3HC3H

Bha10 igg1 fab double mutant variant - antibody directed at human ltbr
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
217
structure length
212
Chain Sequence
QVQLVQSGAEVKKPGESVKVSCKASGYTFTTYYLHWVRQAPGQGLEWMGWIYPGNVHAQYNEKFKGRVTITADKSTSTAYMELSSLRSEDTAVYYCARSWEGFPYWGQGTTVTVSSASTKGPSVFPLAPSSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords IMMUNOGLOBULIN IGG1 FAB, LIGHT CHAIN
publication title Structural understanding of stabilization patterns in engineered bispecific Ig-like antibody molecules
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2009-05-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hc3H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3hc3H01
4R90L 3TEUA 2VLKA 4P48A 4XTRD 3ARZA 1AGDB 1EDQA 4J8RA 1ODAA 3DROA 1TTUA 3EOAB 1D3CA 4PP2B 2FX7L 5DK2B 3VCLA 5GJTH 1UH3A 3UTPE 5CJXC 3BEWA 2VE6B 3TCLA 5ABDE 3HI1A 4P5KA 2ZZUT 5E4EB 1KPVA 3UTTB 2HA1A 5H37G 3TIEB 5GS0C 1BVKB 4LAJH 2DS4A 1L0YA 4U31A 4K7PH 2Y5EA 4F7EB 3EO9H 2Q8AH 1MJ7L 3RAJL 4G7VL 3BT2L 2VZOA 3F58H 3O0RL 3ULUE 5BOPA 3GMNB 4R2GD 1Y6NR 3VWKD 4XP9L 1TENA 3MODL 3HC0A 3NOIA 3V7AE 3QIBB 2GJJA 4RSVA 1T20B 4MCZB 3MRBB 2BY0A 4LLDA 4OM1L 4JB9L 3GI8H 3MCKA 4DFHA 1A6VH 1KN4L 3HCVB 4G8GB 3X17A 4J3OC 5EU5A 3CK0L 5K9KB 2OP4H 5CILH 4QXTB 3HFML 3LN5A 5HHXL 1VA9A 3TPUA 1TXKA 1HQRA 5IEKA 4XVUC 1X5ZA 1MPAH 4XAWH 4NQEA 4S11A 3PP4H 3KPPA 4TSAH 4UQ2A 4H8WC 5LXGL 5EUOB 2EDTA 1MLBA 3QCUH 1VFAA 3IDIA 4HBCH 4NCDA 2DQIH 2ICWI 2WUCH 3S35H 1L7IH 4JY5H 4QXUL 1GC1C 1S7SB 3VMPA 1DLFH 3E6FA 4JFYA 3PHOB 3AGVA 5E2TL 1EEZA 2YD5A 1JFQL 5J13C 2DWEB 3LS4L 4WW2F 5K59F 4HF5L 4HBQA 4KWUA 4GW5A 2KH2B 3FB5A 5DC9B 1WCQA 2WQ8A 3VD3A 2R69L 1HKLL 3NZ8B 3TV3H 5I71C 1VEPA 3L6FB 5L8LB 2F53E 4O2EB 5EA0H 1BBJA 3DX6A 3LZFL 2JLLA 3OR7B 5E0QA 3T0WA 3WJLA 1F11B 3MNWB 4IOSD 4MJIE 3TC9A 5DYOA 4UV7L 4XHJC 5BV7H 4IDLA 