3G6AB

Crystal structure of anti-il-13 antibody cnto607
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
222
structure length
222
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFNSYWINWVRQAPGKGLEWVSGIAYDSSNTLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLGAFHWDMQPDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Epitope mapping of anti-interleukin-13 neutralizing antibody CNTO607.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords CNTO607 Fab Light chain
total genus 48
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6aB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6aB01
3TVMD 2P7TA 5D7LD 1F2XK 1LO3H 1JGDB 4DUXA 2NLJB 2ICCA 3FOMA 4ODWA 4MHHI 3OKDB 5BQ7A 3KPQB 1BZ7B 1VESA 1BPVA 1B6UA 5A2IH 3IGAA 3PJSB 2FIKA 3MLVL 4LCWA 1VFBB 4K9EL 1HXYB 2YUWA 3FQUA 1MCFA 3QO1A 1RJZA 4L9LB 2ATKB 1F2QA 4PJCA 5TDPA 5CEZE 3SE9H 3KGRA 4G7VL 5EBLB 4XP4L 5INDA 2Q6WA 4ZMAT 1HK6A 1MJ8L 2UY7A 5JW3L 3FCTB 3P3YA 4IRJC 5HHVL 1AC0A 5K9QI 4K71C 4M62H 1EEUA 5CSZB 3QEHA 3OB0K 5ITFA 3QUKA 1PKOA 3KJ4C 2FX8H 2VDRH 3BQUC 4AM0A 1HXMA 2DMBA 4JAMA 4Q9RL 2FEEI 1UA6L 3ARDD 4FQXB 2GK0B 4XMPH 4H5SB 5GRUH 1AHWC 1KLFA 5EO0B 3KPRA 3QUZD 5GGVH 1A4JA 2X10A 2HKFH 5C0CB 1FLRH 2F15A 3CU7A 2CKBH 3F65A 1MH5B 3QNZA 1VERA 2Z31A 1UJ3C 2H9GA 5C0JA 4YK4C 4XH2A 3SQBA 4RZCA 1CFTB 4ZO8A 3NAAH 1PAMA 2DBLL 2GT9B 2Q3ZA 4WI4A 5D7IF 3X14B 1MQ8A 1XR8B 2VL5A 3G6DH 1LDPH 1EH9A 4JFDB 2J3SA 1RK0A 3GSRB 1FAIL 1ZHKB 4NDMA 3KYMB 3GBLA 3QDMB 4Y1AD 3L5XL 4H25A 4NFDA 4OF0A 1MFEL 1TZIA 3MYJB 5IOPA 4JPKL 4XWOD 5KBNC 5I9QB 1J8KA 4JM4H 4X7SH 3IDIA 2WUBL 4MA8L 2XZZA 3MRGB 2NY1C 5EU7E 3U4AA 4WUUD 3KPRD 5D5MF 3GMPA 1AGEA 3EIFA 2YEZB 4JR9H 5LGJA 4OZIB 3MRFB 1K5NA 4Y4FD 4OCNC 1QBMH 5DHVA 3MLXH 2H6PB 8FABA 3OTTA 3G6JA 5HI3D 4EI5B 1SY6L 2AQ2A 1Y6MR 3RTQD 2X7LB 3VMOA 1AGCA 4JG1L 4ZO6A 1T7ZA 1JGEA 4N8CL 4Y5XB 5JMOC 2CLZB 2ESVB 1J1XL 4O02H 3I6LE 4QHUA 1D5IL 3QBTB 2XG5A 4M6NL 1YZZA 3OKLA 4XMPL 1DFBL 1LO0H 2JCCF 4Z9KB 5E5UB 2BRQA 4WFHE 5GGTL 5ESQB 4XWOC 5LAXA 3IAGC 4PG2A 2B0SL 2XA3A 3HAEH 3IKCB 4QTHB 3O6MH 2DTML 2X4SA 3PWLA 4ORGB 4NPYA 4JY5L 5IIEB 2VZTA 3W2DL 2N4IA 1JP5A 5J3HC 2CKNA 1I7TA 1K3IA 4N1CA 3RNKB 3VXPA 2OS7A 1GZQB 4L8CA 3ZDYF 3HG1A 1T21B 3W39A 2BVYA 4M43L 4L8SC 2ZUSA 1HWGB 4N5ED 4AIZB 2Q7NA 3T09A 4U1IA 3TO4B 4MNHB 5FUOL 2J8OA 1AR2A 1F4HA 4MNGB 1NMBH 1RIUL 5D1ZD 2YR3A 5CLWA 1KCRH 1HILB 1RURL 3FN3A 5GGUB 5FO9B 2R23B 4Y4KD 1A7NH 4PJAF 1L0YA 5B4MC 5L7XH 3L3JA 3MCKA 4NO3A 1RJCA 1DBAL 1BBJA 3VXPB 4X6CE 5DQDL 4I18A 4JY4A 3ZLQC 3LEVL 4XCFL 4JRXE 2X4OB 1O7VA 2AK4E 5DEGA 4MNQE 3UX9B 1KIRA 1J1XH 3W9EB 1KOAA 4NN7C 3DXAE 4LAQH 3TA3D 1U8QB 2D2OA 5IQ9B 5JHDD 3ARBA 5ITBH 4RWYH 3Q6GH 4KPHH 2WW8A 2OI9B 3QCTH 4HBQA 4OGYL 3HZVB 4PJIA 4J4PC 5EDXA 4Z0XB 1NKOA 3DX7A 4J3UA 3MJGX 3MLRL 3RNQB 1T89A 2WMPA 1MHCA 3LN5B 3VXRD 2JKXA 2OP4H 5D7SH 2B5IC 5ACZB 2EH7L 4QHUB 4QT5A 1PBYA 5SWZB 1F6FB 1KEGH 3IFOB 4DW2L 1M7IB 3I84A 1SMAA 1OTTC 4Q6IA 3CVHH 5HDBF 3RVTD 2EDOA 2J2ZA 3BGFC 4UMGA 3QDJB 4P2RD 3RFZC 1KT2B 3U6RB 3FT4B 4YFLI 1V3MA 5KS9A 4FXKA 5JLZB 2N7BA 1T66C 3BPNC 2NY1D 4S2SB 5EU7C 1XGYH 3OWEA 2X1WL 1S9YB 4JANA 3MRMB 4IRZL 3MV7B 4M6OL 2Z8SA 1SJHB 5C2BH 3BP7B 3AS3A 4EXPX 3HS0A 1IAKB 5F70A 4H25B 5AZEH 3CXHK 1ZHLA 1X44A 3IXAA 2CRZA 4BFBD 4FZEH 3D85D 4JFDA 5E8NB 3G5XB 5MEND 2AJZA 5HHOD 4ODVH 4DVBB 5FYKH 4P48A 4B5EA 5H2BA 2H9GB 2MCPH 4IOIB 3SJVB 4F57L 4LF3A 4NWTL 3U4BL 1G7MB 2AXJA 1C5BL 5F97E 4RFEB 4QXUL 3QIBB 4ZS7L 2Y23A 4G6JL 3TC9A 2M2DA 3HKFA 4WHTA 5E03A 4F37K 3PP3H 1D5XB 3KHQA 2MWCA 3JTTB 4KV5E 1F4WH 3VFNB 5IESH 3P0VL 4LHUG 1Q9WB 2PYEB 2XV6B 4CMHC 2FLRT 3LDBC 2NXYC 4MA8H 4UDTA 1VADB 3I9GL 5EZIL 1NCDL 4XTRC 5INCB 4QRPE 4IBLT 1F11B 5KSAA 2I60H 5LBSH 2F53B 5T1KB 4F9LA 3L5IA 5E1AB 5JNYB 2QBWA 2NXZD 1CG9B 1ND0B 5KVMC 5D96B 4KUZL 3RVXC 4K8RD 3M17B 4HS3B 3MJ9A 4UIKH 5C0IA 5C0NC 3NACH 5D8JL 3RU8H 1P84J 5F1SA 3Q2CA 5GSRB 5J0BA 1JTTA 1R5IB 4N8CH 4GMTH 4WRLA 1IAIM 5C2BL 4F33B 2UVEA 4LSPH 1JNLH 3WKNA 1OSZA 1U42A 5ALBL 3PDDA 2YPLA 4OD1H 2A1WL 3FN9A 1DFBH 3R1GL 3EYFA 1S7SA 4QRPD 2B0SH 1ACYL 4HC1H 1I3GH 4X4ME 1RIHH 4NO0A 1ED3B 4Z7NE 1FP5A 3O9WA 3OKEB 4JY5H 1IARB 4GRMA 2UY6A 1MWAA 5IB3A 3EO0A 4LCYA 1UWEH 5K9OA 3VXUB 2VXTH 4HLZG 3HLAB 4NQVB 4L3ED 5HYJE 4L8SA 2ZUTA 1CGSL 3BZ4A 3PWPE 5EU6E 1GC1C 1JHTB 4NUJB 3UYOD 2W07A 5T3XL 1F6AB 3RZCA 3AFLA 4YXLL 1AP2A 5EZIH 4Z7UB 3PWJB 1RIVL 2P42B 1AFVH 4XPBL 2X6MA 2AK4B 5EIVA 3IDXL 4NZJA 5D72H 4WO4B 3MRHB 1YNLH 4JM2A 3WMSA 3OAYK 4XVSL 5D7LB 1ADQL 5SWSA 5GIRA 3SY0B 4OV6F 1DBBH 5I8KH 3WFBL 4OFPA 3CCHB 5IT2L 4RA3A 1DQQB 2NY5H 5L0QC 4GO6B 3MBEA 1YEKL 4XZUA 5CEXB 1A7QH 2Q86A 4P23A 4KRPC 2JCCE 3QJFA 4MJIE 4ODUA 3H6JA 5FK9A 1RMFH 5ESAA 1RZFL 2Q20A 1G7IB 2GAZB 3KJ6L 1FVEB 4YO0A 1T89C 1G7IA 2GAZA 1XF5B 2HFTA 1MNUH 3H9SB 4HFUH 1UVQB 2VDNL 4WHCA 5GS2D 1NC2A 3MMEA 3X11B 3RWCB 1R6VA 3MOAL 5I6XB 4U1NB 3BMVA 3QXTA 1HH9B 1N7MH 1QFOA 2B2XL 1R0AL 3INUH 4XC1L 1LDPL 4JDVB 1GOHA 1NGZB 1FFPB 4Y4HC 2DIAA 4JREC 1R24B 5DJYA 4JFZH 4XX1G 1VACA 1MFBL 1H8NA 3WHXB 5ICYB 5B21A 3S9DB 2XY2A 4G3YL 3K8LA 1ZVSA 5CHNB 1JCKA 3T04D 