3G6AB

Crystal structure of anti-il-13 antibody cnto607
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
222
structure length
222
Chain Sequence
b'QVQLVESGGGLVQPGGSLRLSCAASGFTFNSYWINWVRQAPGKGLEWVSGIAYDSSNTLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLGAFHWDMQPDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CNTO607 Fab Light chain
publication title Epitope mapping of anti-interleukin-13 neutralizing antibody CNTO607.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6aB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6aB01
3GSOB 4EEEA 4U7MA 3E2HB 1EH9A 3WUWA 1U9KA 4X7CC 2X41A 1VFAA 4FFVC 1CL7L 5J1AA 4M1CD 4V1DA 5INCA 2G9HB 2AJVH 5LCVH 4Y19B 3CGTA 1OGTB 2EIZB 4NRYA 5HD8C 4PJXE 3K4ZA 2ZJSH 4PJCF 4P4KA 3GIVA 5T3XD 3VW3L 3O6LL 3IFPA 1KPRB 4B7LA 1ACYH 2ESVD 2FZ3B 3ILQC 4HIJB 1EFXB 3UBXG 4L9LC 5D8JH 3T0AA 3BDBA 4F9LA 1UKTA 5JDSB 4L1DA 3MO1B 1NCTA 3BISA 1U0QA 2BFVH 4AM0B 3HHRB 1G7MA 3VFVB 4MA1C 4NQDB 5D5ME 1Q94A 3S3SA 1HSAA 4HUWA 3L3DA 1FNSL 5I30H 4AEEA 1BZ9B 5HVWA 3GRWH 4JQXC 3L3JB 3IXAB 3QIWD 5EUOB 5I8OH 4ZSOA 2DJ4A 3CFKB 5IR1A 1I8LA 4LLUA 4L8DB 3TCLA 3WKML 2R2BB 3GI9L 4PYGA 1KCKA 4FQHB 3OG4B 2N7BA 4RA0C 2WUCL 1KENL 4JFFB 2I5YL 2A9NL 3MOQA 2HP4A 2EIBA 3QUYA 3ES6A 1U8JA 3RGVB 4NKIL 1G9NH 1LEGA 4M6AA 4E41A 1DBJL 4MD0A 2E9WA 3Q5TA 1ITBB 3EYUL 4MJ6B 5D4QA 4XXDA 4NZUH 4PRBB 1OAZL 4KQ4H 5C09B 1FBIH 3AROA 4OM0H 4YXKH 2W0FB 3ARDB 5D72H 5EC2A 1F3RB 2BNUA 5BRZB 3RZWA 2Q8AH 1FVEB 5IESL 2YPKB 4Z7VB 1QSFE 1ORQB 4U6HA 1TJIL 3MRKB 4MAYC 3VG0L 1DR9A 3Q3GA 1RV6X 1U8IB 3O11B 5DUML 1BAFH 1Z9OA 1RHFA 3MV8E 2JCCF 4JN2A 3HZVB 1WBXA 5T3ZE 4MQXD 2VLLB 2B0SL 3AM8C 4OLYL 1ORSB 3VXMD 2BC4A 5TH2A 3GMMB 4JZOA 2F5AH 3EOAA 1A9EB 1PY4A 3C6SA 1MY5A 1F4XL 3JZ7A 2Z8RA 3BZFB 2Z92A 3G5VA 5E2JA 3F7RA 3MLZH 1FFNA 5E9DE 3RWJA 4H0GA 3SKMB 4I3RL 3B9KD 3BPCB 5IW6A 4FXLA 1F8TH 3V4UH 4OFYA 3T0EA 3UDWC 2H1PL 1MCPH 1QFPA 1OLLA 3OKDA 4UDTB 5KW9H 5A2LH 4PB0L 3SDXF 1RJZB 3TBVB 4PJDA 4YDLC 4JAMA 3S5LG 5J3HC 3U82B 4DZ8A 1CK0L 2R0LH 1SBBA 3L3KA 2IBZY 2NYYD 3V6OE 5MEPB 3QUZD 4RMQA 4ZUWA 1AXSB 1WFOA 1IT9H 4HS3B 5T3ZD 4POUB 1GOFA 3O45B 4HFWA 4MSWB 2ID5A 4ZO9A 1UGNA 1N6QH 3FFCA 1MJ8L 2X9XA 4KTEL 1G7HB 1MWAA 1ZA6B 3TBWB 3WFHB 4WI5A 3CDYA 1A2YA 1XGYL 1FIGH 1HSBB 2DQDL 3VRLF 1XF2A 1KLGA 5D1ZD 5SWSE 3WFEL 3VRJA 1Q1JH 1FDLL 2YSSB 4HCRA 5GRXG 2X70A 5LGJA 2GTWA 4OIAA 4X99A 4M62H 3CXHK 3CSGA 1EJOH 3IS0X 5K9QG 1WFTA 1A8JH 2DLFH 1Z9MA 3GSUB 2NXYC 6FABH 1UA6H 4HKZA 2IH1A 4NBYB 5CZKA 3V8CA 5JPMA 3G6AB 3S6CA 1FAIL 1PW3A 3RIFF 3WS6A 5DD3L 2XA3A 4NN5C 1GHFH 2HT3D 2DYPA 4OCWH 3GGWA 3FMGH 2YEZB 3L9RB 3V6FA 4F7CA 2VJXA 1I9JH 4OJFL 1KCUL 1E0OB 4PJCA 1CGSH 1OTSD 1CTOA 2PCPB 5ADPL 1C12A 4EUPB 5BVPL 1U95B 3HI6L 1M7IA 2XZQH 3DBXA 1IM9B 2AAVA 3VGAC 2PNDA 5F7NC 2EDNA 1HH6A 3MJ9H 4QHNB 5JPNB 4QXGH 4M3KB 2YD5A 1FG2B 1LEKB 3I2CH 4ZS6C 4PJ7B 3ZE2F 2CGRL 4Z8FL 4FQ2H 1OPGH 4KDWA 2HLAB 4OT1L 4JPKL 2HKHL 1F58H 2F19H 2QR0B 5EIIA 2FNBA 3HS0B 4XTRD 3WDIA 3BDYH 4MA1B 3VWKC 2ZUXA 5SWSD 3KLHC 2EXYD 4TOYH 3D2UB 3NZHH 4XWOC 5C08E 2C3XA 1FNHA 3MNVA 4G42B 4Q2ZA 3V52L 3N1GC 3BZ4A 3P77B 5H8DA 3AY4A 1AC6A 4PRDA 2EDTA 3IDMB 1AQKL 5DRNA 3RWDB 3K2UH 1ZHLA 1JNHA 4NGHL 3LEYL 4OD2B 3G5XB 4L4JA 1UJ3A 3HPJB 1QBAA 3GO1H 4JY6A 2MWCA 1U3YA 1NGZB 2EDWA 4APQD 3DYOA 1HOCA 3UBXB 1IKNC 4PS4L 3B6SA 3N1QC 1JIBA 1S7UB 4YDVA 4H1LH 4L4TA 2EEDA 3QDGB 2O5XL 1BQHG 1NC4D 5JIHA 2EIEA 1RI8A 4UQ2A 1CLOH 2VLJA 3RTQA 2B5IC 1SJHB 3I6GB 1BQLL 4Y5XB 3RX5A 2BXZA 3LS4L 4WHYH 4GG8B 1LE5B 1ZT1B 2UV3A 1CXEA 5D9SA 3O4LB 4F7EA 1EJ6A 2PO6D 3L3OA 2AJSH 3RX8A 5GGTH 4A6YB 1E4KC 1FC1A 3OF6A 4G7YL 5ID1B 2YUWA 3RWIA 3MLUH 4FXGB 4KAQL 3FB7B 4ZG1A 3SCMA 3LKSA 1XGRB 2GJ6B 3O3EA 1UXWB 5ACZA 5TQ0L 4KTDH 5CD5C 4GKZA 4YDKH 5GS0C 1FGVL 4G9FE 5T5FH 3KNBB 4YHKL 5SX5K 2G60H 3WE6B 3C2AH 2IPTL 3BWAB 4L8SB 4LRIC 5EWIL 5KVDL 5F1IA 1OP3H 4JRYA 3HZYB 2ZP0T 5L8LB 5ISZE 3MJ6A 2N7AA 2WBJB 5HJ3B 1DN0A 5JW4R 1KCVH 2DQIL 1UACH 3EO1A 2ZUTA 1FVDB 4NQSB 3BP7A 5IV2A 3UJIL 5KN5B 1Y6KR 1MJ7L 5FDWB 5ICYA 2BOCA 1DUYB 1LWRA 3FO1B 1KJ2H 1PX4A 4D8PA 4RMWA 1FCGA 1GPOL 1I7ZB 4XPHH 4P23C 2R69H 4PGDB 3SDXA 4KTYA 3QHFL 1K8IA 5CCKL 1JWUB 3D5OF 3VFPA 1CXFA 4XZUA 1BOGA 4XNYH 1PEWA 3ZHKA 2VLRA 2GJZA 3BGMB 4OZHF 1P4LA 3QI9D 5FGBC 3D25B 2KH2B 4Y7MA 4G9FD 3SDYH 1HCFX 4XPAL 4KQ3H 4OF6A 1I1AB 4MJ2A 4UTBH 1FZJB 5FYJD 1Q0YH 3VFNA 4EN3B 1QEWB 3THML 1JWSA 4IMLB 3UTPD 1XF5A 3DMMB 4N0UA 2AJ3A 4KJPC 5FOJA 3BVNB 5ALBH 4JFEE 3PXJA 3WFDL 1KCSH 1CGXA 4IOSD 1TVDA 3V7AG 3KPNA 3DIFA 2FX7L 5DQJB 5A3ID 3ULVL 3AAZB 3VD3A 1X44A 1QYGH 4Z7QF 2H26B 1SVZA 3P2TA 4DUWA 2E9IA 5D1QD 5FGRA 1PBYA 1FL6B 3TO4D 3S5LB 2WAHA 5FO8B 5DF0A 5JQ6H 3O41A 1NDGB 4NFBA 1JF1A 3O6FC 3VG9C 4RQQB 3REWB 1LGVA 1I85A 3MQIA 5DZLA 1G7JB 3PWNB 2FATL 1DQLL 1QO3B 3IKCB 3NN8A 5I66B 3GMNA 1F6LL 4HULB 3OXSB 3GHEL 5EH1A 1FZMA 2EH8H 3RVUD 2O5ZL 4Y89A 3WFZA 1VGKA 1D6VL 5F3BB 3VGAB 1X6LA 1BJMA 5E8EA 3WIIH 4LMQE 1EPFA 3JUZA 4Q9BA 1HDMA 1ZT7A 4PGBA 1HN1A 4NQCD 5CSZB 4I0PC 3SN6N 3FQRA 2YD1A 1BGXL 1RULH 4PRIB 1AQDA 4IBLT 2RFXA 2ZCLH 4JO4H 5FYKU 5KS9F 1YN7A 3VWKB 