3HC3H

Bha10 igg1 fab double mutant variant - antibody directed at human ltbr
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
217
structure length
212
Chain Sequence
QVQLVQSGAEVKKPGESVKVSCKASGYTFTTYYLHWVRQAPGQGLEWMGWIYPGNVHAQYNEKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARSWEGFPYWGQGTTVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN
publication title Structural understanding of stabilization patterns in engineered bispecific Ig-like antibody molecules
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 41
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2009-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hc3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hc3H01
3MLRL 3GSNB 2QSQA 5TQ0L 1KJMA 1KPVA 3UPCA 5DMYA 5I66B 4GG8B 3O0RL 4FFVC 1DUYA 5IEHB 4PJ7B 5C7XH 1R24B 4UIKH 5HY9B 4WTWA 5IFHH 1KULA 3JUZA 8FABB 3SJVB 3FO9A 3Q48A 3ULVH 4PP1D 2GTZA 1J7VR 3X17A 1HILA 5E2WH 5HXMA 2RR3A 4M1CD 1QBMH 2F8XC 4BUHA 5I2IA 1BJ8A 5CD3B 3WSQH 1JHKL 2AKRA 3KLAB 4KUCF 4LQ1A 1H8OA 3MRPA 2ARJB 4UTAL 2HT3D 1QFWH 2ZUQC 5HDBE 4X7TB 3CSYB 4PRNB 3FN3A 4KV5F 4ZUTB 5CEXA 3QUYD 1BJ1H 1JIBA 2FWOA 1RV6X 5I1KH 3EFFA 5IBTL 4L4VE 3SDAC 4HGWA 1RZFL 1JRHH 1CS6A 4X98B 3FB7B 3VWKB 5D9SB 2PXYC 3QIWD 1TFHA 1WBXA 3PWVA 5J9PA 1MCOH 4JFPB 3GHEH 3QDGA 3NAAL 4NQCB 1V3MA 2LFGA 5D7SL 1N8ZB 1S9XB 5H37G 3T0WA 1C16A 3L7EA 2H41A 3MRFB 3TNNA 5DWUH 4F58L 5E9DA 1CD9B 4ZSOB 3CPLA 2LVEA 4HUXB 1P9MA 1P2CA 4KHTH 5JW4R 5TQ0H 1X5AA 2D7OA 4WI2A 4N90D 3WMSA 3V6OA 2BNQD 2LVCA 3FJTA 3FQRA 2NXZD 1R3KA 1FCCA 4Y5XB 4JKLA 2NW3A 4LLQB 4AM0A 1BLNA 1A1OA 3LD8B 4WO4C 2OJEA 1CXKA 5DEGB 1FO0L 2O5ZL 2LTQB 4CU7A 5JOFB 3P73A 5ADOL 4CN6A 1A9EA 4QTHB 1GC1L 4GRLA 1A21A 5K33A 4JO4H 5DJXB 1I7UB 4UIMA 5HHXH 4ELMB 1UC6A 5D96B 1FJ1A 4XVTL 1BOGB 1KNOA 3MV11 1UG9A 5EIVA 4PGEA 1JCKA 1JI2A 3S5LA 2EDFA 4UTAH 1WTGT 5I66A 3CCHA 3OKEA 4JFFB 5C09A 1CU4H 2I5YL 5I15L 1INEH 3D2UD 2OTWB 5HY9A 8FABA 4UOJA 1WBZB 3ARDD 3MGTB 2VZUA 1HWGB 3PIQB 4K23L 3TVMD 5GRXG 4J3XA 4JFDA 5EBMB 2J88H 4LPVA 3P4NA 5E2VH 4G6JH 4LVOB 5I8EA 3ARGC 5CD3A 1K4DB 4HJJH 1I1CA 4F37K 2X4PB 1N59B 2OP4L 3OAZK 2MFNA 2NY4B 2FX9L 5DLML 4EOWH 2HN7B 2LU7A 2APFA 5H8DA 3QUZA 4LMQE 3HC0B 5T3ZD 5AD0A 3CSYA 4JO3H 4M93B 1J8KA 2P47B 5D7IB 5KVGH 3BPOB 4M1GL 6FABL 4HXAH 4FTVE 3ARXA 4JDVA 4X98A 4YBLB 1I3GL 3VWKA 2GJJA 3AXLB 4M5YH 1MJUH 1A3QA 3HI6H 1LO2L 3VRJA 3FRPG 4LGPB 5FOBB 3PWLB 3MNVB 4JFPA 4N8VG 1P84K 1FO0H 4Z7QF 3ZMRA 1FYTD 3UP1A 3UTSA 1N8ZA 1RD6A 4KJWD 4N0YH 2ADIA 1U3JA 4MAYB 3MRFA 3BP7B 5I1HH 4ZAKD 1LHZA 3BHBB 4LAQH 1OSPH 4ZXBB 4OZIE 5LCVH 3L3OB 4YNYB 3RL2A 4HLJA 2G75B 4M6NL 4QTIL 1F3DH 3W2DL 1E28A 5JW4M 2EDTA 5C6PB 3TT1H 1RUAL 2VDPL 4Y5XA 2IAMD 1C8PA 4LLQA 2D3VA 5JIHA 3MV7A 4ODTL 4ORGB 4RCAA 1HEZA 5C0ND 2B4CL 4PS4L 1GSMA 4HKBB 5JOFA 1UZ6E 1BVZA 2WP3T 4DJMA 4A6YH 2V5MA 4MDIB 2A9MH 5DJXA 3LQZA 3TT3L 4XNYL 5HSFA 3MUGB 4X5LA 4PJEA 4L4VB 4NC0B 4FQJH 3KPSA 4W6XB 3QPQD 3MRNA 3N06B 4HDIB 4PLJC 4A6YA 2N1KA 5AYUL 3HNTL 1E6JH 3BKJL 1DQQB 4OLUL 2MHAB 5D7JC 5I18H 2PCPB 4GSDH 3X12A 4O51A 2OTWA 1PBYA 3U1SH 4M1GH 6FABH 3VE0B 2XQBH 3W5MA 2J8UE 1WBZA 3MGTA 3RWDB 3PIQA 3DVFA 2DLIA 1C5CH 1P6AB 2W9DL 5ERWA 4E42B 5EBMA 2MWCA 1LO2H 4BFEA 3N1QC 1ROWA 4QXGH 3BKCL 4QXUL 1D6EA 1DBAL 4JO1H 4N8CL 5BVJB 4CL7A 3RJQB 2HTKC 1UJ3B 1WZ1L 3QH3B 5T1MA 2X4PA 4HMCA 4EN3D 5DURB 3DSFH 4HUUB 1ZGLA 4Q9CA 2UWEE 1KPRB 5GS0D 3T77B 1KEGL 5MEQB 3FB8B 1N5YL 3O6FC 4FZ8H 1NAKH 1EAJA 4XCYA 4M6NH 4LCUB 1NGPH 2AVGA 5EU4A 2V5SA 5EWIL 3ROLA 1DQLH 1AGBB 5ISZD 5CINL 2JB5L 1MRCH 3TBTA 2X1XR 3G6AA 3AXLA 4Z76A 4JY6B 1QFHA 4NN7C 2X89D 2DMCA 3R8BB 1XGPB 3VXUA 1H3VA 4PRAB 3EO9H 1YEIL 4H25A 1YEFL 4MS8D 3WJJA 3F58L 2B4CH 4C54A 2WQRA 4GOSA 4EI6B 4CVWA 1NFKA 4CVZB 5A1AA 3KPRA 4NZDA 4R6UA 2WMPA 3MZTA 3BHBA 3SKJH 3UDWC 2AV7B 1TLKA 1JYXA 3O41A 1FNGA 2BVQB 3L3OA 4YNYA 4N90E 5CIPH 2G75A 2BNQE 3HI1A 4EDXA 1G7QB 5E8OB 4ZFZA 4I18B 3C5ZC 4FG6D 5F3BB 1RZGB 4LCIL 4OLUH 5GZOD 3B2UC 1LQSR 4WW2A 2FBJH 1WCQA 2FECL 3QO0B 4MGXA 4JREB 4ORGA 4HKZB 4Y2DA 2YXFA 5IHZB 5BV7C 3S3PA 2W9DH 1F2QA 4R97B 3RKDC 5FHBH 2R2EB 4QXUH 2NY1D 4BH7A 3EFDL 4F9PC 3NTCL 4Z18A 4FTVB 1BZ9B 2CLRA 4PJ8B 3ECBA 4G8EA 4IRZL 3D3VD 4S2SB 4DVBA 2R4SH 5J3HC 3HAEG 2KZWA 2KQMA 4GBXB 1T1ZB 3QI9B 5EIQA 4L3CB 1JZ6A 4OIIH 1DEEB 3DPBA 4HPOL 3TO2B 5J13C 1RFDH 1AJ7L 1OTUD 1T1YB 4I1NB 4NNYB 1I7ZB 1UKQA 4OZIB 5DK0B 2H9GA 1FDLH 4G7YL 5BVJA 4BFIB 1UJ3A 1EH9A 1RVFL 1OP9A 3W11C 4CW1A 2Q20A 3GRWL 1DQML 2R4RL 3ARBC 3W9EB 4Z7VA 3ARZA 3I6KB 3MGAA 1YPZF 1LDPH 1YEGL 3EOAB 4YHYB 5GGUB 4DGYL 1EAPB 5T3ZE 2L4OA 1A6UH 3FO0L 1IGMH 3QFJD 1TVHA 2XZAL 1WAAA 4LCUA 1X5FA 1AGBA 1GOFA 4XWGH 5K9QI 2EH8L 3A6BH 1DN0A 4FFWC 4YPGA 3KPLB 1NUGA 1WICA 2IBBA 1HKFA 3BKMH 3ARSA 1FYTE 5I6XB 3HHRB 4NIKB 4MQ7B 2P8LB 2DKSA 1J11A 4QEGA 5C08D 4PY8I 3RWHB 1XGUB 1BJMA 2J8UB 5FDWB 5EOQL 4CMMA 1OM3H 2OZ4H 2K7PA 3OR7B 5FUZH 3HPJB 4AG4H 1OLLA 2A6KA 2V7NB 4KVCL 4ISVA 1N4XH 5FKPB 5KS9F 2JK5A 4U1NA 2OR7A 3BESR 4B7LA 2BXZA 5DD3L 1HYSC 5DMIL 2FD6H 4YHZL 3HZMB 2OZ4A 3VFNA 3MJ7B 1NDMA 2UWEB 3MRHB 4QY8A 4LDOB 2HG5B 3OG4B 2FO1A 2R2EA 