4PCYA

Crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure analyses of reduced (CuI) poplar plastocyanin at six pH values.
pubmed doi rcsb
source organism Populus nigra
molecule tags Electron transport protein(cuproprotein)
molecule keywords PLASTOCYANIN
total genus 23
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1986-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4pcyA00
1GSKA 1FFTB 2HX9A 3PXLA 3QPKA 1T5KA 1E5ZA 3PPSA 4ENZA 4F2EA 1ASPA 2IDTA 1AZUA 1MZYA 3NP3A 3WI9A 2Q9OA 1A3ZA 4YSRA 3EH3B 2BP8A 1BXVA 1KBWA 2AFNA 3L45A 5EHFA 3WKQA 4EF3A 3NP4A 1OE2A 1TU2A 2IDUA 1PZAA 1ZDQA 1MZZA 1PLAA 3FU7A 2Q5BA 3AG2B 3X2QB 1AANA 2Y1AA 2GSMB 7PAZA 2BHFA 3FT0A 2VM4A 2J5WA 4A2DA 2VMJA 1NICA 2YAFA 2EINB 1PZCA 4W1TA 4JKNA 4BWWA 4E9XA 1SFDA 1CYWA 2CCWA 3HB3B 3S8GB 2HX7A 1BQ5A 4DP8X 4G7RB 2FT7A 3T6XA 1AOZA 4QKTA 1GY1A 2VW4A 1L9TA 2FWLB 3OM3B 2XUWA 4G71B 1SHWA 2YAQA 2XYBA 4NERA 1JZEA 8PAZA 1CURA 4NB7A 2DWTA 2J55A 2P80D 5I6OA 1VLXA 6PAZA 1AZCA 4FAAB 2ZOOA 4AX3A 3CDZB 2DYRB 4A67A 1V55B 4GP4B 3ABMB 1A4AA 1HAWA 2MRYA 4GP8B 2HZHA 2WSDA 1CUOA 4M4RB 1IUZA 1ILSA 4TXVB 1NIBA 1PLCA 3U25A 4BWUA 3H56A 2TSAA 4DP1X 4A68A 1W6LA 3ZDWA 3PLYA 3EH4B 1ID2A 3FSWA 4AKOA 3PCYA 2WO2B 1TEFA 3DKHA 3ASNB 3AW5A 1SF5A 1QHQA 1JOIA 3H4FA 3NJLA 4JHUA 4HIPA 5I6NA 4HALA 3X1BA 4YVUA 3BQVA 3ABKB 4W9ZA 3X1EA 2IH8A 2IWFA 1PMYA 1FA4A 2EIJB 1AS6A 1E67A 2I7SA 1L9PA 3JT2A 4E9VA 2WO3B 1JXDA 3ABGA 3KW7A 2UXGA 3PAUA 5D4IA 2FNWA 4AKPA 2IWEA 1J9RA 2QDVA 1HAUA 2FQGA 4DP0X 1UATA 1OCRB 3NJIA 2QDWA 4YSPA 1GW0A 2GHZA 4KNTA 3OQRA 4WKXA 1JVLA 1ADWA 5LDUA 2YAPA 3IEAA 2PPEA 2UX6A 1IBYA 2IDSA 5F7AA 3UAAA 1L9SA 4GY4A 1OCOB 3IN0A 3NJJA 3ZBMA 3X1FA 2EIKB 3FYIB 3NJKA 4PAZA 4BDVA 1BAWA 5I6PA 3WG7B 1E5YA 5TK2A 3TASA 1MG3C 3WNJA 4HCGA 5I26A 2BO0A 4YSEA 1ASOA 4DP6X 1GY2A 2CUAA 3T6VA 2PLTA 4A2HA 2R7EA 4BWTA 2UX7A 3FQ2A 2FQFA 2AANA 3FSZA 3NSDA 1N70A 1NIEA 1MG2C 2DY2A 2LLNA 5PAZA 4CSZA 5I6LA 3V9CA 3FSAA 2HLEB 3CVCA 2CAKA 2OCCB 4PCYA 1RZQA 4CSPA 5A7EA 1NPJA 1XB8A 4RH4A 5B1JC 2GI0A 1TEGA 4F2FA 4M3HA 2J57A 3QJVB 1KCWA 1KCBA 3T6ZA 4N4YB 1ILUA 2MTAA 1L9QA 2H3XC 2W88A 5TK4A 5AFAA 9PCYA 3EHBB 1TKWA 3JTBA 2AVFA 4E9TA 2VSKB 2XX1A 4QLWA 3KW8A 5I6KA 1SHXA 2QPEB 2VN3A 1ETJA 3QJUB 4P5RA 4YSSA 3PAVA 3NJHA 1CYXA 2XXFA 2OV0A 5B7EA 2I85A 1KGYE 3ABLB 2GBAA 1IKOP 1SJMA 2BWIA 1OV8A 2X88A 1SNRA 2EIMB 4ZK8A 3WNIA 1JZHA 1GS8A 2I7OA 4KO9A 5B1KA 3FYEB 2FTAA 4YSQA 4P5SA 1EHKB 4N8UA 2IH9A 5PCYA 2JFCA 5D4JA 2DV6A 3NT0A 1QNIA 1DYZA 1JERA 2Y69B 3FPXA 1KV7A 1KYAA 1WS8A 1RCYA 2YXVA 5B1JA 2VM3A 1WA2X 2QT6A 3FU9A 1KBVA 4GXFA 3NJGA 4DP5X 1ET8A 5B7FA 2YQBA 1M56B 1YLBB 2NRDA 2PP8A 2FQEA 4E9QA 2PPCA 4HAKA 5B7MA 2HRGA 2XWZA 3ZIYA 1A4CA 4YSTA 2UXVA 3UABA 2CJ3A 2XX0A 4GYBA 1OE3A 2YAMA 4FA7B 1BXAA 1B3IA 3MX0B 4YVNA 1NPNA 1AACA 2E86A 4NAJA 4KOCA 3DTUB 1OCZB 1NWOA 3V9EA 2AZUA 1AS7A 1W6WA 2PPAA 3TBBA 5I6MA 2IAAC 2IDQA 1AIZA 2VW6A 4G72B 2N0MA 2XV3A 3TBCA 1ASQA 1NIFA 1F56A 5F7BA 1AG6A 1IC0A 1XB3A 2BW4A 4UAHA 3DIVA 1PCSA 3D12B 2PP9A 4MFHA 4A2FA 3IN2A 1X9UA 5I5JA 1AAJA 4WTQA 4DP4X 4L0PB 4KOBA 2VSMB 1MDAA 3N2JA 2HXAA 2BZCA 1NTDA 1E30A 4G70B 3AY2A 1V54B 4YSDA 1GR7A 5E9NA 1KDJA 3WIAA 3NSCA 1J9SA 4Q89A 4KO5A 4E9SA 3FU7B 3SBQA 4DP9X 1BXUA 4Q8BA 2X87A 3FQ1A 4KO6A 1WA1X 2XV2A 2TSBA 4HHGA 4YSAA 4KNUA 4YSCA 1JXFA 2FQDA 3RYMA 4HZ1A 1JXGA 2FT8A 1SFHA 2PP7A 3NJNA 3AG3B 2JKWA 2PPFA 2R7EB 1JZJA 3TU6A 3X1NA 2GIMA 2XXGA 4AI7A 3MBWB 3EF4A 1L9OA 1GYCA 4YSOA 2GC4C 1FWXA 5IY5B 3NSFA 1JZFA 4BDVB 4BK5C 4JHVA 5AZUA 2IDFA 2BP0B 2H47C 2JXMA 1JVOA 1X9RA 1W8EA 2XU9A 5I5IA 2DYSB 1L9RA 4GP5B 4E9YA 2YARA 2YXWA 1SDDB 1N68A 1A4BA 4HCIA 1ZPUA 1RZPA 1OF0A 2YAEA 1XB6A 2HX8A 2W8CA 4E9RA 1OCCB 3NJMA 5D4HA 1J9QA 4KO7A 3SBRA 3FQYA 2PCFA 6PCYA 5FC9A 1ZIBA 1SDDA 2IWKA 3OMIB 4A66A 3X1GA 1AQ8A 3AG1B 1KDIA 1OOWA 2BP0A 3BVDB 1NIAA 1URIA 2FT6A 1PNCA 1ZV2A 3S3CB 1ZDSA 1GS7A 4HCFA 1AZNA 4G7SB 4DP2X 3N55A 2XVBA 2DWSA 3H4HA 5B1AB 3FU8A 2J56A 4AKQA 4DPAX 1HFUA 1GS6X 1M57B 3GDCA 4BXVA 4A2GA 2HRHA 3WKPA 4YSUA 2BZ7A 1ET5A 3IE9A 2XLLA 5B3SB 3NYKA 3FSVA 4DPCX 4DP7X 3CG8A 3HEIB 1ET7A 4KNSA 5B1BB 1EZLA 2BP8B 3IBOA 3QJRB 4UANA 3SQRA 1NWPA 2BW5A 5AKRA 2GC7C 3CVBA 3AG4B 3OMAB 2B08A 1NZRA 3S3BB 4BXSV 3S8FB 1PAZA 3CDZA 2FJSA 2AZAA 3C75A 3CZUB 4X4KA 1PF3A 3GXUB 1PY0A 4HHWA 4F7KA 4A2EA 2P80A 3G5WA 1PZBA 1WA0X 2ZXWB 4YL4A 3AZUA 5I28A 2B3IA 2VW7A 1BQKA 1BQRA 3ASOB 1AR1B 2UXTA 1E65A 2CBPA 1RKRA 2YAOA 3ZX1A 3ERXA 3GYRA 3UADA 2RACA 3OMNB 2OJ1A 3PAZA 1ZIAA 5I5MA 1J5DA 3NJFA 2ZONA 1PLBA 1BYOA 1J5CA 3UAEA 3QJQB 1AZBA 1J9TA 2A3TA 1A8ZA 1V10A 1R1CA 3QJSB 2QPDB 2EILB 4UF7C 1AZRA 3QQXA 2YAHA 1M9WA 2GB2A 3EH5B 4E9WA 3CVDA 1IBZA 1JZIA 3S3DB 1I53A 3T9WA 1WS7A 1QLEB 2UXFA 3NSYA 1JZGA 4G7QB 2PCYA 4K9JA 4AZUA 3SBPA 1BEXA 2BWDA 2XV0A 4DPBX 7PCYA 2ZWNA 1NDTA 3OD3A 3QJTB 1SF3A 3FPYA 1NINA 1XMEB 1AG0A 1OE1A 2CALA 1AS8A 1CC3A 2H5UA 3T71A 5ANHA 2PPDA 1NIDA 1PNDA 1A65A 3FS9A 3TA4D 3UGEA 3UACA 1WAEA 1DZ0A 3T6WA 1BYPA
chains in the Genus database with same CATH superfamily