3ZKSD 4YLQT 2A73B 1YMMD 1UYWH 1QP1A 3QXVA 4Z0XA 3NABL 5DHYA 3VXPA 2LABA 1FFQA 4BQ6A 4U4BA 3PNWB 2QHLA 4WU5A 2V2WB 4WW2A 1DTUA 1QRNE 5BCAA 2J7LA 4PGDB 4ERSH 3MZGB 2A9NH 1LDPH 2DTMH 3VI3E 3AXLB 2VIRA 4JQVC 4G6MH 4HXAL 1ZEAH 4PLNC 4RA0C 1NC4A 1PEZA 4MX7B 1BQHB 2VKWA 3IFPB 1KTLA 4PV9B 2EYRB 5D1ZC 1XGUB 3DRTB 4HUMB 5C71A 3U6RA 1M7XA 4LOUC 4BZ2L 3O3AB 3L1OL 3BPLC 4O2FA 5IR1A 2Q7YA 1CZ8H 4XB7A 1YY8A 5C3LD 1YEDA 3GJFA 1I3RB 2NY0C 4KKLC 5GJTL 4LPYA 2V5MA 2BXYA 3FQUB 5DEZA 3HC4H 2P45B 1N2RA 1OTTC 4I0PD 3ARWA 4G9DB 4LCYA 3P4OA 1JZ2A 1OW0A 2Z0BA 3MRKB 2AJYH 3REWB 3WXWL 3SJVA 5TGBA 4LDEB 4K7PL 4GQ9H 3JVGA 3EO9L 2Q8AL 5BS0B 3D3VE 4CGTA 5IROA 4EVNA 1UZ8B 2A1WH 4NRZA 5CCKH 1PKOA 1QR4A 3KWWA 3VFVA 2GTZB 2OR9H 3NZHH 1WISA 4NN5B 2CUMA 4K71C 1G9NH 1JTPA 5GS1C 4DJMA 3GI8L 3RKDC 3EOYG 5F7DB 5J12B 1E4XH 1FZMB 2OP4L 1NAMB 1QBLH 4M3KB 5CILL 2XWTA 2GKIA 3MV11 5EIVA 3L5IA 4ZFGH 4OIAA 1UWEH 1MPAL 3FRPG 4LEOA 4XAWL 4NM8H 3PP4L 4KJYB 3KPRA 5IKCA 1FG9C 4TSAL 5DDHB 4AIXA 2OZ4A 5DD3H 4E9LA 3QCUL 4HBCL 1A6PA 1KJVB 2DQIL 2WUCL 3S35L 1L7IL 3SBWA 4JY5L 3LH2H 1QA9A 1DLFL 4U0RC 2J8OA 4HKZA 3OR6B 3I3EA 4R4BB 2E3VA 1UENA 4UBDD 2AI0H 4PJDF 5E5MA 4CN1A 4MJ5B 3RWFB 3HRPA 3ALXA 2P46B 3VH8G 4KK9D 1QFHA 3KYKH 3RIAF 3W81A 1IGTA 3TV3L 1AGEA 3E2HB 1T1YB 4H26B 1U8QA 3VGGA 4Q9QH 4HKJB 3NCMA 3OXRA 2LAAA 1NSNH 4Y4KC 3EDJA 2GJ6A 2NY2B 2NY7H 4K8RH 4QCIA 5DUBB 2HVKB 5BV7L 2DQFB 4GW4A 5KN5B 5D2NA 1UYWL 1RZJH 2ESVE 4LEXH 2XTLA 4IEFB 3ZE2F 2ATPA 1UVQB 2VJXA 3CFJB 1JWUB 2C4FT 3IFOB 2K3TA 4PJDA 4POZD 4FTVA 3C8KB 5ACLA 5D1XA 1IC4H 2EZ0C 2Y23A 5L2JB 3I6KB 4DZBB 2P5EB 3KDMA 1T83A 4GW1B 2OK0H 4ERSL 3MJ9H 3O45A 1LDPL 2DTML 4ZUSA 1JUFA 3NIFE 1NH6A 5D1QC 4G6ML 1ZEAL 3GFUA 1UA6H 4G9FE 1BFOA 4HAGA 4IJ3C 4U49A 2BVOA 3QUXA 4C57C 1A21A 1N59A 5FYJH 1OP3K 3LEXB 4TQEH 3DETD 4RISH 3KPQA 5JOPE 3RWDA 4PFEA 2XV6B 1CYGA 4LVHB 1CZ8L 4BQBA 