4KOCA

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95i/y108f)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Azurin
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95I/Y108F)
rcsb
source organism Pseudomonas aeruginosa
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kocA00
2JKWA 1J5DA 4BDVB 4JHUA 2BP0A 1AAJA 4YSAA 1WS7A 1AQ8A 5I5MA 7PAZA 2PP8A 2WSDA 4KOCA 2XU9A 3DTUB 1J9RA 4HZ1A 1PNCA 1CUOA 3V9EA 4TXVB 3PCYA 4YSUA 2GIMA 1JVLA 1UATA 1ADWA 3EHBB 4AKOA 1W8EA 2BW5A 4G72B 4HHWA 1OCCB 2FJSA 1EZLA 1KCWA 1PZCA 1ASPA 2Y1AA 2XXFA 4RH4A 1GS7A 1SF3A 3KW8A 1V10A 1AIZA 2UXFA 1J9SA 3ABLB 2FT7A 2H3XC 1CYWA 1WA1X 2BWDA 3IE9A 2IWFA 2P80A 2QPEB 4YSOA 2E86A 1MDAA 3FT0A 3T71A 1JXDA 1ET5A 3JT2A 2AANA 3AG4B 5AKRA 3X1FA 1QLEB 2GSMB 1KDIA 4DP6X 2CUAA 4E9WA 2AZAA 2X88A 1CC3A 3HEIB 1ZPUA 1URIA 1JXFA 1RCYA 1AZCA 1BYOA 5TK4A 4PCYA 5I6OA 3NSDA 4P5SA 1BQRA 2IH9A 1JZEA 4BXVA 4ENZA 1L9OA 5B1KA 3FQ1A 2XYBA 4KNUA 3FS9A 3QQXA 3GXUB 1ZIAA 1AZUA 4E9VA 2IH8A 3CZUB 4N4YB 1SHXA 5E9NA 2H5UA 4A66A 1QNIA 3PPSA 2IDUA 1BEXA 2XXGA 4G71B 2DWTA 4KNSA 4BWUA 1IC0A 4YVNA 3U25A 3CVDA 1W6WA 1PNDA 3CVBA 1HAWA 1DZ0A 1MG3C 4HIPA 1AZBA 1PCSA 1ZDQA 1IUZA 4NERA 4YSPA 4A2HA 4YSQA 2CAKA 2FQEA 5A7EA 4WKXA 1AS8A 3UAEA 3ZDWA 3OQRA 2J5WA 2GBAA 1BQ5A 3S3CB 4GXFA 2GHZA 3NJFA 2FTAA 1NIBA 1TKWA 3FYEB 4YVUA 3QJTB 3ZX1A 2FQDA 1A4BA 3FQ2A 3TBBA 1ET7A 1IBZA 1GSKA 1AG0A 2ZONA 4E9QA 3NSYA 2HZHA 1BQKA 1OCRB 2BP8A 2PCYA 1KYAA 5AZUA 4DP7X 2CCWA 3TA4D 2FQGA 5I26A 9PCYA 2W88A 1ASQA 1TU2A 3QPKA 3FPXA 3IEAA 4KOBA 3FQYA 1M57B 4UANA 1AS6A 2ZWNA 1OE1A 2DYSB 1JOIA 4AKPA 2YAEA 3T9WA 4BDVA 4YSCA 1V55B 3NSCA 1FWXA 1JZIA 4W1TA 1W6LA 4DPBX 3UACA 3CVCA 2VSKB 4Q89A 1MZZA 1KBWA 1PY0A 2J57A 1J5CA 3HB3B 1RZPA 1GYCA 2PPDA 4N8UA 3NT0A 4FA7B 2YXVA 1FA4A 2HRHA 2W8CA 3C75A 1FFTB 1GS8A 5TK2A 4HCGA 1NPJA 4X4KA 2BP0B 2GB2A 3OMAB 4JHVA 1XB3A 1AG6A 3PXLA 3EH5B 2PCFA 2PPCA 4DPCX 4M3HA 3NJIA 5FC9A 4DP2X 2Y69B 5ANHA 3X1NA 2HX8A 1J9TA 3IBOA 4WTQA 3NJKA 1NTDA 4UF7C 4YSDA 4JKNA 4DP4X 1X9RA 2UX7A 4G70B 1WS8A 4P5RA 4YSRA 3X2QB 5AFAA 3NP3A 2ZXWB 2I85A 2XV3A 1YLBB 2XX1A 3N2JA 5I5IA 1RZQA 2AZUA 1SDDB 2PPAA 3S8GB 1WAEA 3FU7B 3EH3B 2TSBA 3WIAA 1E5ZA 1NIEA 1PLAA 1HAUA 1A65A 1I53A 1NICA 1NWOA 2R7EA 2XWZA 3CDZA 3UABA 3UAAA 3ZIYA 3ASNB 2NRDA 2QDVA 5I5JA 3AG1B 2GC7C 1E67A 1A4CA 1SHWA 2IDTA 3QJQB 2IAAC 1BYPA 2DYRB 3WI9A 2XLLA 1KCBA 2LLNA 2UXVA 3GDCA 5B7FA 5I6MA 3IN0A 2DWSA 1TEFA 1KGYE 3NJJA 1L9RA 1SJMA 2MRYA 1GY2A 1OCZB 1F56A 3FSZA 4HAKA 4GP4B 4A2DA 1E65A 1N68A 5F7AA 2PP7A 2BO0A 1ETJA 3SBQA 1BAWA 3EF4A 2VN3A 3UADA 1IBYA 2BZ7A 1T5KA 4YL4A 1JERA 3NJLA 4GP5B 3PAUA 4DP1X 4F2FA 7PCYA 3WNIA 5D4JA 2A3TA 1EHKB 3PAZA 4QKTA 1AOZA 1OV8A 3G5WA 2IDQA 4PAZA 1ZDSA 3SBPA 2FWLB 3WKQA 3KW7A 1OOWA 5B1JC 1ID2A 2CBPA 3S8FB 1NPNA 2DV6A 2YAMA 2EIMB 4M4RB 3QJUB 4KO5A 4HCIA 2J56A 4DP5X 2JXMA 1N70A 1OCOB 2FQFA 2H47C 2QDWA 2OV0A 3ABKB 4HHGA 1X9UA 3T6XA 2CJ3A 2VW6A 3MX0B 1OE2A 3WKPA 4GP8B 1BXVA 2XV2A 1BXUA 2XUWA 2I7SA 4BWTA 2YAOA 4GY4A 2HX9A 3D12B 3X1EA 4DP8X 5I6NA 1A8ZA 1GW0A 1PLCA 2IDSA 2XVBA 3TU6A 1A4AA 4BXSV 2XV0A 2HLEB 2N0MA 5LDUA 3NJGA 4EF3A 2DY2A 1NIAA 1M9WA 3FSVA 3SBRA 4KO9A 2PPFA 3NJNA 1PF3A 3T6WA 4FAAB 1JZHA 2PP9A 2AVFA 1TEGA 2B08A 2J55A 1NINA 4GYBA 2EIJB 1ZV2A 3FU8A 1L9QA 4NB7A 8PAZA 2YQBA 5I6LA 1PAZA 3QJVB 4F7KA 4AZUA 4W9ZA 2PLTA 3DKHA 5F7BA 1WA2X 1XB8A 2WO2B 3CG8A 2OJ1A 3ZBMA 4E9SA 4G7QB 2VMJA 4YSTA 4E9YA 1V54B 2YARA 4NAJA 1NWPA 2ZOOA 3T6VA 1PMYA 1PZBA 1KBVA 3OM3B 2YAFA 4A2EA 2GI0A 1R1CA 1ILSA 1SFHA 3FU9A 2XX0A 3N55A 5B1AB 2HXAA 1ASOA 3H4FA 1MG2C 1SFDA 2YAQA 6PAZA 2FT6A 1SDDA 1L9SA 1IKOP 3FU7A 5PAZA 3NJMA 4ZK8A 3JTBA 1BXAA 3NYKA 2UXTA 4K9JA 5B3SB 5B7EA 3WNJA 5IY5B 1OE3A 1QHQA 3ABMB 5B1JA 1E5YA 3PLYA 2EILB 2FT8A 4G7SB 3WG7B 5B7MA 2UX6A 3NJHA 2OCCB 2P80D 3T6ZA 2TSAA 3EH4B 4MFHA 3AY2A 5PCYA 3ABGA 5EHFA 2HRGA 2QPDB 3AW5A 3OD3A 5D4IA 1NDTA 3IN2A 3MBWB 3NSFA 3UGEA 2X87A 4KO7A 1MZYA 4DPAX 1KV7A 1HFUA 2VM4A 2R7EB 3AG3B 2YAPA 3CDZB 3H56A 4A67A 1RKRA 1WA0X 4UAHA 2EINB 4E9XA 3BQVA 1SF5A 1JVOA 5D4HA 3ERXA 3PAVA 3TBCA 5I28A 1JZFA 3AZUA 4A68A 1L9TA 2QT6A 1PZAA 1AZRA 2IWEA 6PCYA 4CSZA 3BVDB 3OMIB 4A2GA 2FNWA 1ZIBA 2I7OA 4G7RB 2B3IA 2YXWA 1NIFA 3SQRA 2WO3B 4BK5C 1CYXA 3FYIB 3DIVA 3RYMA 2VW7A 1JXGA 1GS6X 4E9TA 1AZNA 2MTAA 2UXGA 3OMNB 2VSMB 5I6KA 4YSSA 2Q5BA 2EIKB 2RACA 1ET8A 1NIDA 2IDFA 1KDJA 3FSWA 3FPYA 3TASA 2BWIA 1PLBA 1XMEB 4HALA 3V9CA 3FSAA 2GC4C 2YAHA 2BHFA 1A3ZA 3QJSB 3S3DB 2BW4A 2PPEA 1CURA 3GYRA 3H4HA 4KO6A 4HCFA 2JFCA 3NP4A 4DP9X 4QLWA 2HX7A 3ASOB 1OF0A 1E30A 3QJRB 1AR1B 1SNRA 1B3IA 4A2FA 1ILUA 1AANA 2BP8B 4F2EA 4Q8BA 4L0PB 1XB6A 1NZRA 3L45A 1J9QA 4DP0X 4CSPA 2VW4A 1GY1A 4AI7A 2Q9OA 1AS7A 4E9RA 4AKQA 3S3BB 3X1BA 1JZGA 2IWKA 4YSEA 1DYZA 4BWWA 3AG2B 2BZCA 1GR7A 2VM3A 1AACA 2CALA 5I6PA 1VLXA 1L9PA 4KNTA 3X1GA 1M56B 4AX3A 1JZJA 2AFNA 5B1BB
chains in the Genus database with same CATH superfamily