3EH2A 1FFTB 1SBSL 3MRGB 4TVPD 3PXLA 2X09A 4F7MB 4B41A 1E8YA 2NUTB 2FECI 2IDTA 5CSGA 3MO1A 4ZTOL 1YEFL 2VRAA 2VXUL 2G3MA 1S6NA 2C7UA 3L4YA 3DURA 5FM5O 4DUXA 4TUKL 3L45A 1BXVA 1YN7A 5G5DB 1JK9B 4EF3A 4CUCA 4LB8A 5MI0C 2XTJC 1NGZB 1CDIA 5AVRB 3QZPA 4YIQB 1FO0L 5CBAB 1I1AC 5L4MA 5ALBH 3MJ8A 4P49A 1UH3A 1BVOA 3VJ6B 1WD8A 3ENEA 4KI5C 3HG2A 2B4CH 4GB9A 2MOQA 3RVUC 3GSNL 2BHFA 4BQBA 4BZ2A 4J4PD 5J6HB 2ZF8A 1YQVH 4Z7VA 1B4TA 5KUKA 2EINB 4EKJA 1KPUA 1H15B 4BWWA 3IDIA 1RZKL 1GYVA 3FN3A 5KYXA 1JNLH 3BFOA 5C0BD 1AOZA 4LVOB 4PJ5B 1DBKL 3ECBB 1UXWA 1FZOB 1MOEA 1NCTA 3VD2A 4IRJB 2XYBA 1XF3B 1JGLL 3B9KD 4HW6A 1A9BA 4CW1B 3RIFF 3S8WA 1B0WA 2I24N 3S48A 5EU4B 1JUFB 1G9NC 4WI5A 1JZ2A 3SGEI 4RDBA 3UBXA 5CCKL 3NFNB 4LPCA 3ROLB 4HAGA 5J13C 2JMRA 2VITB 3L3IB 4RRPM 3HRZC 4QT5A 5DVKA 4LL9A 4UQ3B 4N20A 3O6KH 1AR2A 4V1DD 5D7LB 5L7XH 4Y4FB 1S7WB 1DQJA 3S96B 5INCA 2I9TB 4DKFL 2DQHH 4RZCA 4TPRH 3P11L 2EVJA 2W07B 3RNQB 2WKLA 4KH2A 4XAKD 4MCYA 1AXIB 2CBQA 4G9FE 4N2KA 1QQDA 1BFOA 2P24A 3GMRA 2CZNA 4AKOA 2P52A 1MHHA 3L1OL 5D7SH 4L9LC 5LCVL 3QDHA 1G7PA 1I3RB 1TPXB 4ZMXA 2OJZL 3M88A 4ZQKB 4E68A 1OWWA 2FD6H 1T5WB 1QP1A 1KJVB 3B37A 5D5MA 1YO4A 4GSRA 4FLQA 3DA0A 5IK3A 3S88L 3OKOA 3FTVA 3MACH 4HU8A 3QC5X 2V17L 3QUHA 4F37F 2VN5A 4I0PA 4K8RD 3DOSA 4G6AC 4L8DA 5TH2A 5I0WA 2NX5B 2VCOA 1J8HE 1Y0LB 5DCCA 1A6WL 1Z9LA 2BVOB 5IEKB 4PJEF 4C58B 4IRZH 1B0RA 1KG0A 4L9LB 1T04B 3ABZA 3BJ91 5GIRB 3NMEA 4B5ZA 1IEAB 1S9XA 3MXVH 4HIEB 5B8CB 2J43A 2YZ1A 5IHUL 4ODVH 3B7SA 2NCMA 3G6DL 5I2IB 3EG9A 3MCLH 2YAPA 1HXYB 2PPEA 3L6FA 4GQ9L 4R3SB 3T1WA 4GY4A 3IN0A 4UM8A 1JD9A 1IARB 1FZOA 1RURH 2NXYD 3X1FA 3EYFA 2EE0A 2QKSA 1MH5A 2ED8A 4Y2DD 1ROCA 4QXGL 5C09D 3BAIA 4PN6A 2KKQA 3L3GB 3TASA 1ZEAL 1MG3C 3QH3B 4LKXB 3BWUF 4EI6A 1BAFL 4BGDA 1AR1D 1KXQA 3DPBB 3ATBA 3DHUA 1DVFC 1TQSA 4FA8A 3W0WE 1ASOA 1UASA 2A83B 4X6FB 3DV4B 2EUZA 3RWJA 4E41A 2W9EL 1AGFB 3DVFA 4A2HA 2EXYD 1TKWB 2GW5A 2VN7A 4Z78A 1T1XB 4FNSA 4HF5H 3F7RA 2EH8H 4X5PA 4JFDB 5T1KA 3LKRB 4PJ5E 2LLNA 3FTGB 3UG4A 1QSFB 3L16A 1AZVA 3D50A 5TGBA 5DUBA 3V9CA 3X11A 5C0CB 3CXFA 1OK8A 1R5WA 3HBPA 3QC6X 3QI9B 4MSWA 4P2QB 4BFBD 4QRRE 1PJWA 1NPJA 3APDA 3MMEB 4HU2A 4GO9A 4H7VA 3DDGA 2VDRB 3I2CL 1BREA 4PTTB 2Z34A 3T3MF 3MGTB 1H3UA 3SY0A 1ZGLB 1EEUA 1HX0A 3FFCE 4NKQB 4HWZB 5E00B 1KCRL 3L9RA 1E2VA 1TKWA 3HE6C 3RTQA 4Y7MA 1NEZG 1JNNL 4RMQA 5KVEH 3QFDA 1PDKB 4WI4A 4NQCD 3FCTB 5CJXC 3NK4A 4P23C 1MCJA 1UZ8A 2WAQA 3NAAH 3TURA 5I76A 3BRGC 3KPSB 2JCWA 2Y7MA 5MEOB 3L3HB 3NEXA 4R5VA 4JMXA 2EXTA 5EIVA 3VXPB 5L7XL 1KGYE 1F1DA 1RZ8A 1WIOA 3FUIA 5CD5C 2F2HA 4OT1L 3HN5A 1A1OA 4TPRL 2FGWL 5F7MC 4P3WA 2I7OA 4P5SA 1U2CA 2AAAA 1M7DA 2ILLA 2JFCA 5D4JA 2MWCA 2P3YA 5JNYB 1R24A 1FH5L 3PJNA 4G1MA 3DI2B 3WFDH 4MJ6B 4M6ML 1IGTB 3FT2B 5C0DB 3VXPA 2VXUH 5T3XH 1NAMB 2XWXA 3FUKA 4AT6A 3WXWL 3BT2H 3K46A 3UTTA 1UWYA 2YQBA 4AWJC 3O3DA 4EI6B 1ZGLP 2Y2YA 2V5TA 1BLIA 4S10A 2R59A 4I87A 3UIYA 4PPTA 5ICZB 1GL4B 2Z9TA 4RMBA 2XN9B 4KRPB 2F5AH 4C54A 3IKKA 3C60D 4NN7B 2XX0A 1LO4H 4Q74A 2ZAIA 2YAMA 2EDXA 1TTFA 4XP6H 3PGCB 3U4AA 4JDTH 3RI5K 3GZQA 4DGWC 1R5WB 4P2QA 1DBBL 2X89A 3E6HB 4LARH 5E6IA 3W11C 1M71A 1KJ2H 1QD0A 3NIFE 4YN3A 2F1AA 2CKBB 2F74B 3QORC 4GAGH 3QRGL 4N25A 3L3KA 4I2XE 5CUSH 3UBXB 3DC0A 3WTUA 4G72B 1X7TA 2DYPB 2WCGA 2TRYA 3EJYD 4JPIB 4G6MH 2P7TA 1G6RB 5KTEL 4AGLA 2R0WH 3NZSA 1C16B 1OGAE 5F7BA 1AG6A 1QFWL 3SE3C 4J12A 3UJIH 3VXTA 5LG6A 3D12B 3HS0A 3S37X 4MFHA 1E5UI 5DRZA 5CWSA 3RGHA 5I5JA 1J0HA 3WS6C 4DWHA 5JHDD 1USQA 5D1XE 5MEPA 1B2YA 4Q6IA 5TD4A 5IJBC 3MRLA 1QPKA 4FKEA 1XQ4A 4MAYA 5J1TC 2NNRA 3D69A 2JQAA 4PJ9D 3FB6B 2DLGA 4O51A 2G9KA 5D96C 3BZEB 3AFLA 1M7IB 5GS0H 4W6YB 3VWJD 5DD5L 1WWAX 4GW4A 5LCVH 1MREH 3SPVB 2CDEB 3KE0A 3RNQA 2LFEA 1QW9A 2P42B 2VLJA 2X87A 1LEKB 1MFAH 4HHGA 4OZIA 3KYNA 4UIMB 1JGUH 3NUKA 3FXIC 1MCOL 4BZYA 2BSEA 3UC0L 3NDZE 4ADIA 5BQ7A 1UT9A 1N10A 1K6QH 2DW5A 2A6KA 3V4UL 4F7MA 5IOPB 1P0SE 2J8UB 2H6UA 1DQDH 2VXQL 4WI0A 4KRLB 4D9RD 2VR8A 2GSIA 2V7HB 2YS4A 4PRIA 3GXDA 4PRPB 1IO4C 1LO2H 3IXAB 4FHJA 1RUAH 1JZFA 2KDGA 4AIZA 3U2IA 5DJYA 3FTZA 4KXCA 2YC1B 4BQ9A 2YHGA 2EH7H 2XZQL 4HLEA 1IFHH 4KK5D 2XDHA 2EABA 2IPUG 4JDVB 5DJXA 3TNNB 1UWEH 5GXBB 2D9QB 4JFVA 1FZJB 1F1AA 2W8CA 2WQVA 3HZYB 4MHHI 3WO4C 3DYOA 5F1IA 2HP4A 3UGXA 1UM5L 3QUYD 1E9QB 3TIEA 3VWJA 4KHXL 1CGYA 2TRHA 4X4ZA 4GG6F 1OTUC 2R0KL 2UWEA 1WBYA 4K3JH 2HYMA 1XF3A 4QRQB 4N1EA 2XETA 3N40P 3VGEA 4GIOA 1U9KA 1U8LB 1CVRA 4WDIB 1M7UA 5JIMA 4XP5L 2A73B 3VXSD 4D0CA 4PP2A 5MENB 2EDOA 2GEQA 3WKNA 5JHDA 2A74C 1XCQB 2W0FA 5E8NA 1CK0L 4NIKB 4BH8B 4N2IA 1CYGA 2WXLA 4IEFA 3MCG1 4M5TA 2H0PA 3VMPA 2C1PB 3ECQA 4MNQB 4JRXA 3VH8B 4AKQA 1AR1C 1HK6A 2ATKB 3WIHH 1ET5A 4JQIA 3GI9H 1U92B 2ZG1A 1PU0A 5D1XB 2IGTA 3IDJA 4Z7QF 1SOXA 3CG8A 5KJ7E 4ONHA 2NXZC 3ECVA 4FFYH 1EZLA 3E6FA 5IM7B 3OJ2C 3QIWA 2B0SL 1MCHA 5IHZB 1NWPA 3K7UA 3WEOA 3ARQA 4EIBA 2GC7C 2HG5B 2VMEA 2VISB 4GIAA 4S1QH 3V6OE 4ZMVA 4PCKA 4XNAA 4KVPA 3C6EA 1C1EL 1LK3L 1WV7T 5ELIA 2H32B 4FULA 1KCSH 1Z2KA 3N04A 1M2OA 3U4EA 3VYOA 4ZFGL 4ZOBA 2NR6C 2CO6A 2I26N 1WAAF 3G6JE 5B3JE 4MNGB 4J2XA 4JG0L 4DO6A 2BY2A 3O45A 1JGVL 4TUOA 2HWZH 