3G6AB

Crystal structure of anti-il-13 antibody cnto607
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
222
structure length
222
Chain Sequence
QVQLVESGGGLVQPGGSLRLSCAASGFTFNSYWINWVRQAPGKGLEWVSGIAYDSSNTLYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARGLGAFHWDMQPDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords CNTO607 Fab Light chain
publication title Epitope mapping of anti-interleukin-13 neutralizing antibody CNTO607.
pubmed doi rcsb
source organism Homo sapiens
total genus 48
structure length 222
sequence length 222
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-02-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6aB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3g6aB01
2F5BH 3UZEA 5T5NF 5I18H 5J06A 3SDAA 3C5JA 3WFCL 4WENB 3UJJH 12E8L 4XXDB 2CLVB 3TZVD 3VFVB 1H8SA 1OTTD 1XGRB 2DMCA 3P9WB 2ZNWA 2DF3A 3SOBL 3AREA 4TUKL 3C6LD 3TBYB 3WFDH 1SJHB 3MNZB 1WITA 4FQXB 2RGSA 4I0PB 3TYGL 5IB2B 2D0HA 1F11A 3I50H 4Y2OA 3TIEA 4G8GE 2QHRH 3O3BB 4F2MA 1NKRA 1U6AL 1G6VK 4KJYA 5T3XE 2X4RB 4EBQH 3WIHL 3BI9X 4UB0L 3GKZA 5E7BA 3CUPA 1U8NB 5FK9A 3NIGF 4DGYH 4U1NB 4DZBB 4LLUA 3MBXL 2XWJB 1NEZG 2VISA 3VD7A 4LSTL 5ADPH 1MFDH 5EOCJ 1V5JA 5EC2A 5HGDB 3ZHKA 3KYMB 3OJDA 3RWEA 1GL4B 4Y5YA 2DQJL 3HI6H 5HYQA 1JWUB 2Z31A 3JTSB 5IQ9A 3O3UN 2F54D 2NY6B 3D2UB 4YNYB 5GS0C 1AIFA 5IR1B 4JFFE 3OKKB 5H2BA 2A2QT 3L6FB 3G04A 1CT8A 4K3EH 1MH5A 2ZJSH 1KJ2A 4OQ1A 1A4JA 3BJLA 3BN9C 2JELL 5I0DA 3O0RL 3QRGH 1EH9A 4U1SA 4PJHE 1UXWA 1OAYL 2DQHL 3QBTB 3EDJA 3RZCD 1H3VA 1A22B 2Z91B 1U8IA 1CLZL 5HI4D 4J3TA 5EPMA 4YXLH 2QADC 2R29L 4JGJA 4HEPG 1LO0L 4PPTA 4GG6E 5J4MA 3T08A 3A0OA 3LMJH 4PLOB 1KB5L 3LHPH 5K9KB 1E28A 3VI4E 4CW1B 4OM0L 1IFHL 1WEJH 1FG2A 5F9DC 1EFXD 2G9HB 3O45B 1HQRA 1KC5L 2FZ3A 2BVTA 2J8UB 2Y4SA 1BPVA 4XI5D 4LARH 5EU6B 3QUYB 1NUDA 1DQDL 4S1DD 2PYEB 5IFAL 3MGOB 3ZKXB 1H0DB 2LFGA 2FJGB 2H32B 1IC7H 1KTDA 1ZHKA 5FHAL 1JNNL 2NY2B 2ED9A 4NCC2 2EDNA 3WHE1 3KXFB 4NN6B 4MAUH 1AJ7H 3IVKB 3U9UB 4O5LH 3WFZA 4JRXB 3IDIA 3BIBX 4N8CL 3MO1B 3QYCA 3ARFD 4AK1A 5GGSA 1LEGB 1PLGH 3NIFF 2ADFL 4K3JL 3DSFH 4LVNC 1E6OH 5KBNC 5B4MD 3H3PH 4GT7A 1XGQA 5HYJA 3IFLL 2NXYC 4OIAA 1YC8A 1WWCA 4KVNH 2Q76A 4GRWH 3VXME 1MRDL 3OR7B 1J05B 1TVBB 4NJ9L 4LU5L 4HUXB 4LHUB 3HMXH 4FMKA 3F7VB 1Q0XH 5MEOB 4XMLL 1EUUA 1L7IH 2R2HB 1HYRC 4ODSL 4BK5A 4ZUUB 3HE7B 1YY9C 1I9RL 4UU9B 1XAUA 1MVFA 1AQDB 1XGTB 1J0IA 4TSAH 2GSIB 2JK5B 5JORA 4Z7VF 3H42H 3OG6B 4L3AA 3ROOA 3QCTL 4M62L 1ZK9A 3MREA 1RK1B 5LQBL 4Z7UE 1FNAA 3S5LA 3U46B 1CD8A 4YPGB 1DVFB 2CDGA 2B8OT 3EOTH 3QDJB 4MVBC 3F58L 5IQ7H 4MA1B 1T1WB 3O2DL 4CVZB 2MFNA 1FE8H 4HPOH 5JPNB 3CDGB 1MUJA 1KB5B 2UWEB 4XWOC 4Z7NF 3QJHA 3D0LB 4HMEA 3O3DA 3LN4B 4GKOA 4X99A 3ROLA 4NQDA 5FAAA 3VCLA 1BD2B 4A2MA 1DN0A 1OP9A 1I3GL 1KXQE 3D5OF 4LDEB 5GRJH 5DRNA 4R96B 1CXFA 2XI9A 2G75A 1CE1L 4LSPL 3ZMRA 3EYVB 3HZKB 5ERWB 1J8HE 2F15A 1NL0L 1MJUL 2KQNA 5HHPB 5LXGH 5CGTA 5KW9L 1O0VA 2BK8A 2V9TA 3IAGC 2ZPKH 3E3QC 5E2VL 1KULA 3CX5K 3KPSA 4S0SD 2VZOA 4XPTL 3ZT7A 1U92A 4H25A 2DM7A 1JWSB 2VN4A 5MI0C 2Y6SD 1WZKA 4FQ2H 3CU7A 3RNKA 1UYWL 4LEOB 1LO3L 3CCHB 1AD9B 5KG9A 2DQIL 1U3ZA 3VGAB 1QFOA 3DUHA 2X1QA 4HS8L 3NCJL 2E5EA 4WI3A 2R1XA 5ADOH 4DGVH 1JNLL 2G2RB 1HI6A 1H3TA 3DVNB 5D2LB 2XG5A 3GM0A 1OB1A 3SDDB 1QLRB 3KJ4C 4G6KH 3ZDXF 5C09B 1F4AA 3MV01 2N1KA 1QKZL 1XR8A 3FQWA 2E9JA 3R06B 3VRIB 3RL2A 5GRXG 5K59F 4OF6A 3OXRB 1NC2B 5CJQL 1F97A 4Z7WA 3WKML 4Q9BA 3LEXB 1B4RA 3MV9A 1Z9OA 3GNML 1EEYB 3LDBB 2P47B 4PRIE 4CVUA 2DICA 4HIJA 1X4XA 4QXTB 4OZFA 4NWTH 2FCBA 5AZ2L 3QG7H 5E8OA 4UQ2B 1A6AA 5DMKA 5C9KA 1NGPH 5DT1H 2XY2A 5T3ZE 4N90E 1Y6MR 3OHXB 3QUMA 4MLSA 4KHXL 4XBPB 2YD2A 1S78C 1RZ7H 5J1SC 4P4KA 1BVKB 5DGRA 3R0NA 3RBSA 1URLA 2VLLB 4J6RH 2XIDA 4FQPA 1D3CA 1UWGL 1H3PL 1B6UA 2YKLH 1XCTA 1W8NA 4KZDL 1IGCL 1CXLA 3DETC 4HCRH 5C0RH 1OOAA 1DBMH 5GGVH 1T1YA 3ARGA 5JIPA 5IW6B 4OB5L 4Z76B 4XNYH 4K7FB 3BW9B 2UY6A 2C3HA 3PHSA 3MLXH 2V7HA 1DBKH 4OZGB 1I1AA 1NC4B 4S1SL 4M5ZL 1NEUA 3HR5A 5FCUH 4K9EC 3RY6C 3HTLX 1QFHA 3DHMA 2A73A 5DQDH 2L4OA 2PCPA 4NRZB 2FBOJ 3ALWA 3EFDH 3D18B 4KI5E 2BSSB 5BRZB 2R56H 3AROA 3QIWD 3MJ6A 3GHEL 3GKWL 4KROC 4PJIB 1JZ5A 4PRPA 4XPBL 2QSCL 4NZUL 3V5DB 3QFJE 5E56A 3QQ4B 3TNNA 3D85D 2IMNA 4G9FA 3LD8B 1P6AB 4RRPA 3IS0X 4EI5C 5MENA 1SEBA 2BDNL 1NUNB 1FNHA 3T2PA 3K1DA 3LS5H 3P9MA 2XWTB 3DV6A 1LE5A 5D8JH 5ANMA 3V4UH 1JMXA 3QXTA 4DQOL 1UWXK 2YN5A 2BCKA 1X5XA 4NSKA 3IDUA 1EXUB 2B5IB 3QPQD 3S97C 1A8JH 3SDCB 2IG2L 1I1FB 1U93A 1HN1A 5D72H 1S7XA 3DRTA 4C83B 1A4KB 3HZVB 4OKVB 3I85A 1KEGL 2JLLA 2ZOLA 1G9NH 4KVCL 3T65A 3PQYA 2NZ9C 2GUOA 4LAQH 3MLUL 3ZE2F 1ORSA 3OZ9L 4HFWB 4O51B 1KLGB 1SVZA 4K55A 1MJJA 2J8UF 1I1YA 4PJ5E 3FZUD 4TUJB 3B2VL 4K2UH 3MUHL 4P4RB 1IILE 4PGBB 1NSNL 2E7LA 1YEIL 4L1DA 4JM2C 1KCKA 1OLZA 2DQEH 1MHCA 3MLVL 3NCCB 1QFUL 3FFCB 3C60C 1HHIA 3KWWA 4H0GA 4ACPA 4ZUTA 1J1OH 3V6OE 2C4FT 1X4ZA 1A9BB 2Q1EA 3EYQC 2O5YH 4NO3A 4M7LT 4ZDHB 4IRSA 2WUCL 4JFEA 1LDPH 4HJJH 4H26B 3A67H 5FYKU 5CD3B 4C56B 5FUZL 1VDGA 4P46C 5E7FA 3TFKD 1XIWD 2VC2L 4N9GA 1WF5A 3I84A 2H45A 1S9KC 5SWZE 4OAWA 2DMKA 1HXMA 2BRRH 