4PCYA

Crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
b'IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Crystal structure analyses of reduced (CuI) poplar plastocyanin at six pH values.
pubmed doi rcsb
source organism Populus nigra
molecule tags Electron transport protein(cuproprotein)
total genus 23
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1986-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4pcyA00
3S8FB 1NIFA 2BP8A 5IY5B 2A3TA 3IE9A 2DY2A 1CUOA 3NJNA 2JFCA 3QJQB 4CSZA 1AS8A 3FPYA 1URIA 3FU9A 3NJGA 1ASPA 3NP4A 4DP4X 5EHFA 5B7EA 1JZEA 5PCYA 3PLYA 1E65A 1ILSA 4A2DA 2AVFA 4X4KA 1GS6X 2YAEA 1ZDSA 1X9RA 1J5CA 2YAFA 1IBYA 2XX1A 3FPXA 1AOZA 2YAMA 1W6WA 3MBWB 4AKQA 3EH3B 3FSZA 4YSAA 1BQKA 2BP0A 2J5WA 1YLBB 2ZOOA 3QJUB 3T6WA 1ZIAA 5D4JA 5AZUA 4NERA 9PCYA 4YSRA 3X1FA 1OCOB 1PZAA 1CC3A 3DKHA 2Q9OA 1JZHA 1OE2A 1RZQA 1J5DA 5A7EA 4GXFA 4KO7A 2EILB 1PZBA 3IN2A 1BEXA 3HEIB 2IDFA 2FQFA 3PAVA 1JOIA 5F7BA 3SBRA 1DYZA 2FNWA 3JTBA 1CYXA 2VW6A 3T6VA 1GSKA 2I7SA 4KNTA 4TXVB 1PNDA 1ET7A 4G7SB 1A65A 3CVCA 1AZRA 2XXFA 2AZAA 1NIAA 1PNCA 3NJFA 4A2FA 3H4HA 3C75A 3GYRA 1NPNA 5I5IA 1WS7A 2BHFA 5TK4A 4HIPA 3WG7B 1GYCA 1OF0A 1KGYE 2BW5A 3NSFA 3H56A 1XB8A 2H5UA 1PLBA 3FQYA 2WO3B 1GR7A 1TU2A 2XYBA 3PAZA 1ZV2A 3ASNB 1NZRA 1ILUA 2GHZA 1MDAA 4MFHA 2YAQA 5D4IA 4DP5X 4DP2X 2J56A 3PAUA 1ET8A 1PLAA 3S3CB 3UABA 1A8ZA 1GW0A 4NB7A 4BWUA 3EH5B 4HHWA 2VM3A 1BYPA 1JVLA 1XB6A 4UAHA 1B3IA 5I5JA 4F2FA 2FT7A 1KDIA 1AS6A 2MTAA 2QDWA 3FU7A 5I28A 1AQ8A 2CCWA 1BXUA 1HFUA 4QLWA 3NJKA 3FU7B 1KDJA 2WSDA 5B1AB 3FYEB 2I7OA 3CDZB 3UACA 2EIMB 2GI0A 1KBWA 2VMJA 1JZJA 3EHBB 1AZUA 8PAZA 1ZIBA 1J9RA 3MX0B 4DP9X 4E9RA 2XVBA 4E9VA 2HXAA 1HAWA 4E9WA 2QPDB 3X1BA 4P5SA 2DWTA 3QPKA 2HX9A 2B3IA 4JKNA 1RZPA 3BQVA 3AY2A 1E30A 5AFAA 3EH4B 1QNIA 2X88A 4EF3A 1AACA 2DYSB 2IAAC 1ZDQA 1ZPUA 3DTUB 4G70B 4JHUA 2AFNA 1W6LA 2HZHA 4A67A 5B1KA 2BP8B 1E67A 1NPJA 2FQEA 5TK2A 1V10A 2XXGA 2LLNA 2Y1AA 3NSDA 1AZNA 2CAKA 4M3HA 1SHXA 4BXSV 4FAAB 3NP3A 1KV7A 1KCBA 2XV0A 2PP9A 1CYWA 3PXLA 2FWLB 2YAHA 2JKWA 6PCYA 3IBOA 4Q8BA 2RACA 3FSVA 3ZX1A 1WS8A 2BZ7A 2X87A 1AZBA 2E86A 2WO2B 3JT2A 3S3DB 2VW4A 5B7MA 4E9SA 2BP0B 2EIKB 3WIAA 4G71B 5B3SB 4HCGA 1AZCA 3FYIB 5ANHA 1AANA 4KO5A 3X1EA 2JXMA 3AG4B 2PP7A 4KNUA 3ZIYA 2VN3A 3FS9A 1WA2X 3OMNB 1SF3A 2QPEB 4HHGA 4A2HA 4DPBX 2CUAA 1JERA 6PAZA 2IH8A 4UANA 3TASA 5I6NA 3N55A 1UATA 3OM3B 4L0PB 2TSBA 1MG3C 3NSYA 1T5KA 1L9PA 2CALA 1KYAA 1FFTB 5I6KA 4A68A 3SBPA 1CURA 4HCIA 1BXAA 4YSOA 2PCFA 1WA0X 4ZK8A 1AS7A 3U25A 2IWFA 1QLEB 2XLLA 1PF3A 2IWKA 4BDVA 1NIEA 1OCZB 2FTAA 3ABKB 4GY4A 1NIBA 1SHWA 1E5YA 4JHVA 2FQGA 4NAJA 5B1JC 4YSEA 1PAZA 3ERXA 1MG2C 4A66A 4KO9A 1NDTA 3CG8A 2QDVA 1GS8A 4GP4B 3SQRA 4HCFA 2AANA 1OE3A 4G72B 4W1TA 2ZWNA 2R7EA 3WNJA 1J9SA 2YXWA 2IH9A 1VLXA 2XV2A 4GYBA 4YVUA 1ASOA 4N8UA 3TBBA 1DZ0A 2XV3A 2XUWA 3KW7A 3NJJA 4M4RB 2P80A 2XWZA 3NJHA 4DPAX 2J55A 1L9OA 1L9RA 2UX7A 2TSAA 3TU6A 3PPSA 3CZUB 2YAPA 1ET5A 2YAOA 1L9TA 1QHQA 1NICA 4E9TA 3BVDB 4KNSA 4CSPA 1AIZA 1NINA 2UXFA 3NSCA 4DPCX 3FQ2A 2HRHA 1RCYA 2GIMA 1BQ5A 4WTQA 3WI9A 2EIJB 1XMEB 1M56B 1ETJA 2PPAA 1J9TA 5I5MA 1ASQA 1M57B 4AX3A 2B08A 1PLCA 1A4AA 1PCSA 1GS7A 4HZ1A 1N70A 1IC0A 3QJRB 3SBQA 1NWPA 1TEFA 3UAEA 3UADA 2VW7A 2W88A 3OMAB 1AG6A 2IWEA 4AZUA 2UXVA 2Q5BA 1A3ZA 3KW8A 4ENZA 2AZUA 3DIVA 4E9XA 3H4FA 2I85A 3L45A 2FQDA 3AG2B 4HALA 5LDUA 2H47C 3ABGA 4QKTA 4F7KA 4N4YB 4Q89A 3X1GA 4BWTA 5I6LA 5F7AA 4AKOA 2GB2A 1JXFA 4E9QA 1A4CA 1OOWA 1FWXA 2OCCB 3OQRA 2P80D 4YSTA 4YVNA 2UX6A 4E9YA 2BW4A 5I26A 3TA4D 1SF5A 1I53A 2FJSA 3ABMB 3EF4A 1EZLA 2DV6A 1ID2A 2PP8A 2XX0A 1A4BA 2ZXWB 1JXGA 3AG1B 2QT6A 3T71A 4YSUA 1BAWA 1XB3A 2PPFA 5D4HA 1SFDA 3GDCA 3FSAA 2ZONA 3QQXA 1AG0A 4YSSA 7PCYA 2GC7C 1GY1A 2BWIA 4BWWA 3GXUB 1NTDA 5PAZA 1BXVA 2GC4C 3T6ZA 4K9JA 3ZBMA 2CBPA 4KOCA 3WNIA 1M9WA 2IDSA 1J9QA 4KOBA 1MZYA 2OV0A 1L9SA 1TEGA 5I6PA 1PZCA 2NRDA 1JZIA 4KO6A 5FC9A 3TBCA 4DP0X 5B7FA 1N68A 1V55B 1HAUA 5I6MA 3UAAA 2UXGA 3AZUA 4GP5B 4P5RA 1TKWA 4G7QB 1JZFA 2BWDA 4WKXA 2VSKB 3HB3B 2YXVA 1WA1X 1FA4A 2HLEB 1PY0A 2FT6A 2H3XC 2VM4A 7PAZA 4W9ZA 4AI7A 4BK5C 1EHKB 3NJLA 3RYMA 1F56A 1AR1B 1SNRA 1OV8A 4PAZA 1R1CA 3QJSB 4BDVB 4DP7X 2PLTA 1V54B 3V9CA 2FT8A 1WAEA 3QJTB 2PPEA 2YQBA 1JZGA 1IUZA 2UXTA 4PCYA 4G7RB 2IDQA 3ZDWA 5AKRA 1ADWA 4DP1X 1KCWA 4AKPA 3NT0A 4YSQA 2BZCA 1NIDA 2XU9A 2R7EB 5B1JA 3D12B 2PPDA 3NJIA 2BO0A 3FT0A 1SFHA 1IBZA 2GSMB 1RKRA 3IEAA 2DWSA 1JVOA 4GP8B 1BYOA 3T6XA 1KBVA 2PPCA 1NWOA 2GBAA 5B1BB 3X2QB 4YSCA 2EINB 3NJMA 1PMYA 4DP6X 3N2JA 4DP8X 3ABLB 4YSDA 2Y69B 2MRYA 1SJMA 3QJVB 3AG3B 3FU8A 3UGEA 2N0MA 1L9QA 3WKQA 2IDTA 5I6OA 3S8GB 4BXVA 3T9WA 3IN0A 3NYKA 1AAJA 3CDZA 4RH4A 1X9UA 2J57A 2PCYA 3OMIB 3V9EA 4UF7C 1OCRB 1SDDA 2HX7A 3G5WA 3ASOB 3PCYA 3AW5A 1MZZA 4FA7B 2W8CA 2HX8A 1SDDB 3X1NA 3S3BB 4YSPA 3CVDA 1OE1A 4HAKA 1E5ZA 1GY2A 2CJ3A 3FSWA 1JXDA 1W8EA 2DYRB 4A2GA 4F2EA 5E9NA 2HRGA 2IDUA 2VSMB 2YARA 4YL4A 3FQ1A 1IKOP 1OCCB 3CVBA 3WKPA 3OD3A 1BQRA 2OJ1A 4A2EA
chains in the Genus database with same CATH superfamily