5H35B 5C07D 5I71B 4I48A 1F4XL 2GUYA 1VERA 4R4ND 2NYYC 2WTRA 1PLBA 2X2JA 3EG9B 1QNZL 4JGJA 2Z31D 3UAEA 5BOJA 5I2IA 1TTAA 2VAAB 4XBEL 3GUTB 5DRWA 1F8TL 3W39B 4EJ1C 3PABA 4U6XA 3QJSB 3PL6B 5E9DD 1NLBH 2APFA 1FLTX 2NSXA 4IKKA 5DZVA 4LBEA 1FGNH 2IMNA 1YEHL 2OMUB 2VQ1B 2ATPA 5GISH 1JI2A 3O3AA 1JDAA 2DMHA 4JLRA 2VKWA 1WCBB 4UQAA 5ETUA 4DJMA 2ALWA 2COQA 3B2VH 1R3HB 2E9BA 4ABVA 3B6SB 5F7UA 2WW8A 4PYGA 3BEVA 3L4VA 3MQIA 3DGDA 4JZJC 1DFBL 3L1EA 1TZAA 2BHUA 4PGCB 2MHAB 3QUZA 4R90L 5FUZL 4XBGA 3HHMA 4N2MA 1CK0H 3LOWA 5D1XD 5A2JH 3TESA 1KPRB 3ULVD 5HYQB 3L5XH 4IKLA 3HBGA 4MB5A 4BEIA 3EUUA 1WSST 1F11B 5IJVB 1NIDA 1PNDA 1MJJA 1P84J 1UWEL 2ROXA 3W1ZA 4JKWA 1ULVA 4MNQD 1GJIA 3BE1H 3T6WA 3EYUL 4IMKA 3BWUC 5SWZB 3BHBA 3PGDA 1GSKA 4XPAH 3JV5A 4IRJC 2BCKB 3EW3B 2DQJL 3PGFH 1EO8H 3JUYA 3QPKA 1YEJL 4L4TA 4ACTA 4KHXH 4F15C 4ENZA 1NFDA 5EN3A 4GUPB 3FU3A 4QGTA 1Q1JH 4KZEL 1EJ8A 4RAVA 2X4UA 3ZHKA 3EH3B 5FLVA 4KQ0A 3FT4B 4I8DA 1KN2L 4DK5A 5E7BA 1A9EA 4J6RL 4NC1E 4MJIE 2CO7A 3WNLA 3TN0D 1MZZA 3C6SA 2WJ5A 4FNQA 4M62H 4HPHA 3IWVA 4PV8B 3VFMA 3KPLA 2Q5BA 3FBKA 3MV8D 1J5OL 3IS0X 3BQUB 2IG2H 1QX1A 3VNZA 3EYQD 4HJ0D 3BSGA 3N44F 1E4KA 2HT2D 2BNQA 3MVSA 2P1YA 4PVNA 1ERNA 4YDIL 4QRPE 3GDBA 1S7TB 1D5XA 5HI5D 3TCXA 1G7JB 2J5LC 1UC6A 3DMMC 3ZL1A 5I1HH 1EBPA 1KJMB 2HKFH 5C0JA 5EEWA 3WAKA 3F84A 2NNAB 4M93C 1SHWA 3GIVB 4HKXB 4XCFL 1B0GA 4MNGE 2GJZA 1KEGL 5F72S 1JWSA 5HDBF 4FNUA 1IAII 4X6DA 5EU6A 3VYPA 5E08H 3CDZB 1ACCA 4L4VB 1HOCB 3QO1B 1DUZA 3H85A 4HETA 5FA3A 2FGZA 2MIZA 2C3XA 5AVVB 4P4RB 1MWAB 4GPVA 5EO9A 2OP4H 4PJFB 5CIPA 1IUZA 3NZ8B 4JPKL 4RGNC 4DHLA 3BH4A 2B59B 3GSNB 2DMCA 1AXTL 3PIQA 4K94C 4I0PD 4Z7UF 5E5LA 3UEZA 5ACZA 5I1IH 4S1RH 1Q9OB 2ZCLH 2WOBA 1CB4A 4FERA 1ZK9A 1MLBB 3PLYA 1U8HB 3T3PF 1ES0B 3C5JB 2IALA 4MDIB 4FHKA 2YBRB 4M7LH 4BFKA 4K8RC 1W80A 1NCJA 2HMID 4UU9B 4MQ7A 2NY5C 1GGCH 1D6EA 1QZ1A 1KTKE 2WNGA 2YQ3A 3H9HB 4JG9A 4MJ5A 4N2HA 3KH3A 4W9ZA 4PJHA 1B0IA 4BCXA 2QKIC 4RGNB 1KELH 5J5EA 3NSJA 3BX7C 3DX8A 2ZSWB 4GW5A 2A9DA 4B6ZA 2UYLA 2VR6A 2Z7WA 4Q9QH 4EI5A 2X0VA 4GG6B 1WAAE 2XCMC 4JFHE 1UXSA 4JY4B 4A6YL 5HD8C 2QDVA 4DP0X 4N0UA 2JB6B 4F8TA 4BELD 1RZIA 3B56A 4UB0H 5IFJA 4Z7WF 3BO8B 4AE1A 1BYNA 1JFQL 2QDWA 4ZSOA 3WEXA 3CSTA 2B3RA 1QWUA 2XT1B 3OQRA 2GEEA 3VO0A 1M53A 2EIDA 3OXRB 4MDJB 1YNTA 4HWNA 4P5KA 4JM2D 4R0LA 4WW1A 5ESQA 5EWIH 1FUNA 1G9NL 3QEQE 5C0JB 1O5PA 4WCYH 1ZT1A 3FYIB 3QIUA 1MNUH 2IH1A 2ZOKA 4APQC 4MX7A 5FGRA 5E94A 1NANI 5JZ7D 2XWBB 2WQWA 3B9KC 3FUEA 3D18A 3WNJA 4MHHG 1Z6JT 4JG5A 2VDNL 1A6PA 3FO9B 4DP6X 4FG4A 1E28B 4JFWA 3ARSA 2IO5A 3NCYP 1Z0NA 4LCCA 4NO2A 1UURA 3ARGD 4I3RL 4AEIH 2BHZA 3LDBC 2P4AB 3STZA 2K1MA 3VRLE 3OGCB 4X7SH 1QFWI 2A6JA 3ROOA 3H3PL 3WJMB 3Q05A 3T2LA 4MMXC 5JIIA 1KCWA 1I9EA 2YSSA 3DARA 4MCZA 3VE0B 1K6QL 4LEEA 1CICB 1XGYH 4LSUL 2DLTA 4JGMA 1DVYA 2CLZB 3L9YA 3G6AB 5HYJB 2X1PA 4FDWA 1H3PL 3SDXA 2I5YH 3SE6A 4LQFH 4QOKB 4BJLA 1J88A 2XQ0A 4BSJA 1CGVA 4XN2A 2XC8A 4FQXB 4GG8A 5D2NE 5LKNA 5DFAA 5D5MF 2DQEH 2CGRL 3RQ3A 5E5UB 3NIGE 4CDHA 4EUPG 4Q9QL 1OGSA 2BWIA 4TNVK 1OV8A 2VT0A 4MJ6A 4ZK8A 2CK0H 3MXWL 3CFTA 2ZNXA 2VDNH 2E46A 1QR1B 1WCBA 2EDEA 3O6LH 3UCRA 3V7AE 1MWAH 4MA1B 2X38A 1KIPA 5C0NC 1R17A 1HDMA 3C8HA 4TM9A 3OPUA 5E5MA 4ZAKD 1RZ7H 3REWB 3QQ4A 1FGNL 3VWKB 3QPQD 3PWLA 5D6DA 2VIRA 1AI1L 1S9VB 4PJXB 3D05A 1C08A 2HUEA 2QQLL 3V4PB 5DD3L 3ZXAC 1VENA 1CL7I 3HIZA 1ZVYA 1NM9A 3QFJA 5CBEA 4AYBA 4D8PA 2QT6A 5GSVB 3IJ9A 3IU3A 4PG2C 1FFRA 3ARFA 4N2AA 3LQZB 3VXOB 1CDCA 5E99L 4WEEA 4W9DC 3X17A 1CD1A 1RU9H 3QZMA 4NPYB 3MFFA 1OTTD 2ZXAA 2OL3B 3FCTA 1FI8C 3E2HB 1SVZA 4PRDB 3FHQA 4MDIA 3HW7A 1M2VA 3NDYE 2H32A 1I4FB 4XRCA 2DLFL 5FF6A 2XTJB 3B3IB 1OWRM 2DQEL 4JNXA 2HG5A 4O9HH 5AWNL 2H26B 1G9ML 1UGNA 5DR5H 4GFXA 4RIRA 2WC7A 2YZ8A 4BFIB 2V3FA 4O02L 4JL2A 4PJAE 4DH2A 2BOCA 2YD5A 3D8MA 1NWOA 5T1KB 3UJJL 1RUML 5FCSH 4X6DB 2KLRA 4RMTA 3TBBA 4DKEH 4JR9H 4BFFA 3JYBA 4PJIA 1GJUA 2CUIA 5E5RB 5FV2A 4QHNA 4Q14A 5CZKA 3HZMB 2A74B 4AV4A 2KPNA 2MPAL 3TBWA 1Q9KB 1HSBB 3QNYB 3V4LA 5KANI 5JOFA 4I1PA 3IM1A 2YN3A 1B6UA 3O0LA 4D0CB 1G7JA 1QAWA 1OSZB 2P48B 2N0KA 2QGDA 4JX0A 2XJLA 2AABH 4RZKA 3Q3GA 2E6PA 2G60L 4JGUA 4DGYH 4G80B 4B9GA 4GUQA 1MFVA 2ZXDA 4YXHH 4RNRB 3FOMA 1IC7H 1T20A 2GFBA 5DJ2A 2XG5B 1C8PA 5KAQG 1A6AB 4E9SA 3DX1A 3S35L 4KROD 2HN7A 2VDLB 5J56B 5JW4N 5KVDE 3UBFA 4OIBA 4ZAKB 1HILB 1SMDA 2RMNA 1CGSH 3D34A 3EYQC 3QNZB 4HJ0C 5EOCJ 4NCC2 2TSBA 1CR9L 1MI5B 1N7ML 4HBQA 2OMXB 4LDOB 2IBZX 5KYUA 1M7XA 3BIBX 4UOQA 4XCNB 1JXGA 4Z7WA 3ZKQD 2WZ0A 3I2CH 3K74B 3DUUA 3KXFD 3AWFA 1XVSA 4PB9H 4PEEA 3THMH 5FUCE 2W81C 2ZUWA 1L5GB 4IHBA 4B95C 4PSPA 5LGJB 4EN3C 4HUVB 1DJIA 1XGQB 4XNDA 5T5FA 3BPNB 4YSOA 1LVEA 3U0TB 4C56B 4POYA 1X5LA 1PG7X 3LZNA 5BUAA 4HCRL 3I9GH 4Y2OB 4F33B 3KLHD 5IB4B 3NQIA 3RHWK 2R4SL 2Q7YB 3EOBB 4FQ1L 4XNYL 5HYJD 2Y1ZA 3ML8A 2HAZA 4M02A 3MJ6A 3P3YA 1PKOA 4MAYC 3GZKA 4GRWF 5ADPH 2HLFC 2EIZA 1ZPUA 4RFOH 3C60C 5K69A 3VFOB 1OF0A 3D9AL 4G9FA 3GK8L 1I3VA 3O3AB 4JQVA 4KKZA 4AH2B 4KGLA 1Y6MR 3QHFL 4MAUH 5ITFA 1A9BB 4CW1A 4X9YA 3CWGA 1V7NL 4A66A 3QZWA 1WIPA 4XMLH 1HCVA 2FL5B 