3KJ4C 4XGZB 3P11H 3VFRB 2ZUYA 1D5MB 4C57C 1CCZA 4OQ1A 5GGVY 1TZGL 1PG7L 5FYKH 4FQJL 4GXVH 5JR1H 2E7MA 1XMWA 4Z0BL 1BEYH 5HXMA 1IARB 3TJEL 2DQCH 5ESQA 3B9DA 4EI5D 4G6AD 5TE7L 3I75A 4M02A 3KPOB 3VFTB 4M6NH 4H20H 2X4UB 3O9WD 3TYGL 4C56A 2YD6A 1YC7A 4RGMB 1QR1B 5IB5A 3H9ZA 1WBZA 2ZUWA 1JJUA 4X8XA 1HCVA 4FFZL 4PJ5A 4D3CL 2EE2A 3TNMA 3K8MA 4GO6B 4JPIA 1G6RA 2X40A 3IJYB 2K7QA 2F53B 4M4PA 1NBZA 5I1HH 4LLDA 1SEQH 3BH9B 4K3JH 4DQOL 2A9ML 1Q9KB 3KPSE 5ICXB 4U1IA 1H8NA 1QSEB 4TPRL 3FT4B 3EDJA 4OCYH 4U33A 2B5IB 3KLAB 1FZKB 3ARBA 3PWPE 5C7XH 5I1EH 3CFCL 4HAFA 3SDDB 3WJJA 1A6UH 4UINL 2LFGA 3OKEB 5I1KL 1MHPH 1JCKA 5F89A 5DVNA 5DEFB 3B43A 3GSVB 3MBED 3VWJC 1P1ZA 3D69B 4KC3B 1L0XA 3FCTA 2GSIA 2MMXA 3MGTA 3I3EA 4U1MA 4KROD 3L5IA 1NUNB 2R56L 3HE7A 3BRGC 1QRKA 4PJXB 1S5IL 2C1OA 3QUXA 4OKVB 2BNQD 4YFEA 1ETZB 2EH7H 3VGHA 4ELME 4ODVH 4G8GA 1JN6A 4C4KT 1CF8H 4AH2A 5C0BD 3ZE0E 1D6EB 4H5SB 1NFDF 2B4CH 1BQHB 3EKCA 3MBXL 3D87B 4F9PA 5KSBB 3CIQA 3NACL 4PUBH 2F5BH 2NX5D 5J7CC 1IC5L 4Y2DD 1O5DT 1E6OH 4M5YL 2DDQH 1RUPL 1CD0A 5EG6C 2P42B 4IRSA 1KG0A 3PWPD 4TULL 4J3UA 5E4EC 4XNUL 5M95B 5I1JL 2I9LB 2ZZUT 4L8BA 3FTGA 3FHQA 4LSDA 2SEBB 4ORGB 1X4YA 1NCWH 4QHKI 5DK0B 3QQ4A 4KHXL 4BQ9A 3RWFB 3DUUA 1E4XI 3VFMB 4CW1A 4GSDH 2FJGA 1JMZA 4XCYA 2OX5A 2FDBP 4P59L 1MUJA 4Y16B 1AJ7L 4J6RL 1F13A 1OOAA 1QTYT 1RIUL 5JHDB 3EYSH 5JO5A 4LEOB 2GAZB 4FXKB 5B3NA 1A14H 3LKRA 2VDPH 2EDJA 2FL5B 1HYSC 4LHUA 1J8HA 4J8RA 4OQTA 3WN5B 3U0WL 4QRSB 3EDEA 4Q7DA 4XI5C 1GGUA 3VFOA 7CGTA 3DO3A 4I18A 5TDNA 5E8NB 5LGHH 5FCSH 5HGDB 4MXVF 4W4NA 5FKAA 4Q9CA 1EGJA 2HH0H 1UC6A 4O58L 2X1PA 1R5WA 5FA3A 1F11A 3RBGA 2GK0A 3G6JB 1HEZB 3NABL 2RBLA 3S34H 1I1YB 1QKZL 3DHMA 3C6LA 4OM1L 2BJMH 4U1SA 1AIFB 1WBYB 3LHPH 1RZGB 1RZKC 4ZFZB 3HR5A 1JGEA 3ZKSD 2HJLA 4DKEL 3MV8B 4IRJD 3O6FB 3G6DL 3I50L 4WTXA 3ROOA 3VG9B 3FOMB 5J12C 3VFUA 5EUKB 2X4OB 4HWEH 4YHIB 2XWJA 3PJSB 1GC1L 3SGKA 1UWXH 4GLRH 1AD0B 1RUAH 2A6IB 2IADB 1MJJB 3MV7B 1I8MB 1EA9C 2R29H 4K8RD 1YQVH 1FNEB 1JRHI 4HXAH 1MCRA 4NHCH 4B0MM 3RWGB 5K9KB 2BHZA 1XCQA 5FUOH 2ZPKH 4R4ND 2PW2B 5BO1H 4QHMB 5E9DB 4I0PB 1QLEL 2EDYA 2XG5A 3JV5A 1HZHL 3T0XA 4U6XB 4GH7B 3ZE1F 4X6EB 4PJBE 5C07B 4W81A 5I73C 3GMQA 4NNYB 4YO0A 3DUSB 1IGMH 4PJIF 1AGDA 1YEEH 3LV3A 4XCFL 4HK0A 4LGRB 3KJ4B 1VFOA 1CGUA 3TLRA 4U1GC 1YYLH 2XQYK 1D7FA 3BI9X 1YY9C 3LPWA 3FN0H 2QSCL 4MDJA 4PJ8D 5I1DB 2BSSA 3UTTE 5DD6A 1ADQH 1XZ0A 1ZTXH 2A0LC 2J12B 3QEUB 4I8DA 1OSZB 4LRNL 4KXZH 3PP3H 4P3CH 3WIFB 5E6YA 3AS0A 2YPLD 1CFSB 1JGDB 1UM4L 3QG6B 1IGCH 4WCYH 3P4MA 4Y5VC 1AR1D 4M8QA 4GW5A 1D5BB 1CT8A 4WWID 4NZRH 1UENA 2PUQT 3JTSA 4HDIB 1IKFL 1I3RA 1B0GA 5EORL 5DO2D 2R39A 2GITA 1ZMYA 4UV7L 3KYNA 4P9ML 5DJCB 2BMKB 1A6TB 2VO5A 5E1AA 3H42H 2AEPH 2DLHA 2JE8A 2QEJA 3GMLB 2XQBL 4KJWD 1EMTL 4NUJB 2ED7A 3W0WA 3IGAB 4LARL 3MTRA 5EOCH 5HDLA 3B9AA 3W11C 3V4VH 4ONFL 4ZDHA 5HHVH 1QP1A 4QHUA 1A4KB 1AFVL 3MLRH 3NCEB 5DI8B 3CLEL 3O9WC 3TIDA 3MLVH 4F7MB 2HN7B 1UM5H 5CFHA 1CICD 3U4BH 1DLHB 1TJGL 2OSLB 4YGVA 2J8UE 4YHMH 4QNPE 5C0EA 2D31B 1INDH 4DVBB 1UH2A 3IDXH 3MLWL 3QO1B 2R8SL 1O0VA 4HK3N 1C16A 2D7PA 1Y18B 3MNWB 5JW4Q 5FV2A 2L0DA 4PRPD 5HBBA 5KVEH 1P4IL 1FFOA 2IPKA 3AB0B 3OKLA 3Q1SH 1D3CA 3S35X 1OP3K 2EDRA 3L95B 1CDBA 4NJ9L 3ABZA 4M7LT 1ZHKA 4S1QH 4XP4H 2V2TB 1MCSA 1TCRB 5HGAA 1FFPA 4GAJH 2E8ZA 1A3QA 1RZFH 2I26N 3RZCD 1AKJB 1ZLWK 2R1YA 3QIUC 5T3XL 4MNQA 1YY8A 3QZWB 3SDCC 1QBLH 4K71C 5KSAD 3CXDL 5GJSL 1RUKH 2PYFB 4XPGL 4YE4L 1GIGH 5CJOL 4D9QD 2GSGA 3GIZL 4Z7VF 2HMIC 3RUGE 1J0JA 1W8NA 3ET9F 2APFA 3RHWK 2CKBL 4O2CB 4GBXB 3WHE1 2X9YA 4MNHA 4K7FA 1I7UB 1U8HA 2AJXH 5B8CC 4I48B 1U8PA 5EOTB 2PN5A 4O2FA 5K9OA 5C0JA 2VE6B 2R0WH 3CSPA 5JOPE 1V7NH 5D7IE 3PQYE 5HYQA 5TGBA 4XVTH 4I2XA 1LD9B 4M93B 5C0NC 3LEVH 4P2YA 2KKQA 5EU3A 2MOVA 4MQ7B 2QQQA 4JB9L 4R90H 1KLUB 3BXNA 2YD2A 4KVNH 3H9HB 2OJEB 3MYZA 3H2WA 1UZ6F 4NNPH 3P0YL 4Z0XB 1G0YR 3NIDE 4MD4B 1CDJA 3MRFB 4N1EA 2X44D 3SDAB 2NY1B 3VFGL 2GJJA 1VKXA 2WM0A 5FUZL 2APWA 3HI5H 2EYTA 3VFWB 1NEUA 1YEDA 3OBAA 3OAZK 4ZTPH 5BW7C 1JK8A 1H3VA 4MWFA 3KXFA 4JANA 3O3BB 3QCTH 5IROC 3HRZB 1T0PB 5CEZH 5ICZB 3CPLA 4KU1A 1D5ZB 4U1NB 4UT9H 3VI4E 3LEXB 4MAUH 5I18H 2HVJB 2FJHA 4P2QB 2AVGA 4R4BB 1DVFC 3FQXA 2Z8SA 2IALA 2Y36L 2GQHA 4LP4A 5JOPD 1PZ5A 5GRJH 4U6YB 3GSNH 1DQML 1KB5L 4M48L 3ARGA 2NY7H 3OKYA 5ISZB 3EYFA 1T03H 1RURL 3O8XB 3CU7A 5FK9B 1MI5A 5IBUG 1KEML 1KIPA 4QF1A 4FG6C 1MLCB 4AL8H 5T33H 4HLZG 2XWTB 3LRHA 2NY5L 1F97A 2QKIB 1BJ1H 5IWLC 5EOCJ 4ETQB 4E0RA 5DK2A 5DJ8B 5A16A 3VD9A 2PW1A 3KYMB 5I73B 1S7VB 4L4VD 3GSOA 4OLUL 1KJ3L 5KSUB 5DK3A 2FEEI 2XZCL 4U1GB 1BVKB 2KQNA 5K33A 4JRXE 4UT6L 1YC8A 5E24E 3LKNB 2CK0L 4Y19A 4LEXL 4KZEL 4WDIB 4R26L 5AEAA 3KHOA 1OGTA 4MNGE 3O2VL 1SMAA 4DKFL 4DOHE 3MJ8B 3QH3B 4I4WB 4PJGF 3BKCL 3P9LB 4XP5H 1KPRA 4Y5VB 3HAEG 3I3BA 4KMTH 1NPUA 4HIJA 1EFXA 1NEZA 2Y06L 1WIUA 4X4XB 5GJTL 4F7PB 4YUEL 5I15L 5JDSA 3DGCR 3CAFA 3QCUL 3MO1A 1J0YA 3D3VE 4JFEB 4XPFH 1M05B 2DLEA 3WNMA 4AM0A 4HS6B 3MCG1 3VFVA 4NQDA 2WANA 5JXAH 2DM4A 5T3ZL 1ROWA 1H3UA 1UCBL 4FFWC 3TT1H 3F7VB 5HHXL 1S7QB 2A83B 3L3JA 2OR9L 3FHAA 3IXAA 