4PCYA

Crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport protein(cuproprotein)
molecule keywords PLASTOCYANIN
publication title Crystal structure analyses of reduced (CuI) poplar plastocyanin at six pH values.
pubmed doi rcsb
source organism Populus nigra
total genus 23
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1986-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4pcyA00
2FJSA 3NYKA 1VLXA 2W88A 3FQ1A 3S8FB 3S3BB 1GYCA 5PCYA 3WIAA 4PCYA 3PAZA 2XLLA 1JZJA 1W6WA 2XU9A 3AG1B 2YXWA 1SDDA 2FQDA 4G7SB 1BXAA 2FQFA 1NIBA 2BHFA 1NTDA 3NJMA 3ZBMA 4DP0X 1AZRA 1BXVA 1ZDSA 3QJQB 5A7EA 1A8ZA 1AG6A 2ZONA 5B1JA 2BWDA 1AANA 1JZEA 3OM3B 5LDUA 3JTBA 3L45A 7PCYA 1TU2A 2XYBA 1PLCA 1NIEA 4W9ZA 3IN0A 1E5ZA 1ET8A 1GW0A 2CALA 3NJFA 4NAJA 3H56A 3FPXA 3V9CA 4JHVA 4UF7C 4GP4B 2BO0A 2HZHA 4E9XA 1L9OA 4RH4A 1HAWA 1BYPA 1W8EA 1ILSA 3FPYA 3QJUB 1ID2A 1DZ0A 4UANA 3IEAA 3EH5B 2Y1AA 2HLEB 1JXDA 4HZ1A 1IKOP 4G72B 2H47C 5FC9A 1OOWA 2XXFA 1PF3A 5F7BA 2EINB 1XB6A 1PMYA 1SNRA 1AIZA 2XWZA 2BP8B 3S8GB 1AS7A 1PNDA 2I7SA 1MG2C 2CAKA 1NWPA 1TEGA 3PXLA 2UX6A 3SQRA 2CCWA 1KDIA 2FQGA 2GSMB 4PAZA 1ET5A 3NJLA 3AZUA 3T6WA 2QPDB 4DP6X 3T6ZA 4HCGA 5I5MA 3WKPA 2CBPA 4YSOA 5AKRA 3FS9A 2NRDA 2VSMB 1NPJA 2J55A 3FU9A 3N2JA 3AG4B 2XX1A 4QLWA 1OF0A 3DIVA 4HAKA 1GSKA 3WI9A 3SBQA 1NIDA 1T5KA 2TSAA 1XB3A 4M3HA 2BP8A 2BZCA 3S3DB 3QJSB 4YSTA 5I6MA 2DYSB 1ZV2A 5I26A 1JVOA 1E5YA 2GBAA 1CUOA 2QT6A 2YARA 5I6KA 3SBPA 1SHWA 4DP5X 4YSDA 4MFHA 2FT7A 1E67A 4QKTA 1RZQA 3IE9A 1PCSA 2IDSA 2FQEA 4Q89A 2PP8A 5ANHA 5F7AA 2DWSA 3FU7B 1CC3A 2AFNA 3EHBB 1ASOA 1L9QA 4KOCA 4KNTA 1MG3C 2QPEB 5PAZA 1JZGA 1TKWA 2GHZA 1PZAA 4DP9X 4F7KA 1SHXA 4A66A 2IDQA 4YSPA 4ZK8A 1V10A 1WA1X 3PCYA 1KYAA 1A4AA 1AS8A 4AI7A 2A3TA 3FT0A 3T71A 3X1EA 3TBCA 4E9WA 1IUZA 4DP4X 1KCWA 3CVBA 2PPCA 3ASNB 3QJVB 3FQ2A 4HHWA 3T6XA 2OV0A 3NJKA 1AACA 4WKXA 1M57B 2W8CA 4Q8BA 1IBZA 2BWIA 3HB3B 4KO6A 4BDVB 3CG8A 1ZIBA 1GY2A 3CZUB 2YAQA 1GY1A 3FSZA 3FU7A 2X88A 6PCYA 6PAZA 1ETJA 2WO2B 3TU6A 4DP1X 4HALA 1IC0A 4KO5A 3BVDB 2H5UA 1A4BA 3ZX1A 4WTQA 2VMJA 2IH8A 2GIMA 4CSZA 3ZIYA 2IDFA 1PLBA 3NJIA 1M56B 4DP7X 4E9YA 4DP2X 1GS8A 2AZUA 2HXAA 3G5WA 4GP5B 1TEFA 1V54B 3FSAA 2YAHA 3FSVA 2PPAA 4P5SA 5B7FA 2Q5BA 2EIJB 2QDVA 1BYOA 1JZIA 2IAAC 4G71B 3H4FA 4X4KA 3OMNB 1X9UA 4BWUA 1NIAA 1OE2A 4AKPA 4E9TA 4KO9A 1L9SA 1BQKA 3PPSA 2IWKA 4YSSA 1SF3A 3TASA 1WAEA 2VSKB 1ASPA 3X1NA 3D12B 2ZOOA 4BXSV 2MTAA 2X87A 5I5IA 5D4HA 1CURA 1AQ8A 2YAFA 3KW7A 2PCFA 1L9TA 2PLTA 4G70B 3EF4A 3QJRB 2LLNA 1FA4A 4YSQA 4BXVA 4GXFA 1A4CA 2EIMB 2XV3A 2IH9A 2MRYA 1OE3A 2FT6A 1JOIA 2YQBA 1J9TA 4HCIA 1F56A 2HRGA 3QPKA 4L0PB 1DYZA 2P80A 3TA4D 4P5RA 4JHUA 2AANA 3AG2B 4KOBA 4A2EA 3ABGA 3FQYA 1PNCA 4HCFA 2EIKB 3X1GA 1KDJA 2HRHA 3ASOB 5D4JA 3FYIB 1AS6A 1WA2X 4GY4A 4KNSA 2ZXWB 1HAUA 1RKRA 2PPFA 3ABMB 1A65A 2DY2A 2TSBA 2IDTA 2GC7C 1KCBA 3ERXA 1HFUA 4AZUA 2PP9A 3QQXA 2IWFA 1BEXA 1RCYA 3GDCA 1PAZA 1MZYA 4YSAA 3U25A 2I85A 4E9VA 2BW5A 5D4IA 1E30A 5B1JC 1N70A 2GI0A 1XB8A 3AG3B 5B7MA 1W6LA 2XX0A 5B7EA 1R1CA 8PAZA 1A3ZA 2RACA 4AX3A 3QJTB 2VM4A 5E9NA 5IY5B 1AZNA 3SBRA 1NDTA 1L9PA 5I5JA 4YSEA 1BQRA 4A2DA 3ABKB 1FWXA 3WNJA 4YSCA 5B1BB 2FNWA 1QHQA 1FFTB 2JFCA 4DPBX 1IBYA 3AY2A 4DPAX 1JVLA 2HX8A 4AKQA 1EZLA 1SFDA 2UX7A 3NP3A 4YVUA 5TK2A 1GR7A 1SF5A 2IWEA 1PZBA 3MBWB 4K9JA 4KNUA 2Y69B 5I6NA 2OCCB 2GB2A 1JZFA 2UXVA 4HIPA 1JZHA 3FU8A 3NSDA 2YAMA 3JT2A 1QNIA 3ZDWA 3S3CB 4ENZA 3X1BA 4BWTA 3ABLB 4GYBA 3CDZB 3NJJA 2JKWA 1PY0A 2XV2A 3OMAB 2CUAA 4BWWA 1AZBA 1ET7A 2H3XC 4N4YB 2VW4A 4W1TA 9PCYA 1RZPA 1L9RA 1KGYE 2I7OA 5I6LA 2BP0B 2VN3A 3NJGA 1JXFA 5B1KA 3NSFA 5I6PA 2JXMA 3WG7B 3X1FA 1YLBB 3IN2A 2BZ7A 1AZCA 2UXTA 4UAHA 1OCOB 2B08A 2E86A 1JERA 1MZZA 3DTUB 4YSRA 4M4RB 4G7RB 5I28A 3WNIA 3CVDA 4AKOA 4HHGA 2ZWNA 1NPNA 3PAUA 3N55A 2VW7A 1J9SA 4TXVB 3AW5A 3T9WA 3KW8A 2DV6A 1NINA 2UXGA 2CJ3A 4BDVA 3PAVA 2HX7A 2P80D 1AAJA 3NJNA 2HX9A 1J5DA 2BW4A 1PLAA 5I6OA 1PZCA 3FSWA 3UADA 1AR1B 1OCRB 1N68A 1X9RA 2PPDA 3CDZA 1OCZB 3MX0B 4NERA 2J5WA 2PPEA 2VW6A 3EH3B 3X2QB 3T6VA 1ZPUA 3NT0A 2N0MA 3C75A 1QLEB 1EHKB 2IDUA 2BP0A 3UAEA 2VM3A 1NZRA 4YL4A 1BQ5A 3RYMA 2UXFA 1J9RA 2R7EB 2YAOA 4YVNA 1OV8A 1WA0X 1ASQA 1GS7A 4A68A 1KBVA 1SFHA 3EH4B 1B3IA 1JXGA 1KBWA 1NICA 1WS8A 2WSDA 1WS7A 1MDAA 4JKNA 3UABA 4KO7A 1BAWA 4DP8X 2GC4C 3NP4A 1I53A 5AZUA 3GYRA 1V55B 2XUWA 2QDWA 2EILB 3HEIB 1E65A 2PP7A 4CSPA 1AOZA 1UATA 5B1AB 2OJ1A 3DKHA 4F2EA 3GXUB 3BQVA 1OE1A 4EF3A 4E9QA 1OCCB 3V9EA 4A2GA 3NSYA 2B3IA 2FT8A 5EHFA 4GP8B 3NJHA 2AVFA 3UACA 4DPCX 3FYEB 1CYXA 4A2FA 2R7EA 1AZUA 3OMIB 2J57A 3OQRA 1NWOA 4YSUA 1KV7A 1SJMA 3OD3A 1J5CA 2DYRB 1CYWA 2XXGA 3PLYA 2AZAA 3WKQA 4A2HA 2WO3B 2YAEA 4BK5C 4E9SA 5B3SB 2FWLB 1BXUA 2FTAA 1NIFA 2Q9OA 4G7QB 3TBBA 2DWTA 3CVCA 1GS6X 3NSCA 7PAZA 1SDDB 2YXVA 2YAPA 3UAAA 4N8UA 1J9QA 1M9WA 4NB7A 1XMEB 3H4HA 2PCYA 2XV0A 2XVBA 5AFAA 1ILUA 5TK4A 1ZDQA 3IBOA 1AG0A 4E9RA 4FAAB 3UGEA 1URIA 2J56A 4F2FA 4FA7B 1ZIAA 4A67A 1ADWA
chains in the Genus database with same CATH superfamily