3QUYB 2F19H 4G7YH 2ED9A 3EJYD 3RUGF 3ZT7A 1CG9A 3HG1E 5C0IB 1P9MC 2ZUXA 3GRWH 3HCVB 3STBA 2EZ0D 3QUML 1UKSA 4JRXD 3OAUL 3RHWK 5ABDE 3QIWB 4IRSC 4NO3B 2QHRH 3WFEL 2VZVA 4P4KD 3V6OC 4GAYB 1W0VA 5J6GA 1RZJL 2EC8A 3UEZA 4D3CL 1T1ZA 5DT1H 4M61B 4FFYH 1FNFA 1AI1L 4QOKD 1DEEA 1NUFA 2ITCA 4LHQB 5JPNB 5T3XH 1UZ8A 3GSVA 1INQA 3P77B 4H0IA 1ZWIB 2Q7YA 2VITB 3G5VB 3H42H 4GRLC 4C59B 4ONGL 1RZ7H 1EA9C 2BNQB 1QUNA 1T7ZA 2NW2B 1BQLL 2NXZB 1VFBB 3JWOL 1QTYT 5MERA 1ZHLB 2NQCA 3DETD 2GI7A 1ND0B 5IVXE 3F7RA 3HUJF 1EO5A 4I77H 3V7AG 4WTZA 4X6DE 1YNTB 4P57B 1TJIH 1ZHKB 1M7XA 4HIJA 7CGTA 2XG4A 5ISZE 1F45A 2JIXA 5EU7E 2OK0H 2AJUH 4OCXL 3RDTD 3NH7L 3QO1A 4Y4KD 2QQKL 4QRQB 5SX4I 1JPTL 4LLWB 3DWTA 4I4WA 4W4NA 1G9NL 3MFFB 2Y5EA 4MQ7A 3QUKA 1U2HA 3TLRA 5D5ME 3U79A 4XP9L 5DMGD 2ZPKH 3D2UB 5KOMC 3A6CH 3VFGL 5D71L 1BBDH 1CLYL 3QUMH 3BDYL 3TVMB 3OR7A 3LQAL 3MRBB 2V7NA 3NCJH 4RWHA 4D3CH 2BY0A 4DCQA 1UA6L 3VWKC 5JW4Q 3KYNB 4JANA 5IMOA 1YY8A 3GBLA 1QLFA 4YC2C 5HDQH 3O3EB 3IDNB 3LKQB 2VLKE 3ARFA 3LKOA 3LMJL 4OCNC 3R06B 2IADA 3AM8A 4WI7A 1GZPA 3QNYB 1Y18B 3EYUH 5D8JH 3LIZH 3TIEB 4E0RB 3DYOA 1Q9LB 2JKXA 5IG7B 1RUPH 4PYHA 4M4PA 1AO7E 5T1DL 5B39B 2QADC 3FQWA 4XBGA 1BQLH 4EIZC 1I7TB 3HCVA 3CK0L 4ZFFA 2B1HL 4NWTL 1XR9A 1KPUB 3D3VE 3SE8H 3OHXB 4NNPL 1AKJD 4NFBA 1FNAA 1CR9L 1HZHH 4NZUL 4JG0L 1R0AL 4JM4L 1FYTB 3H3PH 5DJ8B 5CSGA 5D1QD 3LHPH 4Y5XC 5F96H 1BIHA 4PREB 3LD8C 4P3CL 4ZAKB 3RPIA 3WHXB 4XCEB 3NH7H 2LTQC 2EDNA 4HS6B 4X6CE 2QQKH 4JQIL 1JPTH 4G43B 3BWAB 4J8RB 2ITDA 2IQAB 4AK1A 3U7AA 2AGJH 1UQSA 1MRDH 3I9GL 2E3VA 1KEML 1FH5L 3RRQA 4ZFOL 2NW2A 4U6YB 3LRSA 3KJ6L 3MCG1 2MSPA 1N6VA 4XMLL 1T66D 5C0GB 1ND0A 1U3HD 4NCC1 5EZJB 2P5WA 1VADB 4Z7NF 3BDYH 2FHCA 3QFJE 3TO4B 3BSZL 4ZG1A 1FAIH 3N85L 5F89A 1ZHKA 4XB7A 1T20A 5DD5H 3GI9L 4NSKB 4UV7H 2H8PB 3HG1B 4F7PB 4OSUL 1NMCB 3C8DA 2A0LC 3MV01 4QRQA 5ACLA 3B9VA 1ES0B 1UFUA 2IWGA 4NDMA 4QHLA 4JCLA 5KANI 4LVOC 1A7NH 2OL3B 5KSAD 5BJTB 3IJHA 1BQHA 1OAUH 4TNVK 5J1SC 1JGDA 3DO3A 4TUOB 4XPHH 5ICYA 3HB3C 3AY4A 4YHPA 5C08E 4AH2B 1YMHB 4JJ5B 2BVYA 1F8TL 1MJ7H 1S7SA 4EJ1C 3VG9B 3DVNB 1A6WH 5GGSB 5TE6H 3T4YB 3SDDA 4V1DD 1C08B 4GXVL 5C07A 2NY2D 2DMKA 1SY6H 3LRHA 4K94L 4MNQD 1T4KB 2ZG3A 4JG0H 1Z0MA 3DBXA 4RQQB 2VKWA 5HGBB 1C12B 4EN3B 2N56A 3DRQB 1JK8A 4LHUD 5IVXB 1K4CA 5E8NB 1II4E 2HFFB 3WJJC 2VL4A 3R06A 3TBVB 2X05A 1PQZB 3L5XH 4JQIH 4WFGE 1IFHL 3TIEA 3LEYH 4X6DB 4EQ3A 1KTDB 3JBG7 1CXIA 3KPOB 2XKSA 3I9GH 1FLRL 3CFCL 4ZXBC 5ISZB 4XMLH 2YA0A 3DV4B 3MYZA 5C0EB 4OIBA 4JRXE 1T2QH 2N7BA 3QT2A 4JE4B 2EDHA 2E6JA 2FEEL 2X1WL 4LRIA 2OM5A 1BIIA 4WW2C 5DJ8A 3N85H 5D5MB 2F5AL 3SBWA 4FXKA 4QOKE 4EEEA 1T6VN 4Y2DC 1OOAA 2YPKB 2V9QA 1EVTC 3CMOL 4OI9A 4RBPK 4OGAC 4G43A 3BWAA 2EYSB 2IQAA 3S96A 5IF0B 3WXWL 4DW2H 2IPTH 3FZUD 4H8WH 2W9EL 2NY0B 5JR1L 3MA9L 2DQIL 1YY9C 4KMTL 3H9SD 4GAFB 4X8JB 5EZJA 15C8H 1WV7T 1TQBB 5IKCA 1KG0B 3DYMA 3L3JA 2VLKB 3TO4A 2ZSWA 2R2HB 1ZGLP 1SJHA 2NY1B 2P8MB 5HYSB 4OZ4B 3SCMD 1I8LA 5BW7A 1AO7B 1MCWM 2H8PA 3HG1A 2WIMA 5DQDL 3P9LB 1EMTL 3QQ9C 4M8QA 4JQXA 3CSPA 5EU6A 3D3VB 4OKVB 4X9FA 2OL3A 2E6PA 4NC2B 1UJ3C 5BJTA 3VXRD 3RTQD 4AQ1B 4QHKI 2R1WA 4POUB 2DQJH 4UNTA 3WLWD 4OV5A 1I3RA 4HF5L 1IGJB 2WIIB 1FLRH 4J3VA 2W60B 1U6AH 4LKCB 3CFCH 1MCLA 2LQRA 1I8IB 1OTSC 1E4XI 3DVNA 5GGSA 4X6CB 2C9AA 1C08A 3BI9X 3SOBL 1EFXD 2PTTA 3BIAX 1MRFL 3LS5H 4RQQA 1R3HB 2Q8BL 4X9HA 1C12A 1MI5A 1ZMYA 3F6LA 4WWKA 5DK2B 5I1EL 2R0WL 3MODH 5DRWA 2F15A 2DQDL 1MIEL 4U1KB 1N5AA 1ZA6B 2V17H 3TBVA 4N1CA 4ALAL 3QFJB 1X7QA 1OTTD 3PXHA 4WHYG 3FB6A 3I50L 4OD1H 1G84A 4M6MH 5ISZA 2HH0H 3MA9H 4X6BA 1NBZA 3DV4A 4JGMA 5ACZB 5C0EA 1U91A 4YDVA 1JGVH 3EHBD 4HQQL 4ZTOL 3N50A 4KGLA 2DLHA 1DANT 3NZHL 3E0GA 4LSPL 4UB0H 3QCTL 4JREC 5C08B 1N64H 3GUTA 2VDNL 1AXSB 4G9FD 4OJFL 5DJ2B 5DQDH 5JW3H 1JTTA 3P9MB 4G8IB 2UVFA 2YBRA 4XP5H 3AS3A 2YOCA 5GRZA 3WLBA 2F58H 1J0JA 5DC9B 3MYJB 4HIXH 2HMIC 4PJ8C 1IGFH 4LK4A 1UYWL 4FQ1L 4K3HA 1UVQB 1U8MB 3ARED 1KG0A 2F8OA 1YEHL 2M26A 3HNSH 4L8SB 4IIQA 2VLKA 2G2RB 4GBXC 1DCLA 1MREL 1SVCP 1ZT1A 4HLZG 3EYVB 1W72L 2FGWH 4OZ4A 5I1AA 3WFBH 1AO7A 3UTZB 5A3ID 5C0DA 2NYYC 5JORB 3P9LA 1WZMA 4W81A 2PR4H 3FCTA 2FLBT 3HC4H 4JRXB 4LF3A 3RWEB 3P4OB 2C3GA 1G7MB 5FYKL 3T3ME 3CDCA 2DQDH 4P4KB 4K7FB 1C7SA 2YSSA 4ELMF 5DRNB 3IDIA 4PJEF 4D0CA 2CH8A 3I50H 4QOKB 2R8SL 2Z4QB 1DTUA 3ALPA 1MEXH 5L2JB 5F9WB 3RAJL 5E99L 3GJFH 4PYGA 3ZKNC 3L9RA 4XPGH 5B38B 3H7BB 1RAMA 3WFZA 2AP2A 4V1DE 4Y4FD 1ZOXA 3TEUA 4MNQE 3PNWB 3BGFB 5ADPL 2H32B 3NZHH 5IOPB 1WFUA 5EO9A 3OKDA 4NO0D 1T2JA 5C6TL 5CFHA 1J10A 1SYVA 2IGFL 3GJFA 1JYWA 5DK2A 1L7IL 3KDMB 2RBLA 4ODUB 4Q9QH 5E6ID 5J57B 1JPFA 5SWQA 1NDGB 2AJYL 5EBWB 2VAJA 3ELAT 1JWSA 3IGAB 1TVBB 4PRBB 4KKAC 5DJ6A 5ACZA 3RDTB 5MEPA 3LN5B 4AYFA 2D31A 3OR6B 4Y4KB 4FQ1H 1MFBH 4NHUA 5D7IF 5EUOE 2FL5A 1F6AA 5CEZL 2EYRB 5K9OA 3S9DB 1OARL 5F8RC 3JTTB 2APBA 3OGCB 3MRRA 1W72H 2BHZA 3FO2A 3O6MH 4IEFB 5D6CA 3G08A 3SE9L 3T3PF 3ARFC 5DJ2A 3AM8C 4U1IA 3CGTA 2OJZL 3IXAB 1HINH 4PBWD 2EDXA 5F1NA 1RZ8B 5TPWH 1UB5B 2F54D 2VKXA 2WAHA 1BZ7A 3VXSD 2GQHA 1N6QL 43C9A 4UT7L 3OAYK 1ZLWK 1FE8L 4NQXB 4ZQKB 3K46A 3RAJH 3OG6B 