4QOKB 2XA3A 4XP4H 3JWDL 1SEQL 2WUBH 2BC4A 1BQSA 3RUGE 1OP3H 2AJZA 3HN5A 4NQCD 3DPBB 1MVYA 4RESB 5HHOA 3L4VA 1REIA 5F89A 4NEHB 3KD4A 2OSXA 4DUVA 1FL5B 5G55A 4KQ3L 3VH8B 5KYWB 4KKZA 3EHBB 5D1QD 1V3LA 4GT7A 1EFXB 3PP4H 4XPTH 5E9DE 4OFKA 4UQEA 2XN0A 1GS7A 2BNRB 1TTGA 2JVUA 2WVVA 4MB4A 2EYTB 4TNWF 4EXKA 3F6IA 5T1DH 1HVXA 6FABL 1RZGB 1FC2D 4JE0A 4ZMAT 3II1A 5D70H 4PJ5B 3K72B 4ACPA 3BAXA 4IBUA 3NZ8A 3EUDA 2ESVB 5DJYA 4YDKL 5IVXA 1DO5A 3E1F1 3VNYA 3OXRB 3EDFA 4BSVA 4MA7H 1M7DA 1CFNB 2FZ3A 4XMXA 3MJWA 4OZFB 4IEFA 4XMVA 1TJIL 1PGRB 1C5CL 5FF6A 2JKNA 1NLBH 3FHQA 1NGZA 2H3NB 5F6HI 4KY1H 4YWGL 4CKVX 2GQHA 4KTEH 2V0AA 1TJGH 3H9HB 4NGHL 2E7HA 2GITB 1O6TA 1Z7JA 2X88A 5AKTA 5IBTL 3U7WL 3VXRD 4X4YA 1TCRA 1FFOB 3PWPD 1BV8A 2HKHL 4WWKB 5TK4A 1D9KD 2DMBA 3SE4A 2HVJA 1Q0EA 4NWTL 5AENA 1FVEA 4JFOA 2P7TA 1T89A 4AMKH 3LS4H 1AVAA 1NANI 3PGCA 3BCFA 3L8QA 3N50A 3JWOC 1M6UA 1DQML 2H6PB 1UD3A 2QKSA 3EHBC 4QRPA 3ZTEA 4Z7VE 1S5IH 4LMQE 3T3PE 3T4AB 1V7NL 1AI1H 1Y18A 5D5MB 3BVNA 3CJJA 2RCSH 4R2GD 3SKNB 1SHXA 3AAZA 5KVFH 3L1OL 4JKPL 4Y4HB 3C2SA 4RSYA 2C4XA 1WDAA 2AMGA 1IARB 2YEZA 3LIZA 2DQEL 4QHKI 5DK0A 1XGPB 1S7WB 2VKXA 1Q4NX 3GJFB 2CUHA 3X13B 2WZPD 5I1KL 4A2HA 2X4SB 1EO8H 5JA8B 4KRPD 2XIBA 3RWCB 5KZCD 4P2RD 3QWRD 3L9YA 1CU4H 3DURA 3K6IA 3DTDA 1R3HA 2LR4A 4OFVA 1KLGA 2QBWA 4JFUA 3ISRA 2AQPA 4WWKC 1KN2H 5CFHA 3L48A 4KROC 3S88H 4KI5D 3ZL4L 3R0MA 5HYJE 2FNBA 5K69A 4J2QA 4P9MH 2W92A 5FYKE 1JE6A 4XVOA 5J9PA 5E24E 3R4DA 2VDMB 3MV11 1HU8A 3ZQXA 4N2CA 2OP4H 1YMMB 3KDMA 5BPPA 3EBAA 3QIWA 4KQ4L 2E7MA 3U48A 3QNZB 4NQSA 4TULL 5JIHA 1KYAA 5AZUA 2ADJA 4MDIB 1DANU 3P73B 3FKUS 2V3FA 2X4PB 2Z4TA 4XN4A 2ADFH 3AQZA 4BZ2A 3WFHA 3GSXB 3ULVH 1WISA 4PTTB 3WXWL 1IAOB 3BXNB 3FQYA 4TUKL 3L3OB 1RHHB 2CR3A 2ZICA 4W9JC 4BQ8A 1RSYA 1UWXK 1CLVA 3AQXA 1B0RB 5T5FA 2UUDH 3BWUF 3HZKA 2IGFH 2MCPH 5CNHA 2IGLA 2R2HA 4NQDB 1W6LA 4N8VG 1OTSC 3T0EB 1QHPA 4DPBX 4QO1A 1TVBA 2QELA 3EOTH 2O6EA 5ICUA 2XIIA 3B9DA 4Z3FA 4BFIA 3A6CL 4I3SH 1X5KA 4D0DA 2PYFB 1G6VK 4AXWB 5L6YH 3QUHA 3FUKA 2NX5A 2R2BB 1ADQH 4HG4K 2BNQD 3IJSB 4FL4B 3RFRA 4JZOB 2XDHA 2EDXA 3IF1B 3ZW3A 3QJHA 4ZO8A 3T65B 5LBSA 1NGYB 1W8OA 1T03H 4PVBA 4IRSA 3WIHL 2V9RA 1ZHKA 2H1LM 3D18A 4GW1B 4Z3TA 3SZKC 3S3PA 3JXAA 1ZE3H 1SXBA 3QFJA 3HI1B 4JPWH 3NIDB 3VVWA 1KB5B 4JMXA 4NP4H 1A6ZA 2WYIA 3L3OC 1U3HD 1QPPA 5E6SB 4X4MA 1UJ3A 3QZBA 2I85A 2YLHA 4Y89A 4NO0D 3MYJB 1K72A 3FQ4A 4GSDL 1P5UA 1P53A 2YGNA 4WUKH 1A6TB 3FQNA 2AQ1A 2JELL 2X5PA 5E95B 1NIEA 3T0EC 4IK7A 4M5ZH 1NC2A 5EEVA 4NRYB 4K3JH 1IGYA 1A65A 3ZY7A 2NCEA 4S2SB 5LG6A 4NO3A 5F96L 3NACH 4Z7IA 1QZ1A 4OD2B 3KHOA 2C4FT 1OSZB 2FBOJ 5DS8B 4CRPA 2K78A 2VLRE 1CTMA 5H37G 1HSAB 2IANB 1JF6A 4KZDL 4FL4C 4GPVA 2W0FB 3E8UH 4P59L 1HINL 1BYPA 1ZLWH 2XZQL 3ETTA 4V11A 1H9DA 4I2XB 2LLNA 2OW7A 4HJSA 1YNLH 1KIQA 4G3YL 3BGMB 4EBQH 4MAYD 1DQJA 3NBNA 4G80A 1T1ZA 5CGYD 1J5OL 2ADIB 3KLAA 1KV3A 3QAZB 1A1OA 4FNQA 2KPNA 3LB6D 1N68A 4LQFL 3VA2C 5EBLA 1N10A 3GZKA 2N59A 1FN4A 1RIHL 1XL4A 2PKDA 4W4NA 3U82B 1WCBA 5LO7A 5BV7B 3LTVA 2F53A 1QACA 2K70A 3OWRA 4IRZL 2ZX6A 1U8MB 3VFSA 1N0LB 2VCOA 1NDGB 1NCIA 4K8RD 3WNIA 3ZLQC 1EHKB 2B1AH 1FFPA 5BRQA 3AT8A 4XMZA 4P4RB 3RNKB 5GSRB 3KYNA 3LDBB 4OFYA 3ZTNL 4XCEA 4UM8A 5CD5C 1PKQE 5EN2A 5EEXA 3U9UB 2YR3A 1RU9L 5BZWA 4X4XA 4LCWE 4P57A 5FA3B 2DQTL 4N20A 2VW6A 3MX0B 1TJMA 2AP2A 1IM9A 3S3JA 5IOKA 5KSBA 5LB1A 5IMKA 3BDYH 4JLRA 4LL4A 4Z1PA 1ZSDB 4I1RA 1S3KL 3LOWA 2CH8A 3D69A 2YAOA 4MMXA 1KENH 4TOYH 4WJ5A 1EAQA 1JWMA 3HCVA 3X1EA 2E7DA 2RTTA 3A21A 3CPLB 4HUCA 4PBDA 2CKBL 1ONQA 3DOIA 4N0FA 3TV3H 1PLCA 4PV9A 4MCYA 3JVGA 5SX4H 2P49B 4JKLA 2PR4H 2R0WH 5BV7C 3SPVB 1SXAA 3WFCH 4KXAA 4D8PA 2J1YA 3SBRA 1MIML 2BCKB 1IQWH 5CP3A 1GC1C 4N85A 5I1EL 3B83A 4GINA 4PV8A 3SKMA 1RULH 1J0YA 1VGKA 3PY9A 1F4XH 4N5ED 1SLVA 1YYLH 4X6DA 5BJTB 1TMCB 3O0RH 4MHHG 4YHZL 3TEZA 2ENSA 3LDBC 4HCRL 4EI5A 5T3XH 2NLJB 4R7NA 3K71B 4ZAKB 4M5YL 3ZTJH 1BVZA 1UH4A 3MTRA 3JWDC 4N22A 1KNOA 3IDMA 3IGKA 3EFDH 4HUMB 5EU6E 4ODHL 3P2TA 3Q3GA 3OV6A 3K0WA 3U0PA 3CZGA 3WE6B 3DO4A 3FTXA 4XPFH 3KPPB 3INUH 3CH1A 2J4WL 1ZA3B 3T6VA 2WINB 3GMRB 5SWZD 3VH8G 1QX1A 2WBWB 4O02L 3P54A 3WHXA 3MFFA 4PLNC 4U3XA 3ENEA 4P2YA 1P9MC 1O9ZA 5IMLB 5KVFE 4I0KA 1IU1A 1DLFH 1UH3A 5EOCL 4V1DB 2G4GA 1A8JH 5F88A 1S8DA 5D72L 4MNGE 3WDJA 4Y5VB 4LHUB 3KLDA 3IRCA 5GZNC 1L9SA 1MWAL 3WNLA 4F7MB 2I9LB 2OJZL 3O6KL 4WTZG 4ZK8A 4E0RB 4F24A 4HBCH 4FFYL 5CILH 3P0VH 4G5AA 1K6QL 2NCMA 1KIPB 1VEPA 2KZKA 3OC8A 3PLYA 2QADC 1A4JB 1YQ2A 1ZJAA 3BUYB 2EVIA 5FGBA 2R27A 5L4FA 3N85L 1QUNA 2CBTA 1KPRA 2UY6B 1RZIA 5GGRY 4ZAKC 1T04A 1M1XA 5CCKL 1WG3A 4IQHA 3CMOH 2R0ZH 2BVOA 1RQ5A 4KO7A 3GO1L 3HUJB 3RFZC 1WUNT 4HKXB 5F9DC 2R7EB 5KVGH 3AG3B 4NQVA 4XCYA 4FQ1L 2WK2A 2AXGB 1BD2A 1ZV9A 4KGLA 3QG6B 3BO8B 2K1MA 3FO0H 4M56A 1E7VA 4WUUB 2X10A 1EZUA 3SPIA 3N04A 2F5BL 3BSHA 1L9TA 5A2AA 1T7WA 2R23B 2IWGA 1AFVH 4JDTH 5K9KA 2DI9A 4ZYKA 4OZGA 3VX1A 9CGTA 5JHDB 3ULVE 1CG9B 5FFOA 1F4WL 2WLIA 3QXDA 5DUPH 1JXGA 3I6LD 3E7JA 2QQKL 3UZQB 1L9NA 3ZHNA 2A4ZA 1RUPL 4M7LL 5BZDB 2NYKA 2BOBA 3QQNA 2JKIS 4ODWB 3MNVB 2O6PA 1A4KA 4QGTA 4ONGH 4P23C 4A6YH 3TASA 4AT6A 2VN7A 3NJXA 3QAQA 5IB5A 5HVHB 4JO1H 3K6FA 5GS1A 5DWUL 1DR9A 5CINH 1N7ML 1R3KA 3LEXA 