4KOCA

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95i/y108f)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
molecule tags Electron transport
source organism Pseudomonas aeruginosa
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95I/Y108F)
rcsb
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kocA00
5AFAA 2X87A 2FT6A 2AVFA 5B1BB 3SQRA 1SFDA 4KOCA 1PMYA 2BZ7A 3NP4A 2GBAA 2JFCA 1EHKB 2H5UA 2IAAC 1GR7A 2EIMB 4KNUA 2HX8A 3ZDWA 3AG1B 4NAJA 1AIZA 3UAAA 3JT2A 3QJTB 3TASA 1M56B 2IH8A 3CVBA 2WO2B 4YSTA 1X9UA 4YSSA 3NYKA 4PAZA 5IY5B 4BWTA 5I5MA 2MTAA 2YAOA 1FWXA 3X1EA 1AOZA 1L9QA 4GP4B 1JZEA 2UXTA 2YQBA 1EZLA 1RCYA 4UAHA 1ET5A 4KO9A 2BWDA 4W1TA 2I85A 1QNIA 2XLLA 4F2EA 2FQDA 2PPCA 1OE2A 9PCYA 1J9QA 3GYRA 3FSAA 2HZHA 2PPEA 4BDVB 2XVBA 2VW6A 1N68A 2HLEB 2JKWA 3T9WA 2XX0A 1NIBA 1QLEB 4EF3A 1URIA 2BP0B 1JXDA 2BP8A 4L0PB 2BWIA 2TSBA 3SBQA 1NINA 1AS8A 3NJKA 1BQKA 1W6WA 3PCYA 4N8UA 3L45A 1A4BA 1ILSA 4YSPA 4WKXA 4TXVB 3CG8A 4DP0X 3X1NA 3SBPA 2XU9A 4YSUA 2Y69B 4G71B 2YXVA 1TKWA 1BQRA 1OCRB 3ZBMA 1A8ZA 1SFHA 2QDWA 1L9RA 3H56A 3T71A 1BQ5A 2XXGA 1PF3A 2QPEB 2FT7A 1PNCA 2ZONA 4W9ZA 1KYAA 4A2DA 1J9TA 3FU8A 3S3DB 1OCCB 1IBZA 1AS7A 2GB2A 1NIAA 2LLNA 1IUZA 2TSAA 4N4YB 2R7EA 2PPFA 4P5SA 1CC3A 1BEXA 5D4IA 4JHUA 4GXFA 4E9XA 2BO0A 1F56A 1KGYE 5D4JA 1V10A 2FWLB 4E9QA 1PZBA 1YLBB 2HXAA 1IC0A 2B08A 1NPJA 1ZIBA 1NPNA 1BXUA 2IDTA 4DP8X 2R7EB 1JVOA 2UXGA 1SF5A 1FA4A 1JXFA 3FPXA 1GSKA 2UX6A 3FSWA 1TEGA 1WA0X 3S3CB 3QJSB 3QJVB 1T5KA 1AZUA 1MZYA 3S3BB 1BYPA 5I5IA 1B3IA 1WS8A 2DWSA 1WA1X 5I6PA 2PPAA 1E30A 3ABKB 4UANA 5I6MA 3CVCA 2VW4A 3IEAA 1X9RA 1JVLA 3S8GB 3PAZA 1JOIA 2XV3A 3ABLB 4E9WA 1AACA 2AANA 3WKQA 2BW4A 2DYSB 2EINB 4DP2X 4K9JA 3QQXA 4HCGA 1R1CA 1TU2A 1XB6A 3IBOA 1PY0A 3PXLA 2YAMA 3EHBB 2CJ3A 2J57A 1OCOB 1KCWA 1FFTB 2E86A 4GY4A 4PCYA 1JXGA 1M57B 2Y1AA 3CDZA 2CALA 1HAWA 2BZCA 3TA4D 3NSDA 4AKPA 1A4CA 1KBWA 3AW5A 3FYEB 5LDUA 1J5DA 3UGEA 1L9OA 2HX7A 2DV6A 3NSCA 2DYRB 2RACA 4HZ1A 2DY2A 1ILUA 3WI9A 3T6WA 1E65A 1ZPUA 3ABGA 2GC4C 1AAJA 4BXSV 1RKRA 3NJNA 4BDVA 4G70B 1V55B 2OV0A 6PCYA 1ET7A 2GHZA 5AZUA 4A66A 1NTDA 2XV2A 3ZX1A 3QJUB 3UACA 4G72B 3IN0A 3TBBA 1BYOA 1XMEB 4MFHA 3D12B 2IH9A 2W88A 3X1BA 1KV7A 4AKQA 3NT0A 1NDTA 4BK5C 2JXMA 3FQ2A 1ADWA 3AG2B 2UXFA 2PP8A 5D4HA 1JZFA 4HHGA 4AI7A 1XB3A 2VMJA 3FU7A 2FQGA 1JZGA 3FYIB 1E5YA 3FS9A 3DIVA 3UAEA 4FAAB 4KNSA 1QHQA 5AKRA 1BAWA 2CBPA 1AZNA 4DP4X 3N2JA 3UABA 3T6ZA 7PCYA 2GSMB 3V9CA 3OMNB 4DPCX 1PAZA 2Q5BA 3BQVA 2FQEA 4HAKA 1NWPA 1PZCA 2VN3A 3NJMA 2FNWA 2IDFA 5I6LA 3EF4A 4QKTA 4BWUA 5I6KA 4Q8BA 4HCFA 2XV0A 5B1JA 4HIPA 4A2FA 5TK4A 3SBRA 1GW0A 1ASOA 3CZUB 2BP0A 1J5CA 4CSZA 4A2HA 4DP6X 4A2GA 1JERA 4G7RB 5I6NA 4E9TA 3MX0B 4A68A 1M9WA 3NJIA 1NZRA 2ZWNA 1DZ0A 4GP8B 1A3ZA 3NJGA 2XWZA 1V54B 2W8CA 1IKOP 3H4HA 1NWOA 3GXUB 4YSEA 4BXVA 1AANA 2WO3B 3NJLA 3FT0A 1BXVA 4KO5A 2QPDB 5I28A 1KBVA 3KW8A 4GP5B 3FSVA 3AZUA 3WIAA 1GY1A 1JZJA 2OJ1A 2PP7A 3WG7B 4M4RB 4KOBA 4DPAX 4E9VA 3ASOB 4YVUA 2FT8A 1RZQA 2FTAA 2H3XC 4BWWA 1MG3C 5A7EA 1KDJA 3GDCA 1ZDQA 5B7EA 5I26A 4DP9X 2QT6A 2PPDA 1L9PA 1BXAA 1CURA 3TBCA 1I53A 3CDZB 1PLCA 5F7BA 4DP7X 2YAQA 4F7KA 1CYWA 1AR1B 2VW7A 4YSDA 3EH5B 4FA7B 3WNJA 1E67A 2IDSA 2PCYA 3ZIYA 1CYXA 5B3SB 4G7QB 4F2FA 1MDAA 3AG3B 1PLAA 3NJHA 4HCIA 4E9RA 4YSRA 3FSZA 3AY2A 3WNIA 4DP1X 1OE1A 2NRDA 1GY2A 5PCYA 2YAPA 2CAKA 4GYBA 1GYCA 1SNRA 2EIKB 2IDQA 1MG2C 5TK2A 5B7MA 2AFNA 5B1JC 2GI0A 5B1AB 2N0MA 2X88A 2YARA 5FC9A 2PCFA 1SHXA 4YSCA 3HB3B 1OCZB 3ERXA 2WSDA 1JZHA 3NSFA 1WA2X 3V9EA 2ZOOA 3ASNB 4DP5X 3PAVA 1GS7A 4YVNA 3OMIB 2HRGA 4YL4A 1HAUA 3U25A 3N55A 2GC7C 4HHWA 2EIJB 2CUAA 4CSPA 1OF0A 3FQYA 1OE3A 1UATA 5PAZA 1W6LA 3OM3B 1AS6A 3KW7A 2XUWA 1DYZA 2YAFA 1VLXA 5E9NA 4AZUA 1ID2A 3DTUB 1CUOA 8PAZA 2B3IA 4YSQA 1SF3A 1ZIAA 1J9RA 2VM3A 1AZRA 1NICA 4DPBX 1E5ZA 4KO7A 4Q89A 2QDVA 1TEFA 2PP9A 2VM4A 1ET8A 3PPSA 3X1GA 3X2QB 2EILB 2I7OA 3ABMB 3S8FB 2Q9OA 1JZIA 2VSMB 3NSYA 1L9SA 4M3HA 3BVDB 3PAUA 1AZBA 4A67A 3X1FA 5B1KA 3PLYA 6PAZA 1NIEA 4YSAA 3RYMA 1W8EA 1PZAA 2HRHA 2FQFA 2P80D 1RZPA 4JKNA 2UXVA 2AZAA 1GS8A 2IWKA 2A3TA 2MRYA 1ASQA 2YAHA 3G5WA 2XYBA 5F7AA 3MBWB 4ENZA 3QPKA 1KDIA 1IBYA 1NIDA 2YAEA 3OQRA 2BP8B 3IE9A 3TU6A 2CCWA 2BW5A 4AKOA 3DKHA 1PCSA 2P80A 2VSKB 4X4KA 2UX7A 1AQ8A 2DWTA 1SJMA 2ZXWB 3FU7B 1OV8A 2XX1A 2IDUA 2I7SA 2J55A 3EH3B 3QJRB 4KO6A 4KNTA 1HFUA 1WS7A 2IWEA 1A65A 3IN2A 1ZDSA 3NP3A 1N70A 1SDDB 2J56A 2XXFA 3H4FA 1XB8A 4G7SB 4A2EA 3CVDA 3EH4B 1WAEA 2HX9A 4AX3A 1A4AA 2J5WA 4ZK8A 3OD3A 1KCBA 2FJSA 1AZCA 3AG4B 4UF7C 3FPYA 3FU9A 3FQ1A 3T6XA 2GIMA 1AG6A 4QLWA 1SDDA 4E9YA 5EHFA 1ETJA 3OMAB 2IWFA 1MZZA 5I6OA 7PAZA 3C75A 3QJQB 2AZUA 4P5RA 5I5JA 4RH4A 4NERA 3JTBA 1L9TA 4JHVA 1PLBA 3T6VA 1OOWA 2BHFA 5B7FA 3NJFA 4WTQA 3UADA 4YSOA 1NIFA 1ASPA 2PLTA 3NJJA 4E9SA 4NB7A 2H47C 1GS6X 1AG0A 3HEIB 1SHWA 2OCCB 5ANHA 2YXWA 1J9SA 3WKPA 4HALA 1ZV2A 1PNDA
chains in the Genus database with same CATH superfamily