5IW1A 1NIAA 2FT6A 1W8NA 2Y2TA 1JGUL 5T1MA 3JV6A 5ANME 5E6SB 5IWLA 4X80L 2X4SA 3G5ZA 4UTCA 1FNEA 2YO3A 5TFSL 5JHLH 3F85A 5IBUB 4U4IA 5I1AA 1OT1A 2Q0ZX 3OZKA 3QDMA 4KFMA 4EQ3A 5B3SB 4RWYH 1DL7H 3V0WH 4A2GA 3MNWA 4IQHA 2WLZA 3JV0A 1ZLSH 4XNYH 4NJ9L 4QHPA 2JSFA 2OMXA 2VDPL 3B2UD 4JUSA 5SX5K 3QXUA 2NY5H 3T2NL 3OPZL 2Y7OA 3UPAA 1AMYA 1YN7B 3F7YB 5CD5D 3VW3L 3CVBA 1O5DT 3TBSA 4R7LA 3PYCA 4CILA 3DTXA 3P9MB 2AJSH 4UV4L 4JFSA 5EOQH 5TE7L 3N1MC 2P80A 3MUUA 3NH7H 4N85A 3IMTA 1U3HB 2WJ7A 3KWWA 1U8QB 3UYPB 4LAQL 3KPNB 1NA8A 5CCKH 2JKTM 4RMRA 3PNRB 4LCVA 2JJVA 3VXRD 1KBBA 2IANA 3B7TA 4Y19D 3UZVA 2JJWA 3UADA 4JFEE 4HP5A 1ZIAA 5GS1A 2H4EA 2OI9B 3QIBC 4I5BA 4JFPA 1A5FH 2HJLB 5FM5M 2D73A 4BFNA 3BQUA 4OZGF 4S11A 4N2EA 1Q4NX 3NCCB 3NJXA 5F1IB 2V8LA 2WQAA 3FRUB 2E76C 3ZE1E 5C0CD 5JORB 2Z35B 3ELAT 4LCUB 1GC1L 3I6LD 4N86A 5D7JB 5AKTA 1EEQA 4IHOB 2FZ3B 4LLUA 2B15A 5IW6A 2DTSA 4I3GA 1UD8A 4QF1B 1AOHA 4P5MB 5KVGH 1SJHB 2LU4A 3GXFA 3VFRB 3N40F 4YO0B 2PWHA 5ANHA 5I8EA 4HFUH 5C2UB 3MV8E 1CL7L 5C09B 3VXME 1CMOA 4QRSA 3RILA 5EZJB 4P99A 3WKYA 4WI9A 5IVXF 3GLAA 4MS8D 1VZIA 1DLFH 1TTRA 3M8OH 4HUXA 2YLKA 3EJCA 5I1GL 1N7MH 1X5KA 3A3YB 2ORBH 2Q3AA 3HLAA 4PTTA 2EYRA 4DEUA 4L18A 2QSVA 3T0EC 1HWWA 3DIFA 4J3OD 1U8CA 4HD5A 1AC6A 4M7ZC 1P4LB 1OGAA 2VERN 1TU2A 2J6EH 4WFGE 3ZDZB 1MJUL 3O81A 2C4XA 3CXHJ 3VD4A 1QRNB 3C9NA 3D3VB 3P0VL 3BPCA 3CXHK 4QRUB 5ICXA 1MEXL 5GRUH 3HA0A 2VZOA 4JO3L 5JIHA 1HTYA 1NICA 3BVUA 3LNDA 2YJQA 1LNUB 4W1TA 1B9ZA 4K7PL 2MOVA 3S8GB 2XA8H 4KY1L 4J23A 3WTTA 3L4WA 4Y5XA 2XIIA 1E4JA 5T8IA 4CSSA 1FL5B 3BAJA 3WIHA 3DVNB 3LDBB 1L9TA 3EOYG 3GO1H 5I0XA 4MNGA 2CJUH 4WHTA 3N42F 4O5LH 1MDTA 4XI5C 5AOIA 1OW0C 2ZJSL 4LSRL 1JHTA 2R69A 2ZOOA 5IHUH 4DQAA 3FK3A 3N9GL 4X4ME 2B2XL 3Q1SH 4QO1B 2OSLA 2V7NB 3FL7A 4FCHA 3LKNA 2MRYA 1P5UC 3AS1A 4JFOB 4Z77A 4TXVB 1P1VA 2UUDK 4KKBD 5HY9B 3BZFA 4NT6A 2AF2A 4H0GA 2R4RH 4FNTA 4A68A 2JV6A 4B7LA 2LABA 2KQNA 4LLWA 1TYJA 3L95B 4TNGA 3L2LA 3U30C 4RVBA 1ONQB 4H5SA 2VDML 1MFCL 4AJ0A 4ZPVA 5EZJA 3D30A 1V3JA 4PJ7F 1F6FB 3CH8A 5AB1A 3RDJA 4Y2LA 4XP6L 1Q0XH 1NFDF 3R8BB 3VGHA 2I7SA 3KWVA 5C71A 4MDJA 3DETC 1X7SA 2BSSA 4NC1C 3S88H 2UWEE 5D4IA 2EYSB 1W16A 1U8KB 3BVWA 5DFWH 3KGUA 1J9RA 5EEXA 1FNGA 1MWAL 1PYWA 3FQNB 1QSEE 5FO9A 5J1SC 3F2LA 1ZHLA 4G59C 1RQ5A 2LU7A 4WENB 2KDYA 4OZGE 2OM5A 1BQHG 3VQLA 4F8NA 3W39A 2QGCA 2I07B 1XFPA 2JKIS 4HAFA 4Z0BH 2XICA 2BM3A 3OKEB 4OBSA 1AY1L 3E8VA 5HD8D 5DHMC 4J28A 2JK5A 1DO6A 3V5HA 4YE0A 1OLLA 4XN4A 1TJHH 3QI9C 3NJKA 4F7EB 5KYXB 4K9EH 1BAWA 1PVHA 5JIDA 4PCSA 2FIRT 1ECZA 1FO0B 2ZWKA 2J88L 1AD9A 4P59L 5DRXA 3TOPA 4DW2H 1KCVL 4MQ7B 2DN7A 5C0EA 1VFBB 2YBRA 5IVOA 1U8QA 4NWTH 4UT6L 3K1KC 2HTKD 2YEQA 1OPGH 4IBWA 2APBA 2XV6B 5LQBL 2BIPA 2PW2B 1A3QA 4ZMAT 1S7RA 4G5ZL 3FSZA 2YD8A 3SKNA 2EDLA 2DY2A 1WICA 1FNFA 3BUQA 1MAKA 3ARWA 3VG9B 2EH7L 4A1RA 4JPVL 5BQ7B 5M7QA 3CVCA 4CSPA 1P6AB 1EHLH 1P9MC 3CTTA 3WN6A 1BFVH 1URLA 4M3HA 1IAIM 4U6YA 4ANUA 3T6ZA 3V8OA 1IV8A 3WY1A 2AC0A 5C7ZA 1SJEA 4HGWA 3QUMA 2NTFA 3ALPA 5BVJA 4Z78B 1ZT7A 2NUPA 1FDLH 3HHRB 5CIPH 4PJBF 3JTBA 1XGRA 2HJFB 3L3OC 5FIEA 1F97A 1DVSA 1MUJA 5KSAA 1A7RL 4U0RC 4HT1L 2VL5A 2IAMB 1FVCA 4ZUUB 3WEAA 3INOA 1HQ4A 1XAKA 1VEOA 2AEIT 3D69B 2Z92A 3RWIB 3WIFB 4AJYV 5IHWA 5KG9A 2GSGB 3EBHA 4N0FA 4P4KA 1IAKA 1WP6A 1UOLA 2BVPA 4Q6IB 2ADFL 1BLNA 4X7EC 2JQMA 2OV0A 2I85A 4UM8B 3GSOA 3T08A 4FTVA 3BKJH 4N68A 3QPQC 3FH5A 2HFTA 1QLEL 3QAZC 4KJPD 5TQ2H 5IFHL 4G3YL 3SBWC 1XCXA 5IB5B 4XCCL 2YKKA 4PW9A 4Z7QE 3WKML 2FCBA 5ID0A 1ZOXA 1XF4A 4YFDB 2EECA 2NXYC 3UTTE 3R19A 3TH4T 1KACB 1W0WA 3LZPA 1EHKB 2HFGL 2JKXA 5J0BA 1T04A 1BZ7B 2NY2C 3QUKA 3D33A 5IQ9A 5EU7C 5EU3B 2BPBA 2OMVB 4WU5A 1RV6X 2FHFA 1R5VB 1TJMA 4NO3A 4LU5L 1KYAA 1BJ1H 4A04A 1P7KA 1WTGT 1PKQB 5F6IC 3CSPA 1QSEB 4LLDA 4PVBA 2OMTB 1XV8A 4NDMA 5F9WB 1CDBA 4PD4J 1R3LA 3IXAA 1BEYH 5DSCB 1WBZB 1N8ZB 2IFFL 1KGJA 3FN0L 1OO2A 3OAUH 4PRIB 1A7RH 1I3RA 3K2MC 1RZJL 1D5ZA 2YJLA 5CUSL 3LNGA 1AKJA 5DJ6A 3FFDA 4OGQC 1Z5YD 2VMDA 2OKMA 4ANWA 3I9GL 3S5LG 4PJCE 1UD6A 3RVTD 1Z9SB 4Z23A 1PKQA 2XTSA 5JUEH 5D6CB 2ORBL 5C92A 5BUPA 8FABB 3LMJH 1JZ6A 5C0FB 5IV2A 4UQ3A 3V0EA 5FOBA 3APNA 5A1AA 1EXGA 4JFTA 3V9EA 1VFMA 2AZUA 1W6WA 5E4OA 4JY5L 4TVPE 1A66A 4PJHE 3ZDZF 1F2XK 3FB6A 4RGOL 5E8DL 3ATEA 1J8SA 2RCSL 2EDWA 3FRPG 4MASA 1XR9A 4MAYB 1OGPA 2QSTA 3TZVC 2VLJE 2DKUA 2AERT 2BJML 5DD1H 4M7JH 1NKOA 3IN2A 2AS5M 2BVYA 2HJKB 4WTQA 4PWIA 2BVTA 3FOLA 3OR6B 4G9DB 2BIQA 5HHQB 1MDAA 2EEFA 4TULH 1FORH 1QZNA 4KDWA 4XMKH 1I7TA 2CJTA 4LSSH 1HCFX 2YIHA 1F90H 5I9QC 4NO0B 1SOKA 4FJ6A 3LRSA 2WXRA 4CU8A 4FABL 5LHDA 1KJ2B 2VOTA 2EO9A 3CFKB 1WT5A 1JYNA 2DQJH 3PGFL 1BJ1J 2YBGA 3PS6A 4KK8D 1SMAA 2VDMH 3ME0B 4K15A 4GUCA 4MD5B 3MGTA 2R0LH 3G9VA 1EAQA 4DP9X 4ELKB 5D7IE 1YEWA 2B1HL 3QIWB 3F7YA 4HLZH 2ICWA 3KBFA 4KNUA 4JREC 5HVFB 3QO0B 3EXLA 1TEYA 4F2MA 3FC8A 3US0A 3I9IA 2ADIB 4EXPX 2XA3A 4KJQD 3M1CA 3BESR 2WYHA 4CN6A 1IMHC 4IDJH 5AYQA 1K4CA 4H40A 5A2AA 3SZKC 1N19A 3ZRSA 4LAQH 4MMZA 2D8KA 1EJ6A 4WO4A 3U6XS 2PYFB 2Y07L 1VPOL 2PWGA 3QQDB 4PMEA 3ZE0B 4AMKL 3H42L 1TZGL 4HIHA 4BDVB 