2CGRL 1INQA 1G7JB 1IQWL 3WMSA 4A6YH 1WFUA 1YMMA 4G6AC 1NQBA 3D1MC 2B20A 4WDIA 5DRZA 2WLZA 5C0BD 1UCBH 2VDLL 5DJYA 2CSPA 1LK3H 3RAJL 4F57H 4UV7L 2HTKC 4KMTL 1T21B 2FX7L 2Q86A 3WNPA 1UKSA 1G7HA 1IEBA 1U2CA 4TULH 1NJ9B 2YWYA 2YZ8A 4CVXB 2VXVH 2XKNB 2VE6B 3ZYIA 4LP4A 2J8OA 3MRKA 1R3LA 2SEBB 4OCRH 2ZUSA 1IARB 2P5EB 3W5NA 1FZKB 1F3JB 3MTRA 2GAZB 4M61A 2UWEF 1A6UL 4ENEC 4K7PL 3IU3B 4AMKH 4WUUA 1X5GA 2FD6L 3W11D 2OR8A 3HRZB 2AJVL 5JR1H 3VXQB 3B9EA 3VXNA 4JVWA 5LBSH 5I6XB 1K3ZA 4QXUH 3U0WH 3VXTA 4G5ZL 4U1KA 2DQCL 4R4BB 3RTQB 5KSBB 4L5FL 3TA3D 2CRZA 3F7YA 4LSQL 2M1KA 2BC4A 1AR1D 4XAWH 1NLBL 2AK4A 1LE9A 3LEVL 3P40A 4NFCA 3LRGA 4RGOL 1JGDB 1BX2B 3MV7B 4AJ0A 1UM5H 3F62A 1MCLA 4KKCD 5B8CB 2EH8H 4YO0B 5DJAB 1A7QH 4OD1H 1UM4H 4G7YL 3WLBB 2V17L 1NFIA 5CZXC 3T3ME 2ESVB 4QOKA 3O4LE 2BNUB 1DBJH 4MAYA 5ID1B 3GSVA 3RJQB 2MQ3A 4RGMC 5CUSL 5D2LF 2OL3H 3LKNA 1NCCL 4FTVA 4Y1AD 4XB8A 1OCWL 5HVHB 3U6RA 3PIQB 4BZYA 4GKZA 5JMOC 4HUUA 3L3JA 3RL1A 1IAKB 1ZSDA 3GK8L 4CMHB 1FZJA 3MRPA 4PR5B 1SEQL 4IRJD 4CN1A 4OQTL 3ZKMD 1RIHL 1A5FL 3OKLA 3LKRA 4V2BA 1MAML 5EBMA 2H9GB 4QF1A 2A6KA 3O8XA 2UZXB 5D5MB 1DQTA 3ARVA 4XHQA 4X4ZA 1XH3A 3DVFA 1EDQA 2WUBL 4D0DB 2X4PB 2FGZA 1PG7H 3RVXD 3RUGA 1ZA3B 1KIPA 3QG6A 3STLB 2APTA 3IDJB 4NT6A 1KACB 3TM6A 2ARWA 1AGCA 5GRUL 4NQSA 5KS9E 1QA9B 3TO4B 5C0ND 4YPJA 4XCNA 3WNNA 3BSZL 4ZPTB 4X7SH 3VW3H 4G8EB 5I15L 1ZHNB 4ZS6D 2A77H 1XF3B 4HT1H 4OZGF 4LVEA 4LLYB 3C09C 1G6RA 4FQHA 2PO6A 2XV6B 4CN6A 2WAHA 3L3IA 4EUPH 1DL7H 4AL8H 5FO7B 3TBWA 5DJZB 1KFAL 3SE3A 1FLRL 5TQ2L 2AEPH 3HMWH 4UIKL 3TC9A 2E9WA 3TPKA 3ES6A 4YJZL 3LN5B 4NKIH 4RNRB 4KDTC 5CAYB 1GAFL 4PJIF 4UILH 2ZUQC 5D2NC 4ETYA 4LPUA 4J8RA 4RMRA 4RFEB 4UUJA 4N8VB 4J1UA 3C8HA 1KJMA 5C7XL 3W9DB 4KGLA 4JPWH 4AT6B 2A38A 3V6OC 1EPFA 1A9EA 2CRIA 4HC1L 3HC0A 4HS3B 4KKAC 4JO3H 2PKDA 1U3HA 1DQQA 3FQTB 4TNVF 3UJIH 5D7SL 3KPRE 3GRWA 5I9QC 2CK0L 3NA4A 3L3OA 1NCNA 2VDRH 4YK4B 1AXSB 3BPOB 5FEBA 4RISL 4XZUA 2YPKA 4JFPB 4LLDA 4RIRA 3F12B 4MCZA 5EU4B 5EO9A 4U6TA 5FA4A 3BMWA 4RMVA 1VGKB 3ZDZE 4IHOB 5IBTH 1FO0L 1V3KA 1NBVH 1XF5B 2VDQH 3GHBH 3T8XB 3IDNB 2AXJA 4HIXL 5T1LB 4ZTOH 2QQLH 4X6CE 3IKCA 5EULV 2Z8WC 5DVMA 5HHME 1UENA 2YC1B 3QXWA 1EEUA 4TPRL 1X5KA 4BH7A 4JHZA 3CDCA 3RWJA 1HSAA 3QUXC 3JBG7 4DTGH 2FO4B 1I8MA 3WUWG 1W72L 4JRYE 5GS1A 3MJ8A 5F7YC 3O6FB 5GSRA 4OV5A 3ZKXC 4U33A 2DQFB 5IEKA 5TPWL 4RGNE 1MREL 2Y06H 3EJYD 1WTLA 5F44A 2F8VA 3QXDB 3SO3B 1RU9H 1SM3H 1DQLL 2R69H 1UWEL 3BP5B 4R7DB 2I9LA 4XPAL 3SCMD 3ZDYE 5J12C 4ZSOB 3WXVL 1CF8H 1GC1L 2FJHA 1EJOH 1WZ1H 3N1PC 5IT2H 3ZKNC 1MCFA 1KT2A 5H37G 1KJVA 3DTXB 1XCQA 4XH2B 3ARBB 3OKYA 4QRRD 2BVPB 3K46A 1YEHH 4MCYB 4JJHA 4NC2B 4OI9A 4WW2B 5HYSB 3KR3H 1F90L 4PRHA 1BHGA 4L3EA 4HF5H 1A1NB 3PE9A 2Z93A 2JJTC 1S5HA 3MACH 2W38A 3CFBA 1CE6B 5E24E 3GJFB 1FGVL 3OAUH 4LRNH 1QSVA 4JPIB 4XMPH 3SDAB 3C5JB 5C0IB 5JW4M 3GBML 3S36H 1V8HA 3V79C 3T0WA 3ZYOA 2X4OA 4JPKL 5H94A 5M94B 3TJEH 4L29B 4TN9A 4GQPH 1Q9KA 1MI5D 1F11B 5ETUA 4QEGA 1XZ0A 4F2MB 1N26A 3VGDA 5HDLA 1RSFA 3D3VD 5I1AA 1XR9A 4H5SB 4XVSH 4MA7L 3SY0A 1JF6A 3S4SG 1NBYA 3HE6C 1RURH 4XNUL 1JHKH 3CUPB 5D93C 5E00B 1NAMA 4EEEA 2AXFB 1WT5A 5GSVA 4K7PX 4I18B 4H8WL 4TSCH 4X7EC 4L8SA 5JW3L 3V5HB 4ODWA 1KBGH 2IMMA 4QGYA 4QNPF 4C55A 5JA9A 5KSBF 2ZKHH 3PDOA 1W72B 4ORGA 2XZCL 2ZSWB 2OMBA 1P84J 3L3HA 4R90L 2B0SH 2DQDL 3KPOA 1GIGH 4JZJC 4Y5YB 1NMCB 1HDMB 2X4SA 2ZUWA 3JV6A 2Z31B 5DO2C 3LIZH 3EW3B 5I1LA 4QHKI 1I3RB 3VI3E 3WUWA 5H2BB 4IBLT 1ACYH 2HN7A 1CT8B 2GTWA 5CP3A 1KJ2B 1JK8B 1A4JB 4JN1H 3BZFB 5F1KC 3V52H 4U1SB 1UXWB 2X1XR 1NGQL 1U8IB 4MDIA 4IRZH 5EPMB 2F54E 4NC1E 3OJVC 4HWEL 3KS0J 5L2KD 4PJEA 5JUEH 1E28B 2XZZA 4MWFA 2DM3A 3OB0H 2XNAB 1T20B 3BEVB 1FG2B 3X11A 3LCYA 5EZOL 2DYPA 1HQRB 4LIQH 2NXZB 5SWSA 3ZE1F 5DJ0B 2FZ3B 4DVRL 1JMZA 3CGTA 2X9XA 1TVHA 4XP1L 1UEYA 3SGJC 4JANA 5AAMA 1MELA 3PWLA 4Y19D 5GGTA 2OTWB 3TVMD 5EU5A 5EWIH 5D5MF 1FGNH 4F15C 4MQTB 1JFQH 4OCSH 1UH3A 1ZHKB 1F4YH 3K8KA 4IIQC 3BVNA 2Z35A 1VESA 3CH1B 5JDJA 5DD3L 3DO3A 5TE6H 3WJJA 1J1PH 1CGYA 3IDIB 4GSDL 2YD1A 2JJSA 4WO4C 2F19H 1CFSA 3TN0D 5GGSB 4PUBL 3TF7C 4QRUA 1F3DJ 3MOQA 2WBJC 5HYJB 1RK0A 3S4SA 2Q76B 2QQNH 2YEZB 5C6WH 3OF6A 4CADA 2DL9A 1UEMA 1DCLA 3VXSA 4J4PA 2ENYA 5HPMA 1Z3GH 1NEZB 3AXLA 3MODL 4FQJH 2OP4H 5IFHL 4PJCE 3GSXA 4U1MA 2FX8L 3ROOB 2HFGH 2HT2C 4MJID 4LP5A 4Y5VB 4X5XA 3VD3A 1LP9B 4S10A 1ZA6B 3PV6A 3QEGL 1U8KA 1MUJB 15C8H 5KOVC 3O3DB 4RCAA 4Y4FC 5D9SA 3C2AH 4X99B 3ROLB 1C5DB 4X8JA 3MLYL 3VCLB 3ARDA 4KDVA 1IGJA 1PGRB 1DN0B 3FO1A 4XPHL 1AQKH 2XN9A 4EOWL 3JVGC 2G75B 3LS4H 2OTUB 4CDHA 3NABH 5ESQA 3IKKA 5DUMH 4DN4L 5FGBA 4AEIH 5EORH 4RAUB 4NNYA 1IRAY 1NC2D 2QQQA 5IM7B 4G6MH 3SJVE 4XAKD 3AB0B 8FABB 4MQSB 4X98A 1BJMA 3D39B 1DQML 3WS3A 5EU3B 4H25B 5ENWA 1MRCH 3UTZA 3ZYZA 1MCOL 3RNQA 3BQUD 4CMMB 3BO8B 3RY4A 5HHVH 2R1XB 2LQRA 3LH2L 4P2OD 1HI6B 4Q97A 1IQDA 4HBCL 2IH1A 1WAAA 2UVFA 3WDJA 3DXAA 1RIVH 5TDPB 4C57C 1OB1B 3TZVC 1OTTC 2KPNA 1UJ3C 1XR8B 1A47A 3ME0A 3FQWB 4RWHA 4ZFZB 4FABH 3RL2B 4YBHA 4UV4H 2EKSA 3NCYP 5LGHL 4K94L 4Z7WB 4LMQI 4GXUN 2IAMD 3MV9B 4KZEH 3DLQR 5GS0H 4GRLB 4LPTA 2ICWB 1N8ZB 