3L95B 1XXFC 1KXQE 1E8ZA 4YZWA 5KS9A 5DDHB 1B6UA 3MYZA 4NM4L 2Z92A 1A6TA 2HG5A 3HG1B 3SB3A 4DZBA 5EOCH 5HI4C 5SX5H 2APSA 4URKA 5C92A 4JFUA 3LKRB 2X6CA 5IREA 2FEEL 2C4FT 4ZW6A 2D7NA 3Q3GB 3L2MA 1CU4L 3VU1A 4A7TA 3PLYA 1E65A 4LLQB 4CN4A 2Z7ZA 4BRVA 3MV8A 2OZ4A 3WTXA 1ZDSA 1JGEA 3G5YA 2ESVB 3OC8A 1J5CA 4FKKA 2P7TB 1YNKH 2Y5TA 5ICXB 3D05A 1KEGH 4RDBA 1RUKH 5T5FA 1WD9A 1LK2A 2PKDA 1BZ8A 2VMFA 3UTTB 3R0MA 3A3YB 4JY5L 2WTPA 3DNKA 4IJ3C 3W5NA 2FHFA 3F58H 3LIUA 2FB4H 5D4JA 1IGJA 1AD9B 3WEXA 1JYXA 2QADC 4Z78A 4UI2A 4DVBA 1RZQA 4WO4B 4NI6A 3V4PB 2OMXB 1FZKB 1PZSA 3BJLA 4LRNH 2ZX8A 2QVMA 2HKFH 4BE6A 3N43B 1FFRA 2YMOA 4TVSa 3CXHJ 5D9SB 3RWDA 5EO1B 5HHOD 5IBTL 1JWUA 2VC2L 3D3VB 3WY2A 1FCCA 1JTPA 4WVRA 1MWAB 4AMXA 2X53A 3SGDI 4LBEB 4PS4L 4XPGH 3SJVB 1J0HA 3INUH 2W9DH 2V5YA 1L6XA 2DMKA 3QULB 4FS0A 1KPVB 3PG2A 1P4IH 2DQDL 2W9LA 2XXFA 4R7NA 4ZNEE 2X40A 5IFHH 1JPGB 1YN7A 2VLKD 5GRJL 5K33A 2ZOUA 3GSXB 4D9QE 1TJIL 2BERA 4NQCA 3L5HA 2IOOA 1CIDA 2VR8A 1T0MA 2IMNA 1OF0A 1UYWL 1WAAF 3BZ5A 3DX9B 3NSFA 3O2DH 4YBLB 1OAZH 1BIIA 3MHZA 1KPRA 5I71C 1ZLWK 3IJ7A 4BD4A 4MD0A 3EFFB 3FRUB 5DZVA 2CLZB 1U91B 2YJLA 3SE6A 1I1YA 1J0YA 1FNLA 4HAFA 1Y6MR 3D06A 3K8KA 5D72L 4W9DC 4NENB 2OCFD 4Y8DC 4Y9CA 4FQ2H 2JJVA 4PJ5B 4FP8H 2IAMA 3LNGA 5CGTA 5IW6A 2OMYA 3TCLA 4EUPG 3NG5A 1J9CT 5EN2B 5D2LB 2OI9B 4Z3TA 1T21B 3RDTB 3WCYA 3WNMA 1KDIA 1R3IH 1YEHH 4BELD 1KXVC 4KBPA 2WYHA 5FHAL 4ETYA 2BLFA 1F4WL 4HGMA 2X4SA 4NNPL 4PJ6A 4Y1SA 2YMTA 2VDNB 4H4NA 2QTVA 3IK2A 3BZ4A 4AGNA 1RURL 3TO2A 2EXWC 3QUXB 4I0PC 4LSRL 3GJFK 4FJYA 3SODB 4X4YA 1WSST 3UZEC 4AJWA 5D70H 2FHBA 3X1BA 5DHVH 3WFDH 4WGWB 3MACH 5CLYA 1HH6B 3VXRA 5DUMH 5JUEL 5EG6C 4NC1C 1RUQH 5CD5C 2X88A 4Y16A 5EIIG 2NY6B 3U2SB 4Z0XA 1KTDB 3FUIA 3N1MC 3GHPA 2ODHA 4FFWD 4F3FA 2ZSVA 4F7MA 1LEGB 2Z91A 4I1PA 1E3XA 2FQEA 3ARFA 1PS3A 1S7SB 2EDDA 4TVPD 2FRGP 2FJHA 1N6QH 2ZX9A 5DRNB 4BE5A 1SHXA 2J5LC 4QHNA 3FCGA 8FABA 3IRPX 2FX7H 3TC9A 2DIBA 4JO8A 1RZJL 5D7LE 1CYWA 1IC4L 5FGCB 4KXZH 4MX7B 4GW1A 2WKOF 4QHKJ 3QQ9C 4FFZH 4GRMA 3HC0A 3WNPA 2IPTL 3FSVA 5CGBA 2ETWA 2X5PA 4Y19B 3ZE2F 2X89D 1T20A 1A25A 3L3GA 2HJKB 3RX5A 2Y6SD 4FABL 5AW5B 2ZKHH 3AREC 1R3LA 4ZPVB 4OLYH 1M71A 4JQIL 4AYFA 4CGTA 4BEIA 1F41A 2EDRA 1W16A 2WLYA 1X5MA 5DQDL 5E8NA 2WWKT 5FA3A 3PDOB 4ALAH 4H5SA 2VDMH 4Y9EA 3FSOA 4TNWF 3D08A 1T04B 1KN4H 2HT3D 2R23B 2P46B 4UANA 3U4EB 2HT2C 2CHDA 5L4IA 1XSKA 3EIFA 2FVNA 2VLMD 5CN3A 5I6KA 1C9SA 5BO1L 1EHXA 3V6OE 3JWNC 2VXSL 4ZYKB 1JWMA 1BXAA 4OD3H 4A7QA 3QRGH 3QR0A 2DBLH 4ZK8A 1OOAA 1SXCA 5MENE 2PR9A 4IKKA 4YZFF 3SE3A 4LCWD 4G6FD 1K3IA 1CDHA 1YECL 4Q9CA 1N0LB 4AEHL 2YUVA 2FQGA 2YUZA 5IVXF 2LHAA 1M6UA 1TFPA 2VLRD 1BHGA 3I9GL 5GGSY 1UB5A 4KTYA 2BVEA 1T7YA 4HGKC 4JM4L 4M29A 2AANA 3RA7H 4LXFA 4GRLC 1SXAA 5JIKA 4W1TA 2AKRA 3I6KA 3GRWL 2EKSB 1D5IL 2YXWA 4Q7DA 3T2PA 3QJHB 4QXTB 5LNEA 3O3DB 1UACH 3MN8A 5L4FA 1QPXA 5D96C 4H0HB 3OZ9L 5LAXA 1BOGA 4TKWA 5I71B 2H32B 4JB9L 4PMFA 4F27A 1QLRB 3BE1H 4XWOC 3DBXB 3BKML 1ET5A 5IJKC 2XWTB 3T6QC 2MOQA 5T3XL 4TSCH 3F85A 2BNRA 1JZDC 2Y1ZA 3VGGA 3QIWC 3I2CH 4DEPB 1R24B 2K6WA 2W0PA 3GBNH 4KU1A 3MJGX 3H2PA 4OKVB 4KZCA 3UBXB 1YCSA 3TT3H 2BRRL 1BQ5A 4HUVB 4OZFG 1KJ3H 1NBQA 1D5BA 2UZXA 4ZMTA 5FCUH 3EUDA 2J73A 2EIBA 2OCJA 4LPYA 2V2XA 1FNGA 3CBJB 4EN3D 4AL8C 3TESA 5F9WB 4AJ0A 4RETB 2W9EH 2CHWA 3HN8A 5IROD 1NANH 4P2YA 4AE0A 2R0WL 5E9AA 1H3UA 3SD2A 1E0OB 3FUJA 3KPRD 5D1XE 4O00A 4KZEL 2FQDA 4NQVB 4OZ4B 4F7KA 4N4YB 5IHUL 4JQIA 2DQTH 5L2JA 3Q2CA 3VWJB 1MCOL 4QRRA 3P9LA 2OSLA 1YEFH 1A4CA 1NCUA 1XV8A 4Y2NA 2APFA 3GI8H 5E51A 4DKFL 4ESKA 3EYOA 3OQRA 1J48A 2P80D 3LKPB 4M56A 1GYWA 3EGSB 3TEUA 4AGQA 2L4OA 1VPOH 1JNJA 1H6UA 2WLJA 4JDZA 2A1WL 2ATAA 1SF5A 1WFUA 1UB6A 3RWEB 1THCA 1WBXA 3EO1A 4B0MB 3NCJL 1QFUL 4ZTEA 4OD1H 3CAFA 3T71A 4MMZA 2Z8SA 4N8PA 3QUML 1TTAA 4NAMA 4P9HC 1EEYB 2R2BA 1BAWA 5AZEH 2KDYA 3LPFA 3TP4A 1EEZB 3MZGB 3H8NA 1AG0A 3DGDA 3DUUA 3VG9B 1CT8B 1KZYA 1UA7A 2H2SD 3P0YL 3IGLA 3DYPA 4ANXA 3DO7A 5L7XL 5D2NA 3VMNA 2BSDA 1ZHKB 5ESQB 2J88H 2GC4C 4UMSA 5ANMA 5B4MC 2RFXB 4MZ2A 3H0TA 3VCLA 4QHLB 1N59A 2YPKA 5DURB 5IMMA 1U92A 3ZDXB 4OZHF 4B9KC 1QO3B 5T1DH 4PWGA 4EI5B 1ND0B 3FRPG 1BVKA 4KO6A 4K94H 5FC9A 5C0CB 4UAOC 3UCQA 1IFRA 4IBZA 3RVUD 5ITFA 2AHIA 4GFXA 1DUYB 4UTCA 3GRWA 1YEIH 3IGAB 4WUUD 1KGWA 4FLHA 3TWCH 1OSPL 2QGEA 5EZJA 2X6AA 1JZFA 3AREB 4Q6YA 2A9NH 4CVXB 3WFCH 7FABH 2YXVA 3PWJA 4P2OD 4ODSH 5C0NC 1J8RA 2EICA 4UIKL 4Z9KB 2YC1A 2FT6A 3GXIA 4ELKA 4BH7A 1T66D 3P4MB 3NJLA 4N9GB 5E9DA 3RYMA 3LRSA 1SNRA 4PRHD 2F19H 3S36H 1HHGB 1KT2A 3ZHKA 1WAEA 3I3DA 1MLBB 4FNUA 1UM4L 1ZGLB 4WZ9A 2EUZA 2FH6A 2CIKB 1SMAA 4ZT1A 1YEGH 4MNQB 1KTRL 1ZT7B 3QYMA 1OGTB 2BZCA 1EFXD 1QSFB 2P5ED 3MXWL 2WMPB 4TLSA 4YHPB 4KGLA 1GOGA 3ETBJ 5LGJA 3II1A 5EORH 2IAMC 5DD1L 1JHLL 2A6KB 3ZZ1A 3Q43A 1LQBC 5ETUB 5G4OA 5K39A 1YVLA 3RJDA 3HUJA 1UM5H 1RK7A 4D9LH 5K9OA 2AEIT 3FB6A 2UVFA 1PPIA 3D39E 1NWOA 3TFBA 4KJPC 4MJ5B 5JW3H 1MJ7H 2FNBA 3GIVB 4ABVA 4E0RB 4PRPA 1NGXA 3EOAB 1C5DB 3RZWA 3CHSA 5DSCB 2PO6A 3SDAD 4NKDA 4U0RB 4EVNA 4LEXH 5DYOA 2MKWA 2E4FA 2VDKB 5ILTL 3KXFD 4FHJA 2FCBA 1X5HA 