4KOCA

Investigating the functional significance of the interlocked pair structural determinants in pseudomonas aeruginosa azurin (v31i/v95i/y108f)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSITFDVSKLKEGEQFMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95I/Y108F)
rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 32
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2013-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4kocA00
4MFHA 3FYEB 7PAZA 4NAJA 1KDIA 3NSDA 2EIJB 5I5MA 3PAZA 3WIAA 1NIEA 1WA2X 1BXUA 2WO3B 3NJLA 1PZBA 1PLCA 1PAZA 4G72B 1OOWA 1RCYA 1F56A 4GP5B 3EH3B 1L9OA 1RZPA 2R7EB 3NJGA 3RYMA 3PAUA 3WI9A 7PCYA 4G7RB 2HX8A 1UATA 1V10A 2VSKB 1A65A 3FU9A 2DYRB 1AS7A 4FA7B 3NT0A 1ZV2A 2XV3A 3H56A 2B3IA 1KYAA 3AW5A 3FS9A 1ETJA 2I7SA 1JZFA 3OD3A 4F2FA 3ZDWA 4AX3A 1X9UA 4YSEA 4EF3A 3OMIB 4DP8X 3FU7A 5ANHA 1DYZA 3MX0B 2BWIA 4HHWA 2MTAA 4E9VA 3AZUA 4HALA 2HLEB 5I6OA 2EINB 1VLXA 3PPSA 4KOBA 6PCYA 2DWTA 2AZAA 2GBAA 2XWZA 2DYSB 4M3HA 3CVBA 2CBPA 1XMEB 1CYXA 1XB8A 3CDZB 5I26A 2FT6A 1DZ0A 1IBZA 3FU7B 1JZHA 2TSBA 1NIDA 1T5KA 3T6ZA 3KW8A 1TU2A 4KO9A 1KBWA 2YAEA 1W8EA 2TSAA 2FT7A 1AAJA 3CG8A 4UANA 1FA4A 1V55B 1KBVA 1J9TA 1AG6A 3QJVB 2CAKA 3TA4D 5B1BB 2BZ7A 1HFUA 4YL4A 3SBQA 4Q8BA 1NWOA 2J57A 3IE9A 3T6XA 3ERXA 5D4IA 1I53A 2HRGA 3ZBMA 3AG2B 3OMNB 2YAQA 2XV0A 2IDUA 5B7FA 1AACA 1E67A 2A3TA 4JHUA 3QJQB 2XX1A 2UXFA 3WKPA 5IY5B 1AZNA 2EILB 1AANA 1NINA 3OMAB 2P80D 2IWEA 1OE2A 4A2HA 3FSZA 2VN3A 3V9EA 1BQKA 2W88A 2YXVA 4BWWA 2AZUA 3AG4B 4WKXA 5PCYA 1E5ZA 1GSKA 1OE3A 2GHZA 4A2FA 1E30A 3PCYA 4M4RB 3IN2A 1MZZA 2MRYA 5F7AA 1NICA 2CALA 2P80A 2I7OA 3QQXA 2IWFA 5B1JA 3QPKA 3AG1B 3EH5B 4QLWA 2GSMB 3X1FA 2BW4A 4DPAX 5LDUA 2JFCA 1WS7A 3GXUB 4P5RA 3L45A 2ZXWB 5TK4A 3FQ2A 4E9YA 1KCBA 1AOZA 2BP0B 2I85A 1OCCB 2W8CA 1TEGA 3V9CA 5AFAA 4DP6X 1B3IA 2XUWA 1PY0A 1BYOA 1PF3A 1IKOP 3BQVA 5B1AB 1BXAA 3AY2A 5A7EA 1AQ8A 4RH4A 3FYIB 1AZRA 1IBYA 2IWKA 1BEXA 1EHKB 3DTUB 3GYRA 3X2QB 5TK2A 3UABA 4W9ZA 3IEAA 3UADA 3NSFA 2OV0A 1FFTB 4TXVB 2QDWA 1MDAA 2FT8A 2VW7A 2H5UA 1J5DA 1QHQA 4UF7C 2QPEB 2GI0A 1M9WA 4PCYA 1OCZB 2NRDA 1ZDQA 2UXTA 3DIVA 3UAEA 4DPBX 1OCOB 1JXDA 1SHWA 2RACA 1AS8A 2GC7C 1AIZA 2HXAA 4KNUA 2QPDB 1SFHA 1AG0A 2HX9A 2HRHA 2XX0A 3H4HA 3PXLA 4N4YB 2H47C 1BXVA 1ET7A 2FQFA 3X1EA 1JZEA 1RKRA 2FTAA 3MBWB 4YVUA 1J9QA 2HX7A 1AZBA 3KW7A 3NJFA 4CSZA 5D4JA 2E86A 2X88A 2FJSA 2J56A 4A2DA 1OF0A 3H4FA 3QJTB 4WTQA 2DV6A 1M56B 1J9SA 2YQBA 2Q9OA 4HAKA 4E9XA 4DP9X 3JTBA 4A2EA 1MG3C 1X9RA 4P5SA 2OCCB 1L9PA 1PCSA 2WO2B 4YVNA 1IUZA 4DP1X 4X4KA 2IDFA 3CDZA 2UXGA 5F7BA 1CYWA 4L0PB 2IAAC 3TASA 4KOCA 4PAZA 1GY1A 2EIKB 2BW5A 4HZ1A 1NZRA 4F7KA 3FQ1A 1SJMA 1QLEB 1GR7A 4N8UA 2BP0A 3EH4B 1ILUA 1J5CA 3ABLB 3TBBA 2PPAA 3FT0A 4DP4X 4G70B 2FQDA 4BWTA 2CCWA 1ASPA 3TU6A 3SBPA 2CUAA 4BDVB 5I28A 3X1BA 3T9WA 1PZCA 3IN0A 1SFDA 1OCRB 1ASOA 1ZPUA 3NSCA 3T6WA 2Y1AA 3CVCA 5EHFA 4DPCX 5B1KA 1NTDA 3NJJA 1PLAA 4AKOA 4E9RA 4A2GA 1PNCA 3OM3B 3S3DB 5B1JC 3ABKB 4HCFA 3NJKA 2WSDA 4YSCA 1SF3A 1AZUA 4UAHA 2PP7A 2DWSA 3UGEA 1MZYA 3EHBB 4AI7A 1BQRA 2PP8A 3X1NA 3S8FB 3FSVA 3ASNB 4BXVA 1JXFA 4E9QA 1ILSA 1SDDA 3NJIA 2FQEA 2X87A 1J9RA 2QDVA 2VW6A 1NIFA 3HB3B 2PPFA 4E9SA 1ADWA 1XB6A 2VW4A 4ENZA 1SF5A 3EF4A 1E5YA 1SDDB 1OV8A 1ET8A 5I5IA 2FWLB 4JHVA 2OJ1A 2AFNA 1KDJA 3NP4A 1BYPA 3X1GA 2CJ3A 1L9TA 3FSAA 4GY4A 2PCFA 4KNSA 1AR1B 1PMYA 2BZCA 5I6LA 4GP8B 4BXSV 2XU9A 1NIAA 2AVFA 2YARA 1ASQA 4YSDA 5I6MA 4GYBA 1JZJA 4AKPA 1OE1A 4DP2X 2B08A 3FU8A 3NJHA 1ZDSA 2YXWA 4YSRA 1M57B 2YAFA 1GY2A 1KCWA 4CSPA 2XYBA 1QNIA 1A3ZA 3NJMA 3OQRA 1SHXA 4DP7X 3ZX1A 2UXVA 3T6VA 4E9WA 2ZONA 3AG3B 1HAWA 2XLLA 3UAAA 1EZLA 3FPXA 3SBRA 1AS6A 2PCYA 4YSTA 1PLBA 5I5JA 1IC0A 2PP9A 2JXMA 4A68A 2BP8B 3WNJA 3FPYA 2ZWNA 8PAZA 2IDSA 1GYCA 4ZK8A 2PPDA 3S3BB 2JKWA 3D12B 1GS8A 4DP0X 1NPNA 2N0MA 1SNRA 1ZIBA 4K9JA 2HZHA 2BWDA 4G71B 2YAMA 9PCYA 3QJRB 3ASOB 2DY2A 2Y69B 1JZGA 3WKQA 1JOIA 3PLYA 3SQRA 1BQ5A 1XB3A 3NJNA 1WA1X 1W6WA 3C75A 4YSAA 3CZUB 1KV7A 5B3SB 2XXGA 4HCIA 1GS7A 1JZIA 4KO6A 1N68A 3UACA 1PZAA 1WA0X 1CURA 4YSOA 1ET5A 5I6PA 4QKTA 4AZUA 4G7QB 3TBCA 4DP5X 2YAOA 5I6KA 2XV2A 4AKQA 1NIBA 2R7EA 5D4HA 2VM3A 1L9QA 1NPJA 3NYKA 1WS8A 2GIMA 1URIA 4KO5A 1JVLA 4G7SB 1L9RA 1JXGA 2FQGA 3N2JA 4NB7A 4YSPA 4HCGA 2H3XC 1N70A 3N55A 1JVOA 4GP4B 4YSSA 2IH8A 1CUOA 2BO0A 1GW0A 1E65A 3JT2A 1GS6X 4YSUA 2VM4A 1A4BA 1W6LA 4GXFA 3G5WA 1AZCA 1L9SA 4BWUA 4Q89A 1A4AA 3ZIYA 4E9TA 3NSYA 4HHGA 2EIMB 4A67A 2Q5BA 2AANA 3S8GB 3QJSB 5AKRA 1MG2C 3NP3A 5AZUA 3FSWA 2VMJA 2QT6A 4KNTA 3WG7B 5I6NA 1HAUA 3FQYA 2GC4C 1A8ZA 2YAHA 3PAVA 5PAZA 3QJUB 2UX6A 5FC9A 1R1CA 5B7EA 5E9NA 3WNIA 3DKHA 1V54B 2UX7A 4BDVA 3ABMB 3CVDA 1ZIAA 2XVBA 2BP8A 4BK5C 4HIPA 1YLBB 2IDTA 1NDTA 3GDCA 1TKWA 2LLNA 2BHFA 2J5WA 2YAPA 2PPEA 1RZQA 3BVDB 2ZOOA 1JERA 1NWPA 1CC3A 3S3CB 1KGYE 4W1TA 6PAZA 1WAEA 4JKNA 2FNWA 3ABGA 3T71A 3IBOA 2IDQA 2J55A 1A4CA 5B7MA 2VSMB 2PPCA 4KO7A 4F2EA 2XXFA 1FWXA 4FAAB 4NERA 3U25A 1PNDA 3HEIB 4A66A 1TEFA 4YSQA 1ID2A 2PLTA 1BAWA 2IH9A 2GB2A
chains in the Genus database with same CATH superfamily