2CIIB 3FOLB 2XTSA 2MH4A 3CMGA 2AK4A 4FFYL 4IBZA 1OAKL 2ENSA 3WFCL 1HKLH 3SJVA 4XN2A 2J1ZA 2JCCB 1OVZA 3MRNA 2ESVD 3CFCH 1NDMA 1F3JA 1FNLA 3P4MB 1NBYB 1YECH 2CKNA 1K4DB 4JVWA 4PJDA 4LSPL 3QHZL 1FC1A 3PHQB 2VLRE 4LLMB 4FG0A 4JRXB 1H3TA 3K72B 1SY6L 2P5WE 3DA0A 5JHDB 3SD5A 5HBBA 1P9MA 1G6RA 1QFHA 1S5HB 1QFWL 3PWJB 5DQJA 5KSBA 4GG6E 4FP8H 4G1EA 3HRPA 4I0KA 1TETL 1KN4L 4KQ4H 3TN0B 4ES9A 4I3RH 3FFCA 2O6FA 2PPCA 5EU6D 3NBNA 1UFGA 4Y8AA 2MCAA 2A74B 3DHMA 2HZHA 2R1YA 4FI6A 1M1SA 3QDMA 3RL2A 2IPUK 3HLKA 3QPQC 2DEWX 4K3EL 1CJYA 4F7EB 4ELMB 5A2CA 1FZJA 2Y5TA 4H0IA 2W9DL 4NWUH 4QXVA 3DX3A 3TBTA 2YBGA 3NQKA 1DUYB 3L45A 5MENE 1AQKL 4WO0A 4PJXA 2MNUA 4N86A 1NEPA 1JK9A 4OCXH 2GFBA 3SE8L 4DP0X 5L0QC 1WZ1L 3X1NA 4HIHA 3PJSB 1FFPB 5D5MB 5I0VA 2VDNH 2PR9A 4IBUA 1M6OB 4NKIH 2AABH 3ZBMA 3D3VB 3QUXC 1IEHA 2C3GA 4WFGD 3HG4A 2QPEB 5F2FA 3CXHJ 2D0HA 3GFUA 3MA9H 1JG9A 3TBVA 2GTWA 3VRIB 4MQXC 3LIZH 5KVMC 5BS0D 5L6YH 4C56E 1Z9NA 1MCFA 4G8GD 1A1NA 4OUOA 3WJLC 3MV9A 4BFKA 4FA6A 5BVJA 4UUJA 5F1KC 2Y1VA 1SVZA 1MVUA 2R7EA 4H0HB 1ZHBA 5JQ6H 3O6LL 4LU5H 1ZJAA 4PWIA 5EFIA 4EDWH 4K7PY 4OZIA 3D2UA 2OZ4H 3ULUL 3JWOC 4E9XA 4OZFG 4C8XA 3IXTA 3DX4A 4WKZA 1E4XL 3RZCC 4OFYA 3KPTA 3MREA 4OLVH 4X9HA 3VXMA 1CD9B 2AAAA 3JWDC 4KVCL 3CUPB 2VZSA 1ZIBA 4R0LB 1DSFH 1QLEH 4W70A 3WKMH 4OZFH 4HJEA 2ESVB 4AYEC 5IBLD 3U7YH 5LWYH 4BQ6A 4PRAB 4NRXB 3NIFB 1DO6A 3HE7A 3TM6A 4F9PC 2NSQA 1FVEA 3QS2A 5IROD 3HI5L 5T8IA 4LESA 3ILQC 5BS0E 3S34L 1YEEH 4FQHB 4XNAA 1ZLUH 2XNAA 1WCBB 2FGZA 3D2TA 4OM0H 5EBMB 1ODUA 1JP5A 2OULB 4U7SA 4N1CA 3KWVA 4H0LC 1WSST 5ESAA 5DD3L 2PYFB 3DXAA 3MGOB 2X44D 1HL5A 1IGIH 4TVPH 1X9RA 2A99A 1EMTL 2K3TA 1TJXA 1X4XA 4OZHB 2YPLE 5HYEA 1GCYA 5JYMA 3LIZL 3RDTC 4DSYA 4DP2X 4K9JA 1SN0A 2OFQA 2BNQE 3FO9B 4GRLA 1PD0A 3EBHA 1MXDA 3RNKB 2BHZA 4MX7A 2ZJSL 2HFFA 4NGHL 4IGBB 5AVRB 2V7NA 5FHBL 4ELKA 4MKTA 1I1FA 4PD4K 5DRXB 3T1FB 2XN2A 4ZUTB 1JXGA 3BEWB 3MCYA 4PJHA 4BSVB 3ALPA 5E08H 1H6FA 1AGCA 3L3DB 3MOAH 1P1ZB 3VXTB 3Q1SL 1A66A 4MZRA 3FYEB 4HDIA 5C71A 5JR1L 4TSAL 4YHZL 2JJVA 2YGVA 1E6JL 4JO2L 4MS6A 2DYRB 3K8MA 1AGBA 2VLLA 4JREB 4R8WL 3GMNA 3S34H 1ILUA 1A7QH 1EJOL 5EC2B 4CGTA 2HMIC 5GJTL 3LKNA 2IOMA 3PE9A 1R3HA 3T6WA 3UG3A 1BZQK 3S37H 3M07A 1TNNA 3ABGA 3HFML 2Q86B 4FNLH 3VCLA 2VABB 4B96A 1FNGB 4BXSV 1PQZA 1D5IH 5AZ2H 2IGLA 2BNQB 3AACA 1IGIL 3L13A 4TVPL 4Z7UF 4YK4C 2PKDA 3V0JA 5JIPA 2CH8A 3PNWA 3CLFL 2W07B 3NZ8A 2XN1A 3BZDA 3EBGA 3QYCA 1NC4D 3BAYA 4FHJA 1QUPA 5DA0B 4XX5A 1YN6A 2HJLA 1WISA 1Y1UA 3R06A 3TBBA 2WWOA 4CAGA 4HKBA 5BRZB 1JYNA 4HP5A 2HPOA 2HFGH 2Q76A 1CS6A 1HHIA 2JB5L 2UY6B 4QNPF 2XKSA 3EOAB 2LW3A 4PV9B 2OTUB 3WFZA 3O6ML 3N41F 4YS4A 3BUYB 5D4HA 4JO5A 4UOJA 4LAJH 2VMJA 1IV8A 4CBZA 1QACA 4YZWA 4ZMLA 2DN7A 2JJTC 4LCIH 5IR1B 3EYSL 3MRBB 1BVKB 3WLBA 4R4FL 2OAAA 2B3RA 5DHDA 3FBQA 5D1ZD 1CF1A 3F64A 4UM9A 2V6HA 4LSVL 2VR5A 3V0WH 3OKNA 3VD7A 3RJDA 1V3LA 2VISA 3KPQB 4N2OA 3DDGA 3DVNB 7PCYA 1FBIH 4ZX3A 3G6DL 4EBQL 1JGEA 1HZLA 2AQPA 4C56B 1FGNH 1TQCB 1SJXA 3D9AH 4H8WC 3DSFH 4O02B 4XNZB 3SPVA 2FATL 3OG6B 3QFGA 1U6AL 3K0YA 4IRZH 4HQQL 3EF4A 1ITBB 1FZOA 2C9SA 4V2BA 2YRBA 3GTNA 4LGPB 1BWWA 5CR1A 3EIFA 1FVCB 3D18A 3N1GC 4NO2A 3B7TA 4MD4A 5SX5K 4YUEH 3WIHL 5B39A 1MIEH 5CO1A 1XL4A 3EYSH 5E00A 1OGAD 3U46B 4NZTH 1J8HA 3L9YA 3FQ4A 1LDPL 3NN8A 4JHWH 1OF2B 4F5CE 3W0WA 3PDOB 3WEBA 4YSEA 4OZGF 1HHGB 1JWMA 1HTYA 3DGCR 2JH2A 3SGKA 4GSQA 2HJFA 4GP5B 5A1AA 3ZDZF 4ZUVB 3PQYE 4UDUB 3TBSA 3Q2NA 3BMVA 2FATH 4L4JA 5IESH 1ZD6A 3GDCA 2FUQA 1ZDQA 4JBSA 2FVNA 1XHHA 3D69B 1B0GA 4KZDL 1DJGA 2QT6A 4NUGL 3JWOL 5C86A 2OR9H 4J1UA 4DPRA 4PMEA 1QHOA 1I3RA 5HSFA 5F7BA 2V2XA 3WXWL 3MRHB 1JV5B 5IB1B 4PRIB 1G94A 3WDIA 1KJMA 1JGIA 3BFWA 3SCMA 2VLJD 4GI8A 1BZ9B 2ZOUA 1UWGH 4IK7A 1RPQA 2BC4A 2CBTA 1QOKA 1PKQB 1S9XB 3K6OA 2ROXA 1KULA 1IEBB 2ZF9A 4LRIC 4GFXA 4WSKA 3GC3A 2Z4TA 4XMLL 4AYDC 2V7HA 3HNTL 4JFXA 4ZPTB 3ROOA 4TVUA 2Q87A 4WCYH 1U3HD 3D7PA 1DTUA 3BWAA 4J27A 4W81A 1UA6H 3ERXA 5JLZB 5I75B 1TTCA 2AQTA 2ZX9A 1Y07A 1JZHA 3I02B 3KM2A 1AR1D 5CS7A 2B5IC 4OKDA 4X5XA 4KKCC 3SYPA 2OMVB 2VLJE 4PJAE 3V9EA 1GIGL 5I1AA 1C08A 1NCBL 4DP5X 2WCSA 3FU6A 4K73A 4XP4H 4OCWH 4Y4KB 2R83A 5GS1C 1RV6X 2XT1B 2CUAA 1OE3A 1UATA 3I75A 4ZO7A 3QNYB 1UKSA 4ZS7H 2YAFA 2CNZA 2HFTA 2JKTM 2XKNB 1JJUA 1DJHA 5D6CB 3E8UL 3I85A 5BMFH 1G7PA 4XXDB 1ZVSB 1IQWL 1QZNA 3A22A 5CXPA 1MAKA 4RGNC 1E42A 1MFNA 3HUJA 3KL5A 3WD5L 3ZZ1A 4PRDA 4YLQT 3MMEA 1AY1L 1TJHL 3BH8B 3RWDA 1FNHA 2Q8AL 1T66D 2N0KA 1Q9OA 3QFDA 3ZMNA 2DM2A 1S78D 5DC4B 3GMRA 1ZWIB 2IBZX 3RWGB 5J3HD 1NBVL 4P59L 3DV4A 1E2WA 1B3JA 1DQVA 2UZXA 2P5EB 4PJEE 3B9KA 1XT5A 1FSKC 3P2TA 1CG9B 1O9WA 4V33A 4XMPH 4FG4A 2F54D 2WTRA 4OLUH 2YZ8A 3DV6B 3LNDA 4JKNA 2WD0A 3L3GB 3LHAA 2Z7YA 1YEIL 5E2UH 3PWLB 3T8XA 3FQNB 4P5TD 3TGXA 1C7SA 3ML8A 2BH0A 4M3KB 2WOYA 2PO6C 2NY1C 4WI0A 5CKGA 4YPJA 3SDYL 4PRID 3BXNA 1FVEB 1ES0A 1ZA6B 3PFUA 3QDGB 5J6GB 5BRZE 5TDNB 3CFQA 5L6YL 1ZLEA 3VFGH 4Q9RH 5EBWB 4ZT1A 1BD2D 3S3PA 3UJTH 1CXEA 2J56A 1A1MB 3DPBA 2OMYA 3OX8B 1HSAB 5E6IC 3AU1B 3ZE1F 4UQ3B 2YKLL 2X6BA 3OKMB 4UNVA 3QZWG 4H8WL 3L2LA 2V9QA 2Z31D 1MCBA 2HFFB 1S6NA 2MNJB 3AB0C 1ACZA 2X4OA 1JVKA 2P8LB 5F0MB 1M7IB 1T1XB 2GIMA 3PHOA 4P9HL 5F3HA 