4PCYA

Crystal structure analyses of reduced (cui) poplar plastocyanin at six ph values
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
99
structure length
99
Chain Sequence
IDVLLGADDGSLAFVPSEFSISPGEKIVFKNNAGFPHNIVFDEDSIPSGVDASKISMSEEDLLNAKGETFEVALSNKGEYSFYCSPHQGAGMVGKVTVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Crystal structure analyses of reduced (CuI) poplar plastocyanin at six pH values.
pubmed doi rcsb
source organism Populus nigra
molecule tags Electron transport protein(cuproprotein)
total genus 23
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 1986-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4pcyA00
2MTAA 3FYIB 2YAFA 1L9PA 1KDIA 2FQEA 3QQXA 1J5CA 1KGYE 3NJIA 2VW4A 2GB2A 4AKOA 2AZAA 1OE2A 4FA7B 1KBWA 5PAZA 1IKOP 1M57B 1AZUA 2PP8A 2IDUA 2PPAA 1WS8A 1MZZA 3AW5A 3FQ2A 4BXVA 2Y1AA 4QKTA 2UXGA 1NZRA 1PZAA 2CUAA 2VSMB 2N0MA 4G7QB 1L9RA 4DP5X 4YSAA 4G7SB 1XB6A 1NPNA 3C75A 3AZUA 1A4BA 2BP8B 3QJRB 3CVCA 1AR1B 2YAQA 1SFHA 4A2FA 2JXMA 3FQYA 3FQ1A 2QPEB 4KNTA 5I26A 4ZK8A 2P80A 3X2QB 2BWDA 2WO2B 3NSDA 2Q9OA 4GP5B 1TU2A 4YSOA 3OM3B 4YL4A 5B1BB 3SBRA 1NIAA 4KOBA 1R1CA 1ZIAA 2CALA 4NERA 4YSDA 3PPSA 2HX7A 1AIZA 1NINA 3DKHA 2XV0A 1NWPA 3OMAB 3N55A 4RH4A 3NYKA 4E9QA 3EHBB 1SHWA 1WA1X 3PAVA 1NWOA 4F2EA 2P80D 4YSCA 1E67A 5I6PA 3UAAA 1JZGA 1TKWA 1MG2C 3ABKB 1T5KA 3UAEA 4AZUA 5I6KA 3ABGA 1AAJA 4BXSV 1PLCA 2BP8A 4N4YB 2PP7A 8PAZA 3T6XA 3GXUB 1PNDA 4DP1X 3NSCA 4G71B 4GP8B 1AS6A 4NAJA 3NT0A 3X1FA 4DPCX 3MX0B 3T6WA 6PAZA 1NDTA 2YXVA 1OCZB 2YAEA 1GYCA 5EHFA 5I6OA 1JERA 1BXVA 2GBAA 2IWKA 3GDCA 5B1KA 4DP8X 4YSUA 1YLBB 3T6ZA 2H47C 4F2FA 3BQVA 4NB7A 4FAAB 2JKWA 1GS6X 1NIFA 4A2DA 3H56A 3CG8A 2FJSA 3WI9A 1KCBA 3QJTB 2IWFA 3UACA 4KO6A 2UXFA 3IN0A 1JZEA 4JHUA 2BO0A 4A67A 4HCFA 4WKXA 1DZ0A 4DP2X 1M56B 3FU9A 2MRYA 2VMJA 3AG3B 3OQRA 5AFAA 5I5IA 4DP4X 4HALA 4N8UA 3V9CA 1MG3C 2YAHA 4UF7C 2FWLB 5TK2A 5D4IA 3TU6A 2RACA 2J56A 3WIAA 1SDDB 2GI0A 3FYEB 4QLWA 5I5MA 1NIBA 4E9SA 1SNRA 2Y69B 5B7MA 2J5WA 4YVUA 2J55A 4BWTA 2IDQA 3S3CB 2EIKB 1ILSA 1WAEA 4EF3A 2YAOA 1L9QA 3EH3B 2FQDA 2XWZA 1RZQA 3FS9A 1V55B 2HLEB 2I85A 4E9WA 2DV6A 3EF4A 1PZBA 3FSWA 4YSTA 3OMIB 4DPBX 1AQ8A 4E9TA 1NPJA 1A4CA 3GYRA 3V9EA 2ZOOA 1A65A 3ABLB 1ID2A 1ILUA 1PMYA 1OV8A 3NP3A 3IN2A 1BYOA 1X9RA 1N68A 1ZIBA 2I7OA 2XX1A 3D12B 1WA2X 1J9SA 3DIVA 1EZLA 3TA4D 2JFCA 1VLXA 4E9VA 1SDDA 1JZJA 2XLLA 4DP6X 3WNJA 3X1EA 2QT6A 1JXDA 3ZX1A 5I6NA 4A2EA 1ET8A 1JXFA 3CDZB 2QDWA 3NSFA 2FTAA 5AZUA 5PCYA 1GS8A 1AZBA 1KCWA 4G70B 1W8EA 4UANA 1PLBA 3MBWB 1CUOA 4KO5A 3TASA 4DP0X 4Q8BA 1HAUA 5A7EA 2IDFA 3X1NA 3CZUB 3FPXA 2ZWNA 2PCYA 4A2GA 1ADWA 1CC3A 3SBQA 4K9JA 1XB3A 2IWEA 1ET7A 4BWWA 1A4AA 1QNIA 4HHWA 4E9RA 3TBBA 4HIPA 2UX6A 1NTDA 2UX7A 4YSSA 4GP4B 2CCWA 3S3BB 1AZCA 2GSMB 4HAKA 2UXVA 2FT8A 4CSZA 4AI7A 2TSAA 2YQBA 1FFTB 1HAWA 1JXGA 3FSVA 3PXLA 3CDZA 1L9SA 2EINB 4JHVA 4YSRA 1PCSA 1CURA 3UADA 2XUWA 3FT0A 3T71A 1A8ZA 2YXWA 2AFNA 1BXAA 1PY0A 1ZPUA 3JT2A 4KOCA 3ZIYA 7PCYA 3OD3A 2OV0A 1DYZA 4HHGA 4PCYA 1AOZA 1W6LA 4DPAX 1CYWA 1IBYA 4GY4A 2VW6A 2IDTA 3HEIB 6PCYA 2R7EB 5AKRA 2J57A 2YARA 3AG2B 1OCCB 3AG1B 2I7SA 3FSAA 3QJQB 1NICA 2XV2A 1BQKA 5D4JA 5F7AA 2W88A 1ET5A 1I53A 1MZYA 2XU9A 2GIMA 4A66A 2CJ3A 3RYMA 2W8CA 1E30A 1AZRA 2ZONA 3X1BA 4L0PB 5LDUA 4P5SA 3ZDWA 4GXFA 3FU7B 5TK4A 2IH8A 3WNIA 1E65A 2YAPA 2AANA 2H3XC 2IDSA 4ENZA 5B1JA 3EH5B 3SQRA 2BWIA 3ASNB 2PPEA 2FT7A 2UXTA 1ZV2A 2IAAC 2FT6A 1PF3A 4KO7A 4W9ZA 1OOWA 3BVDB 1AS7A 2QPDB 1PAZA 1GW0A 3ERXA 3FU8A 3T9WA 3L45A 2CBPA 2HRGA 3H4FA 1OF0A 1IC0A 3S3DB 1WA0X 3H4HA 2A3TA 4KNUA 2XYBA 2R7EA 3ZBMA 4E9YA 3PAUA 3NJGA 4M4RB 1JZHA 2Q5BA 1V10A 1PNCA 1JVLA 3AY2A 4P5RA 4KNSA 4W1TA 1RKRA 1CYXA 5B7FA 2PPDA 2BP0B 3QPKA 2DY2A 2OJ1A 1X9UA 2BW5A 2E86A 3KW8A 2BW4A 5B1AB 5I5JA 2QDVA 1XMEB 2ZXWB 4YVNA 4AKQA 2EIMB 1NIEA 1E5ZA 2DWSA 1HFUA 5ANHA 3T6VA 1JZIA 3FU7A 2PLTA 2X87A 3PAZA 1ASPA 2PPFA 3ASOB 3U25A 2AVFA 3PCYA 5FC9A 4BDVB 4KO9A 4JKNA 2FQGA 2VSKB 1SJMA 4BK5C 1GSKA 2CAKA 4G7RB 1PLAA 2PP9A 5D4HA 1BAWA 2LLNA 5I6MA 1KV7A 1KYAA 2HZHA 3FSZA 1JOIA 1E5YA 2FQFA 3NSYA 2X88A 3NJHA 4BWUA 1AG0A 1BYPA 2BP0A 2HXAA 1N70A 2TSBA 2VN3A 2EILB 2DWTA 1J9RA 2GC4C 5F7BA 1KDJA 2WSDA 1L9OA 1BXUA 1OCRB 2PCFA 4X4KA 1OCOB 2VW7A 2XX0A 4Q89A 2XV3A 2BHFA 1PZCA 4MFHA 1ZDSA 1V54B 4HCGA 1AS8A 4WTQA 3N2JA 4YSQA 2IH9A 4DP9X 3S8GB 1FA4A 4BDVA 1JVOA 1TEFA 2OCCB 1M9WA 5B7EA 1FWXA 3G5WA 3X1GA 3WG7B 4YSPA 3SBPA 2GHZA 1ETJA 3NJKA 1RZPA 1ZDQA 1SF5A 2GC7C 2XVBA 4YSEA 4A68A 1IUZA 3NJLA 1OE1A 1IBZA 3UABA 3HB3B 1GY2A 3OMNB 2XXFA 2HX8A 1RCYA 5E9NA 3WKQA 7PAZA 1MDAA 1W6WA 3JTBA 4DP7X 2B3IA 4HZ1A 2BZCA 1BQ5A 4GYBA 2FNWA 3PLYA 1GS7A 5IY5B 3NP4A 3IE9A 4CSPA 2PPCA 5I28A 3TBCA 2B08A 4E9XA 3ABMB 2VM4A 3WKPA 1OE3A 1KBVA 2YAMA 3QJUB 3UGEA 1AACA 1GY1A 3NJMA 1F56A 1SFDA 2HRHA 5B1JC 9PCYA 1L9TA 1XB8A 4TXVB 1TEGA 4M3HA 1J9QA 2EIJB 5B3SB 2HX9A 3QJSB 4UAHA 3DTUB 1A3ZA 1ASQA 3EH4B 4AKPA 1B3IA 2DYRB 3IEAA 3NJJA 1ASOA 1AZNA 1SF3A 2WO3B 2NRDA 4A2HA 2DYSB 1SHXA 1JZFA 1AG6A 3FPYA 4AX3A 4G72B 1AANA 2XXGA 1QHQA 1UATA 3NJFA 2VM3A 4F7KA 1GR7A 1URIA 3AG4B 1QLEB 3QJVB 2H5UA 3IBOA 3NJNA 3S8FB 3KW7A 4HCIA 4PAZA 1NIDA 1BEXA 5I6LA 1J5DA 1J9TA 1EHKB 3CVDA 3CVBA 2AZUA 2BZ7A 1WS7A 1BQRA