3ARWA 4A7SA 1BIIA 5LGKA 1J87A 3TYFB 3KE0A 4LKCB 2O6PA 1ZHKB 1NC2A 1I9EA 1CIDA 3U2SA 4X7CC 2OULB 5JW4N 2UWEB 1OW0A 4FXTA 3RDTA 4Y1AA 2R7EB 2NNAB 3NIGF 5CU5A 4TUKL 3Q1SL 3MJ9H 4I0CC 3CH1A 5BPPA 1ZHKA 1CN4A 5CJ8A 2WBKA 4S1DC 5INCB 3TONA 2XV3A 5HHOE 3NTCL 3H7LA 3ZQXA 5C70A 2P5EB 1MKFA 2Q6WA 3QORC 5BZDB 1RIVL 1ZEAH 3O4OB 1TNMA 3THMH 3FU7A 2W5PA 2BWIA 2A38A 3N43F 3NH7H 5BUGA 2H2SD 3INUL 3KPSA 5IJVA 2HG5B 2WP3O 4R5TA 4QRQA 1FO0L 1K72A 3CAFA 5EC1A 1N18A 5BZDA 3L9BA 4YBQC 4W6WB 2VZ3A 3EG9B 4UMGA 5IVZA 3FU7B 1F6AA 1UM5L 1UXLA 2FX8L 1YEWA 1QEXA 1AGFA 4XI5D 4XMTA 1JV2B 2CO7B 2QJDA 2ZUQB 3DHPA 1FSKB 4Z8FL 5ICZA 5M94B 4H8WC 1DEEB 4QTHB 3B6SA 4A04A 2OMUB 2X9XA 4X4XA 5I0XA 3MRJA 4G42B 1DANU 1X5YA 4EN3A 1NBCA 1ZHBB 4RAVB 2QV4A 1MHEA 2W9LA 5D2LF 2GITB 3GJFA 2VDLH 3EYQC 2YD7A 5BQ7B 3LXAA 3BSZH 2R27A 4ZSOE 4LDOB 5BRZA 5HVGB 5BVJA 4RLDA 2F61A 4WCYH 2NR6C 4XOEA 3IS0X 1PX4A 4DGVL 4OSUH 1VZHA 3I9GH 2N3JA 3TT1L 2XX1A 3DMMD 1QLEH 4XOCA 1YPZE 3DURB 3FFCD 3E6HB 3Q5YA 4GKLA 4G7YH 5IOKA 1FL5A 3L9EA 4KITB 4NKDB 4MCYA 3B7TA 2UUDH 5SWZD 4QOKA 4UQ3A 1O6SA 1XXDC 2X2IA 5KOVC 5PCYA 1LL1A 2OXGA 1WZLA 3ARYA 4P2AA 5A2KH 2PWDA 1MZZA 4N2HA 4L1TA 4XCEA 5FXCH 1O9ZA 2R69A 1RZIA 4RGND 1BD2A 4HKZB 4X99B 5IREA 4AQAA 3B5GA 3EH5B 2ENPA 3ZN6A 5L6YH 4POYA 2C3VB 1T5XB 2XWBA 3KPRB 3DRQB 3OJDB 3ARVA 2BOBB 5T3XL 1EXUB 4XXWC 2NDFA 4XAWH 2OXGB 3MYZA 1NDMB 4QXVA 1BQUA 3CGTA 4EIZC 1PJ9A 2H1PL 1KCBA 4JDZB 3G9AB 1KTDB 3UZVB 3EFFB 5DLLA 2I85A 3UROR 3S96A 4WJ5B 1OCCB 4YZWA 3HW7A 3UTQB 4Z7UA 3GHEL 3BGFB 1KY7A 1XH3A 2WWMC 5DU7A 1SVBA 2AV7B 2RCSL 4E2OA 3AQZA 4ZSOA 4PUBH 2DL9A 2CM5A 5DD5H 2I25N 1F4XL 3QK0A 4LMQI 2ZYSA 3ARXA 3UBXI 3NN8B 1W80A 4IRZH 5CEZL 3HS8A 2J72A 3LXCA 1V3LA 3TEXA 5FO7B 2DH3A 2JIXD 3KXFB 1VFOA 1GZHA 3D87B 2IMMA 4EZJA 3CQQA 2BVQA 3IXAB 3V0VB 4PJ5D 3D0LB 3SDXE 3SYCA 4LPUA 1PZDA 4YBLC 4GRWB 4R2GB 3OV6A 4MB3A 2Z3FA 3C12A 1DQML 3RL2A 4S11A 1HNGA 1ZLUH 3IXTA 3FT1A 3A6BL 3QJOA 2EIZA 1WAAE 3MR9A 5L2KA 5FHBH 1XXFC 5FAAA 3ESPA 4XMXA 1JXDA 5GS2D 3BAJA 3LPFA 2GUYA 3IRPX 1YEKH 4OZHF 1JGVL 2YD2A 1SXNA 4U0RC 5IK3A 3SQOH 3FTZA 3HI6L 2FZ3B 4XP4H 2AP2A 3Q05A 4MNHB 5E00B 2FX7L 3IXTB 1BXVA 5AOZA 2JJWA 1ET7A 3ZTJH 2CHXA 1R24A 4DGIL 3MRHB 4ODVH 1T80A 4OD3H 1DQLH 2G9HA 2AHIA 2RD0A 4GFXA 2XTJE 4KTDL 4PM1A 4WI8A 3WLWC 2R0KL 6FABL 4NQVB 3O2VH 1J9SA 2CRZA 4YDLB 4TQEL 4UQ9A 4UQ2A 1KFAH 3VVVA 1MAML 2Z0UA 5CKAA 1U8KB 2WO2B 3PREA 1P9MC 3PJSA 1MHCB 1JNHB 4WO4A 4H8QA 3OMZA 4IYKA 4WGVB 2BMKA 1MF2L 1HS6A 2AVGA 2BIPA 4KPHL 4B60A 4XNMA 1G6VK 4NRXA 5A2FA 4LDCA 1HINH 4P2YA 3FMGL 4BQ8A 4LP5A 1UGKA 4KAQL 1NL0L 2EH7L 4WUKH 2Z8WC 3FT0A 1QFWI 2P45B 2I5YL 1NEZG 3SBPA 1U8CB 4ICXA 4DERA 4P99A 4MAYD 2FR4B 4AQEA 4E41A 4JGMA 1MHHB 4XT1C 1FUNA 1EHNA 1NCAH 3O4LA 3PV7A 3RWFA 1UD3A 2VLJD 2V9UA 1CBJA 3UJTH 4F8LA 1LGVA 4WWPA 3ABZA 5DJCA 4DN3H 1WZMA 2FGWH 3CVCA 1PW3A 4GSDH 3S8WA 1BVKB 3H3PL 1DLFH 4PG9B 4RFEA 1JZ2A 2LTQC 4M43H 4CVZB 4WCYL 2DOCA 3P9MA 5EO9A 2EUZA 5FWQA 1KTKE 1L9NA 2EUWA 4C4KT 3L4XA 2MCG1 5K9QG 1IEBA 4FG6D 4YX2H 3GEWB 1CB4A 3AM8C 3EHBB 4K7FA 4UV4L 5F9DC 4Q6IC 1GGTA 2IOIA 3NPZB 4BXVA 1JXFA 2GYSA 3CPUA 5D2NE 3T0EE 5C92A 1HJBC 3MRPB 3UAJA 4MMXC 2A4ZA 5EO9B 3A3YB 1B88A 3FO0H 3MVSA 3IPBA 3BAIA 2FIRT 3PQYD 3VFSA 2FWLB 2WM0A 4TRPL 2NUPB 1OO2A 2AV1A 3I9AA 4Y4HD 4ZXBB 1R3KA 4JREB 1L9TA 4KZDH 2YFNA 3EGXB 4XVSL 1DVXA 3QXDA 5GGUB 4WI0A 4MCZA 2EDQA 2AVFA 3BIKA 2OSLA 2PR4L 3OAZK 4XO8A 7FABH 4GAGH 1BPVA 5FKAA 1I8KB 3C60D 5FKPA 2VN5A 1SEQH 5F9JA 3VDBA 3ISYA 4Y7OC 4KJQC 1JNNL 2E6QA 5IBLD 4I1NB 3C5JA 4I77L 1PCXA 5C0AB 1LHZA 4EIBA 3IPEA 5C0EA 4G6AC 3CVHB 4HBCH 5IQMA 1PLGL 2P8LB 2KMWA 2X4PA 2HKAA 4XP1H 2ZOLB 4G43B 3V6OE 5BXFB 3FPXA 5D72L 4R8WH 5EO0B 2C9PA 4NZRH 3SBRA 1AS6A 1CXHA 4YFLF 4JQXC 2MSPA 3O4LD 2NMSA 2KUTA 4NJ9H 4FL4C 2DQGL 3MBXL 3S4SB 2PMZA 3V6FB 5EU6B 8PAZA 1NAMA 2P8LA 1VZGA 2WUCH 1F42A 4AENA 5EPMB 5J1TC 3F12B 4TNWF 4LF3A 2HYMA 3NCBB 2XA8H 3FHQA 5C71A 4O02H 1FFNA 5DQJB 4X6CA 1RSYA 1WO2A 3QDGA 4HKXA 1SXSA 4IRSA 4PRHB 4N3UA 1HNFA 3ARDB 1YRKA 1Z9SA 3QJRB 4GI6A 4WI7A 3KPQB 1P7QA 2CJSA 3Q9PA 3K6IA 4HW6A 3WEBA 4BKLB 2LT9A 3AU0A 4HLEA 1SOQA 2ZD0A 5CINL 5F72S 5BUPA 2RB8A 5ACZB 1JP5A 3C08L 4AQ8A 4DKDC 3LIZA 4NO2A 1SLXA 2OMBA 3V7AE 3KPQA 2JELH 1JI1A 2WVTA 5C0RH 3KD4A 4BZ1L 1UXWA 1JF1B 1H6UA 3VGBA 3MOAL 3GSUB 2KQNA 4FQXB 4OIIL 3HG1E 5LB1A 3KWVA 4Z7UF 3DXAA 4FQLH 5MENA 1I8LA 4WVRA 1QR4A 4QHUB 5CJBA 1JVLA 4LSRH 4NIYE 4YFEA 1K9TA 1A4JB 3BPNC 4FG6C 4LSUL 4MGXA 4QYAA 3VE0B 5CLYA 2OTUA 2XFGB 4NKQB 3OG4B 2VM9A 5L9DL 1WEJL 3JVGC 4GW5A 5JHLL 2V4LA 4Z7OE 4K8RL 4AUYA 2WIMA 4KK5C 4UDUA 2R8SL 1XGPB 3MCKB 1W6LA 3GMRB 3OAYK 3DXAB 4KV5F 4X6CE 4QRBA 4Y4FD 1N0XH 4HLJA 4KUZL 4MJIE 5LO7A 2IAND 5KW9H 1TFPA 2NXZB 4N8CH 5E08L 4JFDA 1J8RA 4JB9H 1XSIA 3II2A 3PABA 1ZHNB 4GUCA 4G82A 3IETB 1AYRA 1XSOA 5GS0D 2V9QA 3G04A 4KRPD 2ZUVA 1CXFA 1L7IH 2OTWA 4NFCA 2KLRA 1RJZA 3STZA 3SDAC 5CGTA 1KGUA 1XCTA 2GSGB 3E1ZA 2HFEB 5F9WB 4B53A 4FQIH 3SGEI 1E4XL 4JRYA 2BP8A 4NHCL 4ZYKB 1KXQE 1MLCA 2JTDA 1INQA 3G04B 3HLAA 3DX9A 2VJ0A 1YNTF 4U1NB 1ZLWH 3HR6A 1EK3A 1GHFH 1TCRB 