2RA1A 4XX1G 4PI2A 3FQTB 2WLNA 3LVEA 4X9HA 4P2RB 2CO3A 3AM8C 4FFZA 3SPJA 4U3CA 5F9OH 1A1MB 1NFKA 1N68A 3MFGB 3MRDB 3FDWA 3K71A 1LWJA 3TNMA 1NANH 3REVB 4GXVH 5ITFB 1MCEA 3UBXI 5BVPL 1M7DB 4NRZA 5INDA 4IBUA 2HX8A 3QXWA 2BSBA 4LCWA 5AAMC 3L1OH 4G42B 5AW4B 5HDQL 3O3EB 3BP5A 1ZJBA 3F00A 1J9QA 4N0RA 1EUTA 2PCPB 4LPXA 5EZLB 4JDVA 4UM9B 5F1KC 3VSUA 2B1HH 1J9CT 4XOBA 3OF6D 4U1IB 1T0NB 4KK9D 1A7PH 3NRPA 1DN0A 2JJUA 1CXHA 3HI5L 3HG3A 3CFQA 1F45A 2X4QB 3TN0A 3WLWD 5F6IB 1MCLA 1PNCA 3NFSH 4PJBA 4F57L 5I76B 1CCZA 4HJGB 1BZQK 3GNML 3MUZ1 4JN2B 2OMYB 3E2HC 4L1HA 3EO9L 1YPZE 5LGJA 1WFUA 3PWVA 1KTBA 1ZLVK 1GIGH 1UCTA 5EFIB 5BOPA 4LLWB 1RJLA 4ZSOE 3H7BA 4L3AA 5HVGB 3CVHB 4H2AA 3FSVA 2KMWA 5AOLA 3U46B 3DVGB 4BKLB 3QO0A 1ET7A 2RCSH 5B1BB 1S9WB 4PJ7E 4YLCA 3SO3B 3C87A 3QQNA 4KFZC 2R9HC 4B3VA 2R4SH 4MSWB 5D7EA 1YEIL 5KBNC 4V11A 1L3WA 2P5EB 3LKRA 5IOKA 3VXSE 1D5BA 4KWUA 1KBGH 3AQDA 3FQWA 2HN7B 1GZPA 4X4KA 3LZRA 3ZE1B 4G1EA 3NA9L 2XI9A 4KHTH 1OTSC 4HWBA 5ICUA 1JCKA 2PXYB 3BMWA 2HRPH 4X5QA 3MOQA 1MAMH 1XGQA 3UXFA 2AEWA 1BQRA 3ASOB 5J12B 1HL9A 3J2PA 4OCNC 4IRJA 4G43A 2EDMA 5K9KA 2ZP9A 3WBDA 3QJXA 2M26A 3NCFB 1UH4A 3O4LB 4Y5XB 3QEHB 3WU1A 3O41B 5IW1B 1N0XH 4IS6A 5E7FA 1J5DA 4FQXD 4E41E 4PBVC 1CFNB 1IGFH 1IFHL 5LWYH 4IBQA 1NGYA 1U95A 3TBWB 5JOPD 1IEAA 4L5FH 3NIGF 2B5IC 5B8CA 5J7CC 3PL6C 5ICXB 3GXIA 2YAHA 3FCUB 4E9WA 5ES4B 1JZIA 3PY9A 3CZJA 1I53A 4JBSA 5DUMH 4ZPTA 4XVUD 3KLLA 2E75C 4YX2L 2JKSA 4JG1L 5DO2D 1AQMA 1J8KA 3E1ZA 4BINA 3IKCA 4OSUH 2ZWNA 3IU4H 3FPYA 4LE8A 1CPUA 3RBGA 4HUXB 3MRGA 4LGPB 5FUZH 2APVA 4LZKA 3TPUB 1XH3A 1J8HD 5GZND 2RGSA 2WBKA 2ZKHL 2VN4A 3CMOH 3RJDA 3U6RB 3FZUC 4NIYE 5TE7H 1K5WA 4KDTC 3WD5L 2PF6A 1YDPB 1KFGA 3ARUA 4WU7A 2VXSL 3AU1A 4JRYB 2FNBA 4M00A 5I1JL 1E5ZA 4N6QA 4YC2C 3SDAA 3C6LA 1XF2A 4WWKA 4GBXB 4F7TB 1AKJD 1JYVA 1DP0A 2BP8A 4UT6A 1KBWA 4IGBB 3M46A 3OKLB 2J71A 5HPOA 4I2XA 4CVWA 4QKXB 4X0NA 2YGQA 5KVFH 4X9FA 1I7UB 1KJ3L 1MEXH 1UQSA 2XG4A 3HUJF 2X3BA 1JUFA 3GFUA 2N1TE 1T7WA 5LGHL 1XXDC 3S3JA 3BPLB 1AGDB 5HJ3A 1QFWH 4OFQA 3U6RA 4UUJB 3H42H 7PAZA 4HGKC 1Z32X 3CVIH 4HISA 2GBUA 3GSOB 1G1YA 4QRPD 3SE4A 1CYWA 2VABA 3FCSA 1OSZA 4Z7WE 3MRQB 4XMLL 2YK1H 5DJDA 2V2TA 4QHKI 3JTSB 1CG9A 4YZFF 1BM7A 1HHGB 2NY4B 4WJ5B 2CIKA 3QEQA 1E4WH 5KVDH 4G71B 3WY2A 2BNRA 2QBWA 1DQKA 1RUKH 2R15A 1UB5A 3MJGX 3AUVA 1CURA 1NCDL 4NKMA 3T0AA 3B2DC 1AZCA 1IT9H 4I9XA 2HFEA 4G7YL 4FFZL 3HPJB 4M3JA 4Y4KD 1ITBB 1EO7A 5DI8B 4NT6B 4R5XA 3ISWA 4N0UE 3QG6A 4EO5A 5A2KH 1J7VR 1WK0A 2L7QA 2VUYA 3O6MH 5MEQA 2GABA 2CLVB 2A6IA 1ILSA 3MO1B 3FO2A 2LV4A 4BWUA 1F4YH 1WGOA 4G2AA 3WMPA 2Y06H 5AYUL 1G7MB 2CGRH 5AOJA 1RULH 1SBBA 3ZDWA 4JANB 3BSZL 3KS0H 3M07A 3MA7A 1BOGB 3V52H 1MHCA 3FSWA 3RWCB 5F3BA 4L05A 2OTUA 4I77H 1KGCE 2XZAH 4OZ4B 1P7QD 1JOIA 3R0NA 4ZBJA 5FKAB 2QJDA 3S98A 4KVNH 1QATA 4TSAH 2ESVE 1SLWA 2NDFA 2IEPA 2LR4A 4X6CB 2A9AA 3BVVA 2WUCH 2XIDA 1G7MA 3P2DA 1OB1A 3E80A 3P77A 5IJDC 3BW9B 2VZ1A 5EBLA 3KW7A 2BRRL 3RWEB 2A38A 4P04A 1FG2B 5FLUA 5T3ZH 4OT1H 3PWLB 3NBNA 2JTDA 3RY6A 1GGBL 5HVHC 5JW4R 3WELA 4LPVA 3F5WB 4MCMA 2BVQB 4FXTA 3RZCA 4XC1H 3HNTL 3MV8B 1NAKL 2BX5A 3WTXA 2FSEA 4K3HA 3KL5A 2FHBA 4NKDA 4PLKC 4AE0A 3D4ZA 3HZVB 3SDYL 3UTSB 1BVKA 1D5MA 5EZPA 1IBYA 5J4MA 3FH7A 4C4UA 3P54A 4ODTH 1HHGA 3GZPA 2C9UA 4JVWA 3QDJE 1S7UB 3U2SB 1FIGH 1MFBL 1KYFA 2LT9A 3MCYA 2O72A 4U3SA 4QYAA 3RIAK 5KSBE 4OLYH 4DZ8B 5SWSE 3G6JB 4H5SB 3ZDYF 2DTML 1MHHB 1OF2B 2E74C 3T2QA 4X98B 1N18A 1CN4A 1RUMH 3LXAA 3VFRA 5DEFB 2CUAA 4H1LB 2PLTA 1FPTH 2R7EA 3MJ9H 3GPEA 1DQLL 3PWJB 2YGOA 2YLHA 3P0YH 3SYOA 2X9ZA 1NIEA 2E7BA 4N8VA 3JWOH 1VJSA 2HLEB 2X4TA 3LKNB 3EGXB 4ZFOA 4PJFA 3BZ4A 3HCVB 1PFOA 4XP4L 4A7SA 4HX1A 1TYRA 3STZB 2MTAA 1DVUA 3QNFA 3WNPA 4HKZA 3LPPA 4NO2B 3MREB 3WUWA 4JHAL 1I9IH 3W56A 3CFEB 2F19L 2PYFA 3WFEL 4L3ED 3ZDXF 5I1EH 2WLJA 4ODVL 2BMKB 2ODHA 3FCBA 4NNXA 5GGRB 3RB7A 4N2LA 1YMMA 2VN3A 1DBMH 3BVNA 4G80A 3RWGB 2R0WL 5AQ0A 3KYMA 4QWWC 1T7XA 5FA4B 4AQZA 1CF8H 3JWNG 4YDJA 2XPGB 3OC8A 3PAVA 4FQ2L 4TRPH 2I5YL 3RIAF 3QUZD 4NC2B 4GRMB 1JPGB 2XWCA 5FCUL 3IU4L 1XGUB 4KTGA 3EOTH 3BWAA 3HI1B 3WNIA 3U7YL 4P4RA 1SYSB 2BNRD 3QXDA 2JNZA 3HE7C 4L0YA 1KCVH 1H0DB 1ZV9A 2ZSVA 3FH8A 3WUWB 4LOFA 5BV7H 2NNFA 4ATTA 3MBEB 1CT8B 3P9MA 3ZOAA 5BZDB 3KPMB 5C08E 3HS8A 4PJAA 6CGTA 2XZAL 5AAPA 3TF4A 4TKWA 4HQQH 1JERA 3CN1A 3DRQB 1KV3A 3A4FA 4HCRH 1KLGA 4L3EA 4JO4L 2FD6L 2EADA 1TTBA 4F9PC 4ODXA 3IJ8A 3KM2A 4XO9A 2J5LB 3DMMB 4ZOCA 4QHKJ 2DF3A 2HVKA 4KTYA 4ZO9A 1F3DH 5C08A 5FYJE 5HDBB 1IQDB 3BGMA 1YDPA 2WLKA 1E8XA 4NBYB 4UTAA 2PYEE 3IJSA 5B7FA 3KJ4B 4UV7H 1UA6L 1YAIA 1YLBB 1ZTXH 1EMTH 1GIGL 1MCCA 4JFFB 1SXZA 2P5WD 3KPRE 1N64H 3HUJE 3I6GB 4BGLA 5EF1A 4K5MA 1G7IB 3V8CA 1WCQA 4XCYB 3TBTB 4YUEH 1ADQL 3QDJB 4KZEH 3HHSA 3O2VH 3VG0H 1WBXA 1B3IA 2AHIA 1YC8A 3GI8H 3QEGH 3SCMB 1NPNA 2PWEA 4N0YH 4WY7H 1OP4A 2NY6D 2VL4A 3ZKNC 1ZS8A 4D0BB 4JKLA 3TJEH 1DBKH 3IBEA 5FA3B 4L3CB 4F15B 1WHOA 5HGHA 2XWEA 4Z7NB 4UB0L 2VDNB 2C8NA 4YZFE 2VSCA 4AUJA 4G9FB 3ZT5A 2X6MA 2F58H 4JB9L 4L8BB 2VZUA 4XWGL 5DK0B 2CDGA 2HJLA 4GFTB 5LGHH 3GUTA 4NEHB 1NIFA 2OSYA 