5C0CD 3ZKSD 2VXQL 4RIRB 1NLBH 1C8PA 1NCCH 2E7HA 5J6GB 4WV1A 2HT3D 4CGTA 5DJ8A 5HYJD 3SN6N 4YHLL 3BPOC 4PGBB 4NGHL 1VGKB 3LQAL 3VGDA 4FZEL 3CFKA 3L1OH 1I9JL 1LP9B 4X0KA 4KJQC 4HK3J 4KK6C 1IGMH 4UBDD 2XIDA 5EO9A 2DRUA 4GRMB 1LE5B 3NZHL 5EIQA 4O51A 2HVKB 2IBGA 2ED7A 3MLTB 5I1IL 5CIPB 1A7QL 4W6WB 4PJHA 3BP5B 4KMLB 3RQ3A 2NW2B 1CGTA 4F57H 2V9TA 4M6NH 2HWZL 3CPLB 3PWNA 5GS1B 2XZCH 3F7QA 4QXUH 1T1YA 4WEBH 1ZA6A 3SE4C 1H8SA 1MNUL 5DVLA 3V5DB 4Y2DB 5L88H 1KG0B 3QQ4A 4YDLC 4KQ3L 3MOAH 2VR4A 3B9KC 4HT1L 3RKPA 5F9OH 1W8NA 5E94B 4X80H 2VUOA 1IGYB 2RFXB 1Z2KA 4OZHB 5JR1L 1ZMYA 4KMQA 3T0DA 3VWKB 1FG9C 4F3FA 4MXVE 2H8PB 3QUYD 3D3VA 1S9VA 3P4MB 1L6ZA 2VABA 4Y19A 4LVOC 4Z7WA 2ZG1A 3QO0A 3HB3D 4AEIH 2VC2L 4CJ0A 3VDBA 5EU6D 2BERA 4Q9CA 5CWSA 5EUKA 3MRKB 3H3KA 4ISVA 4PY7A 4KUCD 1K4CA 1HQ4A 3CMOH 4K7FB 1EVTC 4X5LA 3GUTB 2ERJB 4S0TD 2HG5A 2NY5C 4HCRH 2UYLA 3D1MC 4YHZH 1NUGA 1NMBL 1RIUH 4OZFH 1VADA 2Z8VC 3QI9B 3RWEA 5IW6A 2OJZL 2BJML 4HMDA 5TDOA 4AT6B 4GRLB 3CDGA 5EBWB 2DYPA 5JQHC 1HINL 4PJHF 1DDHA 2WWMD 3CD4A 2P48B 1HZHL 4I0CC 4J3SA 1LILA 2D7TH 3JWNC 4RFEA 4XNYL 3CGTA 3RAJL 4GOSA 5DQJA 2PTTA 1V3JA 4P46B 3BN9D 3G5YB 3AB0B 4X9FA 5F3HB 2AXHA 1HNFA 1A2YB 1OGAD 2YKLL 2QTEA 1S9XB 3QB7C 4P4KB 1KJVB 3TO4D 4G6AC 5MENE 3FZUC 1QP1A 3RA7H 2AXFA 3GI9H 4JFPA 5T3XE 5E8NA 2BVQB 2GSIA 3PWUA 2H41A 3TH2T 1A6TB 3UPAA 2DL9A 4LCUA 1YQ2A 3C5ZC 1KIPB 4X80L 1NUDA 1EEQA 4PB9H 2QADD 4F7TB 3ROLB 3RL1B 3NPSB 1S9YA 4XPBH 3JVGA 3PV6A 4U1MA 3TBWA 3IETA 4U7MA 5TFSL 1KXTB 2BSSB 5KS9B 1X7QB 4HUWA 4NWUH 3V52H 5JHDB 1N8ZA 1RHHA 3HZYB 2YN5A 2XWBA 3CLFL 4P3DB 1EHNA 1O5DT 1WZ1L 4GAYB 5HHOA 3ZDYE 1QFUH 1CLOL 2R2CA 3CVHB 5CD5D 1RULH 2DQCL 1K85A 5ENWB 2AJ3A 4GH7B 4FG6C 2OJZH 4XAWH 4PRDB 1VEPA 1UKQA 5ERWB 1ZXQA 1E0OB 3P11H 3P77A 3WIFA 2VLRB 4IDLA 2NZIA 1MHCB 3G08A 4PR5B 5D6DA 4JLRB 5MEQB 3DURB 3QUML 1PY4A 4P5TC 5C3TA 2NNAB 1FZOA 2FBJL 4KKBD 1CIDA 1U8KA 2DB8A 4OIAA 3RAJH 1S7RA 4OGAC 2K9UA 4LFHD 4NNXB 3EYVA 1YNKH 3MYZA 1TQBC 2O5YL 4HCRA 1H3WM 1BIIB 2OYPA 4OB5L 2DI8A 2CIIB 5IB2A 1BWWA 1R0AH 5SV4A 5I1LB 4J12A 4MZ3A 5DJ2B 5AG8A 4NNXA 3GI9L 1W72L 4ZS7H 6FABL 3MCLL 4HGWA 3MUGA 3D25A 1JPST 4HJJH 3VW3H 5FF6A 1KPUB 4MNQA 4O2CB 3BGAA 2DQIH 1P4BL 1UZ6F 3BH9A 3CSYA 4G8GB 4G9FE 4AMKH 1MI5D 1KGCD 4WI9A 4HHAA 5LBSL 4PRPB 1NDGA 5BO1H 2OR8A 4ZFOL 3QFDB 2BC4B 2CIKB 3SJVD 1BREA 3W39B 1MEXL 4MA1C 3MROB 4MCYB 3UTTB 5CBAB 1FFNB 1ES0A 5DD5L 2RQ8A 4M62L 2GEEA 1QFUL 1OM3L 4Q9QL 4LSRL 1HOCA 4Z5RA 1U6AH 4JKPH 1XF3A 1PVHA 3IU3A 1R3KB 3LOWA 3VXME 1OD7A 5LAXB 1EV2E 3STLB 3I85A 3ZKMD 1AKJD 5FGBC 1OL0A 2GSIB 5C09B 4F8TA 4PJ7E 5D1ZA 5GGRY 4XAKD 5E08H 1S7WA 1FLRL 3OKLB 4Y4KA 4KQ3H 1I3GL 4AH2B 4QRQA 1CD1A 2DWEA 2OL3L 3G5YA 1U8JB 2CLZA 3QPXH 1CF8H 2KUTA 2P1YA 5DQJB 4U1KB 4CVXB 1N0LA 5GGRA 4I3SL 2A9NH 5DHYA 1YMHB 4UQ2A 1TZGH 4QRSB 3MCLH 2Z0BA 4PJ5D 4X6FA 2PO6A 1R3KA 5FHAH 4HJJL 5MEOB 4P57A 4RGND 2VDKH 2IAMD 3QUXC 5HSFA 5IBLD 4R97C 1U36A 5B4MD 3IFPA 5D1QD 4QRPA 1DBJH 5T3XH 3B9EA 1X4XA 1FC2D 1NGYB 4YXLH 3G5ZB 3VFSB 2X4QB 1CE6B 1GVIA 5I0ZA 2ZUVA 4LHJB 1AFVL 1CD0A 1BAFL 4K94L 5IBTL 1NL0H 2BC4A 1NDMA 1RUQL 2DLFL 3LEYH 3QUMB 5D6CB 4PRPA 1SY6H 5E6YA 4NDMB 4PJCE 3BGMA 1H3GA 2GFBA 5IVXB 4X9HA 1IGFH 4POZD 1GAFL 1KCUH 1A6UL 3EDKA 1TNMA 2YRZA 4D9QD 4OZHA 5C6TH 1IAOB 3AMLA 1VGEH 4Q2ZA 4YHIA 4BKLB 1NGPL 4U0QB 3QNZB 3VCLB 1JUFA 3QDHA 3ARZA 1YN6A 2X9XA 2IAMC 1CQKA 2GQHA 5GGTH 5GRVK 1JHLL 1HCVA 4EN3A 3QQ9D 2G2RA 2NW2A 4MXVF 2AQ3A 4LLWA 4RAUB 4WU5B 1N7ML 2B2XH 3MGAA 4J8RB 5HYSA 3TT1H 4LIQL 3ZDZE 3QUKB 2NXYD 1ORQB 3C8KB 5DTFA 5JXEC 5E2VL 4JLRA 1CFNA 3HUJA 3PDOB 1HYSC 2AI0L 5FA3B 5FHAL 2VLRA 3T2QA 2IPTL 4Z7UF 2F54A 4BH7B 4JFZL 5I73C 3O3UN 3VWJC 2BVPA 4RMQA 3UTTE 2MQ0A 2SEBA 4KTEH 4HPYL 1V5JA 3NIGE 3ZKMC 5CEZD 3VXSB 1WZ1H 3WLWD 2E8YA 4PJCB 2ZOKB 4GXUM 4JO1H 1WWBX 3CK0L 1RULL 2DQCH 4JFHD 2VZVA 3QEUB 1IEHA 5C86A 4N9GA 3P73A 2C7UB 1NL0L 4X99B 2FJGB 4KHXL 2O26U 1VACB 3MLYH 1TCRA 4LSUH 5LKNA 3QZWB 5HHMD 5DJYB 1NAKH 4PLJC 2VKXA 2YSSB 4HKXA 1BVLB 4P5TA 1FSKB 3DO3A 4CN1A 5C08E 2XPGA 3VD9A 1JVKA 1WBYA 3K3QA 4URTB 3L6FA 3L7EA 5F71A 3B9KB 2WLYA 1UQSA 2HT2C 1LWRA 3AMKA 3NZ8A 2AS5M 1WZMA 4U3XA 1YEDA 5CUSH 2OTUA 4TN9A 3TBVB 5ITBL 1R3LB 3AC0A 5DHXB 1A7BA 2FJHA 4WEBL 1TTUA 5GS1C 3KWWB 1TENA 5ICZB 3MLRH 3H8NA 1JHLH 4G7YL 4P2QD 1LD9B 5FK9B 1GOGA 2ESVD 3ZDXE 3FJTA 4RQQA 1P69B 2NY2C 1XAUA 2IEPA 5CJ5A 2GITB 5IQ7H 3G6JF 4M7JH 4EOWH 5CEXA 1FVCB 2HLFC 4BSJA 2WZPD 1M71B 2IH1A 4DW2H 1RPQA 1F13A 4ZO9A 5DGQA 4YHKH 1IJ9A 1ZKAA 3OB8A 2AKRB 4YUEL 5JTWA 1ZE3C 1BZQK 4EEEA 2I07B 2R69H 2DOCA 5IB4A 3ULVD 4KKBC 2X70B 5IKCA 3QRGH 4OGZA 1MFDH 1NUFA 3PXJA 1JI1A 2AK4A 2Q8BL 1KJ2B 5JW4R 2VLJB 4HSQA 3RGVC 3WUZA 2A6KA 2HP4A 2YA1A 2FD6H 5C1MB 1OM3H 5FKAA 4DGVH 1U6AL 1J0ZA 2XOTA 5J57B 2BSTB 4MB5A 4CVWA 2OJEB 5HPOA 3ULVC 3HMXA 3QO0B 4DVRH 1FYTE 4X8JB 5EBMA 5IF0B 3RY6C 3HLAA 4L4VE 2ZCLL 3NA9H 5FUCC 4LCYB 2G5BB 3IDMA 3QDAA 2VIRB 4J3XA 1TQCB 1IGYA 1UCBL 1I9RL 3MV8D 5E94A 5IW1A 4DZBB 3LV3B 1V3KA 4CDHA 1P7QA 1JYXA 2Y72A 3FQXA 1C5BH 2A9NL 5HGHB 1YMME 1KCVH 2C4FT 2Y7QB 2K7PA 4EI5C 4HQQH 1CXLA 3X17A 2F5BH 4R4NC 