NBZA 4WWOA 3IKCA 4NN7C 2GJ6D 3UZEA 4LCCA 4PTTA 1AGCA 2J73A 4XXDB 1H8NA 1JF6A 1NL0L 2GSIA 1SMOA 3FT2A 3MRGA 1HOCA 2IDTA 3T4YA 2Q2EB 2CRIA 4M7LH 4N2GA 3MXWL 4YUEL 3UERA 4E2OA 2KL6A 2F58H 2CHDA 5IOPA 3R4DA 2ZOKA 3VA2C 1YEFH 5E9DD 3GO1H 3GRWA 3ISWA 1DN0A 2ITDB 1KPVA 5D4JA 1MJUH 1UXMA 1QYGH 1PBYA 1XH3A 3H7BA 3JYBA 3P4LA 3QQ9D 3VD9A 1PZSA 2FT7A 3PFQA 1Q94B 3KPMB 4LCUA 1LMKA 2GFBA 3BGMB 3E1F1 3QUHA 1DFBH 2X5PA 3ABLB 3K8MA 3RIFK 4F9PA 1D5BB 3NA9H 2PTTA 4R4FL 4XP9L 5MENA 2WOBA 1WAPA 4WLCA 4FAAB 5JMOC 4GKOA 2VZ3A 1J8KA 3BIAX 2QPUA 3FZUC 4AMWA 3TF4A 1XIWD 5IMLA 3FCBA 2V2XB 4MAUL 3ALPA 1BYPA 4KDTA 2X09A 2KHAA 2OW6A 4CADA 4CN6A 4WO4C 2B1AH 5I17A 1U8IA 1WIPA 1UOLA 1AP2A 5JUEH 3HMXA 5IBUB 3CZFA 1I3UA 2BY1A 5BO0D 1U41A 3ARRA 3MNVB 5ESAA 2IV8A 3P3TA 2QPDB 4O2CB 2X4TB 3GUTB 1CICB 1OQXA 4HJGB 4KXZH 4ZW7A 4MMYA 1S7UA 2OL3A 4Y4KD 1KJ2B 2XBDA 4NX0A 1NBCA 4ZPTB 4XMLH 4I48A 2BM3A 2IBBA 3LDBC 1FH5H 4OZ4A 2YGQA 2XG5B 3E8UH 3PL6B 5DTFA 1RMFH 3ZJAA 3SIKA 4OKVB 4QRUA 1IL1A 3MKKA 5EU6D 3KNBA 4FOMA 1JGDB 4L48A 5AVXB 1TCRB 4YHYC 4Y9GA 2EUXA 3V5HA 3VFWB 3BVUA 1FWXA 2HRPH 3UTSA 5BVJA 5I1DA 1XAKA 1XIWC 1OZUA 1JVOA 3D8MA 3QT2A 3VI3A 3QCTH 1BMZA 3VRJA 2VIRA 1NGXA 2VLMD 5EA0H 5IHLB 1RZFH 3BSGA 3H9SA 3MMEA 4EN3D 1NSNH 4XC1H 1NJ9A 4DN3L 2YAQA 2ZX5A 2Y7OA 1T04B 3EUUA 4G1MA 4FQIH 4G6FD 3DXAD 5F89B 2VQ4A 2RJMA 3QAQA 1A7RH 1IM3A 4Y4KC 1I82A 3T4YB 4XWGL 3ZHFA 3EFOB 4A6YL 1OARH 1EFXB 2VL5B 4TVPE 4X6BA 2ZCLL 3BH9B 1N18A 3BEVA 1AI1H 2GIXA 1IUZA 2XTSA 4JQIA 1XB3A 4DPRA 2VDOL 1OM9A 2QKIA 3MRLA 3KM1A 4G8GA 4X2UA 1OAXH 4Y16A 5DSCA 4QHLA 1YMMA 1QR1B 3L54A 4K5MA 1H5BA 1IKFH 2G3NA 2H32H 1NIEA 5GRZA 5H37A 1MCJA 1L4IA 2AGJL 1QBML 3DPDA 3QEQA 3O81A 3FNKA 3QO1B 1EO5A 1MG2C 5F9AC 3MRCA 3T5WA 2A99A 1A0QH 2ICWJ 5ACLA 4A1RA 4EN3C 1R75A 2KZ1B 