1S5HA 3FRPA 3QJVB 4JN2B 4LSTH 3FO2B 3MYJB 4MXVE 2N7BA 2ZOTA 4PJIA 1M6OA 2WK2A 4Y4FA 4PVMA 5CP3A 5IOPB 3DYMA 3P3TA 4MJHA 4ZAKD 4PJBE 1RK1B 3VFWA 4UV4L 2EDNA 3QUMA 5HHME 3OHMB 4O4YH 2A73B 4KKCD 1KYUA 4PCTA 4QAMB 2CJSA 2J57A 2OM5A 1UJ3A 4KRNA 2XZQL 1HE8A 3NQIA 3DX1A 1BF8A 4G7YH 1F86A 2D9CA 1AYRA 2N0KA 2WXMA 3H2WA 3MX0A 4Y16C 1K4CB 2NW2B 1LNUA 3OAUH 4JFYB 4D0CA 2H8PA 3FUKA 1YPZF 3DUSB 3WTUA 1CL7H 2Y3AA 3F7KA 2OX5A 3BD3A 3QZWG 1U9KA 5DRWA 3ARFC 2UY6B 4K5MA 1OCCB 3CVBA 1QLEH 4MJJA 4XN2A 3Q6FB 3ECVA 4HJGB 5CEZH 2JH2A 3KYKH 4YDVB 4KWUA 4PJGB 3HE6B 4F7EB 5F9DC 3PU7A 1F00I 1M7UA 2ED6A 4MA3B 3L1OH 1JFQL 1NEZB 2QGCA 3BWUF 5JO5B 4GG6B 1NBYA 2BS71 2ZX5A 3GK8L 4L3ED 3T0EB 1NMBH 4DZBB 4OI8A 3RQ3A 5ICZA 1OGSA 4DP4X 3O45A 3E9TA 4LHUB 1I3RA 3QNYA 3U6XS 3FKUS 3QCUL 5EBWA 4WNSA 1JIBA 3LPOA 4QF1B 2QQLL 3WUZA 1JNHA 1D5XA 1M2VA 3HNSL 5AVQB 2DKMA 1UWGH 3GSOA 4LP8A 3CV5A 2E9GA 1YJDL 2WQXA 4ES9A 3H7BA 3BVNA 1CGTA 3WDHA 1JHTB 4HIJB 3N1GC 1OCOB 2XN1A 5ACLA 4LGPB 2JCCA 1IV8A 1OE2A 3QUYD 5HVHC 2DWDA 4DN4L 1NKRA 1U8MA 2R69H 4Z0BL 4DQOL 1KJVA 2JTDA 3ESMA 2XG5A 4Y89A 2PR4H 5AOZA 1I8UA 3FQXB 3HLAA 3IDGB 1E9PB 3CHXA 1MKFA 3RWDB 2ITDB 3E2HB 3PHSA 4IOSD 3SE3C 3H53A 5EEXA 3DYOA 3APNA 4OGZA 5JIIA 3RNKB 4ONFH 3QZWA 1IGMH 3L17A 1IM3A 4X6FB 2Z4TA 3FTXA 1AVAA 2P52A 2FBRA 3OGCA 1GGBH 4HH8A 4TN9A 4FQPA 4HMDA 3FCSB 5BZWA 1E8YA 1OB1B 3LJ3A 4OBRA 1OP3K 4R7LA 3EJPA 4KROD 1G4MA 1IGIH 2X3AA 4LU5H 2VR4A 4JBSA 5DEGA 1BIIB 32C2A 1A4JB 5L9DH 5DZJA 2I5YH 3RVXD 1ILUA 5C0BB 3ZT6A 3QI9A 2Y24A 3ECBA 4MFHA 2NYKA 2XKNA 3PAUA 4XO4A 3D0LB 2LOEA 2ZG2A 4Z76A 3L5WA 3TN0A 4QCIA 2WC7A 2ZNXA 2DQIH 1DVFD 4LEOA 3U4AA 5DVOA 1U8HA 1JNNH 1ZS2A 2F53E 3LOWA 2Q2LA 4JJOA 3TCLB 1J0IA 1EXGA 2X0UA 1RZJC 3GMMA 4KMTL 4NHCH 5T33L 1BXUA 2R9HC 1R3KA 4U7SA 4GQRA 1C1EL 3VFOB 3BISA 1ITCA 3AUVA 4LK4A 4ZMLA 2J8OA 3GSUB 4ZS7L 2FO4B 2F61A 4JR9H 4LLYA 4HULB 4OJCA 1OLLA 2G4EA 1ES0A 1ZJBA 2JIXD 4FKHA 4Z7QF 3QIUA 2NYZA 4YPGA 4AV0A 3TO2B 5LAPA 4BFEA 2FUQA 4J3XA 3WMPA 4X4XA 2VB5A 4LOVA 3ULAB 4FDWA 4ZFQA 3MRJA 2B3IA 3E1F1 4D9QD 5F7FA 4M8UA 1DJXA 4AC4A 1YEEL 3BWAA 4P4RA 4W9LC 1LDSA 2CR6A 4HEPG 2K45A 4WY7H 2BHYA 4JHUA 1VZGA 2QGBA 5GS1B 2GTZB 4MMZC 3OWRA 3TIEA 3KJ6L 2VMEA 3TVMA 2LR4A 1ZE3C 4P46D 5FO7B 2LLNA 3DSFH 1XR9B 2WTOA 3WLBB 3QCVH 1UGKA 3I6SA 4CA4A 1PFCA 1O6SB 1UA6H 2MH4A 3HAEG 3W9DB 2FO8A 4JS7A 1AOHA 1U6AH 3C6EA 4EBQH 4FEIA 2IQAA 3SYQA 5D2NC 2X9WA 5E1HB 3SKNA 3TXAA 3O3EB 3ETBF 1M7IA 6PCYA 3RL2A 1IEAA 2WN2A 5TDNB 2RACA 3FU5A 1N4XH 2AXGA 4UT6H 4DN3L 3QPXH 3ETSA 5G4MA 3F83A 1AZBA 1MFBL 4TSBH 1BP3B 3P77B 4RIRA 1XF2A 3BP4A 1W9XA 3UTTE 1AZCA 1MJ8L 4H13C 4ZSOA 1AANA 1SMDA 1QRKA 3QSKB 4HG4K 4XBPA 3OAYK 3QDMA 2NXYB 5FO9B 1ZKAA 3REWB 4AYFB 1SF3A 4NNXB 5I76A 5MI0C 4PCKA 1K8DB 5I75B 4H5SB 1HZKA 5C0FA 2NCMA 3I85A 4JFFE 4ATTA 4Z3IA 3SO3C 2BXYA 3II3A 3IJYA 4GXUM 3V8OA 3N40P 2HKAA 4S1RH 5MEOB 2K3HA 2F5BH 1NMCB 3SJVE 1S9YB 3L5XL 3U25A 1Z3GH 1H3VA 2G3MA 5GS0H 3CFMA 5DR5L 4F20A 3RNQA 2D8KA 3UJJH 3MUY1 2B7DT 3ZTDC 4YSEA 1U3YA 3PWNB 3MRQA 4XPTH 5CEXB 1SLVA 3CG8A 3Q2VA 4WGVB 2CCVA 4PLNC 3M8OH 4P05A 5D7LD 4AJYV 5FM5O 4X5RA 4Z95H 5AB0A 4L9LA 2EO9A 4E2OA 1TU2B 2QSCH 2R39A 3OKMB 4G6AD 5FW6A 3ZTNL 2BK8A 5LWYL 5MERA 3CN0A 5FEBA 2PO6C 4QGTA 3D34A 3IMWA 4DPAX 4BFIB 2EVJA 3UZVB 3AT9A 4HOXA 3ULSB 1BZ7B 2HPOA 3BSGA 3H2QA 2OSWA 1GZPA 3UTSE 4XMTA 4P57A 4N2AA 1DBJL 4B9GA 5SWQB 2W91A 4Y4FC 1D5ZB 1IKFH 2VLLB 4G8GA 4M6AA 5JW4Q 2YO3A 3TZVD 4JMNA 3LB6D 4I18A 2BNRB 4S1SL 4I0CC 5KSVA 3RI5F 5C6PB 2O6CA 1LDPH 1UJ3C 2PPAA 1FUNA 5EBGA 2CDFB 1GZHA 1ASQA 3GS0A 5F7NC 4NO2A 4U6XA 3FJTA 1V7MH 3MLXH 1ZLWH 1Y18A 4XGZA 1FFPB 4LPUA 1Q1PA 3NSXA 2JKSA 2VW7A 3MRNA 3DJZA 5MEPA 5FUOH 5MEND 1EGJH 3DK0A 2Z35B 3PV6B 4W70A 3VGDA 1QLFA 5HYSG 1RU9H 1DQIA 3TBWB 3QORB 4XNXH 4S10A 1TCMA 2B4CL 2Q3XA 1OM9A 2FATL 3KWWA 4U3HA 1GRWA 4L4VE 5LDUA 5HYJA 2EUVA 5I6LA 5B3NA 4IMLB 3VH8G 3WENA 3G08B 1ORQA 2Q86B 3G6DL 3W0WA 1U2YA 2P8PA 3LZQA 4M8VA 3LHPL 3QFJA 5TF0A 3T1WA 3CFUA 4NO0D 3PP4L 5DVNA 3TJEL 3P9LB 4O2FA 1Z66A 3TA4D 4R4BA 2O5XL 1QSEE 4CSSA 1B2YA 2PXYA 4YE0A 2D7TH 4JM2B 1JXGA 1EMTH 1UB6B 2X4RB 4RCAA 2PPFA 4K7PL 1NCBH 4DGYL 1I9RL 3O6LL 4MMZB 3QIBD 3QQXA 2FL5B 5EO0A 2YN3A 2R2BB 3L3OA 2SEBB 1NGQH 1ZHLA 1P5VA 2BWQA 2F18A 4OY9A 4PWIA 3RVVD 4KTEL 1SN2A 2V4LA 3L13A 4IOFC 4IRSD 1IQDB 1YC8A 3S5LB 1BXVA 2X6UA 4M8QB 2CBPA 3WNIA 3DO7B 1QVOA 4PLJC 4OIAA 1M05B 3DRTB 3H0TB 1XGPA 3VCLB 1AGDB 3AABA 2HFEA 1U95A 2NY5L 4UT7H 1BLIA 5I1LB 1WCQA 2J1KA 4PJXB 4QRQB 3COOA 2C9VA 4WI7A 3F62A 4PP1C 4J3UA 2ZCHL 2FZ3B 3NFPB 2VLJB 4F8TA 3R19A 3IDXL 4HIEA 4QOKA 2Q2EB 1SM3L 5D1XD 3S98A 4AZ8A 4JDTH 5IEKA 3DOHA 1DFBL 3LV3A 2OMBA 4ODHL 4P5MA 4DTGH 1P1ZA 1OV8A 4ZUVA 5SWSA 4QKXB 2DQHH 1INDH 3SO3B 1GGCL 3BZDA 2CH8A 3N9GL 5D5ME 3US1A 1I1AB 1ICTA 4JANB 4N86A 4Q58C 4WLCA 5JW5A 5FW7A 1MNNA 3D85A 2ZYSA 1VHPA 2IDQA 4PIRF 3Q5TA 4EN2A 2VR3A 5E2UL 1IBFA 4UM8B 3BP6B 3CD4A 2YRPA 5ES4B 4RMUA 3QI9C 1I85A 2MEJB 3DV6B 2DDQH 1TJMA 3F2LA 4WTXA 1Y7VA 3QXTA 3HBPA 3TN0C 1V3JA 5DQ9B 3WSQL 1IQWH 5GIRA 4ELMB 1KBVA 2X10A 4UZGA 3U46B 2HH0H 4OLUH 5B1BB 