5C08B 3ARTA 4ZYKA 1ZWIA 3OMZA 4KK5D 1MFAL 4OUUB 5IESL 2HVKA 3EYQD 4G6AD 3RWIA 4PB9L 2W9DL 4J2XA 2FR4A 4C56A 5F6IB 3BQUA 4HMEA 3H3PL 4J3VA 3SDDC 3WUWA 3DIFA 4LSSH 4O2FB 3BEWB 4OGXH 2JJTC 4N0UE 3EYUL 4I0KA 4NYLB 3OL2A 3HFMH 1EBPA 1RUQH 1PD6A 1QYGL 5J6GA 1A22B 4JEGB 3THML 1T7YA 1AHWA 3E6FB 3QRGL 3TPKA 2BNRA 1I8MB 1FNGB 2GJ6D 2EDYA 2P4AB 4TQEL 1U3HB 2A9MH 5IHBA 2X89D 3OKOB 4XP6L 1D5BA 3LIZH 1ERNA 4JQIH 3K2MC 4F2MB 5GS2H 1BMGA 2G9HA 3ARDC 3KPSB 2B39A 2APVA 4P4RA 2X70A 1EERB 2WK2A 3P11L 4NC2B 3JTTA 5I1KH 1VGEL 3D9AL 3KYNB 3BZDA 1CGVA 4WUKL 4YH6A 4OD1L 2A1WH 1JWSA 2LAAA 3BP6B 3HAEG 3QUMH 4LIQE 2FLBT 5HI3C 1T0MA 4TNVF 4KFZC 1ZS8B 4U4BA 5FUZH 1YNKL 5TPWH 4OCLC 4BELD 2OL3B 3I6GB 1DEDA 2BVOB 4OLZH 1LK2A 5E5RB 3MACL 5K93A 1CDHA 1T3FA 1N64H 1DJSA 1XF5A 4WW2C 2AJZB 3EJYC 2YZ8A 3HPLA 1XGRA 4PRIE 3DGGB 4Z7NF 5HGAA 5ESAB 3NGBB 4HQQL 4XNQA 1YEDB 4P23B 3V6OE 1QFWH 4O4YH 4DN4H 5IHZA 3L7EB 1UCTA 4I2XE 4WWKC 3H3PH 4UAOB 5E4EB 3WNOA 3OV6A 2CMRH 4JO2L 4MS8D 3O6FA 1ZGLA 4JHAL 3QDGE 3MRHA 3HFML 1F5WA 4KHXH 4KK6D 3C2AL 2YRLA 4YBLB 2VDOL 4JQVC 3U30C 4NO2A 5FA4B 5CJQH 3P2TA 2HTLD 4LVNC 5T5FL 2EXWD 3BDYH 2CK2A 4Z7UA 4K55A 2VKWA 5LCVL 4O9HL 3O3BB 2X4NB 4UUJA 1DP0A 1EGJL 1DUZA 2KKQA 1EO8L 1OGAA 5F1IB 4KRNA 5DRXA 4X5XA 1OAZH 3RL2B 1GJIA 2EYTB 5I1AA 1B0RB 1XH3A 5K9OB 4IRJD 2QR0B 3MUZ1 4L4TB 2EYSA 2CDGB 2DJ4A 5JW5B 3TJEH 2YUVA 4EDXA 5DDHB 2D7MA 1U8IA 1J1OL 2HRPH 1CIUA 2F58L 3QXDA 1N6UA 3JXAA 3LZFL 4N0UB 5E8OA 5E8EA 3DETD 2NX5A 4YHIB 1RD6A 3EO1A 1NGQH 5I8EB 1S7UB 3DV6A 4TTDC 3MR9B 1LE9B 4YC2B 1R5IA 5D7JC 1KC5H 5KAQG 4S1SL 4YLQT 4PIRF 2O5XL 5LQBH 4CDGC 4DGVL 4QGTA 4K3GA 3SO3C 4OLWL 5T3ZE 4JRXA 3ARBC 1HSAB 1U8HB 3WN5A 4NGHH 2XXMB 2ZCLH 3VFTB 3CUPB 1CE6A 2X4QA 2DKMA 1NGYA 3MV01 2WINB 5AYUL 2FHBA 3N9GH 4HMCA 1ZGLP 4HD9A 1X5IA 3QXAA 4JY6B 4HPOL 5LWYH 1I9RH 1G7QB 4IDJH 5ALCH 3TIDB 3F58H 5B38A 4M7KL 5IEHB 3V6FB 5MEOA 1C7TA 1A3RL 2HT4C 2HT4D 4H20H 4KK9D 3KPOB 3PHOB 3WO3B 2X4RA 3G9AB 4Y4HA 2IPKB 2JLLA 1AD9A 4L8DB 1BIHA 2F5BL 3HG1E 4K94C 5ID0A 5SWQA 4HWEH 4HT1H 5JPNB 2J6EL 1U3ZA 5IUSA 4GXVL 4M5YL 4M1DL 2EXWC 1I7ZA 1D5ZB 4GXUN 3ZKND 2XXCB 4FMFA 3MV9E 1YEHH 4KVNH 1YY8B 1JNHB 4ONFL 5D5MB 4ZS6C 3ZE2E 5IGXH 2OR9L 4MDIB 4R6UA 5I1EL 1D9KB 3RVVC 5E8OB 2H6PA 2XRAH 4QWWC 4PJGE 1BOYA 1EK3A 4LCIH 3QZWG 4FZ8H 1U93A 4HCRL 3SKJL 4LRNL 1WUNT 1WFOA 3ARYA 1WEJH 4PLKD 2CIKA 4OLWH 1KT2A 3RKDD 1TZIB 3OAUL 5A3IC 3MLYL 4LSUL 5J11C 1VA9A 4KKLD 5KVDH 2EYSB 4NRXB 4WFEE 3SKMB 3PWVB 2V7NA 2GJZB 4FS0A 5KTEL 4X5XB 4EBQL 4PJHE 3FQWB 3FT3A 3U0WH 1JPFA 3S96B 1LP9F 1MJJB 5ALCL 3HI1A 1E4XI 4GAJL 1KPUA 2IQ9L 5C0BA 1CDBA 1BEYL 3P30H 3UPRB 2X1OA 1H5BB 5C9JA 1MH5A 3SDXB 4X6EA 1GYAA 5HYEA 4MWFB 3O9WD 4PJIB 3T0EA 5DJ2A 4GW1A 3QDGA 4RBPK 5I1LA 1ZGLB 2R2EB 2FBOJ 1OTSD 2YMXH 2EE6A 3T0EE 2PF6A 4JAMB 4U0RC 1DBKH 3D2UA 5LGHL 3EYVB 1YEEL 3SDYL 1R3JA 3MA7B 3ZYOA 4Z7OE 1KTKE 5DZOA 5K9JH 4YUEH 4HH9A 4NO3B 1KN4L 2WWMC 4XT1C 5DEZA 3NVQA 3U1SH 4MQXD 3IU4H 1CICC 2VDOH 2QQNH 2R23A 2DLTA 1JPGB 1NGWB 3DROB 1HHIB 3LCYA 1BJMA 4Z7UE 3REWA 3SKJH 2V17L 4OZ4A 1JNNL 1U2CA 4OBSA 4KDVA 1LE9A 2FIKB 1FNLA 3DV6B 1X7QA 1QEWB 1OAZL 2K7QA 4DVRL 1ITCA 4G6KL 4AQ1B 1AGBA 5E00B 1T66D 3PV6B 3MLWH 4ODWB 4MX7B 4WTXA 4LU5H 3ROLA 3CC5A 5K9KB 2FNBA 1SEQL 3EO9H 4WNQA 1UCBH 2L0DA 4GW4B 5GRYA 3RZCC 1A9EA 1GGBL 1A6TA 4ZUSA 3H2WA 2OQJB 5BXFB 2ADIB 1BQLH 1IT9H 3UXFA 4X9IA 2EDWA 3PQYD 3SKNA 1BZ9A 4ODHL 3IFLH 3NCEB 1IBGL 2BCKA 3D18B 5I15L 4DQOL 4RGNE 4FFVD 1VFOA 5AAWA 3L3IA 1NKRA 4P46A 3U0PB 1OGAB 5CIPH 5DD1H 1P5VA 2W0PA 4UUJB 2W9DH 1P4BH 5EFIA 5MENA 2F8OA 4NC0B 3ALWA 4GBXD 2VN4A 1U3JA 4JHWL 2EE9A 4K3EL 2FZ3A 4LSSL 3V2AR 2JELL 4BZ2L 3G6JE 4NO2B 2VQ1A 4RRPA 4D3CH 2ITCB 3CDGB 1QYGH 4AT6A 1NAMH 1LNUB 3TA3B 1P1ZA 3EZ8A 3QI9A 3C87A 4TQEH 3OJDB 3S35H 4YHNA 3BUTA 3NIDE 2FATH 3W0WD 4JFXB 5FYKE 1QSVA 3SE8L 1P7QB 2BHYA 3GUTA 4ZODA 4RNRB 1AIFB 3EW3B 4JB9H 5IW1B 2F74B 4HPOH 2A83A 4OI8A 1DL7H 1E4KA 3NBNA 3VFRB 3U2SA 4BQ8A 4UU9B 1RZKC 5E9DA 1HSBA 4DUWA 5M7QA 4MJIB 1WBZB 4JFEB 3D85A 2R2HA 2X9YA 3IDJB 2Z8WC 1ORSB 4XB7A 4PUBH 4YXKL 4XH2B 3QUXD 2MSPA 4XCNA 5IBLC 1WFUA 2Z93A 1MSPA 3QQ4B 2UWEF 1GGBH 4YGAB 5ETUB 2DQDL 4YHMH 3P4OB 1OTUD 1MI5E 4RAVB 4CVZA 2GCYA 3MRPA 4FFZL 4FQXA 3KPLA 3O6KL 5D7IB 2EE3A 1OSPL 4E41B 3S8WA 3BYYA 3CPLA 3KYNA 4FQIH 4ODSL 1UH2A 3F7PC 5IGXL 5IFAH 3BP5A 1XGPA 3Q48A 1DQML 1J7VR 2VOTA 1LHZA 5JIHA 1GC1L 4P49A 1YEJL 2G9HB 4M6MH 1FVCA 1E4WH 2VXUH 1SHMA 3BXNA 4JHWH 5B8CA 4NQXA 1XR9B 2R2BA 1WEJL 1BAFH 4K94H 3W11C 1OP5K 3U79A 2V7HA 1JK8A 2BCKB 2P5WD 3C8DA 2Q6WB 1JF1B 4D0DA 4MCZA 4P2QA 3LKNB 2ADGA 3BEWA 1J88A 1T2XA 3TBVA 4TSBH 1A21A 1VFMA 4G8GD 1A6VH 4P5KA 2QLVB 2W60B 3SE8H 4XNMA 5BXFA 5DURD 4YHYC 1KCUL 3X3FH 3RWIB 3QWOA 1XGTA 2BVTA 1L0XA 4MA7H 3SDAA 1EO8H 4KK8D 3OHXB 5IMMA 4YAQA 5C6TL 3CNKA 3CC5B 3C6LB 2CSPA 3QHFL 4R2GD 1NGPH 1ONQB 5KOVC 2V5RA 3M8OH 4TVPH 2F53D 2F9BT 1DN2A 5IWLC 1JZ5A 4N9GB 1Y0LB 2DJUA 4X6DB 3RIAK 2Z93B 2VDLH 5GJTL 3WFDL 5D70H 2ZOKA 3LQMA 4OJFL 1UVQA 2AJVL 1XF2A 3CVIL 4HWNA 5J9PA 3L3DA 3N0PB 5EUOA 2R2HB 1OW0C 3LZFH 1NGWA 2P49B 5I1JH 2EIZA 1OSPH 2OI9C 