2BSRB 3GMPA 5SWZE 2NQ3A 4YQXH 4IBWA 3AS2A 5GS1B 5IY5B 1G6VK 5F96H 1EJFA 1J7VR 3CSTA 1RQ5A 3VFRB 4KQ3L 4AIEA 4C8XA 4IU2A 3NUKA 5E5MA 4F92B 1B2YA 5C0GA 1EUTA 4D9QD 4PS4L 1J88A 4JEGB 4IRJB 3D3VA 3CZSA 1R5VB 2Z1KA 4AXWA 5HHVH 4DZ8A 1HWWA 1AVAA 1U33A 3AREB 4YL4A 5I8CA 1NEZB 3Q2LA 4Z0XA 1GH7A 1D7DA 2N7AA 4U1GB 1G9MH 5D4HA 5E51A 2QGBA 3GPEA 3IYLW 4JPVH 3BE1L 2OXHB 4I48B 2G9KA 5T3XH 3I9AA 5CP7A 3Q8AA 4K8RD 3RFRA 3L4UA 4XMTA 4K71C 1U58B 1IM9A 5FGBA 1FLRH 1Q90A 3BKJH 1SVBA 1X7TA 4FQ1L 3ZHNA 43CAA 1ODAA 3LIZA 2WP3O 5FLUA 1IL1B 2HZHA 4F20A 3QJHB 1JUFA 4TYUA 4KXCA 2Z0BA 4QTHB 2EIDA 4RH4A 2OAAA 1B4RA 1U95A 1C5CH 3T2QA 3VSTA 3IU4H 3X12A 4UT6H 3WAJA 4B95C 2EE0A 2LLLA 3QHFL 3LRSA 3C75A 1ZIAA 4NQEA 1I8KB 2Z31B 2ED7A 4M6ML 4EZLA 3VI3B 3FMGH 2NY1B 3QNYB 4FG4A 4W9IC 4UT9A 3MUHL 5DWPA 4QY8B 3KPRA 1G4RA 1T4KB 3V0DA 5FB8B 1DEEB 1OP9A 4AQ8A 2WVVB 3N6YA 1U3HB 4OZGB 1F4XL 1OXYA 4FDWA 1B0GB 2HRGA 1FJ1A 3KLDA 4XBGA 2P45B 2W9EH 2BPBA 2GUYA 3B3IB 4L3ED 2WJ5A 2ZCZA 5CNHA 3VFGH 4URTB 4YSDA 4Z5RB 2H0FA 4K8RC 1XGTA 1C5DA 2XFXA 3O6FC 4K9EH 4YDJA 3WDHA 3OKDB 4OFYA 4G8GB 4Y16B 1SY6H 1M71B 1QSVA 1XGRB 1NICA 2FHFA 1BF2A 3GLDA 3V4VA 2AS5M 4B50A 4NGHH 2XLLA 1BOYA 4Q2ZA 1NFAA 3QUZA 4NNPL 1BGXL 2KLTA 4HWZB 4C57C 2VM4A 4FXLA 3FU3A 2J8UA 4EMZA 1E5CA 3SE3C 4NPYA 3UO1H 5DURB 4JFPB 5D7LA 2YAHA 4YPGA 4OZIE 2X0VA 3BGFB 5KJ4A 3PAYA 3C9NB 3MKGA 4HISA 4KVPA 4JR9H 3MJ7A 3S88L 4K5LA 3T0EE 3ZR6A 2KPWA 1JGIA 2VXUL 5DUBA 4R4ND 1T0PB 2ZKHH 2P8LB 1WJ3A 3D08A 1NBYB 4RGNB 5DHVB 2GSMB 2JLLA 4YXKL 3EZ8A 3DIVA 2YGVA 4X5WB 3S35H 3SBWC 2NXYD 1LO4H 1USQA 3LN5A 4N2NA 1L9RA 5HI4D 3ERXA 4AYBA 1FV1B 2A77L 4X6CF 2QVTA 2PCXA 3NP3A 1X9QA 1KCBA 1DJWA 2QEJA 2HG5A 1CFBA 4NZRH 2BY3A 1RKRA 2AEWA 3E9TA 4GPVA 1MXGA 5F7LB 3HG2A 3N40F 5DYOB 3EUDA 4BFIB 1CFTB 5AD0A 