chains in the Genus database with same CATH superfamily
2VDQB 2X9XA 3LEYL 5JO5A 5H2BA 2WN3A 4X4YA 3RKPA 5CU9A 1MFNA 2BNRB 1GZPA 3VFOA 1G9NL 1SOXA 4YXHL 5E8PB 3I9AA 3V52L 3RWFA 2VLLA 2BFGA 4FYQA 4XO9A 3OV6A 3SDDC 2XQYK 1ZLUK 2FH8A 1FZMB 4M7LH 4QHLB 4DOHE 3HJEA 1FP5A 1KIUB 1JD9A 3DUUA 1TKWB 3GLDA 3R4DA 4G7QB 4LDOB 4KX9A 5DHXB 5DZOA 3EH2A 4XWGL 4YSAA 2JSFA 2ZXEB 3AS0A 1SBSH 1NCWL 4AGPA 4GMSH 3VA6A 1T4KB 1J86A 5GGSY 1PY9A 2XN1A 3U1SL 2DDQL 5DD5L 3UMNA 4NQCA 3T65A 4U3XA 5DD6A 1M6UA 4LKXA 1EAOA 2VO8A 4BEIA 2CDGB 3X2QB 4H8VA 1AGCA 3TYGH 1ZPLA 2APWA 3WN5A 1EA9C 1SVBA 3H9HA 2NY2C 1I8UA 1RZ7L 3O6MH 5C2BH 5SX4I 3ARDB 5E24E 4U1IA 3QDME 3RBSA 3UBXI 2DM2A 4K55A 3ZE1F 2VMCA 2XCMC 3N9GL 1THAA 1BPLB 3PPSA 4R3SA 1N8ZA 1X7QA 3GMRA 3VMOA 3DK2A 3HI1A 1SJEA 2GTZB 3MJ9H 4W9JC 4K3JH 1XF4A 4LDEB 5HDBF 1SEQL 4Y4KD 1K8IB 4UBDD 1TJGL 2HT4D 1QKZH 2P80D 1A6WL 3GPEA 1KENL 1QTYT 2AK4B 1JV5A 4MNHB 2H1PH 4WLCA 1I75A 2A9MH 2BSEA 3DSFL 3G9AB 3MUZ1 4XMLL 4LHUD 4N9GB 1LO0L 4WO4A 4BXSV 5ENWA 1B6DA 1N26A 4X9YA 1NOAA 1MCOH 3FHQA 3RGBA 4J7RA 4CN6A 3P11L 1YYML 4HX1B 2VLRD 2H7WA 5KVDL 1VA9A 2OX5B 4WWKC 3QUGA 5HI4D 3HBZA 4PREB 5C08B 1Z5LA 2GBAA 4RMWA 2F19H 2GUOB 3N85H 5D2NB 1MIEL 1V8HA 3Q5TA 2XN9D 5HDBB 3S98A 1IEHA 2QSVA 1HVXA 4J23A 4AVHA 4JG0L 2RD0A 3BCDA 3BP7A 3V10A 3BZDA 4XNUH 4ZPTA 4PG2C 3UBXB 4YPGB 1AO7A 4N8VB 2CNYA 1SVCP 4WI6A 2VRAA 2EIZA 4U1SA 1NCBL 2PCPB 4L1SA 4OGXL 4WI9A 1MFDH 5KS9E 4L8BA 4PLOB 4MD0B 3TURA 2FYYB 2NY6C 4LPCA 5D7IB 3GSVA 3X12B 4FNUA 2CK2A 4PJXE 3V9CA 2ZCLH 3ZTCC 2FWLB 1KFAL 2ID5A 2UYLB 2PYFB 2VXUH 5J12C 3ZZSA 2ZKYA 4GRWH 4NKIL 3B2UC 4PV9A 4CW1B 5JDSA 2EDNA 3ZE0B 1TJIH 1TVHA 2MCAA 1ML0A 3GMPA 1GMIA 3EBGA 2HMID 4MRBA 3M88A 1JHKL 3ZYJA 3BYTA 4IOSA 3ZKNC 4A6YB 1BD2E 4NRYB 4MMXA 4ANVA 1BF8A 4WWNA 1NC2A 4APXA 2JCCE 4TULL 1K8DB 1QFUL 3E6HA 3QYCA 1ZTXH 2R0ZH 4N2EA 3BLPX 4C54A 2VAAB 1CDJA 1XCTB 3TVMA 5DZVA 3OGCB 4N1EA 4QXVA 2XRAL 2LU3A 4YXKH 2CLVA 2WXLA 1OPGH 3D3VD 1CFSA 1EXGA 3LNDA 5EIQA 1BVKA 4L0ZA 5IV2A 2UWEE 1XT5A 2PO6A 3NP3A 3RURA 2QEJA 3TA4D 1HEHC 2I9LB 3TBSB 1J9SA 4UQDA 3T0DA 4Y0GA 2X2HA 2VDPL 4Z18A 5AAMA 3WHE0 2ZUYA 4YH6A 1PQZB 2PCFB 1XCQB 3JXAA 1JXDA 2KZBA 5I6NA 2EVIA 1UWXK 3GIVB 4OKVB 2OK0L 1J8HE 1X4YA 4G6FB 3CDZB 5E4IA 3EYOA 1PYWB 3NUKA 5EU4B 1MCPL 2WYTA 4JHWL 5AZUA 2Q7YB 1N19A 1ORSA 2V5SA 1GXEA 4WK4B 4W9FC 3Q3GB 1DL7L 4NZJA 3CFNA 1EANA 3A5VA 5GGTH 2BSSA 3BRFA 3ZSTA 1KOAA 2ZTBA 3EO0A 4JDEB 4L5FH 4TUOA 3QFDA 1DSYA 4XMWA 3OC8A 1YN6A 2AAVA 4QRTA 3W56A 2E9IA 5ITFB 3SBQA 5EORH 3GXDA 4JPIA 5I1DA 5IUSA 2IPKA 2DIJA 5C0DB 4UT9A 2OYPA 4JE0A 3GMLB 1ZHNA 1GRWA 4D0BB 3O81A 4OKDA 1H3TA 1MCCA 3BAEL 2ADGB 3HPJA 1KPRB 1QTSA 4X9HA 5MENA 4F91B 3X17A 2VN6A 2XYCA 1ZVSB 1U9KA 2GCYA 1CL7L 2HVKB 1IJ9A 5HHOB 4LPVA 4AH2B 5LQBL 2QBWA 2PUQT 1UG9A 4XH2B 4O2EA 1W80A 3C5SA 2A9CA 4ZQKB 4FXLA 4HK0A 1HSBB 1PGRB 4Q6IA 4S1SL 4ZSOB 5IW6A 3DX6B 5DVOA 2OMVB 3K81A 3ARDC 4WENB 5IB5A 2OV0A 5CIPH 5EOQL 2BFVH 3I6LD 4BSWA 4DPAX 4HCRL 3REVA 3GNMH 4LP4A 5DDHA 1VERA 3G5YA 3DYMA 3MGTB 1IGTA 1UA7A 4GQ9H 4AZ8A 5FYKU 1IC7H 5KUMA 4JHZA 5AKRA 1EDYA 1QASA 4XODA 1EFXB 3GSQB 5EO9B 1G7JA 4KH9A 4FQXD 4PGDA 5JXEC 2WTOA 5F7AA 3VXUB 3WS3B 2FNBA 3C6SA 2AEQH 4R4FL 2BMKA 5E2UH 1C7SA 1EDHA 2X9YA 3IWVA 1SRDA 3MR9A 5IWLA 2GJ6E 1O7SA 3BD5A 4NKOB 1LE9B 1WZMA 1EGJH 3O3BA 4QYOB 3RIAF 4P2QB 5KN5A 5IQNA 4QIRA 2R69L 1NMCB 1DR9A 3WFCH 4LAQL 5D2NC 4L4VE 4RISH 4L3EB 4NKDA 5EF0A 3P40A 1JF1A 4GSRA 5DRXB 2FT7A 3MOQA 4J3UA 5GZNA 3HC0B 3APMA 4W9ZA 5JZ7C 4QWWD 4TVPE 1IX2A 4EZMA 4NUGL 4Z76B 4KKPA 3MKGA 5I1KH 3P0GB 5C3LD 4HKXA 4W68A 4PRID 1IC0A 3O8XD 5DRWB 3FFCB 4U3CA 4UM9D 2GK0B 5GS2D 1UT1A 3PHSA 1Z9SB 4NHUA 3MU3A 2UVEA 3ZL4H 2UZIH 4S1QL 4RRPA 4AE1A 3NBNA 4YNYB 3SN6N 3DHUA 3BZ4A 3MNVB 5IHUL 2BP0B 3QPKA 1A7QH 2EXWC 3WY1A 5LBGA 2CO1A 4BSVB 1MW0A 5KYWA 3BLBA 1XMEB 4XCFH 1C9SA 2KLSA 5DO8A 5DMKB 2ESVA 4H1LG 1D6VH 2EIMB 3BQUD 4MA7H 1PG7L 4KWUA 3CN1A 2H1LM 2IQAB 2M83A 1BVNT 4J1UB 2HN7B 4QAMB 1JPTH 3DLQR 3MUJA 2PPFA 3VWJC 3GXFA 3VW3L 1WTLA 1HHHB 3GMMB 4LSRL 5HHPA 3S34L 4C8XA 4I5BB 3HPLB 4IGBB 4U4IA 2WVTA 3BKMH 2F8IA 4NI6A 3U82B 5ESQA 3I74A 4OR1A 4AYMC 2NTFB 4XX1E 3BH4A 4M7LL 3QFJB 2JLPA 4E41D 2VZ1A 1B0RB 4ZW6A 2F2HA 2A73A 1Q38A 1JK8A 1SBSL 4PJ9D 2DIBA 1F8TH 1BYPA 3JSSA 1K4DB 2HFFB 3M7FB 3IFOB 3VGBA 4Z78B 4Z8FL 2NLJA 1D5XA 5F3HA 3ZRFC 5IQOA 3KYOA 1VCAA 3VG9B 4PV1C 2BXZA 1BMGA 3CFCH 4HGWA 3G6JE 4Y5VB 4PRAB 5CD5C 1TSRA 1I85A 5HHQA 4W9DC 3O6ML 4ETQA 2ZP0T 4HLEA 3PG2A 5I17B 1FNSH 5ISZB 1ZDSA 4U3SB 4CRPA 1N5YH 3HN8A 1LEIA 1QA9B 2PW2B 4N0YH 3MJ9L 3PWPB 2Y2WA 4QNPF 3BISA 4K3JL 1J88A 1B2YA 1NGYB 4HOMA 1QKZL 1W0WB 2XNAA 2V5YA 1ETJA 2CHNA 2H1PL 1FYTA 3LRHA 4NO2B 3HNVL 1H19A 1O7DE 1UWFA 3AQYA 3MRCA 1M6OB 3GLEA 4LRIC 4K7PH 4PGCB 2XXFA 4NN5C 4OLVL 1MCOL 2FJGB 5I19L 1CBVH 2B8OT 2FHFA 1MXGA 3QHZH 4NXKA 3TEUA 1JDCA 2Y06H 1WHOA 3MRPA 3BW9A 4AW7A 3MJ7B 3QDMD 3NP4A 1YMME 4MVBC 1S5HA 2P5WE 5AKSA 5I16B 1U8NB 4XNDA 1IC1A 1MKFA 1QQDA 4NQVA 4XCEB 3OLDA 1DLHB 5L8JB 