1L7IH 2IPTH 3KS0J 1Z9LA 1S7TB 4OGAD 2KBGA 3GM8A 2EC8A 4LKXB 3T2OA 4OCYL 3SOBL 3PV7A 4MLSA 1R3JB 3DUHA 3MA7A 4WFGE 4XVJH 4DZ8A 3ARUA 4HWZB 1FPTH 3DX6B 4N0CD 2PW1A 4HKBA 1H8OA 4JM2B 1RJYA 4FRWA 4G6KH 2I07A 4J3WA 4ZFOB 3PHQA 3ZT5A 2XQBH 5C09D 3Q5OA 3QG6A 5FGRA 4LU5L 2R4RL 3MRIA 4F9PA 4OSUH 1JF6A 3IVKA 3EO9L 2GITA 3U0PA 1LO2H 3U4EA 1A8JH 1Q1JL 4P9MH 4RQQB 4ENED 2WUCL 4NKMA 4Z7VF 3D18A 3HUJE 5DVKA 1NCWL 5EOTA 2C4FU 2H45A 3BD3A 4XHJC 3QUMA 3GSWA 5D6CA 1XF1A 3RJDA 5KVFH 1R3LA 3KPTA 5EU4B 4MA1B 5TH2B 3ROOB 3SEPA 1UB6B 3MNZB 1I8LA 4Z7OF 1HHJB 1G0DA 4KDWA 2UUDK 1A9EB 4NQSA 4POZC 4HUXA 4PB0H 3HC4L 4WNQB 3Q3GB 4X7CC 1LEIA 2R8SL 4GXVH 4OFKA 1IGCL 1HE7A 3CVIH 1PQZA 3GSQA 4MX7A 5HHPB 2JB5H 2JELH 3EJZC 4P57B 1NGXA 4Q97A 3QZWA 4M5ZL 3DMMC 5F7EL 5J89A 3SGJA 2X4UB 3CFJA 3QDME 5D6DC 3VGGA 4QRUB 1Y6KR 3QEUA 2X4PA 2V9QA 4U1KA 4FABL 2E9IA 3UC0H 1M7XA 4LKCA 4JZNA 5ABDE 1U8JA 3S88L 4M8QB 1KENL 4UOW0 2ORBL 3M17A 4HS3A 5C0IB 2DLGA 4N0FB 5JPNA 3TNMA 5E0QA 2I9TA 2JCCB 5ECJE 3LN4B 2CDFA 1JPGA 1ND0A 2IPKA 3LMJH 3OAUH 2VLKB 5HYJA 5C0GB 4JFFB 3PHOA 1T6VN 5T1KA 43CAA 2NW3B 4G9FA 2HJFB 5HYSB 3DX9A 5J12C 1FIGL 4Z7VE 4LPUA 4QF1A 1P7KB 3U0WL 3ZE0F 1JNJA 3TN0D 1D9KD 4LLVA 1S78D 2G2RB 4M93B 4P9ML 2CUMA 5I18H 3MBXH 2DQDH 4YHML 1BEYH 3P30L 1D5XA 4FXLA 1II4E 3UEZA 1DN0B 1UKSA 2H2SC 3QAZB 1JZ7A 3VFUB 4M3KB 2V2TB 4OZGF 2X89A 2VZUA 3NFPA 4JRXB 1H5BA 4EVNA 2FJFB 3SGDI 2ZWLT 3B9KD 3DUUA 3TPUB 1V05A 4PJEF 3GJFH 3CSYB 3S6CA 5GS3A 5IMKB 1BF2A 4GKSA 2GK2A 3TJHC 5JW4N 4QHKJ 2NZ9D 1QRNB 5IVXA 5I1HL 1MIEL 2Y36L 5DGRA 3SKMA 1ZHLB 5KW9L 4ONHA 3KYKH 5ISZD 1F02I 1TPXC 4M5ZH 5F7EH 3NFPB 3UZQA 4X7EC 5KVEL 4UOW1 4A2LA 1EUUA 5GGTA 1CLYL 2PYFB 1GPOL 5BVJB 2E7LA 3W82A 1CI5A 3QUZC 3PGFL 5DSCB 5DDHA 1BIIA 4MA7L 3OXSA 5IVZA 4JG0L 1E4JA 4Y16C 3WDIA 3FT4A 3GI8L 3RX8A 5CP3A 5EWIH 4X4YA 5ID1B 1P9MC 4E5XB 5D7KE 1YY8A 2AEQH 4LNRB 1G1YA 3DX8B 3RL2A 5BRZD 2XA8L 5ERWA 4KJYB 3K2UL 1HNGA 3QUXA 7CGTA 1KCSL 2H32B 2I9TB 1J87A 4Y16D 4DKEH 5HYQB 2VDLL 5GJTH 3BKYL 4LSDA 4Z0BH 1T1ZB 2EDXA 4ZUVA 5FM5M 1QSED 1S5IH 3CFBB 4KAQH 1FVDB 2H1PH 1KJMA 4KJPD 3GRWA 3B2UC 1FL3B 5FYLD 3ILQD 4PJEE 5IQ9A 3MGTA 1YJDC 5CJXC 5A2KH 2O5ZL 3VA6A 3O6FB 3W9EA 5B38B 1MCDA 1DE4B 3D69A 3HNTL 5C0RH 4OFYD 3R06A 4OM1H 5ADPH 1NSNH 4M9PA 5DEGB 1GGIH 2NZ9C 3RX5A 3SOBH 4NC1E 1YMMA 2ZG3A 5K9QG 4QYOB 3C5ZB 5BV7H 4I18B 3UYRH 3BKJL 3S5LG 1IKFL 5DFVD 2WNGA 3PNWB 3ESVF 5J7CC 4PTUB 5HHNA 1OAXH 5KOMC 5EU4A 4J3OC 3DGGA 4KROC 5T5NG 2ADJB 3OX8B 5I66A 1LQSR 2UUDH 3S35L 4TULH 2C5DC 4MNGA 1EEZA 2HN7B 2IF7A 3A6BH 3I6GA 2F54D 1D9KC 3MV8B 4DEPC 2GTWB 5BMFL 5I8CB 5F7FA 2BOBB 4MNQB 3EBAA 2NY3D 5JIIA 3LS5H 1NMAH 3MQIA 1N6QH 1I1FB 4RGOL 1U9KA 2EIBA 2C3HA 3PHQB 1DDHB 2ILLA 4NP4H 5MI0C 4GRLC 2YZ1A 4RFOH 5HYIA 1KCLA 3LKSB 5IIEA 1D5MA 1KCSH 2YHGA 3UJJH 2CIIA 3FO2B 5IB2B 5AYQA 3KPSA 2FEDC 3H9ZA 1WQVT 5D2NC 5GHWH 2PR4L 3MJ9L 5FDWB 4PJAA 3QPQD 2ZSVA 1MREH 4LKXA 3WIHA 1GHFH 2H1PL 3O6FC 4L4TA 3GSXB 2EKSA 4LVEA 3V6OA 4YHOL 5GISH 2EYTA 2DWDA 2HTLC 3VXNA 3VXUE 4NYLA 2LU4A 1HIML 1P6AB 1U3HD 1NSNL 1F00I 2HA1A 2FR4B 4MNGE 3TYFB 3PE9A 2X7LA 3MBEC 5FYLE 3V5KA 4LVNB 1BD2D 4YDLB 4KTDH 4NZDA 1A14L 5DHVB 3VFOA 3B2VL 3TBWB 1J0IA 1BX2A 3PWNB 5C0AB 1A6VL 2XNAB 1OAKH 1B88A 4YC2C 4WHDA 3OHXA 5IMMB 3MLTA 1NH6A 4HV8B 3PL6A 4V2BA 3SQOH 4M7KH 2PXYA 1FGVL 3MBXL 2FIRT 3OXRA 3HE7A 3BPOB 2BVQA 5K59E 3BWUC 4GG6A 4LSVH 1XGRB 4I0PA 3QRFM 3FFDA 2VSDA 3RVVD 4LPVA 1FH5L 1MHHB 2Z31D 4ZS6D 5C8JA 3O45B 1T83A 5F3HA 2BVOA 5GS0H 1T0NA 4QHMB 5FXCH 5DQ9A 4XNUH 3CJJA 2WP3T 3VXRA 1UFUA 5I76B 1MLBB 4JZJB 1S78C 3SGDH 2Y36H 3W5NA 1TETH 5IB4B 3ZL4H 2DYPB 2VDQL 5EBWA 1ZHBA 1FFPA 5BZDA 3ZYZA 2FB4L 3IDNB 3SKUD 2M1KA 5DJZB 5TDOB 1HIMH 3ARVA 2YRPA 3QAZC 1HKLH 5IW6B 3D39D 4LASH 2IH1B 3U7WL 4KI5E 2B1AH 5ITFB 4OCYH 3ZE2F 4AEHL 3NCJL 4WFED 4BFGA 4JKKA 5KSAC 4NM8H 4XCNB 3VI3F 1K4CB 1IAIL 1I8MA 5C3LD 3MMEB 1LGVA 4MJ6A 4LEXH 2J1KA 3NABL 4HKJA 4PS4H 1G9NH 3PABB 5DUBB 3CFDA 1K2DB 3FN0L 3AS1A 1CVSC 5IFJA 3PF2A 1CXKA 1MJUL 4HWBL 3QO1B 1U8NA 1FCCA 1U8PA 1HXYA 4D0CB 4HV8A 2WM0A 1YC7A 2OX5A 3IGAB 3PJSA 3FB5A 2IQ9H 3SKOA 1A1NB 5GIRB 2WIMA 5BQ7B 4XPTH 3V5DA 1P9MA 3MJ7A 4XX1E 3BFOA 5DYOA 1A0QL 2AJXL 3TVMA 5HGHA 1LNUA 3C5JB 3FFCE 1FH5H 4KQ4L 3TNNA 2C3XA 1BVKB 3CSPA 5CMAA 2ENSA 4NQCB 1WWAX 4GG6F 3LV3A 4L4VD 3V5KB 4Z7VB 4OQ1A 1KTLB 4XVUC 4O51B 3V8OA 3SE3C 3LRSB 2VIRA 1L4IA 4Z18A 4MAYA 2IPUG 1MHEA 1LP9A 4X0KB 4KV5F 3BKJH 3WJJA 1KCKA 2BVPB 4PBVC 4LLAA 4FQPA 2P8MA 3UTSD 1JYVA 2VLKE 1CVRA 3ZL4L 1K8IB 3IU4L 4JKLA 3O0RH 2DTSA 3RVWC 4K23L 3WS6C 2D3VA 2MMXA 4XCCL 2ED9A 2NY4C 2XTJE 1WZLA 4I9WE 1CFBA 3MNVA 2Z91B 1KTLA 4L3EE 3NCJH 2V17H 1I1AB 3ZE1F 3V7AE 1TVDA 4L8BA 4N0CC 7FABH 3SDCA 4EN3B 2BOCA 1UZ8B 2AGJL 5B39A 3TVMB 3BVNA 1OD9A 2CD0A 2I9LA 1I1FA 1AGBB 3UBXI 4APQA 4P2QE 4JDTL 1HN1A 1A6WH 4WTZA 5GJSH 5GZOD 4D0CA 1S7QA 2D0FA 2W0FA 3UO1L 1G6VK 3TEUA 4Y19E 1CLZH 3N06B 1U8NB 3MFFB 3X11A 3RDTA 2YA2A 3KPRE 1IT9L 5D71L 5JZ7D 1NAMB 3DROA 5CLTA 3TIEA 3WNLA 4UT6H 3V4PH 2E27H 4QXGL 3AY4A 4ONGL 2DICA 1PYWB 5I15H 5H37G 5FM8A 4KKAD 1RHFA 5BV7C 3X13A 5HHMB 5H8DA 3FB7B 4K8RC 