5F9WB 4WW2F 2HJLA 3UPCA 5I1IL 3UTOA 5DMKB 1YPZA 3O3EA 4F37F 3MUY1 2V5MA 1PX4A 1EV2E 5GGQH 2D7TH 4P4KB 2VLKA 4F58L 3MRHA 3HLAB 1FNFA 1CFVH 3PWVA 4NJAH 2Z0BA 4N1EA 5IWLC 4Q9RH 2OK0H 3O3AA 1T1YB 1T0NA 2IBBA 4LLAA 5F3BA 3ARGB 5CWSB 4MJ6B 2VIRA 4LSDA 1JHTB 1QEWB 4Y5XA 3Q3GA 4LQFH 4LCIH 3U36B 4NC1C 2EYRB 3C5ZA 4YGAB 1IL1B 4ONFL 4HWZA 3RGVA 1DBBL 4JO1H 1AGFA 2DD8L 1M05A 2A73B 1KCUL 3VXRA 3NA9L 5HI4C 3ILPA 3G5XA 3GMQA 4OZHB 2NW2B 3MYJB 1MCIA 3VFGL 1SYSA 3D6GA 2D7OA 4OCMC 4PRPB 3O6LL 4HIEA 4I3RH 1IGIL 3TNNB 4P9MH 3GI8H 3NZ8A 4XPFH 3B3IB 5AD0A 3ZT5A 5JDSA 5MENB 4YHIA 4XI5C 1EO7A 1PVHA 2ITCA 5BMFL 1MHPH 1N64H 2WMPA 3P9MB 1PKOA 3DV6B 1LE5B 1RJCA 5ANMB 4C54A 5JO5A 2O5XH 4S1DC 2WANA 5B3NA 3W81A 1B0RA 5IBLD 1EVTC 3GGWA 3B2UC 3FFCD 1L6ZA 3DJ9A 5B8CC 3RKDD 3GUTB 2J4WL 1AHWA 1PKQA 5I76B 1X6LA 4Y88A 1OM3L 2ICWI 4LBEA 4YHYC 3GSRA 4GAJH 2D0FA 4MNQA 4XVJL 1S7XB 3DRTB 4TTDD 5KZCB 1LQSR 1UZ6F 2B2XL 4AG4L 4IOFD 5JZ7D 2ZOLB 1Y6NR 3ARFC 2NY1B 4R4FH 2GUOB 2DIJA 5I1HH 1AO7A 4QRTA 2Z4QA 4PB9L 5KVEH 4N0UA 4NWUH 5B4MC 5JW4N 1MJJB 1I1YB 3MRDB 2YRZA 2XWBA 5BW7A 1CGTA 4XP5H 4LFHG 1IM9B 1FAIH 2Y25A 4WW1A 3O2VL 3UTTD 3JUZA 4KRLB 4AZ8A 3TNMA 1AFVL 5EOTA 5C0AA 2G5BA 2NX5A 3T4AB 5I1EL 1YNKH 5D7LB 1MHCB 3U2SA 5JQ6L 1HHIB 5F3HA 5BVPL 4DW2H 2OJZH 5EN2A 4ZUTB 2O5ZL 3QDMD 3G6AA 3CC5A 1R5VA 3VFPA 1P7QA 4MA3B 4IRSB 5I18L 4P3DB 1RY7B 4X5LA 3HZYA 2YD6A 3P3YA 4R8WH 1LO2L 4OFYD 5FXCH 1R3JA 5KAQG 1YEKH 3I50L 5FDYA 4OAWB 1RHHA 1X5ZA 2QHRL 1INQB 3VRLE 3MLRL 1Q1JH 5FO9A 4EBQL 4WDIB 2WINB 4L4TA 3WIFA 5DJYB 3QR2A 1FL3A 2IH3A 2KQMA 3CSBA 2D7NA 4NQXA 3QIBB 4HG4K 4JFDB 1G7HB 5FKPA 4DGYL 1IEBB 3S35H 2R1YA 1KV3A 3P77A 1FN4A 2Q3AA 5ADPL 1MFDL 5C0BE 3GIVB 1LP9F 2GJ6A 5HGBB 4JQVC 3ZE0E 4MA8H 3MGTB 5DR5L 3QI9D 5JHLH 3HNVH 4M61B 1KEMH 2Y6SC 3HI6L 4RFNC 4JPVH 4WUUB 1JGEA 3UTSA 1NGWA 1UA6L 4K3EL 4KGJA 2ZJSL 1QLEL 5A3ID 2DKUA 2X41A 5D1QA 3VXNB 3VXTB 5EUKB 4OFPA 1INEL 4YXLL 4U1KB 5FUCE 3QUZA 3C5SA 3LMJL 2OSLA 3G6JA 2BC4B 1EGJA 3SGEI 4PJAB 2AK4B 1LE9B 3QQ3A 1WEJL 5IKCA 4J3UA 2JIXA 1YY8A 3H7BA 3J7HA 4MLIA 6FABH 2GFBA 1CD0A 1TZIB 4IJ3B 5ALCH 4LARL 1IJ9A 2LVEA 2YRPA 4U6VL 4QOKB 3U7YL 4MAYB 3KAAA 1J0YA 5DF0A 3CVHH 3GSVB 4LVOB 1IC7L 4R97B 3LKNB 4FTVB 4XGZB 1HOCA 1BFTA 3U6RB 2V2WA 3L3JB 2AXHA 3RL1B 4D9RD 4MAUL 1AJ7L 2HVJB 1I7UA 2HG5A 4GBXD 1FZJB 2ADJA 4E41D 2BNQD 3PNWA 3MRPB 5F9OH 4Z7WF 1MHHA 1JL8A 1QRND 5K9QG 4Y1AE 5I1KH 3OKLB 3LN9A 3UPAA 2IANA 4R4ND 1K6QH 1KXTB 1PLGL 3OL2A 2DRUA 3DSFL 1M4KA 2A6KB 1UQSB 4F9LA 1X3DA 5JLZB 2X4NA 3UTPD 2NY4D 1CICD 4KVNL 2HKHH 4Q9CA 2XQBH 5E8PA 3RUGB 4WEBH 4P2QD 3HMXL 4NT6B 4NQUA 3QIWC 4KV5F 1NBZA 1AGCB 3MYZA 4NQSB 2BFVL 5FIEA 5DFVD 2UUDH 4HDIB 4TSAL 3P4MA 1SJEB 4Z8FH 3H42L 2BHYA 2QV2A 3BHBB 2CXGA 3E6HB 3QZWG 4G8IA 5KSVA 2EIDA 5C3TA 3S3SA 2RIKA 3EOTL 4GLRI 5IQ7L 3RPKA 2NZIA 2OYPA 4YAQA 1IBGH 4FQHB 2PO6B 4HPOL 4U05A 2GT9A 4LVHC 1I9JH 3UYRH 1O7SA 4DEPC 3NFSH 3L3IB 4Z78A 3FN0H 3QPQC 1AXTH 3TBWB 3ECBB 4OZHF 1R5IA 1QSED 4PJ8D 3ES6B 5GRJL 5E9DA 1NANI 4OLEA 3GO1L 2ATKB 4UUJB 3U4EA 1KJMB 4P23D 2EICA 1WUNT 3FZUC 3MRRA 2VN7A 4JAMA 4PJ7A 5F1NB 4C58B 1BZ7A 2H8PA 2ZPKL 1DQQB 1H15A 4MXQD 3BKYH 2E6JA 4ZUWA 3PABA 4GFTB 1J88A 1A2YA 1BOYA 4JREB 4FQ2L 2VDNL 1TQCC 4ZUSB 1GC1C 32C2B 1UFUA 2F58H 4XZUB 4K3DH 2WW8A 3GI9H 4DGVL 4LLDB 4QYOB 1TENA 4QHUA 2GCYB 4GRWB 5LGJB 4UBDD 4BJLA 4ZFOL 5B38G 3TFKC 3IKCB 1XIWC 2NXZC 3Q6FB 2P7TA 2FYYA 3MUGA 5K59E 4BH7B 1S8DA 2FH6A 2VLRA 1Y0LA 1KN2L 2W0FB 4RDQG 2DJSA 4R9HA 1TXKA 4LEXH 3MJ8B 4OCLC 4YDVA 4NWTL 3OB0K 4OV5B 2OTPA 3QDGD 1NGPL 4HPYH 5IEKB 3W2DH 3LQAH 4J6RL 5DTFA 3UDWA 3ARED 2YKLL 2GY7B 3LPGA 3QZWA 1EA9C 4DKDC 1TCMA 2XTJB 4HWBA 4BQ6A 4HCRL 5MHSE 1DBML 5GGVL 1KT2B 3TT3H 4UIMA 4WY7H 1S7VA 1XCQB 1I7TB 1HH6B 4APQD 1RZIA 3E2HB 3MLXL 4H8WC 5C0JB 4H20H 1MFCH 3EDFA 3W11C 5IW1A 1JE6A 3CFBB 3KGRA 4J3XA 1A6PA 2XXMB 4WGWB 4WHYH 3DUSA 3HUJE 4QRRE 2JF1A 4CJ0A 1T22A 2V2TA 3VXUB 5L6YH 2R56L 1NMAH 1DZBA 5H35A 2IBZY 1KTLA 2X4OB 1AR1C 3IF1A 4K23L 5C0DA 4DJMA 1JZ4A 1Q9KB 4X4XB 5E4EB 1XZ0B 1YYMH 4U0RB 5J6GA 4KKCC 3ZSTA 4B50A 1YN7A 3HC4H 5ISZB 5I1AB 2OR9H 1XR9B 1Z9MA 3RWCA 2VZSA 3LS5L 4RZCA 5FKAB 1NBYB 5D8JL 3V4UL 4FXLA 4NCDA 3UPRB 4JY5H 4YDJA 3AFLA 3F7QA 2RFXA 4M1GH 4WI5A 1VACB 5JW4Q 1ZGLA 3M17A 4LCCC 1T5WB 3D3VE 2PYFB 5DVOA 1B90A 4M93B 5D72L 3HI5H 4U1HA 1DE4B 4WI6A 5A43C 2YK1H 4ORGB 5CD5D 4UOW1 2J3SA 1T4KA 5B38A 3N85H 3KPOB 4PJAF 1TCRA 1G9NL 2X4SB 3JV6B 4IRJC 1RZGB 3ZKMC 3BE1H 2VSDA 5I1LB 4OZIA 5E2WH 2VL5A 3WUWB 1JI2A 1G7QA 1B3JA 4YBLC 4NM8L 3QQ9D 1HKFA 5E94B 3DI3B 1LO4H 2AJSH 3RVXC 5I73C 2FDBP 1MFAH 1NGXB 2GY5A 3OQ3B 4GS7B 3VA6A 1GGCL 4PYGA 2V7NB 2VLJA 5IMOB 5IHBA 2DQEL 2PYEE 2MOVA 4N0RA 4PJEB 2Q6WA 3RDTB 3T3PE 3VDAA 4PRNB 3MRGA 4PRDA 3QEQD 5C0NC 4LNRA 5HHOD 5SWSB 2FHCA 4V2CB 4ZS6C 1CCZA 3QUKB 3RX8A 2G5RA 2Y07H 5AWNH 4OCYH 1LDPL 4JRXE 4HJJL 3A67L 5L2KE 4JANB 3PG2A 3PWLB 2HJFA 4HZLA 2BNRA 1XF1A 1KN4H 5EU5B 4QY8A 5EA0L 3BVNB 2Z35B 3RUGF 5I1CL 1HHJA 5KSAA 1KPUB 4A6YL 4I13B 4M5YL 1BQSA 3PF2A 1EMTL 4NZTH 1D7FA 4Y19E 1UCBL 4F57L 3NIDE 1LK3L 5F1IA 3O4OB 4OV6F 4DKFH 2APXA 2P48B 1J5OH 2X1PA 2CKBA 1DANT 