1TYEB 5DC9B 4Z7OE 4Q9RH 1WYJA 1PTZA 3FQTB 5LWYL 4XNUL 2NX5D 3RTQD 4PB9H 4G8FB 4PJBE 1HJCA 1MFDL 4JCWA 2DQUL 4JY5H 4P2RA 3MC0A 1JHTB 1CGUA 2KS0A 3M7OA 5IQ7H 1FI8C 2ZCLL 4ANXA 1BZQK 5BMFL 1ICTA 3LN5A 4WI2A 1ZOXA 2Z91A 3KM1A 5EEZA 1RP9A 1WV7T 2FR4A 3VFPA 2VM3A 3BWUF 1RHHA 2JXMB 2R39A 1TJIL 4TNVK 1QSVA 2BNUB 2W07A 3PREA 5DD3H 3ZY7A 3DUHA 4BFJA 3CVBA 3WHXA 5HYQA 3EFFA 2CRIA 2V4LA 3CQQA 1YVLA 4M93B 5D7LE 5DJ8B 2IBBA 32C2A 4U1LB 3LZQA 1MAJA 1MWAB 1NMCC 2CH8A 2LHAA 4OU3A 4JKWA 2EVJA 2UV3A 2HJLA 1EEQA 1ZTXL 3F05A 3HBGA 5DGQA 5GRVL 3AS2A 4R5VA 1J5CA 5FWQA 3MLUH 1P4LA 2NNAB 4YXKL 2X1OA 3QA3A 4XMUA 4ZUTB 5PAZA 5DMJB 1I4FB 2IOIA 1U3HD 3MCYA 1VGKA 1S7RA 3FQNA 4LLUB 1G7IB 4ZX3A 3Q1EA 4UIMB 2NR6C 1XGPB 3L9BA 3Q2WA 3QDGD 4G7SB 1Q9WA 2DWEB 5T3XL 5TQ0H 3NTCH 2EDWA 1BD2D 3P4NA 3L2LA 2FATH 1EHAA 5C0BD 3CN3A 3B7YA 4GW1B 4ICWA 3RWEA 3AM8C 2XZQL 4PGZA 1E6OH 1PS3A 3TOPA 3FQ1A 4JG1H 4AQ1B 4U0RB 4N9OB 5GS0D 4JFEA 4Q6YA 3CHOA 4I88A 4HUNB 2XN0A 4O4YH 1AGDB 3NCEB 3N43B 3EJUA 1E27A 4EI5D 5EO0B 1ERNA 3DSNB 2XTJB 4L2YA 2F7OA 3QFGA 4N8CL 4GQZA 3QULA 2V2WB 4HOXA 1RZIA 3WTVA 5EA0H 4L5FL 3BVUA 1IGCH 4KZEH 1NCNA 4MJ4A 1JMZA 3BEWB 1BQHG 3TESA 4E0RB 4YHIB 1CGXA 5EORL 3UO1H 3MTRA 1M7DB 1VFBB 3EFDL 2N01B 3P2TA 4DVBB 4WQOA 1BBJA 3TBYB 3LZFH 5DTFA 3QJXA 4FXKB 2CR0A 2Q76B 3L1GA 1SJVA 1PLCA 3TO4B 5TH2A 1J12A 2C3GA 2NXZB 2PP7A 4OFQA 4UV7L 4XRCA 5HGBB 2YK1H 5KVEE 3SGJC 3NT0A 2CJUH 3O41B 3DUSA 1BZ9B 1XH0A 3ESVF 1ANUA 3LRKA 1D7CA 4HWBA 6PAZA 1EZUA 4CL7A 3FTZA 2OR9H 3D0LB 2DI8A 5B1KA 3L3GA 3UPAA 3VUAA 2MCMA 4W6XB 3VG9C 1X7TA 4GKNA 4JDTH 4Y5VC 4L9LA 3TH4T 4AEEA 2VXSH 5DURB 3WKMH 3OMZA 1PDKB 3QS3A 4JRFA 2OR7A 5AVSB 5EPMA 5E08L 3ARGB 1PEWA 3D8MA 3GNML 1A6ZB 1D6EA 4O58H 4AM0A 3ZHNA 4GQ9L 3RUGA 2X4NA 4NUPA 3RJDA 1IC7L 5FKPA 5BVPH 2NCMA 4HIXH 3EJTA 3U0PA 1T0NA 5HYEA 3UX9B 5JTWA 5LBVA 5JHLL 3RIFF 3TA3D 3QEQB 3FYEB 4RWYH 2WBJB 3LB6C 2AEQL 5E2UL 4X4ZA 1AXIB 1J05A 1XDTT 1EGJL 2WTRA 2IGFL 3QEUB 4PJ5D 2J1ZA 4HBCH 4LLYB 3QEHB 5CMAB 3D2UA 3BOVA 4RISL 1ZHBB 2VL5A 2XZAH 3IT8D 4TL4A 4A6YL 3L5XH 3SKNB 1BGXH 2QLVB 4E9WA 2AERT 3Q2NA 2WLJA 1W8NA 1XIWB 3KE0A 4MGXA 4R9HA 3OMIB 4G8GE 1HILB 5I1KL 3GYRA 3QDJD 2NW2B 2CLRB 3DA0A 3EJRA 4ZJ9A 3FRUA 1MHEB 1TO5A 3NCYP 1ZSDA 3GGWA 4OI9A 5FDWB 3P77B 1OV8A 4IHBA 2UZIL 3V8CA 1WA2X 2OW7A 1VLXA 3KJ6H 1A7QL 2WZPA 1GAFH 3VI4E 1QFHA 1ZVYA 1ZLVH 4HV8B 4OZGA 5E1AB 4XCFL 5A2AA 5EOCJ 3RUGF 1D6VL 5BPPA 4MA7L 5C09D 5I8CB 2MCG1 5CP3A 3ECUA 5EC2A 5DI8A 1JPTL 4M93C 4QHKI 4XPTH 4DK3A 4AVJA 3G5ZA 2VLKA 3F64A 4ZFGH 1RUAH 4PRHD 1KTJA 5K93A 5IVXA 5IMOB 1S9XB 2OCFD 3OGOE 4X0KB 3BKML 4I48B 1P5UB 2FJFB 4DEPB 3KXFE 3KPOA 4N0FB 2R0KH 1XB3A 4LCYA 1VZIA 1VRSA 3W9DB 4OLXL 1UCBL 4PJ7B 1KB5A 2X1PA 4XBPB 3PABA 1F8TL 4XZ4A 3U46A 3P0YH 1G1YA 4IS6B 3OB8A 1FH5L 1JZDC 3FONB 4P2AA 4L4TA 3S35H 3IS0X 4QHKJ 3VSTA 1HXKA 1NAMA 1RZFL 2EDTA 2ZP9A 1GPOH 3QWOA 5E9AA 1PJWA 4OGQC 2E7DA 2NY7H 1QSFD 1HSAA 3CFCL 5GS3A 4AL8H 4AQ1C 3QUKA 4U0RC 4YSRA 4MCNA 4Z0XA 5E0QA 4S1RH 4M02A 4L3AA 1FNSL 1ACYH 3UBXG 1N5YL 2C26A 4N8VG 4AJYV 5BXFA 5IOPB 3ZIYA 1XFPA 4ZMQA 2YA0A 2XTJC 2A4EA 2J7LA 1GGYA 4OF8A 4N0YL 1F2XK 5G55A 4UCFA 2HLFC 4FNSA 4H40A 2CUIA 1OQOA 1YNTA 2IH1A 4P23B 3L48A 3N3EA 4YX2H 5ABZA 3ME0B 5SX5K 5D1QD 1A3QA 1QMUA 2B1AH 2XC8A 3GUFA 2EZ0D 4HAGA 2UUDH 4PIBA 4K7PL 4BFRA 3WEBA 1AY1H 2W88A 3HZVB 3D34A 3NIFF 3OHMB 4FXKC 3F6LA 3Q1SH 4UU9B 4WUUE 5IROC 1CBVL 2C7UB 3FU3A 2CJ3A 2NXZC 2Y06L 4NI3A 4LQ1A 1LWRA 3V4PH 4JS7A 4P57B 4XVJH 4BE5A 3HHSA 3LKRB 4QRBA 1CT8B 3CZSA 3SODB 4YDZA 3WY2A 3V5DB 4B6ZA 3FU7B 2R4SH 4KROB 3RDTC 2Z92B 4Q9RL 4FQLL 4HS8L 3E1ZA 3ML8A 1YPZB 1XEUA 5DYFA 3LDBB 3GMQA 1QLEH 1CLOH 5FW8A 2QMKA 5J5EA 2CRZA 1WK0A 1UB5B 5IFJB 4JQVC 1CFNA 3PY9A 4K94C 3LD8C 5LN8A 1T1WA 1TYRA 1AS7A 3BVDB 3C60D 3QZMA 1DTUA 4JY5L 3T09A 5CAYB 1ADQA 3NIFB 2VNCA 4DKEH 3BAKA 1NAKH 2TRHA 3MLTB 1NGZA 4J3VA 1H3WM 3ARGC 5IQ7L 3MROA 1A21A 3MYZA 3CN4A 4Y4HD 3WIHA 5JOFB 4MAUL 4KXZI 1A0QH 3VGFA 1YMMD 3VFSB 1G9MH 2X89D 1BFVH 2WLLA 3IK2A 5AOKA 5SWSB 2VLJB 3MUGA 4KJPC 1I8MB 2RAMA 3SDXA 1S6NA 4Y9FA 2E56A 2RA1A 4H2AA 2EYSB 3QZLA 5DD3L 1YNTF 2WBJC 2RQ8A 4PEEA 4ZUVA 4IK6A 3LKNA 1G7QA 4MA3B 4YVNA 5KBLA 2COVD 3MRKA 1RZKC 2WWKO 5BUPA 1IEBA 3F6JA 1QI5A 4X5WB 4AT6B 3QXTA 4B95C 1ZT1A 3TBVA 1BFSA 3N1FC 1F1GA 2DH2A 5EIVA 3PAZA 4OD2A 3ASOB 4JR9H 3LRLA 4AGOA 2EJ1A 5DFAA 4KKQA 5D72H 1AVAA 4TSCL 3I3EA 1XIWC 5F7YC 4NQDA 1UD8A 1CFBA 3QUXA 1C7TA 3QG7H 3VAEA 3ULUF 4J3BA 5F1KC 4W4NA 1LP9E 1UQSA 3AABA 4I0CC 4M5ZH 4MCYA 4J2XA 4DK5A 2JNZA 3GXPA 5SWZA 3ULVC 3I6GA 3NTCL 3RTLA 3QJFB 2PYEA 2FATL 3FTVA 1ZGLP 2KBGA 5D7LD 5T5FA 3W3BA 4Q0XL 5H35A 3K71A 4KXDA 1WZ1H 3VE0B 1E6OL 5CEYB 5I66A 3NGBB 3PXHA 4MJ5B 3TNMA 1D9KD 3VI3E 2HWZH 4LIQH 5B1CA 1B88A 1CPUA 1RVFH 3HG1E 4MXWH 4O4YL 4DN3H 2XIDA 3WO4B 4I3GA 5I1AA 1KYOJ 2AITA 5AB2A 5MEPA 2WOBA 4H1LA 1X5IA 5DRZA 3MBEA 1JGVH 4M1DL 1IGCL 1KWGA 1SYSA 2EE0A 4I4WA 4KZEL 3W9EB 5CJQH 3LRSB 4ELKB 3MJ8A 3BD3A 5HHMB 3UO1L 3TBTA 4MHHG 2NY1B 1TLMA 3WJMA 4DEPC 2VCOA 4HSQA 1FN4B 2RJMA 1ZDQA 3LZFL 2Q2EB 5K9JH 1T83C 2AK1H 2GJJA 3DC0A 1OE1A 4QRAA 3FU0A 4XPBH 4C56B 2N7SA 