2K1MA 3G5ZA 2EXYC 1MF2H 3EJYD 1T22B 2A0LD 3I3BA 1Y18B 2N56A 5DJZA 3IDNA 4MSWB 1MIEH 1H3VA 3GJEB 4LQFH 3W9DA 1FDLL 1DE4A 1IAMA 2IPUK 3FT2B 4MMZC 2YSSA 4HKXB 4C4KT 4LSTH 5C07E 5TGBA 1MCSA 3WFZA 4TOYH 4TSAL 1MLBA 5I76A 1EZVY 4XCCH 1JPTH 5FYLL 5HDQH 4BZ1H 4PJAE 3LKOA 4NRZB 4U1GB 2D9CA 4D2NA 4ZUVB 4S0SD 4PRHD 4D94A 2UZXB 3JWDL 4U1JB 7FABL 4I2XB 1QPPA 1XGQB 3JSSA 1WAAA 3UZEA 4LNRA 3PWVA 3DGCR 4JFDD 4WFFD 4LPTA 2IQAB 3LH2L 3C8KA 5HHOE 3AM8C 1E4XH 1IEBB 1CXIA 4KZDL 4XXDA 4DKEL 1CXFA 1Q0YL 2AJUH 2A73A 4NO0B 4P46C 5GS0L 5HD8C 1QKZL 3MV7A 2HJKA 5CS7A 5DSCA 2G5RA 1FFQA 1S5IL 1VFAA 5DK3A 4PRID 4GG8B 3BH8A 2VLJD 5H35A 3ULUE 2C1PB 3SE4A 2YPLB 1PSKL 4PLJD 4H0IA 4DKFL 1CDYA 3W5MA 1MELA 3NCCB 1TXKA 4EI5D 3HNTH 1ZT1A 2J5LB 5J6HB 1UYWH 2CJUH 5DRZB 3RHWK 3IFOA 3U7WH 1EXUA 5F3BB 3WNKA 1YECL 5EU3B 4HUMB 2GFBB 4UB0L 5ADOH 1OQXA 4PYGA 1FZKA 2BHUA 2KL6A 4O5LL 5FF6B 5EOCH 1OB1A 2BMKA 3GSVA 3DNKA 1G9NL 1OTTD 1NDMB 5JNYA 2J8UF 1MJ7L 3BQUD 2ICEA 2I26N 3LQAC 4U1HA 1W72A 3RIFF 4F58L 4TULL 4F8QA 5L8LB 5TJWK 2YBRA 1NCBL 4OD2A 1WC7A 3T3PF 3MNWB 1AO7D 3HZMB 4LLVB 3VGFA 4YR6B 3VGAB 4PV9A 5I73B 3IFPB 1D5MB 5IVXF 3RVWD 3L3HB 3C60A 4FNLL 5T3ZL 4E42A 3QNYA 3QHTC 4JFFE 4P2YA 4X8XA 4WHTB 5GRVL 3D48R 3N50A 4Q6IC 2X1PA 4FP8H 5JQ6H 1KNOA 2QKIB 4JGJA 4MA3A 4JKWA 2Z4QA 1T5WB 4TVPL 3T0AA 1K6QH 5HJ3A 3H7LA 3MV8A 2FL5B 2X4TB 2JCCA 3FO0L 1NC2D 1CD1B 3IT8D 4N0FA 4M1GL 1YEFL 3GSOB 4AH2A 1EEZB 4IRSC 3WDJA 2PR4H 2GJ6B 4DTGH 2BP3A 1SQ2N 4P3DA 3PUCA 3NH7H 2QL1A 5D1ZB 3KDMA 1B4JL 2R56H 1N0XH 4PTUA 5HHNB 3MUJA 4OCXH 3HTLX 4N68A 2BSSA 1NC4A 1L7IL 5F1NB 1TPXB 2ADFH 4PREB 4WO4C 4Y4FC 4DKDC 4YEEA 5MP6H 4U1MB 1EDQA 4N0UA 4G6ML 5E6ZA 1I1AC 2BFVL 1M4KA 2DQGH 4Z5RB 3ALXA 1PQZB 3DRTB 3RUGA 5DT1H 3JV6A 3VFVA 4F7TA 3S5LB 3VGEA 4ODXA 1M05A 3SO5A 3T2PA 4S2SA 4LCUB 1KGCE 1YYLH 4PREA 2EDKA 3SHSA 5HHQB 1HHJA 1UJ3B 1FL3A 4OCWL 2I5YH 3DUSA 5DJDB 1FNAA 1FRGL 4NQED 3O2VL 1RUKL 3GSWB 3BD5A 2BY2A 3T4AB 2XQBL 3VD4A 4YFEA 1CL7H 1EA9C 1I1YB 1B0RA 3WLBA 2Q7YB 5E8PB 3QXUA 1A2YA 3VA2C 4ZD3H 5DRXB 5EN2B 4L5FL 2A74A 1A5FH 4GAGL 5E2JA 5GJSL 3U4EB 3QUXB 3UO1H 2PTTB 5SWZD 4CADA 4PJBA 1KNOB 2QKIA 5CZVL 4E9LA 5JQ6L 3FL7A 3EUUA 3HCVA 3O4LA 1UACH 3AY4C 1XIWC 3QH3A 1AXTL 4UT9L 1WWWX 1JL8A 1LK3L 3C6SA 4LOUD 1AI1H 3FRPG 4KRPB 4PJDB 1I9IL 5LGJB 1QFPA 3HZMA 1N3NB 4HWZA 1YEFH 1IC4H 1VEMA 2R0LH 2NY6C 5JXED 4WHYG 4WFFE 1LEKA 1IZKA 1W0YT 4JY4B 2XQYG 4NZRL 4OIIL 4EI6B 1MIMH 2FHCA 1PEZA 3I6KA 4OUOA 1OB1B 2XTLA 4OF5A 3R8BB 2ADFL 4HF5L 5IMLB 4Z7WB 1G9EA 4I0PD 3VJ6B 1FL5A 5MEPA 5GGUA 2R0KL 4ZUWB 4LDEB 2CLRA 1KJ3H 5CZXC 3VWKA 4LASL 2DQUL 5DURB 5GRJL 3KYOA 3HHRB 5HHOB 1J0JA 1TTGA 2Z31B 4NM8L 4HUUB 2W9EH 3NIDF 1Y0LA 1T7VA 2EEBA 1P84K 3U83A 4UV4L 2V2TA 4I3RL 5KSAD 3KXFA 3IETB 3VFUA 5A43C 1GZQA 5H35B 4K8RH 4L1HA 1AR1D 4OCRL 1DLFH 5E7FA 5SX4I 1I7TB 4RSVA 1ONQA 4KJWD 3HC3H 3JV0A 3TBSA 4U7KA 3GB7B 5SWSE 4FQLH 3E1F1 3V4VL 4HH8A 2DYPD 4YAQB 4IMKA 4V1DA 1Q0YH 1KIPA 1MCKA 2AJUL 2HJFA 3AXLB 5EUOF 1LE5A 5AWNH 4GS7B 3U7AA 5E6IC 3O2WH 5I18L 2VXVL 4Z8FL 3RY5A 4F2MA 1I3RA 4IMLA 5BOPA 1PX3A 1WLHA 3CFKB 4GQ9H 4JQXC 1X9QA 5C7XH 4QRTB 5MI0B 3LS4L 4LCCA 3G9VA 4W4OC 4KU1A 2P5EA 3HMXH 1AI1L 2RGSA 2RJMA 1FNSL 3ARRA 4NKIL 4L4TE 1FLTX 3UROR 4O2FA 3E8UL 3WUWB 4NRZA 4LKCB 4PJFE 3QYCA 4APQD 2EEDA 1ZK9A 5BOZG 2YN3A 4IOFC 4M48L 1UG9A 2F5AH 4Y5YC 3VG9C 3PXHA 1EIBA 1R24A 3R4DA 5L2KD 3KPQA 3MOBL 4W6XB 3QG7H 3FT2A 1NANH 5D7IA 4MSWA 2C1OB 3GSQB 5HHPA 2YEZA 3RWEB 5I1CL 5DC9B 1NCBH 3Q3GA 2XTJD 4U1NA 1HHHA 4ALAH 1CGXA 4PY7B 3MRKA 4N8VA 4DGYH 2Q8AL 5IR1B 3AREA 4NSKA 2AGJH 3QQ3A 2O61B 2NX5E 1YEIL 4R26L 2W0KA 5D1XC 2KDGA 2ENYA 4PY8I 5DD6B 3S4SB 4FQLL 4ODUB 5B3NA 2QQLL 1S7QB 1A6WL 2OJEA 3T0VA 3WXWL 3LAFA 3TF7C 2DD8L 2F74A 1DQQA 4IRSA 4X7FC 4HIIA 4LPXA 2VXVH 2VQUA 2XZQH 4Z8FH 3QCVL 2Y5TA 4DTGL 5C0CA 5GQBA 1XZ0A 1AJ7H 4WWKB 4NN5B 4LVHC 3TA3A 2DMKA 2R56L 1WWCA 5GRWA 2IAMA 4P4KC 1G6RB 1I8KB 1FBIL 4JZOA 1VPOH 1TVHB 3HMXL 1DR9A 3NN8A 2VQ1B 4P2RA 3Q6FB 2FZ3B 3GZKA 4XPGH 5ADPL 2YD2A 2EDLA 2Z91A 2ZCKL 3MRLA 4M02A 3ET9F 5TQ2H 4MAUH 5F8QC 3QUZB 2JF1A 4MGXA 3L3IB 2J8UE 1FDLH 4TUOB 3SPVB 1VGKA 4L8SB 1P2CA 4Y5VA 4NQVA 4R4ND 1RJLB 1RZ7H 1OAXL 2VLKD 5DJ8B 3HI5L 5BW7C 1QOKA 1XF2B 1FV1B 4N8PA 5DLML 3VFWB 2OTUB 1GGCL 5CHNA 3O9WB 3BAEL 3HE7D 2OZ4L 2DQJL 1NBZA 2Z31C 3AS2A 3ZTJH 3JWDH 3MODH 2DS4A 5DWUL 2WLZA 4HBCL 4WTZG 4YGVA 3ARDB 5DMIH 1KB9K 1KULA 3I50H 5TF0A 1YEIH 4JDVA 3O4LE 1UACL 1CD9B 4YBLC 1UH4A 1J0YA 2FYYB 3IDUA 4Y4FB 4HXBH 1IM9D 2X05A 3BP4B 4P5KB 3E2HC 4QOKD 5J12B 4YZFF 3LKNA 1QUNA 4MCZB 4GJTB 3GK8H 2IMNA 4OIIH 1U91A 2ZUQC 4K2UH 1NBVH 3P0YH 5GZNC 2V7HB 4UIMA 4JJHA 1XR9A 2R2BB 4K3DL 1JRHI 4HW6A 3BXNB 1C5DA 1KFAH 4M4RA 2YK1L 2YA0A 1C08B 1Q9LA 5HDLA 1LO5A 1E27B 4MAUL 4AL8H 1XGPB 4KUCF 3MUY1 4ZTOL 1DBMH 1ZHBB 3O3EA 1TVHA 3SGKA 5FOBB 1I8KA 3QFJD 3KPLB 3RWDB 1BD2E 1MJ7H 4X4ZA 2P43B 2LE9A 3K8KA 3P4OA 4WI6A 4KJPC 2Y5TB 3I3DA 5AEAA 5C9JB 2OTPA 4ELKB 4HIIB 4HIEB 1ZT7B 3TM6A 5J1TC 1OAKL 4ONOA 5A2FA 4PG2C 3RZCB 3EYSL 4KRMB 1AQDB 4J7RA 1MHHA 3DOSA 3MODL 5DWUH 1JGVH 2DM2A 3BZ4B 1NEUA 3J7HA 3BGMB 4JFEA 4U6TA 2O61A 