4QHMA 4DUWA 4LSUL 2HVJA 2Q8AH 3G6JA 4P4KA 1CLYH 1NGXB 1Q90A 3ISRA 1FCGA 3EOTH 5F7MC 3PQYA 4EVNB 4X5WA 3IJSB 5DYOB 4V11A 3B34A 4WWKD 1QUNB 1SPDA 3PGDA 2Y7NA 4NJ9L 3WDJA 5EEVA 3LKQA 1C08A 4F57H 3DDFA 4Y4FB 2OTWA 3QIUC 1F6FB 2ITCA 5AD0B 1NSNL 2ROXA 4Y2DD 5DTFA 1NGWB 3F6LA 4B3VA 4WUKH 1YJDC 3UZQA 3UG4A 1IVTA 4G9FB 3UBHA 1K8IB 2HX7A 3ASOB 4LF3B 5GJTL 1TJHH 3LH2L 1P84J 3ILPA 3JTSA 4I3SL 4Z18A 4EOWH 1H8LA 4R9HA 5B38A 1RJLA 2NYYD 3BDBA 3MRRA 4D0CB 4TPRH 5FKAA 4MXVF 1S5IH 1UXMA 4U1NA 3TVMC 2XN9B 4TQIA 4X8GA 4PMEA 1F1GA 1MCHA 3T8XB 2O6DA 5DD6A 5LXVA 4PJBF 3QXUA 2YPLE 4LLUB 4G5AA 1NGYA 2J4WL 3EJYC 4NEHB 2P1YA 5KBKA 2BSRA 3MLTB 1URIA 3NP4A 4XBGA 1G7LA 2CO6B 3FH7A 1N5AA 3EJTA 3D39D 4MAZA 1OT1A 1XCQA 5GGQL 4AOFA 3CU7A 5GZOA 1GS6X 4GEIA 4TRPH 3G6AA 4B50A 1DVYA 2CR3A 2G9HB 3PXHA 4Y4KB 3O8XD 1OCWH 1MFMA 1P53A 4L1DA 4X99B 4AIXA 2DJSA 3IF1B 4GMSH 1D5XB 3ZL4L 5INDB 1J86A 3L2LA 5JA9A 4P2RE 4C4UA 4RWYL 2X3CA 3X3FH 4AGOA 1J1XH 2CBQA 4A2LA 3ZDXE 5CU5A 5ABZA 5E5MA 1OAXH 3IDIB 1VFOA 4GAYA 5HHMD 3TJPA 1Y6NR 2QQNL 4IBVA 2C9RA 4GXFA 3TT1L 2JCCB 1TKWB 2YGOA 3SPHA 3IN2A 4UIMA 2D4FA 3PAVA 3PRZA 3O6KH 1IM9D 2JKJA 3IPFA 4OM0L 2NNAB 2CO1A 2KPNA 3VMPA 4I8DA 3JWOL 4PVNA 2AJZA 4PJHB 5HDOA 3FO9B 4DO4A 4FQLL 2ZKXA 2WZ5A 4L8SB 2VDOL 3GRBA 1I82A 35C8L 4NUMA 3HPJA 2A74A 3GYRA 1U8IA 1BG9A 4ZUSB 3WMQA 1WS7A 1K9TA 4L9LC 5TK4A 3T77A 1HX0A 3MBXH 1FNHA 2KH2B 4HJJH 2ZX7A 2LU3A 1JK8A 1H5BA 4ANKA 2G3NA 2YD2A 2APTA 2VDLH 2X2JA 5C71A 5L0QC 5CUSH 2HJFA 2C1PA 1QSFE 3KPOB 1HVXA 2W65A 1TCRB 3IGFA 4P5TA 4AYDC 3D69B 5A6LA 3MLWH 1Z5YD 4N2GA 1RIUH 3UP6A 4TNEA 3F00A 3KVDD 3IVKA 3RVTD 3AROA 1PLGH 4ICWA 4EAEA 2YD7A 2KT6A 2KS0A 3EOBA 3ARVA 2VR5A 4OCYH 3ULVE 2C9UA 3QK0A 4PTUB 4WV1A 3VGAB 3NDYE 4I18C 5EZOH 3VFNA 3WJLA 2XKNB 3N44F 1U41A 4MQXC 1G7MA 5E8OB 1GZHC 2G75B 3L5WB 4ZOEA 7TAAA 3IFNL 3QWQB 3V0GA 1IAIH 5I28A 4L3CB 4ADGA 2C3GA 1K5WA 4O51B 2E9BA 4NKMA 4XP1H 5TDPA 3GMMB 3K1KC 1JPTL 2P44B 3QJFA 3Q1EA 2Y23A 2ERJB 1R3KB 1X7TA 2I7OA 3NK3A 3C5SA 1XF4B 2HJLA 1LD9A 5BS0E 4GBXB 2PWHA 1S7TB 3SCMA 1A1OB 4Y7OC 4JZJA 2AEPH 4PV8B 3EDJA 5I1KL 3CH1B 1F2XK 3A67H 3KPMB 3ARRA 1BQHG 1TOXA 2ADFH 3O3BB 5AWNL 4NCC2 1T6WA 4NP4H 4GSRA 4U1GC 1ES0B 1NAMH 5D7IB 4AEIL 5IMKA 2JELL 3DOSB 4HP5A 4YPGB 5F1OB 2WCPA 4L29A 1IBDA 4OLZL 1G7IB 1G6RL 4YUEL 1AXSA 4J39A 4KJYA 1NAKL 4UBDD 1I8MB 3QDJE 5D7EA 2WXOA 4YO0A 1T1XA 3D25A 3SE4A 4QNPF 1TQVA 4G70B 2APVA 2PXYC 2WWMC 4Z3GA 4M3KB 4QGYA 3MOAH 4FQCL 5BUGA 4PY8I 5DLMH 1R5IB 3BH9A 4NDMA 4FA6A 1ZLVK 2IH1B 2GW5A 3NSDA 3ATDA 4M5ZH 1YNLL 3LY6A 5CS7A 4U6VH 4EZLA 5H37A 3WFBH 5FFGA 3ULUL 4UT9L 3L3IA 3ZKXC 2AQ2A 2BVOA 2J43A 3C5JA 1EHLL 1DEEA 1KC5L 1Q0XL 1WS8A 5GXBB 1M7IB 2F53D 1S3KL 2LU7A 1S2EA 3D52A 2AXGB 3TF4A 2EIKB 4LZKA 4YBQC 3WHXB 4HV8A 5J56B 4YEEA 3W39A 1CIUA 3QDGA 3IJEB 2QQKL 1C7SA 3P2TA 4NKOA 4RZKA 1XF2B 1JE6A 2ZWYA 2WXRA 4ZSOB 4TL5A 4UTAL 1CLOH 1N2RA 1MREH 2QPEB 5JZ7C 1A6VH 2B1AH 2ICWA 1L5GB 3R18A 3WIIL 4K71C 4GMTL 3IMTA 1T0NA 2ATPB 5I76B 2DQMA 5E2WH 3V5HB 4B9CA 4B27A 1U8PA 2J8UB 3TGXA 3QH3A 4CC1A 5C0FB 2AQTA 3ENEA 3VXSA 2E7DA 5GHWL 3AM8A 2DH2A 3CC5B 4HS8H 4W9CC 3IJYB 3QHFL 3RZCB 1GTNA 3ZGIA 4M7KH 1RVFL 3FTVA 4MJ4A 5ISZE 5EU6A 2Q6WB 5EIQA 2NLJB 4RRPA 4YHZL 2FTAA 1KENL 1D7DA 1OEZW 3ISWA 5GZNA 4M62L 1OAUL 3NCEB 5AYUH 3SDDB 2EYTB 1WBZA 3BXNB 2DI9A 1MSPA 3H9YA 4J27A 1I85C 3O4OB 3QEGL 4Q74A 4P59L 1EJ6A 2WLKA 2E9WA 3N43F 3POCA 4KPHH 3RPIA 5AENA 5EU7E 3JXAA 1GS8A 5BOZG 5LQBH 3GO1L 4WSGA 3TOPA 2UZIL 1A6UH 2CO7A 3TH3T 2Y7LA 2KQMA 2B4CC 1UCBH 3C6LA 2H1PL 4XZUB 2H4EA 2YWYA 1BFOA 3NJJA 5KVFE 4IDLA 3MNVB 2W07A 2XWZA 4P4KC 4ZQKA 2OR7A 5C0BE 1J5OL 4P23A 5IJBC 3JV5A 3UTTD 5ID0B 4CC4C 2VE6A 3LRMA 1G6RA 5BQ7A 1I4FA 2AJ3A 2H41A 4NSKA 5CGMA 5JIDA 3I84A 4FI6A 2WVSA 3QRFM 3KR3L 4GH7B 4IIZA 1DUZA 4P57B 4E9TA 3K71A 4Y2OA 1TSRA 1U30A 4PJAB 3P73A 3HCVA 4CSPA 3HR6A 1HI6A 1VFBB 2OL3B 5EO9A 4K8RH 3FB8A 1XF3A 3PWPE 4JFFD 4XHJC 2XQBL 2JTYA 3QFDB 2X4QA 2DLGA 1FC1A 2FJGA 4I9XA 4AX3A 5DGQA 4XT1C 5B8CB 5I1IH 1UWXK 2GJRA 3V4PH 4HZ1A 4GS7C 3MRFB 4HOWA 1OP4A 4NHUB 5AW1B 1AFVL 4X8JB 4UT9A 3SJVD 3K2KA 3OAZK 1Y18B 2F58H 4G82A 3RBSA 2PWDA 1DN0A 4MRBA 2V5TA 3UPAA 1MWAH 1AHKA 1C5CL 1GC1H 2AF2A 3DETD 5HGDB 3KW8A 1YUKB 2NY5C 5DMIL 2E27L 4LGSB 1WZMA 3ZUNC 5D2LF 4F2ME 4KXAA 4NUQA 1QRNE 3U9UB 1QLFB 4LLMB 1EZUA 1TETH 1D6VH 1I8LA 4QKTA 4BWTA 4UQIM 4HHAA 1XAKA 4HJ0C 5FYKL 3MRGA 3ELAT 3Q8CA 4H88L 4KY2A 2EUWA 4I48A 4N2MA 4J6IA 4UTAA 1ORQB 1BVLB 5IB2B 5IB3B 1K5NA 2BPBA 5GZOC 1J1OL 4K9EH 1EFQA 4YXHH 2A6IB 1U33A 1KBBA 2MPAH 3UTSD 5JHLH 3LNEA 8CGTA 2ZONA 3R8QA 1CDIA 4J4PD 2GC7C 1ETZB 1CICD 5L4MA 3WKML 3CPLA 3R0NA 2QTEA 1KBKA 2XBDA 5EWIL 2CRIA 1MI5B 4PJFB 4TULH 4LAJH 3U79A 5D55A 2CDEB 2WQAA 3MBWA 5BRZB 1VZIA 4Q9RH 2F7IA 4K3EH 2JXMB 5TH2B 5FO8A 4J8RB 1L9SA 4E9LA 3UH8A 4N1EA 3TBCA 4GQZA 3JVFC 4UTBH 4A7VA 2FYVA 2DLHA 1AY1L 3UAAA 3N85L 3KBHE 1HILB 2C9QA 4Z7VE 4EDWL 3GPEA 2UYLB 3O9WB 1BJ1J 3GZQA 3ARUA 4H1LA 4P2QA 5CILL 3PWVA 1BX2A 2EDTA 3SSGA 2VDNH 3BQUA 4IU3B 3LZRA 2BC4A 2EABA 4MNGB 1PY0A 5CINH 2VM4A 4KRPC 4JFHE 4WU7B 2K9UA 5GS3A 1EHKB 