5E1HB 4L8SA 4P5TD 4Q0XL 5T5FL 2QSTA 3E1F1 1X5ZA 4LIQL 5C0BD 2VQUA 4WW2F 4JGJA 4QRUB 3U4EB 3HE7D 3VXOB 2IJ0C 3EDFA 5JORA 4RA0C 3CFKB 5C6TH 3KR3H 3LH2H 3P4OA 1AKJB 4J1UB 3ZTJG 3CU1A 3VXRE 3ZHKA 4LARL 4Z8FH 2CRIA 1T04B 5DJDA 4HFWB 5GHWH 2APVA 4NT6B 2AJYH 1JHTB 5D1QB 2YN5A 3KS0J 4QT5B 1P1ZB 35C8L 1W0WB 1ZVSB 2AXGA 5L2JA 5FUOL 4U7MA 4MJIE 1FQ9C 1RIVH 2B1AH 3H7BA 1A1MB 4QHUB 5E5UB 3TM6A 5C8JA 2E7CA 4OCRL 3O2VL 1K5NA 4M9OA 5C0RL 4HG4J 5GSVB 4HCRH 5IW3A 3PNWA 5B8CB 1OARH 1Q0YL 1I9RH 1NJ9A 5C0CE 5IOPA 4HT1H 4PJFA 2PTVA 3OJ2C 2VJXA 4KTDL 5FA3A 3L5HA 1EJOL 4G6ML 2K1MA 2Z92B 1U3HB 5MEOA 3KDMA 4P59H 2OJZH 3P30L 4ZS7L 4HCRA 1C1EL 2ZG1A 4ZS6D 4PG9B 3AY4C 1CGWA 2ZNWA 1NBQA 4YBHA 3DX7A 3QEGL 5DK3A 4Z7VF 1B2WH 2WV3A 3S98A 3U36B 3BUTA 5FCUL 5IT2H 5HGDB 3REVA 5KVEL 4HD9A 1I9IH 4IOFD 3LN5A 3F62A 3SDDC 4NJ9L 1YEKH 4M48H 1FC1A 3L3DA 4U1HA 1FPTH 2EYRA 1WAAF 4ENED 2WBJD 4AQOA 2LU4A 3B2VH 4G42B 4RAVB 4LIQH 4Y4HA 2Q6WB 1QKZL 2V2XA 3NCYS 4MA8H 1JZ4A 5IIEB 1KN4H 3L3IA 2QV2A 3QXDB 1JF6A 4G9FE 2ED8A 3CMGA 3HMXL 3LS4H 4P2QD 4WUKH 1EPFA 2MPAH 4OF7A 3KHQA 5I0ZA 1AD9B 3STLA 4J12A 1CFTB 1J86A 3O2DL 4V1DB 4OFYD 2NY5C 1U41A 2NY2B 4GUPA 4R0LB 3KWWB 4MNQB 1RUQL 4BKLA 1RSFA 4NQXA 1AD0A 2E7HA 2YUVA 1KB9J 4HW6A 5ALBL 1IKFL 4LPYA 4LHUB 4MD4A 3M1BB 5FUOH 3CH1A 5L7XL 4WEBL 4LRIC 4KJWC 4OCRH 4ZFGL 3SBWC 4NM8L 5E2TH 3WUWG 4D8PB 4QHKJ 1E27B 4ZAKC 2FR4A 4KJPD 1HHGB 4XAKD 3VXOA 3CFKA 5F7KC 5GGQL 2X4UA 2HJLB 3HTLX 1YUHA 4K8RL 4MJ2A 1AKJA 2BVTA 3D6GA 2EEBA 5EUOB 4LGSB 1G7IB 5J1TC 4HFWA 3UYRL 4NT6A 1Q94B 5HYQB 1LK2A 4QT5A 1ZVSA 4OBRA 2NX5D 4JN2B 5D7LA 3LKNA 4LRNL 3TO4C 1CFNA 1QFUL 1NQBA 1Z9MA 4GQ9L 4OCSH 1XF5B 4HH8A 5DUMH 1I8LC 3TBSA 5BW7C 1ED3A 2I24N 4M43L 3U6RB 2EKJA 3IT8D 1U58B 2L7JA 1ZLVK 1U8HB 1NMCC 2A83A 5ITBL 2OXGA 2R2BB 5K59E 4ONHA 4OZIF 2P8PA 1HQ4A 2HFEB 2VDOL 3SDCA 1KIQB 4H88H 1ONQB 1AQDB 3RIFK 4F80A 1TZGH 1P4IL 2APTA 2A73B 2VSCA 1MHPL 5FO9A 3T08A 3SCMB 1AHWB 3BXNB 3PWJA 1ZLUH 1RUQH 4KK5C 4CADB 3PL6A 4JKKA 4U1JB 3ZKQD 1IKFH 1K8DB 4L8DA 4GKZA 3BO8A 4NZRL 2GJZB 1UZ6F 1R5IB 1EBAA 4LSUL 3RTQB 3WIHL 5L6YH 4S0TD 3V5HA 1V8HA 4WWKC 1DLHB 4ZOEA 2VDLH 1RI8A 4O02L 4IMLA 3NFSL 4H26A 4MJIB 5CGYC 4Z95H 1GXEA 4X7FC 1KTLB 3QZWB 1JZ2A 2F54E 5JNYA 4PJBE 1QG3A 1EFXB 5E24E 1IAIL 3VFOB 3VXSE 2BVPB 3KWWA 3OQ3B 3MNZA 2Q3ZA 2C5DC 5C0CB 5I1GH 2GSGB 1F6LL 2J8UF 1MFEL 4W68A 1KCUH 3T4AB 3VXTA 1QFUH 4KRMB 5CJOL 5C0BE 3MNWA 4ZTPH 4NRXB 4F15C 1E27A 4BYHA 3PGDB 2LV4A 3ABZA 3SE4A 3WL9B 4HUKB 5LVEA 1T0MA 3GM8A 1BWWA 4JZJA 2FSEA 2HJLA 4R4BB 4QXTB 4KJQD 4FXGB 5EUOA 5C0AB 4MSWB 2JB6B 2NY0C 5I17B 4O4YL 1KFAH 1UACH 4Y16B 3WJLA 5IW6B 3MRCA 1A7PL 4S0SD 5GGRY 4G9FB 3CZJA 3H6JA 3OXSB 2P5EE 4IIQC 4HHAB 2SEBA 4JN2A 2VLRA 3B9EA 1X3DA 1YEDA 2P45B 1OPGL 2VWEE 1OQOA 2NY1C 1XF5A 2BSED 4UINL 4P49A 3DTXB 4BFGA 5ICZA 4OD2B 5J6HA 5LAXB 1QVOB 3U6RA 1JGLL 4NZJA 4DEPC 1GPOH 4MNHB 4EI5D 25C8H 1XF4A 3AREB 4U1GB 2VUYA 1MAML 2W38A 5GJTL 4PRDB 3ZE2E 2V7HA 4HUVA 1ZTXH 1RZKL 3UPAA 4DVRL 3RVWD 1FRGH 5AG8A 1XH3B 4UAOB 3UBXG 2XWJA 1OTUC 4NYLB 2C1PB 2CLZB 4HKJA 4YEFA 4U1JA 4HEME 4YXLL 4LQFL 3ME0A 1NCAL 5ELIA 4JO2L 1WBYB 4WDIB 4WY7L 5IB5A 2FDBP 3EYFA 3MLZL 3KNBB 1U8JB 5FGBC 3RTQA 3QIUA 4JKPH 1WWCA 5BZDA 4U33A 2GFBA 3QWOB 4P2QE 5IROA 1T03L 4MJIA 3HR5B 4NJAH 1KTLA 3QZWA 4Y4FB 4RFOL 1N0XL 1NL0L 4I48B 5TE7L 5KW9L 1KCVL 2BVPA 3VFRA 1E4WH 5C0CA 2GSGA 4NO0B 3EOBB 5CJQH 2AJSH 3NFPA 3HZVB 4QRTB 4HWZB 5E08H 1BQSA 4JFOB 2BP3A 4GFTB 2F5BH 5E6IB 5FAAA 5L9DL 4AIXA 2D03L 1KIRB 2DQCH 5CLWA 1BREA 3PWUB 3FMGL 2AAVA 1PDKA 3VRLE 3VD9A 4HJ0D 3LB6D 4XAKE 1SJEA 4PUBL 4YDKL 3THML 1EGJH 3SKOB 4XXCA 1Q0XH 2AXFB 4QRPD 1S7TB 3DXAD 1U8LA 4QXTA 1U8NB 1UWEH 3OX8B 5IHUH 2IQ9L 3SPVA 3X13B 2ICWB 2E7BA 3CVHH 4NQED 5C0AA 3IXTB 5GJTH 4UV4H 4ZUUB 4YDLB 3WFHA 4Y16A 2E8YA 1ACZA 4L8SC 4HHAA 2R1YB 4YX2H 3CVHA 4YXLH 4G6KL 5IESL 4J6RH 1MY5A 3RY5A 2F54B 4PJBB 4LVHC 1HHKB 1IBGL 1P4BH 2DQEL 3ARTA 5LAXA 1SBSL 3VXSB 1MCWW 3CSBA 4XCFL 2Z93A 2J12B 5DYOB 4OGYL 2R9HD 2D2OA 3K81A 4M6AA 4LLMB 4CBPA 4DKFH 4WFED 4F7MA 5F8QC 2DKUA 4O2FB 3RIAK 1T03H 4P5TB 1O5DT 2RB8A 1KGCD 1JTPA 1J1PL 5FO7B 1GHFH 4HWBL 5BVPL 1L6ZA 3W0WD 2DYPA 5C0BB 4XGZB 5KW9H 3G5XA 3QQ4B 1VGKB 3V4PL 3ULUE 4OLVH 1NGWB 1CD1B 3MXWL 5F9WC 1NCCH 3FN0H 2CLZA 1AGEB 1KB5L 3RWIB 4LL9A 1G6RH 3L3HA 1IM3B 1WBYA 2EE3A 4LKXA 3BGFC 1NFDE 1VFAB 3W9DB 2WNGA 5DZOA 5CP3A 2HLAA 4QYOA 4OQTL 3EGSB 3TJHC 3FMGH 3BP6A 4OF0A 1G6RA 3VGAC 4YDKH 4PUBH 5CCKL 1S7XB 4TULH 2DL2A 3Q1SH 1F5WA 4OQ1A 4X7EC 3V6BR 2P5EB 2GJ6D 3QHZL 5FYJH 4ERSL 4Y4FA 4YDJA 1BWMA 1NCDL 5J4MA 5ESVA 4KJYA 3L5IA 1FN4A 4PGBB 3RDTC 1AY1L 3GO1L 2ORBL 5INDB 1NMBL 5EIIA 2DQTH 4OFDA 3N1FC 1X5KA 4HWZA 4YHKH 4ODVH 1Z5LB 3LSOB 3FFCD 3V6FB 5IFJA 4CNIB 1ZSDA 3L6FA 5F21B 5IGXL 1FGVL 4P2OA 1S9WB 4Y4HC 3KPQA 1BJ1J 2CR3A 3PWUA 1IBGH 2DQEH 3GSOB 3HI5L 1I8KA 1GZQB 2AXFA 5F1IA 3MREB 3GBNL 1IEAB 4MB5A 3VXME 1L6XA 4MA7L 3TIDB 3X13A 1REIA 5B21A 1QSEA 3IXTA 5DJZA 3AAZA 4OLEA 4P4RB 3MLTB 4HWBH 3SE3A 4TVPH 1EV2E 2HA1A 2X4RB 2Z31A 3GIZL 5L8KB 4QGYA 3U7YL 5JHDD 5FYKD 4R26L 3N9GL 1MPAL 2R1YA 1T89A 4B53A 3MRQB 3IDGB 2XTLA 3OZ9L 5KTEH 