4KDTC 5EUOA 1CFVL 1WT5C 3QEGL 3CFKA 4B41A 3EJJX 43C9B 2C9AA 2CIKB 4L8DA 3X3GL 3IFNH 2R2BA 4JZNB 5FO7B 3VE0B 4JRXD 4FQHA 3PHOB 4NPYB 4NUGH 4NWUH 4YHOL 2V6HA 5DO2C 2EO9A 2VZTA 2VZVA 4JFFA 4M43L 2OTWB 2X4SB 2NY6C 4XVUC 5F72S 1J88A 4P2OC 3LPFA 3RGVA 3MXVH 5F96L 1K4CA 2CQVA 1UWGH 1UM6L 2FECI 3BQUD 1T6WA 2VZ3A 2XZAL 4POZD 4MJ6A 4PRBA 1T83A 5C09A 3DV4B 5D7JB 3QIUB 3RFZC 3KGRA 2H32B 4K71B 5JIPA 2R1XB 3QQ9D 2W0FA 5JA8B 1B6DA 4S0TD 5BRZA 1M4KA 2IANB 4NCDA 3HR6A 1FVEA 1IBGH 2YPKA 5H37G 1G9MH 1ORQA 3UXFA 1CI5A 3LMJH 3MRKA 3ZDYF 4JFHE 3U0TB 5DD5H 1YEJH 3MRBB 3R4DA 5B8CB 3VI3E 3IJSA 2DKUA 1E4XL 3HZVA 3QFDB 5IJVA 5IB2B 4R4FL 1CLYH 1ORSA 2QQKH 5HDQL 4OCXL 1F4YH 4M03A 3HC3H 2VXSL 4LIQL 1A9EA 3M8OL 5DR5L 3TNNB 3JBG7 1BFSA 3BZFA 2OM5A 4NDMB 3HUJF 4QEGA 2UWEE 2X6MA 1VFMA 5KVFL 3N9GL 3MJ7B 2F8OA 2OL3B 3SKMA 1OW0A 5IKCA 2V5YA 3BPCA 4UB0L 3QDJA 1V7ML 4Y4HB 5DLML 4Y4FD 1SY6A 3SE9H 1OQXA 4HKXB 4OGAC 5IT2L 2FB4H 3ARFC 1BD2E 1IL1B 2DD8L 1F3DH 2VDNL 4D2NA 3TBVA 1LO2L 1LMKA 4ELMB 1DBML 1YNLH 2VH5H 4XCNB 2XFXB 2AEIT 3B8YA 2FIRT 5MEPA 3U7WH 5IB3B 4HXBH 3WS3A 1HKLL 1C5CH 5C0CE 4HS3A 5EO9B 4M7KH 3FQTB 5CP7B 3O45A 1HQRB 3EYVB 5JOFB 4MSWA 3TF7C 3EJZC 1AI1L 2DQJH 4XAKE 4RWHA 2ICWB 1G7HA 1NCAH 1HXMB 4CVZB 1JRHL 3WFHA 2G5BB 1HSBA 3M1BB 1KPVB 3A6BL 1XAUA 4HJ0D 1G7IA 5FB8A 1JHKH 1UB5A 4UTAL 5HI5D 2NZ9C 2A77L 1RMFL 4YBQC 3M07A 2PXYA 4H88L 1H15B 3M17A 4U6VL 3HTLX 1JZ3A 4FQCH 2DOCA 3VDAA 3HB3D 3H9SE 1REIA 3BZEA 3HE6C 5FA4B 5TPWH 4JFZL 4LCIL 2YEZA 3QG7L 3EFDH 5D7LD 4RFEA 3MRMB 2PCPA 3U7YH 4YWGH 5JXED 2ORBL 3PIQA 1A7QH 3PDDA 1IM9A 1SJVA 1V8HA 3MACH 5IBUB 4Y4KB 3WIHL 3BJLA 4XHJD 3L5HA 4PB9H 1T7YA 5I16A 5FHAL 4QHNA 5JPNA 3N1PC 4KK8C 4WY7L 1RU9L 1CE1H 2NY2C 4YLQT 1FG2A 1JWMB 4JCLA 5ERWA 1LEKA 4PJ7A 2QQNL 5JORB 4XAKD 5DJDB 2HLAA 2AGJH 1YN6A 4F8QA 2QR0A 3UCRA 3UEZA 3HS0A 1Z3GH 3V9FA 2NLJA 3C5ZD 1TCMA 4JFDA 3D2UA 4QOKE 4DN4L 1IC7L 3RL1B 2WP3O 4G42A 1BWMA 1DBAL 5I76B 3P77A 4OLXH 5FYJL 4PD4J 3CVHL 2Y7QB 3MYJA 1ZSDB 4RMTA 2XWBB 2VDOL 3IDMA 3LPGA 3RWDA 1GGTA 4OD2A 2DWEB 1KCRL 3VXPB 3HPJA 3H9SD 5IK3B 1QRND 3HAEB 5T1MB 4K07A 2CDEB 2W9DL 1E6JL 1FE8L 4BFIB 1X7QB 3K0WA 3ZSTA 4IMKA 5LBSL 2NY6B 1R3HA 4V1DE 2VQ1B 4P2OB 3OAUH 3U1SH 3MUJA 2RAMA 3QDGA 3U46B 5DURB 3W9DB 3V5DB 3AREC 1YECL 2DQUH 2JB6B 4Y5XA 1MREL 2P8LB 2XNAB 4GG8A 4LL9A 5MI0C 1ZT1A 1LE5A 5LXGH 5BCAA 3O4LA 5T5NG 1A47A 2NY4C 2DIJA 3B2VL 5T1LD 3HCVB 3O4OC 5FYKD 4MMZC 4LPTA 3R06B 4PJ9D 4LASH 1OARH 2JK5A 4LU5L 4A6YA 2J7LA 2YD3A 1F3DJ 2R15A 4FXGA 3UTTB 3FB7A 3SPVB 2HFTA 4YXLH 1IQWL 2VXTH 1HK6A 2GJ6A 1UXWA 3D0LB 5DJ0A 4PJXF 4XMLH 1KN4H 1Z5LA 5F6HI 3GNMH 5IOPB 4G6MH 5DD0H 3KNBA 4ZSOE 3WE6A 4H26A 3O3AB 1ED3A 4L8SA 3DXAB 4PV8B 2XTJD 5GZOD 3P30H 5KSBF 4JM4L 1A6PA 3HZYA 5BVJB 5L2KA 3BPLB 2WBJA 5HJ3A 5FOBA 3UZVB 1RIHL 3CLFH 3DVGB 2IAMC 1S7RA 4M6MH 1KELL 5D5MF 2WUBL 1FVDA 3TPUB 4JHBA 2CJUL 5DMGD 1L9NA 5EDXA 4BYHA 5KN5A 1A3LH 5BZWA 4E41E 5FDWA 1FN4B 4WI2A 2Y5EA 5J1TC 1DUYA 3GI8H 3FO1A 3UDWA 3SE4A 3ARFB 3CSBA 1I7ZA 1LK3L 4XBEH 1KOAA 1ZA3B 2GHWB 3MODL 5BV7L 4N90D 1JWUA 1C08A 4R3SA 3C60B 3CZJA 3QPXL 5D1XB 1MCCA 3BGMA 5E8PB 1NBYB 5C1MB 2WLYA 1NAML 2RIKA 2BRRH 3D25A 3V8OA 3FZUC 5IGXL 1I1AA 3SKNA 1FZJA 5TDOB 4EN3A 1QEWA 5J11C 2H9GB 1T80A 3DMMA 4HWZB 3KPRB 3LIZH 1T2QH 3OGCB 4IIQA 3FB5B 5DFTA 5CJ5A 3LZFH 4PJEB 1JNNH 2BSRB 5MENA 4LSSH 4LLYB 1ZHBA 1ZAGA 1NFKA 4NNXB 5DQJA 4QRTA 5L2JA 3AAZA 3Q6GH 1HXYB 2H26A 1PY9A 4X6CA 3HG1D 1NGQL 3P4LA 1FL6A 4HK3J 3S5LA 1U8NB 4WUKL 5FO8A 5DD1H 1NDGA 1AHWB 4RQQA 2FEEL 3REWA 2OP4H 4WJ5A 2VLKB 3HE6B 3PWNA 3MUHL 5D7IB 3IKCA 3T0EE 3PQYB 3H9YA 4GKNB 2IBGA 5SWZD 4DFHA 5GS2H 3S97C 1S9VB 1JGVL 5F3BA 1NANH 2RGSA 4PJDE 4KUZH 1H3PH 4JM2B 3KYKL 5E08L 3AGVA 1KGCE 2A1WL 1F90H 4HJ0C 1B88A 4K3HA 4F37F 4DVRH 2P5EB 3LD8B 3FOLB 4WI4A 4XPTL 4Y1AD 3RIFK 1MFDL 2NY2B 5HVFB 4PG2A 4PRIA 1KPUB 2AJYH 4XCCH 4GRWE 1DL7L 1VACB 3VWKA 2LU4A 2CPCA 3FFCE 4XGZA 4KY1H 3TYFB 1JHLL 3VFRA 1JPFB 1D5MA 2F15A 2Z91B 3S7GA 3B8SA 4FRWA 3EHBC 3GK8H 4M7ZB 1B3JA 1WEJL 3OKNB 5F1NA 3CX2A 4JO2H 1PZUB 2P7TB 1K85A 5E99H 3F58L 3I6LE 1MFEL 2R9HC 4KI5D 4IRZH 3QO0B 3SOBL 5T1DH 1SJXA 3NH7H 4XAWL 2X4UA 4RDQG 5CZVL 1QR1A 3CSYA 3MV9B 3U2SA 1A7PH 1CS6A 1IKNA 5IQ7H 4D0BB 4KKAD 3F7PC 3WYRA 1WISA 4LLQB 4OI8A 1RSFA 1BREA 4XP1H 3IJYA 2F53A 4PG9B 4R2GC 2PR4H 3BH9A 2AK4D 1T22B 1G1YA 4PJCE 1Q9KA 2EDBA 3A6CH 1BP3B 5ICXA 3VD7A 4F7TB 2BDNH 1QSEA 3C5ZC 3FT4A 2OR8A 4HZAA 2FECL 3KLAA 1FZKA 5JNYB 4CMHB 3SDDA 4WGVB 4KMLB 3OKEA 3NFSH 3F5WB 5DEFA 2NY4B 4K8RL 3O6MH 3O4OB 1AE6L 3MUY1 3D69A 3U6RB 5CKAA 4X5WA 2HT2C 3MNZB 4WV1C 1E4KA 1EHLH 4JDZB 4PD4K 5F6IB 4X7DC 2WBKA 3TN0B 4NQVB 1GAFL 1Z9LA 2X4RB 4DJMA 4EKXA 3MCLH 2HT4D 4YHLL 3ZDXE 3OHXB 4OKVA 1ETZA 3DVNB 2G75B 2MCG1 4URTB 3TV3H 3M45A 4QWWC 3RKDD 1G0XA 5DMKA 1WAAF 3QWQB 2C3GA 1D6EA 4H5SA 3WUWG 4KRPD 1BQHA 4LOUD 5EZOL 1DEDA 4J4PD 1MCBA 3ARVA 2VXUL 4S1SL 1DP0A 5H2BB 5KSBA 1MHCB 3TVMD 5AD0B 4KGJA 1MFAH 3D3VB 4WFHE 1A6ZB 3K4DA 1YMHA 1ND0B 3QEHB 1KN2L 3S8WA 3N06B 3IDNB 2GCYA 2IAMB 3IYLW 4UMGA 4JLRB 4NCC1 3HMXL 4NOFA 3RY4A 5JW3H 4ODXA 4MXWL 4RMVA 3ZDZE 4L4TE 