4DK5A 1GZPB 4XN1A 3AU0A 2L0DA 4UUJB 4DFIA 2NTSP 1Q0XL 4FTVD 3L6FA 1BD2B 3QPXH 1J8HA 2R1WA 1FN4B 4G9FE 4KOCA 4ZFOA 1DQKA 1L0PA 1MWAA 1OT1A 1PQZB 3V6FB 4DUXA 3PHOB 3F83A 4UV4H 1UD3A 2RALA 3C2SA 5INDB 3WO4B 1DDHA 5EDSA 1DUZB 4QAWA 3SPGA 1MNNA 1E4KC 2EXTA 1Y7VA 2EE6A 2NXZB 2DL9A 4MMXC 4XNYL 2BP5M 2ZWSA 3K5SA 5ALBH 4R4NC 2J1XA 2WYHA 3SQBB 1RURH 3IK2A 1LWRA 3QQ3A 3U0TA 1EFQA 5JYLA 3TL5A 2DQFA 1MHCB 1QFUL 1J1OL 2F18A 2NXYC 3KM2A 4N1HB 3BUYA 2VMJA 4MQXC 3ECQA 1TZHA 2E5EA 3MRKB 3II3A 1SFHA 5DC4B 4Z7WE 4DO4A 1FFPA 3GJFA 4WGWB 4PRDB 3TLRA 1NUDA 4C4UA 5EPMA 3OKMA 3CLFH 4JZJB 4YDJB 2MPAL 3L17A 4DVBA 5L2KD 1FVEA 2AP2A 4HH9B 4U1JA 4PWHA 3D0AA 1S78D 2NNAB 4WNSA 1RZJC 4MBRA 4N9GA 4HPOH 2YUXA 3QUXB 3QUZB 4UU9A 1ZA6A 3CZJA 4NP4H 4XN2A 5LGKA 5HPMA 4HEMA 2X4OA 1TYEB 4NPYB 4HU8A 4GXVL 4AEFA 1R34A 1CDUA 3C8HA 9CGTA 4XOBA 3IXTB 1MVFA 4ANWA 2CDEA 3LZFL 3DA0A 1G7PB 5DD6B 1Q4NX 5A16B 3BAWA 2EYSA 4I3SH 3X11B 4M5YL 2O26U 5DUBB 3CBRA 4WU7A 2OTUA 1BQLH 5E4EC 1JK9A 1I7RB 4AYSA 4JQVC 4U2ZA 2NUPB 4AZ8B 1T7XA 5HHMB 4ICWA 3QFJE 3S34H 5MI0C 3FPYA 2LHAA 5I8KL 3GTVA 5CSBA 1HJBC 5CIPH 1TF4A 1I8LC 4QRRB 3QUYB 4MQTB 1LL1A 4M5ZL 5TE4L 5HYEA 1ZVNA 1OGTB 4Z23A 3GZOA 4N6QA 4F8PA 1S78C 1SXAA 3MLVH 1MCBA 4LSDA 4FNLL 4HUMB 1QOKA 1JFQL 3G5VB 5LGHL 5C08E 5SX4H 1J8RA 2ZPKH 3MRRA 4PGJA 3N50A 3E6HB 3QSKB 1ITBB 1T89C 3GQFA 4BQ6A 2BC4A 2UUDH 1YUHA 3EBGA 5IESH 1OGAA 2J55A 2Z93B 2J88L 4K3HA 1QA9A 2UZYB 4GRWH 3FTGA 2W5PA 3TVMA 2VERA 4P5KB 1UT1A 1FG2A 4MVBD 4P2QE 1NFDE 1SM3L 3RGHA 1MY5A 1YY9D 2X2YA 1BZOA 4NFBA 5G4MA 5F21B 4MKTA 4NO3B 5BRZA 3CCHB 3QRLA 4JO2H 2WAQA 1QLRB 3MHZA 3OHXA 1SDDB 2QVMA 5AVTB 1OD9A 4HWBA 4E9QA 3FTWA 3KHOA 4QXTA 1OD7A 2WLMA 1GHFL 2IO5A 1X5FA 4H0GA 5B4MC 1GC1L 3U30B 1W80A 4DT2A 1QTYT 1UOWA 2L4OA 2MQGA 3EBHA 2OX5A 2I07A 