1CVRA 1I1AA 2NTFB 4RFNB 5ACMA 3U82B 1PX3A 3KLHC 1SEBB 4XAWH 2FB4L 2OSLB 4LPTA 2BDNL 3VXSA 1U8OB 2VDKL 2FHFA 2XWTB 1VFMA 1MLBA 3H9YA 4N5ED 4LLMA 3E2HB 1YN7B 4RGND 4O2FA 1X9QA 5I73C 5CEYB 5LWYH 1ULVA 1CXLA 5EULV 2Y7QB 3O6LL 3IB4A 5D1QC 3B5TA 3JV4B 2I9LA 3QQ3B 1VGKA 4FXLA 1HKLL 2VXVL 3FOLA 3G9VA 5F3HB 1TNNA 1AY1H 3GO1H 1CGSL 4WUUD 2FIRT 1JN6B 4DZ8B 1EEZB 2DD8L 3FFDA 1MWAH 4XP6L 1NLBL 2ZUUA 1SEQL 3MUZ1 2ZG2A 1EZVY 1FGVH 2OBGA 5JOPD 2C1OB 1U3HC 4GW5A 4XBPA 1RIHH 4DWHA 4Q97A 4KROD 1S7XA 3TN0D 1MWAA 3SDCC 1JZ8A 1QHOA 5CEZD 3F12B 2P5EA 3L5JA 3MGOB 3GBNH 4M8VA 2XPGA 3RBGA 3OKOB 3RNQA 1YNKL 1X6NA 3CFBA 3VGGA 4KRPC 4NKIH 5K9KB 2J3SA 4FP8H 4KI5C 3PL6C 4DN4H 4GKNB 3GIZH 4R26H 3V6FA 4OT1L 2HFGH 3TFKD 1LWRA 3P4MB 1KJ3H 5GRUH 2VXTL 1S9WA 3C9NB 1DSFH 3BEVA 5D1ZA 4OI7A 3GSOA 3F7PC 2KBGA 4EQ2A 3HA0A 4QRPE 1FZKB 3PQYA 3VFMB 3DXAE 3PV7A 1IEAA 4YQXL 5I8KH 4R7DB 3MUJA 4NQEE 2NY2C 1OW0C 4R0LC 3NABL 4XMKH 3GMLB 3UAJD 4P4RA 1NFDB 4HC1H 4OZGA 1X5HA 1WC7B 2H2SC 3BVNB 2X4RA 2EDBA 3Q0HA 2VXVH 3SKMA 4ODSH 1JBJA 3D87B 3IDXL 3QISA 5D2LA 2CKNA 1M1SA 4G8GA 1QHPA 3MRGB 4HC1A 3I3EA 3SE4C 1H9VA 5EA0H 4KK6D 2EDYA 1VDGA 4G7VH 4APQB 5F1SA 4M7JH 3P0VH 4WI6A 5HPMB 2D9QB 4C4KO 5CEYA 1T1WB 3GI8L 3WKML 1FL5B 4Y5VB 3HC3L 4TVSa 4Q58C 2CIKA 1DVFD 5FGRA 2IBGA 3IAQA 4A2LA 3WJLC 3MCLL 4MLSA 4QHMB 1XMWA 4WENB 4ZOBA 3WS6A 5E8DH 3OSKA 1U3ZA 4D94A 1EEZA 3L3KB 4ZPVB 4LCCB 3IJSB 3VXMB 2X09A 1H3XA 4HIHA 4ODHH 4BZ2H 1H3UA 1S7WA 2XFXA 3IDJB 3T1WA 1L4IA 3NCFB 5H37H 2UZYB 4X5XB 1QBAA 5CWSA 4CGTA 5AAMA 1A6TB 4U6TA 1GGBH 2XZCL 4YQXH 3RA7L 5DRXA 1FVDA 4PTTB 4N8VB 4MD0A 2GSIB 3D18B 3NABH 3MXVL 4YDIH 1I8MA 1OWRM 1BPVA 2P44B 3BP4A 3GSXB 2ADGB 4POZD 5I1JH 1X4YA 2C4XA 4RFEA 4L4JA 4YZFE 1AGCA 4D9LL 3IDXH 3UZVB 2H1PL 2E7LA 4H20H 2C4FU 3RTQC 2YD8A 1F4WL 3AB0C 4PBVC 3QIUC 1WSST 3DX6B 4XVSL 4PJFF 1EO8L 4LNRB 4M00A 4KKCC 3E8UL 3NCMA 5GRWA 3MOBL 5DO2D 4JM2A 4HZLA 5EUKB 3VCLA 5IROC 1ZLSH 1MHEB 4L8BA 4ONFH 5F9OH 1ETZB 4HIEB 1A9BA 3GI8H 1HIML 1AP2B 4NBXB 3CC5A 2CDGB 5GJSH 3TV3H 3WIIL 5B39G 4HGMA 3QDHA 4UMGA 3P40A 4GRMA 2PYEA 5JHDE 5FYKE 3QDJA 4K8RD 4EXPX 2DIAA 5HI3C 2N7AA 4YR6B 1P7KB 1RPQA 5EBLA 3BZ4A 1TJGL 1FNEA 3VWJA 1Z9LA 4M1DL 3IJYB 2BHUA 3MRGA 3VRIB 1DLFL 5LGHL 4H1LG 1ZE3C 3DO7B 4XXCC 5L2KD 3U0WH 1F4XH 4PTUA 2XWBA 1EHLL 4RNRB 5EZIH 4CN4A 4APQA 1AFVL 4CKVX 4K9EL 3EHBC 2W07A 2VXUL 3GGWA 3KGRA 2PYFA 5F93C 3U30B 4NKQB 4QRSB 3TH3T 1NBVL 3QEHB 4KRNA 4QXWA 2F53D 4K7PH 4Y16C 4OB5H 1OGAD 4YXKL 2I60H 3GMNA 3MXVH 3QUXD 4P23A 4WUUE 5C9JA 2FIKB 4U3CA 4QRPB 3ES6A 4KAQH 3DXAB 4LCCA 3ZE0E 4AENB 3VXMA 3NACH 4KTEL 5E00B 1A7BA 3EAKA 3KPTA 3LKSB 4NQEB 1M7IA 1S7UA 1F4WH 5JOPE 2A2QT 1G7PB 3B9AA 3CLEL 1V7ML 4XVSH 3T0EE 4S1SL 2UY7A 1J5OH 4XVJH 2FJHA 1YEEL 4X5XA 5JXEA 1OAXL 1JGUL 3E6HA 5CEZE 1QYGH 1HH6A 1PAMA 1RMFL 3DIFB 3BYTA 4FZEL 4LU5H 5F9JB 2YKLH 1FYHB 5FB8B 3QNXA 3FRPA 1PYWA 4PTTA 1P5VA 1OCWL 1IC5H 2DRUA 3LCYA 5A3IC 4BSJA 1G6VK 3VW3L 4NP4L 4CDHA 1MLCB 2ICCA 3V4VL 2AJVL 5KBNC 1BVLB 4FN0A 1IQWL 4LCYB 1QPXA 3DX8A 4MNGE 3DUUB 3EYQD 5BZWB 5DVOA 4M3KB 3RVUD 2DICA 1GJIA 1DLFH 3RGHA 1S3KL 4JFZL 5EU5B 1NC4D 5AZ2H 4WU7B 3DVGB 5EUKA 1MCQA 3WV0A 4LSSL 1EHLH 3WO3B 5JA8B 4Y4FC 1BF8A 1UEYA 2VXUH 4HIEA 1CFSB 1G0YR 5E1AA 3OB8A 4YK4B 5GS3A 5C9KA 3W5NA 3OKNB 5F7DB 5SWSD 3MX0A 5DVKA 3FRUB 4KI5F 3SGKC 4S1DC 1RJYB 3BH8B 1J88A 5H35A 3QHTC 3QXAA 3WFDL 5E6IC 4P2OC 2EE9A 1CLOH 4J4PA 1FORH 5EO1B 4OZFH 2NR6D 3HAEB 5CUSL 3U7WL 2X44D 2HJFB 3H9HA 4WI3A 4RNRA 3DMMA 1JTOA 4QGTA 5EFIA 1F58H 3MA7B 2ADFL 1D9KD 4UT6L 4NPYB 3Q6GL 1EEYA 2D4DA 2J8HA 4JKMA 2HVKB 3SE3C 2EIDA 4M6OH 3NCBB 5TDNB 2WBKA 5L88H 1OL0A 4DGIH 2Z31C 5CSZB 5CAYB 4KKLD 3LZFH 5EZLB 3ROOB 4XI5C 2XTJD 1AGDA 4RMVA 4NN5C 4U6VL 5BRZD 2FIKA 3DHMA 5AEAA 1SM3H 2A6IB 4ZYKB 2QKIA 1I1AC 5GZND 4PJHA 4OF5A 5KVDL 1IQWH 2A9NH 1RU9L 1J18A 1NBYB 1LP9A 4UZGA 3O3DB 1LDSA 2H2PD 1NEZG 2OQJA 3B9KA 1KYOK 3OKMB 3TC9A 5JHDB 3RZCD 4X4ZA 3LKRB 5EUOF 2BJMH 3D0LA 1EXUB 5EO0A 5LGJB 5I74B 1A7RH 2GKIA 2MCG1 5DVLA 5IQ7H 3CSGA 4FQCL 3WKNA 4ZDHB 1IL1A 3HS0A 4PV8B 5EG6C 2VZ3A 5ENWA 3KLDA 3QPXH 3IAPA 2P46B 4XWOC 3D39D 5D1XA 1DFBL 3GKWL 3U9PH 5HHVH 1BVLA 4OCWL 2PW2A 2C7UB 2XRAH 4O9HL 3M17A 3DUUA 4DUXA 4N9GB 2EH7L 5EU5A 4YHOL 1SJVA 1IAKB 3U7WH 1QNZL 3NVQA 1YECH 4PJIE 2VXQH 4BZ1H 3NBNA 3D85A 4WUUB 4AEIH 4ZUVB 5I1IH 1CDJA 1FGNL 2CUMA 4IM8A 2R29H 5D4QA 1CFSA 2E9IA 5M95B 2VWEC 3GBML 5FUCE 2RQ8A 4X4MA 1HH9B 5F7DA 3PDOB 2IG2L 3RL1A 5IB4A 3T0EB 2OI9B 4QKXB 3BPLB 1JPST 5HVWA 4FRWA 3RVTC 3GJFK 3BZFA 2AEPL 3P0YL 4KROB 4PJGA 3WE6A 1BD2B 4F7EA 4YUEL 4FQQB 1JWUB 4HBCH 4W4OC 3BIBX 4ZD3H 1NGYB 5D1ZC 3OGOE 5KVDH 5E7FA 2XA8H 4PJXE 5L2KE 1A8JH 5A2FA 4R2GD 4TNWF 3RGVB 1DBBL 1FSKC 3MA7A 4U1MA 5D72L 4ENEC 1DUZB 1A4KB 2F53E 2Z35B 4UU9B 4MNGB 2BY1A 4O58L 1OGAE 3REWB 1UH2A 1OAYH 4YE4H 4TUJB 1OAZH 5IBUG 3RWJA 3MRIB 1UH3A 1W0YT 2A6IA 3SGDH 1DFBH 4RFNC 5MEND 5E5RB 4OCWH 5TQ2L 4JDZB 4O9HH 2DBLH 2FH6A 3MPCA 1IMHC 4WV1B 5IVOA 3E2HC 3U48A 2QQNH 3V52L 3LKRA 2FZ3B 2FEDD 4PR5B 2HT4D 2BNRD 5LGJA 3GK8H 4HWEL 5CD5C 4NHCH 5DMJB 3JWOC 4JAMB 1UWGL 1MCHA 4UT9L 4PRHD 4FQIH 5I9QC 1FFRA 1HSAA 