3QUYB 3JVGC 3B3IB 4G43B 5DZNA 1MWAB 1N5AB 2VITA 3MZTA 4YZFE 3FO0H 1JHKH 1DANU 4HK0A 1MCPH 5K33A 4MDJA 4MQSB 4F7CB 3ZO0A 4G9DA 2H2SD 3MLZH 4X7DC 3GK8L 2C1OA 2CKBL 1B4JH 4OCXL 4D9RD 5C0ND 2NY2B 5FCSH 1UB5A 4PJDE 2ZNWA 1OOAA 4Q6IB 1KFAL 1MRCL 1M7IA 4JFED 1JMZA 4YHPA 1UWGH 4WW1A 1A02N 4A6YL 1J11A 2DWEB 4KHTL 4ALAL 3UTPD 3TZVD 3GJFB 3C9NA 2Q8AH 3ZT7A 5DJAA 2B8OT 1KTRL 1T6WA 2F53A 5BRZA 5I74C 4NBZB 2RBLA 3EYOA 4RDQG 4P2OC 3CDFA 3FO2A 5CCKH 1QRKA 1G7QA 4HXAL 3E3QC 2X4OA 2FX7H 1QNZL 4CJ1A 1I85A 4XP1H 1FZMA 5LG1A 5KANI 1GSMA 5DC4B 4XPFH 5DMJB 4POUB 1BLNB 1JJUA 5I16B 1RI8A 3D0VA 2EC9U 3KXFB 5FYJE 3UTTA 4PJXF 3L3JB 1CTNA 2DLIA 5EZJB 5J11B 3HE6C 4WV1C 4YIQB 1OARH 1UM6H 4IOIA 3SJVA 1D5IH 1NDGB 1RZKL 3OG4B 3TLRA 4KGLA 1RVFL 5FYJH 1QLEL 3ZHKA 3U0TB 5ICXB 3BH9B 3VRLE 3VGBA 2W59A 2CLRB 1MVFA 1NEZG 3GSUB 3FFCD 3O3AA 5KVGH 2QHRH 3OJMB 5D7KD 1YN7A 4Y16A 1IFHL 1X5FA 4PV8A 1MIML 1FYTA 4ZO7A 4RGNC 3BWAB 3O4OC 1VKXA 2NX5B 4LLMA 2R0KH 3C5ZA 1YEGH 5I1GL 3ZMRA 1YMMB 4NZTH 3HAEA 1HKFA 3QXDB 4R90L 3S98A 1SMOA 3R06B 2IFGA 1QLRA 3PG2A 5I30H 4FQ1L 2IGFL 4L1DA 2Y25A 2DQJH 2ICWA 1XCQA 3BPNB 2W9EL 1SBSL 4X5WA 4XGZB 5ISZE 3DYMA 4M7LL 2XY1A 4NJ9H 3O2DA 4ZFZA 4BM7A 5JW5A 5HXMA 2E9BA 1VEOA 3OAZH 3WIIL 2Y5EA 1I4FB 5F7WC 5I1AB 1BFSA 5JOPD 4CADB 3TCXA 3HI1B 4JDTH 2GY7B 1FIEA 2UWEE 5T1KD 3JTSB 4MD4A 2PETA 5HYQA 3BZFB 2WBJC 4PPTA 4XMLH 1A7NL 3ABZA 5TF1H 3IJSB 1JGEB 2IG2H 5F96H 1CLZL 1DQDL 1H3PL 2Q7YA 2DMCA 2GJZA 1MCCA 2ZPKH 4GRWE 2LTQC 4N8VG 3DXAD 5HHME 1X5ZA 4O00A 3QIBD 3VG0H 3BSZL 1TJGH 2VAJA 4DOHB 4HULB 4F9LC 5GGSB 3P0YL 3C6LC 1FJ1A 2X44D 2HFGL 5C70A 4L3CA 3LKPA 3OXSB 5IVZB 1FNSH 2ICWI 3ME0A 5A16B 1U58B 1M05B 3UTTD 1CFSB 2EXYD 4LGPB 3S5LA 3MRGA 3LY6A 4HG4J 2MPAL 2MKWA 1A6PA 3JBG7 3TN0A 5JHLL 3BHBA 2F5AL 3LHPL 1SEBB 5TDNA 3KHOA 3BKMH 4P59H 5DMKA 3V8CA 5L2KA 3T1WA 3GHBL 2ZCHH 5HI4C 4FFWD 1KXQE 3WD5L 1Y6NR 1JPTL 5MHSD 1T2QL 4H1LA 4NKDB 3AU1B 3BJLA 4ZNCD 3GHEH 2AABL 5F7DA 1H15A 3O8XB 1ULVA 2MCG1 4MNHA 3C5SA 4CN6A 2A2QT 2FJFA 4L8DA 1QFWM 4QKXB 5EZJA 4U1SB 2CO6B 2X4RB 5FV1L 3F12A 3RWGB 3D0VB 43C9A 5I16A 4XCEB 3BP6A 1J12A 1DN0A 3WIIH 4E42B 5C6PB 3RGVD 1FORH 4OM0H 2JJSC 3OZ9L 1NFIA 1P7KA 4P4RB 3WXWH 5E56A 4EN3D 3DHMA 2DD8H 5JOFB 4YDKL 3EYOB 2ARJA 2HG5B 4C83A 1D3CA 3NIFE 3C09B 1OP3K 2B1HH 1Z3GL 3GSVB 2CDFB 3VG9B 4BH8A 3GJFA 4ODTL 5CAYB 3TNMB 1FZKB 4CU7A 2F19L 5IBUB 4LMQI 1YJDL 5CJBA 1CDGA 4PRHA 2CJUL 4Y5XA 1E6OH 3X3GL 5F3BA 1NPUA 3ILPA 2P8LB 1YECH 1QBBA 2RFXA 3NPZB 4KZEH 4MB3A 1ZT1B 5I8EA 4UB0H 2JK5A 4PP1C 4RX4D 4YXHH 2AV1A 2IFFH 2DQTH 2PKDA 1RUPL 1ZEAH 3BZEB 3V4UH 1WT5A 1A64A 1SJVA 3ALPA 3O6LH 3EFFA 3L9RA 2VUYA 3H3BC 2DLEA 1GGCH 2I60L 3TBTA 3TO4C 3LPFA 1OAUL 4HK0B 4NQSB 4XP4H 1T83C 2OZ4H 3OJVC 3BN9C 3CDYA 3JWOL 4NCC2 5F7KC 1I85C 3ROOA 1E28B 3PGCB 5TE6L 4BQ6A 4UINL 1CE1H 3B5GA 1C16A 1NFDE 3OG6B 2GIYA 3KYMA 2FSEB 5EA0H 1RK0B 3GSRA 1YDPB 4NKMB 5IVXE 1KSRA 3CH8A 5E2WH 2VL5B 4I2XA 2BSTA 4YDVA 4K7PY 3O3BA 1EX0A 1JNLL 2PTUA 5FKAB 3RVUD 5FO8B 2E9WA 4QNPE 3QXWA 3S37X 1D6VH 1ZVSB 2HRLA 2DQFB 4RMSA 2PW2B 1EZVX 4JVWA 3RTQC 1EMTH 3KPRB 4S1QL 5EO0A 5D2NB 1IFHH 2J4WH 3U9PL 5HDOA 4ODTH 1X5YA 4UNVA 3K8MA 3SDCD 4NNPL 1NGZA 2D7QA 2DQGL 1T22A 1INEH 1EEYB 1LO5B 3MLUH 1E6OL 4NNYA 1J10A 3X3GH 4JM2F 2IH3B 25C8H 3IJYA 1DQTA 4OQTL 3FB7A 5CSZA 3VXQB 1HWHB 3QIUB 2WBKA 4LEOA 4ZNEA 4KZEL 1S7TA 2AJYL 5FIEA 4ZTOH 4KY1L 4JN2B 1JMXA 3J8F7 1DVFA 4AENB 2GUOA 4UIMB 2I5YL 1DEEA 3GIVB 5JXAL 4NJ9L 3KWWA 4QOKB 4K3JH 1FVEA 4I4WB 3VXOB 2EO1A 5F89A 5F9WB 1YUHB 2L7JA 4G8FA 5EC1A 1BWMA 4G5ZL 4C55A 1KJ2L 2Q86B 3STBA 3B9KA 4NHCL 1WBYB 4NQDD 4HIJA 4F7EA 2NMSA 1BZ7A 3HR5B 5GGQL 4CKVX 2QADC 3IDYC 5D7LA 1MCOL 3EGSB 1PGRB 5B39B 3GMQB 4OV5B 1YNTA 5CJXA 5I2IB 4L8BB 3WJLC 3P73B 4G6FB 3QWOB 3H9HB 1I1AA 3MRCA 1D5BB 4J1UB 2X09A 1AP2B 1FV1A 2DM7A 4MZ2A 1QACA 4TUKL 4P2CG 5JHLH 2F8XC 2NY4D 3NIGF 5CEZL 4LLDA 1JZ4A 5KS9E 1CDUA 5T1DH 4P46D 2VDPH 5JUEH 3EOTL 4J3TA 2GTZA 3O2DH 4MNQD 3TZVA 1DZBA 1ODAA 2AXGA 3BQUB 1R3IL 3S34L 3WD5H 5DXWA 3RWJB 3GMLB 5FYKD 3GMNB 3DSFL 1U8LA 2AABH 2BDNL 3FQRB 1T7WA 4XWGH 4WU5A 3U46A 1ZWIB 2AJYH 5D7JB 3CX5J 3ZHDA 2UZIL 4QO1A 1SM3L 1CDIA 4UV4H 5DEFA 2I27N 4HK3N 4CNIA 3FOLB 4GAFB 1JYNA 4L9LC 3MXWL 1FL6A 2L7UA 4MD0B 5DR5L 3SKOB 2EE2A 3SBWA 3V4VH 1IAOA 2IBZX 5IEKB 1EGJA 1G9MH 4TUJB 4HXAH 4TTDD 4ZXBC 1ORSA 2EDQA 5JORA 3BE1L 3MO1A 5DD6A 3S4SA 4S1DC 3LQAH 3JV5A 1I1RA 4HG4K 3FQNB 4YWGH 3ARQA 2FECL 1K2DA 3QQ3B 4U05A 4PJEB 4UU9A 3U2SB 4BQCA 1J05B 1BD2B 3TCLA 5JW4Q 3VE0A 3IAPA 3TV3L 3RKDC 2A83B 3WEXA 4AJ0A 1JIBA 3D3VE 1AH1A 4V1DD 3OR6A 2I24N 2CRYA 5INCA 3VWKC 4RWYL 4IOFD 2WBJB 5LJYH 4WUUA 2PYEA 2BVEA 4OZHF 4YXHL 1MCQA 4V1DE 4Y2DC 4KI5F 1M7DA 3I6LD 5I6XC 4XVTH 2VDPL 3NFNB 3SO3B 3QG7L 5I75C 1GCFA 4Q0XL 1BFVH 4AQOA 3V4UL 5DHYB 4FQHA 3GKZA 4XPHH 1EFXA 4X6CB 3IF1A 3GO1H 3KXFD 5CJOL 5H2BB 3JUZA 2JIXD 1FQ9C 3O45A 3HUJF 3JWOH 1SBSH 1G0XA 1PG7X 4R0LB 5MHSE 1T20B 4LCCB 4JPKH 4I0PB 1WJ3A 1JZ6A 5DUML 3VXMB 3F5WB 4EQ3A 2BXZA 3UTQA 3P9LA 5AZ2H 4AY0A 1MCEA 4Z95H 1T1WB 3B83A 3BO8B 4P0DA 3NIFF 2IMMA 5E4IA 5AD0B 1X6LA 3QNXA 3CFEA 5AZEL 1J8HA 2VLRE 