1GC1C 1CR9H 3BWZA 2FB4L 2EIDA 5KBKA 2O61A 2P46B 3DNKA 1TMQA 4TLTA 1FRGL 2EXWD 4QYOB 4KGLA 2F68X 3QE5A 1P2CB 1INQB 5I73C 3NG5A 4LAQH 1HDMA 2PPCA 3HZYB 2RMNA 1YA5A 4N9GB 1CF8L 1KEML 3ARED 4DQOH 4YHZL 3V0WL 4PH8A 1CXKA 1A7RH 4P9HH 4O2EB 3VFPB 4HVBA 3SE9L 5A3IC 5K59E 4NAJA 4U1GC 3K2KA 3B7YA 2OZNA 4G8EB 4RMUA 4H20H 4TMPA 2I9TB 2XIBA 3FT2A 3CFQA 3E2HB 4PB0H 3WFDL 4Y5VB 2NDGA 4JO5A 1FYTB 3N85L 4LRIC 5F3HB 4PY8I 1HSBB 4O2EA 3VFPA 5IQ7L 4G11A 4ZFFA 3LRMA 4KZCA 4KKBC 2FCBA 3QIBB 2VSKB 5IM7B 1JGUL 2I9TA 5CF3A 3GSQB 4JPWL 4Y5VA 4CDGC 4PWEA 2VUKA 2W1NA 5I1IL 3SQBB 5D6CB 1X9UA 1IU1A 1HSBA 2CNZA 4ZFOB 1BYNA 2GK0B 1B3JA 1J86A 5CCKL 1F4WH 4TLSA 4P23A 1HX0A 4FE9A 4NI6A 2Y06H 3SDDC 3IJ7A 4R4BB 1ZE3C 4QGTA 2AITA 3MFFA 6PCYA 4AL8L 1M1SA 1J48A 3IF1B 4A2MA 3CVBA 5F0MB 4PRHE 1INEL 4GAAA 3S35X 1LNUB 4L4TE 3QCTL 3JUYA 4P23B 4OI8A 2X09A 4M6OH 4QRQB 4CN6A 1FG9C 4MDIB 4N68A 4PJ7B 4XHJC 3GLAA 3QHTC 3MV7B 1DJIA 5CD5D 5M95B 1QFWM 2AJXH 4LL1A 1F90L 1W8EA 4JAMB 4MLSA 1U9KA 4OZGF 3SKMA 1OZUA 5EZJA 5IVZB 3EO9H 5KJRL 2ENYA 1KBPA 2FIKB 2GTZB 5ICZB 4LNVA 2ZP9A 5HDRA 1OAUL 2NY6C 2Z31C 4EAEA 2ZCKL 2E7CA 1HFUA 4NZDA 1K5NB 3BUYA 2X6CA 2JB6A 4Y9GA 2B39A 5IV2A 3MV7A 5F97E 2DQDL 4QT5A 5AWNL 1H3TA 5E0QA 1N59A 3EYSH 3BCDA 2R69H 4HWNA 1BZ8A 1KF9B 2FWUA 3P9LA 5I17A 3UAJD 2YAQA 2XV0A 3BWUC 3L3OC 4ONGL 1FE8L 4U6HA 2R83A 2GTZA 1DN2A 3QJQB 5LN4A 3U4KA 1GSMA 1PKOA 4F7TB 3VD0A 5J7CC 5AW1B 1VIWA 3KPLA 1XEDA 2P80D 2IWEA 5E6IA 3SPGA 2WXKA 1UOLA 1PX3A 4PS7A 5AW6B 3Q6FA 4A1RA 3BKYH 2CGZA 2QQLL 1NCCL 3QR0A 1OE3A 1GSKA 2CR6A 4ODUA 4AOFA 4N6RA 5FDWA 5G5DA 1GJWA 1SOKA 4BK5A 3IN2A 5AW2B 3P30L 5KSAD 3V6OC 4NKDA 1N0XL 4KUZH 3ZSSA 2A74C 1QLRA 2WWNA 3MRBA 1BG1A 4IRZL 1OY3B 3BH8B 3HHMA 2H0FA 4WIQA 4Y19B 1M53A 2O1AA 2AK4D 4NHUB 4PMFA 2ZXEB 1T0OA 1DJWA 1OL0A 3M8OH 1XGUA 5B22A 1IAKA 5KVFH 1UASA 3TNMB 1M3JA 3OKOA 1KCUL 1U8LB 2NX5A 3GSRA 5CGYC 2CMRL 4HKJA 3KLHC 1FCCA 1DBBH 1FH5H 3KPRA 2VO8A 2D0FA 2X2HA 3ULSA 4NHCH 3VI4E 3DIFA 2RFXA 1IC5H 1NCDH 4WJ5A 4NQEB 2ITDB 3B9DA 1MFVA 4XNBA 1WG3A 2X4SB 4Z18A 5CP7A 1QFOA 3BVNB 4ZFZA 3NQKA 2HT4D 2AV7A 1J05B 5H4YA 1EZUA 3ULSB 3X2QB 3US1A 3OQ3B 3LKQB 5ECJE 4EDXB 3DIFB 4MVBD 5C2BH 5AYUL 5D6DA 3NZUA 4MDJB 3TCLB 3I2CH 1T20A 4PBWD 1ZANH 1CGSH 2C9RA 4Y5VC 4GW1A 2F58H 3IJ8A 2CBMA 4K07A 4FD0A 3EGDB 5K9KA 4Z5RA 4P9HL 2WAHA 4Q6IA 4HHAB 5F7DB 3D0LA 3LQAL 1WZ1H 3QG6B 2AQSA 2EYRA 3EJTA 1NCBH 4M5YL 1TTRA 2I32A 1V7NL 4UAOC 1NCHA 2CA3A 3W5NA 1PLGH 1MJJA 4QRUB 4IMLB 3HMWH 3S9DB 1A8JH 4ZTOL 3FB8B 4WU5B 4I18A 4DKEL 3WV0A 4X5PA 3CBRA 3DBXB 2ZSVA 2CIIA 2R1XB 3E1F1 4BZ1H 2Z92A 2AI0L 5F7HA 3H3BC 4TF4A 3KVQA 3QHFH 3REVB 3MFGB 4ANVA 4R4FL 2E86A 1T3FA 3RBGA 2DICA 4A2DA 3H4FA 1CICA 5CN1A 5DHXB 4CJ1A 3QJHA 3L16A 3MXWH 2DQTL 5GS3A 3QUMH 3EJZD 5C0CA 2AEIT 5CGYD 5F3BB 3GKWH 5K9OA 3KLHD 1U3HD 1X9RA 1UWFA 4PJDA 4LDLB 4ZAKB 4WY7L 1UKSA 2Q8AH 2VJ8A 4G8GD 1GW6A 4OLZL 4Z7WE 3WTTA 3OF6D 4JFFE 5FYJE 5F7UA 1GY1A 4ILDA 4PJGE 5HPMB 4RIRA 1U6AL 2WHVA 4AEHL 1F2XK 4MSWB 2N7BA 1AD0A 3N42F 3UAFA 3I75B 2WOBA 4UOW1 2J1XA 3S36L 2OMXB 2HT4C 5K5YA 2ENJA 4N1HB 1H6EA 4XC3L 1OP5K 3RIFK 3MV9B 4DIXA 2PPAA 2F1AA 4NRXB 4AYMC 2E3VA 1R9FA 2X12A 5LBSL 4RGNE 2B2XL 3X1BA 4ZG1A 4GAJH 1BVOA 1IFGA 1AD0B 1ZPUA 4WI5A 3QEQE 1KIQA 4F3FB 2XTJC 2DS4A 4HAFA 4JFTA 2OYPA 3SKOB 4OFKA 4AQ1B 2YQGA 4JQIL 3SY6A 1NTDA 2ESVB 4F7MA 2K3TA 3S5ZA 2X28A 3DV6A 2CO6B 3VFUA 1KBKA 3O4LB 2X1WL 4HUXA 1HHJA 4M9PA 5DUBA 4HCFA 3U1QA 5I1LB 3EO0A 2IADB 3ILQC 5DJCB 1F8TH 4IOFD 4P23D 4F3FA 5GGVY 1SXZA 3U0PB 4FG4A 4CBZA 2Z7WA 4JRWA 3KR3L 5EO1B 4D8PA 3S8FB 3ZPDA 3LPPA 4LLVA 2A5UA 5C0BD 3WNOA 3RX5A 3U48A 4F7EB 1KCVL 4GRLB 4NC2B 1J5OH 1E9OB 2HVKB 5AVUB 2ZWKA 2FJFA 4FJZA 3RNQA 4K5LA 1QRNE 4WWKA 3RDJA 1CD0A 2VWEE 1UM4H 2D0GA 2MKWA 1QA9B 4KNSA 1EJ6A 1PMYA 3NMEA 3SYQA 5EEXA 3VG0H 4NQEE 4GRLA 4AGQA 3BFQG 4EDWL 1HZLA 5F9OH 4FJYA 3VI4B 2QKSA 4ZD3L 2NUPA 4KI5E 3NAAL 3HC3L 5TDOA 1R3KB 5DJZB 5C6TL 2YD8A 2B08A 3MKGA 2ZCLL 3OF6A 1M57B 4XCCH 1GY2A 1QA9A 2OSLB 1SHMA 3LCYA 3MV8A 4UV4H 4Y1AD 5FKAB 1LK3H 4FQ2L 3RPBA 4JFXA 2RTTA 3L7EA 4KMTL 1KB3A 3QI9A 4PG2C 2Y2YA 3VI4A 3WSQL 3D39B 4E9WA 2ZONA 1I85C 1N19A 5E6ID 5IBTL 1B0IA 5CILL 5BMFH 3PL6B 1F58L 3UZEC 1R75A 1ZK9A 2VCOA 1VADB 1R17A 3VXMA 1OT4A 1CQKA 2A6IB 1HKLL 1WBXB 3CZNA 4HV8A 5C0GA 1OSEA 5IMKA 3I2CL 4QRTA 5D7HA 1RJYA 2E8ZA 2P48B 1NGWA 4HK0B 4BSVA 2PPDA 1J1OL 1G6RH 4LPVA 2WVSA 2OR9H 5F9AC 5FGCE 5IZ7A 4OCSL 3GBMH 3O6FA 3H55A 3P4NA 5F89B 1UXSB 4K9JA 2R9HC 3DI3B 1M1XB 1WFUA 2WB1A 3FSOA 4LIQH 2ZKHH 4G71B 4KBPA 4LBEA 3MU3A 2UZXA 2H3NA 3MUHL 3II1A 2FD6H 5DRXA 1F4XH 4DKAA 1YEGH 1MIMH 4OJEH 1H6TA 3FUKA 4AW7A 4DAGH 5C08E 1MNNA 2C1PB 3L4VA 2J6WA 4MASA 4Y4KB 1BGXH 1UCBL 1JOIA 4YE4L 3QDGB 4HKXB 3CHSA 5TH2A 4E9LA 2BSTB 4H5SA 4MA7H 3LNFA 1UXSA 3CZUB 5D7JB 1IVLA 1GS7A 1ZHLA 3HR5B 3UACA 4OD3L 3DHUA 2OL3L 3JQOB 5DEZA 4Z7VA 4LVEA 1JHTA 4X5RA 4IU3A 4ZPTA 4JN2A 2BINA 2RCSH 1TCMA 2VR6A 5AVSB 3WE6A 5D4HA 4I9WE 2VM3A 4JM2B 5DF0A 1ZHLB 3AREB 2VZTA 1HJCA 3JWOH 3SDDA 4DO6A 4LARH 5KSUA 3OXRA 2GIMA 3ISRA 1M7IA 5T1DH 2ZZUT 4P23C 3MJ8A 2EP6A 2O93L 1JHTB 1W0YT 