1HQRB 2BW4A 2DWEA 1ORQB 2FEDD 2PP9A 3GUFA 4FQ2H 1NSNL 4KK6C 1U8OA 1WFJA 1CQKA 4U1GC 1X9UA 5IIEB 1AAJA 1TQBB 4BZ2H 4YDJB 1T2JA 1QSEA 3NFSL 2VSMB 5IB1A 2GG1A 4TMPA 4A6YB 3V4VH 3LX9A 3LNFA 3IKCB 4KZCA 4QIRA 1FYTB 2ZXEB 4LIQL 1MHEA 5BZWA 2FJGA 3UZQB 1G6VK 1IAMA 4PRPD 2BY3A 2E3VA 5CLTA 5J11B 5ETUB 3OLIA 2WNKA 3BP6B 1RUKL 4DGIH 1WITA 4BFIA 1B2WL 1GOGA 4YGAB 4BIKA 4MA7H 1I3GL 3QUYA 4XNMB 4FXKC 3UL4A 1E7VA 2UV3A 1CICA 3TYFB 1D5IL 3ILQC 3QSKB 4S1SL 3D25B 4UMSA 5DWUL 1EIBA 4JHWL 4KO6A 4MJ4A 5T3XD 4P2AA 5MEQB 3ET9F 2FRGP 4YSCA 3X14A 2ZCLL 3APCA 3HG1A 4MJID 2B0SH 5DQ9A 3GMLA 4G8EA 1ZEAH 3RNKB 4U2YA 5F0JB 1RIHL 4YOKA 3QDJD 4LSTH 5KJRL 1IU1A 1OAZL 4XMTA 2J20A 3MRNA 3BUBA 2X1OA 5AL0A 5A3ID 1BF8A 2F8OA 2JIXB 2XVKA 2BK8A 3HAEB 3HI6L 2XWBA 4L2YA 5C7XH 1KCLA 3GSXA 3Q5OA 3K4DA 1RY7B 4JDEA 1GAFH 1N6QL 2BSTA 2NTFB 4NKIL 5GRVK 5BVJB 1X9RA 3TEZA 2OP4L 5C2BH 3NIDF 4GQPH 1PCXA 4U1IA 5EO1B 3NCJL 1MJUH 3RX7A 5I1HL 3TONA 5J12C 4ALAC 1G7LB 2ZUQC 4HCIA 5F7WC 1NFIB 2XRAL 3K3QA 3MLSH 8CGTA 3RL2A 3KXFE 1XB6A 3F5WA 5GGTL 3AUWB 1HH9B 1RZIB 3KYOB 1BIHA 3VXQB 1GMIA 5DK3A 2DWXA 4XCFH 3WV0A 3JWDC 3CHQA 5AENA 4JY4A 5FFOA 4MTMA 2AJVH 3QUMH 3SBRA 3FQ4A 5FC9A 3SZ6A 4BD4A 2BNRB 5FK9A 1F58H 4BH8A 3RIKA 4F7PB 2YUWA 3FB5A 5FYLE 4FLSA 3NZUA 4CVXB 3G5YA 3JUZA 2OTWB 3HBQA 2NW2B 4DP2X 2EDDA 4KKBC 2WZPA 3HG1E 3GSRB 2FEEI 4DPAX 1K4CB 1NCDH 2V7HA 3N5AA 3Q6FA 3KJ4C 4KVCH 4YSUA 4F1SA 1KMGA 3BE1L 4RISL 4JFED 3A47A 1HE7A 1CD8A 2N7BA 1GOFA 2PXYD 1JGIA 2BP8B 3EH1A 3MODH 4NQDA 1A1NB 2NQDA 4MZ3A 2H3NA 4DUVA 1A1MA 1MRDH 5KZCB 5F97E 3QQ4B 2W60A 3ILPB 5EBGA 1PZUB 4UV7L 2AJ3A 3S8FB 5IBLC 1WRFA 1UEYA 4JRWA 2ZOWA 4WW2C 4ZX4A 1A9VA 4NUGH 4IRSC 2OR9H 4OF0A 4YL4A 5E2TL 3ZKND 1LO0L 2EIEA 4ZXBD 3SGKA 4Z7IA 5FPIA 5KVEL 2NNAA 4WGKA 1BM3H 1CFNA 3DROB 5T3ZE 3C2AL 4KXZH 4PY8J 5KBMA 1FHNA 1U8LA 2XN9E 3QHZH 1XR8B 4YHIB 5D71H 2ENJA 1UENA 4TQ8A 1HEZA 1FFOB 3LH2L 1HXYA 1C16A 3L4ZA 1ZSDB 4ZFZB 3WN5C 3KYKH 5AW8B 2W92A 1XH2A 3SY6A 2OZ4L 3N0PB 2OMVA 5B4MC 1S9XB 4HIEA 1UKSA 1PSKL 4JRYE 1E27A 1UZGA 3ULUE 3LHAA 3T3PE 3LQAH 1NLDH 3MLYL 2NLJA 2BP5M 3VFPA 4QJ4B 1RIUL 3IFOB 1KTRL 3L54A 2PCYA 3MRMB 1VKXB 3EOAB 1Z9NA 3OXSA 4FMKA 1QACA 4KV5F 4ANXA 1BFVL 5IMOB 2DJ4A 3IDNA 4S1QL 12E8H 1SF3A 1ZTXE 3TH3T 2YGVA 3AMLA 4OCXH 4LNVA 3PGDB 2WGXA 1IGML 3B4NA 5D4QA 4ZUSB 5CKAA 1CC3A 4S2SA 3UAJC 3MXWH 5FYJH 4Y5VC 3HN3A 2PN5A 4LMQE 2AMGA 2VR3A 1Y1UA 1NDGA 5KVGE 3OWRA 1ODUA 2AEPH 3HC3L 3HJEA 2W1NA 1G6RA 2PR4H 2PXYA 1W0VA 2H1XA 4OZHF 1P7QB 2DKSA 4PRHE 3GI9L 4C83A 1NAML 3O2WH 5DHXB 3ULSA 2HX9A 4PJBB 1E5AA 1XSKA 3MGOA 5IHHA 3GSUB 4OD3L 3I6LE 1AI1H 1MZYA 1QLEH 1TQTA 2Q9OA 3VFGL 3AXIA 1R5VA 3KYKL 2GTZA 4NO3B 4AM0B 1KGXA 1HIMH 5I74C 5ABAA 4PJDA 5ISZB 4NQXA 4OUOA 3SKJH 4A7GA 3PL6A 3VXMD 5LB1A 3ZTNL 1D6VL 4HT1H 4N0UB 2ICEB 4CADB 4N2DA 2GSMB 4AITA 5CCGE 1MI5E 2J5WA 5F0MB 1D5ZB 1E4HA 3HE7D 1ZK5A 3EIFA 3FHAA 5DFTA 3P4MB 4JZJA 4AYDC 5DRXB 1OSEA 1BSIA 1TQUA 3NCBB 3K4AA 4LVOC 2C3VB 5I1DB 3QUZC 1OD9A 1KTCA 4ZOAA 3FB5B 3LPOA 4QHUA 4JM2A 4G11A 2ALAA 5D70L 4QWWD 5LVEA 2IQAA 5EDSA 1DQDL 3F05A 5EU3A 3FT9A 3H9SB 3D0AA 5KN5B 4W9IC 4HWEL 1AD0A 5AAWC 4NOFA 5JDJA 1PEZA 3SDCD 2F74A 3KG5A 1IJ9A 3FFCB 3TCLA 4A67A 4MCZB 1S7SA 2XBTA 1PG7L 1HZHL 1KXTA 5E2UL 4U1KB 4PRHA 4EOWL 1HAWA 3EKCA 3IFNH 2LAAA 4M8UA 4RFNB 3PP3H 1F41A 5EUKB 2C7UB 5EEYA 4WFFE 1PLCA 4LHUD 5DUBB 1MCRA 1NEPA 3KM1A 5DFVD 5E4EC 4NP9A 5C0AD 3S2AA 1YYLL 4G5AA 5I73C 3FB8A 4RDQG 1W6LA 1IKNC 1QTSA 4POZC 4JRYD 2NDGA 4HOXA 1O0VA 3PF2A 1MPAH 4APXA 1HQ4B 3DK2A 4PLOB 2VL5B 2K9UA 3RX8A 2VXQH 1X5HA 1LD9B 3PFUA 4L1DA 5EZIL 1MUJB 1BWMA 4HIPA 3QFDB 1CF8L 3BQVA 1G9NH 2NZ9C 3ARDD 4XB3A 2WZ5A 4QXUL 1DSFH 4H4NA 3FB8B 1NBQA 1XL6A 3SOBL 4ZD3H 1OAXL 4FQIH 4V33A 1MELA 4BSVA 3F7LA 3TA3C 2AABL 2PCPA 2XQYA 4CU7A 5F6HJ 1KT2A 4PRHD 4Z8FL 1QSED 2Z1KA 5KVDL 4YSPA 1K3ZA 3IMVA 3VU1A 2APXA 3HKFA 1HINH 5EC2A 5IHBA 3HR5A 4K55A 3JZYA 4OD2A 4OVUA 3SDCA 4ZMTA 3EFFA 3I75B 4KY2A 3KLHC 4JQXA 1AHWC 4TS6A 3FAXA 5BXFB 3O11A 4ODTL 2VE6B 4X5WB 2FJGB 4IGBC 1RURL 3EO0A 2BSSB 4N6RA 5E8OB 3NEEA 2UX6A 2IDSA 4PY8I 3WIIH 3ULVF 4LASH 2YC1A 3G04A 3VQ1C 4W93A 1D3CA 2LU3A 3PPEA 4GUOA 4HH8A 4UZGA 3V5KA 4MMYB 3QDAA 3F7PC 1WAAA 2OR8A 3O0RH 3KNBA 4LLAA 1X5JA 3FUMA 1MI5D 3O4OC 5T1DH 4NM8H 3DHMA 3ZTEA 4HWZA 2FATH 4P23D 2P5WA 1MG2C 5PAZA 4DKAA 1H8OA 2QKIA 4X9GA 2G2RB 1TU2B 4ILDA 2AJZA 3QZOA 8FABA 4W9LC 1JBJA 4DETA 5DK2A 3E0GA 2J72A 3TJEL 4MD4A 2FBRA 4LXFA 4NUPA 2ITCB 4I4WB 5I18L 2EDBA 2DI7A 2C3WA 4GRLD 3EXJA 1TQCC 2W88A 3H9ZA 3JVGA 3KL3A 1CFSA 3T0BA 3OAZH 2YUVA 4K73A 3HAEA 3SGDI 3CFUA 4XODA 2VERA 4U0RB 4QLWA 4N22A 1MF2L 4Q9BA 4AIEA 3MUY1 4FXGC 4ZFQA 1XH0A 3UTZA 5I1KH 5DVMA 3DVNA 4R0LC 2HKHL 1SMOA 3AB0C 4PY7B 5CEYB 5LN4A 4H20H 2E6JA 5HYIA 3QIUC 3A6BH 2EXWC 3E3QC 4MKTA 1FE8H 4TVSa 5KG9B 4KKLD 1DQJB 3RPKA 1JZHA 4YEFA 4WU5B 3L5XL 5E1GA 2J1YA 2VLMD 2KS0A 5B1KA 5HI4D 2H0EA 5HTSA 1CFSB 4B9ZA 3NH7L 3IRZA 1ZT4A 1T20B 1IC1A 2GFBB 5FUOH 1CDYA 1DDHB 3JQOB 3QK0A 1NGPL 3NA4A 4TLTA 3L8QA 5EWIL 3ZE2F 2Y6SC 2APSA 3ZRFC 4AVIA 1T1ZA 3DURB 5CNHA 5FV1L 1GCFA 1WS8A 5EO0B 