2OULB 3G5XB 4L4VD 2A74C 4Q6IB 4WJKB 1E27B 4J2XA 3RY5A 5D1QE 3WIFA 3I6GB 5IEKB 1IBHA 1MIEH 2NY6D 2VN4A 3LV3B 3O2VH 4P5MB 4PV1C 4Y9GA 3BAJA 1H5BC 3GMRA 1P1ZB 2PLTA 2VYRE 4EIGB 1LO5B 3BN9D 3QJXA 1CFNA 4P5TC 1JZGA 4OZIA 5E6ID 1DJIA 3INOA 5F88A 1LM8V 1QSED 3OAYH 3O3AB 4YOKA 3QG7L 1KCWA 2VT0A 4L1SA 3VXUB 4AKPA 1X5IA 3OG4B 2OW7A 4MSWA 3D12B 4PJ8B 3V5KA 1NCGA 5CZVL 4WV1C 5LXGH 1MW0A 1RKRA 5AVXB 3IEAA 1NFKA 3WJLC 3QEUA 4O9HL 4R26L 1RUAL 4BSVA 1UTDA 3QUZA 5C7XH 4XCYA 4TTDC 3AXLB 4Q6KA 1KJ2L 2J72A 4YSCA 2Q76B 2P8LA 5SWZB 4AQAB 1DLFH 5D5MF 3ZXAC 5TE4H 5I1EL 4FQHA 1UXSA 2EVGA 3PABA 1TZIB 4A7GA 1SUHA 2BFGA 3KCPA 3LZOA 2JV6A 1UXWA 5JXEA 2AQPA 4RGNE 1RK0A 4FE9A 2GPZA 5E4EC 1NFDE 4XX1G 2FJFA 3S37X 2ID5A 3PQYB 1MCDA 3SCMC 5IKCA 3VXOA 4WI4A 4JZJC 2J3SA 1FZJB 1Q72H 4X42A 2E8ZA 5DJ2A 5EOCL 5K9KA 5E1IA 1KXTA 3PGDB 4Z23A 4WJ5B 3IDJA 3IN0A 1ODUA 2QL1A 3C08H 1A66A 1FHNA 1BF2A 1KIQA 3PE9A 4KUZH 3VXTA 2PCYA 3VXMB 1MZZA 4FA7B 2OP4H 4HUCA 2V2WB 1S9VB 2IPUG 3STBA 3SE4C 1YNKL 4KXZI 1O75A 1OE1A 1QAWA 3HG3A 1KEGL 1AQDA 1E5ZA 1RUKL 3Q01A 5IG7B 1BYNA 4F2EA 4K3GA 1TVBB 1MHCA 2YD9A 4BFFA 3GKZA 1ZHNA 5FWQA 2G2NA 3F58L 2FB4L 3MRRB 4IHOA 2JKXA 4PJDA 4XRCA 4NERA 2QVFB 5DD0H 3TTYA 5KVDE 4OR1A 3W2DL 3BDYH 2JB5H 3JWOC 5DWUH 4H8HA 1WTGT 4N0YH 1A8JH 1QKZL 2NNXA 1CUOA 5KVEH 4LRNL 2C9SA 1HHJA 2HKFL 4M93C 2F2HA 1GAFH 2NY3B 1ASPA 3MVSA 4L5FL 3MRCB 3L4XA 1OK8A 1YNTB 2NZIA 4LFHD 3VDCA 2VABB 3EO0A 3QISA 5E2TH 1EANA 1F4HA 1D7FA 3T8MA 5CMAB 5CCKH 3NBNA 4HH9B 4X4KA 1WP6A 4XPGL 4KK6C 1WRFA 2X4TB 3MLRH 3TJHD 3SQOL 3INUL 2XX1A 1XCQB 3FBQA 3C2AL 1HWHB 2PTVA 1P4IL 3NESA 4J1UB 4LRIA 1USQA 3DIDA 2H32H 3C60D 1BQKA 1VF5C 3BUQA 4QD2E 4XNQA 5IFHL 5MP6H 1EX0A 3T6WA 2NT0A 1S9KC 2ARJQ 4GIAA 4JRYE 4DH2A 2YKKA 1G1YA 2L7UA 3QNXB 2Q9OA 4DO5A 5KG9B 1CLVA 2C7UB 3O2DL 2B77A 3BKYH 1OAZL 1RMFH 2NSQA 4DZ8A 2V6HA 4HSQA 1KCVH 3AM8C 1JF5A 4PJXE 3VM7A 2Y3NA 2FH8A 3UJIH 3TCTA 5IEHB 2YSSB 4KXBA 3T6VA 4JAMA 5I8CA 5HTSA 2DJMA 1KJ2A 1U8OA 5GZNC 4MVBC 3CFIC 3HHRB 4FQ2L 4ZW5A 2HSIA 1PTZA 2XCMC 4UNIA 4XVSH 3ZDXF 1FL5B 3DTDA 3GFUA 5IUCA 2YPLD 3BGAA 3GB7B 4XP4H 3NJFA 3ZYIA 5E8DH 2CU9A 2EYRA 4PFEA 1R3IL 3OZLA 2X2HA 4K7PY 5FDWB 3IMVA 4RAUA 3C6LC 1YEHL 2A74B 3N40F 3TBYA 2Z7UA 5FFOA 4FG4A 1QEXA 4XMKH 2QJDA 5HXMA 4AQ1B 3V4UH 4MB4A 4P23C 1OQXA 2PWEA 4QXWA 4POYA 2HJFB 1PEZA 1L4IA 3CVHB 2W65B 2ZXCA 3QEQE 4ZJ9A 2V9QA 3UO1L 3ASNB 1N5YL 4XMUA 4GW5A 4G8FB 1FFNA 4P2RD 5D70L 2EDJA 2V9UA 1NANI 3WFDL 1CD1B 3EOBB 3MACL 4YDLC 5DURD 4APQA 5DUML 5FGBA 4WV1B 3SDCD 3FF8A 4A63A 3FB5B 2FX8H 3PHAA 1DVQA 3MLVL 1RUQL 5KN5B 3VFNB 4LLWA 3PUCA 5JDSB 5J1TC 2OFQA 5CJBA 1VKXA 3QPQC 2CCWA 1I7ZA 1IAIM 1FBIH 3EDDA 3ULUC 3MRHA 3JUZA 4NT6B 2XPYA 4NKMB 1N64H 4JJ5B 1N6QL 4OZGA 1EVUA 2D4DA 2V0AA 2M2DA 3PL6D 3HZYB 3QJFB 3ULVF 2FX7L 3RIKA 1HXMB 1S78C 4I89A 4KKZA 4MDJB 2AS5M 1FNEA 5BVJA 3QWOA 4G9FE 3GLZA 4JFXA 4FFZL 5C0RH 1I8LC 1XR8A 4IRJB 5I2IA 4WI3A 3D51A 3FOMB 4ZUWA 3V10A 2A6JA 5K69A 3HVDA 4ZOAA 3CZFA 1ZV9A 4QRUB 1HDMA 2YIHA 2IWGA 1UQSB 3G5VA 5DS2A 1UADC 2XN9E 2ZKHL 2OJEA 5B39A 3MV7A 2I9TA 1AXSB 2IANA 2Q3AA 3VD0A 1QSFD 2N7SA 3O2DA 3CDCA 4N0CC 4K2UH 4G7VH 4ALAL 2VLKA 2ZSWB 2NQCA 3DGGA 2VDML 2ZICA 3BFQG 3S6CA 1N3NA 4WFEE 4MD5B 2AI0H 3SPCA 5KSBB 1KN4L 1LJMA 2DKSA 1KCSL 3U9PL 3BH9B 4RX4D 4MA1C 1FYTB 1TVDA 2VR6A 1KJMA 4BXSV 3VI3E 1BBJA 3ULVD 1KELH 5DFVD 4GLRI 3BIKB 1U8KA 4H25A 1QEWA 5FYJE 1L0QA 3DXAE 5KBLA 1BD2B 1NCNA 4IBWA 3QRGL 1EAPB 2DBLL 3TBSB 1QI5A 3GMOA 4M93B 3ULVH 2ADJA 3AWFA 1YG9A 1DEEB 3U6RA 1USZA 3PUUA 1BJ1H 5T1LB 5BZDA 2D31A 3FFCE 3V2AR 1HOCA 1U3HD 3AG4B 3OXSB 4HV8B 2VDKH 4RAVA 5HVWA 4PN6A 4GG6F 3D30A 1LO2H 1L0XA 5BS0D 5HVFB 1I8IA 3BQUC 1GGUA 3EG9B 2Q20A 1SLWA 5ACMA 4ZMWA 5DEZA 1ML0A 1N2RB 4XNBA 3RA7L 3R06B 2QR0B 5HY9A 2ICWB 1IARB 2FSDA 1WAAA 3VI4A 1EJ8A 5CD3A 3LRKA 1A7RH 1PJ9A 5T3ZH 4Y9BA 3DMMA 1FAIH 1XF5A 1B0RB 2VAAA 3GUTA 1CURA 1UACL 4X7CC 1NCJA 5DHVA 5ENWB 3T0BA 4HWEH 1VFMA 2KKQA 2PCFA 3D8MA 3QDJD 2WOBA 5DT1H 3BE1L 1DBKH 1YEWA 3IWUA 3U6XA 4Y5XB 4MYWB 2DMGA 2CJUH 2XLLA 2HCZX 1C5BH 5EU6B 2N4IA 3ZKSD 2NW3A 4JREC 3I2CL 3MCKB 4R0LA 4MGXA 4PJEA 3GBNL 3OPUA 1DCLA 4HS3B 2WLIB 3TT3L 3WFHB 2GJZB 1MFVA 1SHSA 1KJ3L 3AXIA 2WQVA 3QUZC 3ZK0A 2YA1A 5FCUL 4YBHA 1IAOB 1LE5A 2PNDA 2YK1H 1XD0A 4G72B 4NP9A 2EIZB 3KPQA 4RZCB 1QTYT 1MCNA 1OF2A 4FFZA 3KW7A 2W9EL 3NPSC 1P4LA 1WHPA 3RB7A 2NZ9D 5IVZA 5F3HA 2IDCA 4K5PA 5JXEC 1CFSB 4H26B 1P7KB 4MJIE 2VE6B 4U3XA 4JEGB 3IAQA 1G6RB 3BVDB 1I4FB 2AJ3B 2DQTL 2Y7OA 1HQRA 2X89A 4W9HC 2FDBP 2Y36L 1YEFL 2UXFA 4GXUN 3GI8L 2J1XA 1DFXA 4K7FB 5HPMA 2ENJA 1HI6B 1M56B 1QWUA 1A1MB 2VMCA 2Y0SA 1VPOL 3KAAA 5DJAB 1S7VA 3RAJH 2A4ZA 4X6BB 4LCUA 5EO9B 2ZWLT 5JW4R 4OJYA 2X6BA 4FHBD 2ICES 3L81A 1A4AA 5FHBL 3VXNB 2D3JA 3BOVA 4LDEB 3S96B 4OD1L 3QWNA 3VD3A 4ZMXA 2DQCH 1QPPA 2NY0C 4OLWH 2LABA 5ISZD 4LKXA 5AZEL 1BVZA 5C07B 4IK6A 2MHAA 5I73C 2WYTA 1HH9A 3GGWB 5D7IE 3B56A 2J88L 2WKOA 4LEEA 3AG2B 3GXPA 3LN4B 3KWXA 4QWWC 4CVZA 2EH8H 1F11A 4A1RA 4UM9B 4FRWA 3VU2A 3Q8EA 4RISH 4LDOB 5F71A 5EU4B 2X0WA 3K2MC 1CDBA 1CI5A 2RQ8A 4Q2ZB 5T1DL 4IGBB 3IRCA 2RA1A 5JORA 