5DFAA 3GHEL 2NUTB 5FHBL 1T2JA 1LP9F 2BFVL 2DM3A 2NNFA 1IX2A 4PJXA 5ABAA 4X5PA 2DQ6A 5DZAA 3CBKB 4UTBH 15C8L 1J0IA 12E8L 1GIGL 3OPUA 5JLZB 4E42B 1NMCB 4K73A 2W60B 1W8NA 4ZUTA 2FRGP 3SBWC 1ND0B 1MJ8L 1H3GA 2XKSA 3MXVL 1BBJA 4FQCH 3D2UD 4X7CC 5CGMA 1EDHA 3FOLB 2NY5L 4DSYA 4P2QE 4YDZA 5IG7B 5SWSB 1I1YB 4DEPB 2F61A 3PHAA 2XN1A 4AI7A 1WBXA 2F54D 4UT7L 3MV01 2O30A 2CHZA 3SYOA 1K8DA 4JGMA 4BWWA 1FE8L 1NAML 4ELME 1EZVX 5I71C 3WU1A 1TYRA 4CVUA 4PY8I 2JCCE 3GRWA 1UXSA 1BWWA 4TL5A 4OCYH 3JV5A 1RMFL 3SQBB 2BP0A 4WI3A 3RDTC 3VGFA 3KM2A 1I1CA 2GTQA 5HYSB 4B41A 1BAFH 2C3HA 1QHOA 4J4PC 1BHGA 1DJYA 2ISDA 2DZEA 1NEZG 1HZHL 3K6DA 4TXVB 1JNNL 5DXWA 1JVLA 1NCOA 4U1LA 4WK2B 3LRSA 1MLBB 4ZSOB 3CX5J 3ZE1E 4AKOA 1EAOA 4GH7B 4UZUA 2A6IB 4DOHB 1MFBL 2WOBA 2VL5A 1NMCC 2FX8H 4AE1A 1TXKA 5HJBA 4FXKC 3F01A 1I8KA 2UXFA 4TNVK 4OV5B 2PW1A 4AJ0A 1RJLB 3BN3B 4BK5A 4P9HC 4XNZB 2XQYG 4BUQA 3PWNB 1XZ0B 3QULB 4X8XA 2BNUB 4DEPC 1CICB 2ICEB 3EJTA 1UZ6F 2IQAA 3FT0A 4OLZH 4HHAA 3DIDA 4MGXA 3QORD 5CJOL 4WFGE 5FW8A 1BBDH 3VWKD 1LEKB 1P1ZA 3EYFB 4Y16A 2DKSA 3MLTB 2AXJA 2ZOUA 3C5JA 4PR5A 2W0LA 3IDUA 1SOSA 1H9VA 3RWGA 3L3KB 4RBPK 3TNNA 3EZJB 3ZDZF 1FORL 4KHXL 3IMSA 2XV6B 4P49A 4RGOL 4UIKL 1GGTA 3VB9A 4PP1D 3U4EB 2YRBA 5JHLA 3CCHA 4NM4L 4KNUA 3FS9A 2A99A 3GIVB 3CC1A 3MOAL 5AYUL 3LHPL 1FH5L 2Y7QA 1HEZB 5E9DD 1MVUB 4EPSA 4X42A 1C9SA 3FQUB 1EEZB 4U1HA 3FO1B 3PDDA 4YHOL 3EJUA 1ZSHA 3LEVL 2WBJC 4LVNB 1OM3L 2XXGA 2XWCA 5HVFB 1FNEA 3VFUB 1KPUA 1I85C 4XNZC 3K5SA 1U95B 2CKBB 3F58H 4OTXH 1YDPA 4NHCH 2I25N 2FLRT 3IDGB 4UZGA 5FCUH 1CICC 3QFGA 2PUQT 1ZDQA 3R19A 4MLSA 3VGDA 3S98A 25C8H 4HKZB 5GHWL 1D5XB 4GMSH 5HHXL 4MS6A 1RV6X 4R8WL 2F58L 2N7BA 1KCKA 4HJJH 3ALWA 4MD5A 4EXPX 5DHDA 5KUMA 2WGNB 3TO2B 4GQZA 2VXUH 4U1IA 3DO3A 5T3XE 5IMMB 5EIQA 1Z9LA 1PAMA 3FU6A 4XB3A 4PJ7F 4HA1A 4FTDA 5EU7C 1A7OH 3LEYL 2D3VA 3IMTA 3R1GL 5EF2A 1MI5B 1BQKA 3QIUD 1HL4A 2VDKL 3QZMA 1DVYA 3LMJH 4QRQA 1KFGA 1XGTB 3DOHA 1WBZA 2ZOWA 4KTDL 4PW4A 1Z9SA 3WNPA 1J0HA 5DD5L 2FQGA 4LVNC 5CEYB 2NUPB 4F2MB 4X6CE 4O02B 3ECQA 3VXMB 1KACB 3CUPA 3ZUCA 4LT7A 1V7MH 4YHYC 3DVFA 2H8PB 1ASQA 3F7VB 1T3FA 1YJDH 1VADA 2P5ED 4AUYA 1MCEA 3LH2H 3N6YA 1EXUB 3SE8L 5EO0B 3FONA 1U3NA 4BKSC 2ZUSA 4QOKA 2YAEA 4LAJH 1MWAB 2DTMH 5I0DA 2FYYA 3S36H 3ULUH 4EIBA 3PXHA 2UY7B 3GUFA 1IQDB 4PJHE 2OI9B 5MHSE 3DPBA 4KZEH 2K9FB 4O9HL 4JHWL 3QUZD 3F83A 2JIXB 4TQEH 1EMTH 2FSDA 1FL5A 4HUNB 1XSIA 4N0UA 4P46D 4D9QE 3L4TA 5KYWA 4WGKA 1YECH 3KPQA 4O4YH 3GXMA 1EFXA 1NPJA 3FN0L 4APQB 3MRCA 3V0VB 3GMLB 4UQAA 2ICCA 3DARA 1CDCA 4CGTA 5KVGE 4JG0L 1ZJBA 3L9RB 4GW4B 4IKKA 5T33L 2Y6TE 3C5ZB 3IPEA 1AR2A 1E7UA 4PJ5A 4HKJB 3K8KA 4L8SB 4UF7C 2DWEB 3LS5L 5C0ND 2UX7A 1SY6H 1A5FL 3O11B 1HCZA 4P5RA 4DZBB 1CFNA 1E4HA 1I1AB 4J6RH 5I16B 4FZ8H 3H9HA 3ZKND 4UTAH 3WBDA 1FG9C 5G4NA 4HJ0C 2OI9C 3PWLB 3MLWL 5DVKA 3EKCA 2BHZA 4WWKA 5CZXD 3ZOAA 4QRAA 3B5HA 3DTXB 2VQ4A 3I9IA 3C5XA 4LDCA 3KPLB 1YEIH 3WO4B 2CO6B 4NQTA 2NW3A 4UQ3B 3PAYA 3CXHJ 5K9OB 4ODBD 3RY5A 3VFNA 1ZVSA 3I75A 1BOYA 2EE2A 2DTSA 2VXSL 3IDYC 1XAUA 4FNPA 4UB0H 5D5MA 4APQC 4AQEA 1RFDH 3SKNA 2VE6B 4DWHA 5CP7B 2EECA 1PD1A 4MD4B 1KY6A 2FE0A 3TN0D 1NFAA 1WHPA 3UTTB 1LK3L 2YEVB 3C5ZC 4F8PA 1WICA 2H6UA 1JK8B 2FSEB 1VIWA 5IROD 3MCKB 5E70A 3KCPB 5LXGL 3GTVA 3GJFA 5FAAA 4OFQA 4GUPB 3X13A 3DWTA 2IQ9H 2BRRH 2X4SA 3ZO9A 3SY6A 1FZJB 3MRHB 4AV4A 3BN9D 1I1AC 2X6AA 2AJVL 3CFIC 4PJEB 4MNQD 4KHTL 4LL9A 1OAUH 1EAPB 5DLML 2FWLB 4M1DH 3SHSA 4JPVL 3WKMH 5TE6H 5L88H 1DBJH 4ZFQA 4M3KB 4OZHB 2DQIH 4OLWL 2BSRA 1K2DB 3IS0X 3FTGB 3WO4C 3SDCB 2YUZA 5E94B 4QRUB 3HW7A 3GMNA 3PJSA 3T6XA 2F54A 3ZRSA 1FIGL 5AVQB 3EDEA 3T8XB 1OE2A 3QJZA 3POCA 4MDIA 2CPCA 3P73A 4HVBA 4AV0A 3HI5L 4RDQF 5HGDB 5FM5M 3VDAA 1V05A 2AV7B 3L3OA 4PJ9B 1S7TA 2C9VA 3JT0A 2HAZA 2PMZA 4B9IA 4NCC1 2APWA 2CM6A 5MEOB 1A22B 1Q9WB 2HLEB 1UKTA 4NYLA 1BM3H 2Y9RT 2L3BA 3U2JA 3GK8L 3W9EB 4M6NH 4NQDA 3T0EA 3EXJA 5I30H 3P9WB 3TWCH 1KZQA 3ZDXB 3ETBF 3MV9A 3ZZQA 2Q76B 4XNXH 4HJUA 4R7DB 4XHJD 4XX1G 2AK1L 4HXBH 5EO9B 5CIPB 3ARDC 1RD6A 2QEJA 1C7TA 1E5AA 4UOW0 2PYFA 1NMBL 4AXWA 2F7QA 2ZOKA 4IMKC 4M7LT 1OWWA 1QYGH 2R2BA 3M45A 4NB7A 2NTSP 2XY1A 1A7QL 3I50H 1BMGA 3VSUA 3AROA 1UWYA 3PJNA 1W80A 1RUAH 3IF1A 4LCWD 2TRHA 5EU5B 3LZLA 1URZA 3LJ3A 1NGYA 5T1LD 5TFSH 2MH4A 2WHVA 1S7RB 3BKCL 3NA9L 3CN4A 4I1PA 2XN2A 2JQZA 1AMXA 1PMYA 5T5NF 3QORA 1Q72H 5HJ3B 4KRMB 1MF2H 3ZKSD 3RVTD 2K7QA 4GOSA 1BD2E 1FIEA 1I3VA 1KB5A 2EDWA 4NO5B 3TM6A 3D6GA 4GRWH 4PJ9C 4AGPA 1SFHA 4U2ZA 4JRLA 5J13B 4MJ2A 5ICZB 1U4EA 1CDYA 1I1RA 5IQ7L 3MYJA 2NY1B 5BMFH 5JW4M 1J18A 1SLXA 2KZWA 4Z7UB 1CLOH 3FW6A 3SDDB 3H9SD 5LJYH 3JTBA 3RP1A 3V0WH 3O3AA 3UEZA 4AMXA 4CMMB 3BKYL 4M6AA 4CUCA 4DIXA 3HS9A 2QPUA 4OD2A 3O6LH 2P80D 5IKCB 1OSZA 3OBAA 5E1QA 3K80A 4YHIA 1F6AA 4IBQA 4MFHA 3MROA 5GGRB 4ETQB 4CSSA 1HSAA 2GJZB 2IANA 3H53A 5LUMA 3SODB 3T2PA 3UC2A 1CB4A 3WTVA 3OD3A 2W0FA 4RAVA 3HI6H 3TJEH 3UGEA 1QFHA 1XH3A 4I2XA 4N3UA 1W0VA 4O2CB 4FD0A 1AE6H 4OFPA 3BGMA 2DPKA 1P1VA 3VE0B 5DFVC 3D4GA 5FECA 2G2RB 1A7PH 4ZMWA 3FRPB 3MBEB 4R83A 5BRZA 1W72H 1QKZL 