3RRQA 3M17A 3O2WH 3MNWA 4HMDA 4Y16A 5CD3A 3OWRA 2YGOA 5DJDA 2XG5A 1QWNA 2HX8A 4HUXB 3TZVD 3Q2VA 2YK1L 4N25A 2YPLA 5DHEA 2CJUL 2R83A 4KRPD 3CFKA 1GS7A 5DJAB 2GAZA 4CSPA 4LOVA 2OR9L 1CD9B 2ZNWA 2ADJA 2B08A 2H9GB 1A4KB 5DVNA 4M9PA 5EN2A 3WKPA 4JDTL 4ONHA 3H7BA 4LCIH 1JAEA 4NO3A 4PS4H 3HC3H 2DTMH 4JO2H 5TE4H 2C1OB 4F8OA 3HCVA 3UJIL 5JIIA 1RIHH 4U1NA 5ANMB 3Q05A 1JGEB 4N24A 1BEYH 3CUPB 3N42F 1VEOA 4WTZG 5HD8C 3GT6A 1UZ8B 4AKPA 5CP3H 1R5WA 2JLLA 2GEEA 1RJCA 5BVPL 4L37B 1BCIA 4HIXL 4P23C 4HPYL 3PYCA 4LDLB 5SV4A 2NRDA 1OP3H 4ZD3L 2GBTA 4HKBB 4HUWB 3E6FB 1Y18A 3KPRA 1LEKB 3F01A 3GXMA 3QPQD 5GIRB 4RWYL 2ITDB 1QW8A 4BFIB 5CCJA 3DXAA 1E3XA 1IL1A 2ZCKH 3LYRA 3ROLB 5CS7A 2CBMA 4PJGA 1W8OA 2LU5A 1ZS2A 2J20A 3IBOA 3C09B 1RERA 1UGKA 4QF1B 3WY3A 3BHBA 4X6FB 3MLYH 4HBCL 1KB5H 4R7LA 1DANU 1J5DA 3ZVVA 5FIEA 4HMEA 1JWUB 4WW2A 4WTXA 3OKKB 3KPPB 2P24B 5T1LB 3FTGA 3ASWA 3L5XL 4KROC 2Y3NA 4MSWB 5EUKA 3FUHA 2AJZA 3LDBC 4OQTA 2JIXA 2XQ0A 4M03A 1MWAL 4IOSD 3AREB 5C0IB 3LIZH 1RSFA 5EV7A 1MVUA 5DJ2A 5AW3B 2Y1AA 1NLDH 3B9EA 3SCMB 4IU2A 2N0MA 1BMWA 4LL9A 1B0IA 1I8KB 1T04A 1JYNA 4XO4A 5I8OH 5JNYA 1L0QA 2GFBB 2YOCA 3QQDA 2O61A 3KJ6L 4PP1C 3WUWB 2ZOUA 4MDIB 2F7QA 5AVQB 4GPVA 4R7DB 5HJBA 3W0WD 1T2XA 4S0HA 5DJCB 1UH2A 3P3TA 1YEJH 4FFYA 3CIQA 4APQA 2DM4A 2AQPA 4XHJC 2EC9T 5BJTB 1XO8A 5IKCA 3ARBD 3NIDE 4YQXL 1R17A 2ZZUT 4F8LA 1HOCB 1ULVA 1IBBA 3WSQL 3GTTA 1CG9A 4S0TD 3VXRE 5C07D 4ZFGL 4PJGF 5AB1A 3QI9B 4GO8A 4YSDA 1S7TB 3ULUH 4JGJA 1WFOA 3D39A 5L6YL 3RHWF 1LLAA 1HI6B 2WAHA 3EHBB 3L3JA 2R0KL 3HN3A 1T2QH 2J6WA 3DPBA 4R83A 5HP5A 1UACH 1FNLA 3O0RH 2DBLH 2HVJB 3W82A 1OGTB 4DAGH 4CVZB 4WDIA 4TQIA 4ODWA 1QYGH 1F11B 3Q5OA 4HIHB 1ADQH 2VWEE 4FYSA 4N4YB 5DK0A 1DVXA 3TV3H 1AJ7L 3SE9L 2XICA 5D55A 5A40E 4FFZH 1GPOL 3WIHH 3NIGB 4A7TA 2NY7L 3NGBC 3D6GA 1BXVA 3ZYIA 3QZBA 1FRGH 3FQUB 3Q8BA 4S1RL 2C3XA 2R2HA 4TF4A 3KXFD 2CKNA 1ACYL 2EDDA 3WO4C 1HHIA 4HH9A 2DQGH 4NAMA 3FCSA 3CG8A 4PWJA 4U1KA 1BZ7B 1MRDH 3MAWA 5AW0B 3SPGA 5CEXB 1LO2L 5DC4B 3IJHB 2UY6A 2ZG1A 4HCFA 4UOW0 2W60A 1AYOA 4NQEA 4YX2L 3HG0A 1KJ3H 4F1SA 2VDRB 3FSOA 4G9FE 4HALA 2NY1C 4KJQD 3TPUB 2B1AL 2X28A 1MEXH 3IU3A 2GSGB 4IHOB 2Q7NA 5B3JF 5D4IA 4BD4A 3KR3H 1TJHH 3NRPA 1C12A 4N2GA 1AY1L 1BQHA 2B2XH 1JPSH 2NYYC 1U95A 1SNRA 3QNXB 3Q1SL 4MJIB 3T2QA 2J5WA 2H6PA 3IJSA 1W9XA 4W81A 4NKQB 1KZQA 1S7QB 3WMSA 4AJWA 3B9AA 3AXLA 3V4PL 4D0CB 3MRBB 2G0LA 3WD5H 3B1UA 3MNDA 3KGTA 1T1YA 2R4SL 4J8RB 1RZKL 1AZVA 3D4ZA 3MRFA 3G6AB 3PUCA 5E2WH 4HGKC 2KMWA 3DNKA 4IOIB 1NGWB 1QLEL 1CLOL 4XMTA 1AQKH 1HQRB 4E5XG 4IDJH 3QUYD 5FECB 2FBRA 3FO9A 3FN9A 4NT6A 1NGXB 4RWHA 4YSTA 5EUOF 4Y19A 3RP1A 3REWB 4Z7QF 2WWNA 4NJ9L 4DKEL 3RFZA 5KSAA 5DJYB 3HMXH 1LXMA 3WTYA 3FQ4A 3UAJD 1XF2A 5MHSE 4HT1L 3S37L 1A0QL 2ZG3A 4ONFL 1BVNP 1G9ML 4EI6A 1BYOA 1X9RA 1N68A 2I7OA 1BFVL 4MNQB 4R4ND 2JFCA 3EGSB 2Y7LA 3ULVL 1HHJB 4NNYB 43C9B 1FFNA 1JZJA 2DBJA 2BVQA 4NJAH 2AXWA 3QH3B 4MXVF 2BXYA 1JF5A 3LNEA 1TCRB 4R4BA 5CGYC 4V1DB 1U8IB 2AJ3A 2WD0A 4BKLB 4HJGA 3C09C 5EUOB 4J39A 4OZHB 1AP2A 2ZAIA 3O4LB 3MXVL 4M43H 1CR9L 4BH7A 2GSIA 4Z1PA 1U4FA 3L3HB 4NC2B 3SPVA 3VJ6A 4N68A 3GSNB 5C7XH 4LU5H 3GSUA 1ITCA 3O3DA 4JR9L 5E94A 4X9BA 5EZPA 3EO1A 2P46B 5F1NB 1MUJA 2J6EA 2L7QA 4EUPH 5C0EB 2XBTA 2X1WL 3QG7L 3BZEB 4WFEE 5EOCL 3AREC 4PLJC 5LJYH 5TF1H 2FX9H 5JIMA 1OT1A 4HEMA 3FUNA 4M5ZL 3UDWC 3K8MA 1KJMA 2NW3A 4HOZA 3IKCB 1U2CA 2Z0UA 1H8LA 1OGAE 3SCMC 3ULAB 1X9QA 2W65B 3L7EB 3WO3B 1J1XH 5GGRY 2OW6A 3G04B 2XJLA 4XCYB 1WZ1L 2CCWA 2X40A 1AZCA 4ONGH 3A6BH 3FH8A 3RGVB 4LIQL 2HG5B 1BIIA 4MXQD 4PJIE 1RVFL 4MXWL 5CSBA 5I1EL 2OPCA 2IADA 4RQQA 4P48A 4ZNEA 4HK3J 2YBRA 2CDEA 4LEXH 2ATPB 5K9KA 2CPUA 4YBHA 2PWGA 5HYJD 3KPMB 2BHZA 5JW5A 1FNFA 2H0PA 4GJTB 4P06A 1UHVA 1ZPUA 4AJVA 4MJJA 1CGWA 3ZZQA 1UJ3B 1D2OA 3VXME 4HHGA 5EF3A 2WN2A 3D1MC 3PUUA 3ARDA 3QI9C 5CJQL 3KPSE 5HYSB 4OCSH 4DZBB 4Q56A 5AW1B 3HRZA 3KVQA 1CU4H 3GLAA 3IXAA 3RZCC 2ZX5A 3EHBC 4NRXA 2YARA 5K9JL 2AK1L 3BVNB 3AG2B 4IBQA 4K23H 4OQTH 4P46B 1U8KB 5LB1A 3GO1L 4G5ZL 1CD1B 2BRRH 4QHNB 3R18A 2EEAA 2VDRH 3PDGA 5EIIB 2YRLA 4GLRI 4ZO8A 3Q8CA 1AOHA 1AZRA 1UA6H 2FSEA 2ATAA 4U1JA 1CXKA 5DEFB 1Q0EA 3TO2A 2X1QA 3OZ9L 3DURB 3AT0A 1OY3B 5GZOC 3WNIA 5EZOH 1YNKH 2J1KA 5FO8A 1ONQB 1ACZA 4UTBA 2NNRA 2K7PA 4PREA 3HC3L 4PS4L 3WAJA 2D7TL 1NOFA 4PS3A 4Z7NF 2BERA 3EH5B 2OMYA 1TQVA 1RIHL 2GUOA 5HPMA 5SWQB 4FFYH 1JN6A 2FT6A 1A1NB 3K6IA 5IK3A 1SXCA 2QPDB 5HTSA 3PV6B 3HFMH 5I0WA 1K72A 5EDSA 3MV9B 4Z5RA 4HU2A 1CGTA 2KLRA 1QLRB 3MRGB 5E2VH 4M4RB 4KI5E 3ALWA 3SY6A 1JZHA 2EXYD 4OFKA 3Q0HA 2X4OB 3ARZA 3ULSB 1EVUA 3ZQ9A 1WF5A 1LO3H 2ZCKL 3BN9C 3BSZL 1LK3H 4NGHH 2E86A 1INQB 3KW8A 4N86A 4EDWH 2DQTH 5E00A 2F54B 4N85A 4QTFA 1R3JA 4I77H 4OIIL 3TIDA 2ZSVA 4X6CE 3MGAA 5M95B 1MLBA 5JOPE 1OAZH 2DWSA 3T6VA 4PHXA 4LVEA 3MNZB 4G6AC 2PLTA 5EC1B 1INDL 3KWVA 4NPJA 3MV7E 4ISVA 1F4AA 4XX5A 3T3ME 1ASPA 1XH1A 3B6SB 3PNWA 4AXWA 4M5YL 4U1HA 1MLCB 2BCMA 3ILPA 3N6YA 4FQCL 2YN5A 4WFGE 3VWJA 3TWCH 3CZFB 3LIZL 1AHWB 1K8DA 4G7RB 4EN3A 5DYOA 3F8UB 5D4HA 1CICB 1FC2D 3D85D 4FQJH 1NLDL 2VAAA 2DYPA 1CXIA 5FKAA 1EV2E 3M1BB 3NPZB 3CPUA 1VHPA 