2ZUTA 2J4WH 2RAMA 3JXAA 2ZCHL 4N1HB 1XFPA 4LFHD 1U8IB 2BCKB 3TBYB 3IU3B 4LSVH 1J0IA 3I6LD 1HN1A 4WW1B 2VR5A 2CJUH 1IQDB 4V2BA 1DVFB 4DN3L 3TH4T 2A1WL 4XMPL 1KIUA 4OGXL 2EYTA 2Y4SA 1C7TA 4R4NC 4KZEH 5BMFL 4I5BB 5GIRB 3HE6A 1A7QH 3GSRA 1FIGH 1XGYH 3PV6B 1QBLH 3FN9A 4RGOH 4YHLH 4LASH 5D72H 5DS8B 4ETYA 2WINB 1HH9A 5SWSE 4JFEA 4RIRA 3EOTL 3PDOA 2WWMD 1ERNA 4MHHI 4O58H 3T0EA 1MUJB 1I4FB 4HIIA 4AJ0A 5B3JE 2BRRL 3P3YA 2ARWA 1BD2A 3MACH 5IR1A 4YHIA 5SX4H 3VI4F 4NGHL 3IVKB 3KYMB 2BMKB 5DHYA 3O11B 3ULUC 1D5XB 3HRZB 3K74B 5F7HA 1RULH 4N0FB 3RGVA 2P48B 4G6AD 3DUHA 5C0FB 1CGUA 2CRYA 1IM9D 4RGMC 4OV6F 1DUZA 4PRID 4RMTA 1AQKL 2GT9B 3SHSA 4C83B 4GMSL 3OF6D 3BRFA 2FHBA 4OF8A 1VSCA 2XTJE 5HDLA 5K59F 3V7MA 5BRZE 4PJIB 1Q72H 1SHMA 2YD3A 2AS5M 3VWJC 3MLVH 1RJCA 3V0WL 1I3VA 2CLVA 4JDZA 3BD3A 2YMXL 3GHBL 1OF2B 2DQUL 5HJ3A 4APQC 4MXQD 3AU1B 4WV1A 2YRLA 3KYAA 4LPWA 1A7OL 3GSWB 2FZ3A 4PR5A 1QRNA 2DLFH 4XNMB 2B2XH 2KH2B 4JAMA 1JJUA 5FIEA 1QFWM 4X7DC 5CHNA 4AIOA 3KXFD 1QR1B 4JPVL 4O2CB 4P23C 4PJXB 1AGFB 3EOTH 3A67H 2EC9U 1CICA 2B39A 4LSQH 3D39E 32C2B 3VFWA 5L2KB 5KAQF 4LCCC 1J87A 3H3KA 4LSTL 1LNUB 1UCBH 3EJJX 1WJ3A 2G5BA 2R2CA 3FO1B 4POYA 1DVFA 5HPOA 5JIIA 5DSCB 1XF3B 2F53B 1OAQH 1T0PB 5IVNA 5DMKA 3DV6B 1DDHB 5F7WC 5GS1A 1OGAB 4JFQB 2P7TB 3ZL4H 1Z2KA 3VD7A 3QUXB 3Q6FA 2K3TA 1BFVH 2W0FB 5GIRA 4EUPH 1IGCH 3K4AA 1Q9KA 4G8FB 1CCZA 1MJ8H 2AERT 4NWUL 5DS8A 2V2WA 3MLXH 1H5BA 4JVUA 2EIZB 4E41D 3S4SA 3KPMA 5J7CC 2RHEA 4XH2A 2HT2D 4GMSH 3VJ6A 1JHLH 4EUPA 1E6OL 3NN8A 3DYPA 4WHCA 4PRPB 2QJDA 5F88B 3WNLA 1OWWA 2CRMA 2AV1B 5E8PB 3RKPA 4FQXD 2ZP0T 1FNHA 3FT4B 2IPUK 3IVKA 4HK3N 3K1KC 3RVWC 3O11A 5I8CB 5GGRB 1D5XA 3G5YA 5GGTL 4PJ5A 2ATKA 2OX5A 5JLZB 5CZVL 1C5BL 1FZJA 1P7QD 3HMXA 4WJ5A 4AL8L 1A0QL 4XPBH 3LEVH 1OP3H 4RRPA 5KSVA 5DJCB 2DTML 5FV1L 2ZJSH 2IALA 1A7OH 2UZIL 5IMMB 2YD4A 1PG7H 4S1QH 2AJZA 3CIQA 1OHQA 4C83A 3K2MC 2W65B 4YLQT 1ZLUK 1NC2D 3O4LD 1K3ZA 4PJ9D 1NC4B 2VNCA 1BBJB 5AG9A 1N7MH 4PJIA 3RWGA 4J4PC 5MENE 1BX2B 3ZE2F 1WIPA 1WFOA 4HUWB 4UTBL 1UB6A 2HTLD 3SQOH 4DKDC 2FJGB 5SWSB 3IFLH 3TBWB 4YO0B 2BVUA 3DMMC 5IW1B 3SDXE 1LE5B 4R4FH 5KSBE 1XF2B 4Q9BA 3SKNB 2BNRE 2BSRA 1JV5B 5EH1A 4I0PA 1PY9A 1E4XL 1F13A 4OZGF 4PRHE 5CBEA 3INUH 3L7FA 4HJ0C 1QR1A 4PJXA 4Y89A 4YAQA 3MV9A 1RZIB 1MVFA 2IEPA 5D2LF 5KG9B 3G6JA 1S8DB 3QA3A 2H6PB 4WU5A 1D9KB 3FO1A 3I6LE 1IILE 2F9BT 1CE6B 4XTRD 2ZOLB 4S1RH 5J12B 4F3FA 1LE9A 1Q38A 3F7VA 5ALCH 4X5WB 3CFDA 1MQKL 5F7FA 3RX8A 3MLPA 2HLFC 5HVFB 2XTJB 5FYJU 3QIBB 3OV6A 5BRZB 4LP4A 4RMUA 2XACC 4DTGL 2RGSA 4MD5B 4HFUL 1RK0B 4EIGB 3FQNA 2VLJD 1LO3L 3B3IB 3MBED 3QDMA 1PKQE 4JKWA 5CILH 3IFNH 5FYLL 5D1XC 3HKFA 2CDEB 3X3FH 3RZCB 4PRPA 3FT2A 2E6QA 2AV1A 5E8PA 3EO1B 5TGBB 3FT4A 1OSZB 3K3QA 3U9UB 3D69A 1PG7W 5DDHB 1HHJA 3EZJB 3SY0A 3S97C 1XGQA 1DQDL 2FJFA 1K6QH 2XIDA 5GGRA 2O5XL 3DNKA 3BQUD 4UILL 4NQDB 5BCAA 3D39B 5I8OH 5DJCA 2AK1L 1QSVA 4YK4C 3WXVL 2AJ3A 3IU4L 4FABH 4PRIE 4GXUM 4Y19E 2M8XA 3GMQB 1JPSL 1MHHB 1BBJA 2WUCH 5EU3B 4NKDB 1ZT7B 1RHHA 1A6VL 4YEEA 5JHLL 5DD0H 5F1KC 4LLUA 1A6AA 3H7LA 4HJGA 1FZOB 4XP4H 1T0NB 2WWKO 2OCFD 2DQHH 3C5SA 1ZGLM 1CIUA 2FJGA 3ULUF 4GAJL 3HLAA 3IFPA 4Z77A 3BEWB 5IW1A 3H2WA 4OUUB 5E70A 4XPAH 1WIUA 1PZ5A 5EOTB 1MFAL 4LLAA 3ZKSD 2MKWA 1ACYH 4DTGH 1NFDF 1GGYA 1U92A 5DJ0A 3UTTA 4ZO7A 5ESAB 3ZYIA 1QA9A 3TJEH 4O2EB 3KXFE 4L4TD 1J0HA 2IBZY 3NA9L 3PGCB 3JWDH 4R2GB 1CE1H 3BUYB 3C09B 2H6PA 1PSKH 4FMKA 4F2MA 2YPLD 4KVNL 4MJ6B 4KWUA 4KZDL 4TOYL 4Y7MA 5AZEL 2DIBA 1U8KA 1AR2A 2ZOLA 5CMAB 1G7LA 1CXHA 5ITFB 5C2BH 3MJ9H 1WUNT 2PETA 4PJAE 3LDBC 5HHNA 1DQDH 2Z91A 3LEXB 2ICEA 1NCWL 2CDFB 2ZUYA 4I2XA 1GCFA 3QIBA 5I74C 3O9WD 4LSRH 4JN1H 1VKXA 4UBDC 2HKHH 1DZBA 2PN5A 4CRPA 2H26B 5CKGA 4H5SB 1UXSA 5MENB 4MXWL 4M62L 1NAML 1RK0A 1PX4A 4FQHB 1PKOA 4E41E 2G5RA 1I75A 3B3IA 3MJ9A 4W70A 5F7LB 5BO1L 3S36H 1Y0LB 2MKLC 4B50A 3GMOA 3IDYB 4L3ED 4PGDA 3S35H 1KB5B 2CDEA 3SDXB 1JPSH 3C60B 2EKSB 3GMMA 2BSSB 4MQXD 3WN5B 5FO8A 3RZCA 3BKYL 4PB0L 5KVFL 3MOQA 2IAND 2O61B 5I0DA 2BNRB 3EO1A 3NFNB 4X6FB 4XP1H 2GCYA 4WEUD 5JHLH 1I1RA 4BJLA 4L8CA 3K1DA 3OXRB 3OPZL 3S88L 4Y1AA 5FF6A 5F7UA 4DUVA 5T1KB 3MLWL 1B3JA 1BFSA 4PRHB 4OZHE 1ORSB 2Y6SC 1QQDB 1PGRB 3MROB 2RFXB 4NQDA 3D39A 5FHAH 3PGFL 3HE6C 2HRPH 3KJ4B 4HPYL 4D9RE 5GRJL 5E94A 2R56L 4Z7UA 5CGTA 3O45B 5HHMD 1PEZA 2EDQA 1S7VB 3VH8G 5DJYA 3T0EC 5BS0A 3P11H 1MHCB 4NNXA 3BPLC 4MJ5B 3O4LE 3T09A 3ZSTA 4JZNB 1Z3GL 2VR9A 5ANMA 3DUSA 4HLZH 5EU3A 1ZT7A 3I2CH 3ZKXC 2VXSL 5LGKA 4F57L 4GRWE 2CGRL 2GY5A 4XHJC 3MJGX 3WD5H 2OMBA 2F74B 4BZYA 5BV7L 1JUFA 1JNNL 3RGVC 5DQJB 1DBJL 3FHQA 1NH6A 3L3GA 4LPXA 3SGEH 4KDVA 5I75B 5AUMB 3BZDA 5ID0B 1JPGA 5I19L 4MWFB 4S11A 5ESAA 5CKAA 4O2EA 1NAMH 1Z0NA 1IZKA 1U93B 5TFSL 4KUCD 1UXWB 2GTWA 3X14A 2NY3D 5CGMA 5E6YA 1A3RH 3NIFE 4Z5RB 1J8HD 2XKNB 4PB0H 5F7EL 3ET9F 1YMMB 1IM9B 5EC2B 5I16A 4PRIB 1A1NA 4Y19B 3TA3A 3PWPA 4WV1C 1QO3A 3MLWH 3QFDB 4K3EL 5EZOH 3WNNA 2B0SL 1HHHB 3LEXA 2CDFA 3R1GL 1X5YA 4CAGA 2L0DA 4PB9L 1GIGH 1ZKAA 1K2DB 2I9TB 4TSBL 4P9HL 5LXGH 5C86A 3M8OH 3O3UN 3FONB 3LV3B 2VLJE 4FQHA 5MP6L 4JFXA 1JVKA 2XY2A 4N8PA 2ZOKA 1CICC 