4JQIL 5CGBA 2VDKB 1JPTH 2GPZA 3BT2H 1G9ML 3OGOE 1DQKA 1FLRL 2IWEA 4MD0B 5IEHB 5J13C 2HP4A 3GI9L 1U8MA 2NW2A 1N0LA 2I7OA 4OGYL 2NY0D 4G7RB 4X5QA 1NDGA 5FV1L 5KWYC 2NY1C 5F9OL 3TZVD 1E28B 4JHAH 4YXLH 2LLLA 3RYMA 4RLDA 3SDDC 4TQIA 5CMAB 4BH8B 1AZNA 3QIUA 3MRPB 3MKKA 3U9UA 4O5LL 3OG4B 3ZE0E 2BMKB 4EOWH 1VCAA 4KRLB 5FA3A 4WI5A 4ZW6A 1SN2A 2W91A 1RZKL 2P5EA 1JI1A 5DJ6B 2A0LD 2YAHA 4S1RH 3TOPA 3C6LD 3AU1B 2B4CH 2BW4A 4ZUVB 3P0YH 5ADOH 2MTPA 3WNMA 4XE0A 5DQJA 4WGWB 2ITDB 4ALAC 1NFIB 3L1FA 2F19H 2V2XA 2F5AL 4QLWA 4FHBD 5INDB 1J1OL 4YQXL 3MBEC 1BF5A 2G2PA 4G8EB 3QJRB 1RVFH 1HHIA 1UCTA 1PX4A 1FNFA 1T21A 2D4FA 4O58L 5GZNA 4R4FL 1MW2A 3SPVA 5JO5A 3IDXL 4BQCA 4QHPA 3N40F 4P46A 1LEGB 2EXYD 2BCKA 4E9RA 5DRXA 4W9IC 4AKQA 2FJHA 1O9VA 1JZGA 2WANA 4LMQI 4M7JH 4MJJA 3ULVD 2J43A 4HXAL 1H8NA 1H15B 4KFMA 3LPFA 5CHNB 4OGXL 2GBVA 3K71A 3T0DA 3F65A 4OJCA 5KANG 4ZAKA 2A6JA 5E8PA 4X9YA 1EVTC 1VACB 3WJMA 2AW2A 3CZJA 3P4OB 1JFQL 4QJ3B 4N9GB 4HWBH 1OKEA 2YK1L 1QFPA 3RFZA 4J3OC 4NN6B 5TJWK 2ZSVA 3DGCR 3K2KA 4X83A 4ADJA 3O6FD 1DJGA 3DTUB 2R56L 3BSZH 3PQYE 4ZRGA 2WINA 3V9EA 5I66B 1EUTA 3V4VL 3EJCA 5HDBB 3GNML 2HVBA 1MFDL 1W8EA 2B2XH 4HPYH 1N3NA 3B7UX 4WDIA 5FYJH 1A0QH 1AO7D 3P9MA 1LO3H 5IMLA 3W5NA 1HJBC 3G6JF 4JVWA 2Z92B 5D7HA 2HT4C 3Q5TA 2G2NA 4LHUA 3NZHH 1KGUA 1KBPA 3MJ6A 4S0SD 4F7MA 3ESVF 2HCZX 3QHFH 1AH1A 1Z6JT 1T7YA 1NM9A 1O7SA 3O8XC 4P06A 3S35H 3W5MA 1WZ1H 1B6UA 1Q1JL 4P23A 1LQSR 4HIXL 2UY6A 2GSMB 4EDXA 3RWIA 3FUEA 4LLUB 4MWFB 4OQTA 1Q90A 4F8OA 1ZXQA 5AW7B 2B77A 3HUJA 1RCYA 3KDPB 3AY4A 3P2DA 4HEMA 2ZXQA 3PWVA 4OIAA 3WUWA 5ACZB 5A7BA 3GRBA 2CGRL 2UZXB 5DJCB 2AXGA 1PQZB 2JI2A 3KPRA 2GTWB 1T22A 3QG6A 2NSQA 3L81A 4PJ8C 3U1SH 3VXOB 1E9OB 1F3JA 2R29L 4BQ9A 3BYTA 3QQXA 3SBWA 2ZXBA 3QH3A 1UEYA 3IFNL 3WIIH 1UH2A 4N4YB 1C7SA 2NZ9D 2P24A 3HPJB 4B3VA 4I1NB 1BX2B 1ZXKA 3SB3A 1JFHA 3OAUH 5KYXB 4M5TA 1CG9A 3E3QC 3S4SA 1WSST 3CVDA 1CFQB 5T1MB 2OMYB 5EEUA 1DSWA 3QPXH 4Y8DC 3L9BA 4Y9BA 3G08A 4QJ4B 1GYVA 3KXFE 3P77A 1TQCC 2WBKA 4M4RA 3MNVA 3RDTA 3HZYB 2DL2A 2KMWA 4TUOA 1BZDA 2JK5B 3PNRB 3FDWA 5EZLB 3OKYA 4WFGD 3FUNA 2L04A 1G94A 2Z35A 4J4PA 1MAMH 5E1GA 1JGUL 4Z77B 1O0VA 1GKEA 3CIQA 1OT1A 2H41A 2NUTA 3RBSA 4G59C 4PWFA 5L4JA 4NZUH 5J4MA 3L3DB 3MLPA 4NC1C 2K4AA 2GAZB 5JLZA 3C9NB 2LTQB 4E42A 4KQ3H 3K1KC 2W60A 2Y5EA 4QTIH 3GSQA 2H6OA 4TTGA 1BZ7B 1ND0A 2XJLA 4FXKA 3WIHA 3ZR6A 5GSVA 3CFJB 3FOLA 2BNRE 5IG7A 5SWSA 3KPOB 2EVGA 4LKCB 4LSVH 5IQNA 9PCYA 3B2MA 4HFUL 4ZUWA 1SDYA 4J2XA 4X7TA 3GFUA 3QVAA 4KKBD 4AL8H 5H35A 5IUSA 3OKMB 2ESVE 2YPVA 3MRKA 4XVUD 3HZMA 1KCUL 3MFGB 2WWNA 2Q8BH 1Y6KR 1A6AB 1HOEA 2GCYA 5JPNA 1JSYA 1TJIH 1C5CH 4R3SB 4DH2A 4PJAB 2GG1A 5HYSA 1JNLL 4KUCD 1PG7L 3NIGF 4DKDC 3MRLB 1RZPA 3U7WH 1NKGA 5HDOA 4XCCL 5I1AA 4PGCB 3QT2A 2G3MA 5T3XD 2WAQA 4ZSOA 3NJVA 1W16A 2COQA 1MHHA 1R17A 5ETUA 2LTQC 3OMAB 4DKEH 1RERA 3CXDH 1DQMH 4Q56A 2WBJA 4XB7A 1ANUA 4Y4FB 1N67A 1U91B 3HE6B 4G6AC 1V7NH 2VDLH 3GXPA 3U79A 4CILA 1IKFL 1RJLA 2A1WL 4UDTA 2C26A 5DRNB 5EU4B 4BFGA 1I85A 3JSSA 2D0HA 3PWNA 1FPTH 1XZ0A 4GKNB 4JKPH 1BZ9B 1QFUL 5L2KE 3Q2NA 4RQQB 1CICA 4LPYA 3L3IA 3Q48A 2EXTA 3MRDA 2OXGB 5J06A 4NNYB 3AS2A 1RZ7H 4YPGB 5AOLA 1DANT 1L9MA 1Z2KA 2Y23A 5ANMB 3W2DH 3MV8E 4F5CE 1BMWA 1LEKA 4YHNB 1GOGA 2XX1A 3MRIB 4ISVA 5GGVH 2DIBA 4D0CA 4TNFA 5AW8B 3WIAA 1I3GH 2IFFH 4WEBL 5D7SL 3L3KA 3CHQA 3OKEB 5LGHL 5JW3L 2AGJH 1I53A 1ZA6A 3UTSA 2XWZA 5F8RC 3EAKA 2NRDA 2LHAA 4X4ZA 3P0GB 1DJXA 4D9QD 1DJHA 4HAGA 3OAZH 2P1YA 3K2UL 2WIIB 1A4CA 1MNUL 5IB4A 1CXLA 1U8JA 2R9HD 2WKOF 1MVUA 1S6NA 3B2VH 1EEZA 3EJZC 2RFXA 3P30H 5JHAA 4PJ6A 2DYRB 4JY4A 4OKVA 3ISYA 5FUZL 1YMME 5C0EA 4DJMA 4Y4FC 1BQHB 3HE6C 3AMKA 3BP7A 1SJEB 4KQ4H 3VFUA 1QI4A 2JQMA 2DWSA 2WVUA 3L5XH 4QYAA 2Z8WC 3FTWA 2DQHL 2MRYA 3ROOA 3EDJA 1IC4L 3I2CH 4J6IA 1RUMH 3HMWH 4YLCA 1JZ5A 1F4AA 3T0WA 3WXWH 4F80A 3DI2B 4HKZA 3FQRB 4GS7B 4TUKH 3UADA 1CLZL 1D5XA 3NSJA 2XWEA 4YL4A 5EC1A 4B60A 4S1QH 2COVD 3ATEA 5LAXB 3VI4F 1ESOA 2NTFB 4H1LA 5CWSB 4GG6E 4QKTA 3C2AH 1U8NA 3TO2A 5EC2A 3LN4B 1J8SA 3T0EE 3O3UN 1N18A 4WKZA 3CBRA 4CKQA 5B1JC 1A6VL 3QCTL 1N8ZB 3OPZH 1DVUA 5D7IB 3A6CH 4YDIH 4OAWA 1FDLL 1INDL 4X5XA 4UT9L 8FABB 3EGSB 4OM1L 1MI5A 1THAA 4I7ZC 4QRSB 2P4AB 1RZKC 2UYLA 3CFQA 4U1NB 1LP9B 3QDGB 4GP8B 2EO1A 3V4VB 4NZRL 1AQHA 1PDKA 5FYJE 5K9QG 3GDBA 3QYMA 2Z7YA 3D12B 3F7VA 4HLEA 2ERJB 1JTOA 1UVQB 1EXUA 5J6HA 4L29B 3GTTA 2G75B 2OW6A 3IAPA 3OKDB 5E6IB 3RTQC 5IVNA 4F27A 1KT2A 1W15A 3JUZA 4GSRA 4GS7C 4L37B 4FA6A 3QQ4A 2ITCB 3MJ9A 4FFYA 3U46B 4FJZA 4M43H 4OI7A 2QPSA 2ZP9A 1KXVC 2I5YL 3B8YA 3LHAA 5GISH 2JIXA 2G9HA 4GSDH 5CJXC 5C0RL 1AO7A 2JELH 2W07B 5AWNL 2X2UA 1K5NB 3O3EB 3CHSA 1DUYA 1DVXA 4HGMA 4K4KA 2CO1A 1CVRA 3GMMA 3KLSA 4PJDB 1DVQA 4PM1A 4APQA 1SXNA 5BZXA 1Q9KB 1XQ4A 3QJVB 2X6CA 3GMLA 3L1EA 4OGZA 2PWHA 2W59A 4G7QB 3EYUL 2OM5A 1Q1PA 2CHDA 1YAIA 2YPLE 3C5ZA 5LGKA 3DUUB 4RX4A 3QHTC 2OCFD 2XZQH 5DTFA 1B4TA 3V79C 4Q7DA 3BH9B 2DWEA 4X5LA 1I8IB 2YAFA 1J8HE 2ERJC 4DZBA 2FWOA 4P3CL 3HLAB 2X41A 1CK0L 5E6IC 5TQ0L 5I16A 1JPFA 1MG2C 3BMWA 4Y5XB 2MEJB 2BS8A 3TLRA 2AJSL 