4GMTH 3WFHA 1JWMB 2EYTB 4I18A 5HHVL 4C4KO 4Z1PA 3B56A 3LAFA 4N9GA 4JL1A 2BSEA 1YY9C 1ZXKA 3AU0A 4EUPH 1MAML 2OMBA 3W2DL 5HBBA 1JWSB 1U3YA 3VMNA 2H9GB 1QQDB 2SEBA 1FHGA 5KANG 1TCMA 4AVJA 3DRTA 4Q6IC 2WKOA 1HH9B 2K78A 1M71A 1QRNA 3QNZB 4KK6C 3RLSA 2CDFB 4QCIB 2VZVA 4HUWA 4KXBA 2NY6B 1G9EA 1VEMA 1JGEB 2P8LA 1GZPA 1FGVH 1GGIH 2PCPA 2BO0A 5HTSA 3VYPA 2WBJD 5C0IA 3KNBA 3MV9E 1L9OA 3MUHL 1HINH 3QXWA 1N6VA 1WFTA 3GM8A 4RGOH 3TA3C 2PO6D 3SQBB 2IGFL 1FDLH 3FTYA 1CTMA 2I07B 1T03L 1UH2A 1GGCH 4YHIA 1BA9A 4KHTL 1OTTD 4DJMA 2IPUG 4JS7A 3HKZA 5LN8A 2FO8A 4NKIL 4RFOL 5KOMC 4PPTA 4KK9C 4QJ4B 1TTCA 1OAQH 3P02A 3WFEL 1TEGA 2DWEB 3N42B 5SWQB 2P49B 2AQSA 4HFWB 5I0DA 2B59B 4U7MA 4AYSA 5K69A 1KDIA 5FGCB 3VD4A 2V9TA 1FYTB 1IMHC 1ZD6A 2JCCB 1ET5A 4Y0GA 3C6LC 1R3HB 4KKAD 2DTMH 4IOSA 1JZ5A 2GITB 4QHLB 3OKLB 1U8PB 3LHPL 2Y9RT 3TJEH 3ARSA 3CFEB 1LD9A 2NTFB 3VXMA 2FEDD 1FI8C 5E99L 2R29H 5FO9B 4Z7NE 4UT6L 1RJYA 3N1QC 3W9EA 1MCBA 1TZIB 2VLKA 3MRGB 3N2JA 4FQXB 5F88A 3T8VA 4H8WH 3TBYB 5ESQA 3DUSA 1FO0B 2Q20A 3U7YL 3QR0A 3A47A 5CD3A 2J1KA 1IL1A 1AKPA 2R39A 3L1EA 2VRAA 3C5ZD 5GS3A 4KVNL 2JIXA 4M3HA 1DO6A 2LHAA 3O9WD 5F9WC 2P5WD 1IKNA 2HFTA 4RZCA 3FUJA 3R0NA 4CRPA 1U95A 3JYCA 4OKVB 4U1SA 1T7VA 3TEZA 2JJSA 3MRDB 5HGAA 1KLFA 3FQWB 4P2RA 3HMXA 3PHAA 1HYSC 2R4RH 1E67A 1V27A 2CMRH 1F41A 1R5IA 2NZ9C 3NFPA 4G1MB 2VE6A 4RBPH 1CDJA 5C2UB 4F33B 2E7HA 2X3CA 1Z32X 4BCYA 5DK0A 1Q9LA 3Q6GH 4YBLC 1CDUA 2XY1A 4Z3GA 2NXYC 4NS0A 4TULH 1RK0B 3T8XB 1S8DB 3Q6FA 4W6WB 2J20A 3LNEA 3J2PA 2XZQH 4KOCA 5GXBB 2VAAB 3L08A 4Z0XB 1YQVH 1EMTL 1KYOK 3HE6B 3BGAA 4XWOD 4BZ2H 3BO8B 3UTQB 3M45A 2V4LA 1GAFH 2C4FT 2IDQA 4WNQB 5IB1A 3W0WB 4B9JA 1IILE 4IRZL 1J10A 2FLMA 3KVDD 1JZ2A 2WJ7A 5K1JA 1SVCP 1OF2A 1LEKB 4IJ3B 5C8JB 2YJLA 1JS4A 3T8MA 4JFTA 3VFNB 2OMTB 3NPZB 3AB0B 5G2NA 5DF0A 3O0RL 2Q3XA 2XQYA 3VGAB 4IRJB 4HQQL 2AV7A 1TFPA 2O61B 1DANU 2X4NA 4QTIH 4QRUA 1XR8A 3S37X 1QBLL 3OKOB 4Y9CA 2PCXA 4XX5A 3ARPA 1R0AH 3ARDC 4FYQA 5B38B 5J7CC 2A99A 1OQOA 2QR0B 1RPKA 2KQNA 3O6KL 1PY9A 2R27A 2G2NA 1YYCA 4KKLC 3AQXA 4R26L 2F1EA 4RSYA 4TQHA 2VABB 1JPGA 1KJMA 4XX1G 2FLRT 3D3VA 2PW2B 3VFVA 4B96A 5HHNB 5DWUH 4QRTB 4HIIA 4OLXH 5GZOA 4I77L 2PPAA 5AWNH 4RNRB 4P5SA 5B7FA 3AS1A 1KN4H 5KUMA 1OAZH 3TBSB 2ZWYA 4MA3B 2WINA 4ETQB 4BWUA 1A9BA 1VKXA 1IAKB 3MLTA 1HTYA 1GJWA 3C60A 4UQEA 2ARJA 2DJMA 3HNSL 4QHKI 2ZOOA 2PO6B 2VR9A 3IXAA 3QUKB 4CUCA 2V3EA 4HX1B 1CLZH 4S1RH 3WNKA 5DRZB 3GJFH 2MCMA 1E0OB 1CJYA 3SE9H 3ZN6A 4NI3A 3EF4A 1XGYL 5GJSL 1M7DA 2E7CA 4WFFD 5SWZD 2EC9U 1UM4L 5ITFB 3V0DA 3FO2A 2XV3A 2HRPL 2IH9A 2VDNB 1H3XA 3GZQA 3D5OF 3MBEC 2FT6A 5GISL 3GSXA 2VJ8A 4NN6C 3GXPA 4WSKA 4F2ME 3H9SD 4OV5A 3U9UB 3EO1B 5CGTA 3OJVC 1G1KA 1A2YB 1F2QA 2VXUH 5KSAB 1PDKB 3N91A 5T3ZH 4A7SA 3KBFA 5FHBH 4HH9B 3FFDB 1QR1A 2B3RA 3RTLA 4N2DA 1TZGL 1VADB 4ZZFA 1YUKB 3X1GA 2Y7NA 4JO2H 3QZWG 1JCKA 7FABL 2IDCA 1UM5H 3KLAB 2Z92B 1WQVT 1MKFA 3QIUA 4Y7MA 4BE5A 5C0ND 2JKNA 4OVVA 4LDEB 5KSUA 2C3VA 2JJTA 4CVWA 2AABH 1C5CL 1LO3H 1U3HA 5AW6B 1OP3H 4Z76A 3DHJA 4M93B 5C0AA 2VKXA 3H2WA 2XPYA 1RZJL 4OQ1A 2DPKA 1QWHA 1OANA 3FT9A 2VR3A 3C5ZB 2NUPA 4A2MA 4N22A 1A7NL 3O9WB 3V5KB 2DMGA 3B34A 1PX8A 2P5WB 1LMKA 1BEXA 1RCYA 3ZLQC 4LPTA 3RVVC 3EDEA 4PCSA 1RLBA 2XZAL 5LB1A 4LL1A 5FCSH 4M8UA 4JO4L 1QP1A 4MNHB 1F4XL 1E30A 3SDDA 4TPRH 2A9CA 3KYAA 3HE7D 2FR4A 5B7MA 1H3TA 3OKDA 1C9SA 2VM4A 2ZAHA 1C5DA 1PIGA 5E5RB 3U9PL 1BQUA 4ANVA 4BIKA 2I9TB 4GSQA 4XP6H 2NY3B 4HF5H 5IVZA 4AQEA 4LASH 4L8SB 5JYLA 2Y36L 3DLQR 2XTJC 2A9ML 1B9ZA 2AXHA 2JXMB 3O8XC 4JREC 1HL5A 3AROA 2GJ6A 4KJQC 4W9GC 3AGVA 4QRPA 2WWOA 1OT1A 3GLDA 3KWWB 4H1LG 3B9VA 4K9JA 4F7EB 5SX4I 3K2KA 3KG5A 3KGRA 2EIDA 5I1KL 3HS9A 4EOWH 3BZEB 4OGZA 1JI2A 4GO6B 3VTTA 1QSVA 3UAFA 1IFRA 5KTEH 4ZO8A 3VXSB 4H1LH 2VL5A 2CD0A 3KPSB 2NY6C 2EVFA 2I60L 4B53A 2BVUA 4P59L 5DHEA 3NJJA 1IAIM 1NGPH 1LVEA 1J0YA 1DL7H 3GLZA 3ZMRA 2GFBA 3QQ3A 5D7EA 4L5FE 3NJGA 4TUKL 2Y3AA 1S2EA 3NSFA 4FTVE 3NCCB 1A66A 1ZT7B 4J6RH 4IMKC 5FKAB 1HE7A 2QFPA 3FUNA 4M56A 3QPXH 5I28A 3V5DA 3ENEA 5IW1A 5CN1A 1TLMA 1AXIB 3QDGD 1Z6JT 2E8YA 3S96A 2A6DA 5BZXA 2ED7A 4HMEA 2QMJA 2P9RA 4YIQA 4M7LH 3FAWA 4JL2A 3G5YA 1WZLA 3NACH 3OHXC 3S36H 3D9AL 5CBEA 4J3VA 4DEWA 5KYXA 5DUML 3DVNA 2YBRA 4EPSA 4B5ZA 4NT6B 1E40A 2O5YH 2X2JA 3MRQB 3S4SG 2PPEA 3ME0B 5FCUH 1GGYA 1EEUA 4GUPA 4PVMA 4MNQE 3A4FA 1FIEA 4RX4D 2N7AA 2OMZA 3DMMA 4NFCA 4CAGA 5F6HJ 2OL3L 3NEXA 2C1OA 1EX0A 3BUDA 4NKMA 4KRNA 1IBDA 3B5HA 2AEWA 1OW0C 4NQED 1NOFA 4AEFA 5L88L 2WAHA 2XT1B 1CFBA 1X5LA 4FQXC 4GW1A 4XODA 2J8UA 3KPRB 2GY7B 3PXJA 4P5TA 1HI6B 1WA0X 2EDLA 4D0BA 5DSCA 3E9UA 4WO0A 1X7TA 2CKBL 1EHLL 2WB1A 2Y23A 3TYFA 1JF1A 4Z7OB 1WS8A 1J05B 1IT9H 1KCSL 5EF2A 3MUJA 5BZDA 1K8DB 3H9HA 5EO0A 2OXGB 4MCNA 4RWHA 2VDRB 1Z9PA 4GAYA 2VR4A 5KYYA 2Y24A 4F7PA 3WEOA 3IJ7A 3ILQC 2A9DA 4I5BA 4BH8B 4GKOA 1CICA 4R4FL 1P5UB 25C8H 1Q0EA 3OJDA 4GRWB 4NNXA 4FTDA 3VSVA 2N4IA 3WFBL 1IGML 1OE1A 5AB2A 1RIHL 1WBZA 1B0RA 4PJBF 1HE8A 3RVUD 5D7LA 3ZHNA 3BPNC 3L4XA 4HZAA 2WCGA 4B97A 4IK6A 2APFA 3KEDA 4K3EL 3LRMA 1RVFL 2DKUA 3OQRA 3SKMA 2IAND 4R3SA 4UB0L 1YG9A 4JRFA 3QG7H 5DVKA 3HE6C 2WXNA 2WN2A 