2I9LA 4J7RA 4XHQA 3TZVD 1EEYB 4M9OA 2SEBA 5DK0A 2RQ8A 1FORH 4EDXB 2VLJE 3RWFA 5HI3C 3MUZ1 3LN4B 3VFMA 3WLWC 4Z5RA 4Y16A 4XCEB 2DTML 5IMMB 1NGWB 1I7RB 5JHDA 5JZ7D 4LEOA 2NQCA 2DIAA 2GAZA 3RA7H 3WHXB 2I60H 4PGCB 2FL5A 5GISH 6CGTA 2AJVL 1FLRH 4P4KC 2XI9A 5LCVL 2B20A 1IGTB 4QRSA 3WN5A 3UTQA 3TP4A 1TNNA 5DMGC 5E8NA 5J11B 2ZJSL 1EHNA 2ESVB 3G5ZB 3L7EB 4PRHB 2IQ9H 2F58H 5IB4A 5DC9B 4F9LC 1PDKA 3PWLA 5CEZE 1E27A 1ACYL 5HHPB 1I4FB 4G43B 3G6JA 3IB4A 2CKBB 1MRCH 5D8JL 5J89A 5M7QA 4JRYE 5J56B 1MRFH 4U4BA 3C9NA 1I1YA 5IB1B 4OUUB 4OLZH 3IETB 3GSRB 4OB5H 5HHOD 1AIFA 1WBYA 4YBLC 2P44B 2BFVL 3BD3A 1RZGA 3LSOB 5C70A 5CD3B 4HMEA 2CMRH 5C9JB 3LH2H 1RFDH 2YN3A 2GKIA 4NQXB 1NMAH 1N8ZB 1RJLB 5AZEH 3QIWB 4PPTA 4FTVD 3FOMA 3EIFA 4KKBD 4WGWB 5ESVB 5EUKA 5I30L 1ZEAH 4N0CD 1KSRA 5F7WC 1AD0A 4JPVH 3DI2B 2A6IA 3GRWL 1N4XH 2IADA 3KLDA 5I8OL 3MV7A 1I8MA 3SDXE 3TEUA 4Q97A 2BOBA 3KVQA 3RWGA 3MMEB 1HH9B 3SCMD 2PW2A 2UWEB 4QHMA 2VLRE 1S9WA 5CMAB 5E9DA 4I0PA 3QUYC 5HPMB 5KAQG 4OFKA 1G7PB 5C0GB 4U6XA 2NR6C 3FL7A 4EXKA 5JUEH 4X6EA 4I5BB 5C07A 3REVB 5LG1A 3D85D 3ULUE 4NNYA 3DUSA 1G9NL 4CVWA 1ZGLM 1B0WA 5CEZD 3SO3C 2V7HB 2MJWA 4N0UE 4JRYD 4JJ5B 5EZJB 3L3HA 4L3CB 5CP3H 4NZUL 4YZFE 4KQ4L 4NBZB 5I1DA 1FBIL 3QRFM 3QEUA 4OM0L 1OSZA 4HZLB 4YXKL 1RJYB 5D72L 3WIFA 4LAQH 1ACZA 2QBWA 1JGDA 1OT1A 5IVXB 2Q8AL 5L8JB 4RRPG 2YD4A 1D5BA 2EDKA 3BIAX 4HDIA 4PGEB 1JBJA 3J7HA 5DJAA 2C7UB 5DJCA 2BMKA 1BAFL 1A6TA 5HYJD 2ZSWB 4IOIA 5ALCH 1JVKA 2ZNWA 3IGAA 5J6GB 2F5AL 4S0SD 4TN9A 4EUPH 1IILE 2O93L 1KNOB 4RMSA 3ZE2E 5DI8A 1QPPA 4LSVH 3B9KB 1F5WA 4WV1B 3MLZL 4TSAH 2HN7A 4QTHA 1DLHA 2OSLA 2EDOA 5GRVL 3T0EC 3IDGB 2D31A 1X5FA 1KXVC 4DVBA 5EU5B 3P0GB 3QO1A 1F8TL 3V4UL 3RVTD 2PYED 1WAAA 1MCPL 1Y18A 3MNWA 3BMVA 2J2ZA 5K59F 5KW9L 2Q6WB 3LS5H 5DQ9A 1Q9LB 2XXCB 4JG1H 5I9QB 3QUZB 1KIUA 4KI1A 2JKXA 3L95A 2R0LL 4YR6B 2YRPA 4P2RB 4CVXB 4C56E 5DVKA 4OZIB 2V2TA 4KJQC 2EDFA 4NRZB 3LQAC 4BELD 5B21A 1AKJA 1IT9L 4NO0D 2V9RA 4PJ5E 2A6DB 3QZWA 4PTTB 4G6KH 2PYFA 1N6QL 1T66D 5JDJA 1MCFA 2ATPB 2JIXD 4ZXBB 3EO0B 4BSVB 1FIGL 4WW2C 5CEYB 4GBXA 1S5HB 3C5JA 4OCMC 2X89A 1I7UA 4I48A 3MRDB 1HHJB 1P7QA 4NKOA 3UP1A 4M62L 1EJOL 4LSUH 4JPWH 4DFIA 3FQNB 5DS8A 2DLFL 2R0ZH 1BIIB 1N5AB 6FABL 1UA6L 3T2PA 3QP3A 4GUPA 2JTDA 1GHFL 3T3PF 1KLUA 3H0TA 3H9HA 4FZ8H 4H8WC 5IVOA 4OCWL 3SGDI 4NM8H 3FMGL 2XPGA 4Z0XA 4MD4A 3MRFA 2EYSB 1I9JL 3SDAA 4G8GE 1CGSL 2YZ1A 5GS1B 5E8OB 3TA3D 1JZ4A 3GHBH 2XZQL 4HUUA 5IJKA 2EC9U 3VFWA 3LB6D 3MJ9L 4PJ5D 2AJZB 3E6FA 3AS1A 1KJVB 4ETYA 4QXGL 5IBLC 1M7DB 3O3BA 3HRZA 3LN5B 2YXMA 5ICZA 1ZVSB 3I2CL 3QAZC 4POYA 2XY1A 4FQ2L 1OPGL 1D5ZA 3O2DH 1F58L 3ZYJA 1N64H 2F19L 4XB8A 1GGIH 3ARBD 3LEXA 4ELMF 2JB5H 3BDYL 4JEGB 4Y5YC 1OAKH 1AP2B 2HVJA 4AZ8A 4WEMB 5KANI 4P2QA 4TOYL 4R4BA 3NZHL 3ZE0F 4KUCF 1MAMH 1YMMA 5BS0A 2B2XH 1LO4L 4WI3A 5I8KH 5J9PB 3TCLB 2ZSVB 1UJ3C 4JG0H 1S7XB 3K2UL 2O61B 3UJJH 1TENA 2ILLA 4APQB 5D7KD 3O8XA 5FK9A 4CBPA 4NQED 3T2QA 2X1QA 3DOSA 3GO1L 3BPOC 5KVGH 5C6TH 3IF1A 3QBTB 2XWTA 3SQOH 4FA8A 1DANU 2QKIA 4G8GD 4ETQA 3QXVA 5DJ8A 3E3QE 4LLMB 4RFNC 3KYMA 1J8HE 3TPKA 2H2SD 1MPAH 3RTQC 1OTUD 4DCQB 4YNYA 4WVRA 4KK9C 3SO3B 2BCKB 4QRRD 1CLOL 1BVKA 4N0CC 4MLSA 3DETC 3LOWA 2CRYA 3V95A 1WJ3A 3LKNA 5EC2B 4WEBH 1G0DA 1FO0H 2AJSL 4Z7QE 3QH3A 4I4WA 5GGTL 3P9LA 4U6HB 3ZKNC 2PTUA 4Y5VA 5I1GH 2R4SH 3RIAK 3MLUL 2CO6B 1TFHA 2IJ0C 5E94B 3U30C 1IC4H 4X4XA 4HX1B 2W92A 4KTDL 5HHME 2IFGA 1TVHB 4YDKL 4FMFA 1HWGB 5TH2B 1H9VA 1M05A 4FQXD 4JZOB 3JV6B 2XA8H 5T5FL 3GEWB 4HS6A 1A7OH 3QDMD 2G60L 3C2AL 2EXWD 3GSXB 2NXZD 3EO9H 3F7VA 3FKUS 4LPYA 4OFVA 1NCBH 1S7QA 2A83A 4J3WA 1JUFB 5D2NA 1KCVL 2OQJB 2VWEE 1UACL 2CIKA 2P46B 3RWEA 4JZNA 5E00B 5FO7A 3U36B 3VE0A 4ZPVB 3T0EB 3PHOA 4JY5H 4NPYA 1I3UA 3HNTH 5FIEA 1N59B 1KJ2L 2OTWA 2X4SA 3C5SB 5L88H 1KIRA 4EI6A 1IAOB 3C6LD 3HNSH 4P48A 4XPHL 1R24B 2R69L 4ZYKB 2NY3C 4UAOC 5CKGA 2XY2A 3ORJA 4OD1H 4TRPH 3DVFA 4XNYL 4NSKB 1NDMA 4FQ1H 2YMXH 4I13B 1GXEA 4GRWB 3OL2A 5E6ID 3ULUC 3WNNA 2YK1H 4HFWB 3DV4A 3JWOH 5D7JA 4YEFA 3SDYL 2H32A 4KQ3L 1B0RA 4HMCA 1MWAB 4UTBL 2IANA 1Q0YL 3OKOB 5EU4A 1CBVH 2DJUA 4FP8H 1NGPH 2EE3A 3VRJB 2V5SA 5DMIH 4OCNC 5ALBL 3W0WE 4WW2B 4Y88A 3U0TA 1KCSL 4Q9RH 3MRBA 5E2TH 5C2BH 4HH8A 3TO4B 2BX5A 2GIYA 3QFDA 3QQ3B 1QYGL 5IB2A 1JI1A 1V3MA 2Z93A 4PJHB 5HVHB 1I85C 2Q76B 4IHOB 4PRNB 5IFJB 2EZ0D 2AABH 4NKMB 5JQ6L 1KULA 5F7DA 3V6FB 3QDAA 4AQ1B 3VXSE 4DTGH 2KBGA 3CFEA 1C12B 4NDMA 3GKZA 2FLRT 3VXNA 4OGXH 1M7IB 3IFLH 4QXWA 2XKNA 1M71B 1FNLA 3MJ7A 5IEHB 3WJLC 1HH6B 2EH8L 4ZFGH 2OZ4A 4NQCB 5DWUH 4Y4HA 5GIRA 5JTWA 3WUZA 1OB1B 3WIIL 1A7BA 5FUCC 4G9DB 5GS0H 4HKXA 5D6CB 4OFPA 3ESUF 3KS0H 4EJ1C 5IROA 5TE6H 1IL1A 4BH7B 4TVPE 4F57H 3EYQC 1OGAD 1RULL 1CTNA 4MNQE 5KOMC 9CGTA 3LY6A 1CFQB 2ZCLL 4JO4L 3RJDA 1UH3A 3MNVB 4P46A 4Y5YB 2XFXA 5IB3A 3P11L 3EDDA 2IQAB 5D70H 4NZJA 4AQOA 4EI5B 5FYKL 4GXVL 3DPBA 5JR1L 5J06A 1JNHB 3FQTA 5CP7A 1BEYL 1HQRA 3FT2A 3EYVA 2DQCL 1UJ3B 4JY6B 1F42A 3PDGA 1L0QA 1X9QA 1MRDH 4UNVA 1HXMA 4CVZA 1K3IA 4M6NL 4H20L 1U8OA 2G5BA 3BPOB 3DRQB 2ZKHH 3HNVH 4I2XE 3QXWA 3M1BA 3FO9B 1TLKA 4L4TB 1A6VH 