4IRZH 3S5YA 1YEHH 5L2JB 2EZ0D 3KNBA 1MCSA 1IGCH 3IJEB 5IIEB 4UNTA 3WG7B 4AG4L 2OSLA 4MX7B 2XWBB 4Z76B 3G6DL 1FNLA 2ADGA 3IXAA 5K9OA 1FO0L 3ZTNH 4URTB 2ID5A 4IOSA 1IAIM 5C6PB 3DSNA 3RUGF 2EEXA 2N7SA 2VUYA 2VE6A 2Z6FA 5CP7A 2IPTH 2VMDA 1OTTC 2CCLA 4LGRB 2DQTH 1X4XA 3ZGIA 4MVBD 1UT1A 5INCA 2CJUL 3ARGD 3IXTA 4FQXD 1G7PB 2WC7A 1JK8A 4OIBA 2FECI 4X8JB 3EH2A 3MCKA 1S3KH 4JL1A 3ECVA 3O2VL 3KCPA 4IYKA 3UTZB 1CTOA 1T5WB 1NCCH 1FYTA 2BFGA 1AKJA 1I4FB 3OJDA 3TF7C 1WK0A 5GRXG 4W6WB 5ES4B 5C0CB 1B3JA 1XGQA 1EQWA 1E8YA 2BXZA 2FIRT 2YMTA 4QY8A 4Y5XC 2F68X 1CLYH 1NGQH 3SPCA 1MEXL 3ARDA 4AZ8B 5AUMB 2WNGA 4LEEA 3ATDA 2VUOA 4RMUA 5I1EH 4CSTA 1I9RL 3T0VA 5CKAA 1OPGL 4DVBB 4XVSL 1ACZA 1NEPA 4G1EA 2R0KL 2ZAHA 3H6AA 2RH0A 3G6AA 3WS3B 3J27A 1ZTMA 1PLBA 1QA9B 2DN7A 1F2XK 3T8XA 4AEFA 1PX3A 3SDYL 4AM0A 2EXSA 4ODHH 3QJSB 1IILE 1SYSA 3RWDA 3VGBA 2DWDA 3FFDB 1MQKL 2IO5A 2Y6SD 3HG1B 5HGDA 2XRAH 2FD6L 4JO3H 4UILH 2HX7A 5HI4D 3TESA 3L3HB 5FB8B 4PJ9A 3MGTA 1OF0A 1AKPA 4EMZA 3AM8C 5LWYL 3HS8A 1KN4H 1KCSH 1Q9WA 5E5MA 1X9QA 3TH3T 3APMA 4V1DE 4JY6B 4S11A 4G11A 5EOCH 4YIQB 1HE8A 1GY1A 1UOLA 2UV3A 5CCHE 1KGXA 5IJCC 1NCUA 5IHHA 3FT2B 1MWAH 2ILLA 2OJZH 2BZCA 3AG2B 2YJLA 3APFA 3O6KH 4KK5D 5CIPA 5EO9A 5A3ID 4YFEA 3I9AA 4L3EB 5EMYA 2MMXA 1JZJA 2FX9H 1T1YB 4S1SH 4UMSA 3ML9A 4ODVH 4HF5L 1TZGL 4QHNB 3ULUD 4UQIM 1XDTT 4YN3A 1T4KB 2JLPA 4L4JA 4UI2A 4UU9B 5EU5A 2D9QB 2PP8A 2P8LB 5SX4I 1S7RA 1RL1A 4ZMXA 1NH6A 1CDJA 2NR6D 3GO1H 2X6VA 5D7LB 5HJ3A 5IQOA 5ITBL 1UATA 3VQ1C 3O3BB 4BJLA 5DVNA 2J20A 4H20L 4FQ1H 1HILB 4NO5A 4PRBB 5AEAA 2XWTB 5E1IA 1THCA 4R7XA 2PTUA 2JKJA 4WUUE 4MS8C 2MNWA 2CHXA 3DX9B 5C0DB 4PJBB 1BFTA 1YPZB 3UO1H 1CGSH 3DK2A 3B9KC 2GBTA 3ZSSA 1XX9C 4L18A 5AL0A 3FQXA 4JFHE 4Z7UA 4DUXA 1E6JH 2PO6D 3APDA 3SDDA 3LX9A 4H2CA 1MFUA 3OLEA 5JHDE 5T1KB 4BK4A 4CMMA 1UKSA 4JFYB 4F9PC 1F4WH 3WEOA 2X4NB 3VRIB 2XICA 4B50A 3FCGA 3V4PH 5IKCA 5MEQA 3FB7B 5C8JB 4PWHA 3AG4B 3QI9C 4ETQA 2EKJA 1RUPH 4M7LH 4PHZA 4N25A 5E99L 1JD9A 5F3HB 4JRYB 1MIEL 3CFDB 3DLQR 1PSKL 1ZLEA 1HHHB 3HRPA 3B3IA 3ZHDA 4O2CA 1QOKA 3F2LA 1MFMA 4N8CL 5I9QB 4EUPB 4WHTA 4FF9A 5DWUH 1P4UA 2DQJL 1N7MH 3BEWA 1NAKH 3JYBA 4TTDD 4KTGA 1UD5A 3V52L 3PQYD 3MBEA 1B4JH 2ZOTA 4XPAL 2IPKA 3BUQA 2D3LA 3CN2A 3BRDA 1GIGH 4QRBA 1OLLA 3D3VB 3OR7B 5IEHA 4A66A 1QNIA 2AK4D 3EW3B 3SO3B 4G6ML 4G71B 1MJ8H 3MXVH 1WWBX 5AAMC 2WLLA 2VLJB 1E28A 1CFTB 2WYZA 2NY5H 4H13C 3D1MC 5E0QA 5CMAA 1QPXA 4QNPE 3D39B 4UT7H 3FT4B 4XX1E 1IUZA 4N2OA 3N91A 1FE8H 1NAMH 2BMKA 2ZUYA 4XRCB 4U6XA 3O6MH 3OQRA 2GBAA 2VR5A 1B9ZA 2GT9B 1KCVH 1E4WL 2EUZA 3HE7D 3IRZA 1JPEA 5B3JF 1CO1A 4D7PA 5I9QC 2AQSA 3CFBB 5JXEC 3NCWA 4OJAA 1JS4A 3FC8A 3MRNB 2CZNA 4BHUA 3NDZE 1LTXA 5EIIB 1J86A 5A6IA 4YFLF 4W70A 1MCOH 2A77L 3C8DA 3NDYE 3S2CA 1MH5B 4JRFA 1IO4C 3QUYD 1WC7B 3B9AA 4DOHE 3MRMB 3R06B 4LVEA 1MFBH 3O45A 4ODUB 1YUHB 4QXVA 1LEGA 4P3WA 5E2WH 3SO3C 3MKGA 2W81C 2Y5TB 4LRNL 4PJIB 4U0RB 2EDKA 2Z4QB 4UM9D 2W88A 4U6YB 3O8XA 1FZKB 1MLCB 1O6SA 3BESR 5EBWB 1JDCA 4WSGA 5KN5A 4WWOA 1F1AA 4CGUB 5EDSA 2Z1KA 3VD5A 1F42A 1VACA 3KXFD 1WZAA 1YNTB 2WTPA 3FHAA 4MXQC 2AQQA 4N9GA 2NY7L 3ZHKA 2IG2L 3L3JB 3OF6A 3O2DL 4FADA 2OR7A 4YMPA 3HB3B 1H0DB 5IM7A 5I66A 1DSYA 1FO0B 4PJ8A 4LIQL 4X9HA 5F2FA 2ZKXA 1GGYA 3K2MC 3RVXC 3WHE1 4ZX6A 4NPKA 5E8OB 4RGOH 2N0KA 5GJTL 3ATAA 1MCRA 3SGDH 5EU7E 5I15L 1SN0A 1W0WB 3TO4D 3RAJL 2XC8A 4KK8C 3VXTA 2Z92A 2Y2WA 2PPCA 3G04B 4KVPA 1INQB 3K6SB 1LO2L 4GKZB 4ZD3H 4AL8C 1N5YH 5IW1B 3WD5L 1J9TA 1HYRC 1XD0A 4XCNB 4ZS6C 1OM3H 3OXSB 3RX7A 4U0RC 4OF8A 4RFNB 1M2VA 1VZGA 1O6VA 5F9JB 1OF2A 1VB9A 3NP3A 1M05B 1WZLA 4KH2A 1F41A 3T2OA 4AUUA 1G6RB 3BFOA 2ESVD 3FUDA 3P11H 1JCVA 1S2EA 2HB0A 4L9DA 2OMBA 2DM4A 5GHWH 5LDSA 2A6KB 4GUQA 2ATKA 2NY4B 3MCLL 1KGIA 4J5VA 4PCTA 3UABA 4JRXB 1NICA 1NWOA 1MFAL 2WSKA 3CDZA 3HNTL 4NBYB 5HYEA 2UZXA 2WQXA 5DJCA 3HB3C 4ZTOH 1NSNH 2VDRH 3RVVC 2GTWA 3VXOA 4ZTPL 5AYQA 1OVZA 2H0EA 1E9OA 1YEJH 1AQKL 3B5TA 4N26A 2WXQA 4D9RE 3D87B 3NESA 1CE6B 1XH1A 5K59E 1MRDL 4WU5B 1JYXA 1LQBC 2X38A 1IGJB 1OL0A 3BZ5A 1CXEA 3R1GH 3HPJA 3WI9A 2Z64C 2Y7NA 3TTYA 3QCVL 2EDBA 3IN0A 4ADIA 1CFQA 3SOBH 4F2ME 2E7BA 2NYYD 2YXMA 1GYWA 2OMYA 3Q9QA 4Y4HD 5DD5H 4JM2C 5T1MA 3VXME 2R1WB 3ILQD 3O4LB 4RFNC 5L2KD 4Z7OB 1FNSL 2H32H 2HTKD 4JDZB 4O2FB 4JQXC 3VI3F 4QRFA 2E7LC 2GJ6D 4WFEE 2NXYD 4EN3B 3HZYA 3SDAB 4Y7OC 4HGWB 3V5DB 5D6DC 5JYMA 2JK5A 5EZLA 2BS9A 4L2LA 2V9UA 3MV8D 5ENWA 7PCYA 4FG6C 4HC1H 1QRNB 4WO4D 4G6KL 4Q2ZA 4O9HH 3MJ8A 3WKQA 5FLVA 2EE3A 2V5TA 1UWXH 3DMMD 2JJUA 5EOCJ 2P46B 3Q9PA 5HGHB 2E5EA 1QSFE 2FUQA 1BVKB 4HZLA 4KXDA 2WCSA 3SJVA 1T5XB 2D7MA 4Z7QB 5EWIH 4ZW8A 1SXCA 4DEUA 3H8NA 1SN5A 3E6HB 2QDWA 1EPFA 3NIFB 3ABKB 4JO4L 1BZ7A 4YHPB 5HHME 3TCTA 3UL4A 3FN0H 2VMEA 2WQAA 2BXYA 2J88H 2VQUA 1HK6A 2Y06L 4N8VA 1BXVA 3B7SA 2WQ8A 3HC3H 4LKCA 3C5SA 3CVIL 1YZZA 5DDHB 4L0ZA 1JK9A 1GTFA 3UBFA 5T33H 3DGGB 4AYFA 2X4TB 1OCWH 5DK2B 3OKMA 4HJ1A 2ZYSA 5F7LB 3LS5H 32C2B 4JKMA 3HC4H 3D34A 2PYEB 2HWZL 2XA8H 4LEXL 2OL3L 5LDUA 3FMGL 5DJAA 4MA3B 2ZWKA 4TRPL 3SDAC 1TFHA 5DS1A 5GGQH 2OK0L 3N1GC 4R3SA 