1G9MH 2DJ4A 2UVEA 3ZDXE 1PY4A 1FAKT 4LCWA 3UTQA 2VQ1A 3C60A 1IGIH 3WN5A 1H0DB 2BVOB 4PJHF 3C6SA 2G9HA 3NFNA 4X6FA 1DVFC 3VFPA 1LP9F 4AT6A 1TZHB 5DQ9B 4QNPE 5T1KA 2X4SB 3ZDZF 1GAFH 5C7XL 1VB9A 4UIKL 1XGTB 5E95B 3KXFB 1JNNH 4RAUA 2RFXA 3ESUF 3EYSH 3BGMA 4G80B 3SDYH 3ULVL 4F9LA 5E2WL 5ETUA 4DK3A 1RUKH 4WRLA 2B20A 4FOMA 4XNQA 4MX7B 3QG6B 1H5BC 3O45A 1QBML 4XRCA 1LILA 1S7VA 4K7PX 5FFLA 3TZVD 2W0PA 1T3FB 1RIUH 3WSQL 3S7GA 1D5BB 2JJUA 1YDPB 4WCYL 5TFSH 1FC2D 4PJAB 1OB1A 4NQTA 4KH2A 3BN9D 2DQGH 4Z0BH 1XR8B 2UYLB 1QFWL 1G7HA 5JO5A 3NIGF 3TNMA 4AEHH 1KCKA 3C6LD 4E41B 2O26U 2ZUWA 4POZC 5I1KL 3QCVH 2ATPB 4K3EH 2DQFB 4MB4A 3WUWB 1JRHL 1YQVH 2IF7A 4PB9H 5GRVL 5LKNA 3GSUB 3GHEL 4FQXB 3V95A 4CVUA 3G5ZB 1VHPA 4L4TE 1U93A 4G5ZL 5MP6H 4UQ3A 1Z9OA 4LOUC 4OZHB 1BECA 1TITA 5DWUL 4P5MA 1P7QB 3DECA 4PJGF 2QLVB 1I1YB 3F6IA 2PW1B 2W91A 2XKNA 1S78D 2YPLE 3VFVA 1OLZA 4KHTL 3ZHDA 1DBKL 1YMMA 2QQQA 2ID5A 2NTSP 3KVQA 5IV2B 4Y19A 2FO4B 4YPJA 1NC2B 3O4LB 4PJ9B 1NMAL 4UDUB 2KL6A 4YZFF 1HOCB 1KSRA 1TVDA 4HS3A 4I0PC 1FVEB 2I9TA 1VCAA 5I71B 4J7RA 3JUYA 4GRWB 3FONA 2R0LH 3EO0B 3VXPA 5JDSB 1U8PB 4JO4L 1LEGB 3PDDA 1OT2A 1M7DB 4HWNA 5HHXL 4L3EE 4E9LA 5DF0A 3G6DL 3DURA 1JYNA 4WCYH 1H0DA 4XPFL 2IANE 3SO5A 2GITA 3BJ91 3KG5A 3ARYA 2A77H 1B6DA 5DQ9A 1CU4L 4HSQA 2X4SA 1INEL 5GSRA 3CX5J 5BXFB 1XGTA 4LEOB 4TRPH 4QHNB 2XICA 4Z78B 2YA2A 1CQKA 1FP5A 5HI4C 3GB7B 4XCNA 1EX0A 2J88L 5I1CH 3ILQD 5E2VL 4G6JL 4KPHH 3MO1B 1G9EA 4BH8B 4HJJL 5DRZB 2LAAA 1BGXH 5HVGB 4G5ZH 3DX9B 2KQNA 4LLYB 1FG2B 1H3PL 3PP3H 4EOWL 3L1OH 3T1FB 4K3DH 5KSUB 2UYLA 1BQHG 4JO3L 4DKAA 5D70H 1NGXB 1ZVYA 1DBKH 5KVGL 4NO2B 4IRSA 1KLUB 1YNLH 2VLJB 4MJ4A 1MVUA 3A0OA 3MBEB 1JWMB 3GJEB 4ZNEA 1OY3B 1MCSA 2X70B 4HXAL 3CZFB 2ATPA 2DQFA 1P4LB 1AR1D 3DI3B 4P2RA 4IRJD 4M5YL 1MJUL 4W6WB 3HI6L 1NMAH 3GSUA 2CKBH 2V5RA 3GSNH 4N0YL 3VFUA 1GH7A 3V0VB 4TTDC 2YEZA 4MCZB 3T0BA 5I1HL 3BQUB 4Z6AT 1YC7A 3G6DH 4LAQL 1I1YA 1LD9B 2YHGA 1DBMH 1HHIB 1OSPL 1ZA3A 3C2SA 4XPFH 2CKBA 5EPMA 5LCVL 1YN6B 3GSNA 2J5LB 1D3CA 4KV5E 2X7LB 1T7YA 5IV2A 4GG8A 5IEHA 4U3XA 1CN4A 4PJ7A 1R24A 5CP7B 3TT1L 4OLXL 3SJVA 2VE6B 4PGZA 4NC1E 3QYCA 1ITBB 1FFOB 2FATH 5FGSA 5HVHC 1FZMB 3EO0A 4A6YL 2D7MA 5JDSA 4PJDE 3S8WA 2A9ML 2GUOB 3K2UH 3KLAA 5SX5H 4IMKA 4FQJL 2A74B 2IH3B 1H3PH 3UBXB 3UJIH 4KUZH 4HMEA 3QAZC 5C92A 5SWZD 2ARJA 1CL7H 4QO1A 2VDML 1G1YA 3O3AB 3E3QE 4X7TA 5J12C 4PRNA 1E6JL 4GS7C 5F7YC 4ACPA 3QWQB 5I18L 3JWDC 4ZUTA 4GSDL 3QSKB 1IARB 4GJTB 4C4KT 3U1SL 4L4TB 4RWYL 4LEOA 2XTJC 3DRTB 3QWRD 3PDGA 3RY6A 3SDAD 3WBDA 2XQBL 3QIBC 1DP0A 1B6UA 3FB7A 3VI3E 1C5CL 5HYJD 4YIQB 2PXYD 1MIML 5D9SA 5IJVB 2YPLB 1HXYB 3UTPD 2OTUB 1JE6A 4QXGL 2QSVA 2FYYB 4JO1L 3MO1A 4NQCA 1HQRB 4BH8A 5DRZA 3SO3B 1S9XA 1WWWX 5IHBA 4IJ3B 4LLYA 3RZCC 4MA1C 3DSFL 3T1FA 4ZSOA 4HUXA 3LKPB 3UO1H 3QCUH 1B88A 1NGXA 4NO2A 4FZ8L 1A4JB 1NAKL 3BW9B 1H3TA 1NGPL 3RZWA 1H8SA 5HGAB 4GO6B 1DQLL 3D9AH 5HGHB 2X40A 4L3EB 4F8TA 3CZFA 4TPRH 4NKOB 1CLZH 1MRCL 4YGAB 1F42A 4IDLA 4OLXH 2IANB 1FNSH 1CBVL 4LVEA 3VMOA 4WO4D 3EO9L 4PJCE 5DEGA 1HSBB 4YBQC 1R5WB 4YJZL 4M4RA 1J1XH 3JV6B 3BP5B 4QTHA 1I7UA 2X2YA 3MZGB 4MCZA 5FYKU 5T1LD 4ELMA 1EHNA 2KDGA 3SKJL 1LD9A 2XXCB 3U0TB 1BOGA 5IB1B 4HWUA 5F44A 2X7LA 4JFFA 2VDMH 5ID1B 4D9QD 4WWID 4LP5A 2Y36H 5EN2B 1LEIB 1KBGH 2FBJL 1MCRA 4QF1B 4RWYH 3MV8D 5MI0C 4LGRB 2VE6A 5JMRA 2JJWA 1A14H 2DDQH 4F33B 5GRYA 1MIMH 4JLRB 3B4NA 1FZMA 4MXVE 4Z7QE 1DR9A 5FHBL 1O7VA 3ARGD 2R0KH 2GUOA 4R2GC 1K4DA 4MVBC 4PJIF 1L9NA 3C09C 1N59A 4NUJB 2IH3A 3EDJA 2DBJA 2HN7A 4LLDB 5I1DB 4ZMAT 8CGTA 3HC0A 2R4SL 1Q8MA 3TA3C 5D7IA 3M45A 3QJHB 4Y5YB 3MC0A 5FYLD 3VD4A 1DE4B 1YJDH 1D6VH 4OIIL 2AQ3A 1ZT4B 1EUUA 3BRGC 1RFDL 4P5KB 4BSWB 4NZTH 1BFOB 2OTUA 5FOBA 3VXNB 1EJ6A 1CBVH 3PWLA 3MNVA 4OLZH 1FDLL 2H3NB 4R8WH 3R4DA 1HQRA 4PJXF 4XC1H 3IDYC 2O5YH 4GLRI 2VDQH 3C60C 3WN5C 3VXQB 3G6JF 4MAYA 5D2NE 3BP7A 2VDRH 5L0QB 1LDPL 4ODXB 1CF8H 4LLVB 4ZXBA 1S5HB 2XI9A 1A6UL 4TSAH 1CK0L 1G9MC 3QEQD 1IGML 5T33H 3RU8H 1A4JA 3BW9A 4PJDB 4OM1H 1CGXA 4NKOA 4XWGL 4F9LC 3KJ4C 5DTFB 3A6BL 5DUPH 4MQTB 3BKML 5T5NF 1GRWA 4XVUC 1RY7B 4AEFA 4IS6B 4HKBA 3JV6A 4N0UE 2Y9RT 3CFJB 3RVVC 4MDIA 4KHXH 3FAXA 3MUGA 3QQNA 4MA3B 1K85A 3MMEB 4L4VA 4UQ2B 3U0TA 4PV9B 1AH1A 1LO4L 1OM3L 1NGZB 2OZ4L 4R7NB 5FUZL 5IB1A 4AG4L 4HDIA 4B7IA 1KIPB 1N4XL 1TETH 5F9DC 1VGEL 2WWMC 1CXEA 1DQQA 1V7NH 2MHAA 4QCIB 2PCPA 1JFQH 3ESVF 5D7KD 2C4FT 1YYMH 4PGCB 2FD6L 2AK4D 3VE0A 3PHQB 2MCPH 1KACB 3DVIA 3RWDA 3NPSB 4F33A 4E42A 4HK3J 1V3KA 4G3YL 4JLRA 2KUTA 3MLYH 2CMRH 3B6SB 2F19L 4P46B 2HTKD 2Y72A 3QH3A 4NUJA 5JXAH 4M7ZB 5EORH 5SWZE 3HZYB 1GGUA 4HUUA 2QHRL 1EEQA 2VN4A 1KPRA 2X9XA 4FQ2H 3T77A 2VR4A 5MEQA 3O6FD 4PJCB 3FB8A 4JGUA 3OWEA 3QJHA 1CK0H 4DQOH 2LU3A 5DT1L 4JFYB 4GH7B 3OJDB 4FFYL 1DE4A 2Z8SA 3GDBA 1A47A 5B3JF 4FFZH 2X4OB 1P5UA 1GGIH 5T3XL 1QLRB 4P5KA 5E5MB 2D7TH 4JY6A 4BSWA 4ZO8A 5DEFB 4BQCA 1PG7X 3UTPE 3VXNA 3H42L 1XGPA 4PRAA 2UV3A 3FB5B 2Y07H 4UUJB 1RZ7L 5B22A 1U9KA 4EI6A 2EXWC 5LQBH 3BPCB 4CVZA 1ITCA 1LO0H 4I77L 3FQXB 4U05A 4X0KB 2VAAB 2AV7A 4J3WA 1LO4H 2EICA 3D5OF 4YFLF 1BM3L 2BVQA 2BRQA 3FTGB 4M5ZL 1TJIL 