1Q9KB 3NCJL 3PJSB 3VXMA 5FGCB 3L9RA 3O41A 2LE9A 2WO3B 4BXVA 1RJZA 4BINA 3VNYA 4H8WH 2QSQA 1W72B 2DQEH 3SGDH 3RFZA 1YQ2A 2GJRA 4ZSOB 3DBXA 4Y8DC 1GSKA 1K72A 1RK1A 4UQDA 4Q14A 1JVKA 4XXCC 1NAMH 3ARZA 4MA7L 4QOKE 1IBZA 4OFDA 3SZ6A 1CTMA 4WV1A 4PJ6A 2O30A 4AYDC 3DX3A 3IBEA 1FZMB 4E36A 2MEJB 1T7ZA 1S7RA 3OJDB 2DL2A 2VN6A 3FQWA 5ISZE 1MFAH 4MVBC 1QHQA 1FO0H 4OIIL 5DK2B 5CR1A 2AQPA 2VYRE 2WXJA 1JHTB 1YY9C 5JR1L 4ZYKB 4NO5B 2AJZA 4JL1A 1WT5A 3SDAB 2TRHA 4NUGL 3UAFA 4OV5A 2JTYA 3HN3A 4OGXL 1Z9MA 2MOGA 3FUIA 3VXRA 1KN2L 1HE8A 2NR6A 1HOEA 2BY0A 5EBLA 2ZXQA 3MROA 2Q7NA 2P8MB 3AB0B 1X7QB 4ODHH 3RLSA 5TDPA 2AW2A 4B96A 4CJ0A 2E8YA 4QF1A 4Z7OB 1MZZA 2YFOA 1U8NB 4PJAA 3B34A 3UDWC 2EDQA 1ND0B 2JKXA 2GT9B 4IMKA 4M7LL 4Z7NB 2LLNA 3LXBA 4ZZFA 2F58L 3BN3B 3Q43A 4JRLA 2F1AA 2VLKB 1SMAA 5CGMA 1YEFL 2YJQA 3SDXB 4F2ME 3GO1L 5D5MA 1HL8A 3TONA 1T1WA 2D7TH 3ARDA 1MJUL 1QYGL 2YEZB 3L2LA 4ZPVA 3UTZA 1HE7A 2B16A 1QEWA 4XO4A 2OTWB 5I2IA 1YYLH 2FR4A 2OSLA 1M3IA 1RPUA 3UYPA 4PAZA 1SEBA 1DFBL 1D9KD 4PJGE 4Q6IA 3IJYB 4YXLH 5CF3A 3I50H 3NA9L 3N85H 4KFMA 2A6KA 5AEAA 4WNQA 4JB9H 1D2OA 1OCZB 1P1ZA 1CGVA 1T66D 1ZLSH 1DFXA 1GRWA 2F7PA 3Q5OA 2E6PA 2YPKA 2NDGA 4TVPD 2B1AL 3ZYJA 1QBAA 4GI8A 5JUEL 3UBXG 1IAMA 2FJHB 4QXTB 4LCCC 3ME0A 5DQDH 4HGKC 1A6UH 2VZTA 1VFAB 1PAZA 1QSEE 2DEWX 4ZAKA 3DGGB 4GAAA 4F58H 4M00A 4FD0A 3LNHA 4Z18A 5HGBB 1SJXA 3CN3A 2J1KA 3D7PA 1GGBH 2R2HA 2X2UA 5ABDE 1FDLH 4XMLL 2X6MA 5EH1A 3G6AB 1FH5L 2DQUH 3R7RA 2OMUB 3E8UL 2JQAA 3UIYA 3U25A 5CN3A 1RMFL 5I1GH 5JPNA 3LQMA 1D9KC 2PCPB 1F3JA 2JSFA 5EWIH 5I1CH 4D9RD 2HRPL 4M7ZB 1T66C 3QS2A 1FORH 2Q5BA 4KRPD 3VVWA 3QCTL 1DQDH 3QFDA 4CNIB 1QMUA 1EJOH 2WNGA 4BZYA 2XZAH 1XH2A 1G6RH 4LHUD 1VEMA 1RZFL 3FT3B 5EA0L 4NNXB 4ACPA 5FO9B 1NSNL 4XC1L 5DK0B 1Y18A 1PEWA 3DVIA 1HDMA 3GMMA 