1CL7L 2AI0H 2YC1B 4I87A 1Z3GL 4JZNB 4PJAA 3MXWH 2JKTM 5GRUH 3I9PA 1OZTG 4AQAB 4QR7A 4Y9FA 4DK3A 3LZFL 2VABA 1PBYA 3MRLA 2VL4A 3F12A 1SUJA 3N44F 3VXUB 35C8H 1DJIA 4LLDB 4PGCA 2O61A 3K6NA 1YNKH 1P84K 2MOVA 1ZV2A 2QQLL 1WWAX 2CGYA 4CL7A 4A04A 4AYDC 2A7BA 1BLNB 2YQBA 4KZ0A 2QQQA 5G5DB 2I27N 2W1NA 2PO6A 5F7BA 1FSKB 3LRKA 3QUMA 1JZ2A 5JNYB 4WJKB 2D2CC 4Y4FA 3HE6A 2VXSH 2VMJA 4IOFD 3PP3H 1UA6L 1YYMH 3NRFA 4FLSA 1HC1A 4GKNA 4DZ8B 2AABH 3IWUA 3UTTE 4JQIA 4RQQA 4K7PY 4F7EA 2VSDA 1BP3B 2EXWC 5FYJD 5DZ9A 1ZHBA 2OXGA 1A14H 4NNYA 4UTAA 1DVFB 4LLVA 2CK2A 5I2IA 2GI0A 2MQ3A 5J7CC 5CU9A 5HI3D 3TT3L 1YY8B 2QZ5A 1GVIA 1A3RH 5H37A 4NO2B 1AYOA 1XV8A 2R1YB 4FG0A 4YHNA 1SBBA 1VFOA 4XN9A 5C07E 3MRIA 3Q2LA 1Q38A 4FFWC 5DZLA 4IDJL 3TT1L 4PJEE 2BOCB 4MXWL 3OKEA 5E6YA 3MQIA 5B1JA 4JO2L 3FU0A 4KC3B 1FBIL 4KK6D 3BUDA 4G7SB 5IVXF 1N2RB 3L1GA 3C09C 4YEFA 1VF5C 1DN0B 4OZHE 1FL3A 5BOZG 2WIIA 3DDGA 1GSMA 5AD0B 1HEJC 3AY2A 4OLWH 1S9KC 4HZAA 1JXJA 3SGEH 1VHPA 3IN2A 4KKPA 1FSKC 3M1CA 2IH1B 4DGWC 1G7HB 4YPJA 1HL9A 2LU3A 4PP2A 4ZUUB 2PR9A 4XHQA 2YPLD 3HAEG 4ZBJA 4AV5A 1WA0X 4HU2A 3V95A 1M7XA 4WEUD 4E9XA 1GGBL 3TBYA 3RTQA 4M48L 4LSDA 2VXQL 1J8HD 2AKRB 3UIZA 1DVFC 1JZFA 3FQRA 3P40A 1MKFA 4R0LA 2DOCA 2Y25A 2Q3XA 4UOQA 4XO8A 4CSZA 3ZU8A 5LAXA 1U3YA 1KXVA 2GFBB 2NTFA 5CWSA 2VLKE 3N41B 3KJ6H 2YPKB 3MCG1 1MCPL 5CJXA 1B0GA 4PFEA 3BJLA 3GK8H 3PF2A 1ES0B 4XBMA 1KGCE 2VUKA 1NFDB 5L9DL 3LRLA 3OAWA 2MQCA 4QD2E 5GS0H 4XWOC 1N8ZA 1OTUD 2AK1H 2X1XR 3TIEB 1UXWB 4H8UA 4OCLC 8FABA 3UAJD 2IF7A 4K5OA 5LVEA 3F7PC 3MV7D 1A9EB 1A7QH 3HHMA 1ITBB 2FATH 2VDOL 3ZDYF 1JPSH 4U1NA 5DA0B 3QDGA 3RI5F 2HSIA 1U4FA 4HETA 5E08L 3FN9A 5LG1A 3VFGL 4AVHA 2AEQL 2JFCA 1KULA 2YBRA 1JZ7A 2XTSA 5FK9B 5EV7A 3FCBA 3Q8FA 3VVVA 3RGVB 4L29A 2X0WA 4EIGB 3Q01A 4ZX4A 3G5YB 5JW4R 1IVLA 1CE1H 3F84A 2WLKA 2VTFA 4L1LA 1PX8A 4NJAL 3RVWC 3U46A 3QISA 4RDQG 3LXAA 3WFDH 1QEWA 1S9WB 1AIFA 4Q97A 4JDVA 2J6EA 3BVTA 3SKJL 2YD1A 5HDQL 1UUSA 4G8GB 5A2BA 2N01B 4I5BB 3MUHL 2VM3A 5HGBB 4JFFB 4QIRA 2Y4SA 3VWJD 2AFNA 2W9DL 1X5ZA 3IDJA 3BKYH 2JKWA 4PJDA 3V10A 4EDWL 3FZUC 4YGVB 2BVTA 2ROYA 3BP6B 3IS1X 3LKPB 1UA3A 3IJ8A 4KTYA 4MBOA 2OS7A 1EUUA 4ONHA 1TPXC 4P0DA 3TWYA 1BZQK 3DUUA 4NJ9L 4MHHI 3D85A 2PTTB 5KSAB 3PCYA 1FZMB 1RIUH 1U2YA 3MN8A 5FR3A 3IPBA 1I8IA 5I17B 4CC4A 5DFTA 5EULV 3BP4B 1C08A 4Y1AB 3ECWA 2XXFA 1QKZH 2CDEA 2V4LA 3RGVC 4EKXA 2XTJB 3PHSA 5FA4A 4MJ6A 2PCFB 4I0CC 4C56E 1S7XA 2NPLX 1CD8A 1I7ZB 1G9MH 3F05A 5D2NB 4Y5XA 3HVNA 1FLRH 5T5NG 4V1DD 1ECZA 4HGKC 4UWQB 4BCZA 5CBEB 2DI7A 3IFLH 3AS3A 4WIQA 1UUNA 5DZNA 3KBFA 4IGBC 1UM6L 5FIEA 1WE5A 3K6OA 3IAGC 3IJEA 3FQWB 4R26L 3VG0L 4UAOB 4KJWC 2CUMA 1JN6B 1L5GA 4O5LH 3QPQD 5AKRA 1HXMB 1VCBC 4L4TB 2FB4H 3NFNA 1QFWL 1A6UL 3SD2A 4XP5H 4JUTA 1W72A 4UQ2A 4JANB 3VYNA 4MJID 3KM1A 4U3HA 3FB8A 2QQNH 3UJIH 4DN3H 2GJ6A 3GINA 1ZGLP 1G7PA 3F00A 4E41A 5KSAC 1OGTB 3NCYP 3QG7H 3L4XA 4K7PL 1JXKA 3BDBA 1FG2B 3GXUB 1T5WA 1Z9MA 2F5AH 4XVTL 3MNDA 1COBA 1HS6A 3US9A 4YQXH 4B9ZA 3CZUB 5DMGD 5ACLA 3E9TA 3TEUA 2XTJC 2YGQA 1UA7A 2ORBL 3MZTA 5ISZB 1AC0A 4YR6B 1XSOA 3WXVL 5D2NC 5B39B 5JDJA 4O58H 4R4FH 2CKNA 4YVNA 4XPHH 1JV5A 3FU5A 2A9BA 4PN6A 1PNDA 5AVRB 5AUMA 4PGJA 5JHDD 3LXCA 1AZBA 4R9HA 1DBBL 4DVBA 2OL3B 4HXAH 4U6TA 4EO5A 4FHKA 1WTLA 2DYPD 4R5TA 4UAOC 3B5GA 5A7EA 4PLKD 1AY1H 2NY6B 4JFEA 3WS3A 5T3ZH 4JFDB 4C57C 2ZPKL 1WITA 2FTAA 2P5WE 2IXQB 3KPMB 2YZ1A 1IC5L 4NRZA 2WMPA 3GGWB 1CJYA 5JQ6L 5MEND 4BFOA 2FQDA 2FBRA 2R56H 2DS4A 3F3HA 4MA8H 5GRVK 5SWQA 3L3HA 3LKRB 3I84A 5HDBE 4PU2A 3V4VH 5A1AA 2BVQA 2ZX5A 3GNMH 3QUGA 1QR1B 5IJKA 1MVFA 2BHYA 1YEGL 3BAKA 3KL3A 4N0RA 3B9KA 3TYFB 3GS7A 4BZ1L 2PCYA 1YEKL 4LCYB 2EDMA 4M8VA 2HTLC 3MLYH 3L4YA 4JY6A 4N2HA 4UQ9A 2CCWA 1LLAA 2YD5A 4HSQA 3GLZA 2ZSWB 2CO4A 4LPXA 3E3QE 4WTWA 5KSBF 5F1NA 3FT2A 1GGCL 1ZV5A 4LLQA 2G3ZA 4F9PA 3GJEA 3G3LA 1NEZA 4KUZL 4ECNA 2A73B 1XF3B 2AXHA 5FOJA 2CLZB 4L3EA 2QVFB 2ZWNA 1T1YA 3QI9A 3TA3B 2R2CA 5J12C 4ZUSB 1DEEB 1D7DA 2XBDA 1XGRB 3ARXA 2FEEL 3IJ7A 3LVEA 4RGND 4Y4KD 3FO9B 4WJG3 2DLTA 3AC0A 3VFWB 3EJPA 3KPSD 3ALXA 3V7AG 4UU9A 3S36X 1B0WA 1MZZA 2B5IC 1XIWD 2XQYA 5E1AA 4ICXA 2Q2LA 3E9UA 4LLYB 1X5HA 3ILPA 1BQUA 1JP5A 2J1ZA 4HCGA 5A43C 2X9WA 4PRBA 2WQWA 1X7SA 1AQDB 4RBPH 4UT6L 5C0DA 1VGEH 1XB3A 1S78D 4PJBA 1YPZA 4HQQL 3KGSA 3QHZH 4J3UA 2OX5B 3X3GL 2V5YA 2YEQA 5AAMA 1RK7A 1GMIA 3HPLA 1XCTB 3OHXB 2OTPA 1Q0YL 5TPWL 2HX8A 4OF0A 4WQOA 1FGNL 3CLWA 4OGAC 1IL1B 3JWNG 3VGAC 1X9RA 3LV3A 3VFPA 3CSPA 1ZHLB 2JMRA 5F72S 2WW8A 1B0IA 3NA4A 3VFOB 3M8OH 3QDME 5DEGB 3VRIA 5C3IA 3REWB 1GHFH 1MY7A 1O7VA 2ZAGA 3FB7A 3N9GL 1T2QL 2FBJL 5EA0L 1I75A 1UYWL 4LKXB 5HPOA 5FDWA 5AZ2L 3TBVB 1CQYA 1RZQA 4JRYA 3CFDA 4JGJA 5H4ZA 4QHMA 2Z8SA 4IOIB 1HWWA 1HHHA 2CCVA 4AITA 4W9HC 4EUPA 4DUWA 1S7VB 3A5VA 5JXEA 3HR5B 2H2PC 2NT0A 1IBBA 2XQBL 3KPNB 4GFXA 4UOJA 4N87A 3QEHB 1ZT7B 1G4RA 3T8VA 2F9BT 4UT9A 2ZKHH 5IFJA 5KYUB 3IFPB 2XN9E 4H2AA 1KUMA 5EZJB 3SN6N 2Q0ZX 2VDOB 3M46A 3OR7A 4PS4L 5KSUB 3LPGA 5F1IB 2AS5M 5KJRH 1L7IH 3BI9X 3F7YB 2WXRA 4N2DA 2OMUB 5I0YA 3LNIA 4P4KD 2UXVA 3KEHA 5BS0B 2OTWB 