2BDNH 2H3NB 2QQQA 1QOKA 4JRXB 4I48B 4ADJA 3L3DA 1F45A 4M7LT 1S7WA 2FJSA 3F7PC 2VLRA 3J07A 3NCXA 1YEIL 1K5NB 4JO2H 1J0JA 4WEBH 3MJ6A 5K9JH 2VRQA 3MBEB 2A9NL 2DYPB 2QT6A 5C0BD 3WFCL 7FABL 1MUJA 4ODSL 4LRIC 3Q2WA 4OIFA 5HJ3B 4OLVL 4XCCL 3S37H 1U4FA 5KVFH 3TEYA 2FWOA 2L8AA 4AQOA 1YRKA 5I15H 3AITA 2DQUH 3MV9B 1DEDA 3C8KB 3NFNB 2F19L 4MJ6B 3S36L 2FO1A 3ZBMA 4ETQB 1IEBB 2Z93A 2QZ5A 1J9QA 3PWPD 3CJJA 2YD1A 5CIPB 2W0KA 2XG4B 2C5DC 3OKYA 5HGGS 1SY6H 5K93A 1YEGL 1HHHA 4FXKA 3F04A 4FX5A 3QR2A 1ZLVH 5IVXA 3U83A 2ZKWA 2XA3A 2DQJH 4UQ2A 5FXCH 2R8SH 5EUOB 4WKXA 1PZ3A 2VSKB 3LNFA 1I7TB 2WNXA 3SPVB 4BKLA 3KMDA 1XCTB 1PL3A 4Z3EA 3BKJH 3QWRA 1QRND 1UM5L 4D9LL 4W9ZA 1WPCA 2IALB 1CDUA 3BQUB 4P06A 4EN3A 1X6NA 3E80A 3D2TA 4HPHA 3K72A 5JW3L 1MJ7L 2WXIA 5IROA 2WLLB 3H3PH 4G80A 4LEXL 1G9EA 2BP3A 2GHWB 3WIFB 2RCSH 3VG0H 4N5EC 3GEWB 2PPEA 2YQBA 5DZPA 4GKNB 3BSZH 4LSTL 2ORBH 4JFTA 5EBMB 4N2EA 5LBSH 4JQXA 4Z7VF 1ZANH 4YDNA 2CHNA 4GNKB 1EAJA 3WXVH 1NBZB 3OC5A 4M61B 1RZIB 3EADA 3U7WH 2OPCA 2I60H 4BV1A 1HCZA 4WI9A 4N3UA 3FT0A 4O4YL 2XOTA 3W57A 2A38A 4APQC 3B9EA 3IMRA 1YQVH 3NCYP 5FGBC 1BPLB 1TQTA 1JZ8A 3RY4A 4G7YL 4AQEA 2BVTA 4I0KA 4KVPA 3QEUB 4X6DB 3OAUL 1WV7T 1A4KA 1YYMH 4FFVC 4HUXA 4L4TB 1M4KA 1PMYA 5DEFA 1AJ7H 1M3IA 2DW5A 4N0RA 1KG0A 4C83A 5J3HD 1CL7L 1NMAH 4O5LH 4DP8X 2R2EA 4YR6B 3E8UH 1CFVH 1MCWW 4MS8D 5EC1A 4RMSA 2XI9A 1QLEL 1UXSB 3CLWA 1FJ1B 5CEZL 4X4ZA 3KYKL 4XO9A 5EU5B 5IBLD 2GG1A 3PXJA 1X5FA 3L1OL 4P04A 5I6OA 2I32A 4X8CA 2O5YH 4WTZG 1MCLA 3VQMA 1TR7A 3VXOB 4WHYG 4PCSA 4LEBA 1PD6A 2JJUA 2I69A 1NMBL 2NX5E 2PUQT 4F37F 4ZX5A 4JFHD 3S8WA 1KXTB 4PS8A 1XDTT 3IDJB 3OMIB 3V9EA 4BJLA 4UF7C 3BWZA 2PYEA 5D1QD 1A6PA 3D4CA 1MPAL 2ZUQB 1JL8A 1TVHB 3VD4A 4AQZA 2VUKA 3MA9H 4IBSA 5IM7B 4P2OA 3DOIA 4ISVA 1FN4A 1UWGL 3CX2A 2AABH 2CJ3A 4LCCB 1KMGA 3S4SG 4JNXA 4AYEC 4IOIB 3OR7A 2XY1A 1AQDB 1HSAB 1AXIB 4PRHA 2OJ1A 1UEMA 4IKIA 5TE7H 1MHCB 5I73B 3TA3D 3OKKB 3VMOA 4JG9A 2MQ3A 1DBAH 4LASH 2A4EA 2Y2YA 2BVYA 2JFCA 2R69L 4OZHA 3QQDB 1ZK9A 3FPYA 1UWXH 2DM2A 5E24E 3GZPA 3TYFA 1HHJB 3FW6A 3MJWA 1O5DT 3OAZH 4EUPB 1MEXH 4CKQA 4X4ME 2VXUH 3UL4A 1ILSA 5DFAA 2ZT9C 2YAEA 3RWCA 2IFFH 4K73A 2JJWA 4NZJA 4NYLB 4ONFL 1IGML 4RGND 2HT4D 5D7JD 5EC2B 5CJ5A 1W6WA 1KYOJ 5AW6B 2O6PA 3WUWG 2BP0A 4E5XA 1OGAA 5DD5H 5BRZE 3KL3A 1IILE 2GFBB 5A2JH 2QFRA 3MJ9H 5DJ0B 3O0RL 4KK5C 3CGTA 3MNDA 3KXFA 3CLEH 3DMMC 3HNTH 4JM2F 5A2LH 3QA3A 3RWGA 1DCEA 1IGIL 1PZBA 2V7NA 1MFAH 4LU5L 4YPJA 3V0HA 3HN3A 2FQFA 4HKXB 1CBJA 1R33A 4ZAKA 2EIDA 3ZDZB 5L9DL 1PY9A 2I5YL 1G87A 3QORD 5CWSA 5EIIB 3ESVF 4XCFH 2E76C 3MRBA 3FQTB 3L9RA 4JAMB 2X6MA 4R0LC 1A65A 4LGRB 4LSPH 4X9GA 2FGWH 2VJXA 2B8OT 4WRLA 4M5SA 2DQIL 4X9HA 4V1DE 1JNNL 1P7HL 5GGRB 1T1WA 2MFNA 5FIEA 4FFWC 3STLB 4O2EB 4H7VA 4PJXF 4NHCL 5KVDH 2P24A 2RAMA 1OTSD 3VXUE 3CWGA 3VVVA 2ZWZA 4POZC 1PLBA 1SVBA 2D7QA 5DVLA 3RTQB 1NH6A 5EZIH 3UGXA 4Y5VB 3NIDB 3K4DA 2W60B 4YHNA 1HL8A 4JR9L 4XAWH 3B4NA 4B0MM 1U42A 5AW9B 3N06B 1RJYB 4J3OF 4PGEA 5KOVC 3QQ3A 2CBTA 1TZ8A 1IC7H 2J56A 2WQUA 3T65B 3EYUH 4ALAC 2X1QA 5SWZE 4EIZC 3L5JA 1FFNB 1O9WA 2Y6SC 4JRYD 1CLCA 3TEZA 4JZOB 2OYLA 1VGKB 4IBYA 3VSUA 1W15A 2EDHA 3DX6B 5F3FA 2HFFA 2E6JA 4B9JA 4WY7L 1YPZA 2GSIB 2DL2A 1AQ8A 4PSPA 1F13A 2GT9B 2WCGA 2Z8VC 1UD6A 2R69A 2C3VB 1IGYA 2HT3C 4MCZA 4QLWA 3DSFL 1KDJA 4LL1A 3SHSA 3QCVL 2UV3A 1IVLA 1UA6L 1U6AL 3QUYA 5EU3B 2VMJA 4EBQL 1MVUB 4ELMF 3MCLL 2RH0A 2NY4B 4JUTA 5CEYB 1AQHA 4NZTH 1J9RA 1A1NA 1UH4A 1MCWM 3F5WA 4D7PA 2CNZA 5H35B 3VXME 4J3OD 2BOBB 2VIRB 3KYOA 4PW3A 5BVJB 1N4XL 1XH2A 4WO0A 4UT6L 3FT3A 4JFXB 3QPXL 5I2IB 5HHOB 1UH2A 4FEMA 4IOSA 4TSBL 4U6TA 4XBMA 3ZZSA 1PKQE 2ILLA 2JKLA 3KWTA 3L7EB 2OKMA 2A6JB 3HG5A 4XC3H 1TQWA 3C8HA 2ADGA 1JI1A 4EF3A 4DGWC 2F74B 2DYSB 3LNDA 3NCMA 1CMOA 2X4PA 2DLEA 2NNFA 3HR5A 4Z5RA 3SPJA 2OMVB 4HPYH 4M00A 5TK2A 2Q1EA 3LPGA 1ZK5A 1ZGLM 4U6YB 2G2RA 2DEYX 2CA4A 2AQSA 3QEQD 3ZHLA 4BZ2H 2VLKB 4FCHA 2VDQB 2BRRH 4NQDA 4P49A 1Q9KB 3BH8B 3P9MB 1KV7A 1FVEA 3BUBA 5HDRA 4S1RL 4ZW7A 4NN7C 5JHAA 2F5BL 5LBVA 5BQDA 1RULH 4WW1A 1B4JH 3W11D 4BH8A 1QEWB 2UY7A 4ZOBA 3WIHH 1WIOA 2VSDA 1YMME 1Z3GL 4OZFB 3GHEH 1QFOA 5GS0L 3WL9A 4AH2B 4FXKC 1QUPA 2QSQA 2GCYA 1PSKH 4HWZA 3NUKA 2D3LA 3UJJL 4ONHA 1E6JH 1T22B 4HK0A 4CADB 1DVFA 5T5NG 4XPTL 5FFLA 5A16A 3VI3F 3M8OL 1WG3A 4NQQA 2MNJB 1P7BA 1G43A 1CE6A 2X44D 3JV6A 1DE4B 2R56H 1F3JB 5DC2A 3CLFH 1Y1DA 1AKPA 4G9FD 1T3FA 4Z95L 2BOCB 3VFUB 1JS4A 3P30H 4EN3C 2QSCL 1PZ5B 2DF3A 2BZDA 1X7QB 3BO8B 3FCTB 4P5KA 4YDJB 5IROC 2EEDA 3LHAA 4FNTA 1QFUH 4AT6B 4ZMQA 3L4TA 2XWXA 5JQ6H 4CW1A 1XF5B 5LJYH 1KGXA 2JCWA 3BW9B 4N68A 1XIWB 2JIXA 2XN9D 3TBTA 1RXLA 4JQXC 5ID1A 1LLAA 5FECB 4ACPA 1IKFL 2IGTA 2IH3A 4YS4A 3L3HA 1Z32X 4WFED 4EE2A 3EYFB 2JB6B 1T80A 1O9ZA 2NW3B 1Q9WB 3FAXA 4KMLB 5DLLA 2GBVA 1NDTA 4C4KO 1LDPL 2HB0A 2QDVA 5AUMA 2FX9H 1ZA3B 1ERNA 3SQRA 4F33A 1V7ML 3MLXL 1XZ0A 5FYJD 2DZEA 5DXWA 3DXAD 1CXFA 4P46A 4QHUA 4GYBA 2AQRA 3O4LA 2E9JA 4YC2C 5TF1H 1ED3A 4Y4KD 1OSPH 2CLVA 2EXSA 1LP9E 2H2SC 3FQNA 4H8VA 3VRLE 1EGJL 4UT6A 5D93B 4OGQC 4MA8H 5F1IB 5E4IA 3RWJA 2TSAA 2P5WA 1OL0A 