1IAOB 3DC0A 1N70A 4MLIA 3B9VA 2QSCH 3O3BA 3WKML 1CUOA 1GW0A 1E65A 4G9DB 2ADIA 4ZJ9A 2DDQL 4EI5D 2EXSA 4QHUA 5JW4R 1Y6NR 3UP6A 5KBDA 1ACCA 4CA4A 1UT1A 4NXSA 3SDDB 2V3FA 1B9ZA 2C9XA 1T21B 3UXFA 1D7FA 1O5PA 3WMSA 4UIMA 1BAFL 1NH6A 2J2ZB 2QEJA 2EDXA 2P44B 2DEYX 2EE2A 2FATL 3GMRA 4JRYD 2W81C 1OM3H 3QCTH 2GJ6A 1A8ZA 5EORL 1Q9WB 5CU9A 5PAZA 5LJYH 4ISVA 2ADYA 1IGYA 3DOIA 1LD9B 2R1WB 1NLDL 3ARZA 4XXWA 3T2PA 3LS4L 3Q44A 1V54B 1NUNB 1X7QB 1KYUA 2X0VA 4HEMA 1EFXD 2P47B 2WNXA 3BSGA 3LHPH 4BK5C 1EEYA 1MWAH 4HIPA 1UT9A 1F4WL 3GMOB 4QRPB 5CJXA 4GMSL 1RIUL 2OMWB 2OXHA 2HVBA 4WV1C 4XGZB 2ZUYA 4FFWC 3UEQA 4ELDA 4I3RL 3VGAC 2Y3AA 3WIFA 5T3XH 4B9PA 3WTWA 1BJ1J 4U1NA 3L4TA 5LBVA 1OP3H 2J55A 1K8IB 2CKBH 1T2XA 5BRPA 1XD0A 2DWXA 3SGKC 3D39D 5JXEC 3VG0L 4XGZA 1QNZL 1ZJAA 4F33A 5DEGB 3RGVD 1AGBB 1BVLA 4HX1A 5D2LE 1RU9H 2BSDA 1WT5C 4TSBH 3HRZA 3SDAA 1GGCH 3NJLA 3ZDYF 4ALAH 3W0WB 4K5NA 4OF7A 1FZJA 3A6CH 4ZZKA 3DYOA 1ZVNA 1KCVH 2JTYA 3QUYD 4JFZL 4ANUA 4UDTB 3JWNE 1UGNA 1PDKB 3QH3B 5D7LB 1CDHA 4GS7C 3M45A 3D4GA 1G4MA 1L6PA 3OC5A 1J7VR 4ODXA 4FMFA 4NC1C 5FB8B 1DQKA 1ZV2A 1KYAA 5D7EA 5DD5L 1UEMA 3AW5A 2IQ9L 3FS9A 4XB8A 5GRWA 4GMTL 1JZFA 3MNZA 3MLPA 4PGDA 2VLLB 4FX5A 4ZMYA 4GMSH 4J6IA 2X4OA 1SRDA 1MJUH 5JA9A 3AFLA 4XH2B 1Z9NA 3BGFC 3E9TA 3MJ7B 1PD1A 1LJMA 1NEZB 3EJJX 5AOKA 3JZYA 3FTWA 4LHUB 3VD3A 5KYNA 4N2BA 5CGMA 2GBAA 1J0JA 2GSIB 4CMMB 2VLLA 3VYNA 5IB3A 2ZKHL 4BFEA 3ECVA 5CEZE 3HAEG 1IBZA 2R0WL 2QSQA 3KW8A 3TJEH 2AKRA 4LFHD 3O8XD 2BX5A 3G6AA 1KBWA 2EICA 4JDTL 3CFNA 4G6JL 5E1AB 5D93C 2G30A 3GRBA 2I9LB 2VXUH 4UANA 1IC4L 5TFSL 1CG9A 4TVSa 2PXYC 1CFQB 2F6AA 1AG6A 5DK0B 3R06B 3S35L 1B2WH 2DWDB 1A7NL 3K2UH 3SBQA 5I18L 1GJUA 3JSSA 2FIKA 5AW0B 1NBYB 4NUQA 4ZO8A 4XCNA 1JFQH 1E27B 2D0HA 5D5MB 1FORL 1WBYA 3EJUA 3HNVL 5ICXA 1WZAA 4DEWA 4JANB 1M42A 3ZVVA 1Q0XH 3WIHA 3NFPB 4XWOD 3OPZH 3HKFA 2VN3A 5C3IA 3V9EA 1X5MA 3P4OA 1IC7L 4LSUH 4XCYB 4JCWA 5DJ0B 4PVNA 1E30A 4OZGA 1JGDA 4PWJA 4DWHA 5F9OL 2BNQB 4IU2B 3ULVC 4FFYL 5JYLA 5B1JA 3FBKA 1DQIA 3HS9A 3QYCA 4BFIA 2GSMB 5FCSH 4FTDA 3R19A 3F6LA 1X5AA 5F71A 5CSBA 5C0RL 2ZXWB 5JLZA 3IU3B 4QCIA 3FU5A 4EBQL 3FQ2A 1OF2A 4WI9A 3INUH 1BPLB 5KS9E 4HPHA 3ZR6A 4G6FD 1IT9L 3OLEA 1AZZC 4OKDA 3WTSA 4OCSH 1D7CA 4F1SA 5EIQA 1PY0A 3BFOA 4PGBA 3ETTA 3HC4H 3RI5K 3O4OC 5JLZB 3GSRB 3SBWC 1MQKH 3FH7A 4OT1H 4NO0A 1EUUA 2V5TA 3SDDD 3ZE1E 4PRDB 2Y25A 4W9CC 1VCBC 1IBYA 1F1GA 5AVZB 3V5DB 3AACA 4XCFL 2XA8L 4UT6H 2ITDA 4I0KA 5EU7C 4DEUA 4W9ZA 4HXBL 1R33A 2QKIC 4JO3L 3CFIC 3SE4A 1MDAA 3FCSA 2VW7A 3ML9A 4BZ1A 4NO5A 4DGUA 4G9FA 3V5DA 5KJ4A 1AP2A 2EAEA 4C57C 1B4LA 3LPOA 4JJ5B 3JWDL 2W0FA 5ANMA 4AYSA 4M1DL 5TFSH 3QA3B 1BOYA 1I3UA 4QRPD 3BAKA 4LGSB 4KJYB 3LIUA 4JO4L 1NLBH 4Y9EA 2UY6A 1FNSH 1MCLA 3TV3L 2AMUA 2YEZB 1GGUA 4Q6IB 4G9FB 2PNDA 3IRCA 4R84A 4QJ4B 1HKFA 2APXA 1WWCA 2AQQA 4NWUH 3RFRA 1VA9A 4KKQA 4P05A 3GBNL 2HJFB 3F8UB 5FA3B 5GXBB 5GSRB 4WDIB 4CSZA 1O6TA 4UTBL 2X88A 3DPBB 5E6ZA 4JDTH 2F74B 1Z7JA 2PXYD 3LRHA 3O0LA 2FX9L 3UYRL 1SQ2N 2DJUA 3QDJB 5G4MA 3CSBA 1COBA 4LOUC 4HMCA 1T3FB 2ED8A 3GS0A 2DLFH 4YXKH 4Z6AT 1SGKA 1W8NA 5HDOA 3GXFA 5KZCB 2B8OT 5EN2B 4ELMA 3BO8B 3PL6C 5E1IA 2H2PC 3NIDB 5DZLA 1U8IB 1HYSD 1EJ8A 4U1KA 4UWQB 2X2JA 5HY9A 4DP4X 4P4RB 4QPEA 4B50A 3RB7A 3UJIH 5GIRA 3N1PC 4PFEA 5LBGA 4ALAC 4HOZA 3FUIA 2DAVA 4M5ZL 5F6HI 3ZZLA 4ZMNA 5KBMA 4Q9QH 1CWVA 3D09A 1A3RL 4OGZA 4IS6A 4L5FE 5FYKL 4K8RD 4L23A 3KNBB 5DWUL 3MXWL 1MI5B 3HNTH 1N3NA 1NCWH 3JYBA 3K2MC 3OKEA 4A2GA 3KYNB 1VFMA 1RK0A 5DD3H 4YAQA 1J11A 4V1DB 2XV6B 2JH2A 2VXTH 3FQRA 3I9PA 4M29A 1QBML 4I3RH 5AD0B 1OT2A 4W70A 4UZSA 2EDYA 4PS4H 1H3WM 3FSVA 1KGCE 1RIUH 1HHJB 5DUBB 2ORBH 2WBJA 2WW8A 2Y24A 5I1LA 2ZP0T 3LKPA 5LNEA 2RGSA 4IKJA 3GB7B 3H9YA 3BRGC 1JD9A 2GCYA 2X87A 1GZHC 1RK0B 1HHHB 5F7LB 3GS7A 1V7NH 5T1MB 3CN4A 4LEXL 2W94A 1XF3B 5SWSE 4HCRA 2P1YA 4MCMA 4NFDA 5TE4H 1HQRB 1OPGL 3OAWA 2KL6A 4G5ZL 3DSFH 4R2GC 3O3DB 3NCJH 4FS0A 4YDVB 5E95B 2N7SA 1N5YL 4RGNB 2F18A 5IHLB 2XN9E 3EOAB 2BZCA 2X5PA 3QS3A 4HJGB 1FORH 3RNQB 4NUJA 4S2SA 4W9LC 4ZW6A 2FWSA 4G6KL 1ZS2A 3QXVA 2BRRL 3MRQA 3BQUC 1NGQH 4JY4A 4L4VA 4XXDB 3UBHA 4IRSC 2CDEA 4I88A 4AJYV 3ZRFC 2VRAA 4IBSA 2ITEA 3PS6A 3NJMA 4HJGA 5KUMA 2YXFA 1LQBC 3EFOB 3HI5L 2F9BT 2EIEA 2DIAA 4ZMXA 2IH3B 2EUXA 1A14L 3O2DA 3IDMB 3DDFA 2IBZY 1PX8A 4IK6A 4KVNL 3VFTA 2B77A 5G4OA 4FF9A 1AXSB 4YSTA 2NW3B 1P9MA 3F65A 3VD1A 3QNZA 4QMEA 3HN5A 1IGJB 4PSRA 3O11A 1U3NA 2CNYA 4LE8A 4X6CF 2O6CA 1UJTA 4BGDA 15C8L 4PD4K 5GS0H 4QXUL 3S5LB 3L2MA 4M00A 1JV2A 3ALWA 3N43B 4ONFH 4FG2A 1YEIH 2VQ1B 3RHWK 3ZDZE 1S9VB 5IMKB 3QFJD 4MMYB 5ICYB 2QL1A 1EEUA 1FFOB 2WXLA 2JK5A 5GRUH 5CBEA 2EJ1A 3HBQA 3BUPA 3PNWA 5I8EA 2B3RA 1XR8B 2GW5A 4PHXA 1JZ4A 1IAIM 1F3DJ 1RZGB 1E4KA 3ASOB 3GM0A 3QWQB 4PJ5E 4MJID 4YLQT 2ZF8A 3U79A 5E94A 3WEXB 2X3AA 2YKLH 3ILDA 3NJNA 1NFDF 2UZXB 4WNJA 5D96B 4Z3HA 1KV7A 4ZPVA 4DVBA 1X6LA 3Q6GH 4ONFL 4JY6B 2KDGA 3NPSB 5DD0L 2B0SH 5BCAA 1DJSA 5DZ9A 5T33L 3TN0D 3RWIB 4XP5H 2V7HB 1XR8A 3P11L 1TTFA 1GGCL 1A3LH 3KJ4B 3VTAA 2Z8SA 3AT8A 3VCLB 1CFSA 4G7QB 1I7UA 1F97A 1V3KA 1G6RA 3CIQA 4YK4C 2PYEA 