2VLJA 5IR1B 4OI8A 4ANWA 1EK3A 1CQKA 4GAYB 1L9RA 2IBBA 5J3HC 4ZFZB 1XF2B 2QVTA 4Z7WA 3KYOB 5HGAB 2ZWYA 3D39A 4J1UB 3VJ6B 4MCZB 3ILEA 1DQLL 3TYGL 3MV7A 4X7DC 4HFUH 3FTZA 4LSPL 4LEOB 1ED3B 3H0TB 3BWAB 2NXZB 4NNXA 4E9LA 5KTEH 4RAHA 2J8UB 1DFXA 1KCUH 5ADPL 1OV8A 1MXGA 4OZGF 1X6NA 2WYHA 1TQVA 3VW3L 1Y0LB 1LM8V 1PG7H 3CFBA 3QUXB 4P5TB 4AIZB 4U6VL 3VQ2C 2CBOA 1LMKA 3ZZ1A 4OF7A 1XHHA 1S7SB 5EIIA 3GSNL 4OLXH 2VDPL 2WTRB 3LXUX 4Y2DD 2OV0A 4HH9B 3O81A 4D9RD 2CJ3A 4FTVE 1KLUB 3WCYA 3R06A 3FF7A 3UYOD 4ODUA 1YUHA 2DQCL 1PJWA 3GSUB 4Y2LA 4PJIA 3UMNA 3LKNB 2Z4QA 4R90L 5IJVB 1OP5K 4E5XG 4GY4A 1MLCA 2DLHA 1HH6A 5EU3B 4AYMC 5EBWA 1QAWA 3B43A 4PJXF 3L08A 4C58B 5IB1B 3KLHC 3BKML 3VXMD 5I6NA 4HKBB 1KPVB 2DB8A 2W65B 1TO4A 1HOCB 3G7TA 2YQ3A 2WAHA 1YEFL 2AJXH 1JWUA 3C6EA 4J27A 1YNTA 2NXZC 2JI3A 4WFED 2V3EA 2MSPA 4OLVH 5ANME 2O6CA 3LN5B 4FKEA 2DEYX 3L3JA 1HX0A 3MJ7B 4ES9A 3UX9B 2XI9A 1ZWIB 2XPYA 4LASL 1TU2B 1H0DA 4OD3H 4WEBH 5TDNB 5D7SH 2Q8AL 1EHXA 5LGHH 1RIVH 3QUXC 4P5TC 1HNYA 4YBLC 4RVBA 3FOMB 4F58L 4JL2A 1QSFD 2EDTA 1KWGA 3VU1A 2XHNA 1W0WA 4NIKB 3REVB 3T0AA 5FOBB 2O5ZL 3IU4L 3LVTA 4FCAA 1L0YA 1INQA 5E8DH 1RHFA 5HHMD 3K6SA 5FO9B 2X7LA 2RQEA 5IW1A 4ZZFA 4WWPA 4XCNA 4JM2A 1WGOA 1CYGA 4C83A 2YN5A 4HOZA 5JQHC 3EFFB 4JQXA 5F9JA 4PD4K 3PDGA 2E7LA 4OD1L 2XACC 1Y7VA 1M05A 4GKSA 4FFZA 4GQ9L 1IC4H 5D6DA 1G6RA 3FU9A 2VC2H 4MJIA 5DZPA 3N55A 3BWUC 2JKXA 4FFTA 5LGJB 4OCSH 4XXWC 2QKIA 4BFJA 4F7TB 1M6OB 1QSEB 1FL6B 5F7EH 3UPRA 2Z1PA 3GXDA 2CLRA 4Q6IB 3K81A 3B2DC 3DV4A 3FCTA 4CN4A 3GI8L 4JRXA 1Z5LB 3GHPA 2FYVA 5AW6B 3MDJA 4YX2L 4ZNEA 4GIOA 2YUWA 3PWUB 5T3ZE 2TSAA 2D03L 1Q94B 5D7IE 4B27A 1CE6A 4WU5A 2QPDB 3QIBB 3FRUB 3AXIA 3TBWB 4XBGA 1IGJA 4GAGH 4ERSH 1LE5B 3BUBA 4F1ZA 4H8WC 2ATPB 4HWZB 1LP9E 4F9LC 3IYLW 3EUUA 1QI3A 4A67A 5HD8D 2EINB 5CGTA 1JD7A 2OR8A 2YSTA 3B2UC 5K1NA 4G8IA 1DQIA 4BM7A 1DBAH 1M3JA 1SVBA 3NTCL 2EDJA 4PYGA 1HDMB 4JG9A 1IGTB 5E2VL 3SDAA 5F70A 4KJQC 3S3SA 4L0YA 3PHOB 4RAUB 3CFKB 2IC2A 5MENA 5C07D 4FXLA 3ARFB 5A6LA 2GYSA 4GXUN 4Q6IC 1VESA 2I5YH 1BSIA 2JB6A 2UXGA 2QVKA 3SDXB 1HKLH 5FXCH 1HYSC 3BDXA 4FQIL 2VWEC 5KYYA 2EIKB 1G7LA 2WNWA 3I3BA 4JCLA 3E6HA 3ARPA 4LSQL 1IJ9A 4MDRA 2EVHA 2LE9A 3SDCD 3QIBC 3U2IA 1TT6A 2ZP0T 4Z3JA 3V8CA 4HK0B 1UD2A 3U0WL 1RJZB 3B37A 1TKWB 4YDJA 3MRRB 3W0WA 4ICWA 1O5DT 3DGGA 3DK0A 5DK2A 3KPSA 1GCYA 3RG1C 32C2A 3QEQB 3U9PL 3GD1C 4F7CB 2ICWB 4TVPL 2DM7A 2JXMB 1TQUA 4MNHA 4A2FA 1AGBA 3D30A 4P3CH 5A16B 1XB6A 1OAKL 3W37A 4YJZL 2BCMA 5AOIA 2CRMA 4OU3A 3EH1A 4XMLL 3S3BB 3VXNA 3Q1EA 2VLKD 3ARFC 4N28A 4NQEB 3RX9A 3AACA 4YSEA 2F1EA 4WW2A 4RFOL 2AJSH 1UZ6E 3LIZL 4ELKB 3N42F 4LLDA 5TF1H 1KGCD 5FKPA 2ZX8A 3PWJA 4PREA 3ARBD 4XPBL 4UV7L 1JHKH 1Z3RA 4AYBA 4BDVB 5DD1H 5AVSB 5G5DA 1DQQA 1WS7A 3LYRA 3FB6A 1WHOA 1KIUA 4QRRA 1KYUA 4YDNA 1ZCRA 5DMIL 2XU9A 4OZIB 4HWEH 4WI4A 4AC4A 3ZDZE 2DF3A 2G3XA 1IFGA 4HUWA 1PYWA 4G9FB 3IMUA 3WFEL 4Z78B 1ADWA 4XE5B 4K9EL 4Y9GA 5HDRA 2CJUH 2X4QA 4CADB 1EZLA 4WEMB 1M7IB 1DVFA 3SE3C 4L1SA 3UZVB 1DTUA 2FLBT 4QXUL 3X14A 5I1LB 4HS8H 2AQ2A 1SF3A 4NO2A 2AAAA 2J7LA 3ZIMA 4AIOA 1ZPLA 4ILDA 2X12A 4AWJC 3OKOA 4ZO9A 3H42H 3Q1SL 1J1PL 5DYOB 5C0CE 2BOCA 2SEBB 3V5HB 1R24A 5B38B 4YSOA 3W56A 1VPOH 1MREH 3CZFA 2QPFA 1TYJA 2IH3B 3CK0H 3VCLA 1MAJA 2FL5B 2WV3A 4N9OB 1MEXH 3UBXG 4BZ2L 2EEAA 1N2RA 2E8ZA 1ET5A 3ZTCC 4PRHE 3RIFF 2EYSB 1I9RH 3OSKA 1RURH 1OPGH 4MZ2A 4P4KA 4XVSH 3X1FA 1EHLH 1JBJA 4DNLA 4YHML 2R0KH 4FMFA 4Z5RA 3BZEA 5T5FL 3ZDYB 2ZE0A 1CC3A 5CEZL 4QTHB 4RFEA 5EEWA 1BVNP 2A6DB 3ARQA 4WHDA 3TP4A 3K74B 3SDYH 4LLWB 4HS6A 1L9OA 3GSNB 4L5FH 3WFBH 1H3WM 1MRFH 3FQ1A 3HG1E 4MQXD 3X11A 3IFOB 2VDPB 4MZIA 2LABA 4PJ7E 3CFCL 5C08B 2IDCA 4HJGB 4CA4A 3V9FA 2JQAA 1BXXA 1A7RH 2GABA 5D5MF 3PPSA 2K3TA 4M61B 5B8CB 4C56D 5BUAA 1PZDA 1IC0A 5LBSL 1KB9J 3UGXA 2WN2A 4KKAD 1MG3C 3EGXA 4F8LA 3VI3B 1DVZA 3PFQA 2ZP8A 1NC4A 1VJSA 2VLLB 1FRGL 4YDLB 4FNLL 3DBSA 5GGUB 1UXWA 5F7NC 1UASA 1AGFA 2K3HA 3BW9B 2D7TL 1CGTA 4XAWL 3FB5B 3GHBL 2X4UB 1SYVB 2CQVA 1BIIA 4HF5H 4NPJA 1TZGH 4N86A 2Q86A 3KPTA 3GLEA 5J1AA 3DVNA 1QNZL 2YRZA 5DHVH 1GYAA 3VQLA 2MQ0A 4Y5YB 3CN1A 1HQ4B 5D7LE 5FK9A 1U41A 3LQZA 4NUJB 1D5BB 3RGVA 4DW2H 2EDHA 1B88A 2HUEA 3FK3A 4NI6A 5JIPA 3W11D 1OCRB 4H20H 2WLNA 1U0QA 1IM3D 1I7UA 2XWXA 3A4AA 3MC0A 5GRVL 3V6FB 5GRWA 1QO3B 5D2LA 2K0RA 1LK2B 5GIRB 1YPZE 2ZUVA 4NUMA 3TA4D 5M94B 1I3RB 1S9WA 5B8CC 4PJCB 2MWCA 4IGBA 4K94L 1X5JA 1NBVL 3H54A 4LU5H 1LDPH 3D09A 3PL6D 4G8GA 2F7RA 4GXVH 4I5BA 1JWSB 1P2CB 2V9QA 3GJFK 3GBNL 4AYSA 5HGBA 5EOTA 4JFFA 2HFFA 3RU8H 4HIEB 3P3TA 3U6RB 5DJ8A 3MI6A 2HPOA 1H6UA 3CZKA 3HTLX 1CWVA 4YDLC 3IKCB 2NZIA 3NSCA 3BP6A 1IFHL 4ZPVB 3UACA 4AYGA 5BZZA 4AH2B 4F15B 1OWRM 2ZXGA 5BVJA 5E99H 4W68A 1MIEH 1OARH 2IGTA 5JOFB 1TCMA 1PSKH 2F6AA 2X05A 5KSAA 2P5WD 3ET9F 5KANI 1NGXA 3LKOB 2EACA 4NAQA 2OYMA 2HRHA 4Y5YC 5TK2A 3WS6C 3EOAB 2OMWB 3BP4A 43C9B 1OXYA 3HG4A 3HNVH 4XH2A 2H1PL 5TQ2L 2GK2A 1SM3L 4TVUA 2BC4B 3I74A 1AR1C 2X9XA 4XNAA 1T83A 3JWNH 2PCFA 3CLFL 1JNHB 5IUCA 5HHOB 3D3VE 4Q58C 5IVZB 2K8MA 4LPWA 3X1NA 2CWRA 3MRQA 4WY7L 5CBEA 