4NC1C 4PP1C 5E5MA 4RFNB 1JZ7A 4Z77A 1W2KT 5I1HL 1SEQL 2NMSA 4K3JL 1V3KA 4MXVE 3WJJC 3S3PA 4OCYL 4EIZC 5I1EL 5B22A 1DQJA 4F7EB 5C7XL 1NCDH 3MBEB 1A6UL 1J0HA 3BP6A 1MHPL 4G6FB 3KXFE 3S96B 2FBOJ 5D7IF 1YEHH 5MP6H 1UZ8B 3MRMA 4KROB 2J4WH 4DKDC 3HE7C 1XF4B 4YXHH 2QADC 3LKSB 5I0ZA 4QKXB 1XH3B 3O3EB 4Y4KA 3MC0A 2BNQB 3QUXC 3IAGC 4HMDA 5CLTA 4JM2F 3EZ8A 3B3IB 5EBMB 5C0BB 5C0AB 4YAQB 1JWMA 2EH7L 5JORA 2FYYA 4RGNC 3RVVD 4ODVL 3W39B 3Q5YA 5DJDA 1CF8L 1FQ9C 2ZG1A 2B4CL 1D9KB 2ADIB 2NX5B 5CZXD 3T09A 1ES0B 4LHUG 2EKSA 1MI5E 4PUBL 4PLKD 1CGVA 2RR3A 2F5BL 2HTLD 5I76A 5KG9B 4CAGA 4IRSC 2YD8A 1E6OL 2Y7QA 2DDQL 1ZSDA 3BP7B 2XWBA 2DRUA 3VI4F 4QO1A 2CO7B 3ARUA 4K9EC 5EA0L 2DWEA 4Z95H 1H8SA 2BOCB 3WV0A 5IK3A 3VXRA 4D8PB 3HAEA 4IDJH 1NCWL 5T1MA 3WSQH 5GS2D 2CDEA 1IAKB 4KKCD 1OT2A 1WFNA 4HWBA 4GSDL 2VQ1A 3OGOE 4XZUB 1EO8H 4XVJH 4Y19E 2GJZB 3U46A 5I6XC 2VTFA 2Z31C 3PWJB 2GW5A 1MCLA 2UZXB 3W9DA 2NXZC 3V5DA 4M5ZH 3EYSL 2JB6A 5KZCB 2E7HA 2P8LA 1A14L 1F2QA 4GAFB 5DYOA 3X17A 2VDPL 3UYRH 4I18C 2XACC 1LEIB 3HCVA 4I77H 3R06A 4N0UB 1DSFH 3KS0J 5DRWB 5FO9B 3ZHLA 1FFRA 5DZOA 2NY0C 5LGHL 1P6AB 1MI5D 1T5WB 2AQ1A 3JUYA 3SPVA 3KPNB 1V3LA 1K8DB 4NQDE 3D0LA 3RDTA 1QFWI 5CUSH 2HTKC 4JQIH 3WXVH 2CXKA 1BVLB 5EUOE 1FJ1A 3S34L 5J13B 2LAAA 1AXTH 3O41B 4IRJB 2BJML 4OBRA 2ZUVA 3O3AA 3DX7B 2VAJA 3LHPL 3DXAA 1I8IA 2J3SA 3SGKC 4Y2OA 3MGOB 3NN8B 4I0CC 2Y6SC 4HWEL 3O6LH 3T04D 4JFFE 3QCVH 4N8CH 1RUAL 3HN3A 5T5NF 3ZSSA 1VGKB 2F74A 3DRTB 3WO4C 2R29L 5MHSD 1YQVL 2AERT 3TPUA 4HXAL 4NHCL 1BFTA 4LKXB 5FUOL 1GGBL 2ZPKL 1FN4A 4ONHB 1EFXD 5BO1L 2VWEC 1R3KB 3ARFA 1JP5A 5I1AB 4X6DB 2RFXB 1ZA3A 5C09E 5GZNC 2Y4SA 4PY8J 5BOZG 2W9EH 1CL7I 3C60A 1FNFA 1IGML 1CGYA 2EZ0C 5BRZE 5D1XA 5E8PA 1YEEL 1YYLL 3X11B 1VPOH 4QXTB 5ESQB 3FN0L 4HIXH 1XIWD 1MIEH 1ADQL 3ARXA 1ZTXL 4KK6D 3KDMB 1BVZA 4HGWB 1P5UA 2H9GA 3G9VA 1V5JA 4P3CL 2X4NB 2A9NH 4HWZA 3KPRA 3DJ9A 4JRWA 3OGCA 1IGCL 4Z7WB 4JKKA 1T1ZB 4WCYL 4PJEA 4JFFD 1T1YA 4NZRL 3ZTNH 2OBGA 3PG2A 35C8H 4M9PA 4ODUB 5IP4A 4U1IB 3C09B 1DANT 4GG6A 1HXYA 3ZYZA 1TPXC 3H42L 2AEPL 3B5GA 1GZPA 1U8NA 4HUXA 2ARJQ 3MLTB 1AGCA 1AHWA 5EOCL 3QDJE 3VI3F 1BFOB 2VLKA 1BX2B 2BVTA 3H3PH 4MVBD 5D7IA 3V4VL 2E6PA 2X4TB 3PQYA 1A3RH 3ARDD 5HHVL 3MGTB 5BRZD 4U1MB 3MLRL 2QADB 1S9VA 3MLVL 3PP4H 3DX6B 4WRLA 1UM5L 3LN9A 3U4BL 2C1OB 3QUXB 4JM2A 2ZNXA 4EOWH 4YHML 4N1HB 1MQKH 3K4AA 5E2VH 1INDL 3O3DB 4YH6A 2P5EA 3IDXL 2UWEF 3FOLA 3GBNH 1ZVHA 4H25B 4XVSH 2F8VA 3K81A 1RZKH 25C8H 1KTDB 4RGNB 1KPUA 5KVEL 1A4JB 3GUTB 3Q1SL 3RHWF 4M1DH 3SGEI 3VH8G 2Z91A 3VXUB 4S1QL 3A67H 5C6WH 2HYMA 4XP4L 2HJKB 1KG0B 5KSAB 1H3TA 3EOTH 4GAJL 1RZFL 2P7TA 1NBVH 1QBLL 1GCFA 4LPXA 1RUKL 4MS8C 4WFEE 3SO5A 1GIGL 1OP9A 1WK0A 2J5LB 1U8MB 3MV9A 3CX5J 1TTGA 3PGCA 4D0BA 4KRNA 1FZOB 1S78D 2P43B 3CFJB 4LLQA 1MUJB 3NCJH 5SX4I 3OSKA 3JTTB 3LDBC 2NPLX 4R8WH 4UOW1 1FH5H 2AJXL 4PG9A 2VKXA 4W68A 5JA9A 1T22A 1OWWA 5DRZB 1A6AB 5EO1B 2MCPH 3OAYK 2Z31B 4WHCA 5EZLA 4F7TA 2E3VA 2R0WL 1V7NL 5H94B 5JNYA 1T7ZA 2HTLC 2ENYA 1J8HB 3PL6D 3LEVL 3F5WA 2GUOA 3VFOB 4OV6F 4R90L 4KVNL 4NNPL 3U6RA 3DUHA 4PJ7E 3MNZA 2XZZA 4JDZA 2NY0B 1EEUA 5FA3B 4JR9H 4JZJB 3TN0A 2F54D 3HI5L 4NQVA 1LVEA 2X4RA 4RDQF 1J0IA 2DBJA 4ZTPL 1B6UA 1F45A 3MRLB 3OHXA 4JFDE 4YIQB 3DVNA 2IFFH 3QCTL 4OF0A 2EEAA 5EBLB 2NW3B 5CEZL 4WFED 3HR5B 4HPYH 4XP6H 4UT9L 5H2BA 2XWJB 3WL9B 1MHCA 4FFVD 4HKJB 4MAUL 2W0PA 5I18L 1FLTX 2WWMC 1A6ZA 1ND0A 4ODHH 4EQ2A 3QEHA 4OZIF 1BBJA 3IDNA 3MLSH 1L6ZA 3ARGC 1JE6A 3UTSD 1FYTA 5HD8D 1JGUH 4JLRA 5GRJL 5B3JE 3WO4B 3MRCA 4NT6B 3GSNL 1IM9D 4JGUA 4L3EB 3QDGE 2NY7L 3KG5A 1NEZG 4MB5A 3O81A 1T03L 1CD1A 5IMKB 3ILQD 2Y25A 4EDXA 4OT1H 4AL8L 5T33L 2J8OA 4WIQA 4L4VB 4M7JH 5IQ9B 4FZEH 3O4LE 4F3FB 3PF2A 3IXTB 1U41A 4XCEA 5IMMA 4ESKA 2Y72A 4OCLC 3T1FB 1FPTH 3D2UD 4MDJB 4MJID 1AC0A 1AQKH 2BSSB 4PGCA 2AQ2A 2ERJB 3ZDYE 3CJJA 2GJ6E 3O0RH 1IGTA 5DFWH 1CE6B 2D9QB 3P4MB 2EE6A 5CINH 1C5BH 1CT8B 2W91A 2ESVA 4G8FB 1I9IH 3OG6B 3L7EA 4PRHA 4XP5L 4Y0GA 1B0GB 3LRSA 2VABB 2GITB 2O5YH 4HBQA 4KMTL 1MELA 5HHPA 1I4FA 4G43A 3NIFE 2CKBA 4TNVF 1WFUA 1J10A 4QHLB 5L2KE 3QDGD 4OUUA 4UV4H 5J1SC 1MQ8A 3QJFB 4ZD3H 1TPXB 4XPFL 4AIXA 2V7NB 2I25N 3LSOA 5HYSB 5CD3A 5C9JA 4Y8DC 5DUPH 2P1YA 4NQXA 1RJLA 1N8ZA 3CFDB 3NTCH 3QIWA 5JXAL 3PGFH 4J3XA 3TT1L 4NYLA 1JZ8A 3O4LD 1LO5A 2OL3H 3BGFB 2AP2A 1PKQA 2OZ4H 3I6KB 1PLGH 1FV1A 2APTA 3EYOB 4ZUUB 5C0EB 3VXSB 3W2DH 4PLOB 4FS0A 3IFNL 3MMEA 1HH9A 12E8H 2GJ6D 4NUGL 4NWUL 1QACA 1EEZB 3RGVC 1G7PA 5C0GA 4N5UA 4QTIH 1FFOB 4J3TA 3BKYH 2EDEA 1L0YA 3BQUB 2WLZA 2X4QB 1W0VB 3REVA 3S4SB 2DQGH 3DLQR 3MXVL 4LHJB 1ZHKB 1UWGL 2P45B 2V7HA 1T83C 3ISWA 2DQFA 5B39B 4JJ5A 5D93B 2QQLH 4LVHC 4GAYB 5EZJA 4L3CA 1YY8B 1OCWH 2BVUA 1DEEB 4F37K 1MCWW 2QSVA 4OGYH 5MENE 4RAUB 5DTFA 4N1CA 2VL4A 4HZLA 1KB5A 1RJYA 1VADB 4NO5B 1LDPH 4LKCB 5IVXA 4X6CE 1IBGL 2X7LA 1G9ML 2DI7A 2H6PB 4TNWF 4MNHB 4Q9QH 1WLHA 4PGEA 3LMJL 5EU7E 2UY6A 2ICES 2C7UA 2OJZH 3RAJH 4M00A 3LDBB 4EXPX 5DD5L 5KAQF 5K9OB 1YEJL 3VXMA 4H1LB 1WC7A 4I2XB 5J3HD 5SX5H 1T3FA 4LVOB 2ZSWA 1MCHA 5AYQA 3V7MA 5DEGB 4CNIB 1CLYL 3MA9H 1HINH 3VJ6B 2QQKL 4LPUA 