3EOAB 3MOBH 1R5VB 5J5EA 3ARGB 1MSPA 4Z7UA 4RGNE 1E2VA 3Q8BA 4JCMA 4ICWA 4Y9BA 1A6TA 2YD3A 3CFKA 1XCXA 4IJ3C 4GKNB 1CE1L 4J27A 1EAOA 3GBMH 3LZNA 4GH7B 4RGMB 2YKLH 1ZS8B 3AB0C 3C87A 1H6TA 1DTUA 3EHBD 4S1DD 4IOFD 4UOJA 4IRJC 5E6RB 3JWOC 1NGYB 1R47A 3KYKH 4IGBA 3FQUB 3MV7B 4NP4H 5J1TC 2VO8A 5C07D 4QI3A 2FJHA 12E8H 4JGUA 2R69A 1MXGA 5ALBL 5MHSE 1FZJA 1PQZB 4RIRA 4N8VB 3MNWA 5E1IA 2XN0A 2ENJA 4JN1H 4OLYH 5ERWB 1Y1DA 3E8UH 2X4TA 5D2NA 3QCTL 4BINA 3SJVD 5KW9L 4EBQL 3I6GA 1NC2D 4QWWC 4JMXA 1PY4A 4A6YB 1OPGH 4X6FB 4JZOA 4M5TA 1NEZA 4KJPD 1QLEH 3APMA 5A16A 2ODHA 4OCYL 4PJ8A 1RJZB 1IGIH 1RQ5A 2LFEA 3S3BB 5PCYA 1P4UA 4ZUVA 4DTGL 4Q9QH 3X13A 1KJ2L 1MHCA 3WNOA 5CGYD 5EU4B 4JY5L 2WBJC 4WY7H 3V0WH 3GSNL 2HPTA 1JHTB 5L7XH 4HJUA 4JFHE 2PO6C 1NFDA 2ZYHA 2H2PD 4UOW1 1ERNA 1JF6A 1JZEA 3WAKA 3KD4A 3ZU8A 5BJTB 5KVEE 4FI6A 4HWUA 3NJFA 3QDGB 3FUIA 5DEJA 1KC5H 4MMXC 2F8OA 1OTTC 4IU2A 1G9MC 2M8XA 4GO9A 4HKZB 2VR6A 3V9CA 4P2QB 4ZMWA 4UZSA 5C3TA 5DK2B 1S7UA 2EO1A 3O4LE 4D94A 4XCEA 4WWOA 4EI6B 3B9DA 3Q1SH 2RBLA 1P7QD 4FLHA 1NBZB 2PW1B 3U7WH 3PQYD 3QJUB 1BQHG 1YPZB 5KSAC 3IMUA 5D71L 2KZ1B 3ROOA 3BAYA 3CLFL 1S3KH 1NFIA 2R0ZH 4ZXBD 4KKAC 2CR0A 3ARBA 4NUMA 5L6YH 2ZOUA 5I1GH 2AXFA 1ORSB 1UYWH 3ZSTA 3MLXL 2FEDC 3QWOB 4XVSH 5E2UL 5I1HL 1K6QH 4NQEB 3SDAD 1I1RA 2Y3NA 2ZCHL 1MG2C 3CK0L 1VPOH 4M93C 3LKRA 2R1YA 1PD1A 4RSVA 2APBA 5K9JH 1REIA 1FLRH 1YYLH 2FQGA 1BVLA 3L3KB 4KK5C 3GT6A 4Y2NA 1FH5L 3C5ZC 5GSVB 5LCVA 3VXRE 4R90L 2X4PA 1U8JB 1BJ1J 2ZJSH 3O9WC 1CLYH 4MNGA 4X6CF 2R4SH 5T3XD 4LSUL 4UM9D 3QO1A 1OP5K 5IREA 5CEZH 1S5IH 2LABA 1OB0A 4HCGA 4JRYE 3QZLA 1AHWB 5DJXA 4KQ3H 3VX1A 1JNJA 3TFKD 3WTXA 4ZJ9A 3S3SA 3VD5A 2IQAA 2E27H 1T7YA 3UYPA 3IU3B 5DMIL 1GKOA 2V17H 4JFED 4ZD3L 4A04A 3OF6D 5F1IB 5IW6A 1T5KA 3L3GB 2VMEA 2NY3C 3RGVA 3LZPA 4H5SA 4YPJA 4L8SC 5I6MA 3FU3A 5AOIA 2UWEB 4G8FB 4N3TA 1JYXA 3MNZB 4GUCA 5L8LB 2HG5A 1I9EA 1NBYA 2IANB 1ZPLA 1QFWI 5DJ8B 4XWOC 3ZHLA 3ZQ9A 1LDPH 4X0NA 2K0RA 2PWFA 4MFHA 4JFQA 3IE9A 3PDGA 4GS7C 4LQFH 4KKZA 2FX9L 5BS0D 5EOQL 1Z5LB 3JWNE 1NGWA 2EDDA 4FC3E 2ID5A 3U0PA 1KTDA 3DVGA 2OZ4L 3PABA 4W70A 3TTSA 3NESA 4YC2C 3V0GA 3MYJA 3Q8EA 5I18L 1ZCRA 1NQBA 1G7HA 1TTGA 3EHBB 4QHPA 2CR6A 3RWDA 4FKHA 3T65B 2ATKB 1AGBA 3TEYA 5I0XA 4BFNA 3Q8FA 4BJLA 5F0JB 1SXZA 2G30A 4ERSL 1ECZA 3A0OA 3TBVA 3BP5A 3PWNB 2X38A 2JELH 2P5ED 1GGBL 2WLMA 3CSBA 1DVXA 4PRDB 2CHNA 4KTDL 2EH8L 2I69A 1NKGA 3T6XA 3SJVB 3CN3A 3SE4C 4F27A 1FVDA 2A0LC 4XCYA 3OKYA 1PTZA 3WV0A 4NZUL 4FG0A 2A7BA 4PS4L 3ZZ1A 2NR6C 3HB3B 4KZCA 2XVKA 1NCAL 5E08L 4QEGA 4PHZA 1DLHA 4LEEA 1Z3GH 1GPOL 2R9HD 4HS6A 2X40A 3VXOA 3UJIL 3MLUH 5HPMB 1V3LA 3WEXA 2F53D 1QNZL 1IC0A 4CKVX 3BVDB 5F1SA 1BLNA 2EICA 1MCOH 1KPVB 3SBWA 3D08A 5KYUB 4JFDB 3ZKMD 2GIMA 5KSVB 1HIML 1IQDB 1MHHA 5C0CB 2OCFD 4YX2L 3WELA 2ADFL 2BXYA 4QPEA 3AADB 3TOPA 2JK5B 2MOVA 3MRBA 3L3IA 4OD1L 3GMOA 1Y18B 1B4RA 1XH0A 1JFQH 2LU4A 1FC1A 2IAAC 2V5MA 2BVEA 2Z6FA 1BDYA 1WT5A 1L9SA 1JD9A 3ULUD 3PPSA 4IRSD 2XPGA 5F7NC 2EXSA 1RUML 1Q9WB 3L6FA 3R06A 1NDMB 1M53A 4HFUH 3T0EA 3EADA 1N0XH 4NQVB 3BZ4B 1MWAH 1N10A 4KMTL 2HKHH 4ZXBB 5SV3A 5C7XL 3GIZL 1GYWA 5EZJB 4W4OA 4MMZA 3VFSA 1P5UC 4YDIL 1ACYH 5IF0B 1WD9A 4IBYA 1JOIA 2A6JA 2CBOA 2E75C 3DUUA 4OJYA 4JRWA 1UXMA 4AYDC 1Z2KA 2WBWB 1CGTA 2PR4H 2P80A 3HHMA 3QA3B 2DQIL 2XIDA 2YPLE 5FYJH 2B8OT 1GGIL 3ARTA 2Q8BH 3FQYA 1T21B 3D85B 4UM9B 1VFAB 3MACH 1KDJA 3K0YA 5FF6A 3EBHA 1N0LB 1JPSH 1A3LL 3DSFH 3ARGC 4HULB 5T1LD 1DN2A 4OU3A 3QUML 2F54D 1CFVL 4N0CD 2CLVB 3ESOA 5HDLA 1IM3D 1D5MA 1FDLL 1OGAE 1WGVA 2UYLB 4F57L 5L2KA 1ZTXL 1UD4A 2K1MA 5EUOB 4HAFA 1PG7W 2PTTA 3BD5A 1A65A 4Q6KA 3ERXA 1QABA 3BPOC 1F3JA 3D7PA 1JDAA 3IS0X 3JWDH 1UWEL 3DGDA 3GMMA 5LVEA 2H32A 5F7DB 1USQA 2NCEA 3LPOA 3BYTA 3P73A 4XC1L 3MKKA 4G5AA 3P2TA 4QTHB 2XTLA 5MENE 2UZIH 5JW3L 3JUYA 5BS0B 4AX3A 3FUFA 4TL4A 2MFNA 3ZW3A 4F7TB 1L9PA 1A1OB 4AW4A 4YSEA 3PGCA 1N26A 1ZT1B 5ESAB 1XBDA 4F93B 5I1IL 2ENPA 2XQYK 5H94B 2VITB 3I50L 3ZE2E 3OZLA 2GK2A 2GJRA 3QO0A 3D69B 5T1MB 5H4ZA 2DDQL 4YVUA 4FDWA 1G7IA 2C7UA 1PZBA 1FG9C 2Y69B 1UGNA 4J39A 1TITA 3IF1A 4LEOA 1D9KD 2ILLA 3EYFB 5CLXA 4UTAL 1KJVA 3FU8A 3LPPA 4X5QA 1QA9A 5FYJU 5KVFL 1A22B 2R23A 1I31A 1YN7B 3IRPX 3MV11 3QFDB 3C8KB 3TVMA 3WHE1 3L1OL 2HLFD 4AQ8A 4Y9FA 1BF2A 3AU1A 2R4RL 3L9RB 4BSJA 3PP3H 3MNDA 1GYUA 1UA6L 3KGSA 4PLJD 4NKOA 4WW2C 3O41B 1ZGLA 1INDH 4N1CA 5DJZA 5IQMA 1XSKA 4KRLB 2RHEA 4L0ZA 1TSRA 2OLDA 4MAYD 4ZUWB 4HC1H 1K9TA 4NP9A 3SDCD 4OM1L 4PW3A 3F7VA 5IP4A 2M26A 2Q87A 5KJRL 4EVNA 3AREA 3DECA 4UAHA 4HG4J 5HSFA 1ZMYA 3MLZL 4M4RB 2BS71 4HP5A 4RESB 2X2IA 1MVYA 3SZ6A 4TNEA 3FFCA 3K72B 3CSTA 2VMDA 3LXUX 3LV3A 4DFHA 5IV2B 4X4YB 2UY6B 3QJZA 3CVHL 3MRNB 1X4YA 3NPSB 4GEJA 4XP5L 3EYSL 3GBNL 3SZKC 1J5DA 2BW4A 1PLAA 2DKSA 4M1DH 2OP4H 3HR5B 1FVCB 1ZVSB 4Y5YB 2PPDA 4Q56A 4RFNB 4KI5E 5DJ0A 4ZOBA 5DUPL 4BUGA 1F4YL 3TPUA 4IRSB 4M4PA 1LEIA 2F74A 3RB5A 2O6FA 1ES0A 3MHZA 3OLGA 4YDKH 3QNFA 4S0SD 3WKML 5CCGE 1BHGA 2E9BA 1AHWC 2HVJA 1I8KA 2YGNA 4DVRH 1R0AL 2X09A 4C8XA 5FOBB 3TT1L 1OVZA 1BBDL 4BCZA 2X6BA 2F7QA 3UG3A 3TH3T 5E6SB 3EO0B 