1AR2A 4RSVA 3TOPA 3C8KB 5ICZB 5CU9A 3HVNA 4JKLA 4P2YA 1DE4A 4QCIA 4FQIL 3ZIYA 1CL7I 1HAWA 4NYLA 4N0YH 2QGDA 3ET9F 4F7PB 1JYNA 4M62H 5A6IA 2VJ8A 2F7QA 1A7RL 4WI0A 4TKWA 1MJJB 1OOWA 5I15H 5ELIA 1FSKB 3BI9X 1O7DC 1OARL 3D39A 2JB6A 2YEQA 4Z7QE 2C3VB 3T3MF 2Z7ZA 1ZT4A 1EAOA 4A6YA 3VD4A 4K4KA 5E8PB 5I6OA 2WSKA 5KYUB 1AI1L 2WJ7A 2BW5A 4WTQA 3TWYA 1QWNA 1OAXL 2FR4B 3BP4A 3ZL1A 5KG9A 1CI5A 4KXDA 3HAEG 1IKFL 3B3BA 4A66A 1Q1PA 4M4RB 5E1AA 4JG1H 5K33A 4PB0H 3JV6A 1PX3A 3GI9H 1B90A 4X6EB 5ESVB 4KRPC 2KLRA 3BUIA 4M1DH 2CPCA 1A0QL 3FFCA 4UCFA 4B9IA 2FYVA 4DOHB 1UASA 2NCEA 4NS0A 4YQXL 4YHZH 5F96L 1UXLA 1AHWC 3J27A 1N2RA 1U0QA 3ZMRA 4I4WB 4A2FA 3SE6A 4OF6A 4HKXB 5I71B 5F7WC 4TUJA 2N0MA 5B8CA 1J10A 2JKWA 2V37A 5HHVL 4EDWH 3EW3B 1FF5A 2X6VA 3FUKA 5EUKB 3JV5A 3T09A 5I1AA 1HQ4A 4N2FA 5LNGA 1G9ML 4JPVL 5IKCA 3ESPA 4ODTH 2IQAB 3W3BA 5T3XL 3F12A 5EO9A 3FOMB 4HJSA 4UQ2A 3SY0B 3FSOA 4N87A 1MCFA 1FLRL 1O7VA 1VLXA 2EXWD 3BKJL 3V8CA 4GLRH 2NY2B 4WAFA 4EDXA 4I1PA 3TBCA 1P7QD 3TJHD 4NLAA 5IHHA 1C5CL 3IU4L 4LCWA 4UT6L 1SOKA 4JHZA 3P9LA 4X9GA 4D8OA 2NSQA 5HSFA 4YDLB 2DAVA 5CM1A 4NDMB 3FMGL 3QFDB 3FU9A 2CR3A 2QPFA 3OKLA 5I18H 5GGUA 1MFNA 4X8CA 4RQQA 1Y18B 2NRDA 3GMMB 4YGAB 1ZHNA 3HC0A 3VB8A 2BCMA 4HUWB 2LFEA 3FQ2A 5AW6B 3HB3D 3ATFA 1WHOA 3B6SB 1J12A 1L9NA 1C5BH 4JZOA 2Q7YA 3DRTB 4G9FD 2Q76A 2W9EL 4HIHA 1WP6A 4Y4FB 4Z7VB 4Q0XH 4KXZI 2XPGA 2IAMC 2LV4A 3RX9A 1KIUB 1VZIA 3FONB 3VFGL 2I9TA 1GTNA 1XH0A 3KPOB 4QXVA 4H26A 2LW3A 1ZT4B 2OSWA 3MYJA 4IDLA 4K9EL 2I60H 5HHOE 3LY6A 2EXWC 2J43A 4P5MB 3V4PH 3H85A 1JFHA 1O9WA 2LLGA 2J57A 2KZBA 2O5YH 1SY6L 1HKFA 3AY4A 3HG1B 3TBWB 5CLYA 2VDOB 3TJHC 1HXYA 1P7BA 1CC3A 4NGHL 1R47A 1IBFA 3SJVE 1HT6A 3ZZ1A 2A9CA 3STZA 4PJBE 4RDQG 3EADA 3KYMA 2Z3FA 2CJTA 3TCLB 1P6FA 2ZYHA 3ARVA 3FFCB 3UO1L 