1NCUA 5I1LB 4E5XB 2XN9D 1A3LH 3BOVA 1G7QA 3C5ZD 5E8OA 1VGEH 4I18A 5F3BA 3B2UD 1RZGA 3BE1H 2OK0L 2AJUL 2IPKB 3QO0A 3V6ZB 3SGDI 1NANI 3CXHJ 3WIFB 1FFQA 2NLJB 4HKZA 3WNMA 1TPXB 5JW5B 5IHZA 2VMFA 4G3YH 1KTRL 2YUWA 3RKDD 2YPVH 2XNAB 1IGYB 2ZPKL 3A6CL 2X4NB 1HXMB 3MMEA 1Q9WB 4PV9A 2ZSVB 3EYOB 1YPZE 1BBDL 1QBBA 1BZ9A 4FTVA 3TESA 2J6EH 3HZKB 3PG2A 1KC5H 4PJ8A 1WIOA 4S2SA 2Y25A 1NGQH 1UH4A 2X4QB 5J3HD 4D9QE 5HI5D 3NCJL 5IBLD 2YWYA 1RQ5A 4GBXA 2XV6B 2ED7A 4CDGC 3QI9A 4L3CA 3MV8E 1JNHB 2W9LA 2ESVD 1FV1B 4WHTB 5IM7B 2J6EA 3TO2A 3ARWA 5D2NB 3ZE1F 3UJJH 5HDQL 4Z7UF 3F8UB 3T65B 1T1YA 5IK3B 4MLIA 4NNYA 1I7ZA 4OZIA 1X5JA 3EYUL 3LIZL 2CK0H 3IFOB 5D8JL 5DK0A 3MSPA 1RUPL 4P46A 2LAGB 4GMTH 4BFIA 3W11D 1G7JB 1I7RB 3MLSL 1UEMA 4WHDA 3ARBD 3W9EA 1BEYL 5IB3B 2DLGA 3HFMH 3I6KA 4IRJB 3SE8L 3EOAA 4XBEH 5GGUA 1EAPA 1Q9OB 1HZHL 4PJCA 1BM3H 4JFYA 5FYLE 3H3PL 1D5MB 5KS9E 4M5ZH 4N0UB 1T6WA 4PJ9C 3LHPL 3WS3B 5F96L 4FQPA 1JMZA 5I71C 4LVNB 1QLRA 4FFWD 2CPCA 3KPLA 1D5IH 1CDUA 1ZHNB 4UUJA 2AGJL 5F97E 1MRDL 1ADQA 4JPIB 4IMKC 3RUGE 2HKFL 2P8LA 4RMRA 2AI0H 3ULVD 4PLOB 2EXYC 3RWHA 4OF3A 3F5WB 1XGUA 2J8UA 3ARDB 5FDWA 2M1KA 1YQ2A 4UOW1 3QEQE 4D0DB 3HPJA 1FAIL 1PVHA 4X7SL 5I1LA 1IC7H 3OKYA 3DARA 3H0TB 5FKPA 2Q8AL 3RY6C 3X11B 5DD5L 3CVIH 4GKSB 4UV7L 3P9WB 5KN5B 3QHFH 5JMOC 3HZMA 5SWZB 2FRGP 3MJ7A 1A7NL 5JW5A 4XTRC 2UWEA 2XG5A 4TSCH 4C58B 1OAUL 3MRHA 2HG5A 4XPHL 5L8LB 3QUYA 1IGYA 1HE7A 4O5LH 5JQ6H 2ZNXA 5E9DD 4JZOB 1CGVA 1MCBA 2X4NA 3MLSH 3VFTB 3WUZA 2P24B 2ZSVA 3HUJE 5C0IA 2IPUG 5DFTA 1MJ7L 1BEYH 2BZDA 1A6WL 2PXYB 3MRJB 5TE6L 3WHE1 3QIWA 4RMSA 4NO3A 3QB7C 2X4QA 4OBSA 4KK8D 4GAYA 1SY6L 4GT7A 3IKCB 1QRKA 1JNJA 3UTOA 4XT1C 4M61A 4YHNB 1DJSA 1EUTA 5D7KE 2NY5L 5IMKB 1T21B 3WFCH 4H1LB 1IZJA 4WHTA 2AK4E 5EC1B 5JPNA 5F6HI 5FA4B 1IAOB 5H94B 1X5LA 2Z8VC 3DHJA 3ZTNH 4HKXB 3T65A 3L5XL 3P77A 3S36X 4GRLD 1ZWIA 2VITA 3G5VA 3IFOA 3LEYL 4OGZA 1X5XA 2BNQA 3BQUC 3S35X 1I7RA 2XKUA 2HKFH 5D96C 1VFBA 1ZHLA 4FQLH 2HJKB 1T2QL 2IAMB 2R0ZH 4WO4B 3OKLB 3NIDE 5C09D 5JA9A 4XHQA 1A6ZB 2CXGA 1KLGB 1YNTA 2AW2A 4P57A 4J2XA 4KQ3H 1UGNA 4X7SH 3H3BC 4NKMB 2R39A 5J11B 4HULB 4OM0H 3WS3A 1B0GB 2Q8AH 1OP3K 3GMPB 4HK0B 3RNKB 2BX5A 2NZ9C 2FX8H 4JFDD 1S7RB 1YPZB 3S6CA 2FX7H 2ZCKH 3S34H 4U4BA 2ADJB 4LLWA 4DW2L 2IPTL 4H8WL 1KXQE 3WNOA 3MFFA 3X3GH 4DUWA 1PLGH 4KKBC 2NY4C 3D2UA 3IDMB 2HRLA 3QUZD 15C8L 1BAFL 4HV8B 3BPNB 1MSPA 3ARDA 3MUY1 2K9UA 4M93C 4GG6E 3T2QA 3TVMA 4AEEA 3MCKB 3BPOC 3NOIA 4HG4K 2YD1A 3MRBA 5T3ZH 2XN9E 4R3SB 2AEQH 3X11A 4YWGL 5TF1L 1KENH 3V9FA 4WFHD 3VWKD 4YBLC 2NY5H 3KYNA 4L9LB 5C6WH 1SMOA 3IDNA 3LKQA 3O3EA 2C3XA 1YJDC 3UTSD 1J1OH 3QNYA 1B0RB 3IS0X 5JZ7C 1Y18A 4E0RA 1Q9LA 2DQJL 5AWNH 3KHOA 5IG7A 4IJ3C 5TDOB 4NUGH 4MAYC 4KY1L 2QADD 2VC2H 5B39A 1U6AL 2P24A 1I7TA 5BQ7B 3MRJA 1KPUA 3OHXA 4RBPH 4GW4B 4JHWH 2QHLA 3IKCA 3LS5L 5IFAH 1FYTA 5TH2B 2XOTA 1G1CA 4RDQG 4X6EB 3RUGB 2ESVE 4MQXC 3I02B 1XZ0B 3MV7D 1I1FB 1UJTA 4PREA 5FA4A 4ZAKA 5TDPB 3WHXA 3MODL 4XCEA 4HKXA 2V17L 4HS6A 1KXVC 3QEQB 4J8RA 1KOAA 1WCBB 2D9CA 3STZB 4OD1L 2E9JA 4PJAF 2VIRB 3I75B 4M6ML 4U6YA 4HUNB 3KPSD 4J3OC 2HH0L 4WEMB 2CUIA 1ZEAH 1KB9K 2ZKHL 4HS8H 5C0GA 2IAMA 1BAFH 1JGVL 2Y5TB 5ICXB 4X80H 1NKRA 1VADA 1A6ZA 5GGSY 2W59A 1INDH 2WW8A 1CVSC 3O6KH 4EDWH 2OL3H 4UB0L 4NKMA 2DM3A 1LK3H 1N64L 5IEKB 4YWGH 4PLKC 1NEZB 3GMPA 5TF1H 4NSKA 5JPMB 4F7PA 1F2XK 4NO5B 5FEBA 5JW3L 3HUJB 4PY8J 2A0LD 1KJ2B 1WFTA 3G04B 3ZYOA 3V4UH 1ES0A 2R69H 1IAII 3MRKB 3CNKA 3UPRB 4XP5L 4M9PA 2F58L 4OLYH 4OZHF 3DROB 1UT9A 2X1OA 4TUOA 3HB3D 4HIXL 3ULVE 5IJKC 3BDXA 5E4IA 4AH2A 1IGFL 4P9MH 1YMHA 3UXFA 4KY1H 1KTKE 2AK4B 2A38A 4JJ5A 4HV8A 2YD5A 3HNSL 3CFIC 2R1XB 3Q3GB 2Q76B 3OTTA 3T4YA 3MCKA 5ILTH 3EJZC 4PJ7F 2AABH 2FGWL 4HH9B 1T4KA 3RPKA 2MNUA 3WFBL 4ZODA 5HGBA 2PR4L 4EN3A 3DRQA 2WUBH 3VXUD 3HC4L 4GRWF 5IVXA 3C2AH 5E8NA 5DJAB 5CJXA 4MAUH 1ZS8B 2HFFA 2PNDA 4F37F 3O6FB 1PQZA 2WM0A 3CXDL 3KPRD 4X6DA 5IQ9B 2JJSA 1J12A 1KTDA 1MFDH 3KPOA 2BFVH 5L0QC 1CFQB 1EO7A 1MEXL 2XT1B 1S9YB 4RX4D 2ZKHH 4XPGL 3VA6A 1X5GA 1BQUA 4YHMH 2JELH 4NN7B 4I0CC 4OD3L 1Z9SA 2EC9T 2X89A 3V6OE 4YFLI 4I18C 2YN3A 3LY6A 2NNAB 5HHPB 3VGEA 5D5MA 5FDYA 3I02A 2MQCA 3NIFF 5TJWK 4Y2DD 5TDPA 2YPKA 5E4EB 5CZXD 4Q9QL 3GNMH 3JZ7A 4OGAD 3HMWH 4R90L 4GG6B 4R97C 4GXUN 2DTSA 2EYSA 1WCBA 5IF0A 5HHQB 3STZA 2XN9B 2DLEA 2EDKA 2OMNA 2APWA 3KPPB 3U46B 4X8JA 1MFBL 4EVNB 5IBUB 4CU6A 1EDQA 5C09E 4BQBA 5BV7B 3BZEB 2R2HA 3NZ8B 3QI9C 3ZDXF 3TCLB 5DD6B 2P8MA 5HYSA 3O6ML 4RA3A 1WWBX 3BN9C 3NPSC 5GGVL 4L9DA 5IP4A 2YRZA 3V5DB 1GGCH 4JFDE 1KJ2A 3QQ9D 3G04A 1HINL 1WQVT 5TPWL 3D3VA 4GAGH 3GSQB 4OKVA 1MH5B 4P46C 1FFPB 4OFKA 2E7MA 5B4MC 3W39B 3FT3B 2QSCL 3CXDH 4NRYB 1KXTB 4M7ZC 5DURD 4X99B 1CZ8H 2ESVB 1IGJA 2WWKT 2WIIA 2QEJA 4P3DB 4YHYC 5J13B 2W60A 4LKCA 1U8QB 3ZYZA 2Y06H 1I8IA 4NQVB 4LPUA 5DHVB 4ZPTB 4X6CA 4OD3H 2VZ1A 1MJJB 1AXTH 3VU2A 5DFWH 5A2KH 3MLUL 2NY6D 4WFHE 5FGBA 5KAQG 2GK0B 1R3HA 3ARBB 1XCQB 4U7SA 5E6ZA 4L5FL 1F90H 3KR3L 3LH2L 5TE4H 1KJMB 1KPVB 3KYKH 4PFEA 5M7QA 1XIWD 4U1KA 3UTSE 1ZA6A 5I6XC 3NA4A 4Z8FL 4R90H 5GHWL 1B9ZA 3QFJA 3SGEI 1CFQA 3FO9B 1S9YA 1JMXA 3S37H 