2YEZB 2ICWA 2BZDA 4M6MH 4YBLC 3ZLQC 5K9OB 3KPNA 1FZKB 2ZPKH 3ZKXB 2P5WB 3HC4L 5C08B 4HK0A 5FEBA 1AE6H 2RFXB 4U1SA 1IEHA 1D6VH 1MH5A 4G8EB 3QI9A 4H1LG 3FQRB 2AJYL 2PXYB 5IBLD 3EJYD 3P9LB 3QEQA 4O02H 2OM5A 1EPFA 3RVXD 4LHJB 4JO2L 1VGKA 4GQ9L 4NQXA 5C0AB 4J4PD 5A2IH 1Y6KR 2MKWA 4L8DB 2X4SA 1ZHNB 1J05B 4URTB 3MRGB 5CCKL 2OR9L 2FBJH 3KHQA 5J1AB 3NZHL 1XCTB 3O9WB 3U9UA 4NQCD 2X4RA 3QSKB 1G9NL 4RGMB 5A16B 2H6PB 3QJFA 4MB3A 1KJ2A 5DF0A 4ZSOB 5HY9B 3V52H 2HLFC 2JIXB 4EOWH 3MGTA 5E9DD 3GSRA 4MJ6B 1Z9MA 1E4XL 4JM2C 3X13A 1QBLL 1VFOA 2Y72A 4NBYB 1NCCH 3O6FD 4ZFGL 1UWEL 4BFIA 3I75A 1RUQH 3ARDC 2EE6A 4NM8L 3CH8A 3IETA 2BNRD 2C3WA 4WI2A 3X12A 2X1OA 5E8NA 2BCKB 1T22A 5DD3L 1FVDA 3BE1L 1T3FA 3D85B 4X6DF 2G5BB 2PYEE 3EO1B 1Q9KB 2CJUH 3MV9B 4EUPG 4LPCA 3MJ8B 3BISA 3LH2L 2EDHA 1MFAH 5H35B 5F1IA 3SPVB 7FABH 3T09A 5KSBE 1SVZA 2AI0L 1KGCE 4HH9B 1OARH 2QKIA 5KG9A 2X4TB 4M9OA 1YPZB 4WI5A 3VH8B 5DJZB 4NKIH 4PG2A 5CAYB 1GZPA 2B5IB 3L7FA 3KYKL 3U36A 5I6XB 5C0IA 3H8NA 4UAOB 3BKMH 3V6ZB 4J3WA 4H20H 4IRJD 1KIRA 1NSNL 1RUKH 4PY8J 5D9SA 5JNYB 2NY7L 4X6DA 1FV1A 4K8RL 4X4MA 2AV7A 4N8VA 2DD8H 3CDFA 2FIKB 1OAZH 5GRYA 4GSDH 2IAMD 3PGCA 4LEXL 5I1CH 3OJ2C 2VLKE 4C55A 3NIDE 2AXHA 4FFYH 3WN5B 5GZND 5HHOE 1G7MA 3QISA 4Y5VB 3EW3B 2BY3A 1WWCA 2O5ZH 1IC4L 1CLOL 1FIEA 3CSPA 4NUJB 4PRIB 5FF6B 5IW1B 3STZA 5D6DA 1OGTB 5CSZB 1WIPA 3EUUA 3MJ9L 3SE8L 1KNOA 3PV6B 3O2WH 4HUXA 4Y19A 3T0ED 4ZUWA 5J11B 3CU1A 3WFZA 4CUCA 3C6SB 1UA6L 4L29A 5DJDB 3ZZ1A 3KLAA 5HGHA 3IVKB 1T7XA 5FYJL 2W60A 4G3YH 1T7WA 5FYLE 3WYRA 2VDPL 4M1DH 1YNKL 4TQEL 5HYSB 3G9AB 3VD7A 5AAWA 4RISL 4PG9A 2XOTA 1T5XB 1K85A 2GTWA 2WIMA 4WY7H 3HE6B 5EUKB 4X8XA 5JPNA 4M61A 4WGVB 3OJMB 1VADB 4M6ML 4ODXA 3ROLB 4G5ZH 4OUUB 2ZPKL 4J12A 4U1JA 2X5PA 1QO3A 4LMQI 5DD1H 1AE6L 1G1CA 1P1ZA 1T04B 1D6VL 1K4DB 4CVWA 4H1LB 1IGYB 1FHGA 5C0BD 5C9JA 3MRPA 1YY9C 3BEVA 