1AZVA 4XNXL 5J1AB 3FFCD 3OKNA 3QGVA 3WS3B 3CSGA 3Q2LA 1RSFA 4ONGH 1B9ZA 1FGVH 2P49B 3SDXE 3LVEA 1AI1H 2A77H 3NJXA 4GI8A 4HJTA 3QZOA 3MRDA 1H3GA 3U0PB 1A9EB 5IJVA 1J9TA 4JY4B 3KPPA 5BXFA 3P02A 3NIFE 2D7TL 1S7VB 3T0WA 4P2OC 1NWPA 1F1AA 1TEFA 1EMTL 2VL5A 3MTXA 4PVBA 4R97C 1KWKA 4M48H 1NCBL 3X14A 2XV6B 2OMZB 4JRWA 1NGQL 4DHLA 2XIDA 5IMLB 3NFSH 4L2LA 3WD5L 1L9NA 4IW4C 5HDBE 5C0IA 1BBDH 1ORSB 3HFFA 1JK9A 5GSVA 4N26A 2HVBA 4NC1E 4TMPA 1J87A 3FQ4A 3HRZA 1NDGB 1TTCA 3NGBC 4UT7L 3D2UA 4TF4A 4YWGH 2APWA 4LCWB 1T1YA 1KIUA 3NEEA 4G6FB 1I53A 3HZVA 4XP5H 2GITB 2ZF8A 4G9DB 4JFEE 3IFOA 2ZD0A 3ML8A 2XX0A 1CFTA 4MJ2A 1A4BA 3FN0H 3RWFA 1S7WB 5D7LA 1KYFA 1SLXA 1XB3A 2DD8H 4GKSA 5D7IF 3T2QA 3HVNA 1N0XH 4JDTL 4G5ZH 5I19H 1MHEB 4MJID 4LDLB 2C1OA 1UZGA 2RD0A 4Q0XH 2R1XB 2XZQH 4DTGL 5C9JA 2NSXA 3IS1X 5J9PA 2DQHL 3UAFA 4KOCA 1INDL 4NNYB 4OAWA 3A4AA 3FOLA 4AGMA 4M1CD 2VITA 4BFGA 3GMQA 1FZOA 5TPWH 1JPSH 1RZKH 5ICYA 1TEGA 2Z93B 3WJJA 4PRBB 2X2UA 3Q5YA 3VFTB 4DP0X 4ZAKC 1N68A 1OK0A 4RNRB 4FQIH 5IMOA 2JVUA 4HKZA 5I82A 1KSRA 4L8DA 2XFXB 5AOJA 1CE1H 3MRKA 5J13C 5FOBA 2DDQL 4RSVA 5FYLE 3L5IA 5HSFA 4UQ2B 4F8QA 1EGJA 2H3XC 3VFPB 1IQWL 3UOAB 3NOIA 1BVNT 4IDJH 5JLZA 2PTTA 1ITBB 1XGUA 4XCNA 2HH0L 2IMMA 1BM7A 4OLUL 1VADA 4F93B 1UXLA 2EE2A 4NC0B 4XPHH 3LX9A 2O6EA 2Q8AL 1RUMH 5MENA 4ZTPH 2D3VA 4CMHC 5G5DA 2XPZA 5GGVH 1CLYL 4CJ1A 1V54B 1FZMA 2R4RH 5I1AA 1G7JA 3R4RA 3HHMA 5GJSH 2G9KA 3KPRB 1BMGA 3BPCB 4QT5A 2MCAA 3SE8H 3ZSSA 4H20H 2R0LH 3CUPA 1IAII 4F57L 2ZKYA 1NIDA 4NIYE 3LKOA 5AOKA 1MHHA 5B1JA 1B0GB 4NO0A 3NJIA 4PS3A 5IESL 5E70A 2AGJH 1SYVA 4HEMA 4PLKD 4WUKL 5DJYA 5T1KA 3P4NA 5F6HJ 3HC3H 5AVZB 3WOVA 4O2CB 3UPRB 1TJHL 2WAHA 5D1ZI 3LEXB 3DBSA 1XBRA 3WNOA 3AS2A 4EOWL 2V7HB 1UD4A 3MUJA 2XXMB 3V5DA 3JV4B 3QIBA 1F42A 3VWKA 4HUXB 4TPRL 1FV1B 1GYUA 1S5IL 2WVVA 4OFPA 4C83B 1PZDA 1KG0B 4ZO6A 4IRSA 4ZXBA 2DIEA 3RIAF 4GO8A 1FSKC 3RL1A 4ILDA 4KK8D 3AG3B 3BAKA 1I7RB 3QUYC 2ARJB 2A6DB 3MCYA 5EF0A 1W8NA 1EV2E 2AQNA 3BWUC 5AEAA 1BIHA 5IF0B 3BUYA 4UUJB 5I17A 4K5NA 4P2CG 5JNYA 1RV6X 2CRYA 1SN5A 5AW8B 3JVGA 3M1BB 2Q0ZX 3HIZA 1CWVA 1OCRB 1SJEB 5C07E 3AW5A 2WNKA 4TRPL 2JLPA 5EEUA 4TTGA 2IBZX 4ZUTA 5LUMA 1KIPA 1OCWL 4JL1A 2PCPB 4WUUB 4E42B 4QY8A 4GSDH 4AEFA 4PJAF 1TZAA 4M43L 2KPWA 4GMSL 4MRCA 2NUPA 5KS9E 5E8EA 1ZVYA 3IMUA 1QTSA 1OZTG 1J1XL 4JUSA 2WXJA 1G9MH 4L48A 3OR7B 1OAXL 4WK4B 4JN1H 4PRHB 5KAQG 1DQQB 1QYGH 3NH7H 2H9GA 1S6NA 3OJ2C 2XTJC 3C09B 5DVMA 4IU2A 1GYVA 4JRXE 3NN8A 4FI7A 4KXCA 5J6GB 3GUFA 3NJGA 4QJ3B 3U4BH 3V79C 4HUUA 2B20A 3AGWA 3MV8E 5EHFA 4WNQA 3O6KL 4X6CA 1E40A 3KPNA 3B43A 4BHUI 1E6OH 1HCVA 1RJZB 1S7UA 4I3RH 5DC9B 5IQLA 3RVXC 5HYJE 5LHDA 3SO5A 1IT9H 1R4XA 1EFXB 2P5EB 4HFWB 4ZS7H 5FA4B 1X9RA 3NTCH 3FPXA 1YO4A 3UROR 2V2TA 5DJZB 2IEPA 1DVFC 4N9OB 5IOKA 4AKQA 1XL6A 2GAZB 2WAQA 3A24A 3CFEA 3RU8H 2JKIS 1RIHH 3UJTH 4ZMAT 5HHNA 4AENA 4ELDA 9PCYA 3ZMNA 3IRZA 1IE5A 1FL6B 1L6PA 3MBXL 2NX5D 4HJJL 2OL3H 1J5DA 1MFCH 4FG0A 4PW4A 3EJJX 3SDAB 4N0FB 5CUSL 1C12A 3ILQD 3V6ZA 2PF6A 2JKNA 1TUPA 3KXFB 4TYUA 3BZEB 2DWEB 1OAJA 3MLWL 5F7BA 2FNWA 1RIUL 2PW1B 4XMLH 5IBUG 3NA9H 5EUOE 2CBMA 1OXYA 1GJUA 1PLGL 3BFOA 5G2NA 3BZFB 2I7SA 3P3UA 3C5XA 4OCYL 5C0JB 3M1OA 4PJFF 3WE6B 5KYYA 1PNDA 4W68A 1WLHA 3AQXA 3V0VA 5EZOL 1OO2A 4Y4HD 4NQCE 3RKPA 1ZLSH 3FT2A 2CIIA 1P4BH 2K4WA 2NY1C 1SJHA 3HAEB 4OGAC 4RFNB 2EDQA 1IAIL 4U1HA 2VERN 3WHE0 2AXHA 1O6VA 3QAZB 4JFSA 4UMGA 4P46C 1T1WB 4X7TA 5LNDA 1KGYE 4XP1L 4GO6B 3VB8A 3MFFA 4JFDB 3NZHH 2ZXEB 4X9YA 3OF6D 4TQPA 4NAQA 1YMHA 2WY3B 5J06A 4R4NC 1I3VA 4FG2A 4MB3A 1JXKA 1CK0H 2HMIC 2AEPL 5E00A 4X50A 3DTXA 3ASWA 1NEUA 2GUOA 3RPBA 5DJ8B 2AQ3A 4KFZC 4YHNB 2ADFL 3GSQA 1PBYA 2X70A 2YD3A 1HXYB 4NP4L 1NAML 3D39A 4L3EB 4YX2H 5BRZD 4L4TE 1UD2A 3MREA 1AC6A 3DURA 4HBCH 1RPKA 3T1FA 3EH5B 2VM3A 1BYPA 5C1MB 3O8XA 9CGTA 1B3IA 4F2FA 3DROB 1GKEA 3HPLB 4YJZL 1UOVA 2WM0A 3MOAL 4CRPA 1HFUA 3K6SB 1YPZB 5AW4B 2WSDA 2APBA 2QLVB 2NNCA 1JWSA 4JG0H 4PJBA 4NLAA 2Z6FA 4M5ZL 4MCZB 4U1MB 1H9DA 1JZJA 4U6VL 5GS0C 4LPVA 3WFBL 4MMXA 3CSYB 3MR9A 3QUYB 4R96A 2B1OA 3IJ8A 4KJWC 5GS2D 4J2QA 4K4KA 3FN3A 3F5WB 4RA3A 4GI9A 3HRZC 5DMKA 2WB1A 3AS0A 4V1DD 3GLEA 4JKNA 3KYOB 5GS2H 4YDZA 2R2HA 1AO7A 5JA8B 1HYSD 5TDOA 1XH1A 4B5ZA 5EFIB 4U1JB 3VXUD 2UZPA 4BA0A 1WIUA 1WBYB 1GZQA 3BGMB 1CLOL 1MREL 1A6VL 1MN4A 1Z3RA 2B1AL 4KHTH 1Q4NX 3ARTA 4G6AC 3BP5B 5E2WL 3HS8A 5F7DA 5E7BA 3X3GH 5F9AC 2M83A 2TRHA 3K4AA 4KKBD 3GSNH 2B2XH 5SWZD 1J05A 4KROB 4HS8L 3VAEA 5FYJU 4M7KL 2V33A 4OH2A 3RFZA 1FYHB 3S3DB 4FNRA 3WJJC 5FKPB 2A9DA 2CO3A 1DQJA 2G5UA 2ZPKH 5B3SB 5DJDB 1EQWA 1RL1A 3LB6C 3MV11 5AYUL 4M9OA 3S7GA 3X1EA 2J8HA 4YNYA 3KM2A 3VGBA 1ONQA 3QZNA 5DK3A 3MU3A 4HWZB 4JFPA 4TQHA 1WA2X 1TLMA 2BHUA 2X4UA 1EJOH 4RBPK 2BIIA 1F8TH 4NXKA 3VFSB 5LQBL 2Y5QA 3CFJA 1B0IA 1RZ8B 5D1ZA 5A16B 5HYSB 4IMKA 4XPAH 3VXMD 3SY6A 1CE6B 2NR6A 1UCBL 2HUHA 3PPEA 4MWFB 4OGXH 1NGZA 4F7PB 4MAYD 1JRHI 3X13A 1NAMA 3DV4B 1OT4A 1FNFA 3VH8B 1WUZA 2QPFA 1XMWA 4HKJA 3SN6N 2G60H 4TLKA 3WAJA 2W81C 3LRGA 3UTPE 1BMZA 3FNKA 1DQLH 1TIUA 2JIXB 4G42A 1FFOB 1SHWA 1N8ZB 1R19A 2YFOA 