3T0EB 3W38A 4LL4A 3HZ3A 2I60H 3VFTA 1IFHH 3AQYA 4JZNA 4AEEA 2F5AH 4S1DD 1WBZA 1T03H 2DQDH 4LKXB 4H1LB 3UTPE 3VFVB 5ESVB 4CJ0A 3MUGA 1E27B 5AB2A 1DP0A 3AS2A 1TZIA 2R8SH 1Q9WB 4XNQB 2GTZB 2EUWA 3RWFB 4YSOA 3TYGH 5D7KE 4PGJA 2BLFA 4Q6YA 4RMWA 4FXTA 4MMXB 3TNNB 1L7IL 1BQHG 4WF7A 1EHLL 4WWNA 2TRHA 4YO0A 3EZJB 1MLCB 5C09A 3L5HA 4KTGA 1FNSL 3GQFA 2HJLB 4HOXA 4KVPA 4LE8A 1WZMA 3VFUB 4L8SA 2JFCA 3SDDB 1NL0H 1JHLL 1E7VA 2V0AA 1Q0YH 2PW1A 4HHAB 1AD0A 1RZKL 2C1OA 2MCMA 2YFNA 5GRVK 5LGYA 3BPCA 4NWTL 1DHKA 5DQJB 1F3RB 5KAQF 3MYJB 2B5IB 5LQBL 4MRBA 1KZQA 3GSRA 3ZRCC 5EDXA 1FPTH 3AROA 5IR1A 3FXIC 2YRLA 3FQWA 1BW8A 3RJOA 5ID1A 5IB5A 3X1EA 3GXIA 2QKIA 4KZ0A 3G5YA 5KS9F 1L9QA 1IGJA 2B59B 5E24E 4U3XA 3BGMA 1U95B 2WNKA 1OZTG 2PCXA 3QDMB 5LAPA 4ABQA 1RCYA 4C4KT 2IALB 4HUWA 2IG2L 1TTRA 3OXSB 1T0NB 3OR7B 3SPGA 4FQPA 2ATPA 4NO5B 4OBSA 4YHLH 2XLLA 2UZYB 4JFYB 1Y18A 1DO5A 1BGXH 2YD3A 5EZJA 1BQUA 3HPJB 2EUXA 1MCCA 4HPOL 4FQXC 3EGDB 3ARDB 5TQ0L 4WEBH 4PJGE 3T9WA 2ICWA 3V6OE 1KXQE 2E76C 1JXDA 4NZ8A 1W6WA 5HGAA 2ZX7A 1SUJA 3QQ3A 1JN6A 4UQCA 3ULVL 1RK7A 3SBPA 3BFQG 4Y2OA 2PWDA 1GCFA 2YXVA 4YH6A 3HG1A 2GCYB 2PO6B 3CC5A 4NNXA 4LZKA 1VFAA 4HPYL 2IIJA 3LNHA 4PRPB 3O0RH 5LCVH 4JFDD 4K07A 4WNQA 4LCUB 2H32H 1VEMA 4MAUH 2NYYD 3MLRH 1QSFD 4NSKA 1OANA 3FFDB 1OQXA 4F33A 1QRNE 4JO3H 1YUHA 3RY6C 1U92A 1G7IA 3SCMD 1N6UA 2CJUL 1OHZA 1Q72H 4R4BA 1U3HC 4ANWA 3B8SA 3IJSA 4FXKC 1A6ZB 2DWYA 2WW8A 4MDJA 1NKOA 4XX1E 4PS4L 2FSEB 3TTSA 3BD3A 4G59C 4LCVA 4QYOB 4XPHH 3JYBA 3FUHA 4P2OA 4PJ6A 3MLWH 1T2QH 3NEXA 4JFFB 3QJSB 4JM2A 4TLSA 4YE4H 3DTXA 3TN0C 1AZVA 3CCHA 3K8KA 3V5HA 3WDJA 1KB5A 4ZUWB 3HCVA 5ACLA 1B3IA 1RZJL 4WU7A 2WUCL 3S5LA 2J12B 2BNRD 4PWKA 4YEEA 2ORBH 3CVCA 3DX6B 5DZNA 5AYQA 4NCDA 4LHJB 1BDYA 1JOIA 1Q94A 4UIMB 3ZPDA 2A0LC 3LMJH 4PP2B 2GSGA 2WXRA 2Y3NA 4QAMB 5KVFL 2LLGA 4BIKA 1H5BB 4FX5A 4NWUL 5KEZA 2QLYA 3HLAA 2VR6A 4HU8A 3O4LB 2PWEA 4M6NL 4X5RA 3DX9B 3DDFA 4CADB 4KKLD 3ZKQD 4B9PA 1ZGLB 2E75C 5EC2A 1J18A 3DOSB 5EOQL 2KPWA 2PYEB 2C3WA 3JBG7 2A2QT 1X5XA 3AW5A 2Q86A 5DHYB 2P8MB 1Z5LA 2AK4B 2XKNA 4AGNA 1I7RB 2VDKH 3KPNB 3OTTA 3ARXA 4RZCA 3KBPA 3LZOA 1I9IH 5SWZD 3GSXA 2YBRA 4UM9B 1RERA 2J44A 2CSPA 2OA9A 5T3XL 4JFZL 3BPLC 1SLUA 2J6WA 1UEYA 1P5UB 3ZZSA 5IF0A 5FKPA 5IVOA 3AITA 2DMCA 3CHPA 5HGGS 1HHIB 2Y2YA 1REIA 5AZUA 3K72A 4JFEE 2ALAA 3VXPB 1XH3B 2WQAA 4PJGF 3CWGA 5T33L 1U8LA 4U1KB 3V5DB 2W0KA 2VXVH 1AQDB 4RAVA 4UZGA 1VFUA 4UT7L 4FNUA 2VITB 4EAEA 3O3DB 4KRLB 3CFJB 1LTXA 5J1TC 4L4VA 4HS6B 5DEGB 2WNGA 1V7NL 1XB3A 1AZZC 2CRZA 2OZ4L 3ULUH 4JEGB 1KTLA 3FS9A 1XTLA 5AEAA 4ZMVA 4XVOA 1F8TH 4GKSB 2X4UA 3T2NL 1U2HA 2CCVA 3LIUA 5FDWB 4KROB 3TF4A 5E0QA 3FT1A 4I18A 1HSAA 4F91B 1V7MH 4UTBA 1NC2D 4RISH 1MHCA 1KBGH 1UH3A 4HLEA 4QRSA 2OJEB 4F7PB 1JK9B 1T89C 5CD5C 1H3PH 2NR6A 5EO9A 1YMMA 1FFPA 5D5MA 1QVOA 5EO0A 1IJ9A 3JUZA 4OVUA 1DANT 3MNMA 4NCC2 5D96C 2AK4E 1AHMA 5DC2A 1T7YA 4APQC 4IU3A 4QXUL 2XZAH 1FNFA 3OZKA 4CC4A 4IIQB 3D39D 1ZHNA 1AIFA 2VXVL 3TBVB 3QWRA 5I1HH 4NENA 1I3VA 4HCFA 4IMKA 2XV0A 4DKFL 1GYAA 2DZEA 2AK1L 4UT6H 2BOBA 3QULA 1PIFA 1ASOA 1ZLVH 2XN9E 4AEIL 4ANUA 4JFWA 5I8KH 4K9EH 3VFVA 3TCXA 3WNPA 3G6JF 1E27A 5L2KA 3F00A 1SN2A 2RHEA 3CN4A 2PTTA 3KPRD 5L2KE 4OZIB 2XWZA 4ZFFA 2P7TB 4ISVA 1BQLH 2NY5L 4AH2B 4ZFOA 4N2EA 4N9OB 5E99L 5EZOL 3CFBB 1QA9B 3EFOB 1EJ8A 4KO5A 2YIHA 4KRNA 3DTDA 4UBDC 3KW8A 3I6LE 4LOFA 2NNCA 1PVHA 4U0QB 3NQIA 1BIIB 3BVXA 4UV4L 1MWOA 3CZJA 3LRKA 3PWPE 4M8VA 4Y5VA 4PRAA 3FL7A 4JHBA 3SEPA 3VFUA 3A4FA 5BJTA 4DKFH 1IILE 1A21A 1CURA 1SYVA 2ADIB 3HFMH 3OV6A 2ZOKB 2GY5A 4TV3A 1IGMH 5ECJE 1A2YB 2PYFA 3V4UL 3RL1B 4F7KA 4HD5A 2DEYX 2X9ZA 4K5LA 3RAJH 2NNFA 1OP3K 2VSCA 4R7DB 1HYSD 5IV2B 3RX8A 4WEEA 1I8IA 2OMTA 1BZ7B 1QRNB 3VXQB 1MDAA 2PXYC 4DIXA 2ICEC 1G7QB 2ARJQ 3PUUA 4RMSA 3D4YA 1X7QA 3U2JA 3TYFB 2VLJA 1RIHH 4M7LL 2H9GB 3VXRB 1BWMA 1OAZL 1UM5L 3IK2A 2Y5QA 2R1WB 4Z7VB 4PRPE 1SNRA 1KELL 3L3HB 4PG2A 1G7MA 5TK2A 3HPJA 1M71B 4ELDA 1N0XH 3AGWA 4JM4L 2VLKE 4QJ4B 2GI0A 4PUBH 1BQHB 4OZGB 4RAUB 3BIKA 1MWAB 1V3KA 3EFDL 3EXJA 2XIIA 1I3GL 3KXFD 1MHHB 3GTVA 3W9EB 4FXGB 1JTTA 2G9HB 4HMEA 3NESA 4IKLA 4TL4A 5IHWA 2D7OA 3GS7A 5ILTH 2IAMA 3P54A 2CIIA 5BRZD 4JZJC 5HGAB 1IIIA 2EC8A 4LPCA 2UZPA 4RMTA 4Y2DC 5GSVB 2MPAH 1K72A 1ZVSA 3SGDH 1T21B 4KUZH 3WMSA 4HK0B 4PRDB 3FQYA 2ZYSA 1FGVH 1F58L 5DR5L 3D39A 3SCMC 3TO4A 1J8KA 4E41E 4LDOB 1QTPA 1G0DA 4YDKH 4LSSH 3C8KA 2OMXA 3VI4B 4BFOA 4HT1L 3KPRA 4XPGH 3BISA 4KUCD 2VM3A 1Q9LA 4N0RA 1M7DB 3U30C 1JPTL 5F7FA 2XI9A 3F6LA 1RU9H 4YR6A 3QAQA 5FWQA 2DIJA 5E8OB 2AEQL 1JZIA 3L3GA 3OKDB 4CMHB 4ODVH 1WG3A 2EVGA 1ZSDA 5J06A 1NCGA 1AZBA 1YUHB 2VKXA 3KHOA 3LKQB 4PW3A 3WXWH 3EYQD 4PJ8C 5I1CL 4KGLA 4R83A 4ZS7L 3N5AA 2HH0L 4EIUA 1PZ5B 5K33A 3FB7A 1T5XB 3V6FA 1IT9L 2FBOJ 2ERJC 1UB5B 2A0LD 4KK6D 4N68A 1CVRA 5DO2C 1MHEA 1ZLWK 1Y7VA 5D7LE 5B21A 5L4JA 1OAKH 3BUBA 3WFCH 3B7YA 4OGXL 3CFKA 3X3GL 2EYTA 3QPKA 1IGFH 1DBKH 2H1PH 4IMLB 4X7CC 4ZUUB 3QCVL 3UTOA 2EDRA 3G6JA 2DL9A 1NGXA 5AL0A 5JDSA 3QK0A 3RTQA 3EO9L 3Q6GH 3HCVB 3UPRB 2WBJA 1YDPB 4GIAA 2ARJA 1FVCA 3D18B 5CCKL 