4YJZL 1F4YL 4U1KB 3VH8B 2E7LA 3HC3L 4CDGC 1X5HA 4Q0XH 3K1DA 3RNQB 5T1KD 3MZTA 1BJ8A 1OW0C 3B9KA 5CGTA 3STLB 4Y4FB 4PRIE 4HLZH 3WFDH 4JO1H 1EO5A 1CU4H 4FMKA 5EIQA 3KXFB 5CBEA 2FX7H 4WUUD 5EU5A 5AWNH 3SE9L 2ZUUA 1T7XA 1J5OH 2FB4L 4WHDA 2CH8A 3CDGA 3CX5K 4PJDF 4XMPH 1CDGA 2Q6WA 1G1CA 1F3JB 1HI6B 2DQHH 2Q7YB 3PNWB 1Q9LA 2NXYD 2FJHB 3QUZA 4HT1H 3FQXB 4YR6A 4CVXA 4P2RA 1YNLL 2VH5L 4OZIA 3U7WL 4HXBL 1PZ5B 4MYWB 5GPRA 1C5CL 4GRWF 4JDTH 3QT2A 1J7VR 4BFBD 4P99A 2A6DA 2VIRA 4YHPB 1MH5B 4M7KL 3ZTJG 5C0FB 1IC1A 5EZIH 1AGEB 2F53E 3R8BB 1S7TB 5GQBA 2DQJL 3JV4A 2ATPA 1NCAL 4HWBH 4W6XB 1AH1A 1QSEE 4ZXBA 5F44A 3QUKB 3TM6A 3EO0A 4JQVA 4BSVA 1OTTD 4JN1H 4ZS6D 5CEYA 4WW2F 4LBEB 1HE7A 1JHKL 4K3EH 5TE4H 3NPZB 3MRDA 1HHJA 2PXYC 3FQNA 1LQSR 3VWKD 2Z35B 1N2RA 3KLHD 1BIIA 2NCMA 1N5AA 5ADOH 4XWOD 2Q87A 4FQCL 4GXUN 4R9HA 4DN3H 3PXHA 5TPWL 1Z2KA 1P69B 3EFDL 4BZ2H 1G7QB 5ANMB 2EYSA 2VLME 3L6FB 5GS1A 4JVWA 5E8OA 3SGJC 4YWGL 3U7YL 1P4BH 1MCWM 2IGFH 1NEZB 1A7QL 1OM3H 3MACL 8FABB 4HLJA 3L5WB 1TXKA 2AK1H 5KSBE 4WTZA 4PB9L 2AJZA 1KJVA 2VL5B 3NBNA 4I9WE 4YFLI 2J1KA 1M7DA 1IZJA 1CE1L 3LN5A 2A74B 2VQTA 1ZVSA 1RK1B 3SJVB 2AGJL 3EUUA 2QSTA 5I1KH 3TESA 1QSED 2ICWJ 4YX2H 3L5XH 3ZDXF 1Z3GL 4RISH 4GS7B 4U3XA 3SDDD 1T04A 1AP2A 2EICA 5KANG 3TJHC 4CRPA 4RIRA 2DKMA 2ZUSA 3QWRD 2EC8A 4OLXL 5J9PA 4JO3H 4YQXH 5H37H 2ZSVA 4JY4B 1QRNB 1S7XA 4WNQB 4K94C 2O61A 1HKFA 4APQA 1BHGA 1QD0A 5A2JH 4UT7H 5HHNA 5ITBH 3SKOB 5JHDE 4IMKC 3MROA 1JPSH 4P3WA 5ESAB 2AS5M 1PQZB 4K7PH 5CD5D 2VLMD 4B5EA 4QCIB 1K4CB 3WLBB 5GS0D 1NC4A 3KPPB 3ZDZF 1H3WM 2BSTB 4LLMA 4UILH 4ZQKB 3OAUL 3U1SL 4OLEA 2DTSA 2VN4A 4M6OH 3X13B 2GFBA 4DCQA 4Y5XC 5EC1B 1EDQA 3DI3B 4PREA 4JHAH 2BCKA 4LAJH 2PO6A 2DQUL 1E4WH 4LVHB 1ZKAA 5T1LB 2VSDA 3LRGA 4PJ9B 3IKKA 4R0LA 5LXGL 3G6JE 1QPXA 5C0RH 4LASL 4BQ6A 3FO2B 1OARL 5CSBA 4LCUB 2YN5A 4R7NA 1Q0XH 3D39B 3AS3A 5E94A 3H7LA 4YXLL 2VXTL 3IJSB 4HX1A 4OIIH 4UU9B 4NOBA 4P23D 1WCBB 2H8PB 5IJVB 4XMLL 1KN4L 1TVHA 3GNML 3MRRB 4AT6B 2KDGA 5DVMA 4L8SC 3MV7E 4G6ML 3JV6A 5DD0L 1E28B 1Q72H 5HDBF 5CIPA 1R3IH 1X5AA 3GSXA 3P30L 2WBJC 5IMLB 4OLWH 1T2JA 4F58H 4U3CA 1ZANH 4HUKB 1JUFA 4ZOAA 4XC1H 1JV5B 3DURA 3P4OB 1N5YH 5IKCB 1S9YA 1C1EH 1P53A 3NA4A 4CN6A 3V7AE 3CLFL 1T4KB 2OQJA 3QDJB 5HY9B 4M6ML 2FIKB 5C07E 3EBAA 1KYOJ 5E00A 3U36A 4HJGB 4KJPD 2HG5A 4ZPVA 2YR3A 4RRPA 3WIHA 2X2YA 3MRQB 3SE4C 4HC1A 2LU7A 5F1OB 1A3LL 4WI9A 4OD3H 5F97E 4QXUH 1N59A 2VZSA 2YPVH 4RWYH 3GI8L 4XMKH 1EX0A 3C5SA 1T7WA 1QSFD 4XBEL 1IAOA 1R24A 4ZYKA 3K46A 3RU8H 1PKOA 3BSZH 4O4YH 4OFDA 4HKBB 3WS3B 3MV8D 4NSKA 1FFQA 3O6FD 5C86A 4GQ9H 3E6HB 1I1AC 1B4JH 2BRRL 4EZMA 4EN3C 3ULUF 3CVHA 1EVTC 1YJDC 4FNLH 2NTSP 2E27H 3DMMC 5KTEH 3OKOA 4IIQC 2ARWA 1INQB 4FQQB 1SMOA 1AY1H 4C55A 1DJSA 4O5LH 1G7IB 4YZFF 4JGMA 1D5IH 5FB8B 1UB5B 3LIZL 1T2QL 2FX9H 5E9DD 2GTZB 4I0PD 4WW2A 1FGNH 3LZFL 4BZYA 1JNNL 5DGQA 1MHEB 4LSSL 3HG1B 2I24N 5D1QA 3TO4A 3JXAA 3ETBF 2PXYB 3M17B 3QQ3A 3Q6GL 4S11A 3HMWH 4PJHA 1CQKA 5EU7C 2IH3B 1X5JA 5FAAA 2Q76A 4GAGH 4IHOA 4PRNA 3BZEB 5IFJA 1MEXL 5DD1L 3ZT6A 4NKMA 4AIOA 4RFEB 4R6UA 1QHPA 2YBRB 3V0VA 2OP4L 3WD5H 4GW1B 4G3YH 3PIQB 2ICCA 1WAAE 5IHUH 4HUNB 1M71A 2E6QA 4PIRF 5IEHA 1J1PH 3V0WH 5I16B 4NQCA 2Z4QB 1W72H 1RZIA 1OB1A 4Y1AB 1OTTC 4KUZL 1H3PL 4G9DA 4P9HC 5ERWB 5D6CA 1F90L 4PG2C 4LVEA 1MIMH 4DVRL 3VGGA 1YN6B 4BH7A 2XQBH 8CGTA 4PP2A 5BMFH 2H41A 3ARSA 4X6DF 4ALAH 4DWHA 1NAKH 2NLJB 1L7TH 2AJYL 4HIHA 4MA8H 4XCCL 3QHTC 4JFDB 1CFQA 2HWZH 1BQSA 1S7SB 1WIPA 1TDQA 3OXRA 4Y5YA 4AG4H 5DJZB 3F12B 2D0FA 4KY1L 2IQAA 3MRJB 3MYJB 4BSWB 4EI5A 4OSUH 1F6AB 5BJTB 3GK8L 3VWJD 1CDHA 3JWOC 4JO2L 4N5EC 1OAXH 2FBJH 4RGMC 5E99L 2NNAA 1T20B 1A7NH 4IRZL 4G80B 2EO1A 5T1DL 3PWVB 3NH7L 2OS7A 1CQYA 1EIBA 3DRQA 2G5RA 1R3HB 3FJTA 3O6KH 1A7PL 4DAGH 3FO9A 3QULA 5IQ7L 4CU8A 5HPOA 2AK4B 4X9FA 3I3DA 4XP1L 3QJHB 1XGTA 2HRPH 4TTGA 1CLZH 2PR4L 4FQLH 1RZJC 3SDDC 3A6CL 3NPSC 2AV7A 2BDNL 4JFOB 2CK2A 1ZV5A 1NAMA 4XNXH 4R96B 2C4XA 4JKWA 3MBEA 2JJTA 3WDJA 3NFSL 2UUDK 2JK5B 1GZQB 3S96A 2FJFB 2KZWA 3O6ML 1UZ8A 2IPUG 5C08D 2ADJB 3VRIB 1XF4A 2X05A 4N9GB 5ABDE 1EHLL 2JELH 1I1FA 1XH3A 3MLPA 1KV3A 5DJ0B 2BNQA 1NSNH 4Z78B 1MSPA 4NO3B 5ECJE 1Z5LB 3MCLL 4QYOB 3B3IA 3ZT7A 5I1IH 4GBXD 5EBMA 5C0BA 5C0AA 5D71H 4P2QE 4W6YB 4YAQA 4KRPB 3TV3L 3W39A 1YMME 4H26B 1ZOXA 5BS0E 4KHTH 1ED3B 4HUMB 5HGHB 3B4NA 4X4ZA 3TVMB 4H0IA 4LDOB 1D9KA 3OJVC 2ADIA 2NX5A 5EIVA 4Y2DA 4DGIH 1ES0A 5L2KB 1O7VA 4ZUVB 5FOBB 1HYSD 1MFAL 2XRAH 5JMOC 4IEFB 5KG9A 3JWDC 1S7RB 3QUMH 1N7MH 1ZLWH 1A5FH 2L7JA 3ZZ1A 4XI5D 3TZVB 2VDQH 3ARQA 4ENED 5BZWB 3EW3B 5B38A 5JW3L 1QLRB 4X9HA 3IS1X 1QUNA 4P3DA 2EEBA 2CRIA 1FNGB 1BOYA 1JF5A 2UVFA 4YC2B 1FORL 5CJQH 1IAKA 1WZMA 1UYWH 4KVCH 4Z76B 3V5HB 1C08B 4Y16C 5JQHC 4R3SB 1YZZA 1LO3H 1FP5A 1J86A 1NKOA 4X83A 3QPQC 1CDIA 1MJUH 3PWJA 1G7LB 3QRGH 2VDKH 2P8PB 4P2QD 2CUHA 4NC2B 1LNUB 3GB7B 3WN5C 3RA7L 1OVZA 4GJTB 1Y0LA 3SKNB 2I60L 4HEME 5I71B 5GISL 1LEIA 5I2IA 4GKSB 4U1JB 4U7KA 1FLRL 5F7LB 1UH4A 2J88H 5DRWA 5ISZD 4IIQB 2A6KB 5FO9A 3O8XD 4X7EC 5MENB 1T5WA 1ZHBB 3OAZH 4OKDA 2IQ9L 2F58L 1K8DA 4MCYB 1KYOK 