2VUOA 1FFNB 4NQEE 3QUZC 3QFDA 5CP7A 1IKFH 2F9BT 2H26B 1FL5A 1QD0A 1WBYB 4JRYE 4PJHF 3O11A 5JOFB 2D7QA 1INEL 1P53A 1M4KA 5C09A 5DJ8B 2FBJL 5F89A 1QR1B 2B20A 4KU1A 5ETUA 2YWZA 4XBPA 3W9EB 5EZJA 4O5LH 3PHQB 3DBXA 2L0DA 3V52L 4EOWL 3KJ4C 2QADD 1S8DB 4F8TA 4I5BB 4HCRH 3RWIB 5IMKB 1HCFX 1RUQL 1XGQA 3IT8D 4ZXBB 3BW9A 1I1AB 5ERWB 3HHRB 1RK1A 4PJHA 1EHAA 1IZKA 3VXSD 4D9LH 5TDOA 1NBZB 1FC1A 4EUPB 5IVXB 1KT2A 2IBGA 2CJUL 4U6XA 5EO0A 1SQ2N 4UUJB 3MA7B 1XF3A 1MI5E 1MFAL 4MD5A 1NDMB 4J3TA 5JOEA 1F3DJ 3HS0A 3JUYA 1OARL 4RGOH 1JF1A 2CLZA 4KKBC 1JHLH 4YZFF 4X7CC 5DRNB 5SX4H 3V4VH 2VLRB 4LASL 4NJAH 3RL1A 1WWAX 4FABH 5ISZD 1HHIA 2AK4D 2NXZB 1CS6A 3BKML 2YA2A 4H20L 1RUKL 3QXDB 4L9LA 2IFFH 4G42B 2DD8L 3FO9A 1WK0A 5D93C 5IB2A 2DWDB 4GSDL 2BX5A 5I1CL 12E8H 1EX0A 5ICZB 2H32A 1M71A 4FFYL 2Z92B 1K8DA 4YH6A 3T77B 2GSGA 2P24B 1TVBA 3CVHB 1D5MA 3QUMA 2O5ZL 3UROR 3NFNA 1G84A 2WMPA 4IIQB 2R1WA 2YD2A 2HTKD 4TUJA 1NUGA 4M3JA 5EIQA 3O2WL 2E5EA 3SJVE 4CMHC 5JW4N 1RUMH 3F7VA 4P2OA 4BJLA 5K9QG 4APQB 1NUNB 2XICA 4JFOA 5ICYB 3QDME 1CIDA 1IAIH 4X8JA 4G3YL 1NANH 2PCPB 4B7LA 2ICEA 4M1DL 5E1AA 2QQLH 1CDYA 5JDSA 4Y4FD 5EBMA 1IM3B 4JLRA 4WY7L 3ARBA 1EERB 2NZ9C 2K7PA 3QJHB 4F7TA 4Y5XA 2J5LB 3SKJH 4Z7WF 2HFEB 5GGRY 2AABH 1OP5K 5DD1L 2W91A 1UXWB 2DJ4A 3S96B 4JO3H 3HZYB 5EWIH 2ENSA 5F7LB 2E8ZA 5GGSA 2YZ1A 4Z77B 4RDQG 3OJDB 2J6EA 4OGYH 3QQ9C 4IOFC 2D31A 2XG5A 3QDJA 4WFFD 1IKFL 3RWHB 5KOVC 1FG2A 3E0GA 2DLTA 3O4LE 2RAMA 1W0VA 1L7TH 2OMBA 3QNYA 4LBEB 5DI8A 2PTVA 5EIIA 2Q86B 5T3XE 5L8KB 2YBRA 1OLLA 1LE9B 4Y2OA 4O5LL 1MAMH 4Z7OF 4Z7WA 1Y18A 3OKNB 4O51B 4PJCF 1MHEB 3HNSH 2FJGA 4OQ1A 4DAGH 1R3LB 4AQOA 3FN9A 3TN0D 4LNRA 4HCRL 4Y4HB 4U1IA 4OLUH 4S0SD 2CIKB 2V7HB 4GAJH 3TJEH 2E7BA 3FCTA 3OKDB 2A6IB 4HKBA 5KS9F 2DJUA 3GBNH 4G7YH 4RQQB 1P84J 1YN7A 1OSPH 1D9KD 5CHNB 3JWDC 4PD4K 4ODHH 4WTZG 2H3NB 3BZEB 1B90A 2H8PA 4Q0XH 