5IW1B 2XACC 1DLHB 5CUSL 1M7UA 3EUUA 5KSUA 1TJIL 2I9TA 3BMWA 4IRJA 4XXWA 1YN7B 1UJ3B 3HLAB 1OWWA 3FOMA 3CFTA 3L4VA 3PGDA 3X12B 3FU9A 2CHWA 5KVEL 3OJVC 1JGVL 4UV7H 4FNTA 3Q8AA 4IRSC 5HTSA 3VNYA 1ZVYA 1WP6A 5FW7A 3ZDYB 1KIRB 3NAAL 4FJZA 5E51A 3DBXA 4MB1A 5I6OA 4HJGA 4LOVA 3PF2A 3KD4A 1JTPA 3TBYA 1FFOA 3T0EE 3UP6A 4NERA 2ENYA 2H45A 1XO8A 3GLAA 4R0LA 1NBZA 4GRWF 3RGVC 2HJKB 5IHZA 5DUJA 2EVJA 1QRKA 4HJUA 4YO0B 1M2OA 3H3PH 3VDAA 4ZMAT 1A6WH 3VXSA 2NT1A 4IBVA 1IEAA 3O6LH 1USQA 1P5UA 5GIRB 1FO0A 1JZ4A 4OD1H 4IBYA 1Q0XL 2ADGB 5GRZA 1TLMA 4W9HC 3U7WL 1FSKB 3BLBA 4KPHL 1U8OB 3AU0A 4PS7A 4PJIB 1TJIH 4K3HA 2WIIB 1YY8A 4P8QA 5I71C 1HDMB 3BI9X 3JTSA 4MZ3A 1T1YB 3QDGE 3S4SA 5K39B 2OPCA 4L1DA 5KVEH 1YHPA 1EHKB 1JGVH 4UV7L 5HYJA 3TYGL 3ISWA 2NT0A 4KNUA 1S7SB 4UCFA 4AC4A 4NQVA 1NSNL 2Q7YB 2GI7A 3DO4A 3SKOB 3LHPL 4PH8A 3PL6D 4OAWB 5AZEL 2BY0A 4PY8J 2WVVA 4Y9EA 4RMBA 3VFMA 1G9HA 4DFHA 5ISZB 2QZ5A 1ZLVK 5I5MA 4X5XB 2EDLA 2CLZB 4HG4J 5EOTA 2B4CC 5I1LA 2LFGA 1BX2A 1JZEA 4AVIA 4XTRC 3KLDA 4MXVE 1UCBL 3D34A 3IMRA 2MQGA 2Y7SA 4Z7NB 5EEXA 3DIFA 4LSRL 1X44A 1OIOA 2RQ8A 4PI2A 3T0EC 2D4DA 1IC1A 2L7EA 1PCXA 3VGGA 1YVLA 3VCLB 4CGUB 4AEHH 4Y89A 4Z3TA 3IPEA 2D3JA 4A7SA 1HINL 2WBXA 2PW2A 4XXCA 1FHNA 3I6LD 1HJBC 4XRCA 2BVEA 4FMFA 3CFDB 4GAGH 1IC4L 3KLAB 4S10A 1U8MA 1EXUB 1YEDA 4OJYA 1LK2B 4ETQB 1EO8H 4PRHB 1LP9A 3NZSA 4X8XA 3T2NH 1JHTA 1EZVX 4YSPA 3VXOA 2Q76B 5ACZB 1L3NA 4Y5YB 5C8JB 2GJ6D 3B9KB 1R24A 2YJQA 4YBQD 2EKSB 5D6DC 3FT4A 2QFRA 3IDXH 4U1SB 4XGZA 4NSKB 1MH5B 2NTFB 5EMYA 3FCBA 5IMMB 3T71A 4JGNA 4LEXH 3VXNA 1RPUA 5EU6A 5GZND 2DQMA 4LGSB 4WI0B 3ZYOA 3LNFA 5K1VA 4R8WH 3HHRB 4BQ9A 2NNAB 3BQUB 3UP1A 3OKNB 3TA3B 2CGYA 4ZZKA 1LNUA 1IGYB 3NFSL 4KUCF 5A2IH 1F11B 1FE8H 4OCYL 1JRHH 1X5LA 2WINA 5DDHA 4C56D 2N4IA 1BEXA 4JNXA 1L6PA 5TF1H 4ACPA 4FFVD 4YDJB 2BO0A 4Y2NA 1KGYE 1X5AA 2ALWA 4NHUA 4XO3A 3HG0A 1MLBB 3HMWL 1GHFL 4JDTL 4P3CH 5INDA 1HH6B 2MHAB 5CP7B 5LXVA 4IRSB 2UXGA 4B9JA 2H6OA 3WFBL 2KERA 1GSKA 3KWTA 3S96B 1E8XA 3S36H 4IDJH 4PRBA 2B8OT 2GSGB 5D8JH 5I82A 1WHOA 1J1XH 1U8JA 5K59F 5LQBH 2WUBH 5HHXH 2HRPH 4RESB 2ZAGA 3FUKA 3JVGA 4OCYH 3S8GB 2ODIA 2J2ZB 5SWSB 3WKQA 1SLVA 4F8PA 3QQXA 3RWFA 1IBGH 1NC2B 3C08L 2X70A 5EUKA 4PQXA 1XB6A 5J12C 1NGZB 2R56H 3DYOA 2FJHB 1ZT1A 2FX8H 4B95C 4FADA 4NM8L 1I7RA 5GGTL 1FFTB 3L4WA 3O11A 4BK4A 4GY4A 1RZJH 3LRLA 4PJDB 5CIPA 4B5ZA 4QTHB 1TO4A 5C3TA 2BZCA 1UZ8B 3QEQA 3D39B 2VERN 1KBWA 1UYWL 1CD1A 4NN5B 4PB0L 3EJCA 4PEEA 3C60D 5KSBB 2BIOA 4FHKA 2HX7A 2XG4A 5TE4L 5JQIB 1A7NH 4PYHA 4BKTC 1EDQA 1WRFA 4AQAA 3ULUD 4DGWC 1HXMB 4FTVA 4XMZA 1A6TB 3WI9A 3BAKA 2JB5H 2NY3C 3DMMA 5LBVA 3UGXA 1CTMA 1ZSDB 3MCLL 3WCYA 2R1YB 1ANUA 5ANME 1UQSA 5AVSB 2YSTA 2YEZA 4OD3H 2EIZB 3LPGA 2RBLA 1LHZA 5GRUH 1MW3A 2B1AH 2ZP9A 3S7GA 4E68A 1GYVA 3MN8A 3UACA 4JMNA 4MNGB 3DJTA 1ADQL 1IBDA 5E1AB 3V4PH 1S78C 3H0TA 3RGBA 3ZK0A 4HXAH 4MZ2A 1JBJA 4QRBA 2CMRL 4MCYB 5F9AC 3QI9B 1RULH 3X13A 3BDYH 3H9HB 2PP8A 2Z8RA 3I2CL 4CVZB 4IRSD 4AQEA 4WO4B 3UBHA 3MUY1 5J13B 1WUZA 1Q90A 3LKSB 2YMXH 4JANB 5IVXE 3VFNB 1RZ7H 2ICWB 3HAEA 4P2RD 3Q5OA 4JDZA 3LZFL 3QHFL 1AYOA 5DUBB 3SJVE 3M1OA 1TENA 4ZBJA 1NMBL 5HVFB 4Y5YC 5HDBB 3SGDI 3IKCA 4JKPL 2J4WH 4G7VL 2OSLB 4HJ0D 2FECL 3LN5A 3QIWC 5EF0A 2R59A 3T6ZA 4EVNA 5C09E 2XPGA 3OMNB 3PS6A 3SDCB 3HNTH 1TTGA 5C07E 4KTYA 3HG1B 3EOTH 4NNXB 3NJMA 5FCSH 2XY2A 1MFCH 1TVHA 3UTSD 2E4FA 1TLKA 3G5ZB 2W65B 4HWZA 2NUPB 4WWKC 2RGSA 4WZ9A 4UTBL 2BMKA 4OB5L 2WQSA 2IWGA 3JWDL 2Q3AA 5KBLA 2X2JA 3QUMH 3U0PB 2ED7A 4C57C 3GIZL 1V3MA 4Z7UA 1M9WA 2NY2D 4NJ9H 3QHFH 4ZSOA 3ZE2E 4D0DA 4F57H 5I1JH 4AITA 4JGJA 4LLVA 2PWFA 2X3BA 2YMXL 1SQ2N 4U0RC 3RBSA 5A3ID 2W8CA 2YPLB 3UROR 2DS4A 3QIUB 3Q8FA 2X4SA 1DSFL 1QLEL 5IMKB 1XH2A 4S11A 3IJSB 3VYNA 5I28A 5K59E 5BJTB 4G8GE 4BK5A 4M7ZC 5IGXH 3T3PB 2EDQA 2J4WL 4G7VH 1AGDB 4N2AA 2ZG1A 4P9HC 4AV5A 1BP3B 5JQHC 1RZQA 1MCEA 2H0EA 2JK5B 1MQKH 3JV6B 3NH7H 4GBXD 1XXDC 5B7EA 4HWBA 5I26A 4D2NA 2D31A 3NFNB 3TURA 1QSFB 3OR6B 4GSDL 4OW6A 1FAIL 4NQDB 4LCWD 2EADA 4N8CL 4J3OF 3WFDH 4PN6A 1T04A 3SKOA 3MOBL 4L8DB 2X6CA 5FYKH 4NX0A 4O4YH 1QPXA 4F7MB 2GUOB 1VFMA 2DI9A 3IDUA 4PJ7B 3BVVA 4QHLB 4QRRD 1HKFA 4H1LH 1EEZA 4L9DA 2CJTA 2IMMA 2AEOA 3QBTB 5KAQG 3U83A 5B3SB 1IZJA 3F7LA 3D5OF 3P40A 1UA6L 3ZUCA 4E9RA 3WTWA 4XT1C 3DX9A 4IU2B 5DEFA 2KPNA 1GGIH 4OT1H 1RUML 1PZ2A 1FJ1A 1QZ1A 3RKPA 1JD7A 4JFHD 1MCWM 5CZXC 1F4WL 3ZXAC 1NMCC 1TZ8A 2JVUA 1WAAA 1MHHA 1OTTD 2MJWA 4G8EB 2AJ3B 2AJUH 3BP4A 4WSJA 5SWZA 3MRNB 2WMPB 2F2HA 4MA3B 2Y1YA 4IIQC 2G5UA 1JTOA 1NSNH 4PJBB 1CICB 2ZNWA 4YSCA 2X2IA 3HB3B 1KTBA 2WSDA 3VACA 1ZJBA 5FOBB 5FLUA 2J88H 5D93C 5FGCB 5I8KL 3D0AA 4PWFA 3PAVA 3TEWA 2MWCA 1WC7A 3IJYA 3ARFA 2X0VA 2A77H 1KCRL 3JYCA 4HX1B 4L9LB 4FABL 5DYFA 3TEXA 5IT2H 1WZLA 3QZMA 1KB5H 2DMGA 2VN4A 2XZAL 5EIIA 1QSEB 1E8YA 1CGSH 3MYJA 4NQUA 5DFVD 1QX1A 4U7MA 3VXNB 2N7BA 4URKA 2F7OA 1EAJA 4LHUD 3UL4A 1I1AC 5DT1H 5DF0A 2V5SA 2R4RH 3L95A 4LPVA 4M56A 4JUTA 5D2LB 4MD5A 3OG4B 3HC3L 2JSFA 1PFCA 4G8IB 5GGVL 5CEYA 2IALA 4HUWB 4KKQA 1F1GA 3B2MA 4YAQA 1AO7B 1XF5A 1DQJA 2Z0UA 5I66A 