1Y6KR 2OJEB 3A0OA 4N5UA 4CKQA 1QI5A 4RQQB 1VESA 3SGDH 1IKFL 1FSKC 3GBML 2ZUQC 3B8SA 3HAEH 4FXGC 3VXTB 4ODTL 4BIKA 4JN2B 2LFEA 4HKZA 4JMNA 4X99A 4U2YA 4EUPG 1CFSB 3O8XB 3HIZA 3POHA 3WFZA 5KANI 3V52L 2MCPL 1JVOA 5DJDB 4XBGB 5IG7B 3JT2A 4DK5A 2V8MA 3IFPA 3LQMA 1NUFA 2VQTA 4ANWA 1A7RL 4RSYA 4KHTH 3WUWG 1D7BA 4TKWA 1HEHC 5KTEL 3PG2A 2XIDA 2WJ5A 2I60H 4H44C 3UTOA 1Q94A 2D7TL 3C5ZA 2BFVL 1MFAH 4PLKC 3T08A 3S8GB 4GO6B 3RLSA 1XH3B 4HJJH 5KS9F 5I6NA 5IG7A 2VABA 3IFPB 1T21A 2YXMA 3LDBB 3WDIA 4YHIB 1QAWA 4AWJC 2RIKA 3JV0A 3P3UA 4MBOA 5IFJA 1ERNA 1R1CA 4LGRB 2X2YA 1WYJA 2IAMA 4YGAB 3W82A 1Q94B 5IOPA 3CVDA 4NFBA 5I6XB 1DFBH 2V9RA 3NAAH 3Q2LA 5T5FH 4CADB 2P7TB 1DUZA 3TO2B 5C09E 3EFDH 3M46A 2EVHA 5DUML 2B20A 2R1WA 2JF1A 3SZKC 4WTXA 3ZL2A 4IGBB 3ESVF 2HTLD 5J57B 2A74B 4TS6A 1OM9A 2CLZA 5FV1L 4X6DA 1SJXA 3D25A 1UB5A 4ZBJA 5IMMB 4ZRGA 1R46A 1UWEL 4J4PC 5JW4M 1CU4H 2DWEA 5LGJA 5DMGC 2ADGB 2ZKXA 1CL7H 5LN8A 1SYVB 1A4CA 2R4SL 4U3SA 3MJ9L 3ZE1B 4X8GA 5KG9A 3QYMA 4I87A 1NCWL 3GSNB 1AI1L 2GAZA 5JIDA 2X0UA 4APXB 4X6DB 1DVFA 1GAFL 4M1DH 1NANH 3REWB 3V0EA 1SY6A 3L3OB 3N91A 4M8UA 1KT2B 4E41D 4PLJD 1VZIA 2EEFA 3WIAA 4YXKL 4JY5L 4TQPA 1CGTA 4MJ6B 5IBUB 3SE9H 2ZOKA 2GAZB 5KYWA 4NN6C 4HWUA 1YQVL 3MRIA 2Z31B 1TYRA 3HTLX 3U4BL 4M4PA 5C97A 1MJ7H 3NJGA 7PCYA 4GG6F 4DUVA 4UM9D 4Y2NA 4O2CA 3OJVC 2WLIA 1XGZA 5HHQA 4N28A 1AJ7H 1EV2E 2D2OA 4LLMB 4V2BA 1KG0B 5I15H 2HKHH 3DTDA 3F04A 5IEKB 1QPXA 2AQNA 1NMCB 2NY3D 4X8JB 4AIZA 3VI4F 4GNKB 4XNMB 5TDPB 2IF7A 3BZ5A 2VDOB 3OXSB 3QUML 3OMIB 4MB4A 4PJIF 4Y5YB 4DEPC 5FB8A 5IFAH 1G0XA 1VGKB 3MX0B 4BGLA 3WNKA 1RP9A 5I5RA 2NNFA 3D0VA 1Y6MR 1BZQK 3D85B 4OF6A 5DHYA 4LLMA 5I66B 4KOBA 4PV8B 2IAMD 3H9SA 4B27A 2JCCB 2VL5A 4MXWL 2X4RA 4PRIA 1RQ5A 3MJ7A 5I26A 1LEIB 4PJCA 1NIDA 2DQTH 2ESVD 1HHKB 2XN1A 1RUPH 3B3BA 1TSHA 2H32A 3PHSA 1UZGA 2V0AA 4JRXB 5IBTH 5HVWA 5DTFA 5CIPB 2YAEA 3BAXA 3VXOA 3CSYA 4KK5D 1U95A 3WXWH 3ZHKA 1NFKA 4BBWA 5TD4A 2XQBL 3HOGA 4MXVF 4I1RA 5HGAB 1G94A 4LPXA 2HPTA 3UPCA 4GRMA 3T0WA 4K7FB 3DLQR 3RX8A 5HYJA 1PVHA 2ZCLH 1FNFA 3GSWB 4EOWL 1YEHH 4JRXA 1YY8B 3HMWL 4WKZA 4H0LC 4PLJC 3DJ9A 3NUKA 1CFQA 1SLUA 1VENA 2BFVH 4U1GB 2E59A 1OK0A 4J23A 2UZYA 4KK8C 5E03A 5BJTB 2DWDA 4PQXA 4XMZA 3WFEH 4Z3EA 3O6MH 1FHGA 1WJ3A 3CDYA 2J7LA 3D7PA 4L3EA 4MJIB 1DN0B 3QR2A 1KACB 4I85A 2IO5A 1WFJA 1B2YA 2UVFA 5CEZD 5E2WL 2UZYB 5GGUA 2CHDA 4MCZB 4A2FA 1N5AA 2WD0A 1FZOA 3IJEB 1IBHA 4H8HA 1AHWB 7FABL 3DYPA 1R4XA 4JO8A 5CLXA 3P4OB 3QDGD 1N4XH 4MJIA 1S6NA 1JJUA 4M93C 1O9VA 5EBLB 3T0DA 2V5SA 2OCJA 1F8TL 2K8QA 2VE6A 2EDLA 3N1FC 2R56L 1AHWA 4HETA 4L1HA 4OZFA 3SODB 4X50A 1G9MH 1IBDA 1OD7A 1QSEE 4FCAA 3MV8D 5CS7A 1OGSA 3UBFA 2OI9B 1J8KA 3JWNG 1OF2B 2XUWA 1B0GA 2LU5A 3MV7D 3BUDA 6CGTA 1UUNA 3GTNA 4H26A 4UB0H 3Q7JA 3IDIA 2F53A 3MBEC 3RVTC 1MAKA 4ZI8A 1T22B 2CXKA 3BSHA 3PHOA 4KWUA 1TTUA 4FKHA 4J3SA 4YHML 3ARQA 5H37H 3DTUB 4W4OC 4FTVE 4J1UB 3HC0B 4JM4H 4M1CD 1FPTL 1ZTMA 3F12A 1A6TB 4M7JL 3UTZB 5E6SB 3UADA 2BSEA 4LU5L 2XWDA 4DVRL 3DGGB 1CFBA 4YIQB 5DRWA 15C8H 4BHUA 2XG4A 3TVMC 1G7JA 2FT8A 1MQ8A 2NSMA 4TQHA 3JWDC 4OZHB 4PRHA 2X9ZA 5EOCH 3QZWB 2OP4L 1AQMA 2ZYHA 2DB8A 4TPRH 2MQ0A 5DVMA 2VJXA 1KUMA 2HFFB 1KGXA 1M9WA 2BERA 1UYWL 2VL4A 1A6TA 3UTZA 4CC4A 2XRAH 1U92B 1NGXA 3GZQA 1H19A 1E5AA 4X4YB 5IHBA 4JPIB 4QXTA 3O2WH 1J9CT 1NQBA 2Q2LA 1DBML 4PW3A 1TZIA 1UWXH 4M4RA 4ZDHB 3TP4A 3MLVH 4ZOCA 1BFOA 4JKPL 3IFOA 5D1QB 3HBZA 1TEYA 3GJFH 3RWCA 2GT9A 1Z5LB 5DMJB 3VXRE 3WNPA 5EH1A 1ZD6A 3QEQD 4M62H 4WLCA 3ZL4L 3MNVA 5F8QC 2D7NA 4FFVD 3X12A 4QNPE 5IB1A 1Z9LA 4PY7B 3N0PB 5IROC 2I07B 3UYOD 3GSOA 1A4JA 4ODVL 2W9EL 1CJYA 3RWCB 4W9KC 2BNRB 4JNXA 4PU2A 3SE4C 4L37B 1L9PA 2O26U 2OKMA 3LOWA 3WFHA 2F74A 1IUZA 1IM9A 4MXQD 5TE4L 2IPKA 4PJ7E 3QFJE 5F7BA 3L3GA 4L0PB 4NSKA 4MYWB 3O9WC 5KBPA 4CKVX 3KH4A 4J7RA 3FAWA 4BHUI 4Z3TA 3RWHA 2BP0A 4D94A 5E4EC 3DVIA 2P3YA 3L5IA 1Z3GL 2NZIA 3JV4B 2XWCA 4PR5A 4JPVL 4W9DC 5EOCJ 1X5ZA 1QSEB 3PIQB 4PJEF 1QFWL 1S8DA 2OTWB 1T0MA 2EXYC 4Y2DD 2DMCA 2GJRA 3S3PA 4BDVB 3DMMB 5C0FA 5KYXA 5CR1A 1CE1L 4HUKB 3BO8A 4M56A 1PZCA 4NQQA 1RZJL 3BOVA 2QHRL 2OMZB 5FIEA 1W0VA 2IBBA 5IB4A 3MXVL 2FJGA 3HCVA 1J0IA 1KJVB 5FM8A 3NA9H 3SDCB 4PRHD 2YJQA 5DUMH 3VSVA 4OGYH 3SOBL 4HCRH 2XDHA 3FCUB 1DFBL 4NBXB 3ZHDA 1OKEA 2L04A 3VXPB 3U6XA 2BDNL 2VXQH 2YFOA 2W0LA 4PLKD 2OMZA 2PP7A 1FRGH 5T3ZL 1ED3A 2X6UA 1JGEB 1IFHH 2YD5A 1N3NB 3ULVE 4JREC 3CLFL 4KUCF 4W68A 5I2IB 4FJ6A 3DOSA 3D1MC 3SDCA 4YAQB 4DN4L 2W9EH 4XMUA 4ABUA 1ILSA 3G6JB 4RISH 5JNYB 2WZ0A 2YN5A 3VX1A 1CF8H 4KZEH 1H6FA 4KI5C 3U9UB 1BF2A 4ONHA 4D7BA 3RVTD 2DIEA 2VDKH 1MXGA 1NCJA 3MTRA 3Q2CA 1ODUA 3EOYG 5F7FA 1ES0A 2IFGA 4P2CG 5IHWA 3U2SB 4OUUA 1YNKH 4ODBD 1AGEA 4JHVA 4OM0L 1AQDA 3DOSB 2E4TA 3V4PH 3KLDA 4D8OA 1HHHA 3JUZA 5D1ZI 1RPUA 1KXTA 4J2QA 3EXJA 1S78D 4PWGA 4IIQA 4M48L 4WK2B 1TQCB 1TQVA 3B7UX 1T7YA 1SQMA 3CHQA 4ONGH 5DA4A 5IW3A 4X7TA 4LU5H 5FHBL 3QQ3B 1E40A 3TC9A 1I9JH 4H8WL 4GQRA 4HF5H 4OW6A 3HHSA 1AQDB 4AV4A 3P77B 4E0RB 3KL3A 4NWTL 1QVOB 1HKLH 1R3JA 4J3WA 5FK9A 5FW8A 5CZRA 2X05A 4M1CC 1YNKL 4YHKL 3VFRB 1SHXA 3AAZB 3W9DA 