3EJZD 2IH8A 3I02B 4ENED 2F8IA 3GSRA 3HCVA 2J8HA 2B2XH 1NPNA 4WKZB 3ZDZF 4EXKA 1A1NA 2HB0A 4K3EL 3DUUA 3MRDB 4K3DH 1U8MB 4JR9L 4JY4A 3HB3C 4PJ8D 5D2LE 1G9HA 3AABA 4FNTA 4LZKA 4NCC2 2R0ZH 4S1DD 4AQ1C 3OWEA 1L9PA 5DRXB 2ZKHL 4OM1H 1QUNB 3RDTD 3RNKB 4JHVA 3WFBH 4Z78A 1BMGA 5SWSE 3S35L 1G1OA 1N8OE 4AQAB 2HJFA 1LO4L 3WSQH 5I1AB 2I9LA 3BP7B 3B9KB 3ILPA 3QI9B 1KCUH 4XVSH 1F86A 1ZT1A 1UUNA 3EXJA 4TXVB 4X9HA 4XCYA 3BO8A 2WNKA 4NZRL 4KKNA 4MJIB 5EU5A 4UNUA 2ZCKH 5FK9B 4FQXB 2VWEE 3WKQA 5KJ7E 1TPXC 4RIRA 2PETA 3QPXL 4GBXD 5JW5A 4AV5A 4UV4L 1X5XA 1RJLB 4MB3A 1WRFA 4I88A 1U8JA 3O3EA 2WKOA 1OVZA 1QSFB 2K6YA 2O6DA 3EJZC 3OC8A 3WN5A 1FLTX 2WKOF 4A7TA 4ENEC 2ADYA 3N55A 4GRLD 4L23A 3QH3B 3WIAA 3OKLB 1A4JA 2CO7A 4WEMB 2UY6B 4NFDA 1WISA 4YHKH 3GHEH 2YQ2A 4OF0A 4IBQA 3MRQB 4EQ3A 3SGEH 4GUOA 4PJ8C 4JFYA 4R83A 4AC4A 5JPMC 4S1DC 5ALBL 1RURL 2CRZA 3BPOB 4L9DA 5KS9A 3RDTC 2VSKB 1Z5LA 4MCZB 2O61A 2F53B 4C58B 2WYZA 1BVLB 2OJZH 4LDCA 4U1MA 2YFNA 1OV8A 4JRXB 5CS7A 1MIMH 5DS2A 3FCTA 3IDMB 2BO0A 3TEXA 3WEOA 3O2DH 3L95A 4JKPH 5ANME 5HYSG 2J6EH 3S97C 1J18A 2A73B 5DEGB 4ZQTA 4AQEB 2K70A 2EC9U 3CLFL 4NZFA 3EF7A 5TQ2H 5E6SB 4ZMNA 5ID0B 1B0WA 1JS4A 3TCTA 1WGOA 1PNDA 3MV9D 3FKUS 2ZUTA 2WZPA 1FPTH 3HC4H 1IKNA 2GTZA 1Z0MA 3RUGF 4NUJA 2IADB 4G80B 2JJUA 2GHWB 4HPOL 4PJ7A 4NP4L 4XCCH 2AQ1A 1P5UA 4PJ7F 2BRQA 5E5UB 4X0KA 4GRLC 4Q74A 4AGQA 5F3BA 4OLUH 1NUGA 1HAUA 1MW0A 3FH8A 2I85A 3LVTA 4GH7B 2AVFA 4JW3A 2XWCA 2FO8A 3L9EA 2NX5B 3TBTB 4LAQH 4MAYD 5FO8B 3IJEB 1EERB 4JUTA 4YSUA 2FZ3B 1BM3H 3BIKB 2IPUK 4PW3A 1FIEA 4I3SL 3MCKB 2VAAA 3BWSA 4BGLA 2EUWA 1OT2A 2WWOA 2IPUG 2V8LA 4X83A 2OI9C 5F72S 3I6LD 5IBLD 4FHKA 1BQLL 4L1SA 3OZKA 4OGQC 4PJIA 2RB8A 3QWRD 1MI5A 2GYSA 1T22A 4KNTA 4QOKD 1BVKA 4JFXA 4X5LA 3ZUCA 3S34L 5JIIA 3U0WH 1UWGH 2JI2A