4KQ4H 5F7WC 4NNXA 1CFSB 5TDNA 4E5XA 1N59A 2VXVL 3E0GA 4FP8H 4TSBL 4QRUB 1F4XH 4OCRL 4IDLA 4NQDD 1QFWH 3S4SB 1QPXA 2PTTA 2L0DA 3GMOB 1A6TA 3QDJE 3O9WD 3X12A 3WFCH 3ULUH 4CADB 3VXSB 3NTCH 1LO5A 4PRAA 4AMKL 3L1OH 5TH2A 3AXLB 5JR1L 3GSQA 2H6PA 4DKEH 3TYGH 4D2NA 3B4NA 2A83B 1FVEA 3GSXB 5GHWH 1K8IA 5LBSL 1U6AH 3U0WL 4FFYL 5EO0B 3KPSD 1IAOA 1JBJA 5L8LB 1NFDA 2F5AL 3QWOB 3SKNA 2CRMA 1D5BB 4XAWL 5T1KA 1P5VA 2DS4A 4PJXF 4OLXL 4MJIE 5D9SB 4X8JB 4Z77A 3BJ91 3ARDB 1UM5L 3ZO0A 1IGJB 2IADA 2EH8L 5DJ6B 3KLDA 1A7QL 3SKOB 4POYA 1EHNA 2WP3O 5E6YA 4BUHA 4BSVA 3EJYC 1L9MA 1P84K 3BAEH 5F7LB 5ESQB 5EH1A 5D96B 2MKWA 3QPXH 2JJWA 3BXNB 3SCMC 4NNYB 3FB7B 1ZLUH 3T1FB 4KDWA 5GGRY 4GRWF 5F89A 2JELH 4Q6IC 4Y4HB 1DR9A 1XGPB 4A6YB 4X98B 5HTSA 5BV7H 1YNTA 3HAEG 3WS3B 5T1DH 5C0CA 1CG9A 4ORZC 2C3WA 3MRBA 5HSFA 1MJ7L 7FABH 1LO0H 1AY1H 2BVEA 3MMEA 1HILA 5ENWB 3PHOA 1RZFH 3RNQB 3JWNC 4XAKE 3VMNA 2QEJA 1HIMH 1IFHH 5DWUL 1HYSD 3V0VA 2F8OA 2AK1H 5BS0B 4W4OC 5F7UA 1QO3B 1RPQA 1K5NA 3MRQA 3EYOA 1UG9A 1TETH 1AKJA 4PGDA 1F45A 1ZHBA 3D69A 4JY4A 4NBYB 1QRKA 4JQIH 5DUPH 2EKSB 2VR4A 5FHAH 3CDFA 3K74B 1I1AD 4JFOA 1YUHB 5EIVA 4WEUD 3FHAA 1ZT1A 4X7SL 3VW3L 1RZ8A 3NH7H 2VJXA 2A77L 5DA0B 2HJLB 1YPZB 4JFFA 3WS6C 3MJGX 1OGAA 3VXOB 1M71A 2VAAB 4LLWA 4N8CH 2BP3A 3DX9B 3NVQA 1KPRA 5D1XD 4YR6B 3MRHB 1F42A 4PJHA 1XF4B 4AL8L 4K3JH 5GJTH 1T5XB 3SE8L 2AEPL 2NY3D 2E7HA 4G9FD 3O3AB 2PW2A 1HCVA 3QIBC 1WFTA 3AS2A 1T0NB 4UILL 3V5KB 3RY6A 4HH8A 1UM6H 2W65A 4ZUVB 4PJ9A 1SY6H 3Q3GB 1KPVA 3LVEA 1I9RH 3V4PH 3SO5A 3C5ZB 4JPWL 4HWZB 3G9VA 2OL3B 3RGVB 3IJYB 1I8IA 3QCTH 2XKUA 3VFOA 4Z7OF 3G5XB 3ILPB 3GMQB 3UJIL 3V7AE 5SX5H 3UCRA 4XRCB 1SYSB 2VDRL 2YUZA 5DMGD 4EI5A 4GUPB 4ZYKB 4EVNA 3PQYD 4HIEB 1H3GA 2CKNA 3CH8A 1CFQA 4LKCA 3JXAA 5L9DH 4I5BB 3BYTA 5IIEB 3NZ8B 4ONHA 3HAEA 3T0BA 1I3GH 4NQCA 3FO9B 5IBTL 3N9GH 1NBVL 3LQZA 4LNVA 4N1HB 1XF2B 2OZ4A 5JO5B 4ZTOL 4KRPD 3TVMC 5C9JA 5JXAL 2QQLL 3ABZA 1B0RB 1NGZA 3GGWB 1NL0H 1MJUH 1NCTA 2WP3T 5KW9H 3HS0A 4OLUH 1GJIA 4G9DA 2EC9T 2HFTA 1GGIL 2YN3A 3MUZ1 4TVPD 3DYOA 3U79A 5DC0A 5GZOD 4LBEB 3KPMA 3GSRB 3CXHK 4MNQB 5KVDL 2L7UA 1T89A 2Y06L 2J6EL 4PJEF 4JFED 5IB4A 4D9QD 4KPHH 1UB6A 3FFCE 4G6FD 1MHEA 1RU9L 1S7WA 1SM3L 2AJXH 2CK2A 2R69L 3TN0C 2Z4QB 2VITA 4NO2A 4Z7UA 4N0UB 4HS8H 4XWGL 1ES0B 4LSRH 1YEJH 4EUPB 1MFBH 4R2GB 1ROWA 1CF8L 3C60A 4K8RH 2CDFA 4NDMB 1EJOL 1WZ1L 4PJGA 1YMMD 1QACA 4WHYG 1QKZH 5EOTB 5KSUA 5C0AB 3CSPA 2NX5B 3U30C 5DK2A 3U2SB 3AUVA 4X5WA 3KLAA 3KR3L 1EHXA 3U82B 2R4RH 5EN2B 2AKRB 2EDFA 4HF5L 5E5MA 1G9ML 3G6AB 3CC5B 2W07A 3UTTE 4PP2A 4HIHA 4P46A 4ZTPH 3OAUL 4LRNL 4PG2C 1TZHB 3NAAH 2DI7A 3PWJB 3HI1A 4HKJB 4OF5A 3QDME 4KJWD 4XC1H 3TJEL 2X42A 5I71B 1R3JB 1H3PH 5JA8B 1RHHB 1V7MH 4NRYA 4KZDH 5GZND 1IGCH 1XGYL 5F8RC 5FO9B 4Z7VA 4XVSL 4AYFA 3WIFB 4UDUA 3SKMA 1J7VR 1RURL 2WBKA 1FL3B 1JHKL 3FQRA 1TJGH 5A2JH 1FNEA 2X89A 2R1YB 1OPGH 1CFNB 3T0EB 1CU4H 4TSCL 4PJFB 2DM2A 3P77B 1AGEA 3BKJL 4DOHB 2X40A 4JQXA 3QXAA 1KBGL 4Y2DB 3OAYH 1EO5A 2ZKHL 3K2UL 3MUJA 2GJ6B 4KC3B 2B0SL 5DDHA 1GIGL 1QNZH 2R0KL 3LB6D 2IPTH 4Y4KB 1X7QB 3GKWH 1TLKA 3VFNA 1BGXH 1XFPA 3BQUC 3UTSB 4YC2B 1D6EA 2DQGL 1NGWB 1ACYL 5BZWA 3U0TA 4P2OC 1D5XA 4JN1L 5D1QB 2C9AA 3QHTC 3V52L 1F6AA 2GK2A 5DMJB 3RGHA 4BYHA 1KNOA 1E0OB 2BDNH 4DN3H 4IRZL 2P24A 4XC3L 3PHQA 4PGZA 4DQOH 1MFEH 3SQOL 1FL5B 3S96A 3G6JB 5JUEL 1PYWA 3DMMC 4HX1B 2AJYH 3QQ3B 4LRIC 4U1JA 3TH2T 4OD2A 1BQHB 2IAMC 5INDA 3H7BB 2EDHA 1SMAA 3EBAA 2IG2H 3O8XD 5CFHA 1GZQA 2LAAA 3ORJA 5F7EL 3D25A 1H8NA 5E1AA 1NBQA 1RFDL 3RIFF 4YH6A 3WFEL 3GMMB 5DRXA 5JW5B 4KVCH 2C1OB 5E8EA 1NCUA 1FGNL 3FOLB 1OWWA 3OZ9H 5IVZA 3BGFB 5DUBA 4XHJD 1F4YL 5LWYH 5D7JB 3MFFA 3QUML 1NDGA 2V2WB 3B2VH 2E9IA 2N4IA 4HLZG 3H9SD 5TE6L 1U8LB 4C4KO 1IZJA 1I7UB 1NSNH 1BFOA 1J1PL 2HG5B 1AI1L 5D4QA 2ADJB 1MCWW 4BZ1H 3PNWB 1MHHB 3ILQD 2DI9A 1VFAA 3K4DA 3MCG1 2F19L 4PREA 2XTJC 2IANB 4QHNA 3C2SA 1MIML 4WNQB 4U31A 3QCVH 4D9RE 2X05A 2D7MA 5EIQA 2FSEB 1YPZF 4KUZH 4Q7DA 4E41E 4EN3B 2BNQE 3IXAA 2Y72A 1G7LA 1QRNE 2QQNL 3O41A 4YDLB 5DSCB 2J88H 3GSUA 4XXDA 2CLVA 4MMZC 1NLDH 1NBZB 1Z3GL 1Q9WA 1SJHA 3MNZA 3UTPE 4PB0H 4FQJL 4I0PA 3P4MB 2OP4L 3C87A 1MCDA 3NFNB 4WV1C 1S7TB 4NUJA 2J2ZA 1D9KB 3O3BA 4OF3A 2HFGL 4P2QE 4OIIL 2APBA 2IFFH 2X4RA 3MNVA 4G8IB 5KSVB 1U3HD 2VDLH 3H3BC 5TF0A 1OARL 1GGYA 5IBLC 4U0RC 5FO8B 1VADB 2GT9B 5FYJD 3LV3A 5E08H 5IOPB 1VERA 3RKDC 15C8L 3BDXA 4QXGH 5D2NA 4OGYH 4Z78B 1NCWL 5K9JH 3C2AL 4KTEH 3IRZA 4YZFE 1ADQA 1R3IL 1BEYH 5IVOA 5IVXB 2CJUH 3KYMA 4TTDC 1L7TH 5JNYA 3LS4L 4IOFC 5JZ7C 3NABL 1JWUA 1JN6B 3JTSA 1VA9A 5CCKL 2WV3A 4K7PH 3U4EB 1TQBB 4YNYA 1QSEE 1PSKH 2AJVH 1MWAH 2DIBA 3OKKA 4X4YA 4G6ML 4HK0B 4JAMB 1CLYH 1A1OA 2EEDA 5CSGA 1U58A 2KZ1B 3Q1SH 1BZ7B 4WFHE 1H15B 3HR6A 2Z91A 4G5ZH 5CJBA 4ZUWB 2M8XA 3TYFB 3QJFA 1MRCL 4LSQH 3UEZA 3EHBD 3H9HA 4FFVD 5GIRA 2X4TA 1VENA 1NLBH 1JYXA 3LEVH 4GS7C 4NRXA 4D0CB 5HHVL 2G9HA 3O45A 1KGCD 4QHUB 1RIVL 2Z8SA 4MMXC 3V0AC 2C4XA 4TVPL 2F8XC 3QUXA 4G7YH 1JCKA 2V17H 3QHFL 3CU1A 3IJSB 4KK6D 3QUYA 1FL6A 1K8DA 4FABL 1I9EA 3RIFK 3BD3A 3EJZD 2FJGA 2P7TB 2H32A 4PRHD 1BF8A 3ZTJG 1CLCA 1NCCH 4L3ED 