1P2CB 4HIIB 5IESH 5KTEH 2YGPA 1BREA 1E3ZA 5D7SH 4PSRA 4RBPH 3BPLB 2OA9A 4LT7A 4CADA 5FUOL 4L1DA 1OD7A 2M1KA 5ITBL 2A74B 1G9EA 1IJNA 1IC4H 3AU0A 4H25B 4ZX4A 5FHBL 2PCFA 3NRFA 4HS3A 4ERSL 3GIVA 3PJSA 1OIOA 2HTKC 2VN5A 3FW6A 3V6FA 5AVXB 2XT1B 1Y6KR 4H5SB 1IBGH 2YPVL 2OJEA 3PGCA 3ULUL 1NBVL 2IH9A 4DEWA 4YSQA 2A1WL 5KUKA 4OIFA 4PVNA 2VL4A 1T2QL 2PWHA 4P4RB 4YSPA 4LSVH 1FFRA 2K78A 5DZAA 1Z66A 4JDEA 4YHOH 3O0RL 2DBLL 4NO0D 3WIFA 4Y1AB 2B1HH 2IG2H 3BDYH 4OCXH 1QYGL 2B59B 4OJAA 5F9JB 1ADQL 2A9AA 4DGUA 1REIA 4JFOA 3TV3L 3ELQA 1GYWA 4DWHA 1HOEA 4G9DB 4FFZL 4KJYA 3MFFB 4MCZB 1DZBA 4R97B 1FZJB 3HE7D 2VAJA 5DFTA 3RGVC 2N7BA 4AYDC 1FRGL 2IAMD 2SODB 2ENQA 3LRMA 4JG5A 5JUEH 1EAPB 5CILH 4N20A 5ETUB 1N12A 1IGFH 2VDKB 3QJHB 2IGLA 3IAPA 4XZUA 2DQGL 4O02L 2WCPA 4FKKA 4RA3A 3CSYA 1IM9B 4C4KT 3QUZD 5AWNL 5TDOA 4ZQKA 1RY7B 3QNZB 1HIMH 5IB1B 4PJDB 1UXSA 1WSST 3BKYH 4L3CB 3RPIB 3P30H 2Z34A 3BP4A 3P4MA 4G1EB 5F9WB 1T66C 3CMGA 4XP5H 1OD9A 2BOCB 1G7MA 1QUNB 4GAJL 1MEXL 3DO4A 5TE6L 2FGWH 3WMPA 2J6EH 5EU6E 3UC2A 4BYHA 2B2XL 1JPSL 4P46C 1AGEB 1HDMB 2OJZL 3EOTH 4BZ1H 3ZKMD 3H9SE 2EICA 1FV1B 3QQ4B 2X53A 3V0VB 2E0PA 1BEXA 1OKEA 3WD5L 3A4DA 3IDIA 4X9GA 5JIHA 5IBUB 4YAQA 1EHKB 3VFWA 3GMNB 1ZE3H 2RH0A 5G4NA 5AD0A 3ARPA 4X98B 5E2WL 3DVGB 4OF3A 5AVRB 3OR7A 1RUML 1LE9A 5DJ6A 2X9WA 4QRPE 2R0LH 1AQKL 3RVWD 1WJ3A 3QQXA 3FF7A 4IDJL 3TN0D 3BKCH 1JS4A 4MJ6A 4MQSB 4OF5A 4X5LA 1DQJA 1IKOP 2D7NA 2GBUA 1BF2A 1G7PB 2GJZB 2ZXBA 3FTYA 2D9QB 2G9HA 5L2JA 3HMXL 2RCSL 4QKTA 5DFVC 1XAKA 3CX5K 1AC0A 1L9RA 3HS9A 3Q9QA 2DWDA 1CE1L 1BQLH 2CK0L 3C2SA 3HS0B 2OMTA 2ZP8A 4WTZA 4JO3H 4XXDA 1KT2B 1L7TH 4ZUWB 3WJLC 3QZWG 4KH2A 1J11A 1E4XH 1SZNA 5EO1A 2G9KA 5E5LA 3TNNA 5JQ6H 2GABA 3O45B 2WO2B 1V7ML 4X4ME 1D7BA 4NDMA 4Z23A 3AUWB 4TOYH 4F9PC 43CAA 5C7XL 4EKJA 1R3IH 1H5BB 2AXFA 2ERJB 2Z4QB 3BSGA 2EECA 4EPSA 5MHSD 5ID1A 3M86A 3C8DA 2IQAA 1CTNA 3IDGB 4GBXD 1URZA 1A9BA 4CVXB 4UTBH 1PZ3A 3LEVH 3P4OA 2FX9L 4NCC2 1AHWC 4YSCA 1RUPH 4JUTA 3D4YA 4JFDB 1ZA3A 1E67A 4YLCA 3F2LA 3RKDC 4X6DB 1PIGA 1Z3GH 2WZ5A 3LKOA 4OSUH 1AZZC 1J1XL 3QFJA 1BWWA 4HIEB 2C9PA 1SMDA 4HC1A 4KUCD 2I69A 1B0RA 2XIIA 4NOFA 1JZ2A 5MP6H 1NCHA 2JKJA 4FTDA 4ONGL 5J6SA 4PJAF 3A6BL 1NC4B 3BPLC 1PLGL 4HUUB 1ITBB 3QK0A 2A74C 4N2BA 5DMGD 1VF5C 4V11A 4YSUA 1R0AH 3UYPA 4BINA 4N6RB 4NB7A 4FXGA 2IMMA 2VRQA 3QCVL 3HZMA 1KIQB 4OLUH 3WI9A 4TNGA 1BQUA 5FYKH 4ODBD 1CDIA 2P8PB 3FN0L 4X7EC 5I17A 3A4AA 4BFNA 4JKKA 2PWDA 3MYJA 3ARFB 1JD7A 3BRDA 1K3ZA 5AFAA 4PJAB 1X5XA 3IYLW 4XCNB 1B90A 4K23L 1IM3D 2HJFA 4OQTL 4RDBA 2KC0A 3FT2A 1F2QA 3QAZB 2VDRL 2GI0A 4OI8A 2YSTA 4FQ2H 1QSEE 2Z31B 2Y69B 4E9SA 3HAEG 5KYNA 2EKSB 4Z7UA 2AEPH 4WGWB 2V7NB 5AVUB 3HR6A 1FL6A 3FB8B 3VXMD 2FQDA 2XWZA 1NBZB 1JUFA 4UI2A 3UBFA 5BO0D 1YNKL 3SJVE 5HGDA 1OK8A 5GRVK 1P84J 2G60H 3IMBA 3LHAA 3KMDA 2HLEB 3VM5A 4AY0A 2WNKA 1BLNA 2EO1A 4PJEA 4HKZB 3GMOB 4GRWE 3GS4A 2X05A 4YE4H 1NEZB 4DOHB 2ZOOA 4R90H 1MCHA 4J3SA 1UH4A 4K73A 4F8PA 1T03H 1MFCH 1DVFA 3BMVA 1UKQA 2B4CH 1JHTA 1ZIBA 3WUWG 1HS6A 2IFFH 4N0UB 1DLFH 2XY1A 3OAZH 4JZJB 1LO3L 1JZ8A 2DI7A 1LK3L 3ZMEA 1MQKH 4NGHL 5IB4B 4K3GA 4EDWL 2DQTL 1FVDA 4D0DB 3NFPB 4I77L 2OR8A 3US9A 1C5BL 4WHTB 1T89C 1ZHKA 1ZTXE 4YHPA 5J6HB 1F6AB 5C0CD 3SYCA 3FQRA 2F74A 1UTDA 5T5NG 2J2ZB 1HH6B 2EIBA 2HRPH 2R23B 1FAIH 5D71H 3E7JA 2NDFA 3D25B 5HHVL 4P5TD 5GQBA 1CUOA 3SE8H 3S0PA 4WI4A 4KI5D 4LCUB 3K2UL 4G43B 4Z7UF 3TWCL 3T8XA 3GSNL 2YUZA 3UTTD 3ZE2F 2GITA 1DN0A 3UJTH 4U6YB 3L5WB 4FQJL 4GNKB 1CC3A 4PJCA 4ZYKB 5A16B 3RILA 4E5XA 4RAVB 4ODXB 4AYFA 5FGBA 1A4AA 1P7KB 4NAQA 5IESL 5KTEL 2F53B 1KLFA 5I1JL 5E4OA 5D7SL 1PKQB 2Z4TA 3HS0C 3TONA 4PJEF 3QUXD 1S9WB 4XNMA 5I8EA 3P73B 3F7VB 3TT1H 1IC4L 4TNEA 2AJXH 2ZWZA 4BZ2A 5AENA 1OAQL 1KBGL 1FLTX 3EOYG 5C0ND 3V5KA 5EWIL 3H9ZA 4L5FE 4WFGD 2V2XA 1NSNH 5C0GA 5KSBB 2NDGA 1CFQB 5CEZL 5IHWA 1A7OH 2AI0H 2ITFA 1IBGL 1W72A 1E50A 1T7XA 1H5BC 1X6NA 4QXWA 5KS9B 1RSYA 3VRLF 4DUXA 3ZDYF 3DVNA 1MF2H 2AK4E 3F7YB 4QJ5B 3B2DC 3UG4A 4AIZA 4YHOL 5CZXC 4HKJB 2Y07H 4O9HL 4PJXB 4Z9KB 4YBQC 2V7HA 3C5ZD 2IG2L 3BDYL 2XKNA 4OCXL 1YCSA 3EJYD 2F7IA 1I7ZB 1N3NB 4J6RH 1JGUH 4FFVD 4QLRA 3NG5A 2CU9A 4GKSA 4BE6A 4NNXB 5C08E 5I0ZA 4KKLD 3O2DA 3U0WH 4P5SA 4PJCF 3KBHE 5HDBE 5JUEL 2VMFA 4AYEC 1P4BH 3HG3A 1NDMB 3KYAA 3QB7C 1L5GA 2YAPA 2JCCB 4RZCA 4ENZA 1U8MB 2LLLA 3RDTA 5DQDL 1P53A 4GW4A 4LSSH 4XP4L 3KLAB 4YIQB 2PXYB 5BVJB 2WXPA 1OOWA 2E47A 3BKYL 2V9RA 3P30L 2I5YL 2EIDA 1ZLDA 2WXIA 3ZL2A 3KPNA 4XP5L 2CM6A 4M6MH 4JO5A 2A3TA 4QDGA 2XYBA 3ARFC 4XI5C 1OM3H 2UWEB 4JO8A 4JHBA 2FGWL 3KYMA 4QXTA 1PSKH 2YO3A 1UWYA 3AY2A 3B56A 1P6FA 2OMUB 3EOTL 4UB0L 4J5VA 4BZ1L 5D8JH 4F7MA 3QAZC 1U42A 3V0AC 3WLBB 4AGLA 5JMRA 2H3NA 2BW4A 2Z31C 5I5JA 1J8HB 2VXVL 3EYVB 3PP4H 5BS0A 4FCAA 2WBJA 3DETD 1UH3A 1KTLA 1CBJA 1MFMA 5ICYA 4KDVA 4HC1H 4FG6C 2UY7B 5CP7A 3T0XA 3DXAD 4MA1B 5AOIA 4JG9A 1PZSA 2R0LL 4FMVA 4EIUA 3DMMB 2AV1B 4XMZA 4MBOA 2LAAA 2AVFA 4AWJC 3D69B 3KJ4C 4BDVB 4KO9A 4PLNC 1CIDA 2A6IB 2FZ3A 3ZO0A 1XF5A 2LLNA 4FERA 1B9KA 3H9SD 3ES6B 3U7AA 3T0EE 4ALAH 3ZGHA 3AAZB 1HILA 2ZOWA 5H94B 1BQLL 2V3DA 5IJDC 4L0YA 5G5DB 2YS4A 