2LHAA 5B3JE 6PAZA 5I24A 2O4EA 5E8PB 5GRYA 3OKKB 3VA6A 1CDJA 1A6AA 4RRPM 3ARDA 1C1EL 2YPVA 4X6DA 3CU7A 4J6RH 3UZQB 4K5PA 3V4PA 2AJVL 4PVNA 5ICZB 1ZTXL 1QAWA 2MRYA 3TL5A 4WW2C 4PU2A 3ZE2F 4D0CA 4N8VG 3MBEC 2J43A 1DLHA 5F7YC 3S5LG 2GT9B 4EZLA 3ILPB 4LVNC 3QNZA 2X4RB 1WE5A 1SJMA 2ZXWB 1U8JB 3F8UB 4GAFB 1AIFB 3UJTL 4C4KO 2Q7NA 3CLWA 2J55A 4MJ2A 4F9PA 3HFFA 4L1TA 3FRUB 4P5TA 1TQSA 3AUWB 2VN7A 4XE5B 3OGCB 4LOUD 1KTDA 5GHWL 3ZE0B 5FYKD 4OGXH 3X3GH 4A2MA 1N7ML 3QIUC 3ZLQC 1U4EA 2A6DB 5AWNL 3FUEA 3R1GL 3KS0J 4MD0B 2IG2H 1RLWA 2XVLA 4G80B 3AG4B 4UYQA 5F7NC 2CO7B 4Q58C 1VIWA 4X4XB 1RUPL 2G3NA 3ARWA 1T3FA 2NY3D 1I7ZA 1D9KD 2NY4C 1C5DA 5DYOB 1JGUH 5HDQL 1AKJD 1ETJA 2CK0H 3JUYA 4NQCB 5D7JC 5DR5H 4FFYH 3UIYA 3HVDA 3RWJA 5EBMA 2Q2LA 4HJTA 4PUBL 2APWA 2DQDL 4NUGH 3V6BR 3BKJH 1EHLH 4MXWH 2DH3A 2WKOF 2Q2EB 3DXAB 3MGOA 4P5RA 3K71A 4RH4A 3TZVC 3TJHD 3JTBA 1BMWA 2BSRB 1U8OA 4I8DA 1QSED 4WTQA 2YUWA 3AWGA 2XQYK 5C92A 3MV8B 4NQCE 5GHWH 1NIFA 2GQHA 3Q2WA 3K8LA 2OJZL 4KXCA 5E9DE 2YD7A 3EFFB 3L7EA 5LNDA 4ZTEA 1CZ8H 3IS0X 3P0VH 3RWCA 4KRPD 3QDHA 3NGBB 3BWAB 4KV5F 2YXWA 2CKBL 2H26B 3BEWA 1J9SA 1C16A 1H9VA 1J1OH 4NQVB 2X3AA 1P4BL 3QXTA 3UZVA 3WFEH 2A73B 5TE6L 3P73B 3AXLA 3VFSA 1I85A 1CK0L 2AVFA 3ULVE 2XBDA 4C59B 2WSKA 3JWNG 3CHRA 2F6AA 3T0WA 1JDAA 3GSQB 5HP5A 1NKGA 4A6YB 4K7PL 2E9WA 4TMPA 3JT2A 3WLWC 4QOKE 4YHLL 1SVCP 4UOW0 1MCOH 1AXSB 2W9DH 5CJ8A 1OAUL 2FEDC 5D6CA 2L7UA 1OCWL 1XZ0B 2OL3A 2G9HA 4Y2LA 1TNMA 2H3NB 1CZ8L 3P0VL 1DUZB 1EO5A 1KACB 5GS1A 3BUPA 2Z1PA 4GUPA 1J5IA 2VE6A 4EIGB 1G5GA 1GMEA 2VLMD 4BE6A 2W59A 3N42F 4Z95L 4BGDA 4F58L 3KNBA 5KYYB 3ARBD 4YE4L 5F1IB 2BVUA 4OY9A 2XDHA 2W80C 2Y3AA 1M4KA 1TZHA 3SBWA 4POZC 4LARH 1J9QA 1K8DB 1NJ9A 1XR9A 3SQBA 4N0FA 2Z93A 2IOOA 1ROCA 5ACZA 1E4KA 3S35L 1I8KA 5JO5B 4ABVA 4WK2B 3RDTB 1I9IL 1URIA 4GI9A 4KXBA 3BSZL 4L0PB 3UJJL 4PG9A 4LLYA 1XIWA 3SDXA 3DSNA 4ZSOB 4Z7QE 5I1IL 4JRWA 4OGYL 2KT6A 4WUUB 4AZ8A 3MU3A 2DQIL 2OL3L 3ARRA 4AEHL 1JRHI 4MMZC 5IBUB 5ADOL 2HTLC 1VADB 1KPVB 2ZYHA 5CSBA 4GJTB 1OTUC 3F01A 1CIDA 4Z6AT 2VR7A 1IGYA 5D72H 5G4MA 1L9RA 4TNEA 4LT7A 4Y4HD 5ALBH 2XXGA 1U8PB 2HKHH 1HWHB 4X7DC 5C07D 4Y4KC 4OFVA 3UC0L 1I9RH 2VQUA 1PDKA 5IW3A 2ZONA 2LLLA 4PCTA 1G9MH 2IF7A 3EGXA 4KK8D 3HE6C 3PHOB 2AQ2A 4U1LB 1Z9SA 2LLNA 5AOJA 1ZS8B 3D48R 1U8CB 4XMKH 3JWNC 2OSWA 4U4IA 3LQZB 5F96L 4OI9A 5BXFA 4FE9A 3NSXA 12E8L 3LS4H 4JHUA 3W2DL 4MS8D 1F56A 1YRKA 2VMFA 4KRPC 1XGPA 1YMMD 3B2UC 4KQ4L 1XXFC 2ZJSH 3ARVA 4NGHH 4NQEB 2B08A 4UMGA 2IDTA 3GXTA 4PS4H 3VFPB 2R7EB 4NENB 5EU7C 5G4OA 3WNNA 3L4ZA 3TF7C 4PJEA 1TEGA 5ALBL 1DLFL 1ML0A 3ZL2A 3GBLA 4K3JL 4DO4A 2WHVA 2IH1A 4QRPD 5IHUL 3EDDA 5F0JB 2BFGA 2FIKB 3MJ7A 5EBGA 1F90H 2ZUQB 3BT0A 4X0KB 3H1ZA 1OPGL 3E8VA 4KHTH 4XPAL 3AC0A 5IJDC 3FN0H 2DD8H 1I75A 1H6EA 4TYUA 3IEAA 5D7SL 2EDWA 1N12A 2WQUA 3IS1X 5IB1A 1OGSA 1PSKL 3QG6A 3L3IA 1D5IL 2XNAB 5EOCJ 3SB3A 1I1AD 2FO4A 1OGAE 5LG6A 2ZUYA 4Q0XL 4X9FA 3WEMA 4RVBA 3REVB 3MA9L 3EGSB 5ADPH 4G6KH 4WGKA 3CZSA 5KVDE 1RUMH 2FHBA 4OCMC 1E43A 1K3ZA 4U2ZA 2WK2A 4MCZB 1BBDH 5CJXC 1GKOA 4U1MB 4X7SL 4CW1B 1SOKA 4XPBH 5GZOC 1E5BA 1F0LA 3PHSA 2FZ3A 3ZE2B 3FUJA 1DVFA 1Q8MA 1LE5A 4Y2DD 1E4XI 2BNRA 2J5LC 3WN5A 5DRXA 4ODUB 5HI3C 4FC3E 4P06A 3T2OA 1I7UA 2WV3A 2V4LA 1VGEH 2NY2B 5HY9A 1Y1DA 2R2CA 2ATPB 2DICA 3BQUC 4LVHB 4XP6L 1R5VB 4U05A 4N2MA 3GPEA 4YHYC 3M7OA 5JPNC 4D94A 3PP3K 4YAQB 3MO1B 1F02I 2Y7LA 4WHTB 3PPEA 4G3YH 1YO4A 5C07B 2DYPA 3CZEA 1UB6A 4FQCH 4NNPH 4PTTB 5EU4A 1NTDA 2FECI 4H8QA 5GGRA 4A66A 3HI1A 4BHUA 4JQIH 3K6IA 4LDEB 1TSHA 2XWTB 4OH2A 4JM2F 4G72B 4YXKL 3UAJC 4ZYKA 2VABA 2IXQA 5TH2B 4GW4B 4JDZB 1P9MC 2GITB 3SJVB 3X1BA 1R3JA 4DGIH 4Z7WF 3EYQC 3NT0A 1Q9KB 3GLDA 3TX4A 1EXGA 4P2RA 5DLML 3HMXA 1S9VB 1RK0A 2VN5A 5SX4I 3CXFA 43C9A 3OPZH 2ODHA 4YBHA 3VXUB 1KLUB 2MMXA 3QUHA 3HKZA 3PIQA 1KTDB 1ZTMA 2JI3A 1K6QH 3DV6A 4BH8B 2AK1H 1HQ4B 4H88H 3CLFH 4G1EB 1CYGA 2A6DA 4MHHG 1D5MB 3HC2A 2DDQL 3SDXE 4HWZB 1S8DB 5I2IA 4M9PA 3NA9L 5AVUB 2GSMB 3BEVA 2MTPA 4KQ3H 4YE0A 1U3NA 3LPWA 2IPKA 2R2HB 3MJGX 1KPRA 1NFIB 4QXUH 5DS1A 4U1SA 5ANMB 1GZHA 1NLDH 2BVYA 4HS8L 3C5ZD 1KLGB 2VAAA 1G7LB 3I9IA 3QDGA 2DQHH 2HG5B 4WI5A 2V5TA 2V2TA 4YXKH 4BV1A 1JMZA 1YZZA 5DJYA 2XVKA 1HCZA 3BPOC 4UQBA 4A2FA 5AZ2L 3TJEL 1GW0A 4PGEA 4XN1A 4QJ5B 3KDMB 2CO4A 5I6NA 5I1GH 2C3VB 3MLVH 1C12A 3C08H 4NPYB 3WMPA 4MJ5B 5HI4D 5B38G 5IJCC 2WJ5A 3HNSL 1E8ZA 3QFJA 4LVEA 3V5HB 4IBTA 3DROA 1P7QD 2ITCB 1XF4A 3LRGA 4HFWA 3S5LB 5C6WH 1S3RA 4BXVA 3H7BB 1MLBA 4DAGH 3L7EB 4IOFD 2PWHA 1NGXB 3DX6A 3F7VB 3FT0A 1M3JA 3BLKA 1U8HB 1ORSB 4KOBA 4PJCF 3O2DL 2AJXH 2NDGA 2OMWB 4ODTH 2FTAA 2OSXA 3S96A 5SWSD 2CG9X 3ZE0F 4N22A 4WHDA 5J57B 5HDOA 5BVJB 4A7QA 4J7RA 3IVKA 2FE0A 1KCVH 4WV1B 5FFOA 5LN8A 5GJSL 5ESVA 4GS7C 1EJ6A 2P47B 5TDOA 3SD2A 3L3KB 4D8OA 1DE4B 1LMIA 2M26A 1ZGLA 8FABA 1LWRA 2Y07L 3MLVL 2FH8A 4MCNA 2XQBH 1DN2A 5EIIG 4POZD 1QO3B 2DOCA 2HN7A 3Q13A 5HHOA 1H6TA 5C0IB 4CJ1A 1E2ZA 3PXJA 4PTUB 5GXBB 3MAWA 4Q97A 5SWZB 3TBYB 4NC1E 4UU9A 3ZY7A 4TOYL 4YSRA 3V7AG 5E2WH 4MHHI 1IAOA 1FYTD 4L8SB 4QXWA 3VWKA 1EA9C 1RP9A 3FQUB 