4AYMC 2B20A 2CDGA 2B1OA 4OIIH 3WNLA 2J2ZB 1EVTC 5ESVA 5DWUL 4LOFA 5IFHH 5AWNL 3V0HA 4JKPH 4PGBB 3KHQA 3VXUD 4XNQB 3T1FA 5IQLA 4IKLA 4PWJA 2VYRE 4P2YA 1AGDB 2MQ0A 1MNNA 1XGTA 1KY7A 5MEQB 1QBML 4WCYL 1KFGA 1ZVNA 4HCRH 4OTXH 4PJEE 1KF9B 4XHJD 1TYJA 4FCAA 1YC7A 4XVJL 5T1LB 4CILA 3GXUB 2WXLA 1CLZL 4GUOA 1N2RA 3V9EA 3LEVL 4PRIE 1RIUH 2PNDA 2DBJA 3QFJA 4P8QA 1XCQB 2XRAL 4KX9A 2GG1A 2XFGB 4WJ5A 1NCBH 2WXKA 3EHBC 2QKIB 1J8KA 4NN5C 4UQAA 1WP6A 4IU3A 1CL7H 3WL9B 5CLYA 1NWOA 4MYPA 1I8IB 3SYCA 3RWFB 5CHNA 1NA8A 4Z7WF 3O2VL 1YMHB 1YEEH 2WO3B 2ZUWA 4NKQB 1QYGH 2VDQH 4M6OH 4X8CA 3T3ME 3GSVB 4ZX6A 1HH6A 4HUVB 5EU7C 3GK8L 1SDYA 3KPTA 1U8LA 2QGDA 5AYUL 4HJIA 2X41A 1XH2A 2OR9L 3DO3A 3LIZA 3LSOA 4FQJL 4MBRA 3RFRA 1YO4A 1UM5L 3P0VL 1GS6X 1YAZA 4H8QA 4X2UA 2YXVA 5AOLA 1UUNA 2FX8L 1BIIB 5AW5B 5DRWB 4ZPTA 3ULVD 1E28A 4OGXH 4WO4D 1MFBH 3UAAA 4N8UA 4YDZA 3O3AA 3V4VH 3AXIA 4K2UL 5HI5D 5HYFA 3D30A 3K5RA 4NAMA 2H26B 2ZYIA 1NUDA 4G3YH 3T0WA 5CGYC 4DK3A 5BVJB 2Z31A 4OV6F 5C70A 1NGXA 1W72H 2GUOA 4X0KA 5LLIC 5DHVH 3BPCA 3IK2A 5E5MB 4BQ8A 1U42A 2H2PC 4LP4A 1QUNA 5BVPH 3NYKA 5EU6E 5DZOA 1L0QA 4L8DB 3TCLB 3FT4B 4I1RA 4HUXB 5DC2A 1T1YA 1M2VA 1RPQA 2ZUUA 4KXZI 3ZOAA 1LE5A 1FZMA 4XB7A 4X4MA 4OCMC 4KXAA 4L4VE 2Y7MA 3QCUH 3MRFB 4PJBA 1DCLA 1X6LA 1CK0L 2FQDA 5CJXA 1BXAA 1DBBH 1IAIH 3IJEB 3MJ7A 1ZTXE 2F0CA 2AGJL 4PJGA 2BOCB 5IROC 4DKTA 2YXMA 4QRQB 1SJEB 3N41F 3LRSA 3STZB 4KZDL 2VQTA 4ZXBC 1ET8A 1SVBA 1RUKL 1VCAA 1BW8A 1Y6KR 1XTLA 4JG1H 3OG6B 5CSZB 4LL4A 1FJ1A 4JRXD 5KTEL 4FFVD 3SDAC 4Z6AT 4Q9RH 4JFFB 5JPNB 4P2CG 2X4RB 3NA4A 5EBMA 1DQLH 4ALAL 5INCA 3QEGH 5CIPA 1EXHA 1TNMA 1KPRA 1AR1D 2GIYA 3HS0A 4U1NB 4UANA 1NGPL 4BQCA 1CGUA 3EO9L 3O6FA 1IKOP 2IG2H 2FX7H 1XF4A 3UBXI 2Y5TA 2WNXA 3HMXL 3QRGH 5DR5H 4GO8A 1ETZA 1RMFL 5A2AA 3DI2B 4PJCB 2AJVH 4K3DL 4WEEA 1GW6A 3TFKC 2ADIB 2C9RA 2HP4A 3MKGA 4K3JH 5IGXH 4J6RL 5LXGH 2H1LM 2M1KA 3NCBB 1OGPA 2MQGA 1KEML 5D7JA 3REWB 4M7JL 2HFGH 1M1XB 2RFXA 3RWGA 3T2NH 5EZOL 1COBA 3MREA 3S36L 2AJ3B 5KVFE 2CBMA 2YN3A 3GO1H 3OAZK 4LARH 4O4YH 4WFHD 3SPHA 5ISZA 2IADA 2AXGB 3FXIC 1WIUA 4WWID 3FOLB 1I1AA 2VSMB 4HPOH 4IKJA 4I3RH 3WUZA 2VLRE 4XC3H 1UCBH 1E4JA 2YK1L 4FI7A 4KX7A 4X6BA 5D1XB 5FO2A 4EUPA 4FD0A 4MA8H 3ZMNA 2DYPA 5ACLA 5GRVL 1FBIL 3FHQA 4PTUA 4K9EC 4U3HA 1VESA 2OCJA 3IKKA 3KPOA 4I3GA 1BX2B 1HSBA 3JBG7 4YL9A 5JXEA 3IGKA 1QEWB 4FQCH 2E56A 4WGWB 2QVMA 3D4CA 4XCCL 2CE6A 4YSTA 1EEYB 2ITCB 4LE8A 1RJLB 4M29A 4G6KL 1SHWA 2Z1PA 3VQMA 1QLFB 5GRXG 4LPVA 4M1GL 4UZUA 2AQQA 1A6WH 2IDSA 2BCKB 5D7IF 1DE4A 3WTSA 5E9DB 1HWHB 5D2LE 4NUGH 2DWSA 2BSDA 3KDMA 4NBYB 4WU5A 4HKJA 1CC3A 2CUHA 4L3CA 2DKMA 4KMQA 4M8QB 4IKIA 3MV9D 3PL6A 1H8SA 1AFVL 1JZGA 1I1FA 1OGSA 4JFXA 4CC4C 5I23A 4EZLA 5TF1L 4H8PA 4QHMA 4WO4B 4B9FA 4ADIA 4XNAA 4ZK8A 2H1XA 2F8VA 2YUXA 4MA1C 3HVNA 3PCYA 4G8GA 2F5BH 2R9HC 5IQ9A 1AGEA 3KH3A 2ENYA 4WJKB 3FB6A 2FZ3A 4PJHB 5BUGA 3HPLA 3QXAB 3ARUA 1Y0LA 3NZHH 1JDDA 2L3BA 4I9WE 3IFPB 4X6CA 4J8QA 5DYOB 5F1NB 5HHME 4XPFL 5IB3B 1KCUL 4TNVF 1T5WA 2TRHA 3ZKMC 1KB3A 2DICA 2QSTA 3RGBA 4I2XB 5KBDA 2C4FU 3NN8B 1MFMA 4G42B 1RP9A 1MY5A 4GQZA 4XN4A 2WIIA 1NGQL 3RPIB 2HJKA 4P07A 4HIJB 1W9XA 5DA4A 1F8TL 3GRBA 4QNPE 4JPKH 4ZS7H 1VFMA 5BRZD 4BK4A 4LHJB 5AL8A 2R29A 1RUAL 2Z4QB 3SY0A 3K6OA 3TX4A 4P99A 3UYRH 3DX1A 3QIBB 4Y5YC 4ZOAA 1MRFL 4RFNC 4JFOB 4Z9KB 2H0PA 3D18B 1S7TA 4HIHA 4IRSC 5IMMA 2XIBA 4YHOL 4G43A 1OB1B 3FN0L 3ZIYA 3NJIA 2P47B 3QUYD 3BWUC 5IIEB 2IH1A 4DP2X 2ED6A 2AZUA 5E0FA 1CGXA 5TD4A 1FZOA 3FH8A 1DJXA 1KXQA 4HUMB 4MJIA 43C9B 3QHFH 3MRHB 4PWGA 1FO0H 1IX2A 4UT7L 3H4FA 2BERA 1MJ7H 3DDFA 3MJ8A 2NNAB 4OJDH 1QRNE 3GGWB 4FJYA 1MF2L 2BJMH 1SUHA 2A9NH 2BSTA 5DD6A 2G4EA 2DD8L 5AENA 4YGVB 2DIBA 4LVOB 3QJRB 5C0GA 3OAYK 3U7AA 4HJTA 1H8LA 2QVIA 3L5XL 2NZIA 4XRCB 2QVTA 1YUHA 2EIMB 2G5BA 5J13B 4Z3FA 4YXKL 2KMWA 5IHHA 1OE3A 4G80A 3V6FA 4MMYB 4BZ2A 5C71A 1YEGH 4N0CC 4U3XA 3CFTA 5ELIA 1F56A 4L3ED 3SDXF 3RWJA 3W39A 1H0DA 1CIDA 5HYJB 4Z7QF 3FONB 4W9LC 3REVB 2X1QA 2GAZB 3IFLH 3GHBH 4D2NA 4KC3B 3TF7C 3ZE0B 4ONHA 1JWUB 5I8OH 2QKIC 3BIAX 2OMUA 4CDHA 4W9KC 4AV5A 1PNCA 5HYSG 4PMEA 1DVTA 3BI9X 2WKGA 4XWGL 4X6DB 3U7WL 3MVSA 1ZLUK 3AABA 1D5ZB 2C3WA 4PRHA 3ASOB 1LLAA 5IOPA 3NSJA 1QSFB 4FOMA 4CMMB 2YEZA 2ZXWB 5TDPA 3DK0A 3GMLB 4RMUA 5L6YL 2O6CA 4HD5A 4M43H 2O26U 5BO1L 1PX3A 1UYWL 3QUXA 4PGZA 5F7FA 3JWOH 1OP9A 1ZA3B 4FNLL 4O00A 3RWIA 3VXME 1FGNH 4LGRB 4DKFL 4LLQA 1I82A 5EEUA 5EBWA 2CO7A 2VLKE 5B3NA 4NQSB 4Y5VA 1B9KA 3FRUB 5L2JB 2LFGA 2BW5A 3JTSB 3GUFA 4JPIB 4N1EA 1MFDH 4UQ2A 3ZTEA 1II4E 3HBZA 3QI9B 1V5JA 3ZYJA 2Q76B 4NC2B 3LEYL 3LKSA 1C12B 4NRYB 3QJHA 2RACA 4J3SA 3P30L 5HGHB 3ETBJ 5JYMA 3DROA 2VDOB 2R2HA 3WS6A 3GJEA 3WNJA 1I85A 4NIKB 1B0GB 4YSCA 4WGVB 2A9BA 5F0MB 4F8QA 2IV8A 2VZUA 4Y5XA 3DBXA 4OFYA 3MV9B 4PLJC 1WDAA 5TDOA 3GJFA 1HJCA 2UX7A 3V4UH 1DVFD 3RQ3A 4HEMA 4GBXD 4R0LA 5FPIA 3VSUA 1MFEH 5C0RL 2VDPB 4MAYC 3SDCC 3FU0A 3MUGB 4HWZA 1FRGH 2CIKB 5IFJA 1VACB 4P3WA 3VA2C 5CEXB 3RJDA 3L7EA 4N2FA 1Z5YD 5D1QD 2WZAA 4OZIA 3GMRB 4PFEA 1HDMB 1UZ8B 2W1NA 3HAEB 5CAYB 3MRIA 4LQFL 3CDZB 1NAMH 2WZ5A 