2GTZB 5GGVY 4PP1C 1RIVL 5EOCH 1HILB 2B1AL 1IJ9A 4DK6A 5F6HJ 4M1CC 1MF2L 1QFOA 5I2IB 4HCRL 3QXTA 1I9RL 5HHPA 4HT1L 4K2UL 4JB9H 4KXZH 1ZLWH 3MV7E 3MRPB 1VEPA 5C08A 1AXSA 2QR0B 4LFHG 2HT3C 1AE6H 3EDDA 5GGVH 4P59L 5FXCH 3P4LA 4GG6A 3P9MA 4G8IA 5CEXB 3QUYC 2FWOB 1EFQA 4PJEE 3EFFB 1B2WL 2QSCH 5IT2L 3KPSE 4HGWB 1UENA 3MYJA 2HMID 1I9IL 2XXMB 3H9SE 4N9OB 3QIWC 1E0OB 3PWVB 5J9PB 1YEKL 1UVQA 3L95B 4M48L 1U8MA 1FPTL 2HAZA 3BZEA 2AEIT 2G2RA 1PW3A 3B2VL 2G60H 5DZNA 3EYVA 1C16B 4MA8L 3L7EB 1KN4L 3MUHL 3TNNB 4EBQH 3MLUH 4I3RH 2ZCLL 3CPLB 3UTZA 5IWLA 3LS4L 4WUKL 1P2CB 2MPAL 4L5FH 4FS0A 4JRXA 3RWEA 1DL7H 3DSNA 4JDTH 5HDBF 1G7MA 1MH5A 4P4KA 1WEJH 3FT3A 4K7FA 3FQRB 1ODAA 4NRYA 5DRNA 2NXZC 5T3XD 4Q6YA 2H32H 2NW3B 4QOKA 4AM0B 4MZ3A 4P3DA 1A1OB 2Z4QA 2OJEB 4NM4H 1IVLA 3ZKND 5B38A 2YC1B 5GISH 1A9EB 3O81A 4GRLB 1Y6NR 1MF2H 4D2NA 5E2TL 5DC0A 2JIXD 4OLWL 2H32A 4JPKH 4AMKH 1CIDA 2DF3A 4K2UH 1NLDL 3T3PE 3S5LB 1T5WB 3VXUE 1EHXA 3CCHB 3OKEB 4ODUA 5C3LD 5C09B 2W0KA 2GK2A 3KPRE 1NDGA 1GYAA 5EBWA 2BERA 3W81A 1E4JA 3IGAA 1TVBA 4KKAD 3ARDC 4PRBA 3RDTA 2OXHA 5HYEA 1F4YL 3TVMC 4JFDB 3OR6A 4Y4KA 3S3JA 2GW5A 5BOZG 3ARUA 1KCRH 3K7UA 3P4NB 4GQPH 4NQUA 3PABB 4OCSL 5I8EB 3AMLA 3U0PB 2DJSA 2X41A 5KSAB 5DUML 2MMXA 3JTTA 3PP4L 3UZEA 3H8NA 3OGCA 1XGRB 2AEWA 2QR0A 3QUZB 2ZCLH 3VG0L 1MFCH 3ARFD 3T04D 4Y88A 5AD0B 1SJXA 2V5YA 3IXAA 4H88L 1RZ8A 1UB5A 4RISL 1TZGL 3DJ9A 1LVEA 5HTSA 4JDVB 1FBIH 4MYWB 2X9YA 4ZQKA 3VRJB 5FECB 3L95A 3UX9B 2WANA 4YC2B 1P7HL 4JEGB 4N0CD 4PJDF 3UTSB 5FM8A 2ADIB 2BY3A 3TYGH 1GOHA 5JOEA 4IOSD 4FNLH 5L6YL 3P0GB 3BGAA 1WITA 4OLWH 4QRUA 2QADB 3U4EA 5GXBB 4XPTL 4I3SH 2VDLL 7FABH 1NLDH 2YK1H 4DFIA 1FO0B 4Z95L 1KN2L 3MLRH 5GRVK 3RL2B 4J1UA 3O0RH 1NEUA 1E28B 3BMVA 4M02A 1T04A 4Z7VE 5I1GL 1JHTA 3PP3K 1ZLVH 3RHWF 5D1QA 4AY0A 2P5WD 2AXJA 2IAMC 3MV7B 1HEZB 1P1ZA 3VI3F 5DFVD 1W0WA 2B8OT 5C0NC 1KCUL 2YC1A 1F4YH 1A1MA 4QHUA 4KQ4L 3W82A 1WAAE 1P69B 5J11C 3PXJA 2V2TB 4IHOB 3LQZB 4ZTPL 3Q5TA 5GSVA 2A6JB 5B8CA 1JHKH 4MCYB 4PJEB 3PP4H 3KPSB 3QPQC 1T5WA 3MRNB 1XEDA 2GHWB 3H9SB 4FMFA 2Z92A 1U3HA 2Q86B 3VG0H 2I26N 4A6YB 2MJWA 3HRPA 3X12B 1KFAL 4O51B 4PG9A 4RISH 1UACL 3JV0A 5IBTH 3U36A 3BPNC 5HGDA 1RZFH 1RHFA 5ERWB 3QNZB 3VG9C 3JV5A 3SDDD 4PJCF 3PABA 5C07D 1D6EB 1EVUA 3NAAH 2BOCB 3LAFA 3U0PA 5D7SH 5KSAA 2DM7A 5T1MB 3VXRB 4RAVA 4G42A 2AXHA 4NCC2 5E8EB 2Q6WA 1YA5A 1GPOL 3WDIA 4EN3C 1XGRA 5IIEA 3LOWA 4L9LC 4F58H 3QXDA 4MMXC 2FBOJ 5CJXC 25C8L 1N0LA 4YH6A 1ZGLB 1JP5A 4XPTH 3FQTB 5GS0C 2IFFL 2O93L 1KN2H 1AD9A 4J3UA 1CFTA 4RMWA 3CFEB 2JJSC 2M2DA 4V1DA 4XCYB 1ZTXL 4O00A 5EU4B 1OW0A 1VERA 5SX5K 4R0LA 3ROLB 1FRGL 4MNQA 5EU7C 3TBTB 2YWZA 3G6AB 4Z76B 4KTYA 4WGVB 1NKOA 4LHUA 5FECA 3VXUB 3M1BA 4NOFA 4H25B 5B3NA 4JHZA 2BNUB 4MXVF 2O5ZH 4PD4J 4MS8C 4KQ4H 3FHAA 4KDTA 5F7NC 5ADOH 3HPLB 1GC1H 2E5EA 4JKPL 3KPRB 1R3IL 4NFCA 4D8PA 4N1EA 1HK6A 4ZO9A 1HHGA 4XVTH 1CL7I 5DGRA 1VESA 1FO0A 2UWEF 1FNGB 3O41B 4NJAL 3N1PC 4EDXB 3HI1B 4ZFZB 4U7KA 4FG6C 1G7IA 2I5YH 5T3XE 1MQ8A 5GZOC 1E4WL 5I15H 4WW2B 3UMTA 3V5KB 1Q94A 5HYQA 4JY4B 5CJQL 2AJSL 2YUZA 1TQBC 5E08L 4Y2DB 4K23H 2VTFA 3RWFB 3UCRA 2F5BL 5CIPB 4WI4A 3TO4D 2EDRA 5HD8D 2V2TA 4BH7B 1MFNA 4IHOA 2DQCL 2A6JA 4MCYA 2B7DT 3HG1D 2OP4H 1EGJL 1U58A 1Q0XL 1U8HA 2CLRB 2FX9H 5DLMH 4JHBA 3ECBB 4G8EB 3UC0L 3V8OA 3H9SA 1QLEL 2Q86A 2R2BA 1UWEL 4NFDA 4ZO6A 5EU6D 4DVBB 5IHUL 3CVHL 2HFEA 2IFFH 2XQYK 1KIQA 3CLFL 1ONQA 3QR2A 1AQDA 4UV4L 4Y8DC 2A73A 1SQ2N 3SCMA 1AHWA 4KKNA 4OAWB 3BXNA 4KK5D 4CADA 1I3GH 4OZFG 3QNZA 4YX2L 3MFGB 4JRYD 1K8DA 1WT5A 2H9GB 3LPWA 4J6RL 2BOCA 2GJZA 3HNVL 2PKDA 1R5IA 1P4BL 3D0VB 4D0BB 4CW1B 3VXRA 3U4AA 5E8EA 4Z7VB 1MI5D 1R3IH 4PP2B 2Q87A 4WWKD 4DKFL 4WFFD 1DLHA 3FQTA 1H3WM 4TNVF 5CGYD 4UI2A 5IMLB 4JJHA 1GHFL 1TVHB 4DKEL 3CFEA 1SMAA 1EFXA 2D7QA 4QTIH 2D0HA 3VFOA 3VH8B 3W2DH 4OLVL 3LN4B 2NY6B 1NCCL 3FN0L 1RUAH 4ZUWB 2P43B 1DN0B 2VDPH 3UBXI 3WNKA 3AC0A 4YPGB 1G6RL 3NGBB 4ODTH 5CJBA 3UYPA 1XIWB 2BNUA 2RCSL 3T4AA 4PS4H 3HPLA 3TT3H 4XNYH 4NRXA 3PGDA 1OT1A 3UYOD 3WL9A 5E4EC 4TULL 4CMMB 3ORJA 2YRPA 3Q1SL 4RX4A 3UC0H 4R4BA 1QLEH 5FYJL 2A6KB 4ISVB 4FXGA 5AYUH 2NY0D 3HNTH 2JK5B 3BKJH 2DI7A 2JB6A 4MSWA 4P2YA 4U1NB 5DA4A 3CLFH 5I17A 3V5KA 4P48A 1IE5A 2P5WE 4JY4A 5IW6A 3SQBA 2DQTL 3VFNB 3PHSA 4G9FA 4YHKL 4ODVL 3OXSA 1NDMB 3BIKB 2NX5E 2VLKD 3RWFA 5CIPA 4QY8B 4DAGL 4Q7DA 2X9WA 3BKCH 4I9WD 3T2OA 1DBAH 4N8CH 3HNVH 3EJYC 1CG9B 3DTXA 1AO7D 1WZ1H 4OD2A 1QVOA 2JCCE 5IWLC 1F97A 2VO5A 2EZ0C 4MNHA 3AREA 4P4KC 1KEGH 1W0VB 3JVGA 1T7WA 1T7VA 5HI5C 5J6GB 1N5YH 5IBLC 3SN6N 1M4KA 4PRDA 1L0YA 3IRZA 4DKEH 1Y6MR 4TVPL 3V79C 5EWIH 2ITCB 5K9QG 1QPPA 4OAWA 1XH3A 5CP3H 2V6HA 1UZ8B 5CINH 2ZUVA 3GSVB 1INQB 2JB5H 2VLMD 3HE7B 3K80A 2C1PA 4NYLA 3RX5A 4DOHE 2Q7YB 5C07E 5KTEL 1YEIH 2LE9A 4WDIA 1YEFH 2RCSH 3F58H 4XAWL 3D0VA 3TP4A 3KNBA 4D0BA 3DOSA 1U8JA 5MERB 3ZT5A 1T2XA 3DETC 4P9HC 4PP2A 3BN3B 2NCMA 3QWOA 4MZ2A 5LWYL 4Y8AA 3H9ZA 4N68A 5IVZB 5IMLA 3HR5A 4JVPA 2QQLL 4HIJB 4I48A 3VH8A 1W8OA 1N26A 4LCIH 2JIXB 3LN4A 2UZXB 3QO1B 4ZUWA 4NO0A 3EOBA 4Y4KC 2VL5B 3SGKA 4BQ9A 3HZVA 1MWAL 3V8CA 4QRTA 4LHJB 2QL1A 4JFOA 1XIWA 4I4WB