5JXEC 5FUCE 5DD6A 1JNLL 3FCTB 1S9XA 5AW3B 3UBXG 3SY0A 3U4EB 4CC1A 3JWOH 5F7EL 5GJSH 5B1AB 2OR8A 1RUAH 2Q3ZA 2YARA 5A16B 4S0HA 3S97C 4XCYB 4KITB 1WD8A 5BZZA 3MRFB 3D85D 3QEHA 4M93C 3GD1C 4HT1H 3LNEA 1HNYA 1PAMA 2H6PB 3QXAB 2LVCA 4YNYB 5DD1H 2F5BL 4AQZA 2C7FA 3QR1A 4ODWA 2WXHA 2EDOA 4Z7WE 1I8LC 2X1WL 2ZUTA 3U36B 3ULAB 4TQEH 4YL4A 1N0LA 4UNTA 1OP5H 2C9PA 2M8XA 3FF7A 4HIJB 2JCCF 2XIDA 1T0NA 3SGEI 2EIJB 1MKFA 3PL6B 4MDIA 2ICCA 3EJPA 3IJ9A 4QXGL 5I1DA 3CV5A 5I73B 2CRYA 1PKOA 4XVJH 1HXYB 4ODXB 1WAPA 3STZA 1ICTA 4PRHE 1QYGH 3MLUH 4BZ2A 4ZTPL 2IGFL 4GG6F 3IBEA 4G43A 3F85A 1BX2B 4MASA 2Q9OA 4B7IA 1VEOA 4X6DB 1Z3GH 2COVD 2WXJA 3U0TA 2DL2A 1OP4A 1LK3L 3WFDL 1SRDA 4AK2A 3UJJH 3G08B 5GZNC 3EJTA 3B7SA 1W8EA 5T3ZD 4Z7NE 1NFDF 3UG5A 4TNVK 4TQEL 2FQFA 3A47A 3VJ6A 5AW0B 2BJML 2TRYA 4V1DE 4J6IA 3L5IA 3P4LA 4IRZA 6TAAA 5IREA 1U8MB 4FFWD 2F9BT 3AVEA 5GGSA 4BZ1A 1DQDH 2CCLA 3OQRA 4PMFA 4JZOB 4AV0A 1SXSA 1E4WH 5C6TL 3IJEA 2XQYG 5IUSA 3L1GA 3WD5H 3LS5L 4P07A 4P49A 4PIRF 3HZVB 3VGEA 3Q3GB 3E8UH 2XETA 4TSBH 32C2B 5EU5B 5GGTA 3NP3A 2XTJC 1NBVH 3VD2A 1UCTA 2CQVA 1I1AA 4N3TA 2KL6A 3CQFA 2J5WA 3CZGA 3RVXD 4W6YB 2X6UA 3EHBD 2HTKD 4JG0L 3ZL1A 4TM9A 5D1QA 4LCYA 5DRZB 4LSRH 1ZKAA 1IQWH 4N90E 1UD4A 4Y16A 3N44B 3NJVA 2VZOA 1UH2A 4KROC 2A5UA 2ICWJ 2ZKHL 3LDBB 5HJBA 3ECUA 3FUFA 4A7GA 5GSRB 1JHKH 4QTFA 4GAGL 1G7QA 1MJJB 2E7MA 3ARGC 2XV6B 3HC4L 2BCKA 1MRDH 5F3HB 2EECA 4P46C 2KHAA 4NBYB 3IRPX 3V8OA 1CMOA 4Y4FD 1F4YL 3RZWA 5JA8B 3ZTNH 3NJFA 5IVXA 1J8HB 3RP1A 1UOLA 1FPTL 4MJIE 2X4PA 1OF2A 3QEUA 1AH1A 4N2IA 4KWUA 3D07A 3SE4A 3UYRL 4E9SA 1XD1A 4M8UA 4XZUB 4ZS6D 2HKFL 4AL8H 2NOYA 1GS6X 4FG6D 4LKXA 1FZKA 2OCCB 5ANHA 3RI5F 5G2NA 3GZKA 2BFVH 4HPHA 3O9WA 2V5RA 3WKPA 3HI1B 3TBSB 5C0RL 2YA2A 4S1SH 4X6FA 3VFWB 5LBGA 3VI3E 5GS0C 5EUOA 5DT1L 4A2LA 2RJMA 2H5UA 2N1TE 3DIDA 4GKLA 1S7WA 3VA2C 1XF2A 4QPEA 5CWSB 2ZF8A 3L1OL 4FFZH 1NGZA 5B8CA 1AIZA 2P45B 4KC3B 5CAYB 4PP1C 3QJTB 5AG8A 5AYUH 1H8LA 4GUPB 5I0DA 1M56B 1OSZA 3K80A 3A6CL 2WBWB 4FZEH 2OM5A 3NYKA 3SDAA 2F1AA 3ESOA 1KPUB 5MEPB 5D7LB 4DK3A 2EO7A 2VAJA 2RD0A 1R0AH 1TDQA 5BO1H 1IBGL 4KUZL 2ZKMX 4KU1A 5D7IA 2W0PA 2BFVL 3BDXA 1KIUB 1M42A 2QSCL 1CQYA 3E7JA 5EC1B 3MLPA 4AL8L 3LKQA 1NBQA 1MCOL 4H8UA 2FQDA 3GBEA 9PCYA 2NPLX 4AT6B 2H2PC 4JFSA 3BGMB 3U7YL 4Y7OC 1J0KA 2NYKA 1T83A 2WYTA 1S7VA 3RX5A 2ZKYA 1FV1B 4ZO9A 3VDBA 1NCCH 3QE5A 2FWOB 4H1LG 2VGLM 3BZEB 5JPMC 4GKNB 1U3YA 3HB3D 3LN4B 4F3FA 1HEJC 2KQNA 5DJ0A 4CKQA 1DVXA 1MI5E 4NZRL 4Z3EA 5DVKA 2HLAB 3OL2A 1MFDL 4R9HA 2JIXD 5E1GA 5GISH 5JNYB 3GMQA 2G0LA 3MRGB 1OWRM 2FL5A 3GSOA 2IV9A 2KLRA 1QD0A 3PWVB 5EZLB 5F1SA 3P4OB 3RWIA 4WO4A 3RPIA 1J48A 3KR3L 4Q7DA 3W9DB 3BAEH 1C9SA 4L8BA 2XWRA 1BVNT 3LQZA 5GPRA 4HOMA 4MMYA 4JQXA 3ARGD 4JDTH 4P3CL 4A6YH 2FT7A 1G43A 1YNTB 4W9ZA 5TQ0H 5A3IC 2GT9A 1OGTB 5C0BD 5T1JA 3MRPA 1J9TA 3NRQA 3VX0A 2V37A 1L0YA 4XZ4A 2GCYA 2PO6A 3LN5B 4NLHA 5FO7A 4NZFA 5TF1L 2XTJB 3TS8A 1RZ8B 2IBBA 2XWCA 3HBZA 3LEYL 4XP9H 2QJDA 4P5SA 2IFGA 4Z7VE 4HGWB 4PJ5A 1AO7D 4R3SA 3SDDD 3CNKA 4LCUA 2GYSA 1U8NA 5IK3A 1I7TB 3QWOB 1PG7W 2YSSB 4B60A 1LP9E 2KYIA 2UVEA 3QUMB 5E8NB 3MJ7B 2IEPA 4RGOL 3T8XB 4UQ2A 1MF2L 2NUTA 3GM0A 4PV8A 1FORH 2BVTA 2VDMB 2W81C 3K81A 4BZ2H 3VWJD 4IOSD 4PY8I 2VDPH 1NUFA 2GSIB 5B38B 3H8NA 2XC8A 3EJYD 4Y9BA 1XBRA 3QR0A 4MCMA 1Z1WA 3D6GA 3VD4A 4O2FA 4QYAA 5DXWA 1JGDA 4LPTA 4QYOA 3L5WB 4EN3A 3H9SD 3LCYA 5IIEA 2AANA 2PUQT 3BAXA 2BW4A 2Z91B 3F58H 3O6KH 1S7TB 3RY6A 4CVXA 5BNXD 2X12A 5EBLB 3C09C 4W9EC 1F4XH 4KDTA 4UYPA 2IBGA 5FECB 1PY0A 1VHPA 5K1JA 1ZLWH 3K5SA 3U36A 4AG4L 4R97B 3F2LA 3K1KC 3NACL 1LEIA 2VOTA 4WUUE 3VGAC 4PCYA 3RUGE 3BWUF 1MCRA 4L0YA 5HY9B 5INCA 1J12A 1HI6A 1K5NB 2WWMC 5KSAA 2BVQB 3O4LA 1KJ2H 1NAMH 3UBGA 3LRMA 2YUXA 4N5ED 2VXQA 3GSNH 5MEOB 5ECGA 1T2QL 2CM6A 3OKYA 1V7NH 5EU4B 3WIFA 4Q0XH 1K4CB 5I1IH 1JPSH 3V2AR 1E65A 4XWGH 1Y6NR 3F58L 3IMWA 3O6KL 4R5TA 3CLEL 5CJOL 3TT1H 2A9ML 2XQ0A 4PWJA 2K78A 3EBIA 3BD5A 3PWUA 4J3OD 2GITA 1A9BA 4K4KA 3UJIL 2WWKT 4WTXA 3N3EA 2DJSA 3INOA 3RGVB 3ZX1A 2YBRB 2BVPA 4LIQE 1SJHB 3SGKC 3R4DA 1UM4H 1J5OH 3QDJE 3ZSSA 3VMNA 4PJBA 5IFHH 2WXIA 5FAAA 2ZOLA 1TO5A 3CVHB 2IH9A 5DMIL 2WLLA 3FU3A 3N85H 4Y7MA 4QT5B 5LBSL 4P57A 4AKQA 3OF6D 4BK5C 4AGOA 2JXMA 2XSKA 3LTVA 5LXGL 3FT2A 1KN2L 3GDBA 4W6WB 3IJEB 2WQ8A 5CJXA 4OV5A 2YGOA 3FU7A 1I8KB 4KI1A 3ME0A 1N10A 3D06A 1KCUL 2H3KA 5ID1B 3MRLB 1Z9OA 1CE1H 5C6PB 1KGUA 5JMOC 3BQUA 5EOQH 2IQAA 5FM5M 3CLEH 3TT1L 4WUKH 5E9DB 3W11D 3V9CA 4JFEB 1T20B 4AYID 1M2VA 1ZE3C 5D1QB 3HS0B 1PAZA 4DPCX 2AJUL 1Y18B 3MV8E 4G8IA 5CEYB 4FL4B 4B0MM 3QUZD 4XB8A 3CXHK 2P52A 5E8EA 5ENWA 5DS8B 3GJFK 4HAGA 3R7RA 3ARUA 2X2YA 2XXCB 1VGKB 3IETA 2YPVL 4UDTB 5IBTH 4ZW7A 1OT4A 1YMMB 1OAJA 3CGTA 3GBDA 1QWUA 1J5CA 4A2HA 4YHIA 3SPJA 2ZXGA 1NUGA 4GSRA 4FQ1H 4A2GA 1SXNA 3QUXD 4Y9CA 4RA0C 5KSUB 2BIIA 1UOVA 4JZJB 1A3ZA 3NJGA 1B90A 1UJ3A 3O41A 2FUTA 4R0LC 2Z92B 4GMSL 2CR6A 1KBGL 4NC2B 2BIPA 3GM8A 4EUPG 5D9SA 1BG9A 4M7KL 1F86A 1JZJA 2AXGB 3FTGA 3TJEH 3VFPA 5DJ2B 2EABA 3DO3A 1YNLH 2VTFA 4WNQB 3IU4L 4GIOA 1ZT4A 1HEHC 4CC4C 4IKKA 2R1XB 