3B2PA 4NGHH 3CXDH 3HE7A 4F15C 1IAKA 1HK6A 4NAJA 5B1JC 4PTTA 4JFZH 4PWEA 3WGVB 2GY7B 1MG2C 2IH3B 5HI4D 3TH4T 1CGXA 2WXFA 4LNVA 2X1OA 4K8RL 1Z9NA 4LVHB 4I4WA 3QG6B 3K1DA 3AMLA 4ZX6A 5I1IL 3V4PL 4ABQA 4NO3B 2R7EA 2K70A 4KKAC 5E94A 4PB0H 3VQ1C 1JPST 3D18B 2F58L 3GSVA 3QIBC 1NDMA 3VWKC 5F7YC 1YMMD 4MAUH 4P46B 3HA0A 2J55A 3A6OA 4NO5B 3QW9A 3KLSA 1MWAL 1GC1L 4ZXBC 3V9FA 4IRSC 1RUPH 3GD1C 1L9RA 5CSZA 1DFBH 5E99H 5C08B 3T08A 1TETL 2QADD 5FF6A 1OP5H 4M4PA 4N6QA 3OKNB 2F53A 1CDCA 2P26A 3UPCA 3MNWB 5HD8C 3NSCA 4DPCX 1X4XA 3JVGC 2NY2C 3L6FB 2H6OA 1XMEB 1OALA 4XTRC 4BHUA 3FTSA 3GTNA 3F6JA 4TNVF 1PLCA 1JPFA 3FO1B 2MCG1 3VRLF 5LVEA 1LP9F 5H2BB 4K9EL 3VXPA 3KBFA 3QXAB 4YXHL 5FB8A 1ZWIB 3MRLB 2MPAL 5J11B 1CTNA 2LTQB 3UADA 1Z0MA 5JHLL 3ZU8A 4DK3A 2CKBB 4E41E 3PP3H 4QRRE 4M6OH 3S3PA 4LLDA 4Q9QH 4TUJA 2F54B 2IV8A 4TULL 2R15A 2H47C 3MUGB 1FG2B 4FN0A 1KPUA 4Q9RL 1QFWH 4KV5E 1AE6H 4K3EL 4LSUH 5IQ9A 2AXFA 5FUZH 1G4RA 3T3PB 2AK4B 2VAJA 5KVGE 3L95A 3NIFF 1E7UA 3VGHA 2VRKA 5HVGB 5BV7B 3LSOB 5DDHA 3SIKA 4UTBL 2YZ8A 2OTUB 1FRGH 5D6CB 1EBPA 1E4HA 3BHBB 2X6VA 3LKRA 4G43B 1KIRB 1ID2A 2PP8A 1T1YB 3UBXI 3LZPA 1OZUA 3A6BH 3Q3GA 2VDNL 5D2NE 3GDCA 4PI2A 3FSAA 1CFTB 1H8SA 4YK4B 1HT6A 5CINL 1BQLH 3CSTA 5ANME 3OB0H 4LLQA 3CVHH 5D7LB 3QB7C 4YHOH 3QUGA 2K7PA 1L0PA 3D6GA 1NTDA 2P7TA 1MIEL 4LPXA 4GQ9H 4HKBB 5ICXA 5C09B 3O2VL 2L7JA 5C9JB 5TD4A 3KG5A 3UTTA 4A2MA 1NM4A 4OJAA 5EOTB 1NCIA 3FOLB 1AD9A 3FQUB 1LO0H 5BUPA 3AJ7A 1ZHBA 4X5XA 4OFDA 5FV2A 3ZJAA 4FLQA 4PP2A 3V6FB 4WO4A 2ZX6A 3V4PA 2OMXA 1FZKA 4FYTA 2EXWD 2YGVA 4I0PD 1JMZA 3P69A 4JFFA 3VTAA 5D9SA 3TZVB 1XD1A 3OTTA 5LXGL 5EO1A 2J4WH 4IRJD 3T0VA 3HB3B 5E9DE 3D3VA 1F97A 1A7OH 1MWAA 2QEJA 4D0DB 5T3XE 1I75A 4DO6A 5C7XL 2VR7A 4LBEA 4QTHB 3FUMA 1OM3H 3SJVA 4IYKA 1JGUH 2BNQB 4Z7UB 5E6YA 4TNWK 1DLFL 1KPVA 2D2OA 3GXFA 5TE4L 5I66A 1VADB 1A5FL 1OTUD 1S7XB 4JDEB 4YHIB 4XN1A 4DP7X 1JPGA 3OJMB 1PKOA 3DX7B 3QJTB 3GSXA 3ILEA 1SGKA 4PCYA 4OVVA 4G7RB 1OSZB 1M3JA 2H6UA 2LE9A 4JFED 1Q72L 2Z7WA 4HXAH 3DX9A 4YSQA 1X5KA 3K8MA 4QT5B 1U8CB 3HMWH 2V8LA 3HUJE 3B9AA 5JXAH 1H19A 4N0UB 3C08L 3EFFA 3FRUA 3JQOB 4HWBH 3JSSA 3QQ9D 2CLZA 5JHLA 2KLRA 4KUZL 4NO0B 3AMKA 4PRPE 4E9QA 2Y6TE 4DWHA 4QJ5B 2KDGA 2MQGA 3GZOA 3O8XC 2QKIB 3OZKA 1TTUA 1D3CA 4NENA 3L3JB 1JGDB 4X7SL 3P9WB 4GKZB 2AMUA 4PJ5A 4N20A 3RPKA 3ZTJH 5I0XA 5L8KB 1WC7B 2X1XR 5G4NA 1J12A 2Y69B 5DD0L 5D2LA 5EN2A 5AG8A 2EO7A 3HTLX 3BDYL 2JB5L 3P3SA 4UTBA 4R5XA 35C8H 5DWUL 1DO6A 4IRSB 1VEMA 4N0YL 3RL1B 1NCCH 5GGUA 2AJVH 4GRWE 5KVEL 4MMXC 5FYLD 3B2MA 4H8WH 1GAFL 3U48A 5EMYA 4RH4A 1BG1A 1N10A 3CC1A 4QRTB 4WCYH 1DBBH 1SDDA 3QUXA 5CCKL 4BGLA 3J27A 3MLRL 2VJ8A 4HSCX 4YSPA 2HVKB 1JXDA 3AQZA 4A2GA 1HH6A 3VX1A 3ARWA 5D1XB 3I3BA 5MP6L 4HJUA 3N3EA 3VD2A 3U2SA 1CQYA 4A2EA 3OSVA 1HEZB 1KTDA 1NIFA 4TM9A 4U31A 3BFWA 4G8IA 4N8VA 1FDLL 3VD1A 2A2QT 3CQPA 2DQFB 1PX3A 3BKYL 1RMFL 2VO5A 1WWAX 3NIGE 1KCVL 1S7SA 1NUFA 2X1WL 2H9GB 2Y7QB 4YGVB 1AS8A 2VQTA 4MLSA 5AVVB 1QSEA 4ZDHB 3TO4D 3UJIL 5DRNA 1HL9A 3RFZC 1JPTH 1VCAA 5MEQB 4NLHA 3IJHB 4WNQB 2F8VA 1TMQA 3EBAA 4MX7A 4EIBA 3KLHD 1KTBA 1IB5A 4XWOD 1LXMA 2VM9A 3IPEA 4FXGB 5DI8A 1KTCA 2EO1A 4XVSL 2EVFA 4Y19A 3CHRA 2R0ZH 3QIWD 3EH3B 2DBJA 3CQFA 4JPQA 2HJKA 2BM3A 2JELH 4B3EA 3WHE1 4XP4L 3FQWA 1A7QH 5E8DL 3CFEB 3OV6A 3EHBD 3MODH 5D1ZC 1ZRUA 1PZAA 4ZPVA 4J3SA 4IMKC 4LKCA 3GMLB 2NR6C 4AENB 5FDYA 3L4ZA 3LMJH 3PDOA 4XMKL 1BQHB 3UBXG 4MA7H 1T04A 1OAQL 3V4UL 3WTWA 4N24A 3BD5A 5C07D 2IDFA 1TLKA 2ZXBA 3U4EA 1HHIB 4WWKB 1P6FA 4OFVA 1XAUA 2Y22A 5GRWA 1OIOA 3IDMB 4KNTA 5F7UA 5MHSE 1Q9OB 4ZYKA 4TUKH 3KLLA 3RUGE 3WKYA 3HE7C 4Y2DB 1MCQA 3IBEA 1SOSA 2PW2A 4I9WE 5JHMA 3B1TA 4QRPB 2FR4B 1KC5H 2FX8L 4IGBD 5CR1A 4XB7A 4BYHA 3VD9A 3FT2B 4JRXD 1NGPH 1IMHC 1FBIL 3Q44A 3MV8D 5EUOF 3MBED 5HYJD 4U1KA 1N64L 3LXUX 3H3BC 5LO7A 5DHYB 2LFGA 2EKSA 2EDEA 3PAZA 4C4BA 4KVCH 2G2PA 3QJHA 4QXTA 3O3DA 4PYHA 3MDJA 5C0RL 3IMSA 4H0GA 5IB1B 1HZLA 3DTXB 1FGNH 5D4IA 2YAQA 4N2BA 4YHYB 5IB4B 2LVCA 1PLAA 5A2FA 2H32A 3NPZB 1QFHA 1QLRA 2GJJA 3DBXA 4NC2B 4WEEA 5FLUA 3KNBB 2XWTA 1WICA 3CCHB 3S5ZA 4J28A 2DLTA 3MREB 1W2KT 3DURB 1CLZH 4YHZH 3GJEA 3O8XB 5E23A 5CJOH 4K2UL 4G7VL 4M62H 4NFDA 4OKVA 5CIPH 5KYWB 4HUVA 3DX8B 2AI0L 5B1AB 4F9PA 2EH7H 1PY4A 4CBZA 3GBEA 3ESNA 5IFAH 1ZJAA 4BCZA 2WANA 4PJBB 1AZUA 1KELL 4X6DF 5FPIA 3TV3H 5J7CC 3OJVC 4NQCD 1BA9A 2H1PH 1J7VR 2DWTA 1MLCB 3BMVA 2HX9A 3ULVL 1RZPA 1IM9B 1V3MA 3BQVA 4ZO9A 5F97E 5AAWA 5IJDC 3EBIA 4NQVA 4OZ4A 5C9KA 2L7QA 2NXZB 3LD8B 3OLDA 1TMCB 1PD1A 2FAUA 3VWJA 1E4WH 2VDKL 3ZRSA 1LO2L 2BP8B 5LBGA 4GW4A 5HI5D 3JWNG 5E4AA 5LG1A 3LKPA 3UP1A 3EGSA 5BJTA 1M7XA 3IKCB 4NUJB 2IAMD 3EFOB 3FCBA 3BUDA 4XHQA 4Y5YA 3RWEA 2DJUA 1TTFA 2UWEB 2XV0A 3KLQA 3SYOA 1A7RL 2OLDA 3PXLA 1EEYA 1RAMA 3MRPA 1FAIL 5DJXB 4KJPD 4L4TD 5D6DA 2VZVA 1EEZA 5F7WC 4C47A 5H94B 4HWEL 1CT8A 4JDVB 4U1SB 3ZKMD 12E8H 2X87A 5DT1L 3T5WA 4K8RC 1DBKL 1KB3A 1DJWA 1HC1A 5ESQA 4E9SA 2CJUL 3QDME 3LPPA 4WO4C 1W91A 1YQ2A 3CZEA 4UQ9A 5JIMA 3K80A 3LKNB 4QHLA 3GZKA 2WZAA 1QO3A 3NCYS 3ZMRA 4EI5A 4ODWB 4PRDB 1AKJD 3GSRA 4OJDH 5C0CA 4Z3FA