3MUUA 4N2IA 1AGDA 4G6MH 1ZLSL 5HY9B 3H55A 4DP4X 4JM0A 5CCGE 3D07A 2BIHA 5DJ0A 2GEEA 4WI8A 1P6WA 1VFMA 2QMJA 5CLTA 1JN6A 3NIDF 4PH8A 2RGSA 3J8F7 1YLBB 3GBML 3FH5A 4L4TA 2WVVB 1JRHL 1F4HA 1IAMA 2TRYA 3IPFA 4KZCA 4PRAA 1UWGL 3BQUC 3CC5A 5F6IB 1HCYA 3ZVVA 4F15C 3EOYG 2DD8H 3EYQC 1LO5A 1E4WH 5DJYB 5IVXB 2IAMC 3GXFA 2G0KA 2LV4A 5E5RB 2N4IA 3ZIYA 1NCAL 4BSVB 5K1VA 3ZMRA 3LAFA 5D7JB 4F1SA 1M7DB 2FZ3B 4JREC 4GSUA 2GC7C 1MHPH 4GBXD 4XMKL 3TBSA 5GJSH 1LYQA 4NCDA 1MRCL 1YEEH 1CR9H 2A77H 2XLLA 2WPGA 4W9FC 4XNUL 1KCBA 2QHRH 1J11A 3H3BC 2YGPA 4TVSa 5B39A 3QRBA 5IHUL 1GJUA 3E80A 2HVJB 2J5LB 1FVEB 2P7TB 1GY2A 3NABL 3PGCB 4I4WB 3UOAB 3GMQB 2ED8A 3NAAL 4DETA 4QRPB 3TFKC 4W9GC 4PLJC 5DUBB 4XN7A 3QDMD 1Y18B 4JZJC 5DURB 2EDYA 3BVNB 5I1CL 5K39A 3NJLA 4M62H 5TD4A 2A3TA 2BIIA 4ZFOA 2NY3B 4F57L 1E4XH 2YEZB 2IXQA 2C9SA 2HT2D 2IG2H 4NPYA 5C0AA 5DK0B 3BP5B 3RL2A 2EH8L 1CF8H 5GS0D 4XBEH 4FERA 3QDHA 2EUXA 4K3DH 4IM8A 5D1XC 3LKRA 4L4VA 5D7JC 4H0LC 2F8OA 4KVCH 2BY1A 1QR1A 3AVEA 2ED9A 4DGUA 2WTOA 3ETBJ 1T6VN 2QVIA 2XN9D 2VM9A 3GT6A 3E2HB 5F0MB 3HC0B 5GJTH 3O2WH 4JFZL 4LCYA 5CKGA 5FFLA 5DD0H 3DURB 4G2AA 2PCPA 1AHMA 1R3HB 4JFPB 1IJNA 1XGYL 2ZSWA 3H7BA 4KX7A 3W9DA 2J5LC 2KQNA 3WD5H 1WCQA 2ZOLB 4OY9A 2A73A 2CLZA 4H88H 1A8ZA 3QDJA 2CGZA 2BVEA 1H3XA 3LKSA 4EE2A 1DEEA 2OJEA 4ZUSA 1A4AA 4XP1L 4FG4A 2N0MA 2BIMA 3KDMB 2XZCL 1DBML 1AP2A 5E23A 3VFWA 2Q7YB 4FYRA 5JW5B 2P45B 5C71A 4I3RH 5CFAA 1M9WA 3NG5A 4DKAA 1E3XA 5FPIA 1XGUA 2NY3C 3NCMA 5C7XL 4PY7B 4PRPE 4EQ3A 1R3JB 2VOTA 3MCLH 2WBXA 3PV7A 1BFSA 5DI8B 5A2KH 3MA9L 2AV1B 2KERA 3MOQA 2DBLL 1Q8MA 2G60L 4AC2A 1AQDA 2QLVB 2VQ1B 1AQKH 2ZWZA 4UINL 1JUFA 1F02I 3ZBMA 2OX5A 3DBXB 3E2HC 1MRDH 1TVBB 2LFEA 4FTVD 3S96B 3DVGA 5E0FA 3OKKA 1CZ8L 4BFIB 4G6JL 4S1DD 1IL1A 3GXNA 5CZRA 5TDOA 4K9EC 4WFHE 4MCMA 1ZHLA 4PRID 4PWEA 3H7LA 4WCYL 4JEGB 2DMGA 4PJFB 3O4LE 4FXGC 1GKOA 4Z7OE 2IIJA 1FNSH 2YGVA 2MNUA 3VD2A 3G5VA 1P6FA 3QJHB 3SGDI 5E2TH 2AJUL 4IRSB 4IOIA 2NMSA 3DROA 3W1ZA 4KK9D 1QRNE 3HR5A 1W91A 3KPNA 1ZLVH 4B9PA 3ABMB 3BPNC 3BPCB 2VYRE 1ZT7A 1T1WA 2P3YA 2X1OA 3FT3A 3GQFA 3SCMB 4RWYL 1CI3M 1MCHA 5IQMA 4HK3N 2F7PA 1A6ZB 5KYUA 3IFPA 5F7FA 4JFVA 5PCYA 1BW8A 5EZJA 3K4AA 5KSUA 5TDPA 3IE4A 1P5UB 1I9EA 3D52A 2E47A 3NIFE 3NSFA 3DX2A 3VGHA 1EGJH 4OGQC 2OMUA 5DRWB 2C9PA 5CN3A 3MA7A 4RGMB 1TFPA 1IGYB 2DMHA 2VERA 3HUJF 5F7HA 4GAYA 4ZFZA 1MJJA 1XF2A 1MDTA 5HGAA 3KYOA 3CVIH 1SJXA 4J1UA 3VJ6A 2GUYA 1JVOA 3Q5OA 4LOUD 4MCZA 4QWWD 4U1GB 4FI8A 4OLUL 5D4HA 3ESPA 4HC1A 1ZGLA 1JG9A 1ED3A 3O3DB 4LQ1A 3H0TA 3BWAA 4JO8A 1PZAA 3KZ8A 5H2BA 2BVUA 4GRLD 2PYEE 4YZWA 3OMIB 2WP3O 3GUTB 3RZCD 3SQRA 1INEL 1OSPL 3FMGH 4JGUA 4TRPH 5J56B 1DQJB 3DIVA 4G80B 5TF0A 1TQSA 4E9TA 1CL7H 1Z3GH 2BSED 3KLAB 3TXAA 5DU7A 5I19L 3QUXA 4P5TA 1VRSA 4AIZA 5EBLB 3L6FA 3VXUE 3TJHC 3V0AC 2GY7B 3SCMC 1A1NA 2QQLH 4K2UH 5T3ZD 4HH9A 5D71L 1R6VA 3V9CA 3VFSB 2HT3D 5IB2B 1IZKA 1FFPB 4LHQB 3CIAA 5I0VA 1A3ZA 4F33B 5E5UB 5DVOA 3BE1H 1UOVA 3LKNA 5IJVA 1E2WA 2DBJA 4RGMC 4XCEB 4N6RB 2VAAA 2ZCHL 5IB1A 2Y7OA 1JPGA 4CVXA 4H7VA 1CPUA 1XR9B 4HKBA 1KPVA 5BZWB 4X4XB 2NQ3A 1OAYL 4HUVA 2OMZB 2WXJA 3OZ9H 4U1GC 4P57B 5I1GL 3DXAA 2YLKA 4XXWA 2P26A 4BEIA 3N1PC 1VFUA 3QRLA 4Q8BA 3ZYOA 1Z9PA 3TT3H 5K9QI 4K94C 3QZNA 5IMKB 5AQ0A 4JLRB 4DKFL 3D69B 4MMXB 1ZWIA 1OY3B 4ZFGL 1JWMB 1MCCA 4IDJH 4IIZA 2I60L 2YMXL 4MXWH 1ONQB 3WN5C 1WFMA 3M7OA 4NQCB 3CFEB 4PV9B 4OVVA 3K91A 2JF1A 4MCYB 5FFGA 5FOBA 4NZTL 2LVCA 5C9KA 2X40A 4K5MA 1P7QA 2P8PA 2FEDC 3EJJX 4D8PB 1JHTB 3H3KA 4AVJA 5I5MA 1JZ4A 5HPMA 4JY5L 5D1QB 5FO9A 3U1PA 4F9LA 1KYOJ 4PV8B 5IBLC 1VGKB 5E7BA 3KYMA 3PFUA 4X6DB 5C3TA 3MOBL 2GIMA 3OGCA 4IBVA 4YDVA 3DETC 3EFFA 5T1JA 3ZMEA 1T6WA 1PZCA 5KW9H 1KNOB 2E6JA 3Q3GB 2PXYD 2K7PA 2VXQH 3L5HA 5C0IB 3U0PB 1M6OA 3ABLB 3WN6A 2HRLA 1O7DC 3MLXL 5C2BH 1FAIH 3D4YA 1CYWA 5IGXH 3IE9A 3N0AA 3BIBX 4KKLD 4Q6IA 5AAPA 4KDTC 1OP3K 4XP9H 4J39A 5KBDA 1AHKA 2NNCA 3MFFB 4JS7A 3WHXB 1U6AL 3DUSB 1NFDE 4LESA 4WK4B 4CJ0A 5L9DH 4OV6F 2DLIA 2K45A 4B96A 2VZOA 1Q94A 5TGBA 3Q6GH 3RKDD 5F88B 1KC5H 1YQVL 4DP6X 1KDIA 4FI6A 5EZIL 1J87A 3QIBA 3FRUA 3JVGC 4P2CG 1VFBB 2AZAA 4IKJA 3TBWA 2QV2A 3WY2A 3HEIB 3VD9A 1LE5A 2DEWX 4AEHL 4PCYA 5E6UB 3C8KA 5D1QC 5AW3B 4HWZA 3ZE2F 2IH9A 4JR9L 1WT5C 4MB3A 4LIQE 1Y1DA 3MRJA 5E08H 3MACH 3LRGA 2AXFA 3KHQA 2EAEA 2XYBA 3JWOL 4G7YL 4ANKA 2D8KA 3DGDA 2MCMA 2AEQH 2QSCL 5IP4A 1RZIB 2X4OA 1T04B 1N6VA 1M1XB 5KOVC 5DHYB 1QMUA 4XNBA 2BVOB 5KOMC 1C5DB 3ARFA 1I1FB 3BVVA 1U36A 4PS7A 3SGEI 4UTCA 3U25A 4NJAH 4YK4C 2SODB 3BRGC 3AXLA 3KJ4B 4ENED 3ZTDC 1E6OL 1IEHA 2LAGB 3KYKL 1IC7H 3SDXA 4G8GE 3NFSH 4GQRA 4OJFL 5HDQH 1N59B 3K8LA 3WENA 5KZCB 1SLWA 5ALBL 1NKRA 4P2RB 4JFFE 5JDSA 3B3BA 4XMPL 2OZNA 1AS8A 1QRKA 3L3GB 2W9DH 3ZDWA 4PRHD 2B59A 1HZLA 1RLWA 1BQ5A 1D9KC 2DQDL 4ZYKB 4GXFA 3S3CB 3LH9A 1NIBA 3UYPA 3ARYA 3NIGE 2WLIB 5AG9A 2XJKA 3QXDB 1RJZA 4X5RA 1TKWA 1M7UA 4Q6YA 1UB6B 4U6HB 2VITB 3G5XB 4NJ9H 3SE3A 4DEWA 1OO2A 3APCA 4H25A 4HJTA 3RA7L 1IBZA 3TBBA 1FLTX 4R2GC 1OT2A 3HG1D 2R4RL 3QEQA 1W2KT 5KJ7E 2KHAA 4Y1AE 2XKUA 4DPRA 4NKMB 5IB5B 2FO4B 4QT5B