3L1GA 1WHPA 1I7TB 5T5FA 1DJYA 2Y6TE 2XG4A 2HUHA 5JOFA 2VDNH 3T6QC 1UOWA 5BRPA 1SJHA 1RZPA 2W65A 4EZMA 1BZ9B 5JPNC 4NRXB 5EOTB 2DI8A 3OB8A 2QADB 1RPUA 1G9NL 1CU4L 3GRWH 4EDXB 3IN2A 4C56A 5GHWH 2BHZA 1OT2A 4S2SA 4ZQKA 4RAUB 4Z7NB 2JMRA 3NFNB 3QZWA 1XSJA 4TSBH 4HXAL 4XHQA 5IMOA 4JPVH 1MFNA 2ZX9A 3TBTB 3LQAC 3HCVA 4PS8A 2CZNA 4D7BA 4G82A 3HZYA 3LXCA 3P3SA 3DVIA 2NUTA 3NCJL 4YFLF 1P1ZB 1NINA 2CJ3A 2R0LL 3MLWL 3HZMB 3QORD 1K3IA 1BJ1H 4F8PA 5E8EA 1YMMD 1JK8A 1ITBB 2FUTA 2H0FA 2W38A 2V5TA 3B9AA 1I3RB 4CN1A 3SE3C 1ADQL 3UPCA 1KGCE 5T33L 4XNUH 1IKFH 4WEBH 4UUJB 2HJLA 3U0WH 4XTRD 4UWQB 3MLUL 1YEHH 4UIKH 5IBUG 5DJDA 2VM3A 3HFFA 1U8KA 1MCOL 5FUOL 4FFTA 4PQXA 3AJ7A 3D2UD 3DRQA 3GPSA 4HHAA 4XHJC 5D1XC 1H15B 1UJ3A 2AV1B 1OCWH 1ZHBB 3GSUB 4OUUA 4MCZB 3G5VB 5GGRB 1AD9B 5AOZA 5KVGE 4A68A 5T1JA 5JIKA 4LIQL 3UZQB 3TYGL 5LG6A 4ZMLA 1TTUA 2FNBA 5DD5H 4LKXB 1UJTA 2YRLA 1M7IA 1JFQL 5FOJA 1MHPL 3BD4A 5AZUA 2XWEA 4H1LA 4PG2C 1WAAF 3HN5A 4J6IA 4OFQA 2CXGA 3H3PL 5JW5A 4FNQA 4MXQD 2APTA 1S9WA 2PP7A 4JG9A 2ZOWA 3H7LA 4KWUA 2APWA 4D8PB 4DH2A 2IALB 3FTWA 1HU8A 1P4IL 1QOKA 4JN2B 4XGZA 4FLRA 3JZYA 5DJ2A 4BV1A 4TVPH 4GP8B 4LLMB 1EK3A 1NKRA 2ZWSA 2EXTA 3NOIA 4NXKA 3FF8A 1N64H 3IM1A 2WW8A 1KV7A 1PX4A 3NRPA 3ULVC 4WO4C 5I6XB 2EEAA 3Q2NA 4ODVH 2ICEB 4XP4H 5C0AE 4PUBH 5FFGA 4OBRA 5FYJL 32C2B 5FM8A 2AJSL 1VEOA 1UXSA 4KRPD 5ICXB 4IBSA 2CLZA 5EMYA 3MACL 2ZPKH 4PJ9D 3HHSA 3T3PF 3ZRSA 4OLZH 1JPSL 1KPUB 3UTSA 5IG7B 2Y2YA 1UEMA 1CLOL 4X6EA 1AKJA 1J9QA 1FIGH 2HB0A 4UILL 1A7PL 5BXFA 5IMLA 4XNYH 1HWGB 1THCA 2KDGA 3DX8A 3P4NB 4BKLB 3CJJA 3ULSA 2K8QA 1J0HA 1MQ8A 4GLRH 1DVFB 3S4SA 1E8YA 3IDJA 4FAAB 4L4TA 3EJTA 4NQCA 4O2FA 1I9IH 5FO7A 1IIIA 2XA3A 4LCYB 4DOHE 2EKSB 3VFGH 4DPRA 1A6VL 4JGMA 1OM3L 3VG9C 3KR3L 4AK2A 3D0LA 1J7VR 2R51A 1BG9A 2FYYA 2GJ6E 4WI0B 4QAMB 4NNYB 4QRPE 2Y06H 3S97C 1O7DC 2UZIL 3DTDA 3OX8A 3WIAA 3ZHKA 4F2MB 1PSKL 2WUCH 1W6WA 3D87B 4GT7A 4MJ6B 2MNJB 1SDDA 2NDGA 3ZYOA 4POYA 3ZTNH 4FFVC 4R2GD 4KUCD 1PYWA 3MODH 5B3JE 1PAMA 1E8XA 4XCNA 4CU7A 3B2MA 2A4CA 2R83A 2HLAB 1AG6A 1ZSDA 4PCTA 2ZTBA 5DS2A 4U1GB 1Z1WA 3RUGE 2W07B 1NIEA 4Z7WA 3V7AE 2MOGA 2DMKA 3VFOA 2CGYA 2X2HA 4ZFOA 5J13C 4Q2ZB 4IBVA 5D55A 4K5NA 1HILA 4ZFZB 2HZHA 1V3MA 3BCFA 4FP8H 2BLFA 5D1ZA 5EUKB 1KLGB 4ABVA 5J12B 1TJXA 1MAKA 4WW1B 1ILSA 2ROXA 3NA9L 4OD2B 3MXVH 1OOAA 3FB5A 2XG5B 4LRNL 1F6FB 1INDL 3CXHK 1DDHB 5DO2D 2J3SA 2YMOA 3VRIA 1DSYA 1U58B 4N0UE 2DQEL 2BIMA 5DI8B 3GMPA 4N26A 1PMYA 1UWXH 5JIQA 1WISA 2FGWH 3G08B 4RAVB 2MCG1 3WIFA 2DI7A 3FUKA 3GKWL 1MFUA 1PZDA 5SWSE 2CO2A 2HVKA 2EDMA 2WCPA 2Y07L 3Q1EA 3QAZB 3TEUA 4ZG1A 1UB5A 1F02I 4U6VH 4RISL 4W9CC 1F90H 3DURA 3T4YA 1BQLH 1RZIA 4OLWH 2Z34A 3MXWH 1NL0H 1FFOA 2X9ZA 3QYCA 5MHSD 5DD0L 1T83A 4G8AC 5B8CA 5DQJB 2NLJB 5CGMA 4FADA 1JE6A 3O11B 1P53A 4XOAA 2QPDB 1RV6X 5D93C 1TZOA 1T2QL 4HA1A 3T6ZA 1XO8A 4UT9H 1HK6A 2RD0A 4MJHA 2IAMD 2OP4L 2QKSA 5DWPA 5FO8A 2J8UE 4NZFA 3FU9A 3TWCH 2UY7A 1NMBL 3NCXA 3SE8H 4KJWD 4PRPA 2FVNA 1GSKA 4WVRA 1CT8A 4IHOB 4DVRL 3IRCA 1KN2L 2JKXA 4A6YH 4FQHA 4ZAKD 2Y1YA 3S98A 1G7MA 4EN2A 3TIDB 1XF1A 3ZE1F 1HHJA 4K5MA 4YDVA 4NC1E 4PB9H 1L3NA 2QT6A 4XPAL 1FVEA 2YARA 1E6JH 3JV0A 2ZUTA 1MCSA 1GZQB 1DUYA 1XF3A 1A1MA 3VXTB 4FTVB 4EIZC 3T77B 4Z7IA 1UASA 3DOSA 4CMHB 1JPTH 2A83A 4R4BA 2D3NA 1UGKA 2OQJA 3MLRL 5D7LE 2XWCA 1IC4H 2KERA 1IAOA 4L9LA 2J5LB 4PJ5D 2AXJA 1MJJA 4PJ9B 2EYSB 3BLPX 3O4LD 2VR8A 5CWSA 1CBJA 4HCRL 2QPEB 1MN4A 1JN6B 1JG9A 2UZXB 5DGQA 4G9DA 5EF3A 4X8XA 4Z7UE 3TPKA 3I3EA 2AVGA 3CUPA 1VFUA 3R7QA 2YSSB 3UTTD 4TSAH 5I74B 1OAXH 4DW2L 1NLDH 1BQHA 2R0KH 1DP0A 1K8IB 4MNQB 4Y88A 1KTLA 2F5AH 3BP6A 1JAEA 4I13B 7TAAA 1MPAL 2QADC 4Y1SA 1TVBB 3VUAA 1RSFA 1NBVH 3FQ2A 1BM3H 4JFWA 1XEDA 4Q0XH 1YEEL 4ONGH 3ARZA 2IJ0C 4FGMA 1UB6A 5J6SA 5A2FA 2A74A 2CRIA 5TE4L 3UAJD 3CG8A 5LQBH 1AJ7L 1IGCH 3CZUB 4J8RB 4NEHB 3EXLA 1ACXA 5D2NE 4Z95H 1XHHA 1BF8A 2DQJL 4IOIA 1ZLSL 3QCVL 1KIUB 4KO5A 4MX7A 5T1KA 4EI5D 4OGXL 2MSPA 1HZHH 4NENB 3ZX1A 3V4VL 1BG1A 4D0DB 1YYMH 3N42F 4B9GA 2HN7A 3RAJL 4W9HC 2YAHA 1FNSH 5DHYA 2JCCF 5CFHA 3HG4A 5FHAL 1BM7A 1T4KB 1PL3A 4DZBB 4AVKA 4OJCA 4CADA 3SJVE 4LVHB 3X14B 3SSGA 3LRHA 3F12A 4HS3B 1USZA 4H4NA 3C5JB 3NZ8B 1MJUH 1L3WA 4ZDHA 3TP4A 5CZVL 4RGNB 3C2AL 5E8NB 3ILEA 4BCXA 2KLRA 2DTSA 2YAFA 1TETH 4G70B 3CDFA 2BNUA 1X7QA 3D34A 3F58L 1R3JA 5DJAB 3OPUA 4BSVA 5KANI 2EVHA 4N90E 2FHCA 4M3KB 4POZD 4LCCC 1XIWD 1UZ6E 2Q2EB 5JQ6L 2VC2H 2X1OA 2ZQKA 1N5AA 2LR4A 2YQ2A 3CHQA 2ZX7A 5DEFB 1JV2B 4NNPH 1VGEL 4JDEB 3W9DA 1ZSHA 3HN3A 2QVFB 4FFZL 1I7RB 1KV3A 2C9VA 1MRCL 3EG9B 3BAIA 2VISB 5JIPA 3VFMA 2WVVB 4LNRB 4NQXB 1BFOB 4KPHL 1E9PB 1EA9C 1LMIA 5I6XC 3CFQA 2HT2D 4MB1A 2ICEC 4QXGH 3RY6A 5D4JA 3L5JA 1GRWA 4XP9L 5FLUA 1JNLL 5KAQG 3KH4A 4U1KA 1DO5A 1Y7VA 1Z9LA 2OX5B 4IMLB 4Q6YA 5FECA 4BFEA 2WXMA 3GMNA 4MNGE 4UMGA 2KLTA 2ZKYA 1DVQA 4HKXB 4MVBD 3BUYB 1NCTA 3BAWA 3PWPD 4YHLL 1A6ZB 3LVTA 4Y2DD 4ZAKB 4JUTA 2C3HA 3GDCA 4HOXA 1AI1H 3E3QC 4UCFA 4KX8A 3U82B 5FB8B 2A6IA 4XAWH 1LO5B 4P9HL 3EH2A 3INUL 4LEXL 3TWYA 4HU8A 1DVFC 2GTWB 4K7PL 4O4YL 3SOBL 3GSWB 2V8MA 1VENA 5B4MD 4YDJA 