3GB7A 5C0AA 3D39B 2FEEL 1N26A 1ES0B 1R5WA 5HHXH 3VFOB 5A3ID 4NFCA 5JLZA 3K4DA 1EAPA 2YD9A 4ZUTA 2MJWA 2VYRE 5KZCD 1TTFA 3GFUA 4O02L 1JE6A 4JO4L 4PJXE 5JPMA 1X5KA 5D1XD 3TJHD 1NMCB 1NC4D 3VXSA 5L2JB 3CX2A 1T4KA 2V5MA 4R4FL 4ACPA 4KKNA 2F53E 4PJIE 3VJ6A 4O2CA 5JOPE 1B0GA 2GKIA 5IMLA 4CU6A 3VXNB 2DWDB 1PKQA 5D93B 2CPCA 3HUJB 1RZ7L 1RZGA 4OTXH 4HH9B 5JXAH 3MUGB 1UEMA 4JGUA 4K9EH 4K3JL 3L5WB 4Z0XA 1KLUB 1F45A 4PJAB 5FDWA 4PFEA 4HS6A 1AKJA 3D2UB 2EH8L 3BAEH 2QHLA 3GBNH 5CGYC 4C54A 1MJ8H 4P3CH 4NHCH 2AK1H 4GW1B 3ZYJA 1T5XA 5SX4H 5K59F 3RJQB 3I75A 4HBCH 3ARFC 3QH3B 3ULUL 1FZOB 2YD7A 4X6EB 3SDDA 4PP2A 3DURA 5HVFB 5MEQA 1BBJB 4C4KO 5B22A 1LP9E 2BK8A 3UPRA 4RAHA 3G08B 2FX8L 2VDRL 5EB9A 2OK0L 3P77B 1KCRL 3MREA 1JPFB 1ZLVH 4XXCC 4Q9RH 1CGYA 4OZIF 4KDTA 2FECI 4A6YA 1DQJA 2AJSH 1FFRA 3GM0A 4FTVA 5E1HB 1I1YA 1I9EA 3OKKB 4BSWA 5I1DA 3SCMC 2VERN 2ZKHL 1U95B 4ZTPH 3WSQL 3QUYC 1N8ZB 3T65A 1I1AD 3KPMB 3B6SB 1ZSDA 2ATPB 4ZXBD 1RIHL 3PNWA 4WO4D 3O2DL 3RNKA 1R3IH 3MRNA 3S34H 5IJKC 2V2XB 2WANA 5BJTB 2YK1H 1S9WB 4WWKD 3W81A 6FABH 3D39A 4OFIA 2YPVH 5DA4A 2BNRE 1SYVA 3IRPX 4RISH 2P24B 4ZPTB 3LB6C 4OTXL 1ZLUH 2E6JA 1WV7T 3PWUB 1MOEA 4X7SL 1I3UA 1ZEAL 1FVDA 1FE8L 4NOFA 3UTQB 3HNVL 2Y4SA 4CW1A 3PGDB 1KJVA 1U2HA 1XFPA 1MFCH 5C0DA 2QSCH 4JE4B 1S7VB 2CRMA 3V9FA 4Y88A 1S7WB 3HG1D 4LRIC 1JGVL 3T2NH 4TPRL 3ZDXF 5DD5H 5C0EA 1F4YH 3T1FA 2B4CH 2VN7A 4E5XA 3IYLW 4GW5A 3TIDA 2HMID 5FYJD 1ZA3A 1CXHA 4HEME 3NFNA 3BW9A 3VGAC 2WINA 4PJXB 3B4NA 1RZFH 3CUPA 5EOQH 2LTQB 1D6VL 3K74B 4OF8A 2H2PC 4FQCL 1MY7A 1LO0L 5CBAA 5E08L 1L0QA 3F7VB 3MPCA 4NCC1 4ZTPL 4X6BA 1H5BC 5HBBA 2BY3A 5L2KE 4HHAB 3ECBA 5D2LE 3GNML 3IAQA 3TCLB 1ZHKA 5J1SC 3WCYA 2G75A 3GSNL 4GT7A 5I0DA 2ZZUT 1T03H 3X14A 1IGTA 1KB9J 1P4LA 4KKCD 4A6YH 4IMKC 1MCBA 3MO1B 5C0JB 1REIA 4U33A 4M43H 3MRQA 4Y2DA 1W2KT 1F4WL 3O11B 4H1LH 5E8EB 2L4OA 3MLVH 3CIQA 3GRWL 5FUOH 5L8KB 1T1YB 3QFJE 4WIQA 3A6OA 1NCDH 3HNVH 4I0PC 3ETBF 1C12A 1EHLL 5GS1A 3O41A 4KROD 3H9SE 4WHYH 2YUZA 1UM4H 3BRDA 1NCCL 1X5AA 1IM9B 3WS3B 3DX9B 5L7XL 5JW3H 2FX7L 2KPNA 3DTXA 4EIZC 5EO9B 5DO2C 43CAB 4M8VA 1WIOA 4XP1L 5GGQH 2QR0A 3NACL 2B4CL 1A7OH 5I75B 3IJHB 1BECA 3F7RA 4E41E 1OP9A 4QHNB 2R4SH 3TYGL 4WV1B 1CBVL 5EBLA 1S3KH 4I5BB 4WCYL 3LKOB 5FYJL 1QLEH 2ZOLB 1FZJA 3FONA 3WFHA 5HGGS 1X4ZA 3VRJB 5ICYA 3DRQB 4HUWB 2QHRL 3UZVB 3WHXA 5L9DL 5F93C 2HT2D 3AREC 3QDGD 1LVEA 3DV4A 5I74B 3CH1A 3GSNH 2MOVA 1A1OB 3CXHJ 5JZ7C 3JV4A 3OQ3B 2XG4A 3RI5F 1WF5A 4FQ1H 1SJEB 3Q5YA 4HIJB 4GLRI 4QRRA 2NY2D 1UB6A 3MNZA 1PYWA 1QO3B 1VSCA 1NC2B 3QWRD 5CJ8A 4JM4L 4HPYH 1AE6H 4JFPB 3HPLB 4Y5YB 4PRAB 1KN2H 4LHUD 2H2PD 1G7PA 1C1EH 1S9XA 4H26B 1DQLH 4M6OH 3MFFA 2BX5A 5DR5H 2GY5A 4PG9B 3ZHLA 3TT3H 1EUTA 1T80A 3DWTA 4QOKA 4Y8AA 3IDXH 4X6DE 4XZUB 1PW3A 1MCIA 2IG2L 2VXSL 4YBHA 3WXVL 1G9MC 3B8YA 1HZHH 1H3PH 3QG6B 4LEOB 1JWSB 2D7TL 3JV4B 4LGRB 1DBBL 4F7MB 3DI2B 5IT2H 3RZWA 1IC5L 2BRRL 1BJ8A 4JFOB 3WYRA 4WO4A 5HYFA 3CLEL 3DX6A 1GRWA 2MCPL 3FB6A 4PLOB 4H88H 4DZ8B 1KPRA 5D2NA 1LO3L 1IKNC 1FNGA 4C58B 3L3KA 5EUKB 4R4BA 1YY9C 2VDNH 4BQ9A 1JTPA 4RFNC 4D8PB 2A6IB 4YDVB 4BUHA 3CU1A 3GHBH 3O6ML 2DTMH 4IOSD 1BFVL 1HYSD 2DIJA 1FE8H 1MHEB 3CMGA 4QHNA 5IJKA 5FO7B 1ED3A 4OCMC 4M61A 4LRIA 1J0KA 4R7DA 3OB0H 3JWOC 4OFDA 4TPRH 3EYFB 4M3JA 4UIKL 5EU5A 1F4YL 5HGBB 1QVOB 2KH2B 2LFGA 3C6LA 1GGTA 1CICB 3W0WA 4PBXA 5GGVY 2OZ4A 1A3LL 5E8DL 3MRBA 1QSFA 1P4IL 3O11A 5HTSA 3SDAB 5DJ0A 5F88B 4E0RB 4G42B 4W6YB 5SX5K 5ALBH 2VXSH 3ULSA 1G0YR 2WAHA 2Y06H 3GSNB 4HEPG 5T1LB 3QCUH 2VLLB 5DQDH 5IF0A 3NA9L 2FBJH 4HZLB 3MLPA 4U0RB 1IGML 1ROWA 2G75B 3G04B 3VXTB 2AERT 5CBEB 4FQQB 4OB5H 2NX5D 5I17B 5EIIA 2CK0H 5HVWA 1F11A 3MLSH 1AD0B 2XZCL 3G6DL 1KJ2A 1BFTA 3F6LA 2VXTL 3R8QA 1NMCC 1MUJA 5KN5B 3OGCA 2ZUWA 2OP4L 5D7SL 1OPGL 1UH3A 3O9WC 1MFEH 4NBYB 4OLYL 4MYWB 3MX0A 3VFGL 1RIVH 5CSBA 4XB8A 4JR9L 3QQ9C 1J8HE 3RWCA 1G6RL 1ZV5A 4R7NA 2Z9TA 2B4CC 3EOAB 3KPSE 4PGCA 3ARWA 1S7VA 4UINH 3IDJA 3KLAB 3DXAB 3GMRA 1H15B 3O8XA 5F7DB 4IRJB 1ADQH 4XP6H 2DL2A 4JFDE 5EA0L 3DI3B 1V7NL 1BQHB 2YS4A 3OXRB 1NQBA 2WIIB 3VFRA 3HS0B 1IE5A 3SDAC 2ZSWA 3S3SA 3I2CL 2P24A 1SJHA 5I1KL 4N5EC 1M1SA 3OSKA 4PJ8B 4JANB 1MCRA 1BVLA 4P5TB 3MRJB 4ZUUB 4K07A 4PJGF 1EMTL 4S1QH 3WFCL 5L9DH 4KXZH 4FXKB 5FYKL 2ITCA 2PO6C 3MGOB 5TPWL 3U9PH 3QIWC 2PNDA 5FECA 2C9AA 5J56B 4YEFA 1FNEA 5GS0D 4NWTH 1F4AA 4JFHE 3U4BH 4XBEH 5EZLB 1UENA 3FHAA 5DD3L 1Z0MA 3QA3A 4P2OA 1N59B 1JHTA 4G6JH 4EKXA 5SWZA 4DOHE 4LLUB 4R2GC 5J1AA 2YPLE 5JDSA 1OAQH 1HDMA 4CU8A 1RZIB 3LRHA 1OLLA 2XN9D 5DVMA 2IALB 5MERA 3VXUA 3GSXA 1A6AB 1CFNB 5HGDA 3MREB 4CL7A 3U7YH 4KTYA 4G3YH 4D9LH 2N1KA 2DM4A 5IB3B 4JFQA 3DX7B 1DQLL 3ARBB 5D7IE 3TT3L 4ZPVB 3RGVB 5FHBL 3B5TA 1QSZA 4G5ZH 5IBTH 4Z78B 1WZKA 4R3SA 3P4LA 3ZKXB 1MAKA 4ZQKA 3F62A 5DI8B 4PJ5E 1CZ8H 3L1OL 5T5FH 3BDYL 3UTZB 5DK0B 4ERSL 1V7NH 2BSRB 1GAFH 1QLFA 3LEVH 4XCFH 5L8JB 2HAZA 3KR3L 3V6ZB 3AB0C 3V6BR 4XAWL 3A0OA 1HILA 1GZPA 2FO4B 4OD3L 5HI5D 4OZ4B 2MQ3A 4QY8B 2C3VB 3QCTL 2HN7A 4OGYH 4LP4A 4WW2A 5I66B 1UM5L 4I9WD 4KH2A 2ADJA 3OX8A 2OR7A 3QIUC 3P4NA 1G9NC 1T4KB 4PD4J 3WFCH 1CG9A 2KQMA 