4HUCA 3ORJA 3OWRA 1OAZH 3QEUB 2MTPA 2CCVA 5F6IB 4F5CA 3B2MA 1CTMA 5DVOA 2XLLA 4ZX5A 1X9LA 2N4IA 3TEUA 1DVQA 1TQTA 4JM4L 1A14H 5CMAB 5HDQH 4NKOB 1JWMA 1I7RB 2BNQD 2E6PA 1Q9KA 3QWRD 3CLFH 4IHBA 4JE0A 4RMRA 3U30C 2JV6A 4LESA 3BZDA 4DAGL 1XF4B 3WNJA 3RGVC 5L8JB 5DRZB 2C4FU 3BE1H 1J1PL 2BM3A 3GBDA 3H9HB 4NM8L 1KEGH 4ZK8A 3S3BB 4PJBE 5KSBA 4GKSB 2BRRH 3BEVA 3DRTA 3QNZB 4EN3B 5I75C 4Z7OB 5C0BB 5L2KE 3BRDA 2HUHA 2OS7A 1FL3A 4XMWA 5J6HA 3GJFB 3KXFE 5EUOA 4EXPX 3VACA 1LO2H 4DO4A 5KVMC 4NENA 2YAMA 3PF2A 4ERSL 3H9HA 3L54A 5GQBA 5DHVH 5MHSD 1G7PB 1FF5A 1Q4NX 3DRTB 2GPZA 3EXLA 1S7RA 1WDAA 5TTRA 5CBEB 1N59B 4GG6B 1OWWA 3HMXL 2AAVA 5IQ7H 1UCTA 3C75A 2EDJA 1KN2L 5EFIA 5KUKA 4TLUA 5EUOB 3E6HA 3HUJB 4U6HB 4U0RB 2FEEI 1E8ZA 4N85A 1CZ8L 3KJ6L 1WUZA 4M03A 3K71B 1KTLA 4XE5B 3I02B 4XRCA 4NRYA 1HXKA 4PRPE 3OWEA 1S7RB 5D7SL 5EUKB 1HOEA 1BIHA 2VZ1A 1JWUB 3Q6FB 3WHXB 4PVBA 5HYSB 2CDGB 4KHXH 5IESH 4LFHG 3ULUH 4CAGA 2K6WA 4FYRA 1KPVA 4XXCA 3AGVA 4AQAB 4Z7UE 1L9MA 3MUGB 4XMLH 3SKNA 2GJZA 1KTLB 3IGFA 3L5HA 4GQPH 4I2XE 4UOZA 5JHAA 1G6RB 3T3PF 4G7SB 4XI5C 1S7TA 3DETC 3AXLA 3N2JA 4NB7A 4Y2OB 1A6UL 2R2BA 2YPVL 4WV1A 2VZVA 5E9DB 5E5MB 3MLYL 2IV8A 3TBSB 3L3IA 4CNIA 2CJTA 2JVUA 3DDGA 1W2KT 4H8PA 3TNMA 3TBVB 2VN4A 4Y7MA 3C87A 4DOHE 1O0VA 4PJCF 4HKJB 1M3IA 4J8RA 1TZHB 2XJKA 5IKCB 2PR4H 4RX4D 3NCEB 4UNUA 4Q9CA 3FSWA 4UU9B 1TZGL 5D2NA 2WVUA 3W38A 3J7HA 4U4BA 2RFXB 4AYDC 5IHZB 2WB7A 1WIOA 3PAVA 4G2AA 4P0DA 1DJYA 4S1SH 2W38A 4HUNB 5FM5O 4TPRL 4I77H 4P07A 4QXGL 2NUTA 5EMYA 1JXKA 2H6PA 2YMTA 2OSXA 3H8NA 4KI5D 4WFGE 5EU4B 4LMQE 1CS6A 1DQTA 3ECBA 4Y4HB 3CK0H 4ZXBD 4Z7NF 2W60A 3NFNB 2BY1A 4ZFOL 5IFAL 2ENQA 1BVNP 4Q6YA 5JIPA 2CK2A 4PJ8C 1OGTB 4KZDL 2VOTA 2ZPKL 4Z1PA 3WJMA 2AC0A 5LAPA 4KC3B 1CC3A 2NTFB 3S3CB 2XWJB 4M5ZH 2A1WL 1B4TA 2VR9A 3TFKD 2FBJH 1YVLA 4LASL 4RA0C 2A77H 3O0RH 1MDTA 1RUQL 3ECBB 3MR9B 4BKTC 1IO4C 3U0TB 4EVNB 3NFNA 5EIVA 1D2OA 1SOXA 4F2EA 5IHUL 1DLFL 3MTXA 5IK3B 3RL1A 5I76B 3U25A 4D9RE 1JZ7A 4OF8A 3BIBX 1ID2A 3BKMH 4APQC 3FB8A 3NCXA 4WU5A 1PIGA 3FQWB 4GMTH 7PAZA 4YX2L 3HE6C 3MRHA 5IFHL 4OV5A 4OT1L 5AB0A 1MCOL 4OLWH 1QO3A 1GYAA 1VF5C 4KRNA 2CQVA 1PAZA 3EAKA 3IPFA 2J4WH 5T3ZE 4NQXA 4P3CL 1QRND 4O02B 5FA4A 3QDMB 4UT6L 5EBWA 4PCSA 3N9GL 1ZJBA 4AVHA 5IESL 5C0CB 1U8KA 4XHQA 3DX1A 1A65A 4AM0Q 4FZ8L 1QKZH 4PJDB 4RBPH 4HG4K 3BGMB 5ETUB 3VI3A 4J4PA 4A7GA 2I7SA 3RKPA 4WW2B 2AXWA 1TJGH 2XZCH 2ZXGA 5DJ2B 3RX9A 5HHOB 1SXBA 2HUEA 5HPMA 4J5VA 4A7UA 1LEKA 4K7PL 1E9QB 3CV5A 3S2AA 4MSWA 2IBZX 4K3HA 1WAAA 4G80B 4Y1AE 4AJ0A 4JO4H 4YGVB 3MRLA 3LZQA 3QEQA 2JKTM 2V33A 4FQ1H 1IL1A 1YEHL 5LXGH 5I1EH 3UBXG 5DDHB 3WLBB 3TF7C 1LO0H 1R5IA 5EIIA 5J4MA 5MEND 3X17A 4EUPA 5DQDL 5EOTB 5CIPH 3PWPA 1RFDH 3RDTC 2NNCA 1JZHA 1MVUB 4NN5C 2ZICA 1NGPH 4TL4A 3IDGA 4AQ1A 3IAGC 3SPHA 3BWUF 5DT1L 1A1OA 4MXQC 3DGDA 4KO9A 5FUZL 1YYMH 2VO5A 4PJXA 3T0EC 5JOPE 5LUMA 4H0IA 4PJCB 3QUXC 3MLSH 2EADA 3SGJA 3EDJA 4KHTL 4URTB 3PGDB 1T6VN 2VR3A 2NYYD 4PVLA 3VD7A 4UTAA 4A6YH 4D2NA 3IDGB 5B1CA 3BPOC 1U3HC 1JNNH 5IUSA 3DVNA 3WO4B 3T1FB 4HF5L 2J25A 5D9SB 1KPRB 3ZRSA 5F1SA 3NCWA 2HPOA 2HRGA 3MLZL 5DMGD 4PB9L 4F7EA 1TTBA 3QUZC 4FXGA 3PGDA 2HVKA 3FKUS 5MP6H 5KAQF 4Q7DA 3OAYH 3TBYA 5DFVC 2OYMA 4OFYD 1KCUH 5K93A 4PJFB 4ONOA 2NY1D 5CWSB 4JGNA 4EBQH 5BJTA 1JPSL 3FSZA 3OGCB 3ILPA 3QXDB 3TBWA 5DURB 1GC1L 4HH9B 2QELA 4KKRA 3WEAA 3W11D 3H6AA 4XNUH 2ED9A 4ETYA 2Y1ZA 4XBMA 5DJ6B 1BD2E 2GHZA 1KXHA 4P2RE 3FTSA 2XQ0A 4BQBA 5HVHC 2DN7A 4R26L 5I74B 4L3EB 3OX8B 1EJFA 1GMIA 3GJFK 5EA0H 5GJSH 5I1HH 2MNWA 3AG1B 3M7OA 1H15B 4GQ9H 1D9KB 3DV4B 3SDXB 1M9SA 4NM8H 3D3VE 2F7QA 4NO3A 1S7XB 3L45A 4S1RH 3PHQB 1PD0A 1YG9A 3KPNA 4Z3IA 3TO4A 2ZOLA 4YXLL 1DSWA 4RFOL 3T3MF 5E51A 3HE7A 3NZSA 1FE8H 4BK4A 4AK2A 1HSAA 3GMMA 5ACLA 1RJCA 4PJIA 1Y07A 5JQ6L 3CFKB 4Y16D 5GS1C 3TM6A 3KPNB 3K6OA 3BCFA 1G7IA 1A6ZB 3TX4A 5A7EA 1ZVSA 5L2KD 1OAYH 1J0HA 3DX6A 5J0BA 4RGOL 1R0AH 1IC4H 1TLKA 4XPFH 3F83A 5DS8B 3FN0H 3IDIB 5TK2A 4ZFGL 2Q3ZA 2HKFL 4R97C 3EYSL 1FFTB 4D0BA 3BMWA 3EJYC 1YQ2A 3KLSA 4J1UA 5JQHC 1HCVA 1QHQA 2VRKA 3DX6B 2EC9T 4UF7C 1P4IH 3I9IA 4FQHB 4K9EC 1YY9D 1A9BB 4WEBL 5BMFL 3UH8A 1MJ8H 4V11A 3TT1H 3KPOA 2BOLA 2G3XA 5IJDC 4BE6A 3CCHA 3DUSB 4QAWA 1P4BL 2ZOUA 5EU7E 3M1BB 4L18A 3NK3A 3HS0B 5I1GH 4YLCA 4MNQA 4Z95H 2FUTA 3LTVA 2QADC 1ITBB 4HU8A 3T2QA 3WS3B 1QACA 3UCQA 1ZKAA 4FQXA 2XIIA 1C5CH 2F53E 3KPOB 4KXDA 3K8MA 4XP4L 1DDHB 1ZS8B 2NZ9C 5B39G 1RKRA 1QZ1A 4G1EB 3PP4L 4KDTA 4BCZA 4JR9L 2FATH 3WY3A 4I4WA 4JM2A 1MW3A 4AGLA 1OF0A 4M7LH 3LNGA 3W11C 4UTBH 2WV3A 1AXTH 4K7PH 1SEBB 2YGVA 3TEZA 2APSA 2FO4B 4Y8AA 1OAYL 3X12B 2OA9A 3E3QE 4Z0XB 4LOEA 4U1IB 4PW9A 3L2NA 1U8MA 1JRHL 1U8HA 1V3MA 5T33H 1XGTB 3BSZA 1V7MH 4HZ1A 3N9GH 1EVUA 2AXFA 3HNTL 3JWNH 3O2WL 3AJ7A 4R7NA 1SJMA 2TRHA 1AHKA 4OIFA 1IEHA 3UTTE 3EH4B 1ILUA 3BVVA 4M9OA 2Y7NA 3PWUB 2HT3D 5DC9B 1FV1B 2O6EA 3TBBA 3ZE0F 1EHLH 2X4QB 3BKJH 5FECA 5EWIH 3IDJB 1U8HB 2YGQA 5E7BA 4N2OA 3UJIL 5AZEL 4AIEA 3NA4A 5ADPL 2LHAA 4KRMB 3R7RA 3RPIA 4XR8C 4A7VA 3LS5H 3T6WA 4F2MA 1ZLSH 3K46A 1FV1A 3DVFA 1J88A 4GFTB 3RP1A 2ID5A 3IDJA 3WTVA 5FYJH 