2C9RA 1Z9SA 4Q6IC 1IAOB 1A7BA 1ID5I 3FU9A 1SDYA 3BUYB 5D1QE 1NCUA 1A7QL 3UTQB 5D9SB 4W70A 2CU9A 1NJ9B 5I24A 1R46A 5HHMB 2XFGB 4OCLC 1W9XA 5F71A 5LBGA 3QJOA 4P46D 3OZ9H 4ESKA 2BMKA 4ELDA 2VJXA 4Y0GA 3UO8B 4AEIL 1DO5A 3RP1A 4YO0A 5I8EB 1TFPA 4Q9CA 4KU1A 5I1EL 1A4CA 1N26A 4U6VL 5DT1L 1EUUA 1OQXA 3A6CH 1A3RH 4QRAA 2JI2A 4P2CG 1XCTB 3O8XB 3KD4A 3ETBJ 3DIFB 2AJZB 1UM6H 1HC1A 3BZ4B 2AITA 4KBPA 3MBXH 2VMCA 4IK6A 1OL0A 4ZNEE 4XNUH 5JOPE 4MXVE 4AQ8C 3QCVL 2IDQA 1FDLL 5IKCB 2ITDB 4PJDE 1KT2B 2EEDA 4ZS7H 5JXAH 3Q2WA 4FZ8L 4DZBA 4IRSB 1T2XA 1JXKA 2UZIL 4YDMA 3V0FA 1CDUA 5A2BA 3Q0HA 5D6DC 3RE0A 3SDDC 4N9OB 5IVXA 1HJCA 5IESH 1M6OA 1Z3GL 2GJ6B 4YPGB 5D7IA 2WVSA 4L8CB 2QVMA 5K1VA 3G5YB 43C9B 1X4XA 4PS7A 2AQSA 5A40E 3L7EB 4GW1A 2HXAA 4NM4L 2CXGA 3GBDA 3GLDA 4LSRH 4OZFA 3GM8A 1KY7A 3OZ9L 1HINL 4B9CA 5ADOH 2WXKA 3BEWB 3P9LB 5IVZA 2D7QA 4I13B 1J9SA 2ITFA 5DU7A 4KO5A 5DDHA 3IDXH 3LQAL 3MLYH 5F9AC 1A3RL 1OTSD 1F18A 4JG1H 4BCZA 2B1AL 1TTGA 1Q9WB 4NHUA 3GLZA 3PQYB 4K5OA 1KB5H 4JREB 1DSFL 1KBKA 2I32A 4ONHB 4PREB 1QLFA 4LLVA 3FUFA 2DAVA 2WTOA 5IF0A 2XTJD 3GSUA 3NJNA 4QRBA 5I19L 5JHDE 3MV7B 5FX3A 5HPMB 5K1JA 3JBG7 4BQ6A 1MIMH 5SWSD 5LWYL 3A21A 2SEBB 1KGWA 4NO5A 5FKAA 1PFCA 1OAUH 3ESNA 1W72B 3TVMC 1DEEB 3BUDA 4XWOD 4X2UA 4YXKL 2G4EA 4UTAL 3ASWA 5IY5B 4BRJA 3DJSA 1BZEA 1J11A 3II2A 2VJ8A 5AZUA 3VM5A 3ZE1F 3UTPE 4YX2H 2OX5A 3SQBA 2D7NA 2MJWA 4WHYG 4M61B 3SN6N 5AW9B 2W95A 35C8L 1OAJA 2R69H 3PNWB 4X8JA 5GJSL 3NA9H 1UFGA 4R2GD 4RBPK 4AUYA 2ICEA 4CADA 4PLNC 2NLJB 1ZHLB 4P2YA 4YLQT 5IW3A 2EE2A 5F1NA 4R7NA 15C8H 4J8QA 3PUUA 4HH9B 4R83A 3V2AR 2PYEB 5IR1B 4ADGA 5CEZD 1OTTC 4GT7A 4NQVB 1ZA3B 3DI3B 1MREL 1T03L 1AQ8A 1EFXD 1H9DA 1FAIH 1XR8A 4I0KA 4YHIA 3SSGA 1RUQH 1S7UA 1G5GA 2WWOA 3U9UB 1T5WA 3V52L 4RDQF 2ZOLA 3PP4L 2DQIH 4RA0C 2NTSP 1W0VB 1EHNA 1IM9B 2GSIB 2QZQA 1U6AH 1JIBA 3C5ZC 4EN3A 3TVMD 3O2WL 3IE9A 1U0QA 2JB5L 5IP4A 1VB9A 3TZVD 1QRNA 3C9NB 4BYHA 4GRWE 4DPCX 2AJ3B 3ZR5A 4Z76A 1AO7D 4PFEA 2Q10A 5E6ID 4LKCA 4FLOA 4V2CB 2IGFH 3Q48A 2EYRB 2W9LA 2FX8H 4HK3N 2O6DA 1XZ0A 2B08A 2QLYA 1TOXA 2A1WL 3ARGB 3LD8C 4QTHA 4CMHC 1PF3A 4BSWA 1EAOA 3QDGE 4JPQA 4XCYA 3TBTA 3SPGA 1FV1B 5LNGA 4M1DL 3BZEA 5EU4A 5HI5C 4HPYL 4AY0A 3LKQB 1CLOH 2J2ZA 3FULA 4TNFA 3N42B 4ZFZA 1BQKA 1QEWA 3ZZ1A 1SOQA 1CFQA 2DWDA 2OJEA 4OGAD 1IQWH 1YEEH 3SQOH 3IMSA 3ARXA 3NFPA 1YJDH 4ZFFB 4L4TE 1UADC 5EUOF 1D9KC 4YHYC 4OCMC 4K7PH 2XKNA 2O6PA 2XTJE 4K7PX 3UZEA 4X6BA 3BIAX 5I5MA 3WE1A 4O2FA 2GSGA 4OLYL 4P4KB 4UI2A 3ULVE 4FFVD 4PYHA 3PFQA 1U6AL 3F3HA 4PV9B 3QCVH 1ZHNB 1I1AA 1RSFA 4OD2B 3SDCB 4UF7C 4WK2B 3MUGB 1N8OE 3CK0H 1AZRA 3MJ9L 3QQXA 1HOCA 3QO1A 2ZJSH 5HVWA 2FHCA 3EDJA 3KYOA 4BE6A 3O6FB 1IBZA 2HTLD 3R0MA 4NZRL 1I3GH 2FYYB 4F3FB 1QLEB 2NYYD 2OXGB 1JP5A 1T03H 4RIRB 4K4KA 2XV0A 5DJ0B 4DPBX 5J89A 2VLLA 1J1XH 1WISA 1HZKA 1D9KB 4YHYB 3VTTA 1IGIH 1KCUL 3TZVB 1P4IL 1DN2A 1AS8A 4UQ9A 3FTSA 2AXGA 4WUUD 1ECYA 4GKLA 4Y9GA 1CLYH 4PJGF 1KC5L 1XEUA 1G9MC 3D52A 5G2NA 3H3KA 4A2MA 5DZPA 5ISZD 1YEJH 3A4AA 1KEML 4LCYA 4IOSA 5I73B 1MH5B 3V0GA 1QBML 2G5BB 1JPEA 5AG9A 2X70B 2VO5A 1NMAL 3NABH 1VCBC 4OGXL 4YSRA 1A1NA 4PJXA 5GS1C 4Q2ZA 4EQ2A 2XBZA 3UTTD 1XGPB 4OV6F 4WNQA 1B3JA 1E9OA 4YHNB 4D9RE 2DICA 3BAXA 4IU2A 4L9LA 3FQNA 3KYAA 4PRDA 1N9PA 2E59A 2OXHA 3WO4B 2Y36H 3RUGA 2YR3A 1V3KA 4LLMA 3L2MA 5DC4B 1MFAL 2AV1A 2X53A 3HB3B 5HYQA 3A4DA 4HJGA 4IBLT 1TTCA 1MQKH 3LEVH 2KL6A 1H3TA 3ZVVA 3D0VA 2QVFB 1RK7A 2I60L 4OIAA 1C08B 1BQLL 3RY6C 3X3FL 1TLMA 5E1HB 5JDSB 4DESA 1KTDA 3TT1L 1WLHA 1EXUA 3C5ZB 1AZZC 5DMGC 4TSBH 4WO0A 1LE5B 1UD4A 3GMLB 1EHXA 3IDXL 4NRZB 1T89C 2J7LA 3MMEA 1A14L 4J3OF 4OGYH 4BBWA 1VGKA 1JV2B 3ETBF 5TGBB 3X11B 2C3GA 1E4XH 1KJ2L 2CBOA 4NQCA 2J73A 3QRBA 3M17A 4APQA 2Y6TE 2TSAA 2AQTA 5K9QI 4ZUWB 2IV9A 4U3XA 5LNEA 3NN8B 5CU5A 4Z7AA 4N87A 5K59F 3TBYB 1TEFA 5A2IH 5IZ7A 3F7VB 4KITB 1BF2A 1RZJC 3BZDA 3OAYK 2EICA 5D93C 1W72A 4CVZB 2Z0BA 1YCSA 4F9LA 2CXKA 4KQ3H 2HTKC 2CR0A 2Z64C 1ZHBA 4PJ5A 2Y5TA 3IGAA 3MCLL 1V7NH 3FHEA 4MQXC 4P48A 4XXDA 1TQBC 4APQB 3QNXA 2CDFB 4Y5XC 3MOAL 2JKJA 4PGDB 2ZYIA 3ABGA 4AQ1A 5B3JF 1LK2A 2NXZB 4FLRA 3TT3L 4XZUA 4KPHH 4JW3A 4A2LA 3W38A 5H4ZA 1JG9A 3FU0A 4PRPE 1CBVL 5EIIA 1HHHA 5L4JA 3NJIA 1CT8A 1RAMA 2D0GA 5JHLL 4IMLB 5FO7A 1THAA 5F21B 5FUOL 5KSUA 3RA7L 5T1JA 2AVGA 4UOJA 1RJYB 4PWFA 2Y07H 1WG3A 2G30A 2K4AA 3H1ZA 4HHAB 4MNHB 1BQHB 1PL3A 4MMXB 4XCEA 4O02A 1AGBB 2DI8A 5C07E 1PZSA 4BFOA 4LSPL 3NGBB 5I75C 2YFOA 4BZ2L 4ZX5A 4KGJA 4PW3A 4XX1E 4ERSH 1T6BX 2EIKB 1T21A 4KUCD 1JGDB 2ZX7A 3CLFL 3BD4A 3QEGL 4N9GB 5IBUG 3S2CA 3IFLL 4L3EE 2WBXA 3EJYC 2NZ9D 5TK2A 4AEHL 2J6EL 3W37A 2O6EA 4EI5D 4I3RH 1MLCB 2BY1A 3DUUB 5DZAA 3KZ8A 1UA7A 3MREA 3HZYA 4QXVA 3E8UH 2XHNA 3KLDA 4PJ5D 1XZ0B 2CHNA 4R6UA 2KERA 1J1PH 2FJHA 5I18H 3OKYA 4XNXL 4WEBL 1S78D 5AL8A 4EI5C 3DX4A 1D2OA 4N4YB 3NZHL 3VDAA 5JW5B 3AMKA 2H1PL 4JRYA 4XGZB 1TT6A 1L4IA 3CH1B 1A22B 2AVFA 1EWHA 4PGJA 1QR1A 4OKDA 1SYSA 4M6AA 1AHWA 2WKGA 1AMXA 3QJUB 5DF0A 4V1DA 3U46A 1GC1H 2X6VA 1Q9LA 4U1JA 3GXNA 3Q1SL 4GKZA 4JL1A 1HWGB 3ALWA 3QFJB 3ABLB 3G3LA 4JO4H 2YXFA 3NCEB 