1S8DB 1OCWH 3SDYL 2VLRB 4M8QA 1Y0LB 1OSPL 1UXSB 3V6ZA 3VGFA 1QG3A 4YDVB 1PEZA 3U9UA 1CI5A 3GK8H 4RFOH 4KTDH 3VGHA 3WIHA 5GGUB 3RI5F 1JWMA 2XACC 1YMHB 1YJDC 3GM8A 3MO1A 5GGQL 4OQTH 4NKQB 4ZQKA 3SGDH 5DTFB 4QHLB 4C4KT 1JPTH 1CFVL 3QZWB 1L0YA 4NJAL 4Q9RL 3QDGE 5E03A 4P5MB 1I8KB 4OUUB 5DHYB 3QI9C 1TVBA 4XB7A 5MEPB 4UIMB 4NZJA 4WIQA 1QSFB 2A6DB 3F7VA 4K71C 4Y8DC 4L8DB 2R2HA 3CNKA 4LQFL 2X4UA 2WQRA 3O11B 4LCIL 2F74A 3HE7A 4KUCF 5E2TH 4XP9H 1CD1B 5IW1B 1AQDA 1XGTA 2GSIA 5A3IC 1GVIA 1T2QH 3DUSB 1RK1A 2ADGA 1G9NC 5I15H 3U46A 1DVFA 1T22B 2V2TB 2QL1A 4HWNA 1S7UA 2NLJB 9CGTA 1B4JH 1LD9B 2H26B 1BBJB 4PJFF 3IF1B 1G0YR 1GHFL 5C0DB 2UWEA 1KB5A 4I3RL 5CGYD 5ACZA 1JPSH 3D0LA 1J8HD 3HE6A 3GI8L 3LN4A 2PTVA 2COQA 1X5LA 1FLRH 2MKLC 4UIKH 5J7CC 3KYOA 3RWIA 3RWCB 5CZVH 1N64L 4YBQD 1YNLH 3EYVA 2O5XL 5ERWA 4YDJB 2RFXB 4LOUD 3JSSA 3PGDA 4TRPH 1IZKA 5HHPA 3KPNA 4JZJA 2QR0B 3M17B 4PBXA 2EH7H 5CJ8A 4BZ2H 4GAJL 4TYUA 4NPYA 2DYPD 4GAYB 3ZHLA 4GBXC 3G6JF 5B38B 5D7SH 2HYMA 1TCRB 1JWSA 3T0DA 1UVQB 3K81A 3LZFL 4R4FL 3KG5A 4R4NC 5C2UB 5KVEL 2X9WA 4NWUL 2QADB 4RISH 1G7QB 2G2RA 2NY4C 3DVNA 1FAIL 3T2QA 3ARRA 2LVCA 2EZ0C 3SDDA 5EZJA 1FO0H 1Q94A 3QWQB 1BQUA 1YNKL 2F53D 4N1CA 3R06A 3VRIA 5DFVC 1P4IH 5HJ3B 4DW2L 4N8PA 2Q6WB 3F5WA 5ESAA 4TPRH 3SGJA 3KYNA 3MRGB 4PRDB 4LNRB 4X7TB 4OF0A 4AM0A 1FFRA 1EEYA 5GRWA 3QWRA 4QXTA 4HAFA 4IIQA 4MB4A 5KAQF 1N5AB 3S34H 4UQ2A 4NQEB 5TPWH 1MREH 3ULVD 3OHXA 2HJFB 4HZLB 2BNRB 4JG1H 4R8WL 3RKPA 1FC1A 1CGVA 1BVKA 3OF6D 3QEQE 5FM8A 2CDEA 2VLLA 1UWEH 3O2DA 4ZOCA 5HHOE 1YEKL 3X13A 1G6RL 2IQ9H 3KPRA 4WO4A 1HHJB 4PJ8C 5E0QA 1GC1H 1P1ZB 1Q1JL 5E95B 1C1EH 4LVNB 4ZXBD 1C16A 1I7RA 3GSOB 3OTTA 2GKIA 5F1IB 4G80B 2BVUA 4TNWK 5IW6A 4K7FA 2DL2A 4G43A 1KOAA 3EO1B 1YEEH 2NXYB 2WBJA 2NW3A 4KI5D 3FONB 4AIOA 1PQZA 3OKOB 1F90H 3GDBA 4MXWL 1NC4A 4P23C 3S35L 4QRSB 5D6CB 3BP7B 4E5XB 1OVZA 1B88A 1JGVH 3QHZL 4RX4D 3MC0A 2ZCLH 4G7VL 1BJ8A 2YPLD 4MXQC 4X9HA 5KVMC 1DN2A 5BRZA 3X12B 2XN9D 1KEML 1LO5B 2QSTA 5T33L 3OGOE 4JPKH 1N7MH 5ACMA 4H1LH 3V5DA 5DK3A 3NBNA 1UZ8B 2H6PB 5IVXF 4NQDE 1RZJH 2JKXA 1FVEB 1UGNA 4UBDC 5JOPD 1NFDB 3AS1A 3SKNB 5T1KB 4WI9A 1EXUA 4UDTA 5DYOA 1CGWA 1JPFA 5JW3H 3VWKC 3SDCA 3IFNL 4Z77B 4B53A 1EEQA 3KPSE 2IADB 3VJ6A 5ALCL 1A7NH 4HJ0D 4C83A 1NCAH 4FXKB 3DXAD 4OKVA 5IROA 1YEGH 5IB5A 3FB5A 3QXVA 3AREC 4O51A 1KLGA 5MI0B 5IJVA 1A6VH 5DI8B 1V3LA 5F89B 4JKPH 4L8CB 4JFYB 4PGBA 5C0FA 2ATPA 5C0CB 4PJDF 5F9OL 4APQC 3MRBB 2PXYD 4G8GB 3MMEB 5I1KL 4GW4A 3KJ4B 4HWEH 2D7PA 1K6QL 1RUPH 3EYFA 2VLKD 3TZVA 4E42A 4YUEL 3H2WA 4YHKH 3S6CA 1SVCP 2D0GA 5SWZD 2HKHL 2XQBL 1K5NB 3EYOB 3PP3K 2IGFH 3FB8B 4WEBL 4LK4A 1AKJB 1DUZB 4UT7L 4PGDB 3BISA 3QA3A 4XVTL 5IESH 3RVVD 3D69B 4C56A 2BOBB 4JY4B 3I2CL 4FMFA 2XPGA 4Z8FL 1YYLL 4JFOB 4N0FB 1G7JA 4M7KH 4LPCA 1G7MB 4NIKB 2AI0H 5DRWA 5CIPH 3ULUD 2GYSA 1HH9A 2X2YA 2OM5A 3MXWL 3VXRD 4JFFB 5IWLA 2P46B 3L5XL 4GSDH 1OGAB 3RIAF 1M71B 1T21A 4GXVL 4LLWB 1IBGL 3U7WH 1KPRB 3W0WD 3ARWA 1NJ9A 4HK3J 4PJHB 4NM4H 4CVXA 3FN0L 2XKNA 1AXTL 1U3YA 2F54A 2SEBA 4GG6B 1J1XL 2PW2B 5CD5C 3PGCB 3LKPA 1FZKA 4FFWD 1F3JA 4F7EB 3P0VL 1RULH 1CL7I 2UZIH 4WU5B 4WWKD 2W65B 3IU3A 4ERSH 2YD4A 4JKLA 5I2IB 3CVHB 4G9FE 3VXQA 3QQ9C 3PWUB 4JHWH 4KROB 1I8IB 2FX8H 5MENE 5F70A 1UWXH 3VFOB 3B5HA 5FYLD 1J0KA 2AEWA 2D7QA 3RTQA 3DBXB 5KSBA 2VXTH 3HG1D 4L3CB 4EI5B 5DJ8A 4EVNB 3RRQA 1K9TA 5HI5D 4K3DL 1AO7D 3BPLC 5IGXL 1CFQB 3GI9L 1HSBA 4XBEH 2OLDA 2X6MA 1JGDA 2OX5A 1BX2A 4ONHB 3MV7A 3HAEB 4BSJA 5E6ID 4LLQB 1KCVL 5F72S 4JY6B 4O2FA 4GQ9H 5B8CA 3K2MC 4NQCB 3V7MA 3WLBA 4EOWH 2X44D 3PQYE 1G9MC 2ESVA 3BKCH 4RDQF 4ODXA 5C9JB 1NGZB 5E5UB 5ID1A 3LPWA 2HWZH 3IDYB 3VXMB 3MLPA 4JZNB 3HS0B 1SMOA 5C86A 4LEXL 1P7QD 3KPMB 3REVA 2A9NL 1IAKA 2BERA 1DQMH 1B0WA 1CTNA 1M7XA 1ZE3C 2FEDD 4PR5A 3VG9C 3W2DL 3LQAL 5I75C 1KIQA 1MHEB 2W9LA 4M48L 3KJ6L 4F3FB 1MCOH 4NO2B 4Z7UB 2DLFH 4JM2B 5KOMC 2EYTA 4TVPE 2BSTB 5D5MA 5I66A 3C60B 3RX5A 4LGPB 2CDFB 4MNHB 3MBED 4JFEE 4D0DA 4PJGB 3U0PB 1NGYA 3QXUA 4D9QE 3TT3L 3O9WC 3STLA 3IDJA 4L4TD 2AQ2A 5KSUB 3QSKB 5DK2B 4X5WB 4H20L 3FMGH 4HKZA 1MFCL 2M26A 3HCVA 4EN3C 5E5MB 5LGHH 4HZAA 3OX8A 4HIHB 4GJTB 4I9WD 1YMME 4P46B 3VFWB 3VGGA 3GB7A 1CTOA 4G8EA 2P5WD 4LAJH 4PLKD 3UO1H 4U1LA 5JPMA 3VA2C 2X5PA 1LEIB 4EXPX 3Q6GH 4LLYA 3K4AA 3HI1B 2VH5H 2DDQH 4UOW0 1D9KC 4Z0BH 3RIAK 1E4WL 4BQ8A 5EBWB 5EOQH 5FO7A 3S35X 5DD0H 5GRVK 5DEFB 5GPRA 5DZLA 2QQKL 4XBGA 4P48A 5F6HI 4WFFD 3BIKA 4J2XA 2OR9L 4Z7VB 5BOZG 4ZO7A 4CRPA 4UDUB 5F7KC 3OKNB 4OCNC 3FQRB 5TQ0H 1P53A 4JQVA 3QUZD 3QIUB 4JY5L 5LKNA 3QULA 2XFXA 2I27N 4F7PB 3W9DA 5C70A 4FQQA 1EAPB 4ONFH 5ESVB 1AGEB 4AT6A 1DBBH 3U4BH 5IV2B 4PIRF 2JIXD 3HI5L 1KCUH 2YK1L 1N3NA 1JF5A 1NFDF 1Q9LB 1MF2L 3N85L 1F6FB 5HHNA 4L4VD 2XYCA 3NGBC 3ZT6A 3BE1L 3DX8B 3VFNB 3TP4A 5E2WL 3HNTH 4PRIB 2CIKB 5F7MC 4XX1E 2NY7H 4WJ5A 2AW2A 1D6EB 5B3JF 4JFPA 1D5XB 5L2JB 3F12A 3PL6D 2AJZB 4NZRH 1MFAL 1VGKA 2K1MA 1KNOB 5BMFH 2H2SD 1XF5A 1LNUA 2P24B 3RHWK 3T8XA 3PHQB 5HI3D 3IDMA 5T1LA 3IFPA 1D5ZA 1OGTA 3RU8H 3EJJX 3S96B 4PBWD 3V0WL 2YMXH 4GRMA 4MB3A 4K8RD 2YC1A 1I1AC 2H1PH 4U1JB 4AEHH 4P2RD 1WBZB 2YXMA 3FCTA 