3ARZA 4F7TB 4PY7A 1RZFL 5FFLA 4JCMA 1UXLA 2P5WA 4IKNA 2WP3O 4WJKB 1FL5B 1QI3A 2ZCZA 1QBLH 3ET9F 4OM1L 4P2QB 3TBCA 4A55A 4Z3HA 3OB0H 1EUUA 4XBPA 2CO7A 1OO2A 5JDJA 3B5TA 5J1SC 2X09A 5HJ3A 1CD1B 4LSTH 3N0AA 2F18A 4YBLB 3VO0A 4X4ZA 5IMOA 4GIPD 3ULUF 1IAII 3ILEA 4G7QB 1SYVB 2ADIA 4JW3A 4PJ9C 5DK3A 4U1IB 1H19A 5DD0L 5ALCL 4LO9A 1D5XA 3QG7L 1BQLL 2ZIDA 3WS3B 4DP1X 3BAWA 4ZFGL 4DESA 5AAPA 4D9RE 4A04A 5F7MC 3BVWA 5B22A 1W8NA 2YAPA 5AENA 3QJFA 1JGUL 2IDQA 4K9EL 4L1LA 1YPZE 4WU7B 1J1PL 2R0WL 2XWBB 2IH3B 4ATWA 5C3LD 4UTAH 2YMTA 3GK8H 3TYFA 3FQXA 4ZO6A 4DEPC 4L3EA 5GGQH 3EJZD 1B2WH 4XMVA 3GRWL 4A39A 5T3ZH 1A25A 3SODB 3CXDH 2WN3A 5DA4A 2EEDA 3JSSA 5IM7B 2Y5TB 3GSUB 4R4ND 2ZCHL 3GHEL 3K2IA 2UYLA 3MO1A 4EPSA 5GRUL 4AQEB 3U25A 1WGVA 4YHML 2XQYA 3V6ZB 3DSFL 4G43B 4U6YB 3V52L 3W9EA 5SWQB 3IDMA 1AS6A 4XNMB 4Y1AD 5D2NB 3U9PH 1QR4A 3GHPA 3VUAA 4RLDA 5J11C 1TTFA 2R0ZH 5FHAL 1XZ0A 2OL3B 4PJBE 5K1NA 2CRMA 3N6YA 4NHCH 2D4FA 4K94H 3S36X 2J6EL 3EUDA 2MCG1 3S8FB 2VDOH 4TTGA 4X8JA 4LF3A 5LO7A 4YIQA 2H8PA 2R39A 3LY6A 3AREC 3F05A 2OX5B 3B4NA 4EE2A 1EFXA 4Z76B 3GIVB 5IUCA 3D2UB 4M02A 4UINL 3QUXA 4KJYB 4KTEH 4PJIF 5E1HB 5TFSL 3LKOA 2JWYA 1O6SB 4GUCA 4AUJA 3VXPA 1IZKA 2X41A 3CUPA 4MNQD 4JFQB 1HJCA 2MIZA 2YQ2A 4RFOH 1XGQB 3TPUA 1CDGA 2VITA 4JKWA 3KMDA 1CBJA 4GOSA 2VRQA 5ANMA 2P9RA 3FRPA 3SJVD 1RURH 4L8SC 2YPLA 3IE9A 3IRZA 4MS8C 5EZIH 1K9TA 1X5ZA 3AB0B 1TSRA 1UB5A 1WCBA 2Y07H 2Z1KA 3WTTA 3MV7E 2NY6B 5CLYA 5K9QG 5DJAA 2X4UB 2FJFB 1KEML 2W38A 1T6VN 2QHLA 4RZKA 3GSVA 4GB9A 1BAFL 3MRKB 1X7TA 4IMKC 4XN7A 5FO9B 2EYSA 1WAEA 2Y72A 2BOCA 4G8GB 5DJCB 4V11A 2GAZA 4ZQKB 3M8OL 4GINA 3Q7JA 5IOPA 2WC7A 4TNWK 4WNJA 4JDVA 1FVDB 4TVPD 1WFIA 1MNNA 4GBXB 2XN9D 1I1YA 4MLSA 2OYKA 1ZHNB 1TIUA 1MFVA 3SKMA 3WY4A 7PAZA 5TTRA 4K3EH 5I17B 4MGXA 3BJ91 2NY7L 3QCVH 4G6FB 2J72A 3QQ9D 2EAEA 3RILA 4J3WA 5C0NC 4NQTA 1ONQA 3UBXI 2AJ3A 2XWEA 5EZPA 4OLWL 4ZFFB 1J0IA 1BAFH 2DQIH 2DQEH 2OL3H 3NCYP 4IBSA 4HJGB 4L3ED 3B9KC 2VMCA 3UMNA 3C2AH 1G9NH 2QMKA 4UT9H 2CA4A 4JGUA 3CFBA 4WI2A 4XXWC 3PAYA 4QGYA 3IGAA 3FUNA 1A3RL 2V3DA 3BIBX 4PTUA 5BV7C 3FB6A 1SJEA 5LGHL 5HDBE 3RX9A 1A14L 4QRRA 3VFOA 1GGTA 2X87A 3ZE1B 3KPSA 2V17H 3NABL 3MQIA 3NAAH 2A9DA 5E5MA 2CKBA 3J7HA 4N85A 5DCCA 2Q8AH 3GO1H 4FP8L 1JXJA 3ROLB 1P2CB 5JQ6L 3CAFA 1EGJH 3QNXA 1OW0C 4TLUA 5IHUH 4N6RA 1R3KB 3AMLA 3QUZC 3W2DH 5JORA 1EO8L 4MQXD 1WBXB 1UWXK 4FQXB 2Y24A 1NM4A 3QHZH 3U1SH 4YNYA 4JHAH 4CN6A 3QJOA 4LSUH 4ZOCA 5FXCH 1NM9A 4NOBA 1SGKA 1BEYL 4UTCA 2AITA 2BNRB 4XB7A 3L1OH 1GZQB 3RL2B 1X5HA 1MCSA 1G9NL 2R4SL 4MYWB 3V0AC 2FWOA 5KBNC 3SQOH 1A64A 3GZPA 1MREH 3CZLA 4QRUB 3QIWA 1UURA 5IBLC 1A3QA 3CQQA 2FEEI 3SPVB 3D33A 3GYRA 3V4VH 4BDVB 1OARL 3GMQB 3MROB 1MWAA 4MB3A 1HESA 2Z8SA 4NPKA 5DD5H 5IROC 5C08A 3FH7A 3VFNA 4AQ8A 5GGRB 1WK0A 3AS1A 3L16A 4NUPA 1NIBA 2D03H 4EF3A 4GKZB 5H94B 1LO0L 1VGEL 4XODA 4IK6A 5J12B 3LHPH 2NLJB 1BBJA 1RJYA 4PJDE 4Y2DA 1U0QA 5L8JB 4WO4D 1ZHLA 4AQOA 2GPZA 1CICC 5F7UA 4AVJA 5F44A 3POCA 4P2RB 1UKQA 2C1PA 4RX4D 1Z5HA 1YEHH 3US0A 5IB3B 2AEPL 2CO2A 4MAYD 5F9WC 1JHKL 4U6TA 8CGTA 1EH9A 1R47A 3ATDA 1YEGH 43C9B 1D6VH 3I9AA 2YA0A 1MCPH 2APVA 4EI6B 3ARDD 3FT4B 3D69A 4OSUH 3SIKA 3GMLB 1LJMA 4IOFC 5C0ND 2PCPB 1TKWB 1HQ4A 1BLIA 1IC4H 3P11L 2DQCH 2TSAA 3SGJC 1A1OB 2YOAA 3H55A 1F6AB 4MA7L 5IFAL 2VDKL 3ZTJG 1T83C 3KR3H 1HHHB 1JV5A 4LU5L 3LV3A 2AQQA 1D2OA 4WJ5B 3NA4A 4F3FB 3PU7A 1PZBA 1YLBB 4JQIL 4ZW5A 2DKMA 5IQ7H 1BXUA 3ELQA 1LL1A 1AKJB 2J1KA 4NKMA 4KKNA 4ZAKA 3G6JE 4N0CC 5F0PB 5KUKA 4ZUUA 4WFFD 4DGIL 4N25A 3G6JB 4UB0L 1X4YA 4W68A 3QPQD 5ICYA 5G5DB 3QI9C 4TQPA 4BZYA 3L4YA 4LHQB 1CF8L 1QSFA 3OR6A 3QDJD 3V0EA 1XF4B 5J13C 4JFXB 4DN3L 3T09A 1D5ZB 2PPAA 1E30A 4EUPB 3V79C 4UANA 4KJWD 4WW1B 2QV4A 1YMHA 4Q4EA 2FHCA 4XBGA 5D1ZB 3QRGH 5C70A 3PY9A 1MUJA 1EEUA 5INCB 4LVNB 1ULVA 3WV0A 4C83A 1PEZA 2X28A 1NGWB 4GEJA 3RU8H 4EBQH 4PB9L 5C2BH 1KCWA 3EOYG 4OQTA 5F97E 5JOFA 2WQWA 1P5UC 3CDZA 4XPBL 4FEIA 4X6FB 1UACL 4XNMA 5D2NA 1CFBA 2H3NA 1CGXA 3ZDXE 2C9XA 3HBPA 2V9TA 2FHFA 1A22B 1F13A 2DWDB 3O11B 1NCJA 4NFCA 1N8ZA 5HDWA 5CGTA 2VO8A 4GAJH 5H4YA 4K9EC 1WICA 3U9WA 4DVBA 2O5XL 2VDQL 3VXSB 4X5WA 2JKJA 4IOIB 4ONHB 4U0RB 4HG4K 5KTEH 4QCIA 1OAQL 5T1DH 2XG4B 2OQJA 3TA3D 3S9DB 2MPAL 1INEH 4X7TA 1C5BH 3LKOB 4WEUD 4N2HA 4MBRA 1WD9A 1X3DA 2RIKA 4M1CD 1U36A 4NO0A 2WNXA 1PFOA 4Z7VF 5MP6L 4GQRA 5MEQA 1OEZW 1KIUA 3LSOA 4HWBH 4F2MA 1F58H 5AW8B 3F7QA 5KS9B 2YK1H 3F7YB 1XGRB 2BSSA 4XWGL 3FO2A 3RG1C 3TN0A 1P5VA 3IGFA 3HHMA 4PJFE 1D9KA 1U41A 1LP9F 1HC1A 1S7QA 2NZ9C 3FDWA 1VADA 1EX0A 1J88A 4IBLT 1A6UH 2CDFB 1N0LB 2HT3D 1HCVA 1K3IA 4GW5A 4U33A 4TVPE 1GW6A 2O61B 2FQGA 3NCYS 4EIZC 4M43L 1II4E 1GTNA 1PY4A 2J8OA 5ISZA 5F3BA 2WLYA 1TMQA 2FJFA 5CKAA 1QHQA 3RFZB 3MACH 2VH5H 2H2SC 4PJHF 4U1LA 1XQ4A 1ECYA 1TITA 1PG7X 2P44B 3CPUA 3UABA 2FL5B 4J12A 4ZQKA 2BDNL 1F4AA 5BXFB 4D9LL 2ITDA 4D0CB 2EE9A 1XIWD 2DLFL 2ZXEB 3RPIB 2ZAHA 4LASL 1MQKL 4BQCA 2BSTB 2YEQA 3WL9B 1QNZL 1WLHA 4D3CH 2DM4A 4IRZL 3M6DA 3VJ6B 3I2CH 1H6UA 1LO5B 1DVTA 4P5TB 3II3A 3RUGF 3ZKND 2IFFL 3BKCH 3KVQA 1E8WA 2J21A 