3PIQB 4PRBA 3V4PA 3RWGA 3UROR 3RPIA 3UP1A 5FK9B 4MDRA 1MWAA 5EO9B 4AGMA 4ZJ9A 3WDJA 2PYEA 2FTAA 2BNUB 1I7ZA 2AI0L 1P5VA 3EYUH 1OQOA 4Y5YC 2BVQA 2PABA 3EJQA 4UDTA 2MH4A 1HHHB 5BQDA 2G9HB 2OW7A 5PCYA 4CRPA 1QNIA 3C12A 2K6WA 4HDIA 1MFCH 4KY1H 4EN2A 3RVVD 2HFFA 3R8QA 3HS0C 1QFOA 1XGUA 3UDWC 4P46C 5C7XL 3CCHA 3CXDL 4PD4K 1T0MB 3WS6A 2UZXA 3I3DA 4PR5B 3RG1C 4U1NB 1R33A 3I3BA 3T4AC 3O3BA 1IVLA 3V0VB 1HL5A 4XMZA 5KW9H 5F3HA 1F1GA 1B2WH 4N0FB 3MYJB 1U8JA 2PP8A 1XD1A 4Z7UE 2OMWA 5K5YA 2MCPL 2Q86A 1I1CA 4ZX3A 3QUYC 1GHFH 2VH5L 3C2AH 3L3KB 1X5GA 3ARGA 4U1SA 3QPXH 4O4YH 3UABA 3H54A 5BO0D 3NEOA 3HG5A 4YE4L 4AV5A 4N90D 2NY1B 1YNKH 2NOYA 4JCLA 5DZLA 4ETQB 3QUXC 3EGXA 3FT3B 4GOSA 4PRAB 3OXRA 3L5HA 4Y9CA 2VLKE 2VLRE 1E42A 4UT9A 5J6SA 5GSRA 1AH1A 1SM3H 4BKTC 3DTUB 1OCZB 2P5WB 3QIUD 4WI3A 4FXGB 4Q6YA 1U3JA 2ZYHA 1OOAA 1AIZA 3D48R 15C8L 4RQQB 4QD2E 4ZFGH 1JZ7A 3FO9A 1BBDL 3NESA 4OQTA 5BZWB 3UZQA 2HT4D 4GSQA 5AZ2L 3IGLA 2J12B 4ELME 1FG2A 1MJJB 1OPGL 3ES6B 3KPOB 3W3BA 1OIOA 3UPRA 4HIQA 1WBZA 3FW6A 2G75B 3QQ3B 1A14H 2DQFA 3U9UA 5JHDB 3MC0A 3MYZA 2G0LA 1TLKA 4QRFA 4J3UA 5F7LB 1ORQA 2BZCA 4X99B 1HHJB 3QCUH 3BAYA 4WI7A 1JFHA 3ETSA 3C09C 4LVNB 1T2QH 2CDGB 2XVLA 5IGXL 2VE6A 1MRCL 5DZNA 5TDNB 1H19A 1Q0YL 2WMPB 2NYZA 5F1NB 4XPAL 2ETWA 1Z3RA 1PW3A 4ZXBC 4ZW3A 5HHOD 3CHSA 3VWJC 1OLZA 3GSNH 3UMNA 5SV3A 4Y8DC 3COOA 5CS7A 5FGBC 5I15L 3FQ1A 4JO1L 3K81A 4P3DB 3FAWA 5CIPB 4R96A 5GGSB 4H8HA 4AQAB 4R7DB 1AQKL 1ICTA 3RYMA 4XVTL 3FQTA 4WTZG 3HC4H 1CGXA 1FZKA 2JKWA 2HLAA 3C08L 1II4E 3H9HA 2HT3D 1D7BA 3MUJA 4IM8A 5CN1A 1JFQH 1JDCA 3S5ZA 1GZHA 1E40A 2GIMA 3QJHA 5HJGA 4AI7A 1MAJA 4M8VA 3HFMH 3NTCL 2Y7NA 2GC4C 4U1MA 2HJFA 2F7QA 3JWOC 5GZOD 5D9SA 4RGMC 1PY9A 3N41F 5MENE 4ZUVA 3HI6H 4JFQB 1T21B 2H47C 3JVFC 5IMLB 1ROWA 2OZNA 2R69L 3HPLA 3BZFB 5T1LD 2Q8BH 1A5FL 4OFDA 1HIML 2YK1L 2WYIA 4JFOA 4IRZA 2NX5D 2YRBA 5HYSG 3D07A 5B39G 1YN6B 1FZMB 5AKVA 1O9VA 3BO8A 4CC4C 3AACA 4QLRA 1OCCB 3T3MB 1YY9C 4UBDC 3DV4A 4NQEB 4HKXA 4HV8B 4E5XB 5LJYH 3HI1A 3FT4A 2OYMA 4OVVA 3X1GA 4IW4C 4G6JL 2JI3A 4CDGC 1DBBH 1G7HA 5EBMB 1W72L 4HJJL 5I16A 4YK4C 4XVOA 5TF0A 3GD1C 4PJEE 2L04A 3CFJA 4M7LL 4WW2F 1KGCD 3FU8A 3N43F 4RFOL 4GINA 3TIDA 4HJEA 1GS6X 1TZIB 4UINH 1U8HA 5D8JL 2RHEA 4BSWB 4U1LA 2B77A 3GRBA 1M3JA 4R7VA 3I50H 4X6EA 4FMVA 3NQKA 2CCVA 5IB3A 4PJDB 5ISZA 4A7VA 3OL2A 5CXPA 3JWDL 2VTFA 4V1DE 2X4PA 3T8XB 4WUKL 3CU7A 3D7PA 1JZ5A 1RHHA 1JGVH 4B9IA 5EORH 2DQUL 1OGAB 4P3DA 2NY1C 1IGMH 1XF2B 1NGQH 3W0WD 4BXSV 3VTAA 3CDZA 1UYWL 3B1TA 4HPYH 1I1RA 1RH8A 2GJZB 2YD0A 2R9HD 3G08B 3EFDH 3KDMB 5JO5B 3CN4A 4L8SB 1I7RB 4MJIA 3LRKA 5DRWB 1X7QA 4CMMA 4FABH 4XPBH 1HXMA 3KEDA 4J4PC 5CKGA 3T0DA 5E8EB 2AEOA 4HIXH 3I84A 1FBIL 3EUDA 3L4CA 2OCFD 4JKPL 3CZSA 4GKNA 5E95B 2RACA 2EXSA 1UT1A 3OMNB 1HL8A 1KYDA 3UPRB 1LDPL 2BNQE 3QUXB 5CZVL 4XPFH 1VADA 1BQHA 1IJNA 1BYOA 4UTBL 2FZ3A 3SKOB 3UTSA 3G5VA 3EO0B 3QJQB 1EAPB 1I31A 2VQTA 4L29B 1A6VL 4OKVB 4ORGB 5FDYA 1JTPA 3ZDXB 4AM0Q 4EUPB 5ITBL 5DLML 5F7EL 4IMLA 2FEDC 5FO7B 3WGVB 5KSUB 4W9FC 3SPVA 3WTSA 2BFVH 2DEXX 2GBVA 4TYUA 3LHPL 1PG7W 1U2HA 2ZX9A 4PLJD 1OP3K 4GI9A 3WSQL 2QGBA 2BERA 3ULUL 1DEDA 3HFML 3TWCL 3MRIB 4MA3B 5FYKE 1UXLA 4PQXA 5DJZA 1FSKB 4FTVB 3OD3A 3MLZH 2NY7H 4OLUH 4QRPB 4YEEA 3EFOA 1MRCH 1OE1A 4UQCA 3BHBB 4Y89A 1DQVA 3DBXA 5BUGA 3ZTDC 5D7KD 1N6UA 3HS0B 3EO9H 1SM3L 2VKXA 4H8UA 1U8JB 5GJTH 3ZW3A 4C4KT 2O61A 4MRBA 1PD1A 5HGBA 1NBYA 4LVHC 3U4EB 1ED3A 2GJRA 3PHSA 3U36A 1NCAL 3RWCA 2BINA 3MRBB 5F3BB 5AG8A 2DYPA 3UG5A 4AV0A 5J06A 4WV1B 1NEZA 1Q8MA 3BPCB 4QRUA 3S7GA 1T4KB 1IKFH 5KEZA 4IIQB 4J1UB 1QOKA 5C0DA 1WWWX 2MFNA 4GBXD 4JRXD 1FE8L 3LNIA 3W9DB 3NP3A 1A3ZA 5BCAA 2H3NB 1SXBA 2K3TA 4JE4B 2H8PA 3NP4A 3VXRB 4F27A 3IETB 2ISDA 1JWMB 1VFUA 3CFNA 3X12A 1JMZA 1T2QL 3FU7A 2HFEB 4YWGH 3PDDA 1I8UA 2D31A 5G4OA 1A6ZB 3V9FA 4QHMB 5C8JA 2KUTA 4PBXA 2VMJA 2HUHA 5JYMA 5C0RH 3K71B 2CIKB 4OQTH 1PZCA 2ZX8A 4ODWB 4YHPA 3UTPD 2DMKA 2E47A 3IDGB 4ZD3L 1NFAA 1Q0EA 43C9A 5JLZA 3V4VL 2FR4A 2QQKH 4WI2A 1GY1A 3U7AA 4OI8A 5FW7A 1YYCA 4ICXA 4RGNE 4YDVA 3D4YA 5K9OB 3SODB 1NGQL 5T1LA 1EBAA 4QYOA 2J55A 4GG6E 4WI0B 2WINB 1FHGA 5F1SA 1U8IB 3CX5J 2H9GB 1JF1B 3K1DA 1UJ3A 1ZLWH 4JO3H 3WL9B 4FNLH 2MSPA 1VAHA 4L48A 5L2JB 1YMMD 2IFGA 3B9EA 3DXAB 4GP8B 4LLYA 4QHLA 3QI9A 2R1XB 5SWSA 3U25A 4X8XA 2JJTC 4XN1A 3B2XA 4NXKA 4N0YL 4WY7L 5CGMA 5L2KE 2JWYA 3O6FC 3ZYJA 3VCLB 4BFGA 3Q2LA 1KJ2A 2F54E 2LTQB 4OH2A 4PJGA 2BNRE 2KH2B 2NX5E 3B5GA 1N12A 2QVTA 4OLVH 4ELMA 1IKFL 4KXZI 3GWJA 5GRJL 3OB8A 1KPVA 3GMRB 2IH8A 3V6FB 3WTVA 4FFWD 2Z8SA 1B9KA 2ARJQ 4YXLL 1AS6A 5FKPB 4JN1H 4E9VA 3WHE1 4F5CE 5C9JA 3S0PA 2YQ2A 3EOAA 1DZBA 1VGEH 4OLUL 2VZSA 3Q2VA 5CZRA 3PJSB 5GHWH 4B7IA 3LIZA 1CVSC 5E6UB 3DJZA 5DHDA 2DMBA 3WY4A 1E6JH 5KYYB 4NO0A 2LHAA 3O6ML 4DVBA 2Y3AA 2WNWA 3UPCA 5A6IA 4WWNA 3WE6A 3NIDB 4CNIA 1UJTA 4MD0A 5DJAA 5K93A 4HQQL 5C97A 3VDBA 1X5IA 3QEQD 5CMAB 5IFAL 1IC4H 3EF7A 3EO1A 2J88H 4P59H 1N4XH 1V05A 1MVYA 1A6VH 1A4JB 5ITBH 1HYRC 1W2KT 2BCKA 5ICZA 2LLGA 2ZXGA 2IC2A 2F15A 1IE5A 2WKOF 3DROA 4LRIC 3P73A 5D2LB 1RZJH 4HCGA 2VR4A 4K94L