4OLEA 1JTOA 4JO3L 1BOGA 1L7TL 1MHHB 4MWFA 5LBSA 5FDWA 2YC1A 3P77A 2YQ2A 4JZJC 1EMTH 1E4XL 4NZ8A 2VKXA 5JXAH 3SDDD 1M05B 3RU8H 3S36H 3JV6B 5JQ6L 3DARA 1KLUB 1E4WH 1U8LA 3MRMB 5E1AA 4KKNA 2J43A 1GGIH 2LR4A 3MOAH 1ZT7A 5DS8A 4HG4J 4PJHA 5DJ0A 3TEYA 1AO7E 2HT2C 3DVIA 3QUHA 4JLRB 2H32B 1W0VA 1GGCH 5BO1L 4MB5A 4PBWD 5DSCA 1HK6A 3RPKA 4FKEA 3L8QA 3LEVL 2E46A 4KX8A 3G3LA 4U33A 3U30B 3MRLA 1RULH 1G7HA 4EZLA 2NY2D 2ETWA 4FG0A 2ARJA 5KZCB 1SN5A 4OSUL 5EIIG 1E5UI 2ZF8A 3ZT7A 5IHHA 4RIRA 3K5SA 5MP6L 4N5EC 2JI1A 4PJ7A 3JTBA 5HHOE 4PRPB 5KSVB 1QO3A 1QEWA 2GJ6B 1BQ5A 3SQOH 1WBXB 3L3IB 2W59A 2FWOA 4PIRF 4U31A 1NFKA 3DOSB 4JQXC 1R0AL 5DLMH 3B2VH 3UZEA 3ZKQD 4AC4A 4PS8A 4L4VB 3WFEH 2FL5B 2VDNH 1BJ1J 4XCCH 2WMPB 1KBKA 5I24A 1PY4A 2JELL 4QRRE 5BOPA 4TQHA 2Y2TA 4FNQA 2VDKL 3FT4A 4HF5L 1JV2B 5H8DA 3BC9A 1R4XA 4LBEA 3VD5A 1NGPL 5D7KE 1FFOB 2LQRA 2KQNA 1DVYA 3IETB 4Y8DC 3SDAB 4WWKD 1WE5A 7FABL 2D2OA 5J6GB 1MRFL 4CNIA 2VN7A 2FWSA 3M46A 4AITA 5J57B 1QUPA 2NSXA 4P23A 3FPYA 4OCYH 4PJHF 4YK4B 4DQAA 4XP9H 2VIRA 3KYNA 4FQ2L 4WUKL 2XV6B 4TSAH 2WBXA 1AIFA 4P2QE 4W4OC 4UU9A 2NY6D 2VLMD 1J9TA 2H1XA 1OAYH 1JYVA 4L3EE 5M94B 4PRBB 1SHSA 1FZKB 5FUCE 4S1DC 5INDA 1XR8A 3LEXB 3D33A 3FYIB 1EQWA 3LVEA 1CT8A 1IAOA 4UT7H 2IBZY 1WT5A 2PTTB 3B2UD 4L29B 4Z95H 1N67A 5IMLA 3DTXA 2LAGB 3FUJA 1X3DA 2R9HC 4KI1A 1T20A 3GSOA 2ADIA 1FIGH 1M57B 3IGAA 2HVBA 2PXYC 3QPXL 4Y9CA 4YE4L 3ZZLA 1QSED 3ZKND 4FQIH 4R90L 4EI5C 1KXTA 2OTPA 1N6UA 4FG4A 1T03L 5F0MB 1MFCL 1NZRA 1PZAA 2UXGA 3L9RB 4HZAA 2IFFL 1XB6A 4Q97A 2CO6A 2C3WA 3C75A 3HLAB 3WAKA 1A4BA 4JZNA 5BUGA 3K1KC 1AR1B 1MQKL 2YAQA 1KCLA 1U8PB 3BIBX 1J18A 3KLLA 5MENE 3U9PH 1ZGLA 3Q2LA 3SD2A 5DVPA 2NUPA 3JZYA 1EAJA 2I32A 4HD9A 1VDGA 4GMTH 4YDVA 1K4CB 5AVZB 4OZ4B 5D93B 5K9QG 1JI2A 1X5GA 4JPKL 3FOLA 1IB5A 2HRPL 1XHHA 1FAIL 4Y5YA 4XN1A 5T3ZD 15C8H 4HIJB 4NO5A 3L6FA 3ZDZF 4YL4A 1I3RB 3SE8L 3O2DH 4ODUB 1LD9B 3VXQA 3BN3B 4HFWB 3EW3B 4DKDC 4MA1C 4MMZA 4X99A 3WELA 3L9YA 1G43A 4EZKA 2XV0A 3C08L 3UJTL 1Z9LA 1NFIB 2KDYA 4FZEH 4WW1B 4K71B 2FECI 4J4PA 3U4KA 5IQ9B 2H32H 1OAXH 2P5ED 3LRGA 2AEIT 3SQBA 1O7VA 3UTQA 3ABKB 2AKRB 4KTDH 4BUGA 3SE4A 3DHPA 1AXSA 2EABA 5JR1H 2BP8A 2V5MA 1VACB 4CJ0A 4OAWB 5DQJA 2BNRD 3B34A 3DX7A 3JWDH 5AVWB 3TT1L 2AJXL 5E5MB 3UIYA 4IRZA 5H4ZA 2P5WB 2Q2LA 4WFFD 1FFPB 3ARSA 1BW8A 3UTPD 4UM8A 2OL3A 1AD0A 4XN5A 4QOKA 1G6RB 4BGLA 5T3XD 4Z7OB 3GF8A 4K8RH 5LNEA 3QZWA 1A7OL 4UDUB 1CDHA 2AI0L 3HI6H 1U93B 4B7LA 2M8XA 3PWPE 4FQQB 2R1YB 4FTVB 2YD7A 2IH3B 3ISWA 4JO4H 4N2KA 4PJBB 4UAOB 1TTBA 3H2WA 1MF2L 1MHCA 4DP2X 4R2GB 1HCYA 3OQRA 1MXDA 2Y07L 1MH5B 4J2QA 2CDFA 3TFKD 1WAAF 3IDJA 3U30C 4ZS7H 5GGSA 2V33A 3OF6A 1HZKA 4P9HC 3QIBA 2XZZA 1SMAA 4QLWA 3ARDD 3R19A 4Y5XB 4J6RL 1X5JA 4C56A 4PG9A 4ODVL 4M8UA 4LSUH 2ZUQB 4JM2B 5IBUG 4J3WA 1R33A 3BIKA 4QNPE 3HJ0A 3BH8A 3R0NA 1YRKA 3TF4A 1ZLEA 4IRSA 5LBSH 4L05A 3HC4L 2WXKA 5LGYA 3QIUA 4J3OF 2C9SA 3VFRB 2AK4D 3VNYA 1S7VB 5IMKB 3HN5A 1I8LC 3BAWA 1LYQA 2I85A 5JXED 5FW7A 1SDAB 4LSSL 1FG2B 4U1MB 2WJ7A 4FLHA 2AV7A 5JPNB 4PQXA 5DMYA 5I5RA 3U7YL 3Q01A 4XNYL 3SDAC 3MUHL 2BVOA 4M6ML 4ZOBA 2L3BA 1OM3L 3SGEI 5C08D 5BZWB 4Z3HA 1BG9A 2ZPKH 4LFHD 5CBEB 1MCDA 3HIZA 4GT0A 5IW1B 5ABAA 3NFSH 3GSXA 4OGYH 5D8JL 1JNJA 4EN2A 2RMNA 5AYQA 4HKBA 3X1EA 5AAPA 3V6OE 3X3GH 3JV4A 2CNZA 4B96A 1V7NH 5I30H 4X7CC 5JA9A 1H8SA 2P3YA 3PP4L 2IALB 2C4XA 3Q7JA 2ZOLB 4KK5C 2FTAA 5GISH 3CU7A 3J07A 3GI9H 2KKQA 1I1YB 4TQEL 3O6FB 4F37F 3CH1B 1X5FA 2YRZA 3HAEA 1MPAH 1HYSC 1T0MA 2YZ1A 2Q86B 3VG0H 4KKZA 3PP3H 3TASA 5IJCC 1FSKB 1HAUA 3IDMB 3S6CA 5EZJA 3A0OA 1X4ZA 4Y2OB 2IDFA 3D9AH 2J8UA 2DF3A 2ZX7A 3RL2B 3V0DA 1OHQA 3J8F7 2PCXA 1KXQA 3ZUNC 3VQLA 4BWWA 1FYTE 1XV8A 2WV3A 3S5YA 5TDPA 1XSJA 3BESR 5CZVH 5CSZB 4AQEB 4HIPA 2UX6A 4HETA 4AIXA 1C08B 2C3VA 1IQWL 3P4LA 4K07A 4LRNL 3VH8B 2LU4A 5JXAL 1AR1C 4KRLB 4JX0A 2FT8A 2GFBA 5MERA 4C83B 4PLKC 3RU8L 3S36L 4D8PA 3WUWA 3F7PC 2BNQA 1E4WL 1EJOH 2JB6B 4O2FB 3JWOH 3P9LA 3KZ8A 4O02A 4P07A 1N2RB 1GGIL 1N8OE 1RIUH 5D93C 5IREA 2R2BB 2AFNA 3JUZA 3WE6A 3O11B 7PCYA 4POUB 2YR3A 1G6RH 3GINA 5IJKC 3MA7A 1QWHA 2OQJB 1GGCL 3ZOAA 2XXMB 5C9JA 1CYWA 1FO0B 1OP9A 1WP6A 4P2RE 2D0HA 1FNAA 4O2CA 4BK4A 3BH9A 3PGDA 4G6FD 3VVWA 3H0TA 4K71C 1UENA 3MRHB 5E6RB 2GG1A 3RZCA 2CIIA 1A4JA 3DIFB 2Y1VA 3EOAA 2QPSA 2VR7A 4PCKA 3CSTA 4CVWA 4HXAH 3G5VA 3LKSA 5JHDB 2J8UF 4LLVA 3FFDB 3VXSA 4UDTB 1L0YA 5E4AA 3KWXA 3SQOL 3VXPB 1I7UB 2WM0A 4LLQB 4E68A 3ZDWA 1C16A 5CHNA 5IEKB 3B4NA 1TVBB 2NZIA 5DLML 4MS8C 3B2VL 3ARWA 2WKGA 4DIXA 4IRJB 3P9MA 2W0KA 1EO7A 2VDNL 1EHNA 4XCCL 4YDJA 4LEOA 4OLYH 5E6YA 3C6LA 3TH3T 1FH2A 3NPSB 1D5ZA 1IIIA 3OSVA 1CK0H 4G8GB 2BY3A 3CDGB 5D1ZI 3TCLA 4GAYA 1SPDA 3RL1A 3RWCA 3H3BC 4MVBD 1FL5B 1XGQA 4UAOC 4GIOA 4P4KB 4OD1L 5HHOD 2J72A 4KNUA 4R2GC 3QEQE 3IJHA 5CM1A 3NJGA 4LESA 2Q5BA 4EVNA 4OCYL 1MJJB 3IMTA 4G8AC 4XP9L 3WHE1 1TIUA 4U6TA 2H2PC 3D50A 4M7ZB 1ID5I 1JDDA 1I1AB 5T5NF 5GRXG 4TSAL 2GSGA 4Y5XC 2EVFA 3FB6B 1R5IB 3GJEA 1QR1B 4MJIA 3QNXA 1YC7A 2ZUQC 4JM2C 4J3OH 1V3JA 2BCKB 4FHBD 3JTTA 1MI5A 1KXHA 2AJUH 3CVHB 3US1A 3SYQA 1CDGA 2HG0A 3QXVA 2YJQA 4D0CA 5KJ7E 3F5WA 1USZA 