1OY3B 1GZQB 1MCHA 4Q9QL 5F7FA 4RGMB 4JZOB 4XVJH 2Y07L 3H0TA 5AWNL 4OCYL 5LAXA 5E1AB 2B2XH 4NCC1 2YUXA 3P0GB 5H8DA 5E8EB 5D1XC 2DLIA 3KPTA 4JGUA 2WBWB 4NN5C 3L95A 3BP5A 4PB9H 1MCEA 1YQVL 2XA8H 1R3KA 2AXGA 3G5ZB 3GSNH 3MFFB 2NY3C 1NDGB 1JF1B 5F6IC 5DXWA 5K9OB 4NZTL 5FYKD 1G7PA 3O2VH 3RUGE 1BFOB 3ZYJA 4XTRC 3DTXA 1G84A 1BZQK 3QFJB 4DKFL 4MCYA 5CBAA 1J5OL 3I75B 3RP1A 4JCMA 1II4E 4X9BA 3GMNA 3WKNA 1VFAB 4PREB 2JCCE 2Q3ZA 1A1NA 3ZL4L 4UNVA 5KANG 2CUMA 3H9SE 5E8DL 1MPAH 1ONQA 1A0QH 4FP8L 1WWAX 1U95A 1F4XL 4H1LG 4HQQH 3GJFA 3TT1H 4HC1A 1QFWL 1A14L 3IXAB 3D85A 2K7PA 4UMGA 4JPIA 1T3FA 2JJUA 1NANH 1G7LB 4C59B 5C0IA 3O41B 5E1HB 3ULUL 3GSUB 5E9DD 4PJHF 3NTCL 2CIIA 5DMGC 5J56B 1OLLA 3L1OL 2EDWA 4YIQA 1LO2H 1Q9WB 1SQ2N 3FT4B 4L29A 4GG6F 4JFXB 4DKEL 3P4OA 3CIQA 4POZC 2QHLA 3C09B 4NUJB 5GHWL 5KVGH 3VI4F 1WLHA 3MLRH 3K3QA 5DVLA 1FIGL 3MNVB 4H5SA 2OXHA 3B8YA 2D2OA 4KRPC 1VFMA 3E1F1 3FQXA 4PJ5B 5E00A 2Q7YB 5LCVH 5DD6B 3LV3B 2AXFA 1JIBA 1PZUB 2ZUQB 3UMTA 1ND0A 4PLJD 4I18A 5D2NB 5JTWA 1TZGH 3V5HA 1NKOA 3PP4L 4J12A 3WNMA 4X6DA 5GZOC 2X10A 3MROA 4J3VA 3FFDB 1W72A 2XTLA 2ZSWA 3EDDA 5DR5H 5EZLB 1DBAH 5JNYB 1S3KH 3JUYA 1HDMA 3BAEL 5FYJE 3PWPD 1FC2D 2MHAA 5FYLL 2W9EH 4YDKH 3QPXL 2FR4B 1T80A 2AJUL 1D5IH 3MV8D 1I3RA 5I9QB 5EFIB 3UX9B 4X4YB 5GGSY 1UA6H 1OP3K 2HMID 1JK8A 1QLEH 4XNXH 1A1OB 1RVFH 3BZFA 1U58B 1ZS8B 5BV7L 1U36A 3BIAX 5T1DL 1INEH 4X0KB 3UXFA 4P99A 1KELH 7FABL 4JKWA 1AY1L 3QJFB 4M9OA 2YA2A 3H9HB 1RZFL 5GIRB 2X4TB 3C8KA 3CD4A 3B8SA 5CEYB 4NRXB 2XNAA 1HIML 1T20A 3BEVA 1OP5K 2AK1L 4FFZH 2AV7A 1OAUH 1HHHA 5DJ0A 2VZTA 1FQ9C 1TETL 1FJ1B 3QUXB 4RAHA 4S2SA 5HD8D 4Z7UF 4JM2F 1FL6B 1K8DB 3IDXH 4KJWC 4U6VH 4BSWA 3U7YH 2OTWA 1JNJA 2FATH 4JQIL 5DUPL 3S3PA 2VRAA 4OFKA 5IP4A 4FN0A 5GXBB 1ZEAH 5KJRL 1KGCE 4L9LC 3CVIH 3BDYH 4ONOA 4PJGF 4M8QB 1SHMA 3EOAA 3CMOH 3STZA 4NNPH 3CH1A 1CS6A 1U42A 3NH7L 2FEEL 3V6ZB 5DFTA 2DB8A 5J12B 3G5VA 1JWMB 3DV4A 1JZ6A 2VKWA 4PRHE 3WDHA 4L3EE 4ZQKB 1EBPA 1KUMA 5GJTL 1M7DA 1S7RA 4DKAA 1MEXH 1WV7T 3G08A 3GMPA 3BOVA 3BRGC 2YEZA 3I3EA 3LB6C 1UM6L 4KRMB 1SY6L 2X4UB 2BFVH 2F74B 4K07A 1NEZA 4R0LC 3BZ4B 5TE7H 3V4PL 2ERJC 3SDXA 4IDJH 4B5EA 5J0BA 3NPZB 4X4MA 2HFEA 2VQTA 4P0DA 1KSRA 2ADGB 3O4LB 2E3VA 4Y5VA 3S88H 1QVOB 1S7UB 1LP9A 1ZA6A 3X3GH 1HHKA 3BUTA 1KCSH 2QKIA 5ACZB 3HE6B 5L9DL 3KLSA 2ZUVA 5CP7A 5D93B 3O8XC 1C5DA 3HNSH 3DI2B 4MJ5A 5JOFB 1QFWI 3KDMA 3VWJC 4MXVE 3KYOB 3SJVD 3RWIB 3FO2B 3N9GL 4LCCA 3GO1H 2HRPL 3QNZA 2OTUA 3OKMB 4R6UA 2VLJD 1RJYB 1IC4H 1EBAA 4U6YA 3PGDB 4M7LL 3CSGA 4XHJC 4BFIB 4NFBA 1FVDB 3KPNB 4JZJB 4RAUA 3UAJD 5BZDA 4U49A 2B1AH 4IRJA 5IM7A 4OLUL 2F9BT 3BD5A 8FABA 3D39A 4NPYB 3W39A 4WUKL 4QKXB 5F97E 5EU3A 3ILQC 4KPHL 2W92A 3ZZ1A 2AJXL 5HHXH 4PJEE 2VDNH 4BKLA 4QWWD 4CMMA 3BO8A 4LSRL 1YEJL 3F7RA 1MFBL 4M4RA 2A6JB 4K8RL 5C92A 1QR4A 5FDWB 3SE3C 4FNLH 3QH3B 5TDPA 5KSAD 5D1ZD 4PD4J 5EZJB 4MZ3A 1Q94B 2A6IB 1WCBA 4V1DD 4QHKJ 2BMKB 4YFLI 4B0MM 4ZFZA 4GH7B 2NXYD 2R4RL 5JQHC 3F5WB 3T0XA 5ESAB 5IHUH 3KYNB 3V9FA 5F21B 5J6HB 2BSED 1KN2H 4ZTPL 4AM0B 4F15B 1FDLH 4GRLA 2ICWA 1N8ZA 3NAAL 4IIQB 2F53E 1U3HC 1ZMYA 1AC6A 5GRYA 3RWFB 3NOIA 2I60H 3C08H 4DUXA 1RI8A 3WDIA 4ZNEA 1WIUA 4PLNC 4XC1L 2CDEB 2RHEA 1VPOH 1GYAA 3HLAA 5IUSA 4O9HL 1K3IA 4O02H 1I75A 3X13B 3H9YA 1V7ML 4JLRA 3KPRB 4WO4B 5J13C 3EUUA 4JN2A 4HXAL 1JVKA 3ULVE 3QFDA 1CFTB 1C16B 1I7RB 5DHVH 4Z95L 4YDIL 5CWSA 4MJ6A 5I8CA 2NW3B 4G43B 2WBJB 3EOBA 1JHTA 1TJGL 1QEWA 3THMH 1PQZB 2HAZA 1J0HA 3U36A 5CEXA 1OPGL 5HXMA 2EYRA 1CU4L 1IL1A 5T1KD 3BDBA 4XCYA 2VDPL 3FKUS 3L7FB 1UC6A 1C7TA 2FEEI 4P57A 1A1MA 5GS1C 4OZHA 4JR9H 5HHMB 2NW2A 1QNZL 2LABA 3MYJA 4LSUH 3WXWH 1FIEA 1RJZA 3MLWL 2B4CH 2IPTL 4PJBE 1T2XA 1BGXL 4K23H 4KJQD 1Y6KR 3BRDA 5EOCH 2YPLE 1YJDH 1M6OA 4RGNB 2Z92A 3B3IA 3WNLA 2XN9E 5J57B 4DN3L 5F7HA 4Y4FB 2ZUYA 3PUCA 1EZVY 1MFEL 3EJZC 2BOCA 5F9AC 2AJYL 2GTZB 1TJIH 4FQCH 5JHDD 3T77A 3TGXA 3GUTA 3DIFA 4UDTB 5DYOB 1JPFB 1TITA 3OWEA 5I76A 3QAZC 2P44B 4LCWD 3S8WA 3VJ6B 1I85A 5JOPE 1OT1A 5CHNB 2YOCA 3IETB 4PTUA 3IGAA 3IDYC 5A16B 5CJOL 1AKJD 1B9ZA 4H88L 4RWYL 2I9TB 1N6UA 5IB5B 3FB5B 2C1PA 3HUJA 3NCEB 2AV1B 4QRRA 3VDCA 5LWYL 5GJSL 4JM4H 5IJVB 1FNGB 3MRDA 4NM8H 4PGCB 1WAAE 4LGRB 1WFOA 1FPTL 5L8JB 1IM9A 3DXAE 4OGXL 1IE5A 4AY0A 5IMKA 5C0FB 3TBVA 5IF0A 1DLFH 2ATPB 4M43H 1GGCH 2PTUA 4BZ1L 3DVGB 1QBLL 4W4OA 3T4AA 5D7LA 1T66D 4HWBL 4HH9B 4FQLH 1WSST 2DOCA 4GW4B 4KHTH 1OGAD 1MY7A 3EYFB 3TZVB 4E42B 1WT5C 3QCVL 1UJ3B 4M7ZC 4L8SC 2FBJH 3I02B 4KUZL 4MA3A 1LILA 2ICEA 4MD0B 2ZSVA 4LPYA 1MI5A 4P3DA 2J88L 3QA3B 3QQNA 1NLDL 3U4AA 2CLZB 3OR6B 3BPNC 3CX5J 2VLKE 3NZHL 2YWZA 5CGYC 4D9LH 4PB0L 4PJ9D 3MJ7B 2XPGB 5CEZE 5EA0H 2XZQH 3WS6A 5I1CH 2Y5TA 4M5YH 3BKMH 1FCGA 5DRWB 1EMTH 2IFFL 4ELKB 2WINA 4YFLF 1T6VN 1HH9B 4YBQC 1QPPA 1UT9A 3BUYA 4HUMB 3QIBA 4LOUC 4ISVB 4JFDA 1D6VH 1ZVHA 5E08L 3T3MF 4QXGL 5K9JL 4OGYL 3KYKH 3ULUE 4KTEL 4ZAKD 3AY4A 1MAJA 2DKSA 1B2WH 2F54B 1IAMA 3JWDL 4TSBH 3WFBL 1BEYL 3GIVA 3EYUH 1FYTA 2YS4A 3VXRE 5HGBA 2CJUL 1H5BB 3QIUC 3CFDB 1TNMA 1L7TL 3LKPB 3MGTA 4M9PA 1RMFH 1VB9A 3CFCH 2Q8AH 3MGAA 1T83A 4NQCD 1G9EA 2C3XA 3W0WE 1Q9OA 3EYSH 