4QRTB 5L2JB 4KGLA 3QNZA 4X6CB 1MRCL 3N85H 5HHOB 5DEZA 1MRFL 1KIQB 1BVLA 1NLBH 1T1WB 4OLZL 5E2WH 4HHAA 4IRJA 5D2NE 4OB5L 2DF3A 3DX7A 4WJ5B 3C08H 2CMRL 4J3SA 5E95B 3O3UN 4BUGA 3LH2L 1RFDL 1OD7A 4NO2A 1YY9D 3MGOA 1KJMB 1DBBH 1NMAL 4TTDD 5AZEL 5EO0B 4XC3H 3D9AH 2J6EA 2ZUQB 2A0LD 3FQUB 3KYOB 3TH3T 4JPVL 4YK4B 1U8LA 1N4XL 3NCYS 4XBPB 3DRTA 5K59E 3VA6A 3WJLA 4OZFA 3MFFB 4LKXA 2DMKA 4ONHA 2JCCB 4RGOH 1R3KA 3GMOB 5I8EB 5I1AA 4BQBA 1LE9B 4U7SA 2IBBA 4X6DA 1HNGA 3C8DA 3BIKA 5JUEL 4JFED 3MLYL 2W0KA 1WSST 1IAIH 4KKLC 4M3JA 4I3SH 4KV5F 2IANE 4NFCA 2OR9H 3OQ3B 4U05A 1XF3B 4PJ8A 3W11D 4WFGE 5F1NB 2QTEA 3X11A 4QXTA 3BKMH 1KT2B 1DQQB 1J12A 2YPLA 5I17B 2CLVA 3GSNB 3KDMA 4HGWA 3CSYB 3U2SB 1OF2B 2X4NA 4LAQL 1L4IA 3X14A 1LHZA 3SBWA 1BFVH 2IG2H 4Z7WA 1IGJB 1T1ZA 1JPST 2X4PA 3HRPA 5BOPA 1WWWX 4B7IA 4JFPB 3T3PE 4RBPK 5HYJB 1QBMH 4ODUA 1SHMA 5KJRH 3MLXH 3NIGE 5F21B 3JWNC 2H2PC 4OLVH 2CDFB 4X6FB 3TBTB 1FHGA 3NPSB 5ALCL 5C9KA 3MLTA 1BFOA 2FEDC 3QZWG 4AIZA 1BX2A 5D7JD 2Z8WC 4X5WB 2X4TA 1GL4B 2FCBA 3QIUD 3SDCD 3MCKA 4GW4B 4MXQC 4G8IB 4LSVL 5EU6B 4FABH 1UKSA 3VDBA 3DX6A 4TSAL 4YHYC 4YDIH 1A21A 1VESA 2HMID 1F4WH 3O3DA 2VITB 2Q86B 5DMKB 4PRPA 5I75B 4H25A 3OX8B 1KTDA 3AB0C 1JMXA 3EJYC 1UXSA 5J6HB 1IEHA 1A4JA 3LS5L 1N3NB 4X7FC 3GUTA 3VCLB 1YMHB 4JG1L 2AKRA 5C0ND 7FABH 3MRPB 3RZCA 2ITDB 3VXUA 2GCYB 3PDOB 5J4MA 2ZG3A 3KPSD 5C3LD 2HJKA 5KSAA 4LVNB 2BVEA 3GRWA 5D6DA 1MHHB 4ODXB 3EDFA 5CJ8A 1P7KB 2R4RH 4G6KL 5HDOA 2JIXB 2FSEA 1I9RH 3BEWA 3TT3H 3VXOA 1AD9B 4CL7A 1U8MA 3QXUA 4GBXC 2VDNH 2GK2A 4HFUH 1YPZB 1FZOA 3CFJA 4Z5RB 3JTTA 4WI7A 2N56A 4U1LA 1NC2D 2FLBT 4BK5A 4EQ3A 1DBKH 1A6AA 5DRZA 5EO1A 3EGSB 2Z31A 1MCIA 3AMLA 4M93C 4LSUL 5J57B 4JPWL 5H94A 2F8XC 2R0ZL 5INDB 4KUCD 4PLJC 3DARA 1DVFD 2E5EA 4DGYH 5AZ2H 3UTQB 5HSFA 4LSPH 1RUQH 2NY1C 3S36X 3SDAC 5HHQB 3W5NA 4NIKB 4FZ8L 4WI8A 1MCOH 1J0KA 2QL1A 1JHTB 4ENEC 3ULVE 1XF1A 5IJKC 5IB4B 3PWLB 4UBDC 4JZJA 1E27B 4FG6D 3GHBL 3GSQA 3U9PH 3C9NB 3MRLA 2OMNA 4YIQA 2M2DA 4H88H 4MMXC 4PJAB 5EBLA 2NW3A 3W9EA 3AXLA 2D3VA 4LNRB 1J05A 3O2DL 1N64L 1GGIL 4X9GA 3WL9A 4HKJA 2JB5L 1OWRM 1OAKL 4W4OA 3VXRE 2V9TA 3QNXB 3RRQA 1MAML 2WW8A 2B2XL 2BOBB 5I8KL 3O8XC 4HC1H 4NQEB 4NT6A 1R3LB 1RIVH 1A22B 4GOSA 3KR3H 5GRUH 4L3EA 1VGEH 3ZT5A 4JG0L 1S9WB 3WNOA 1LILA 2EDDA 1JNJA 1J1OH 3DTXB 3UJJL 1YYMH 5IMKA 1SM3H 2ICEB 5KVGL 5C6TL 1WZKA 3SQOL 1CLCA 4QRQA 4L4VA 4ZO6A 4WU7A 5IQ9A 2WZPD 3RIAF 4F3FA 4X80H 3IXTA 4G6JH 4CN1A 2PKDA 1MPAL 1PFCA 4GRWH 3LQAH 4M8VA 3L3HB 3T1FA 4TTDC 5AG9A 4FFWD 4QHKJ 1R5VB 3X12B 1OAUH 1MWAH 3MGAA 5GSVA 2VISB 4IOFC 4WEBL 3IRZA 2AXHA 1CE6A 3WXWH 4JREB 1FO0L 4HCRH 3FN3A 4G8FA 5EB9A 4TVSa 4DEPC 2AQ3A 4F15C 5I1GL 1J87A 2R4SL 5DJAB 2D7OA 2VABA 3DXAE 15C8H 2NY6D 5BZDB 4XVUD 1IC4L 4WTWA 4HGKC 1S9KC 3AVEA 4GKOA 4P2OD 4OZHB 4QHLA 4IOIB 4U31A 3QDMB 4RX4A 3QJFA 2BHUA 5C71A 4ELKB 1CZ8H 2V7NA 5HYSA 2XA8L 4UUJA 1BM3H 1A7OL 4H8WH 4RAHA 5CILH 4YPGA 3CFDA 5FKPB 2P49B 2AJUH 3EO9L 5EUOF 5D2NC 3I9GH 5EPMB 1NCBL 3NAAH 1PGRB 3I6KA 3MRNB 4QTHB 4Q74A 4ZFOL 5KBNC 1QSVA 3EYOA 3PE9A 2VUOA 4ZUUA 3K80A 3VXSA 4X8JB 3CVIH 3ME0A 4YHYB 2R1WA 3UTTD 4JY5L 1KTLB 4P0DA 5F1SA 3HNTL 3MJ9A 5E70A 1Q9WB 2OCFD 2W9LA 5DUBB 4D94A 1EEZA 5DRXB 5DQ9B 5L88L 3BQUA 1PSKH 2X4QA 1W0VA 3DROA 3HNSL 3S4SA 3T65B 3S37H 4EDWH 3FB8A 3QXAB 4PJFA 1AO7E 5E6IB 4LFHG 4OD1L 3KJ6H 4TRPL 4C83B 4D9LH 5D7JC 5B39A 4FQ1L 5FF6A 3KPRE 2CIIB 2YMXL 4GAYA 1DEEA 2YK1L 4PJEE 3C87A 4RAUA 3JWOL 5E5UB 4JE4B 1VADA 4NO5A 5F8QC 4GG6E 4LKCA 3OKMB 1CBVL 2MNUA 3RI5F 4FP8L 4OGAD 3FO0H 1C5DB 2H6PA 1IMHC 3C5JB 1NGPL 4K23H 5DMIL 3ARFD 5DGRA 3VFSB 1P7QB 4NKOB 5I19H 2VLKE 5DS8B 4Q9RL 5C2BL 5E2TL 1P9MA 4H1LA 1U2CA 4X5LA 5L8KB 1DUZB 3RVWD 2P5WB 1OL0A 5D1XD 5DEGA 4CNIA 4X6BB 1Y6NR 4GUPB 3VJ6A 5HYIA 3BYYA 3H0TB 4U1KA 3VH8A 1U3HB 2AABL 4ORZC 2XPGB 3ALWA 5CLWA 3BFOA 3RNQA 4DTGL 2BP3A 3WFBH 5IFAH 2P5EE 2B7DT 3JVGA 1DQDH 3EJZD 4OGXL 3GJFB 3IFLL 1VFUA 4Y4HC 4HUUB 3STLA 5GGTA 3ZYIA 4Y4FA 4B53A 1U93B 3U0PA 3KPRD 2ARJA 4ZFGL 3E6FB 5DWUL 3CMOH 4MQSB 4YHNA 4LSRH 5F7KC 4DUXA 4XX1E 1R6VA 5GS0L 3NCMA 5DJ2A 4LSTH 1NCCH 3UZQA 5FECB 1FL3A 5TE6L 3FT3A 3R1GH 4F57L 2NZ9D 1QOKA 3QXDB 2FH6A 4P46C 1F3JA 1HI6A 2Q7YA 3UO1H 3PNWA 4P5TB 4YBQD 2WQRA 5I1CH 5AG8A 5LAXA 1YMMB 5BS0B 2VLKD 3HE6D 5D70L 5D96B 3MV9E 3KPLA 3PQYD 2K1MA 4YHPA 4QT5B 3G9AB 1MH5A 5C0FA 2KUTA 3SHSA 2VNCA 4BK4A 1AGEA 5FXCH 1S7TA 2LVCA 4JVUA 4WWKB 3IF1B 1NKRA 1LP9B 1MRDL 2CUIA 4ZAKC 3QEQB 3QUKA 4KK8D 1PAMA 1NFDB 2ZKHL 3HNVL 1XGQB 4MZ3A 2NY2D 2L4OA 4K2UH 4NZTH 4AYFA 2LTQB 3U79A 4LBEA 1A6VL 5FCUH 4YNYB 1T0NB 1QVOB 2FWOA 2DI9A 3ULUH 2Z35A 5EOQH 4WI6A 5L9DH 1SYVB 3V5KB 3PABB 1JGLH 1H3GA 5JW5B 5D7LA 1NCDL 3P9MA 3DNKA 5JXEA 4BQCA 2IWGA 1CFNA 1G7QA 5ANMA 1X5GA 4AEFA 1YEHL 3L6FA 5MP6L 4U49A 4Y4KC 2J4WL 4NN6B 2F9BT 3HA0A 3VGEA 4YXHL 4DEPB 5ACLA 4F15B 8FABA 3L5WA 3L7FB 3TC9A 4HAGA 3ULVC 3SE8H 5JHLH 2VL5A 4F2MB 4PJ7F 4XBGB 2P8MB 1I3GH 4P5KA 2A74A 1RK1A 3SJVA 4BM7A 2OK0H 1FYTE 3ZKXC 1X5KA 2YKLH 2J6EH 3ARED 1A9BB 2LQRA 3ZL4H 3F7YA 4LLAA 5IIEB 5D2NB 2NY4D 4ZO7A 5TFSH 1BLNA 3RWEB 4TNVK 3RVXC 4JY4A 4Z7UA 