4P23D 2IVFC 1A6UH 1EEZA 2XWJB 2G2PA 1FWXA 5D1QC 5T8IA 1URLA 4I3RL 4JANB 5I8CA 3O4LB 1QHQA 5MERA 4AEHL 2XWXA 5EO9A 1XGRB 1MWAA 4GW4A 5F9JA 3SDXA 1ED3A 5HDQL 4U1LB 4CL7A 4FMFA 4XZUA 2K70A 3WE6A 4GRMB 1B4JH 2ZYRA 5ID0B 1MI5E 2HWZH 15C8L 2NW2B 2UXVA 5D70H 2KHAA 1D5BB 2AEOA 4WHYG 2X6AA 4GKZB 4L8BA 3F5WA 1JV5B 2JTYA 2ESVD 4G8EA 4J4PD 1I3UA 4MDJA 3V6OE 3X1BA 5DJYA 3K8MA 4OCXH 4WHYH 1MCEA 4XMPL 1BVKA 4L23A 3SGDH 3IVKA 3M17B 4NUGL 5IM7B 3VXRB 2BVYA 3KPLB 1D5XB 2X5PA 3UBGA 2IXQA 3QORC 1QAWA 4GXVH 1KJ3H 4H26B 3QEQA 5I6PA 1KGXA 1S7VB 1YVLA 3UDWA 4JRYB 4PLKC 4XMUA 2UXTA 4M7KH 1FHNA 4RBPK 4S1QH 1JERA 2WQ8A 2ICWA 3F85A 4Z3IA 5T3XH 3VGBA 4CVXB 4URKA 1OAKH 1VJSA 1OGAD 2NTSP 1DBAH 4XTRC 4RQQA 5ABDE 3T1WA 4E0RB 2PWDA 1J9SA 2V0AA 4KBPA 2QLYA 3NZHL 3UBHA 4LVNB 3O3DB 2NY7H 3BKML 2OMVB 5EORH 2BVQA 1FQ9C 2EDKA 5DRXB 1ZE3C 2X42A 4ZPVA 2RH0A 3IXTB 3AXLB 1I8UA 1YEKH 4X4XA 1LK2B 1T1ZA 1DR9A 4BFKA 3POHA 3WLWD 5CJ5A 5E7FA 1FSKB 1XSIA 5ANMA 3SKNB 5JLZB 3C75A 5FYLE 3MTXA 3EFFB 4AT6B 3UYRL 5IBLD 1E3ZA 3G5XA 4X5XA 1E4XH 4HSCX 1AZVA 3SQOH 1J9RA 3HRPA 2WQSA 3HC4L 3O3EB 1CXEA 4U2YA 2J71A 5F7HA 4K0OA 3U46B 1CBVH 3CPLA 3O3BB 5FYKL 1U8MB 4K9EH 3LS5L 1FG2B 2P28B 1L7TL 2OL3B 3HZVB 1CE6A 1MDAA 4MJJA 3UPRB 3QHFL 1JJUA 1SEBA 3RNKA 4AV0A 2XUWA 3CD4A 3EFDH 3MCKA 1S5HA 2C9QA 2CKBB 3MA7B 3R4DA 4CMHC 5M94B 3FQ4A 4RFEA 4F2EA 2YEQA 3ZKSD 5C9JA 4B50A 5TH2B 4XXWA 4PB0H 5GS0L 1X44A 4H0IA 1U2CA 2E9IA 4G6MH 4HC1A 4JDZA 1ZOXA 4HYTB 4N2BA 4PJ9C 4ZW7A 3IAPA 4U7SA 4UTBH 3TA3A 4CU6A 2NSXA 4Q58C 5F9OL 4OR1A 1AO7D 5IWLC 4NPJA 1YEGL 4NGHH 2BMKA 3GNMH 4GRLD 2XXGA 4Z78B 4J7RA 3U6XA 3GJFK 5I74C 4ZNCD 5L2KE 1MCJA 3KWTA 3M88A 4BHUA 2FWLB 4GKLA 1T5XA 1CFNB 3E6HA 3N0PB 2WKLA 4LLWA 2PYED 1WFUA 3V0FA 4Q4IA 5I8EB 1ID5I 1W80A 2DL9A 3SPVB 3WXWH 5FS5A 1FNGB 4ZMXA 1LJMA 4FXGB 7PAZA 2ENQA 4U1JA 4LCWA 1GGTA 4CVZA 3D09A 4JO1H 4FABH 3C6LA 1I8MB 4KI5D 3ZYIA 4AZ8A 2R59A 2QQNH 1S7QB 2NNCA 2ZG1A 5CZXC 1F5WA 3CBRA 5TK4A 1ZDQA 1CGYA 2DQMA 3GMQB 3B2UD 4OBSA 1UZGA 5D6DC 4IBWA 2BNQE 4C58B 2O93L 5E8DL 3L5WA 2R2EA 1IGTB 1JGLH 3BH8B 4U1MA 5HHOA 2ZCLH 4IIQA 1RURL 1OP3K 2CO6A 5JMRA 2GEQA 1Q9OB 4HIXL 3NCWA 1BVZA 2FJSA 2GKIA 4L18A 5BMFH 1M7XA 3KCPA 5J11B 4KVPA 4N86A 1GYCA 3QR2A 4QUOA 4IHBA 4R7XA 4R7VA 1YEJL 3HPJB 3ECQA 3DHPA 1BLIA 5AAMA 2MEJB 1UWGL 3DIFB 4FLQA 4MB4A 1AY1H 1FC2D 3S5YA 5C92A 2YPLB 3BGFB 4LVHC 5E94A 4E5XB 4P4RA 2XWBB 1ZDSA 4DQAA 5GZND 3G5ZA 2LLLA 3O6FD 4HJGB 1OAUH 1TQSA 4XAKD 3U4EB 4YAQA 4NYLB 5DO2C 1GW0A 1YECH 1OGAB 2B77A 4KQ4H 4MD5B 5CBAB 4G83A 2MH4A 1BD2D 3PE9A 4MAZA 3FUEA 4YUEL 5H37H 4PW4A 4EJ1C 4OFIA 4HU2A 4YO0B 3IWUA 2BIIA 5LBGA 1J5OH 1HEZB 4HKBA 4B27A 5DZPA 4X99A 3EYVA 2XVLA 1FL6A 3S37H 3EH5B 1G9ML 2VLJD 4HUKB 3FFCE 3STLB 3ZSSA 5E2WH 5IBTL 1Q1JH 3WS3B 2BINA 4OI8A 2UZPA 5EPMB 1JHKH 2QTEA 1AQKH 1TQCB 5DJCB 5TDNA 5A2BA 5KEZA 5MENB 3GLAA 4XXDB 3RL2B 3IU4H 1KCVH 4OLUL 3D4ZA 3RFZB 1K85A 2OYLA 4YHNB 3L3JB 1NWPA 2V5SA 1UOVA 3PXLA 5TQ0L 3TXAA 3PJNA 1JPFB 5I76A 1TZHB 2R56H 1XF2A 4TSBL 4FKKA 1R24A 1SYSB 2E9JA 3ZE2B 2B39A 4JM2D 4HS8H 1E2WA 1R34A 4EE2A 3FCSA 1G5AA 4ZAKC 1W72A 3BSHA 3QG6A 4I1NB 2YEVB 5AKVA 2CBPA 2P8MB 4G7YH 3FMGL 4G2AA 1RZJC 3BZFB 3KGUA 1QVOB 3PNWB 4QLWA 3BLKA 3NFSH 1IC7H 1CI5A 5EU6D 1TIUA 5F72S 3B3BA 3N85L 4ODWB 2NNFA 4F58L 5AD0B 4L4VD 2YPVH 3D07A 3I74A 5BV7B 1R3KB 4GNKB 4ZTOL 3GC3A 4QRRD 4TUJB 3PL6D 1N19A 4R7DA 4Z0BL 1ZV2A 4U2ZA 3V52L 3L3OC 1E5YA 1JGUH 4FXKB 4K5PA 5E00B 2OMYA 43CAA 3BCDA 3IJHA 1YDPA 4TKWA 5E1AB 5H2BA 2FT7A 1RZQA 2F8IA 3IJYB 4AEEA 2JVUA 1EDQA 5KVDL 3CN4A 5IHWA 4QY8B 3TJHD 1DQMH 3CMOH 2Y1VA 1OHQA 3DI3B 3MBEA 4ZO7A 2YO3A 3RU8H 4XCFH 3CDGA 3OKMA 3B2DC 3BESR 5C09D 4O2CA 4XMWA 2AMUA 2NYYD 3Q3GB 1CFSB 4N2IA 4U6YA 3VB9A 1ZVYA 4KV5E 2GTZA 3QJFB 2VLLA 2WOBA 5TPWL 4M7ZC 1A21A 1T0OA 5GGUA 1AP2A 1U8CA 2FHFA 4AI7A 2BX5A 4WW2F 5DFVC 5DU7A 4DP4X 5FYKE 1S46A 3CVBA 4PV9A 2WXFA 4HV8B 4XP1H 2FWOB 5MEPB 1O9ZA 4ODVL 2WXRA 1WBYB 4XP4L 3WMQA 4KZ0A 3WIIH 4U6XB 3LQAH 4F1ZA 3FO0L 3PJSB 1ML0A 2JLLA 1ZEAH 3TO2A 3CGTA 3GHEH 3OKEA 5C08D 4Y4HD 4BFJA 2A4EA 2YC1B 3GFUA 6PAZA 1YNTA 3GTNA 2Z64C 4BEIA 4L0YA 1KBGH 4WNSA 4FEIA 4KGJA 1A4BA 1FIGL 2VMJA 1CFMA 4TQEL 1NAKL 3TJPA 4BQ6A 8FABB 1QX1A 4N20A 1YY8A 2VDKL 1NC4D 4PJEB 1MCQA 3TONA 3IDNB 3G5WA 4X4ME 3HI6L 5A43C 5A3ID 5A6IA 1JWMA 3OC5A 4PRIB 4PJBE 5TE6H 2GT9B 5AKSA 5FA3B 3WUWG 2R1WB 4E42A 5TF0A 3PHOB 3QULA 4M5SA 3GBEA 4MHHG 1XIWC 1LK3H 3O8XA 3R1GH 3VFGL 1DN0B 2J88H 3OMNB 1A7QH 2H41A 2WV3A 3LIUA 2HT4D 3PGDB 5I0WA 1JWSA 3QH3B 4JB9L 2H9GA 2XDHA 3HVDA 3QDMD 4PJGE 2ZZUT 3G9VA 3WJJC 1JRHH 3MJ6A 3TN0B 3PPEA 1WEJH 2QQLH 2WLLB 3MJ9A 5D4HA 3WHXA 1AQ8A 3KPPA 4XPTH 1M05B 3I6KB 1QSEE 5L9DH 2ZICA 3T3MB 1L9TA 5C0DB 5AQ0A 3ZTNL 4ES8A 1FA4A 3CX5J 3BAEL 1YEDA 4GOSA 1GTNA 2GIXA 2HT2C 3CSFA 1A0QL 1JGEA 4K94L 3BP7A 3DX6B 2UWEF 5CGBA 2D7PA 3TNMA 3KLDA 1AGCA 2VDRL 4V1DA 1DJHA 4OT1L 3BSZH 3FFOA 3MOAH 4P5RA 4LDOB 4TUUA 3U36A 1F4AA 2EKJA 4MVBC 3FCGA 4Y4KD 1IJNA 3BMVA 4Q4EA 1I8LC 3B1TA 4HWBH 2JF1A 4QF1B 3MA9H 1Z9SA 4IMKA 1FE8L 1XQ4A 3FO1A 1W91A 2DS4A 4PIRF 2KQMA 4Y2DC 2X44D 3FRPG 