1EFXD 3SGKA 4X8CA 1EUUA 1VJSA 4UT7L 1Z9PA 2DQDH 4IRZH 3WNNA 1MNNA 2Q3ZA 3CFMA 3DRQA 3VXUD 2D3NA 3L1OL 2F15A 5D1ZB 3ZTJH 1P7QA 2FQGA 1FIGL 2B5IB 4JFXB 5HHXH 4RCAA 4FQIL 5D1XB 4DQOH 4OFVA 1KYAA 4BCZA 2WLIB 4L9DA 2QVKA 1S8DA 2NY0B 4P2QD 2ARWA 2VOTA 3GRBA 1WFNA 3MACH 4OV5B 3QIWB 5BRZE 3NJHA 3GB7B 4GXVH 4L3ED 1BFTA 1MFEH 3RI5F 1XH3A 4F5CA 3BJ91 2DLFH 5HI5C 1P4IH 3B3IA 1ES0A 3LKQB 5CR8A 4LCWA 4XMPH 4ZW8A 2WQAA 4GMTL 1USQA 4MRCA 4PY7B 1KCUH 3CZEA 3F58H 2YSSB 5C0AA 1F4WH 2NR6D 3BEVB 4NENA 5HSFA 5BW7C 15C8L 2E76C 3FFCD 3WEOA 3E1F1 4A38A 3O2DL 3O6FC 3DJSA 4AQOA 1S9YA 4WTQA 1KC5H 4QHPA 5TE7H 4NUQA 4F7PA 3VXOB 1FSKC 5KW9H 4FZEL 5AZ2L 1E9OA 2Q8BH 3GWJA 5LCVA 1XTMA 3RUGE 5C8JB 3BWZA 5I18L 3QWRA 3ISYA 5GJTH 3L3DB 4DPRA 1RZPA 2OMZB 2QELA 2YBGA 3ZO9A 2WW8A 1IUZA 4LIQE 4W6YB 4KTDL 2ZXGA 2OYKA 2QGCA 5IVXF 2RIKA 3CSBA 4P49A 3AUVA 5JR1L 1IFHH 3LQZA 1JXKA 4P9HL 5FM8A 4FJYA 4WUUB 4M7LT 2HYMA 3B2XA 4RFEB 4Z7WA 3JWDL 2Q6WB 2R4RH 3KPLA 3S96A 4JFFA 5ES4B 1JI1A 1TF4A 1ZV5A 2VZSA 5FA3B 2VISA 4IGBD 5TFSL 3ZHKA 2EVHA 4AENA 2YD4A 1RJZA 2R1WA 1XGTA 4BFEA 2RB8A 3AQZA 3QFJD 1AI1H 2F8OA 3ARRA 5A2LH 5INCB 4LNRA 2FB4H 2C3HA 3HI6L 4KK6D 5CWSA 4CN1A 5I76A 2BHUA 3BAIA 3EG9B 2XPGB 3HLKA 4HJJH 4S10A 4YGVA 5DF0A 1T7VA 5TGBA 1M2OA 2ZWYA 2M26A 4DKFH 4XGZA 1U3JA 1J9QA 2DD8H 2H26A 1OVZA 4YHZH 4F58H 5FYJD 5DVLA 1P6AB 3FO2A 2DYRB 3CDFA 3NACH 4F9LC 3H6AA 3OVUB 1JGLL 4OB5H 2YOAA 5AUMA 1BWMA 1UOKA 1B0GB 5KYUB 4G1MB 4UQ3B 4Z0BL 4ZS7L 4G80B 2DYSB 2FYVA 2LVCA 5L7XL 4OLZH 1CFVL 1KJVA 1M7IB 2YA1A 1WWCA 4I8DA 5ISZD 1JK9B 1KCRL 2E6JA 4IBSA 4G8IB 2HUHA 3QJVB 1U8KA 4P46A 3IXTB 5DRNA 3MZGB 3S8FB 4DHLA 4P5KB 4MD4A 2ICCA 3PWPD 4YDLC 3FUMA 3ATFA 5EU5B 5GJSL 5CBAA 1TTGA 1YPZE 4KJWC 1WS7A 4KTEH 3JZ7A 4BZYA 3N44F 1XD0A 3DI3B 4DSYA 4IRJC 4PU2A 4AGMA 3S9DB 4GXUN 4LLWA 2GVYA 2VLKE 3LB6D 3RPBA 3CVHH 5KBMA 1EEYA 3NJXA 4Z7WF 4KUZL 3NIFE 5IVXE 4AYSA 3QWNA 3AROA 1OE2A 3W1ZA 1N7ML 3NPSC 1ECZA 1MRCL 1U8HB 2PPAA 3SOBH 1LP9B 4TN9A 1L6XA 4BXVA 2YRPA 4DGYL 4ZI8A 3U2SB 5SWSE 5T1MB 2ZPKL 4ZW3A 3NH7H 4NP4H 3NFSL 3AZUA 3VD7A 4X80H 3V0IA 5E7FA 4ZMAT 1BVLB 3C8KA 2BS9A 3X3GL 2YEZA 3FQYA 5I30L 1V7NL 4M7ZC 4PP2A 3KPQB 4Y4KA 1DFBL 3HG1B 2FWUA 3O3AB 2P80A 5GISL 1HXMA 2YKKA 5AQ0A 3A6CH 1E2ZA 1P5VB 1I3GH 1TZIB 4MLIA 4JPWH 2R2EB 1TU2A 4IJ3B 3MRIA 1URLA 2ICEB 1EDQA 4LHUA 5BRPA 1A2YB 4XPAL 4Q52A 3ZHLA 1AR2A 4AK2A 3F7LA 3NDZE 5I75B 1AFVL 2VLRA 3CHRA 4MA8L 4BHUI 5HYFA 3RWGA 1NWPA 1U30A 4HHAA 2J1WA 3N55A 4HP5A 1DVTA 4LSPH 4OT1H 4QTIL 5D1ZC 3B6SA 1SHWA 2B5IC 4EZJA 1QNZH 2KDGA 3JTSB 4F37K 2X6VA 2WVUA 1JL8A 3HUJA 2XN9A 5D1XC 2HT3D 2BIHA 2XKUA 3L2MA 4GFTB 3MI6A 1KYOK 1MG2C 5CZVL 3DV6A 3PWUA 4DF9A 2NY0C 1Z7JA 1YEKH 2CA3A 3UEZA 1N59B 5ESVA 1KELL 5FB8A 1HEJC 2VJ0A 2X10A 4TRPH 3QIWC 4XN8A 5HYIA 4GKZA 4UQ2A 3LH9A 2VR8A 1L6PA 3MX0B 3INUH 3T6WA 4Z3GA 1YAIA 1EJOL 4WGVB 1JERA 3JWOL 3QXAA 3ULUE 4XC1L 1BVZA 1T7ZA 3CZNA 1UD3A 1RIUL 2WVSA 2BVEA 4JJ5A 4HDIB 1HH9B 2AJSH 5C0RH 4M6AA 2IWFA 1G6RL 4G6JH 3QZOA 4X0NA 1MFUA 2I27N 5HHME 4FDWA 2VSCA 3PQYB 1CF8H 1LK2B 4JL1A 4I89A 3Q6FA 1LQSR 2XQBH 3AG3B 3CFBA 1EHXA 1NDGA 2ZKXA 1AD9B 2B9AA 4YR6B 3DGGA 2ZICA 3IKKA 5K39B 3D48R 3SBWC 5DD0H 2XWDA 2FECL 1DDHB 2Y6SC 4HXAL 4B0MM 2XTJD 3UL4A 3HKFA 1MREL 3A4FA 3OKYA 1OF2B 2Y5QA 2HLFD 2WXHA 2IDQA 1H15B 2BC4B 4LVNB 5IQLA 2EIKB 3D3VA 1DBAH 3DRTB 4ABQA 3CLFL 3WJJC 4HAFA 3HUJF 1ZANH 2AABH 2B20A 3WDIA 2X12A 3BVTA 4G9DA 2AJYH 2QL1A 1FZJA 4OLYL 3VFUA 2X70A 4ZUUB 2DEWX 5CXPA 4GH7B 3PF2A 5IROD 1SN2A 2C1PA 3MCKB 4PGBB 1PZBA 4XX1G 4IU3A 1YY8A 2NXZD 2AQ2A 2EADA 3UPRB 4KC3B 4I0KA 4NQDE 1A1MB 4K3DH 2RFXB 1SY6H 2DQHL 1ID2A 3LNIA 2DRUA 4F7TA 1JFQH 5C70A 3RDTD 5L88L 3Q48A 4LQFL 4LSTH 4WY7H 4OZFB 5GSRA 1UASA 3RNQB 5GHWH 2WQVA 4MZIA 3NCJH 1BMZA 1UD5A 1Z5YD 2PYEE 5EB9A 4E9VA 1QUNA 3ECBA 5DURD 3UEQA 5MEOB 5FYLH 1SOSA 3ARGD 4PH8A 3I9PA 3FQWB 3VDAA 1B6UA 3NIDB 2AJUL 5E1QA 1DQQA 5E6IB 1QAWA 4H7VA 4QYAA 4WZ9A 1G7LB 5T1JA 1A5FH 3WENA 3VQMA 5HVHB 5B39B 3L5JA 3VXRB 4FMKA 2ATKB 4KJPD 4KO5A 5LUMA 1D5MB 3H2QA 3CH8A 3QEQD 3JWNH 3ROOA 3DVGA 4MXQC 4XP1H 2WBJD 4ZS6C 2JH2A 4FNLH 2DN7A 5HHXL 5CF3A 2G3ZA 2PCYA 1SJHB 1KGCE 4Z7VA 3KDPB 4WHYG 1KY7A 5I0VA 4DQOL 3FOMA 3QHFH 4O5LH 4JRYB 4Y9GA 2R1XB 2QLYA 4HEPA 2DZEA 5DHVB 2OMXB 4PWEA 3T0VA 1Q72L 2X4SB 2LW3A 4Z77A 4LNVA 4HQQH 5FPIA 3LNGA 5GGUB 5J9PB 1HXYA 4XMKH 3V9FA 5FO9B 3POCA 4GXVL 5IIEA 1RUQH 2D7PA 2V3FA 1MOEA 2DAVA 2A99A 2NSQA 4K7PY 3U36A 5CCKL 1AH1A 3PL6B 2DLFL 1RL1A 1P4IL 1T0PB 3TL5A 5B38B 2AQRA 1XIWD 3NFNA 4CSZA 3PDOA 2BVUA 1TETH 4KY1H 1ZA6B 5C92A 3G08B 3PXLA 1HAWA 3FSVA 4JDVB 5DQ9A 3F58L 4HZLB 5ELIA 2YPKA 1F4WL 2WZ0A 2B9BA 3P3SA 3RNKA 5I1LB 2E7LC 1EXUB 2QR0B 3ULVD 1FPTH 4FL4B 4FQXA 1TENA 3JWNC 1HT6A 1E8WA 2G0KA 2XXCB 3RI5K 4IJ3C 1O6SA 2ICEC 1E9PA 5FFGA 1KC5L 4XAKD 4QXGH 3MLXL 1ZHLA 1FE8H 5KW9L 3QXUA 5KJRH 5E8NB 4IIZA 2Z4QA 5JPMB 3QYMA 4X8GA 3OKDA 3L3OA 4OM0H 3VFMA 4G9FB 2GJRA 2ZKMX 2YLKA 2YGNA 5T1DH 1KEMH 1GC1C 3FU5A 3B37A 1QZNA 1T1XB 3DX8A 2XFXB 4QHUA 3V6ZA 3EJQA 5I82A 1OP5H 1XF3A 3CZJA 1AYRA 5E9DB 4PJGE 4AYID 5KSUB 3OQ3B 4TKWA 5HJDA 4RGNE 1H6TA 4Z7VF 5LDUA 3H3KA 