2DTSA 3RZCB 3SE9L 5DURB 4PY8I 4NO0D 2P43B 5MERA 1PSKL 1MWAL 3GBNH 2Z8RA 4NOBA 1CLYL 5L2KA 4IOSD 2VXSH 1XMWA 1TDQA 3Q1SL 3LQAC 4FFYH 1EFXB 5EUKA 1EAJA 4LQ1A 1VGEH 5DJ8B 2F5AH 2JJSC 3IT8D 4PJAA 4HFUH 3SBWA 4Y19A 4RBPK 1PKQE 3CZJA 2CLRA 1HSBB 2KL6A 4OLXH 1FHGA 5DEZA 5FYLE 3FAXA 4MNQE 1TZIA 3ELAT 4O2FB 1W0VA 1ZWIA 3D0VB 4OFDA 2K9UA 4OFVA 2DM4A 3HG1E 1YECH 1IAIL 3MOAL 3VFUA 4URTB 1PEWA 4ODXB 4YHYB 1AE6H 1AO7E 1FRGH 1VEPA 2EDKA 1IM3A 5HY9A 4XGZA 1S7SA 2GHWB 4J3SA 3ARFB 2FHFA 3VG0L 5DJXB 3TN0A 1FORH 3REVB 4M4PA 5TDOB 4ZXBC 2HVJA 4RFOL 3OXSB 4KTDL 2ZWLT 4KI5C 1MJ7H 3P4NB 4PJCB 5B22A 1KIQB 4HUWB 4MQ7A 4G6AD 4BQ9A 1DLHA 1O7VA 3B5TA 3FQNB 2EYTB 1JPTL 2ICWJ 2R15A 2NY0D 1UQSA 3KNBB 4NKOB 5DWUH 5JLZA 5I66B 1KB9K 1CXKA 1X5YA 3DECA 5JXEA 1QQDB 1NGYB 2J8HA 4OFIA 5ACLA 1JPGB 2D4DA 3IXTB 4MNGE 4Y16C 4P5TD 4MJIA 2FX9H 3FQUB 4KQ3H 4HKZB 4TOYH 35C8L 5E2TL 3AS3A 4MZ2A 4OGAD 4XP9L 3HCVB 5DZOA 4HDIA 1P5UA 2RR3A 1SJEA 3OX8B 1U8PA 2R8SL 1T2QL 2HKFH 3BHBA 3GB7B 5FB8A 5FGCE 3E6HA 4L4TE 1ORQA 5C8JA 3B9KD 4U1LB 3MRJB 5JPMB 1PZ5A 1B4JL 3N50A 4FS0A 3QEHB 3ZDZF 1R24B 2DWEA 3PDDA 4HGWA 4OLYH 1JPSL 4I9WE 1Z5LA 4DOHE 2P5WE 4KAQH 3ECBA 3SE8H 1JP5A 4JDVA 4XBGB 2GJ6E 2FNBA 4HJ0C 3BIKB 1F5WA 4FXGA 5IJKC 5CZVL 5E6ZA 3P30L 3FRUA 1YNLL 4M7JH 2ATKA 4GXUM 1F3RB 4XT1C 3QULB 4Q74A 4XP6H 4TRPL 1JNHA 2XFXB 1N2RB 4FQQB 1SJXA 4WFFE 5DHXB 4UQ3B 4K3GA 5F1NA 3UBXI 4RFNB 2IALA 4W6YB 3QRFM 2EH7L 4BZ2L 3BQUA 3ZDYF 1N3NB 4PJXA 2Q8BH 3S7GA 1QBAA 3ZKQD 1JZ7A 3G9AB 1QBBA 4P2OA 4YLQT 1RHFA 2PW1A 5HHNB 5DEGB 5JOEA 5DS8A 2PXYC 2CH8A 3CJJA 4NKMA 5ABDE 3TPUA 2IQAA 5CILH 4ZUSA 32C2A 4NP4H 4WJ5B 4OIBA 1A6WH 4QYOA 4RMTA 2GCYA 3DMMA 4L4VE 4GMSH 4ZPVA 4LRIA 3TO2B 3BT2H 2V5RA 1WVZA 1AH1A 1B0GA 3U1SL 5LGJA 1LNUB 3RVVC 1BWWA 2ZOKB 3HMXA 3IDMB 3IFPB 1D5ZB 4HMDA 5BO1H 5JXAH 1OGTB 1P4IL 1A7OH 2O93L 4GRMB 4Y5XC 3Q6FA 4BK4A 1AD0B 5HVWA 1WBXA 3FCTB 4MSWB 3ZTNL 4HUKB 2OI9C 2ED7A 2W0FA 4MD5B 1GGIH 3ULUC 3SE4C 5CJ5A 1OAKH 4O2CA 3H0TB 3S34L 1VFBA 4I8DA 5KVDH 5FHBH 3ARSA 5LAXB 2J6EH 5MHSD 4P9HC 4JG1L 1CR9H 4P2RE 2IANE 3ISWA 4DUWA 3T1WA 4N9OB 3L95B 2R0WH 3WNKA 3DOSA 1R3KB 4XWGH 2AXGB 5C07A 1GH7A 2IQ9L 4HJGA 4FQXD 4WRLA 4I0PD 4XPGL 4CDGC 4OT1H 3REWA 1G7PB 1C1EL 4FFWC 3DNKA 1CWVA 5L7XL 2LV4A 3MA9H 1IAII 4MB5A 1I7TA 1HH6A 1YEEL 5A1AA 4WWKC 5CBAB 1SYVB 3A6BH 1QP1A 2N7AA 5C0JA 1ZKAA 3GMNB 5SX4H 1IC5H 1IGFH 2D03L 3EO9L 4HKBB 3DGGA 1G9MH 4DCQA 3RFZC 4WU7B 1JGVL 3QIWB 4LCYA 4OI8A 5FYKE 4AIZA 2RCSH 1ONQB 1E4XH 2ZCLL 1U95B 5CS7A 1AHWC 2MCPL 2PUQT 3VI3F 3D85B 4DUVA 1I7ZB 1T3FB 2EDXA 3VXUA 4WV1A 5E2UH 2CIIB 3IFOA 4HV8A 2BY2A 1N7ML 3RPIB 4YIQB 2FJFA 3SGDI 5HI5C 4M6AA 1T2JA 3P4OB 5HGHA 5BV7C 2NY6D 3D2UD 4X4XA 1RZJL 3TEUA 5E6IC 5C71A 1U8MA 5EIIB 4LVHB 4KI1A 4D0BA 1NPUA 5ISZA 5E9DE 4DEPB 1XGYH 1L9NA 4H0HB 1SBSH 1FO0B 2P8MB 5FKAA 1SBBA 1S9VB 1ZANH 3FQXB 4ZFOA 3UPRA 2OQJB 2WZPD 5HHQA 1A7RH 1WIOA 5E8NA 1ND0B 1N0LA 3SHSA 6CGTA 1VACA 4PJ7E 5SWQB 1T5WA 2PYFA 2EC8A 3BKJH 4X6DB 4YXHL 2G60H 3MROB 1DE4A 3K2UH 1A7NL 1UACH 1NCAL 1CDBA 5I0ZA 3G6DL 2EYSA 2FEDC 5F88A 1YEGL 2MHAB 4TNVK 2R0KH 5DQ9A 1LK2B 1RZGA 2VZUA 4XP4H 5FM4A 1U8JA 2D4FA 5EU6D 2CO7B 3QUYD 1UKQA 5F96H 1KIRB 2PYED 3LKQB 1RUKH 2DQGH 1A6VL 2Y9RT 4JKPL 2IBZX 5E94A 3MBEC 1TQCB 2NY2D 4ONGL 4EDWH 1NGXA 3PWPE 4HCRA 3OMZA 2R0ZH 2V7NA 3BGAA 4JG0H 3KXFD 5IMOA 4XC3H 3MV8E 3SQOH 4JRXD 3RDTA 4ZMAT 1RUPL 2P8LA 2EDJA 3C8KB 4XMKH 4PRNA 2VLRE 3U83A 4YHKL 3GIZL 2IEPA 4OFYA 4OD3H 1X5IA 1XIWB 2AV7B 3GBLA 1HHHB 4PLKC 5JIIA 5F7EH 3QUKA 2IGFL 4PJCF 3SKUD 5IMMA 2GJZA 4S2SB 1WBYA 1RFDH 4ZNCD 5IESL 3WFEH 1Q72L 2X7LB 4LHUD 4BSWB 3B83A 2I07B 5C0BB 3AGVA 4OZFH 5IB1A 4R7NA 5I1GH 4MDJA 3HE7D 4H1LB 3N1GC 3PWNB 2CXKA 3QUMH 2BVOB 3EOAB 3STZB 4M7KL 1KPUA 4HIIA 2AI0L 2OMNA 2AS5M 3FRPG 2DIAA 5FOJA 1AI1H 2EDRA 3G5VB 3V6BR 1DVFD 3DV4B 2ITDA 3QUZC 4RQQA 2LE9A 3QDJD 2P49B 3U7WL 3GFUA 5J9PA 5JMRA 5I30H 2R2EB 4NM4L 2GK0A 2D9QB 1MIMH 1RUML 2APWA 1RD6A 2WWMD 1ZLSH 1M7DB 5AG9A 1S7RB 1WTGT 4NC0B 4P3WA 2PF6A 3G08B 1BD2D 1QYGL 3GMOA 3GMPB 1RULL 3MRLA 5D71L 2UZIL 2P42B 3S3JA 5FFLA 1LGVA 1T0MB 4ERSL 3Q5TA 1AP2A 1PJ9A 3KVQA 4BQBA 1BZ9A 3X14B 3SDXB 3IU4H 3TA3B 4I3GA 3PL6C 4JHWL 2A83A 3OJ2C 2HFEB 4OIIH 4FZEH 2OJEB 2CMRH 5EO0A 3L5HA 3WV0A 2H2SC 3TJHD 5CSZB 4LLMB 1OARH 1YC7A 2VXTL 4MHHI 2CRYA 3CSYA 3HN3A 4RGNC 1ZLWK 1HHKB 3QWOA 4EJ1C 3WEXA 1D5BA 2QKIB 4K8RC 1BVLA 2XQYG 5J3HC 3CFJA 1OW0C 5KN5B 1V7NH 1NCWH 5CP7B 4XBEL 1JTPA 1H3WM 1YN6B 3KPPB 4MJ5B 1R3IH 5DD1H 2UY7A 1P2CB 4GQ9L 4YHLH 3KDMB 5DJ6A 4Y1AB 1U8QB 3SKOA 4P2CG 4LCCB 3OGCA 3AMLA 3SDDD 4F7MB 43CAB 3QNZB 3DURB 5C09D 3BKCL 1OQXA 4OM1H 1HNFA 2A74B 4U6YB 5CCKH 5ICYA 4OZIE 2N7BA 4GBXA 2B7DT 2HWZL 3BXNA 5BZDB 4OBRA 3FB7A 1FV1A 4IRJB 3T1FA 1U8HA 1H3XA 4Y4HA 1FNLA 1XGPA 1Z9SA 4A6YA 4NUGH 5CIPB 3W39B 2VLJE 3RVUD 1NCBH 4YBLB 3QWRD 3VXPA 3MPCA 1F8TH 1FFOA 4U7SA 5I73B 3SGKC 3OAZK 4P2QA 3T0VA 4BKLB 4HULB 3WLWD 2A1WH 3FOMB 2DLFL 2HRLA 5IEHA 3MCKA 1I8LC 5ALBH 1CK0L 5BS0A 4I3SL 4KMLB 4OGZA 1QO3A 3VFTB 1A3RH 4TVPH 4IMKC 3QHFH 2GIYA 1WCBB 1MSPA 2BNRE 3CFIC 5KVFH 5EC1B 1BWMA 3FMGL 1MCKA 3PGFH 3C6LC 4M02A 2WBJD 4Q0XL 