3S35L 4I9WD 5ID1A 1T6VN 2A1WH 4NWTL 4C83B 4MS8D 1PG7L 2C9SA 4H88H 1W8NA 3MU3A 1LO4H 4YE4L 3ZDYF 1KB5B 3OHXA 1D6EB 1UWFA 2B1HH 1YEWA 3F64A 4XN8A 4Y89A 5EU6B 2DWEA 5SWQA 3BT0A 4OZFG 4U1HB 5B4MC 4HFWA 5L8KB 4FXGC 4PP2A 2TSBA 1HHKA 5IB4B 4L4VB 1G1CA 1FYTA 4X7TB 4AK1A 1R3HA 4NQQA 5DTFB 1PAZA 3W81A 1J1PL 4XNMB 4QHLA 1U8PA 4QYAA 4FRWA 2X7LB 1C5BL 4OZFH 4WI4A 3CFEA 3NZSA 4P4KB 2YMTA 1T0MB 1NL0L 3P4MB 2FUQA 4E41D 3V0IA 1OW0A 4KJYB 4W68A 5KAQF 2EDTA 3K46A 3MRGA 4PJDE 3VD9A 3OBAA 3SDYH 1DQJB 5AL0A 3VWKB 4AQZA 1FO0A 4A7TA 1AZNA 1RJCA 3MYZA 4NUPA 1KOAA 4OIAA 1XT5A 5C9KA 1BVNP 5CEYB 4M03A 4J4PC 5T3ZD 1ZXQA 5J11C 4Y16B 4WWKD 3LEXA 2XA8H 5DD1H 2X70A 3SGJA 3VCLB 1HHGB 4N5ED 1VEPA 5C0BE 2VLMD 1O6SB 2QSCH 3INOA 4KNUA 4ELKA 3MRDA 4JZNB 3WYRA 5LGJA 1T7WA 4WI5A 5E1GA 3KHOA 5E8OB 3H8NA 4HIPA 3TF4A 2CU9A 2QQKL 1T22B 2ZF9A 4BA0A 3OC8A 1GIGL 4J3OD 1KIPB 1QNIA 3P9MB 2NCMA 3MMEA 5JOPD 4X80L 1U41A 1S8DA 1JPTL 1I3GL 2MKLC 2V9RA 4TL5A 4N3UA 2D0FA 2FBOJ 2BVOA 4HPYH 5E7BA 1A7BA 1BBJA 4WUUA 4XBPA 3FT1A 3N1GC 3MRLA 4WNQA 3BPLC 3K74B 2VDML 2I7OA 4X6CE 2H6PB 3VRJA 4XPBH 1B0IA 2BNRD 2BP0B 1JZDC 2BIQA 2R0WH 2WBKA 4B41A 3WG7B 4O51B 3X1FA 5JHDD 5CFAA 3V6BR 1Z9OA 5DC9B 1MZZA 4UV7H 3VACA 3CVDA 5E70A 3WLWC 2VLRB 4TSAL 4AUJA 1TQCC 2R0KL 2NX5D 4KUZH 4OGAD 3BVXA 4YXLH 3BT2H 4IEFB 5IBLC 2O61A 3ES6B 1R3IH 2FSDA 4FQIH 1J1XH 1NBVL 1WC7A 3NJNA 5CUSL 2O5XH 3GZPA 5EBGA 1X5IA 1KELH 3D33A 4LKCA 5KVDE 1N68A 4I4WA 4OZHF 1HQ4B 4YHYC 5GGTL 1V7ML 3N40P 4QHKJ 4R5XA 3MGOB 3MUY1 3ZUNC 1JGIA 2QR0A 4J5VA 3PAYA 2W0FA 1KXQE 2VABA 4J28A 4BBWA 2QGBA 5H35B 5I2IB 4HUUB 4PG9B 5EUOF 4KTEL 3AC0A 2EDHA 4QRTA 4TSCL 3V4PH 4FQ2H 1SBBA 4CSTA 5I66B 5D2LB 5LXVA 3FQXB 3AUWB 3ZRCC 4PBDA 4XZ4A 3MUUA 3FK3A 3IPBA 4HMCA 3EH4B 2WBJA 3IJSB 1TVDA 4YHZH 1U8HB 5FWQA 4CNIB 3UO8B 3KPMB 3RIKA 3DHMA 3ZL2A 2PO6A 3QUKA 3NP4A 1J0JA 4FXKC 1NPUA 5DRZA 4X5WB 1UACH 4UQ3B 2DWDB 3CFDB 1MJ8H 4ZI8A 5HHMB 3P77B 2OYMA 3BH9A 1NAMA 3ISYA 4PBXA 4MMXA 4NIYE 4XE0A 4DSYA 2WQVA 4DETA 2W59A 4N0RA 2B3IA 3BWAA 2OXHB 4HAGA 4YQXH 5DQ9A 4ZZKA 3GSRB 3U9UA 2HFEB 2ZSWA 1A2YA 5FA4B 3GRWA 4LVEA 3HAEH 3WJLC 4WFEE 4UQBA 2DYRB 4UU9B 3PHQB 4NNPL 5F6IB 2HCZX 4KI5C 3EYOB 5E95B 4UDTB 4AGNA 4U1MB 1BAFL 3WFHB 2D9CA 3EGXA 3MNVB 4I18B 1XDTT 3SPJA 2OW6A 3AT9A 3TBBA 3B2UC 1MFCH 1JUFA 3NTCL 2ICWI 4ANXA 3V8OA 3Q9PA 1U8QB 4OB5H 5DUBA 2YBGA 2SEBB 3NIGE 5F0LB 5DJ6A 3C5ZA 3ARXA 4MKMA 3DRTB 2LQRA 3EOBB 1B2WH 2OTUA 3O9WA 4PWIA 3CBJB 3HC3H 2P5WA 1BJ8A 1TJIH 1M71B 4X83A 4BUHA 3UO1H 1QRNB 1PJWA 3U4BH 3DX3A 4NO2A 5DT1H 4YK4C 3EJRA 3MRMA 4HUWB 1GC1L 4MNHA 3EZJB 3IBOA 1F86A 4XX1E 5I1LA 3SGKC 1ZTMA 1BZOA 4R8WH 3E1F1 1KXVA 1DVUA 1GZPB 2JQAA 1TQBB 2OULB 1QSZA 3KJ6H 2PCPB 3MO1A 3VFRA 3D6GA 5K9KA 2RMNA 1C08B 5C0IB 2D03H 3KNBB 3M1OA 4G7VL 3TO4D 2I9TA 1KGIA 1E8WA 3S8FB 3IGAB 2IFFH 5TTRA 1AXTH 1ZHLA 4L8SA 5D6CB 4HEME 4KDVA 3LNGA 3MV8D 1R17A 3BWUF 3D4GA 5HDBE 4LAQH 1J1OL 5K5YA 2CUIA 2HH0H 3IDUA 2X6CA 5AG8A 1Z0MA 1CFQB 2WVTA 4PH8A 3VI4E 4OZIE 2XNAA 1KACB 3OPZH 3TN0C 4BM7A 4CW1A 4ELDA 3HR6A 7PCYA 1TU2A 2WLZA 2XYBA 3OGCA 3OTTA 1NCCH 1I9JL 4TM9A 3OLDA 3H56A 2WP3O 5B22A 2TAAA 2AJYH 3WN6A 1OT4A 2YRPA 3HC0B 1SEQH 2OMNA 3D25A 3SCMD 4AC4A 1KZQA 1FCGA 3VXMB 1LD9B 1HN1A 3CXDH 1RJYB 5IR1A 4LBAA 4JM2C 2VLKB 4K7PX 5C1MB 5ESQB 3DUSB 4JDTH 1KTJA 4HDIA 4FG4A 5CD3B 1IL1B 2NY2D 3SE4A 1XB6A 1SNRA 4M1CD 2JIXB 1FPTH 1YEFL 2NSMA 1AS7A 2C8NA 4RZCB 1PNDA 4FCHA 4XO8A 5HGGS 4H0HB 3OXRB 4AL8L 4NZ8A 3SQRA 4E2OA 2DQHH 1XFPA 4MXWL 2VZ3A 3LDBC 1KLFB 2A73A 4NHCL 4NT6A 2OMXA 4JG5A 4PAZA 3NJLA 1IJ9A 1BJMA 1NCUA 1R5IB 3ILPA 3MRQA 2VE6B 3ME0A 4FQ1H 1FORH 4DGYH 1FFNB 2NY7L 4LESA 2J6EH 5CD5D 5IFAH 5EORL 4QXTA 5DK0B 1S4IA 1Q9LB 5EH1A 3KVPA 4NZTH 3FS9A 4Z23A 4P4KC 5I0ZA 3VFTB 2CKNA 4I48A 2L4OA 2QZQA 5C0FB 1T7ZA 5HDOA 1INEL 1ZV9A 3QXVA 2C9PA 5K59F 5ADPL 5SWZA 3QQ9D 1J8RA 1Y1UA 3VWKC 3TJHC 4MRCA 3ETBF 2WN3A 2AXWA 4BZ1H 2BP8A 3X3FL 3H9SA 3WMPA 3QNYA 1A1NA 2DQDH 3QJSB 1AR2A 3SQOL 2XZCL 4M61A 3VNZA 4AXWA 1OF2B 4Y16C 5AALA 1CD9B 1ND0B 4ZTPL 4R5VA 2OXGA 2BM3A 5I6KA 1PLGL 3DPBA 1L4IA 2NDFA 4QKTA 2VZ1A 2AV7B 3O2DH 1UXWA 2X53A 1P5UA 2X4NB 4HWEL 5HHVH 4AWJC 3MFGB 2DMBA 1Q0XH 2Z3FA 1Y07A 4M6NH 2WLJA 4QRUB 3RY5A 1XR8B 2QV2A 4KKBD 1MAMH 3CZJA 3SPIA 4HLEA 3UC2A 5I1AB 3PS6A 5H4YA 2P3YA 4YSPA 2DQ6A 2NPLX 4FLOA 4PB0L 3QHTC 4UYQA 4G6ML 1Z3RA 3VFVB 2OBGA 3CCHA 4X5PA 4HIIB 4A37A 5CSGA 1H3VA 3X1EA 3MRCA 3HE7A 4WAFA 3V8CA 4E9WA 3VW3L 3GNML 1P2CB 4GKNA 4RRPM 4Y4FD 3QARA 3VO0A 2ITEA 3SO5A 3EW3B 3V4LA 2WINB 3FCUB 2K9FB 3Q5YA 1CD8A 1A9BB 3B6SB 1VKXB 1BFVL 1IBZA 3MLTB 3C60B 4I3SL 5IMKA 1QUPA 3EKCA 5GJTL 3V9FA 1NGYA 3ISRA 5ENWA 3IXAB 3FQUA 3MV7A 1BVOA 1S78D 4UT9A 3TH4T 3RBGA 2L0DA 1ZE3H 2HT4C 2XKUA 4PJCF 2DLGA 1T03H 1A9EA 3QBTB 5DZ9A 5ERWA 2IH8A 3RRQA 3FO2B 3UMTA 2P45B 4ZS6D 1M56B 1H3PH 3FZUD 1S9XA 4NKIH 1QBAA 2RGSA 4LBEA 4RFOH 3TFBA 5HYEA 3CIQA 1OD9A 4D9QE 3UZVA 3WFEH 5LBSH 4FYTA 5CO1A 1JZIA 4MKTA 1U9KA 1KB9J 3SCMB 5KSBF 2NY5L 1J8HD 1BMGA 3LHPH 1KENL 4LU5L 4BQBA 1A25A 5E99H 4LHUD 5KSUB 1JHTA 1CURA 4UT6H 2DLFH 1G6RL 4I87A 4EXPX 1SY6L 5C0AB 