5FOBA 3P9WB 2ARJB 5DURD 1ZHKA 4YFLI 3HB3D 3IS1X 2VABB 3C60D 3ULVE 1MCCA 3AVEA 1AR2A 4PJCA 4FTVE 4Z7NF 3MV8B 3TVMC 1NMCB 1CXIA 4KXZI 4RGOL 1EO8H 1JHLL 4MQTB 4YHLH 4NO0D 5CBAB 4FQXB 2R15A 4PJGF 2HVJB 3LD8C 4GLRI 4MNHA 3S34H 3V4VL 1X3DA 4NJAL 4XHQA 5GISH 3RWEA 3W2DH 4IOIA 4FABL 1QFWL 2JJTC 1NKOA 4MNGB 1NUDA 2CKBL 1FBIH 4HDIB 4D9QE 1U9KA 3DV6B 4I3RH 1TZIA 4F3FB 3W11D 3U79A 1QSFB 3GMLB 1X4YA 4NHUB 3WD5H 4NO3A 5T3ZH 12E8L 1U8OB 1SYVB 4PJBB 3WIIL 3ULUL 3B9KC 1BLNA 2N1KA 3MOQA 2G9HA 3HNVH 1KTDA 2VLLB 2BC4B 3VFUB 3ARGC 4GG6F 1SJHB 4PJGA 4OFVA 5D2LE 1WC7A 2VZ3A 2DKSA 2ERJB 4UIMB 5F6IB 1VFBA 2IANB 3IDXH 4KQ3H 3QEQE 1KYOJ 1RUML 4RAVB 4IRSD 4WTWA 4I8DA 3R0MA 1FFPA 3MJ6A 5IB4B 1I7ZA 4DKFH 2ZSWA 5DQ9B 1IAIL 3QUKB 1IJ9A 1SJEB 3PXJA 4JFFD 5DK2A 2WBJB 2QQLL 4Z7QE 3D39D 5FKAA 2A6KB 1S9VB 4P2QD 1EHLH 5JUEH 4GG6A 4W68A 3UTTA 2AVGA 4ONFH 4B50A 3UPRA 5IP4A 3RPIA 3TPKA 3TIEA 4ZQKA 4Y16C 1L9MA 3H7BA 3WLWD 4JO3L 2F58H 5EWIL 3KR3L 5ELIA 4C56D 2DI8A 1HXYB 4GG8B 5JMOC 3ZE1F 1H5BC 3F5WA 4YDIH 4C58B 3DXAA 3GMNA 4RMTA 2R2EA 3RIFK 1DQJA 1S7RA 3C6LC 1MCWM 1SHMA 3VFGL 2EDLA 1L7TL 1X5YA 1A9BA 3MRBA 4MCZA 4ZPTB 3IKKA 1WVZA 5EPMA 2I26N 2XTJD 4L3ED 4P5TB 4WFHE 4D94A 2GIYA 7CGTA 3MRQA 1MAML 2FHBA 1MWAB 1HKFA 3CLFH 5IQ9A 3QRFM 1BIIB 3BIAX 3HNSL 3HUJF 4DAGL 5IB5A 2DJSA 3IDNB 5CMAA 5JORB 1U2CA 4YHPA 5D7IF 5BJTB 4OLUL 3VGAB 5DS8A 4DN3H 4GAJL 3TJEL 1G7HB 3CXHK 3GBNL 4G7YL 2GITB 1OSPL 2BDNH 1RFDH 1MCPH 4ODHL 4X4ME 3VRLF 2GAZA 3S7GA 5IG7A 4Q0XL 4JFHD 3G6JA 3QO1A 1PZ5B 4X0KA 1XAUA 1FLTX 3E8UL 3KYOA 2COQA 3NIGF 1HIMH 3N1QC 4DTGH 3HUJA 4KK6D 4HEPG 8CGTA 1FRGH 1EO8L 4YHLL 2FGWH 1CF8H 4WTXA 3P77B 2NQCA 3PDDA 5D7IA 3L6FA 3ZKND 1IEAA 4YDVA 3S34L 4LQFH 1XCQA 4F37F 3QUYA 5GISL 3KNBB 1F11A 4Y19E 3W2DL 5A3ID 1T0NB 2F5BH 4M93B 1A6ZB 3N06B 3CDYA 1FBIL 3WFBH 5ECJE 2Z93B 4I3RL 1W2KT 4HIXH 1OAQH 4G80A 5EFIB 3DX8A 2OTUB 