4WI2A 2IPUK 4CU6A 1NC4D 3MJ9L 2J5LC 3SDYH 5ITBH 1YUHA 4U3CA 1OSPH 2WSKA 2HT4D 4EUPG 2HLAA 1MVUA 3RY5A 1X5FA 1O5DT 3UO1L 4V1DE 3BX7C 3AC0A 3JZ7A 3TWCH 2VZ3A 3Q6GL 4PJ8A 2VH5L 2YBRA 5EBGA 1IGYB 5BRZD 2DDQL 2VAAA 3VXOA 4ZD3H 5E5RB 3DX9A 4Z0BL 3BH9A 3TESA 4EDXA 4YR6A 1BFVH 1D5MA 5BQ7A 4PLJC 1XF4A 5EOQL 1VKXA 1P4LA 5DD0L 1T5XA 4JLRB 1BOGB 3BN3B 4JN2B 5BCAA 2Q87A 4P23A 1T7VA 1LWRA 4DZ8B 1JYVA 3QFDB 2YPVL 3V5KA 1JGUH 5I8CB 4PG9A 5TQ0L 1EVUA 3EOBB 4ZUVA 3WE6A 3L5WB 2MMXA 3T2NH 5CEXB 4WHDA 1H5BC 2HMIC 3FTGB 3HHRB 2GQHA 2OL3A 3AAZB 3U4BL 3IJYA 4XCYB 4OCWH 1HHGA 1CVRA 3SDCD 3DO7B 3RZCC 1ZVSA 4P57B 1A1MB 4AEEA 2VABA 5D7IE 4ODBD 1NFDE 4PV9A 1RJZB 4XRCA 5ICZA 4GUPA 4JB9H 3NN8B 4ZYKA 1ED3B 4P5KB 2ZG3A 3HNTL 1GHFH 4X6DF 2NY7L 5IMLB 3UDWC 4I5BA 1M6OB 4LPVA 5IIEA 1H9VA 2Z92B 3CFKA 3WFHB 4NZRL 4J23A 5B3JE 1CXIA 3FO9A 1P4BH 4GW5B 5TGBB 5HD8C 2K7QA 3VWKA 2UYLB 1XF2A 5T1MB 1N5YH 2YSSB 5INCB 3E3QE 2A0LD 3RU8L 2FIKA 2YMXL 3QDGA 2BOCB 4QRPA 4WGVB 4JVUA 2H1PL 4AEHL 3T77B 3DIFB 4M3JA 4HHAB 4PS4H 3ETBF 4U7MA 2MNUA 3SCMB 5C0CE 3M07A 3VRLF 4PTUB 3IGAB 3KS0H 3BWUC 1N4XH 4Q6IB 1QBMH 3OG4B 4TUOB 5JHDE 3LZFH 5DJDB 2C1PB 4C56D 3HUJB 1KG0A 2XA8L 4QRRB 1FSKB 5D7KD 5EDXA 4APQA 4LCWE 1ES0A 1KYOJ 4EUPA 3GSNL 5I17B 2X4QA 2XT1B 4E9LA 2K3TA 4NDMA 1BQHG 5IMKB 3TBVB 4TQEL 5IF0B 1BJ1H 3BH8B 3BMVA 4PD4K 1DFBH 3ZE0F 4GKNB 1P7KA 2C3VB 3JWDC 2AKRA 1RQ5A 1YEDA 3MXVH 2J7LA 1MPAL 1A0QL 3S5LG 4HQQL 3VD5A 3TT1L 2ICEB 3OPZL 1ZVYA 1TZHA 1G0XA 2ZSVB 1MI5B 3PWJA 2P5ED 1OGAE 4ESKA 1XGUA 1MLBB 1CL7H 4HKJA 4X9GA 3D3VB 4YHML 3H9ZA 4F37K 3U48A 5DURD 4QTHA 1F3DH 3ARXA 3JV5A 3W9EA 1G6RH 3GJFK 3KHOA 5KVGL 1F58L 2Y5TB 4IEFB 1GZPA 4PRBA 2DQTL 5GRZA 2IC2A 1M7IB 3BUYB 3SDXF 3RTQD 5LCVL 3DWTA 1K2DA 4MXWH 1CFNA 3UAJC 3T0EA 5AYQA 3NIGE 4PJFA 1DUYA 1TZGL 3QHZH 1FZMA 3VGBA 3R1GH 4G7VH 4Y2DA 5J1AB 1ZHLB 1FYTB 2IPKB 2LTQC 5FECB 3MV7D 4EIGB 3LSOA 1CDUA 3B2UD 1DBAL 5JIKA 1S3KL 3BPCB 3ARYA 4ZO9A 3HA0A 2J6EA 1Q9OB 4Y8AA 2W9EL 4Y4KA 3T2OA 1X7QA 2PR4H 4YDKL 5T33H 2ESVD 1D5IL 4QWWC 3VFMB 3KYAA 1E4KC 4OCXH 4WI7A 5MERB 4WCYL 3Q2CA 3GRWH 4CBPA 4OI7A 5C0GA 4XNXL 2NTFB 3GSNB 1RVFL 5FYJH 3TCXA 5L2KB 4UTAH 5KSAC 4NQCE 5D1ZC 2NPLX 3QISA 1TJHL 1DSFH 3QEQA 2VL4A 1EJ6A 1RUQH 2HH0L 5D70L 5HHOA 2EO9A 5FA3A 1X5AA 1KELL 2HFFB 2EEAA 2BHZA 1CN4A 5HDBF 1FL5A 1DJSA 4RMWA 4JFQA 3F6IA 4HX1A 5A40E 3HPLA 4Y19B 2BX5A 1BQHA 2CLRB 3TVMB 4OZFG 4FFZL 3IFNH 1GGTA 1OAUL 2FWOA 1W0VB 4QCIB 5I74C 1ZWIB 1JGLL 1RZKL 3GMMA 3VFUB 5JW5A 3IDXL 3S9DB 2C1OA 2FATL 2LU3A 3PJSB 3FOLA 1ZEAL 2CUIA 3QO1B 4UAOB 1IM3B 3CVIL 5HY9B 3BDYL 5D7JA 1S7SB 4YHOL 3CMOL 3LEYH 4NNPL 3TN0B 4PJGE 3TO4D 3O2WH 3ALPA 1U8LA 1QOKA 2YR3A 2R23A 1KENL 4LLVB 4MS8D 1KJ3H 3L3DA 4MQ7B 1WC7B 2NQCA 3EZ8A 4S11A 4UOJA 3O9WA 3VFSB 4I2XE 1DLHB 2CUHA 4WNQA 4YUEH 2O61A 4W68A 4F33A 3H6JA 1DDHA 3U30B 5EG6C 5IHZB 2FSEA 3NIFE 1MEXL 4EN3A 4KKBD 1UADC 1CVSC 2W91A 3A6CH 4RAVA 4O2EA 5J8OA 4UT7H 5DSCA 2WNGA 3NPSC 4XVTH 4W6WB 5DK0B 4MJIB 1AR2A 4KJQC 4U1GC 5KTEL 3MRCA 5TE7L 3I2CH 3MRMA 3UC0L 5IFJB 4RRPG 4IDJL 1FZOB 1YYLH 3NFNA 1S7TA 1VFUA 1U8PB 1D9KA 2AAVA 1HINH 3GMRB 3CLEL 5FB8B 3QO0A 4CNIB 4Z7VE 3D9AH 1ORQB 5C8JB 1AGBA 1GGBH 1PZ5B 3S88L 3MXWH 1FVCB 3L5XH 3X3GL 3P73B 2DWEB 4GXVH 4HGWB 3P2TA 1KCSL 1I1RA 5FO8A 1VADA 3PV7A 5IOPA 4XCEA 1Z5LB 3BESR 4LPXA 1SJVA 3BYYA 4Z7NE 3HNSL 4LDOB 4JDVB 5D6DC 1NAMH 1J1XH 5IVXA 5LJYH 4FXGB 1F4HA 3FRUB 4AENA 3P0VH 3DRQB 5LVEA 4WFHD 2APVA 4Z6AT 1JN6A 4HWUA 1IC4L 3SKJH 3WYRA 3PXHA 1OT2A 5T1LD 1JNHB 4F7TA 4KXZH 2B1AL 4HK0A 1I3VA 2IALB 4XNZC 3QNYA 1K4DB 3V95A 3BQUB 4PJXB 4R26L 4OLVH 1E6JH 4P2OB 1Z0NA 3O6FD 2PW1B 5CP3H 2HVKB 5DS8B 1T66C 3TYFA 1JV5A 5HHXL 2LU4A 3F8UB 4NKMB 5HGGS 3TPUB 5L0QC 2IQAB 3FJTA 1F2QA 1E27A 4D0CA 5IGXH 4WEMB 4HG4J 3FB6A 1JI1A 4FNLL 5F9JA 1KCVH 3DMMB 4ZPVB 5I16A 4X7DC 2IAMB 1B0GB 3HUJF 1ZT4A 3IJSA 5T5FH 3ZDXE 5H37H 4F80A 1ZAGA 3ARBD 2E27H 2EE9A 4PJDA 4PJ9C 2XZAH 5HDQH 5IHUL 2IBGA 1TPXC 3I3BA 1WBXB 3AM8A 1EHAA 2R4SH 5ILTH 5GGTH 5D1XA 5F71A 4HW6A 1UXSA 3KPQA 1FDLL 2A9NH 2P1YA 3F6LA 4JO4H 3ARZA 4O2CB 1VFBB 3IRPX 5GGUA 3SDAD 1YMHA 2I60L 5FM5M 3C08L 3LKOA 5AYUH 4JFHD 5C0EA 5HVFB 1RZJC 5GISH 2CPCA 4M48H 3KJ6H 1VPOL 2PNDA 4IMLB 1X5HA 3RA7H 4QHLA 4O02L 4ZAKC 5C07B 3UJTH 4HJGB 2C4FU 3BWAB 2MPAH 1W0WA 3REWB 5EUOA 4P5MA 1I8KA 4OUUA 5DHYA 1NCDH 3RWGA 4JFZL 3WIIL 5MEPA 1QSFA 2OCFD 2A6DA 3TCLB 5CJXC 4L8DA 5FUCC 3THML 5BJTB 1T03H 3O11A 2VLMD 1CD1A 5C08A 3ULVH 3DGGB 4DCQB 4LCYB 2V9RA 4AIZB 4CVWA 5F1OB 2DWDA 1ETZB 1S9WB 4FQ1L 4JR9L 4WV1B 4LSUL 1V3MA 3WXWL 2DBLH 2ORBH 1T89C 2NLJA 4DWHA 3TA3C 1K4CB 2B4CL 1LD9A 2H26A 3IFOB 1BBJA 4XCCH 1DTUA 1NAKH 4HV8B 4XX1G 2YD9A 2Z31D 4FQIH 4HLJA 3WJLC 2FJFB 5D2NE 1E4WH 5EOCL 3ZKSD 1YJDL 5HGHB 2HTLD 4ODHH 1FNSH 3DYMA 3MRIA 3OJMB 2QQKH 3T3PF 1U8MB 1TNNA 4D0BB 4NN7C 2VB5A 3IAQA 2UZYB 4G42B 4KMQA 3CPLB 3I6GA 4XNQA 4ZFOB 1W2KT 4ODVL 5HHQB 4U1IA 1TJIL 4FQCL 5E8NB 2QR0A 1IEAA 3K8LA 4JO2H 2WWKO 5ECJE 1E4JA 4ELMA 1JTOA 4J3OC 1QLFA 2FH8A 2R2BA 4GG8A 2CD0A 4GAYA 1EO8H 2NXZD 4NQTA 1MF2H 2NYYD 4NQVB 2EYSB 1QR1A 1HNGA 3VE0B 5F88B 4AH2B 2D31A 4MD4A 1UVQA 5DQ9B 3UTTB 2VDOL