1AY1L 4LB8A 2V7NA 2XICA 4B9IA 2A9AA 1JZ6A 4AMWA 2ZX5A 3U7YH 1VB9A 3I9IA 3HI5L 3QDGA 4LLUA 4XB8A 4XPGL 4KVNH 4MS8C 2FIRT 4HKZA 4WW2A 3E8VA 4P2QA 2HRGA 1UVQB 4KAQL 1KXTA 3QUZD 2BS9A 1YECL 4KQ4L 3M46A 3SDDB 4JHUA 4JGJA 1I3VA 2PW1A 2BSRB 2OW7A 4HCFA 3SY6A 1I8AA 1RIVL 3F6IA 3OGOE 4RX4A 5F6IC 4MBOA 2N59A 4PRAA 1TFHA 3LZFL 5IVZB 4AQEB 4DOHB 4O58L 5IHUL 1MREL 3QWOA 4Y7OC 1ZHNB 3ULVF 1W2KT 2VXQL 4NQEA 4B9CA 3HG1E 4U4BA 4APXA 3EBIA 2GJ6B 4QRPB 4U3CA 3U48A 5A6LA 3B8YA 1EMTH 1F18A 5C8JA 4QOKD 1ANUA 4PJHF 5DZVA 4C59B 4AW7A 5GIRA 2X10A 4O2EA 4IRZH 4OLVH 4QJ5B 4Z8FL 4YSAA 4IM8A 5AZEH 4HK0B 1BOGA 5L4MA 4V33A 4ZFFA 4CU8A 1TO4A 5C0JA 4PRPE 2H7WA 2CLRA 5EU3A 5IB5B 3O0RH 3RUGB 4KMLB 3P3RA 3QJTB 1TQBC 4HQQH 2YGQA 4HGKC 4OM0L 3SBRA 1V05A 1ZAGA 3T4AC 5EF1A 4TTGA 4J3OC 3QQ3B 4O5LL 5F1IA 4RA0C 1BQRA 2ADJA 3L3GA 1QBLH 2DRUA 5GRZA 5FYJD 4X9FA 4AKQA 3WMSA 5HPOA 2UWEA 3O6KH 3BN9D 2IANA 3V5DB 4PRBA 4R26H 5E6UB 1HOEA 3S96B 2A6DB 5KN5B 1BEYL 4YIQB 5F21B 1F13A 4N0UB 4MB5A 4N90D 3TCTA 5CBEB 3SHSA 3K6NA 3VG0H 5KBLA 2A38A 2AK4D 4I77H 4J12A 1ZT4B 5KYXB 2YBRB 3IMRA 5SWSB 3VGFA 3X17A 2EE0A 3LMJL 4PCKA 4OGAC 2FWSA 1HNGA 4M6ML 4BWWA 3KLLA 1J9CT 2F15A 1SOSA 2OJEA 2OMZB 3HNSH 2V3DA 3DMMB 1P84J 5C07A 1CD0A 2C1OB 3U4AA 4BSWB 4NKMB 2VN3A 4KU1A 1T20A 1XGYH 4YSRA 3DTUB 5GJSH 4GW1B 5AVZB 2J8UB 3O45B 1M42A 2X28A 1RFDL 1UM4H 3B43A 4CBPA 5AVRB 4OAWA 3SJVA 3I3BA 2HRPH 5DSCB 1NC2A 5GISH 4K4KA 3OL2A 3TYFB 1JF1B 3AW5A 3IDXH 1LQSR 4ALAC 3V55A 3M1BA 1F1AA 5BZDB 2HX7A 1AAJA 1TQVA 3H9HB 5A2JH 2FECI 2WUBL 4GAYB 5KYYB 4F7PB 1WUZA 1TZGH 1RERA 2E9WA 3U6RA 4I5BB 5ILTL 1CICB 1S7RA 3VA6A 4FG2A 4NNXB 3OJDB 4OFKA 1WRFA 4WQOA 4QHUA 1WBZB 1YCSA 1B0RB 1IQDA 2Z91A 4B9ZA 4ECNA 5D7LB 1GOHA 1C5CH 3IE4A 4L4JA 2PXYD 5AVXB 2CH8A 3OWEA 4GG6E 1RZJH 3ZKND 1YAIA 1DJSA 1QFWM 4JO3L 3SKMB 1Y18A 4R3SB 2P52A 3RTQD 1IARB 2HTKD 2AJZA 2WSPA 3DOHA 1A7NH 3H54A 3UBXB 9CGTA 2MNUA 1N8ZA 2ZCZA 4ADGA 4FL4B 1HSAA 1D6VL 4Z7UB 4Z3JA 2XZAH 3LXBA 3H0TA 1A5FL 1NANI 1P7QA 4JO4H 1F4XH 3PQYA 1OIOA 1NDMA 3C6SB 2J88L 2YD4A 1MI5D 4ZXBA 4OY9A 3BW9A 4Y19E 5GGVL 1JRHL 3P69A 4OGYL 3U9PH 4KK9D 3NSYA 4MQSB 3RL1A 1XGUB 5IF0A 5G5DA 3SDAA 1NJ9A 2FJHB 2Y36H 2IEPA 3UACA 3VSTA 4DPCX 3ZIMA 1FZJB 2A9MH 2WGXA 2R7EA 4RIRB 3DGGA 2RIKA 4LCWD 3MNWB 4EDWH 1XXDC 1SJMA 2X4TB 5D2NB 4DN4H 1T21A 5I1KH 3BISA 4UM9A 4Y1AD 4I0PD 4A2HA 2JKSA 2WOYA 3CWGA 2QELA 1N0LA 3SPCA 4JZOB 1NEZB 4E9SA 1C7SA 4OZHA 4P9ML 2WIMA 1BXUA 1THAA 2FTAA 1WE5A 4G7QB 4PJ8B 3RURA 1CN4A 2I26N 1ZANH 5KBMA 1PZSA 2I60H 2V6HA 5TFSL 2UYLA 1X6NA 4ZUVB 4P59H 1EXGA 4JFEA 3X13B 1MHCB 3WY1A 2N3JA 3OF6A 5EUOA 2H1PL 4YLCA 3B2XA 4PBWD 1SM3L 2B5IB 2BSBA 4NWUH 3WJMB 5CLZA 4Z7NF 1EWHA 4TUKH 3JVFC 1XCWA 2OR8A 1WCQA 3NIFE 3P0GB 1GCFA 1AG0A 1NCWL 4QO1B 4G9FD 1UADC 4QTHA 3UOAB 3WOVA 5GRJL 2EO7A 5EDSA 5BS0A 1IVLA 1S7UB 2ZOLA 1HXYA 4WK4B 3RZCD 4F7TA 2DJSA 4XCEB 3D9AH 2XWDA 1A1OA 2X6UA 4N2KA 3HBPA 4GW5A 3SDXE 2ITDA 5DUMH 2VITA 2X05A 3ROOB 4PREB 2VMCA 3KXFD 4JFVA 3S35X 4Z7QE 2XU9A 3UROR 4DGWC 4OCNC 2J72A 1NFIB 1Z9MA 5T1MA 3ARBB 3SCMC 4R83A 1PG7X 1LNUA 2DI9A 1SBSL 2AXFB 3SKJL 2OL3H 4ELMF 2DL2A 3QGVA 2P5EA 1QFPA 3L45A 5L88H 3EJYC 3LKRB 5MP6L 1FYHB 2R1YB 2OSXA 4LFHD 1YN7A 3KYNB 4NAJA 1A47A 2JH2A 5TQ2L 2R2CA 1X3DA 3L9RA 4ZMVA 5MEOB 3U1QA 4UF7C 2EDEA 2X4PB 2CKBH 2ZAGA 4MNGB 3HLAB 1MH5A 3LNHA 5AAWA 1EHLH 4E9XA 1XXFC 3QO1B 1HQRA 4O02L 4F3FA 2B4CL 1BYPA 1KCSH 4X7SL 5DJXB 4EQ2A 1W15A 2C34A 4MJ5B 1ID2A 2AJXL 3ARDD 3SDDC 1EGJA 5I5RA 2IQAB 2Y1AA 2F53A 2W0PA 4HPYL 1WWAX 3UYPB 4K71B 2Z0UA 1QLRA 4R4FH 4BFIA 1IQWL 3WFBH 2WXGA 5IW6B 2E4TA 4CBZA 5CD5C 1CTNA 1IGMH 1RIHH 5IQNA 3WIHA 5K9OB 3WN5A 2X9WA 2DLTA 1XH1A 4L9DA 3RGVB 4FFYA 4H5SB 4X4YA 2UY6A 2CAKA 4B3VA 2EIZA 1N6QH 3FB8A 3QQ9C 4K3EH 3AM8C 1RVFH 5H8DA 4UB0H 1FVCA 4Y5YA 5ANME 5FEBA 4JFQB 2OMWA 5GRUL 4IRSA 2G3ZA 1CFTA 3FTUA 3HIZA 2PWHA 3U0PB 1KTDB 3WKPA 2BNQD 3DVGB 3PABB 1UOKA 1O5PA 2HKAA 4JPWL 4NCDA 1MI5B 1CE1H 3GZKA 5EZLA 5HGBB 1EZSA 4Y8DC 1ETA1 1G7HB 4JFZL 3QT2A 3DIVA 3QDJE 3DVFA 2ZE0A 1AGBB 5IVXF 2TSAA 2ZOTA 5DCCA 5J3HD 4IBUA 2QFRA 5E8PB 3TBVB 3BP5B 2PWEA 4R7LA 4UBDD 1F6AB 2H6UA 5ALBH 5I26A 4YJZL 5GGQL 4PGBA 3VVVA 3IKCB 5KUKA 3H9YA 1AMYA 1OZTG 4WHTA 3QCTH 2VDOL 3GKZA 1UKSA 1FVDB 3C8HA 4XCYB 5MEQA 5KW9H 4EBQH 4I0PB 1PZUB 3N50A 5E56A 2FQEA 3VDBA 5T1LA 4ZYKA 2F54A 3MRPB 5H37A 4HH8A 4UQCA 1IM3A 4HS6B 3VXOB 3BFQG 5DQDL 3WEXB 1MG3C 3DGCR 2LGNA 1KJ2H 1TKWA 2E5EA 3TV8A 1PFCA 2VDPL 1PZAA 1TJHL 2WZ0A 3H42L 3W1ZA 1N4XH 3GSQA 4PJ7A 2W60A 3BP4A 1I8IA 3GSNH 3RWFA 1MHHB 1FZKB 2AERT 4DGVL 1S78C 1YMHA 3FOMB 4M02A 3QW9A 1MAJA 3ML8A 5I82A 4Z3HA 4HUVA 3L3IB 1Z9NA 4I1PA 2HFFB 1QPXA 4TOYL 4ZS6C 1DLFL 3RZCB 2EDWA 1CXHA 3QQ4B 3UTPE 3FZUC 4L2YA 4Q8BA 2H4EA 2YWZA 2XPGB 1BIIA 2WLKA 4BDVB 3G6AA 1ZIBA 3R06B 4JCWA 2VRQA 2QTVA 2VJXA 4WEUD 1G9NC 1CXIA 1IEBB 3O4OC 1TJMA 2X9YA 3K2IA 5D71H 4QR7A 2H26A 3CLFH 2HA1A 4NC1C 5HHOE 5IUCA 4NJ9L 1LWRA 3NAAL 2K6YA 1CICC 3BUIA 3S0PA 4CSZA 4MMZB 3VFSB 3CQFA 3ECWA 5AW0B 3MLXH 3B83A 2A6JB 2JQZA 1D9KA 3DUUB 5DT1L 1S7WA 5E2UH 1GS8A 5I1HH 3AAZB 4TS6A 2YPVA 5E5MA 4DVBB