1JWSB 5B1JC 1W0VB 4JRLA 4YC2B 1BZ7A 3H0TB 2JELL 1AZUA 2Y36H 2A1WH 3CZGA 2X41A 1G7QB 2NY0D 4N1EA 1BQRA 4Z7AA 2V37A 4MJ4A 4LLQB 1EGJH 3QCUH 4W4NA 5B21A 1OM3L 4J3OH 4MNQD 3BHBB 4YZFF 2C1OB 1MFDH 5HYQB 3U36B 1QSZA 3CBKB 4B5ZA 4YDIH 3ZDZF 4Z78A 5FUCC 1I1FB 1E2VA 1JGEA 2DLTA 4LRNL 1ADWA 4G8EA 4YC2C 2IANE 3ESUF 4FLQA 3GXMA 4U4IA 3U9PL 1GGIH 1SN5A 3MDJA 4LLQA 3VWJA 2R8SH 3CUPB 4ONHB 3JV6B 3V8OA 3NP4A 1IM3A 3VWKD 1N4XL 5DMKA 2EKSB 4ICWA 5IQOA 1JK8B 2DMHA 4CMHB 1ASQA 1NCUA 1NLBL 2OR9L 3FF7A 4LCWA 4W9FC 5BV7C 5DZOA 3VWJB 1OVZA 3GUTA 1J12A 4X7TB 3T2NL 2BIMA 2J12B 5GS2H 1O9WA 3VXQA 3ZX1A 2W91A 3BT2H 1T5WA 2EXYD 1Y18B 4R8WL 1E4XI 2AJSL 1YNLL 4N2KA 1QBAA 5FUZH 5A2BA 5I0DA 3N0AA 4WUUE 5AVVB 1NCOA 2NNAA 1GYUA 1TLMA 2A83B 4C56A 4XCFH 1WGVA 3ARPA 4OLXL 4U7MA 2DZEA 1A7NH 1EDYA 2R1YB 1DO6A 3BW9B 3SKUD 2PP9A 5FO8A 4BH7A 4K3EL 3RTQA 4OZIE 3FUNA 2W92A 35C8L 1YEJL 1G87A 1JYNA 2W9DL 1UQSB 2P24A 4O02L 2FWOA 1CIUA 4P57B 5F1KC 5AALA 2X4NA 5FO8B 1MCSA 1ZV5A 4Y16B 4X8XA 4P3CH 1RIVH 2YPLE 2YRPA 2DM4A 4JDVA 3FU6A 2VR7A 2H3KA 5KSBB 4XBEL 2JB6B 3CFEA 5AW9B 3W39B 4N0FA 5IV2B 1Y0LB 1E2WA 2DQGH 4FZ8H 3LNDA 2DYPA 2O4EA 5DMIL 4ORZC 3SQRA 1NJ9B 3WFEL 5A7BA 4JKWA 3GKZA 1YN7A 1BZOA 3BH4A 3DROB 5HHOD 4Z3JA 4RRPG 1RVFL 4Y19D 3RZCA 4OQTL 4ZMOA 2V3DA 2WXJA 3QFDB 4KKAD 2XQYA 3FTVA 4PD4J 4GG6A 1EAQA 4N90D 4IRSD 4XCCL 3V4UH 3MOQA 1I3RA 5E23A 4XNQB 4G8AC 3WYRA 2XQYG 4K94H 4P5TD 3P2DA 1QLRB 3QFDA 1WD9A 2LU3A 4LP8A 1JWUA 5GRJH 1IEAB 5HYSA 2R4SH 3QAZB 3UTSB 1UZ8B 4MCNA 1JYWA 1RURL 2AXJA 3DURA 3GK8H 3N55A 1IQDB 4XNDA 1MCEA 3RVUC 4WY7H 4FQQB 4HDIB 4YNYB 3ULVL 1R5WB 1IAIL 2P5PA 3D4YA 3PQYE 3B9KB 1DBAH 2WY3B 3MLWL 3U1SH 3QI9C 4PG2A 2B9BA 4XTRD 3W57A 2EIMB 4OCYL 1T1ZB 4YHPB 3QJSB 2UUDK 5E9DE 5AZUA 1UD6A 4JO2L 4IOIB 3TBVA 5TQ2H 3FQYA 5T5NG 5HI4C 3U4EA 5J13C 2COVD 1WWAX 1UWEH 3I6KA 5F6HJ 1VRSA 1H3GA 1CTOA 2X7LA 2YAHA 4N8VG 1RMFH 1UJ3A 3WKYA 3VG9C 1M7DB 4YMPA 3BPLC 2XETA 1FCGA 1W15A 2NQCA 3ASWA 3EGSB 3GINA 3K0WA 5DJXA 2JJUA 4LEBA 3GMPA 4K7PY 4TSCH 1WE5A 2VDOL 3HG4A 4B7LA 5T5FL 2H45A 1Q1JH 1E50A 1TKWA 2K4WA 4BELD 5AW3B 3UTPD 1H8OA 3TEYA 4MKMA 3A47A 3HLKA 4FYQA 3UDWA 1I3GL 2WMPB 3LKNA 4HFWA 3V5HB 1SOSA 3EGSA 1USQA 3PWJB 2DD8L 3QT2A 2WBJC 4K3DL 4DGYL 1NFDB 5HI3C 2WQWA 2F7OA 4PJAA 3ECWA 5DD1L 1OEZW 4FI6A 1CBVH 1Z5HA 2FEDC 1NL0H 2EH7H 1T7WA 5E1GA 3WJMB 5J1SC 2O5YL 1NPUA 5TJWK 4IMKC 3MN8A 2I27N 5C9JA 2EVGA 1UACL 2QVKA 1TEFA 2YEZA 3V0VA 2NY5H 4G5AA 1BBJB 1KELL 3PWJA 3MJ9A 3Q43A 4MWFA 2CIIB 4NI3A 3V4VL 1NCAL 5A2IH 2ED6A 3BAEL 4MXVE 2ICWB 2JJVA 1E4KC 2PUQT 5C7XH 3VD4A 4UTAL 3T0EB 5K39B 1BM3L 1F13A 2Y7QA 3EJYD 4X5XB 4G72B 4XPBH 4UQDA 3PHAA 2AQTA 4W6XB 1HXMB 4B6ZA 2CHZA 1ITCA 2QZ5A 5IEHA 4U1HB 5K9OB 1IJ9A 1DBBL 4G8GE 4XPGH 4RGOH 4HIHB 4K71B 3L5XH 3KDMB 3SCMD 4O02A 1A2YA 2JIXA 1E42A 1MCJA 3H56A 2QVTA 3MV9E 3QC6X 2CGRL 3IJYB 3OD3A 3IBEA 2ZTBA 4JFED 5EORH 1KJMA 3HI6H 4L4VE 2PCXA 4UV7H 3MNMA 3RUGA 4DP8X 5EN2A 1A7QL 4HIIB 4WW2C 5I0VA 1BEYL 3D85D 5C1MB 4HALA 4WW2A 2SEBB 3HN8A 3HPJB 1ADQA 3VNZA 2QTEA 5ENWA 4XX1E 1ECZA 2GBUA 5DC2A 1F86A 2JJSC 3C6SA 3HG0A 1BJ1H 1HCYA 3AXHA 5KVEH 2YD6A 3FQNB 2OAAA 3PJSB 2CBPA 5BNXD 4F15B 1P6WA 4JFEE 3MLUH 5SWSA 4HIIA 4YWGH 4M02A 2N1TE 5H2BA 3SYOA 4KVNH 5GISL 5D8JL 2X70B 1PKQE 5ENWB 4HUXB 3KGSA 4ELKA 3OKEB 1U8NA 2OM5A 3RWJA 3QZPA 1AAJA 1TVDA 3PWPB 4OFPA 1OSYA 2B59A 4QHMA 3VGGA 3ZKND 4NPYB 3IAQA 2F0CA 3CZFB 1A1OB 5HYEA 4NIKB 3CFBA 4OLUL 5CSGA 5H2BB 2EUVA 3EYOA 3L3HB 5H94A 3CDFA 2P4AB 3UGUA 1NGQL 3Q48A 1T1WA 3LKPB 3GB7A 3L48A 2EH8L 3L8QA 4IJ3B 3RTQD 2Y23A 4OJDH 2ALWA 4YO0A 5FR3A 1GPOL 2ZUTA 4LVHB 4YHMH 4Y1AB 1BZEA 3CFBB 3HNSL 4YZFE 1JV5B 3PWLB 1BWMA 1KPRA 3WHE1 1FHNA 4YUEH 2JMRA 3T65A 1G84A 5DZJA 4KGJA 1EX0A 5I9QC 5IROD 5F2FA 4JO1L 4LCCC 4B9FA 3B2VL 4CILA 5E1HB 4NUJB 1DFXA 2Z34A 3MGTB 4LLYB 4WTZG 5BO0D 4GRWE 4PRID 1CPUA 2YOCA 1JZ6A 2E7LC 5D1XE 1ZGLB 4GKZA 1O6VA 1SJHB 4PRAB 2H1XA 2CDEB 2Z7UA 2EDBA 5AB2A 4JFEA 2BW4A 1XF1A 4DPAX 4DW2H 2KPNA 2ZWYA 3HC2A 3TWCL 4L1SA 5JOPD 1UJ3C 3EFOA 2VH5H 4BJLA 4ZXBA 4LEXH 2GEEA 4BYHA 4NNPL 5DR5L 1A1NA 1UD5A 1D5XA 5JW5A 3TWYA 1U4FA 2YUWA 1YYLH 2WXNA 4PRAA 1FP5A 1W9XA 2B15A 1AGDA 5AFAA 3O6FC 5FKPB 3VFTB 4EZKA 2HTKD 5J11C 4IRJA 2FH6A 1QW8A 1RUMH 5IVNA 3K72B 2OMUA 3ATDA 3C5JB 4HC1L 5JUEL 1O7DC 5DFTA 3BSZL 3BLBA 1ZWIB 3VXRD 5F21B 4U1SA 1PZSA 3FYIB 5E70A 5LAXB 1BEXA 5F89A 1EHKB 3OGOE 4IRJB 1BD2D 3I9GL 5BRZB 3HRPA 4M5SA 3ATEA 5CAYB 1MWAL 2VQ1A 3GZPA 1JYVA 1NOLA 4MMYA 5HDLA 2WP3T 4W9IC 1ZWIA 3EDFA 2FBRA 2V2WA 1D5BB 4JFPA 3TGXA 3PNWB 1XV8A 3LZPA 3AGWA 2HMIC 4JJOA 1UM4L 4AMXA 1KNOB 1F3DH 1OARL 4E5XG 2J1YA 1OCZB 2YGNA 3BKML 5D7JA 1EZVY 1OB1B 1QYGH 4CU8A 1Q1JL 5HJDA 4DPBX 2ICWJ 4F8TA 3S36X 2EE3A 5ITFA 4FQHA 4OZHE 2HLFD 1SHWA 4NQDD 1A9BA 1KYDA 1Y1UA 2ZKWA 1M6UA 5ABAA 3KBEA 3W1ZA 4XPTH 4N4YB 4S1QL 4C8XA 3M1BA 2FQFA 1TQWA 4YVUA 3CZJA 1EXUA 1G9MC 1FZKB 2OW6A 3UIZA 1M7IB 4TVPD 3BH9A 3P4MA 2APFA 1RULL 4JDZA 4PLNC 4OCYH 1CFTA 4HK3J 4CGUB 4WTQA 2ZXDA 5MEPA 4R2GD 1HNYA 2Q9OA 5KVDL 3O3BB 4FOMA 3U30B 3Q0HA 5FW6A 1J8HD 1P4LB 3L9RA 5BRZE 4KDWA 4OR1A 1YZZA 2IGTA 4JL1A 