3C5ZA 2AP2A 5H37H 1UT1A 4XE0A 1LD9A 1GH7A 4Y5YA 1V54B 3TNMA 3LVEA 2J8UB 3RE0A 3NJLA 1TZGH 3CPLA 4XCCH 3B5HA 4N2CA 4KKAD 1ZPLA 1JPEA 3C12A 2D7QA 2XFXB 5E6YA 1SJEB 3WG7B 4ZPVB 2ZYIA 4XBPB 1UM4L 1J5OL 2FT8A 3L81A 1NAKL 2FO4B 5CMAB 3T0DA 5LNGA 2WPGA 2QQLL 4CDHA 1HHKA 4R2GD 1KJMB 2VJXA 1TF4A 5FV1L 3MA7A 4D3CL 1CFQA 3CN0A 1S46A 3MBXH 4GMSH 2ZWSA 2R2EB 1JWUA 2WAHA 5D1ZC 3PYCA 4P59H 1DEEA 1MOEA 4MCZA 2C3HA 3IM1A 2UWEE 4HWNA 4CW1A 4TULH 1D5XB 1CYWA 3WS3A 4QNPE 5K69A 2DPKA 1NGPL 2J88L 4P3DB 2R51A 1NMAL 5KVDH 1YNLL 5C7ZA 1M7XA 5GS0D 2IFFH 4R5VA 5INDB 1U30A 1HN1A 5A2FA 4DUVA 4M1CC 1F2QA 1JS4A 2ESVE 4ZPTA 4APXB 2B59A 2DKSA 1CXHA 5CGYC 4X9GA 3BKYL 4CA4A 3MBEB 3DMMD 3OXSA 4HK3J 3UTTE 3DURB 5HHOD 5FYJH 3O45B 2CAKA 4GYBA 3GBNL 1KB9K 2E56A 2FR4B 3VXTA 1H15B 4BYHA 3C6SA 4BJLA 1AFVH 1VFBA 4OZFB 4GSDH 2WJ7A 4KX9A 3ZT6A 5HPMB 2AGJH 4IHOA 2J2ZA 2PCFA 1T0OA 1OCZB 5AW5B 1U4FA 1CE1L 3EDJA 3ARTA 2ICWI 2Q0ZX 2X38A 4GKZA 5JW4N 3OBAA 4M62L 3ASNB 3BZFB 2WMPA 2VC2B 3MSPA 1TJGH 4CILA 4TULL 4HMDA 5DHVB 1RZIB 3PWPA 1RSFA 1HOEA 4HHWA 3HHSA 3U9UB 3VM7A 2NY4B 5E6ID 2WXLA 1YNKH 1P4LB 3O8XC 2ZNXA 2EXYD 2K8MA 2WXOA 5DI8B 3FC8A 5AOKA 2Z31C 2HUEA 1I8AA 1ORQB 4HKBB 5BRZA 4AZUA 3DTUB 3FN9A 1CFTA 3RWGA 4KJPC 5DQ9A 4Z1PA 4LRNH 4OZGE 1J87A 1S9WA 3GIVA 4AEIH 2VDNB 1ZXQA 1E5ZA 2ERJB 5I2IB 2OS7A 3F7KA 4Q2ZA 1COBA 4H0GA 1LEGA 4Q6IA 2WY3B 3ZDZE 5A6LA 1KLGA 3IYLW 4LBEB 3ALXA 1L9SA 4FERA 4AW7A 2HCZX 5C0JB 1LVEA 4JM0A 4YC2C 3WJMB 3U9PL 4L2YA 2YQ3A 3OJDA 1NQBA 3TVMB 4AJVA 2ZE0A 4KKAC 2P8PA 3N40P 1YPZB 1TQBC 3BVNB 2YGQA 2G2RB 1P69B 3DRQA 3DX8A 5TDNA 4YHYB 2F54E 1SJVA 4TNFA 4PJ9B 1FCCA 1IGCH 2VO5A 2RFXB 5TE7L 4ONGL 2F19H 3MBWB 4P5MB 4JRXE 3T2PA 4C56A 4AIXA 4ELMA 4YXLL 2IV8A 4QDGA 3MCG1 4QRAA 2JIXB 4JFFA 1PCSA 4GKOA 4JG0H 4AGPA 4HV8A 4Z78A 5DJCA 3WNLA 1LGVA 4K0OA 3QIBB 1G7JA 5T5FH 2P24A 3QJRB 2CO1A 4ORGA 5FEBA 1PJWA 3PJSA 4HUVA 5CJQH 5DUBA 4ZMYA 2VDML 1IFHL 5C09D 3IDGA 3QUYA 3HG5A 5FIEA 4U1GB 2B4CH 3P4NA 1HILB 1CI5A 2AMUA 5GGVH 4P23B 4K8RD 1NAMA 3HMWH 2XWXA 3MLTA 5DD0H 5ALCH 3QG7H 1MFDH 2I07B 4UF7C 3ARFD 3APDA 3FQ1A 4H8WH 1NGWA 1P6AB 4OIFA 2A6JA 4OZIF 3PNRB 1ITCA 1AMYA 1KGWA 2D3NA 2QTVA 3H2PA 5EHFA 5GRVL 3CMOH 4PJAF 2UWEF 4IS6B 3T0AA 1G4RA 1MZZA 4OJEH 2EP6A 1KBKA 4B97A 5I1EL 1B0GB 3FFCE 1QLRB 4QRRE 3IGAB 2DIEA 4XC3L 3TIDB 5EULV 3FUMA 5IB2A 3IDJA 3GZOA 3GJFB 4NQCA 2PTUA 1VJSA 2G3MA 4LLVB 1P7KA 4GXVH 4UQIM 3A4EA 1NL0L 2ITEA 3FT9A 4LHUB 1N7MH 5D7LD 1AR2A 3QIUA 4HK3N 2VQTA 1KY7A 5TPWL 4PHXA 1CGWA 1E90A 4CDGC 1XSJA 3SDDA 1SHWA 5E94B 4P4RA 3O8XD 5FK9A 3RU8L 1T7WA 4YDLC 4O2FB 5LCVL 5CD3B 3MV8A 4OIIH 1UFUA 4NO0B 3L5WA 4M1GH 3OPUA 5D1QE 1AI1L 4F2MB 2VLME 3IT8D 4F8QA 1PMYA 1OP5K 5F9OH 5JHAA 2J1WA 4FQXA 2VERA 4JE4B 3F7RA 1DQMH 5AAMA 1P5VB 5E56A 3UTQA 4UAOB 3LYRA 3BT2L 4MX7B 3G5YB 4I5BB 1U3ZA 3L1EA 4P2QD 4R90H 3P30H 5DZJA 5TGBB 1BYNA 3EYFB 1ZEAH 1OAXH 5IY5B 2ED6A 4KZEH 1DBAL 1FH5H 1Z9MA 4OF5A 4RMUA 5C0DA 1S4IA 4PTTA 3NFSH 4WV1C 4A6YA 1QFUH 3VGBA 5SV3A 1NCCL 4PRNB 1F4XL 2NX5A 2NQDA 2BRQA 3GBMH 1TCMA 5IHHA 1IGFL 2H1PL 1A4JB 3NPZB 2YRPA 1D7CA 4JHZA 4AE1A 1QVOB 5FGBA 3MV7D 5J5EA 3B83A 4O2CB 4A38A 1OE2A 3QDJB 1RJZA 4ANKA 1N2RB 1ZAGA 3FSAA 4MA3A 3BWSA 2A6IB 2XVBA 4CMMA 3WL9A 1RK0B 3BCDA 5E6RB 5BS0A 4O02H 1S7RB 4U1HA 4BFRA 2QL1A 5DJZB 1O9ZA 1NLBH 1MDTA 3BE1L 1GZPB 2BP8A 3IMTA 3LEVL 5KOMC 4MA8L 2FB4H 2HT2C 3O4LD 4HULB 3GI9H 1QBMH 4BEIA 1KFAH 3IDIA 3L3JA 4ELMF 3NPSC 4P57B 2YHGA 1MW2A 4GO9A 1N4XL 2J8HA 3BX7C 4I7ZC 4NIYE 3ULVH 1CXLA 2Y69B 1E7UA 1TKWA 1KYFA 4I2XA 2A83A 2VAAB 2LE9A 2VKWA 3IMUA 1KF9B 2X6AA 1J05A 3T77B 1BZ8A 1CL7I 2FX8L 4HUCA 5D7IE 5JHLA 3ZT5A 2X6VA 1PF3A 2ED9A 1QMUA 5E6ZA 1LO0H 1A14H 3RUGB 4JRYB 1RZKC 2WWKO 1OB1B 4WTZG 2NY7H 4GQZA 3OKOB 3FQRA 5J6GA 3L95B 4B41A 5M94B 1FYTE 1OCWH 3S3DB 2EXWD 2GB2A 5HDBF 3E6FA 3MTXA 4NPYA 4JFFE 1NGYB 2XJLA 3MXWL 1RHHA 3B5GA 5E8DH 4U1GC 2DMBA 3QUZB 4WI6A 5HHNA 5DRWA 3N1FC 3HUJE 3BSZA 5IROA 3SE9H 5M95B 1N3NB 4JN1H 4Y5XC 1KY6A 5DJXB 5DSCA 3KCPB 3F7VA 3PGFH 4GRMA 1NPJA 1T0MB 4TLTA 1I8IB 1EZUA 4LNRA 5DK2A 4X99B 3GKWL 1W16A 1SOSA 3WIIL 1FA4A 4Y19D 2VLKA 1JI2A 1XGYL 3BJLA 1USZA 2X4PB 3QEUB 3FSWA 4F7CA 2ZKHH 2R23A 2WXGA 5A6IA 1SN5A 1UWFA 2DYPD 1IM3B 3WE1A 1I8MB 1R6VA 1C8PA 4PG2C 4L23A 3HS8A 1BYPA 4MB4A 5F7DB 1H15A 4QRQA 3PDOA 3GXPA 2UY7A 5I6PA 1WBZB 3POHA 4M9OA 5I17A 5IEHA 2VQ4A 2VW4A 3NJXA 1RLBA 2CMRH 3CBKB 4RAUA 4E9WA 4U1JB 3ZDZB 4DGYH 1XF3B 3HG1D 1L7TL 3UEQA 1BQSA 1CR9H 2QELA 2VT0A 2IAMC 3DOSA 2NQCA 4LLUB 4M8RA 4NKDB 4FQJL 3FB8A 1HK6A 2ADFH 4OVVA 3CDFA 1NBYA 3NIDF 4PY7B 4CKVX 1F18A 2IVFC 3BVUA 5T1KA 1KEGL 2NY3B 3PHQA 3U7AA 3OXRB 1RSYA 2CDEB 1TQVA 2EE6A 3FQUA 2PNDA 3E9TA 1RQ5A 5F9WB 4RFEB 4DT2A 2V9RA 3OKEB 4KY1L 1RI8A 4JE0A 3K71B 2OMXB 5ICXA 4Z8FH 2C7UA 3PP3H 1IAIH 2E3VA 4RSYA 2MOVA 1Q9LB 3ZZLA 1RH8A 2PW1B 4HHAA 2DB8A 3H3KA 2BC4B 4LL1A 1H3UA 3C5JA 1V27A 3BZ4A 2H6PA 3QXAA 4GLRI 3SDAC 4K94C 3T3PF 3FN0L 1FN4A 1PZSA 5IVZA 4HIJA 1HS6A 2O6PA 5J89A 4UM9D 3S6CA 1MY5A 2K45A 5AVYB 1WH0A 4K3JH 4BA0A 5KZCD 3UTTB 4HIXH 2CUIA 3HVNA 4HS6A 5DEGA 3TBTB 3HNVL 2VSDA