4HIEA 4PTTB 5BV7H 4PRIA 3RZWA 3O8XA 3A6OA 3MRQA 1R5VA 2BHYA 4ZOEA 3MSPA 5TK4A 3CHSA 3LKPA 3CCHB 5FDYA 4K9EC 3V4LA 2K6WA 3F04A 3MRDA 2XWRA 4JGUA 5DEGA 3U2JA 1YJDC 1B4LA 1ROCA 1IAIH 3WL9A 3EGXB 3VMNA 2DD8L 4L1HA 5CJXC 2NSMA 3DV4B 12E8H 2H2SC 4F58L 4YHZL 4JY6A 4N1HB 3EOBA 3BQUA 3II3A 3BUQA 3NACL 3T9WA 4JRXB 3RY6A 3S2AA 4OB5L 1A1OB 35C8H 3H4FA 5I1CL 2P8PA 3S3DB 4K7PX 3CWGA 1EUTA 4UINL 2ICES 2EYTB 3BFQG 3VX1A 1LMIA 1PNCA 4UQEA 4BH8B 3P2DA 4PYGA 1SLWA 4ZZFA 2BP5M 3A67L 3J27A 3L3KA 3PGFL 1KPUA 1QD0A 2BW5A 2XWBA 4EDXA 1WC7B 3V0EA 1DEEB 3QORB 1GHFL 2CIKB 4NQXB 5HD8D 5BQ7A 5K9OA 3ESOA 4LVNC 3O9WB 2I24N 4E41A 4P23D 4YWGH 3FAWA 5D2LB 3CPLA 4KTEL 4ODSH 3SE3C 3UG5A 2V37A 4W9KC 3MRRA 3FB8A 4PJ9A 5DWUH 3KD4A 5B3JE 1NA8A 3CVHL 3SPJA 3S88H 1KBBA 3LV3A 4PBVC 4HLZG 2X4PB 3OHXB 4JKNA 4H20H 1BSIA 4MYWB 5L2KE 4IMLB 4ZMVA 1SJMA 3M6DA 3N1GC 4AV5A 1GSKA 3B7SA 4UQAA 2F5AH 3SOBL 2BS71 1TDQA 1SUJA 4AYBA 1B2WH 4QCIA 3SDYL 4Q9QH 2F9BT 2HKAA 4HKZA 3LJ3A 3GMOA 3NH7L 2OTWB 3LMJH 4KROD 4OLWL 3W5MA 4X80L 4PVMA 3TYFB 2X88A 3VH8G 2F5BH 1AG0A 4OUUB 1F3RB 3CSGA 4V1DE 5KBDA 3PHOB 4Q74A 5EUOE 4OZHE 4F15B 4PJIB 2CZNA 3IDUA 5F7BA 5T1KB 2QTVA 3O4LE 4XMXA 3WBDA 1BAGA 5C71A 1DQIA 2D2CC 2N3JA 2LVEA 3IDXL 1L9MA 4KV5E 2L4OA 2FUQA 2XWJA 1PZCA 5E6IC 4PP1D 2C9VA 3K8KA 1QW9A 1J8KA 5HVHC 4NZUH 1HH6A 2VLJD 5SWSD 4CU7A 2IFGA 3CVIH 3H7LA 5JLZB 2X0VA 3KPSB 2NQCA 5KWYC 1TEFA 4IQHA 4WJKB 3POHA 4B60A 3QDMA 4OT1L 4EOWH 2CKBB 1W91A 1QNZL 4XHJD 3VCLA 3X1GA 4G43A 1MFAH 4ZFZB 3RWDB 1AGFB 2FD6H 2C9QA 2WQWA 1F3JA 3MV8B 1YEKL 1TG8A 2NX5A 1ZLWK 1S7WB 3ZXAC 3RTQA 1E28B 4JKPH 4GUPB 4M7KL 4RAVA 1JWSA 2NNCA 1YY9D 3AGVA 4MDJB 3OPZH 2B3IA 2N7AA 4JL2A 4HLJA 4KXCA 5GRZA 1EAQA 3PL6C 2E9GA 3CC5A 1XF1A 2EUVA 1WQVT 1UVQB 2D0FA 3UXFA 1DE4B 3TBCA 3L7FA 3WNLA 1AHMA 4Q4EA 1E5AA 1CLCA 1WD9A 3FQXA 4FQHB 5K33A 4ZMOA 5IG7A 3FJTA 4MQ7A 4W9GC 2AJSL 1AACA 4P3WA 2WLKA 4Z3JA 2HLAB 4G6JL 3ARYA 1YMHA 2FIKB 6FABH 4R5TA 1CF8L 4JN2B 1R34A 4U6XA 1K5WA 5KAQF 5ICXA 2B39A 2ITCA 1B3IA 4EBQL 1OLLA 3B9KB 3QP3A 4FP8L 3IEAA 4HMCA 1XBDA 5JPMC 2QQKL 4KK9C 1KLGA 1OTSC 1CZ8H 2X6BA 3IJYB 3EYSH 5DD0L 3KM2A 5D5MB 1AANA 1S7XA 1MCFA 1X5AA 1HHGA 2A5UA 4YBLB 4F7KA 4R8WH 1TFPA 3GDBA 1DBAL 2Y22A 5AOLA 1U3HA 5FK9A 1I7ZA 1N3NA 4S11A 4NKMB 4MKMA 3EJCA 1F4XH 3OF6D 5C86A 1W2KT 3RWIB 2BZ7A 2NY1D 4WI8A 2AJYL 3QDGA 4LSQL 3FO1B 2JQMA 4JFPA 1KPVA 1T5XA 3MV7B 4QRQB 2MTAA 1BD2A 4C56D 5HGHA 2N59A 2NYYD 3IRCA 2V2TB 2RTTA 5C0BA 1L3NA 2FEEI 4DERA 4AGQA 2AZAA 2ROYA 4GS7B 1AMXA 2GIYA 1MHPL 2X1XR 2XWXA 3B7TA 3PWJA 3MV9E 4K3DL 4CC4C 2DEXX 1SY6L 3WEXB 5LG6A 1E9QB 1U8CB 5FM5O 2AQ1A 1JFQL 1CL7I 3PE9A 3UC0L 2ZSWB 4B7IA 4WY7L 3OX8A 4EI5A 1R3KA 1IU1A 1IFGA 1KIPB 5GHWL 3DYPA 1HWHB 1S4IA 3NCJL 4E42A 3Q8EA 5AAWC 4Z7NE 3BZFA 3QJRB 3R06A 3ETBJ 1RXLA 1XMWA 5F7KC 5F6IB 3ETTA 5D9SA 3QO1A 3DGCR 3QORC 2G2RA 5FA4B 1FGVH 3BCFA 3NSDA 4ZNEE 5CFHA 3RVVC 1G9NC 1J8HA 3O9WC 4KGLA 1M1XB 4KZDH 1XGUB 1A5FL 4LCCA 3ALXA 1OGSA 4HK3N 1I7TA 2L7JA 1MNUL 1NIAA 4OZIA 4R7NB 5D7HA 1JNLH 2UY7A 1J1PL 2HX7A 3MLWL 1KN4H 4WSGA 4FNLL 5H37G 4D2NA 2DQFB 2JKXA 3DKHA 2FE0A 2VXQA 4H8UA 2QV2A 5GS2H 5C3IA 1PZ5B 1KJ2A 2WIIA 2YUVA 4RH4A 4R7VA 4X5XA 5CGYD 4IDLA 1DP0A 5IJVB 1U91A 4O5LL 4L1BA 5TDNB 2IQ9L 1M7XA 5LO7A 4HQQL 3EYFA 2DQIH 1UOWA 4QHMA 2X4TA 1RUQL 4PR5B 5T1LD 4XPFL 1CXFA 1G87A 2D7OA 4WSKA 1PJ9A 1GJUA 1H6EA 4WNQB 3BUPA 1A64A 5B8CB 4X5PA 3ISRA 3OKLB 5F8QC 3NSCA 4G71B 4F3FB 5I2IB 3IB4A 2BK8A 3WFHB 1TQCB 4DPCX 4KY1L 4PV8B 1TETL 3EXLA 3ARED 4PLJD 3TJPA 5EMYA 5I6OA 4F15C 2XTSA 4RX4D 1SHMA 1CDYA 4AUJA 4WIQA 1HL5A 1FPTL 3SCMD 3I9GH 4WHCA 1RK0B 3JV6A 4QXGL 1IVTA 1FE8L 2BSDA 3NQIA 4FEIA 4EXPX 1A7PH 1Q1JL 1LDSA 1S5IH 2CA4A 2DMKA 5FF6B 1TZHA 1YJDL 3WMQA 3PIQA 3IFPA 3X11B 4ZFFB 4JKLA 4WTWA 4OM0L 5E6ZA 4Y1AE 1PD0A 2R27A 3NZ8A 1HCZA 2J21A 5T1DL 1KEML 3GXTA 1FVEB 5EU6B 1HL4A 3S35X 4OZIF 1MN4A 1J87A 3OKOB 1ZWIA 2WNWA 5F89A 3QXDB 1IZJA 3BO8B 3LOWA 4MDRA 2D31A 5JW3H 3QI9D 5F0JB 1TCMA 3QDJA 2UZYB 4EF3A 2YAOA 3KPTA 5FYKE 5BV7L 5ILTH 3S4SB 2IXQB 4NWTL 3VRJB 3EHBD 2ICWA 2H6UA 4DETA 2JJSA 4LMQE 1XEDA 5ICZB 4QRPB 2ADFH 3D0VB 2NZ9C 5DD1H 5B3NA 1UWEL 1H3VA 4TUUA 1JHLH 1YECL 2G75A 1QVOA 5D7JB 3CFJB 5IB3B 3W2DH 1YC8A 1MY5A 4WK0B 3FCTA 4LVOB 1GJWA 4P3CL 4J28A 1OXYA 35C8L 1A65A 1JV2A 4ZW5A 1TSHA 4XNBA 5C09A 5CKGA 4EIBA 5GZOD 3B9KC 4H8WH 5CLXA 2VZ3A 2EO9A 3NQKA 4MQXC 1RZ8A 4XBGB 5E8OA 2YFNA 4ZFOA 4KI5C 2D4FA 4PGEA 2PW1A 1ZLUH 2P44B 4PRHA 4DK6A 3GI8H 4HXBL 5A2CA 3HKZA 5L0QB 5EOTB 3WNJA 2MHAA 2JCWA 4YEEA 5D6DA 4BJLA 1R24A 4CBPA 4YBLC 5JW4R 4A2EA 1HYRC 4RGOH 4DVRH 5C0JA 2GKIA 3K72B 1VAHA 1T1ZB 4XXCA 4YWGL 5DJZB 4G5AA 4MNGB 4ODSL 3UZVA 3HZKB 4CKQA 3SKMB 3E3QE 5IT2H 3CZGA 2W0FB 2K6ZA 1JPFB 3L4TA 5DWUL 1XBRA 3GJFA 1TXKA 4HU8A 3K6DA 3S88L 1SYVB 1NCTA 2GT9B 5I8KH 3BN9D 1NLBH 4MJID 3D18B 4H20L 2MCPH 3ILDA 1D5BA 1E6JL 2SEBB 1RU9L 4A2GA 2F5AL 5TQ2H 1GZQB 3IF1A 3FULA 1TTUA 1DQDH 4MMYA 4GG8B 4GS7C 1QSFA 2JK5A 2WVVB 3LNFA 1DHKA 4CUCA 3ZTNL 4V2BA 2VH5H 4PJ5B 4G6KL 2Y5EA 5LGHH 4G6AD 3QUMA 4D9QE 1P1ZA 1KEGL 1BYNA 3WXWL 1GZHC 1XD1A 2ZJSH 1JPGB 2F5BL 3AU1A 2OSWA 3W38A 2F61A 2KPWA