3VG9B 1JN6B 5IB2A 3P4MB 3RTQC 3AY4C 3GSUA 2ZX6A 4UIMB 2K4AA 3AS0A 3P4LA 5KYUB 4FP8L 4WTWA 3D2TA 3T3PB 4JB9L 4LHUG 4M7KL 1Q1PA 3SEPA 2D7MA 4U1IA 4EKXA 3T77A 1UM6H 3IE4A 5BRQA 1OARH 1VFUA 2VABB 5DZNA 3KZ8A 5JHDA 3ROOB 1AQHA 4YHIA 3I85A 3IXAA 4P9HC 2DBJA 2X6BA 1YEGL 5EU5B 4B7IA 1IGTA 4MQXC 4CW1B 2ZSWB 5TE6L 1NMAL 5I8CA 4Q58C 1YO4A 3ULUF 2ZWLT 3QULA 3GT6A 1VKXB 4F8PA 3ES6A 3HMXH 4F5CE 3IETA 3H7BA 4PJDF 2V3EA 5E8NA 3SDYL 2CLZB 3NJKA 2WSDA 1G0YR 4WO4D 2ODHA 2WVVA 3MJWA 4ATTA 1K8IA 4H88H 4K2UH 4OLVH 4K3EH 4LVOC 3TVMD 1MWOA 4B9YA 3IFNL 3GTTA 3ES6B 2WLZA 4XB3A 1UZ6F 4YQXL 4CC1A 1BHGA 4F33B 3TH3T 1GCYA 5HJGA 1J9RA 2VKWA 4ZZFA 1DVFB 1NSNH 2CR0A 1NEPA 4X7SL 1QYGL 3QHFL 1XB6A 4YEEA 5KOMC 1AO7A 1I8IB 3M17A 4PP2B 1Z9MA 3O3EB 1K2DB 4XP9H 1AKJB 2E7HA 5FWRA 4JQXA 3BDXA 5HHVL 3SDCC 43C9A 1XAUA 4KFZC 2ZOKB 2AABH 2XACC 4JG0L 3FSAA 1ORQB 4GY4A 5I1EL 1QSFE 2Y7LA 4A38A 2KZ1B 4WGKA 1BZ9A 3GMQB 1JFQL 1AD9A 1A6WL 4Y16C 1RLWA 4DK3A 5L0QB 2Q7AA 3NZ8A 4LT7A 4UT9L 1HHIA 43C9B 1ZDSA 4KI1A 4YDKL 5EOQH 1N67A 3OJ2C 5JPMC 4UIKH 1LP9A 5E4EB 4NP4L 5GZNA 4IM8A 1AGCB 4FQPA 5J11B 3SJVA 1S9WB 1X5JA 5JUEH 3VNYA 3CTTA 4N5ED 1HAWA 3MRKA 3D08A 1OAZL 1ACZA 4GEJA 3VXQB 5ADOL 5DHYB 4CMMA 3QUYC 4L0YA 1WK0A 1YEFH 3SZ6A 1IC0A 3H9SB 2AJVH 4M5TA 3SGEH 2JCCA 2X3BA 1NBZB 4MA3B 2BPBA 1P0SE 5I1CH 4L1BA 1PEZA 3O9WA 3BP5B 1EHXA 4JPKH 5AOMA 3SQBA 1QQDB 4AUUA 3MRKB 3C6LD 2GK0A 2JKWA 3C60A 3F7RA 3KCPA 3Q8FA 3GC3A 3G6JF 2WLYA 5IJKA 4YE0A 5D1QC 4QRRB 5E8PB 2Z0BA 1WTGT 2XKSA 4KVCH 5JZ7D 2FWOB 2PO6B 5IMOA 4XVUD 3UTTD 4RMBA 3HRZC 4K9EH 5EF3A 1CT8A 1FBIL 2B1HL 3DK2A 4PHZA 2VDKL 2VISA 4OZFH 4XCNB 5FV2A 5GRUL 3V6BR 1QI3A 1DQJA 2WLMA 3NA9L 2H9GB 4MAZA 3QQ9C 4PBVC 4JAMA 3SKMB 4HUVA 3SPVB 2ARJA 3KLQA 1NAKL 2R0LH 4JFUA 3NEEA 4YSOA 2P28B 5I6PA 1MCHA 3FCTA 4QKTA 4DP5X 1KSRA 2WLHA 1MCWW 4CC4C 3LNEA 1KIRB 4DQAA 4KAQH 4XPGL 2DQ6A 2VXUL 1ID5I 2ARJB 4GB9A 3CH8A 5CCJA 4B0MM 1N0LA 2RHEA 1MY5A 2G60L 5LQBH 1FAIL 5GGRY 2MQCA 5EIIG 2E5EA 3MBEB 5AWNH 2H3XC 3FFCE 3LKOA 5CD5C 3VH8A 4Z7OF 4KMQA 4XVTH 2Y7OA 3B2UD 3FB7A 4R90H 1TVBA 2IWGA 1IQWH 4X5LA 4LKXA 1N0LB 3UTSA 3V4PB 4LQFL 5EG6C 4X9GA 4QTIH 1FVCA 2V2TA 2XNAB 3ZIYA 3FNKA 3NSYA 4N6RB 5IB5B 4AXWB 2AJXL 1QEWB 5K9JH 2DW5A 1MEXL 4P49A 1MREH 4AGOA 4NO0B 3ROLB 3TOPA 2E4FA 4HLZH 3FTUA 2P5ED 4H0GA 4TUOB 5F3FA 4A7GF 5HPOA 2VDQB 5H35B 4RGMC 5HHMB 3NJVA 1I9IH 1IAKB 1AHWC 2X1PA 4KQ0A 4K71C 2BDNH 2VXQL 1QEWA 4KY1H 4JG1L 2OQJA 2XVBA 3ZXAC 5CUSH 4HS6A 3R1GH 1QABA 1U91B 2G4GA 3AMLA 3N41B 4BFJA 4Q14A 1YLBB 1LLAA 2IDTA 4B9ZA 3FCSB 1JTPA 1RK1A 1FH2A 1M7DA 4MHHG 4N0UB 2COQA 3B5HA 4S0SD 2VXSL 4YIQA 5DRWB 4CUCA 1UD8A 4M6ML 2Z4QB 1OXYA 1K8DB 2DQMA 1UWYA 3KYKL 3BWAB 3L95A 2PABA 1P4IL 5BVPL 1RZJH 3TZVA 4ALAL 1HH9B 4NJAH 4NCC1 3ZHFA 4JPWH 1XSKA 1FC2D 3UAJC 4ZFZB 4EN2A 5AVYB 4LEOB 4B97A 5ITBH 3V0DA 3RTLA 3BVUA 5L88L 4Q9RL 2B1OA 3V5HA 4H1LH 5GISH 1JHLH 3TYGH 1PNDA 4YSQA 1Z66A 3T0XA 2NY6D 1KLGA 2WNGA 1FN4A 1BFOB 1CBVL 3EDDA 2YK1L 3CX5K 4DK6A 2JCWA 3HN3A 5FPIA 3NSDA 3VE0A 3S37L 3GO1H 4L8BB 1SUJA 2IC2A 2R0LL 2FB4H 3QG6A 4YFLI 3ZTCC 4LLAA 1T1YA 5C0ND 4B3VA 5JDSA 2YA2A 1GXEA 4QI3A 4P2QE 4FQXD 3LV3A 4R97B 3VRIB 3VRLF 4KMLB 5GS0L 1F11A 5EZLA 3T3ME 4Y8DC 1TUPA 3MMEA 2H0EA 1IRAY 2YIHA 2QQNH 5CFAA 5JHMA 3DJSA 1L7TH 4WW1B 1OGAE 2Z92B 3L3GB 4JHBA 3L5XL 5FCUH 3TN0A 4HISA 3RVVC 2GSGA 1KTJA 4PCKA 4PJIE 3MACL 3SDAD 3SKJL 1L0PA 2DQHL 3TN0C 1A66A 1CLCA 1G7HA 4P2OA 1CO1A 1K4DB 3IJYA 1CFNB 1MSPA 1QSFA 2H1PH 2ICEB 2ICEC 2QQKL 4HWZA 2VERA 4HOMA 3UIYA 3L81A 4IDJL 3Q1EA 1T0MB 1HOCA 3SGDI 2DYSB 5JO5B 3RVWD 1HC1A 2WKLA 3TN0B 1RZKC 4KQ4H 5C0FB 5KYXB 1X5IA 1L5GB 1CYXA 1XB8A 2BVUA 3H9SE 1L7IL 4PJ8D 1C8PA 1S9XB 3IMSA 4WEMB 4QYOA 5KJRH 2BZDA 1GKEA 1KIPB 1LO5A 2AQ2A 2FJGB 3HCVB 3MNWA 4HWZB 1SLWA 3H2WA 3TZVD 4NQSB 4P46A 4PREB 1X5FA 3DHJA 5F7MC 3CG8A 4KJPC 2ZWSA 3WEOA 1Q9LA 2FEJA 1KBVA 1S9XA 4F9PA 2CAKA 3TURA 1T0NA 4XP9L 3TCXA 5ID0A 2DJMA 2K7PA 2PWHA 3RWJB 3MZTA 3UOAB 5IW1B 4WWKC 4I9WD 2ESVE 4GSQA 4OSUL 5IF0B 5T1MA 4ANXA 2FSEA 1A6WH 2Y5TB 3QPQD 3I74A 4JHUA 3EYOB 3L3HA 3NIGE 4JM2F 4R7VA 4S0TD 5E24E 3CLEH 1T03H 1Q0EA 5D6DC 4GKOA 4NN7C 2WQVA 3WNLA 2EILB 2JB5L 1FJ1B 2KQMA 4U6YA 3C2AL 4K5PA 3BAEH 1KXTB 4FKKA 5EO1A 4D8PB 3C8KB 4WU7B 1Z32X 3O41A 3I6GA 3AM8A 4N26A 4N2FA 5HI5C 1JV5A 3L2LA 3PWLA 1FL6B 4TNVF 5D6CA 1IV8A 3GD1C 5F7AA 4ZFOA 1BBDL 2VDKB 1IX2A 1WCBB 5DRNB 1X5XA 2JLLA 3LDBC 3P77A 1HXYA 3PWPE 3UO8B 1R3JB 3K4DA 1JHKL 3RDTB 3O41B 4OIBA 1KCRL 1REIA 1GTNA 3VFRA 3SDYH 1ZA3A 3ZTNL 1YDPB 2IAMC 2XXMB 4QIRA 3ZE0E 2WXGA 3B56A 2NY5L 5ACMA 1L6XA 4AZ8A 3DUUB 5DWUH 1AXSA 3TBTB 2NW3A 4XE0A 4ZMWA 2BS8A 2Z6FA 1D5XB 4EI0A 3BT2L 3O8XC 5JOEA 3CSGA 3MOBH 1YDPA 1QWUA 3BQVA 1BXAA 4DJMA 2EEXA 3S5LA 3VWJC 3EJSA 1V3JA 3VMNA 4JFXB 4OCXL 1HILB 3NDYE 3V0FA 3VFVB 4K94C 4G6MH 5SWQB 5ABZA 4MJJA 3BEVB 3PE9A 3UABA 4N24A 3VQ2C 4X98A 2EECA 2A2QT 4LLDB 3FULA 3Q2WA 4MJ5A 4CDHA 2LQRA 3QR1A 2D03H 5AW5B 2QDWA 4AGNA 4ZMQA 4XO3A 2CO7A 2ZNXA 3EF7A 5F0PB 5J3HD 4Z76A 4YDZA 1E5BA 2GJPA 3HZ3A 4TRPH 4L0ZA 1CGUA 5F93C 4F7TA 5A40E 4PBXA 5IR1B 1XR9B 4W93A 4NNYA 3KPLB 3HE6B