2BHZA 5JPMB 5DK2B 5E1AA 2O5YH 2FO4A 3HG1B 5C6WH 1MAJA 3GNMH 3HC0B 4JFFD 2HLAA 4GUPA 3HRPA 1ZVYA 1AY1L 1MQKL 4C57C 3V0VB 1PDKA 1A47A 1NBQA 1UWEL 1FAIH 1FZMB 3LEXB 4XWGL 4LLYB 5HYSG 3MRRA 3L7FB 1INQB 2CR6A 2VC2H 2XT1B 2B5IB 3MGTB 1K4DA 1R5VB 3PDGA 4OZFB 1SM3H 1EHXA 1KC5L 3GRWH 5DRWB 3OAYH 2BNUA 4G9FD 3MXWH 3U9UA 4IRZH 1XEDA 4UNTA 2APTA 1JZ8A 1BF8A 1A3LH 5E8DH 1MJJA 3VXMA 3WIHH 1BP3B 3AS0A 4UDUB 5D72L 1A4KB 2ESVA 3FQWA 3G5XA 1YNLL 1Q9OA 4ETQB 1MVUB 2IWGA 2NY6B 1AGCB 3QCUL 4XVSH 5DMGD 5LGKA 3STLA 4YHPB 4ERSH 4JG1H 4PRPE 2HFFB 5D2LA 3T4YB 2NY5L 3BP7A 2R4SL 3TYGH 1XF3B 1QR1A 1IGJA 1QSFE 1FNEB 3EOBA 3KR3H 3TZVC 4NKOB 3QDJE 1HOCB 4OZIA 1UB5B 1S3KL 3QFJB 4KVCL 3DVGA 2VR9A 4DK3A 3KJ6H 4WUUB 4UQ3B 4XMKL 4HFWA 4JKMA 3HNSH 2Z92A 3SGKC 3FRUA 4QXTA 3FFCA 4PGJA 1F97A 3VE0B 1N5AA 4JN1H 2KZWA 3INUL 4OLYH 3E6HB 4OKVA 5CINH 1CK0L 1K8DB 1QFWI 1AY1H 1NLDH 1B90A 3I9GH 4G43A 4KJQD 3RTQB 3W2DH 3VFGH 1L7TL 3MFGB 1CFTA 5SWQB 4G80B 3V0WL 5ID0B 2NY4B 4N90E 4PGCB 4EVNB 3QJHB 4NQDB 1AD9B 4DK6A 4Y4HB 5IEKA 4KUZH 5SWSD 2GJJA 4FZ8L 1S5HB 4ELKA 4L3AA 5IB1A 4HUVA 2VXQH 5IEHA 1NFDF 1A7RH 3WIHL 2FDBP 4YDJA 1RURH 1KIUA 3I2CH 4BK4A 1U8KB 3DVFA 2OTWB 3ZZ1A 5IJVB 1B0WA 3FQTB 1UJTA 1YYML 1KUMA 1I9JH 5D2LF 4I3GA 5HHXL 1A7PH 3NZHH 4PRDA 2GTZB 3TZVB 3STZB 4H88L 4M8QA 3Q6GL 4KPHL 4Y19D 1T2JA 5DD3H 4PJFB 4WI7A 4R4FH 1KB5A 1KCVL 5CD3A 3GSNA 4PRHE 5I9QC 3EO1B 5T1MA 3BP4A 1TQCC 1O7SA 2EH7H 5C0FB 5DJ0B 1MFAH 4Y4FA 2IBZY 4ZAKB 5IVOA 1ADQA 2XFXA 3NOIA 4D9LL 5JR1H 2HTKC 1JGDA 1CK0H 3W0WB 4LPCA 4NPYB 4RDQF 1IEAB 1O0VA 3EGSA 4M03A 4QTHA 1Q0XL 4KKLC 3I3EA 4NKQB 4XBPB 3GGWA 2XKNB 5DFVC 2E5EA 3IDGB 4AEIL 3GEWB 4PTTB 1JWUA 5KSBF 5EU6A 1NBZB 2PCPA 1TITA 5JMRA 3ULUH 1CZ8L 4JPIA 2PUQT 1XF4B 2AXFB 3PHSA 4OLUL 4WY7L 5F8RC 4LSRH 3RWHB 1A7RL 3KYAA 4PGZA 1LDSA 4MMXC 1DVFB 5DRNA 2A6IA 4QEGA 1NAKL 1RMFL 3SPVA 5FB8B 4WJ5B 6CGTA 2DKSA 2QJDA 2D31B 5IK3B 5FA4A 1G7HB 4FHBD 2X40A 2ZKHH 4PRBB 3TP4A 4HFUL 1KPRB 3LRGA 3Q6FA 4P2RB 4LNVA 2PO6D 5IB5A 1N64L 5IM7B 1TJIH 5EPMA 2YKLH 2CK0L 3T8XB 1GOFA 2UYLB 5DF0A 4K7FA 1QRNE 1WAAE 2PW2A 4ODHH 5IHZB 5EO1B 2D31A 5CWSB 4G7YH 3FB8A 4HWUA 4DQOH 5FO8A 2VDKL 4XNQB 1OPGH 3ARFA 3WE6A 3BRGC 1QFWL 5DRNB 3VI4E 1S9VB 1OAYH 3P4MA 2D0HA 4MQ7B 4MXQC 2VRAA 1WBXA 5DD1L 1TVBB 5D1XB 5IHUH 1OGTA 3L3DB 5EUOB 3T77A 4I8DA 4R8WH 1ZLUK 3DYOA 1F6LL 5SV3A 1OT2A 4CMHB 2DF3A 3SE9L 1HHGB 4B41A 4LL9A 1C16B 5IR1A 1IMHC 3WUWG 2VZSA 1B9ZA 4X6DA 4FQJH 3BEVA 4XBGA 4HS8L 4WI2A 1NAML 1HHHB 1AO7E 3IDGA 3R0NA 4R2GB 5A2LH 1ZA6B 2NYYD 1MFDL 3CLFH 1A9BA 3DO7A 5HHVH 3QIBC 4Z7QF 4PGDB 5JO5A 4QXWA 5D8JH 3RU8L 1TNNA 4JB9L 1KF9B 5CSGA 5I1IH 2XFXB 4AM0B 2I25N 2OCFD 5C0FA 1D7FA 2AV1B 2XWTB 1UKTA 4XMKH 2ADGB 4YPGA 2R1YA 5GGVL 2ZOLA 5GRZA 1JF1A 3FMGL 4D0DB 3QP3A 1I3VA 3TGXA 5INDB 2NXZC 4CMMB 1I7UB 2JB6A 3BN3B 4NN5C 4RIRA 2LVEA 3D87B 2AV7A 4QRRD 2IANB 4X7TB 3CDCA 3TT1L 2F58H 2BNQE 4OAWB 1JYWA 3BIKB 4YPGB 4APQC 2Y07H 4LCWB 3SDDD 1W72H 4FFZH 3VRIB 4C83B 3FQTA 5KJRH 1OAQL 4U49A 4AZ8A 3DTXB 5JOFA 4KI5D 3WS3A 2C4XA 3BGFB 2NLJA 1GC1H 4JRYD 3ZE0E 3ELAT 2GCYB 3FQXB 4M6ML 3TBSB 4R8WL 5DHVH 4YHZL 2O5XH 5LQBL 3CK0H 4ZOBA 2UVFA 1UXWA 1WCBB 3NFSH 3RHWF 2BJMH 3EJZD 3F12B 4NQCD 1TIUA 2D7OA 5T33H 1CTOA 1T1XB 4EXKA 3H9SA 3THMH 4MS8C 3RVTC 2JJUA 1HHGA 4AIXA 4P99A 1AGDB 4MLIA 5J06A 4JQIL 3VXUD 1A7PL 2XQYK 4Q9QH 1K8DA 1S8DB 4MJ5A 1CBVH 2ARJQ 3LN9A 3LSOA 3RGHA 4OD3H 3FB8B 2NY0C 5CUSL 3Q5TA 5D1QC 1Z0NA 4JFXA 4GBXC 1SYSB 1UM5H 4KI5C 1XGUA 3TA3C 3T8XA 1KYOK 3FMGH 1J18A 3KXFE 4P23C 3RPIB 5A16A 1I7RB 4PJDA 1ZOXA 2QSVA 1IC7L 2EDRA 4OFVA 2OL3H 1ZA3B 1NEZB 1QR1B 1XIWB 1OGAE 4XC1H 3T4YA 5F7UA 4JPWH 3O4LB 4EUPA 5KG9B 5E6IB 4YJZL 2VAAA 2ZUYA 4YHKL 4I3SH 4MAYC 3H0TA 4NUJA 1MRDL 1TZGL 4PJBB 1B6DA 4ONFH 1MVUA 5KJRL 3EFDH 4ETQA 1KEMH 3I02A 1F3JB 3JTSA 3D3VD 3G5VB 8CGTA 2R1XA 3LQZA 4I48A 2AEIT 1ITBB 3HRZA 5DVNA 1CLOH 1I4FA 4DUVA 3OKEA 4U6XA 5DRWA 1BJ1H 2EZ0D 3NZ8B 4HGKC 4X9GA 1KTDA 4ZFZB 3DUSB 5DJDA 3E3QE 1U8MB 3L6FB 4ZPTA 5DJXA 1K4DB 1R5VA 4BSVA 4PYHA 2DLFH 3ARGD 3VMPA 4YHLH 5KVDL 3T0WA 2IJ0C 4XI5C 3NPSC 4LLYA 3VDAA 5ESVA 2Z8RA 3LEXA 2COQA 1OTUC 4KKCC 4DCQA 4NOBA 4XP9H 1RZJH 4O9HH 2XACC 4ZAKA 4F33A 4X99A 4M7ZB 5IWLA 3P9WB 4GAJH 3UTSE 4KVCH 1HI6A 1CWVA 1EJOH 1DUYB 5IV2A 3KPPB 4WFGD 3T65B 1CDCA 5F6IC 2M26A 3QULB 1Z5LB 3GSUA 5F9WC 3KJ4B 2CDEA 4LLQA 4HKZB 1RUML 4R0LC 3BUYA 4Y1AB 1VB9A 5ISZB 5FA3A 1OTSC 1DBKL 5LGHH 1IC7H 3V6ZA 1ORQA 5DTFB 5CINL 1IGCH 2Z4QB 4R96A 4JPWL 1MWAH 4MAYD 4J8RA 4NQEA 4LVHB 5E2VH 1L7TH 4PP2B 4LLWB 4RAUA 4OGXL 3QT2A 3WNPA 4P9HC 4RMRA 4PJ9C 4XXCA 5D2NE 4WENB 3I75B 4HS8H 2OLDA 3QDGB 4S1RL 4PV9B 1MEXH 3KLDA 5BS0A 1FHGA 1S7XA 4QHLA 1WC7B 4WEUD 5FUCE 4PRIB 3SDXA 5IB1B 2ERJC 3BESR 4Q74A 3RPKA 5IMOB 4Q2ZB 3PQYB 4BKLA 1CT8B 5C0BB 4FG6D 4RFNB 4QNPF 4JKPL 4YK4B 3QJHA 1P4IH 4NQDA 4DVBA 2IALA 2CLVB 1PKQB 3MV9A 4OZGA 2VMFA 3D9AH 4W70A 1ZGLM 2Y06L 4G8GE 3T0XA 4LCWE 1BOGB 4NRXA 1EXUB 4XNYH 1RZJL 2Y1VA 2A38A 5DO2D 1J0HA 1OQOA 5E9DD 2CKBB 1I8LC 2BNQD 3PP3K 3F58L 4QRRE 3MRMA 4PJGB 1C7SA 4FXGA 3MLSL 3UBXG 1EAPB 1U93B 5HY9B 2BZDA 4F9PC 4M9OA 2HYMA 4M4PA 2BNQA 4