2WSKA 1QRNA 4WNQA 3TN0D 1P84J 5EN2A 3STBA 3E8UH 4Q6IA 2DLIA 4Z95L 3ALPA 3SKOA 4O2EB 3BRDA 4DGVH 4GRMA 3L1OH 4IDJL 4OZGB 4PBVC 1KIRB 5ESAA 5F9DC 3WSQL 4EI6B 2KL6A 1PQZA 5B3JF 3BHBB 2BY0A 3L3IB 2I27N 4L1HA 4QCIA 1X5YA 3WLBA 4KPHH 3KPPA 1I7TB 2BSTA 4ZQKA 4XXCA 3DX9A 1NJ9B 3MZGB 5T3XE 1EO8L 4XVJL 1NDMB 1NLDH 3MOBH 3X13A 3MREB 1N6VA 4GRLB 5EC1A 1H0DB 2BVPB 2ESVE 3MRIA 3D3VD 4M5ZL 4PRHE 5T1LA 4PJ9A 3LKPB 1B0RB 1HHGB 3V6BR 2VERN 2R0KH 2IAMD 5EU4B 3UYRL 2X42A 4N0YH 4I77L 1DSFL 3FO2A 4NP4H 1G6RH 1WICA 4LCUA 1A7RH 1IGIH 4B50A 3D39A 3AC0A 4QRPB 3RDTC 3GZKA 4LPVA 4Z18A 4ODSH 2G2RB 2UZIH 2AXGB 2ZOKB 3MOAH 4UU9A 1WCBA 2H8PA 5CUSL 4LGPB 3MRRA 4JQIL 4AT6A 2Z93B 3WXVL 1PKQE 5TQ2H 3B2UC 1AXTL 1E28A 2OR7A 5F7DB 1HHIB 3VU2A 5FEBA 5MEQB 1J0ZA 3NIFF 1N26A 3CFEB 2W60B 2EE9A 3BPLC 5IMLA 3FZUD 3TWCH 3VXNB 4TNWK 2BZDA 2XKNB 5LWYH 1M6OA 1R3JB 1JV5A 3P4OA 3V0AC 1QQDB 3QCVL 3QIBB 4N8CL 1KEGH 1T4KA 5GIRB 5HY9A 2FIKA 1BF8A 4KWUA 3P4NA 4UNUA 4HJGA 4PRHD 2LU3A 3CD4A 3MRQA 2NTFB 2BVOB 2XN9B 3ZYOA 1KBGH 4YHZH 1S3KH 3ZKMC 3WDHA 1YEFH 5F9OH 4TSBH 3GFUA 5HGBB 3C60C 2FH8A 3RVWC 2YWYA 4UZGA 5D1XC 3LKOB 4P46B 2FO1A 2W9EL 4JFHD 4HKBA 3NFNA 4HF5H 4BUHA 1QBBA 1FNAA 3HZMB 2A6JB 5IVXE 3EZJB 1OSPH 1XIWB 2BSED 3E6HA 5I1LA 3FT2B 1H8OA 4K9EH 1VPOL 3BIBX 1H5BC 4YFDB 4HIXL 1MIEL 4C59B 1U8OB 3W81A 1INQA 3VXME 3FONB 4FQQA 5E56A 4ZAKB 1J18A 2BRQA 4V2BA 2GTZA 5E5MB 2IMNA 43CAA 3C8HA 3TFKC 1MHEA 3ZTNL 3HG1A 4Z77B 35C8L 5DZNA 4X6CF 1DDHA 4W6WB 4XX1G 4FQIH 5HYEA 1K4DB 1MAJA 1OHQA 4OQTH 1BD2D 3BH8B 4LCCA 1DQJB 1AHWC 2IH3A 3BP6B 1EGJH 3EHBD 2YBRA 3BT2H 3BKJH 4N0FB 5IM7B 5SWZA 3QYCA 2DM7A 3H3PL 5CGYC 4GW1A 4CDHA 2R9HD 1A3RL 1RZ7H 4JM2C 3SGJA 5C0CD 2HRLA 5GGQH 3OJMB 3PP4L 2Z4QA 3LD8C 4Y1AA 4OF3A 2C3HA 4HJJH 2MTPA 3ZHDA 3WNKA 4EOWL 1MQKL 2FYYB 5E2VL 4P2RE 3HZKB 4OZIE 3GBNL 2X5PA 3AFLA 4XVSL 4R2GD 1RZKL 25C8L 3ZKXB 1P5VA 3UC0H 1KFAH 3OJDB 2EKSB 3I85A 1S7SA 4C4KO 2DIBA 3CC5A 1GC1C 4M1DL 5DJZA 5I8CB 4M7ZC 3F12A 2RCSH 4HUVB 2PTTB 3MRJA 4BSWA 3A67L 1F6AA 2V9QA 1XGPB 5D2LA 5BJTA 1HIMH 3EOTL 1MCDA 2HT2D 5K9JH 3CZFB 1T20A 4TQEL 3VXRB 1NBVL 4G80A 1NH6A 3PWVA 3T0BA 3T0DA 1EUUA 3CK0H 4LSQH 4X4YB 2DMBA 1YA5A 2A2QT 3N1MC 4QWWD 2AK4A 4WO4C 3NCJL 3QJHA 4R8WL 3QR2A 1FH5L 4CMHC 4S10A 5DQDH 1RUMH 2MCPL 3PL6B 1P2CB 4P2RD 5DYOB 4JFOA 3F6IA 4K3DH 4R96A 1GGCH 2FGWH 3BW9A 1MLBA 3CFBB 1GZQA 3B5TA 2FJFA 1J9CT 3FQWA 1ADQA 1CXHA 4QOKD 5F6IC 2ADJA 2F54B 3TN0C 3VRIA 4ONGH 1J1XH 3RPIB 3IDYB 4N9GA 4XH2B 1CGWA 1BQUA 4JR9L 3ESVF 3A6OA 1FL5A 3AUVA 4ZXBD 3RDTB 4Z78A 4NO3A 3BN9C 2X1XR 4QYOA 5HI3D 1P84K 4LIQE 3WLWD 4HD9A 1FJ1B 4Z7NF 3VXTB 5M94B 2IFFL 4NCC2 3ARPA 4J4PA 3WFCH 4X0KB 1Q9OA 1U58B 4YEEA 5HGHA 1CXKA 2GI7A 1I8IB 4HPYL 5GSRB 3TVMA 4KK5C 4OAWB 2FR4B 4XP6L 4V1DD 4EIGB 1WTGT 4ZUVA 3UTSB 1INEH 4PJGB 4LF3B 3HFMH 1YNTB 4JKPH 2F74B 4ODHL 4P4KD 4LDEB 1URLA 3MLSL 3TZVA 1JGUL 2D03H 4JGJA 1QLRA 2PETA 2OTUB 4L9LB 4N8VG 2YA2A 1FNGA 2EDQA 4RCAA 4NQTA 4NWTH 5F7EH 4HG4J 4Z76A 1N0LA 3V5HA 1YPZF 3RWCB 2HFGH 4M7JL 4TVPH 1XT5A 4FZEL 4M1CC 4MJIB 2R23B 1G7LA 1S9XA 1LO4H 2P8PA 1JYXA 1FPTL 1LNUA 2MQ3A 5FV1L 3GB7A 5LQBH 1U6AH 1AO7B 1H5BB 3PUCA 4J12A 3O0RL 4GKSA 3LKQB 1DE4B 4U1JA 1T7VA 4O51B 5GGVH 4MGXA 3SKJH 1EERB 4XNMB 2A6KA 3R8QA 5CINL 1MNUH 1C5BL 1T1YB 5ENWB 3DGGB 1I9IL 2WINB 4JFYB 3QUYD 3G6JF 2HAZA 4MCYA 2O5YL 5F3HA 3S9DB 3F6LA 4GG6B 2NR6D 1MFCH 1YNKH 3QFJB 2ZCKH 1KLFA 4PBWD 5HHOA 4E41D 4HUXB 1GZPB 1KIQA 4PJAF 3IDJB 2YC1B 4UV4L 4UI2A 1T1WA 3E1F1 3H3BC 3JV0A 1TMCB 1AGCB 3QIWC 4FTVA 4LLWB 4ZD3L 5IW1B 1IVLA 2W0LA 5DUPL 1YDPB 1UADC 1KJMA 3NTCL 4OF8A 3PGFL 5EO0A 2BVYA 3QQNA 3MXWH 3ARTA 5C8JB 2D7QA 3L5JA 1NMCC 2OL3L 3FQUA 3KYOA 5F6HJ 3IU4H 2OZ4L 4JFXA 2QHLA 4XBPA 1ZLUH 1PLGL 2OTPA 1FAKT 4MAYB 3W2DL 4NJAH 4MJ4A 3MFFA 4LQ1A 4ZS7H 5J0BA 1AGFA 5FGCB 5ETUB 12E8L 2JCCA 3QISA 1CDUA 1R5IA 3G04B 5EFIB 3GMOA 5I8EA 1LE9A 1QR4A 3D85A 3EDKA 2AXFB 4QTIL 5TDPB 5FYJE 3BKYL 1XR9B 3UTPE 2DQGL 4M7LH 1EHXA 1RAMA 5CBAB 4OZ4B 3HUJB 1XF3A 1JTTA 1IFHH 4F8TA 2QQLL 1KT2A 1OCWL 1DQQA 3X3FH 1IEBB 1FVCA 4OGYL 4EBQH 5I17A 3GSNA 2YA0A 3VD4A 4MA3B 4BH8B 1OF2A 4OFYD 3T0ED 1LDPL 3N0PB 3PGCB 2NY5C 1IGFH 1IGJA 32C2B 4PJHE 1KF9B 4MQXC 4Q9QL 5C0DB 4JFPA 4QY8A 1K3ZA 4YDLB 5HYJA 4WO4B 3CH1B 1KGCD 2OJZL 5EZLB 3FN9A 3RAJL 4ERSH 4ZUSB 5SWQB 4QLRA 2CDFA 4X6FA 2E7LC 3TBTA 4PTUB 3MA9L 3RL2B 1HINL 2GUOB 2KQMA 5T1KB 4NQCE 4KJQD 1NCNA 1HYRC 2Y23A 3UMTA 3B9KC 4Q0XL 3FFCD 4XB7A 1B2WL 5A2FA 5ACMA 5F7MC 4GW4A 1FO0B 4G8IA 5EU6A 4WUUB 4LGSB 3QNYB 2GT9B 4JO1L 1CU4L 4ISVB 3I6LD 1DCLA 2PYEA 3WBDA 2VITA 1JFQH 5AWNL 2Q86A 1Y6MR 3ROLA 3OX8A 1J5OL 4K55A 5CGMA 1A1NA 2R2HB 2NYYC 2NXYB 4Z7OE 2D4FA 5J6HA 5I9QC 4PV9B 3PGDB 3QUZC 3IDIA 1NUGA 1DFBH 4XMPL 3OWEA 4NN5B 1PG7X 1N3NA 2DQHL 3VCLA 1ONQB 2DYPD 4HT1L 1BBJB 3BAEH 3MRPA 2ITDA 3KYAA 4NO0A 3PDOA 1FYTB 2OMBA 4HQQH 2WWKT 2QSQA 3HC0A 2Y5TB 3MRCB 4JDTL 1FSKC 1MHHA 2DS4A 2BNRB 3TIEA 5DVLA 3RWHB 2UYLB 1XGUA 4ZFOB 1P7KA 1CD1B 1U2HA 3UYOD 5D1ZC 2JIXA 4XWGH 4ZXBC 3BE1H 5EZIL 4NBXB 4WTZG 4JQVC 4TUJA 4LCWB 1AD9A 3ILPB 3BN3B 4HWBL 1KXQE 5IBLD 1YPZA 2D0GA 4ODWA 4JN1L 2XKSA