5C8JB 5TE6H 4OLZH 5DZLA 3WD5L 2CQVA 3BDYH 5T3ZL 4KTYA 3CPLB 3K1DA 4OGZA 1I1CA 3HNVL 4YFLF 4PGDA 4JJ5A 1W0WB 1MQKH 5KSUA 4LNVA 3GKWL 3NA9H 3BWAA 1NBYB 4HX1B 2LTQB 3H3PH 2EC9U 2PW2B 3IDXL 4KQ3L 4MA3A 4V2CB 5BZWB 1GGYA 2OXHA 1CT8A 1QBMH 5IMMB 3IFPA 1FJ1B 3D9AH 4PV9A 2Y6SC 1FPTH 2EYRA 5E6IC 2XN9B 2JTDA 1XGUA 3DRTA 4DKFL 4N0CD 4PRPD 2Z8VC 1S7QB 3EYUH 3LKOB 4HIIB 4IMLB 4WHCA 2YD8A 2NYYC 3RA7H 5EOCJ 5C09E 4XX1E 4WWKD 4HMEA 5ESVB 1KLFA 1RJYA 4G8IA 4PJXE 3U7YH 4PY7A 3UYOD 1EHLL 1AKJB 5JUEL 3KPSE 4UINH 4R4FH 5I75C 1JWSB 4ONFL 3MLTB 4Y2DD 1LEIB 3CFIC 3HPLA 4G6JH 1FYTE 3OV6A 1RV6X 2YRPA 2F58L 5BS0A 4MA7H 4HT1L 1F02I 3TO4C 1T0PB 2NX5D 1R5WB 1X5AA 4HJ0C 3QXUA 4YDIL 1UZ8A 4EN3C 4H0GA 4X4YB 3MREB 1IRAY 4EI5D 1IAKA 2GTZA 1ZT4A 3C87A 4MLIA 5D70H 3C5SA 3OX8A 2RIKA 4XPGL 4JO4H 3ECBA 3WKMH 4OF8A 3UTSD 1CE6A 3JV6A 1U3HC 4PRHB 5CP3H 4EXPX 1G7LB 4K7PX 3T0VA 1T7YA 3U1SH 2H9GB 4AEIH 4PJ5B 3O3EA 2XYCA 1L0QA 5SWSD 1TVHB 3MYJB 5J13B 1ZAGA 3TBSA 4L3AA 4LPXA 3CLFL 3JV4B 1DVFD 1SBSH 3PWNA 3P0VL 3QBTB 1BOYA 3FOMA 4ZFOB 5HGAB 4ETYA 5JXED 5IMOA 1CD9B 1YMMA 3QPXH 4JCMA 4DN3L 3Q2CA 4KKAD 3BD3A 2FJHA 4WW1B 5FA3B 5IJVB 1BD2E 3H0TB 4X6FA 3WFCH 5HTSA 1TLKA 2BDNL 4JPIB 1KJVA 3FT2B 1P4BH 1MCPL 2V2XB 3MV7D 3PP3H 4KDWA 1KBGH 1R0AL 4CDHA 2WUBH 2QBWA 4XC1L 1SEQH 1GOFA 2E7CA 1QBAA 3UZEA 2PR4H 4JPVH 1WQVT 4MJ5A 1KXVC 4AQ1B 4K3HA 4YIQB 3GRWH 4P0DA 5SWZB 1TQBC 4RFOH 1EUUA 4DTGL 3S35X 4Y1AD 1FRGL 2IPKB 2FGWL 4XXCA 1T1YA 4LQFL 5IK3A 1UH4A 2ZG2A 4JVPA 1SM3H 2ITDB 1HINH 2EDDA 3MX0A 2F5BL 3H9SE 2VDLH 5D96B 4Q58C 2KQMA 5D1ZB 1JPFB 1RZGB 2Y5TB 1YUHA 3WFBL 4W6XB 2FO4B 5IIEA 4HIXL 1OAQL 2WLYA 2A0LC 3CFJA 3KYMB 5TE6L 4I0PA 4OLZL 4S0TD 4PJEB 3IFOA 3BDYL 3GSOB 2NY0B 3SDCB 2P8PA 3AAZA 3C8KA 3LB6D 5GS0H 1FVCA 3TT1H 4DZBA 1XGPB 1FNEB 4GW1A 5MERA 4NZTH 5CSBA 1RJZB 4OF3A 1FQ9C 3MOBH 4J1UA 5J6GB 1GAFH 1MQKL 1ZT7B 1OTUC 4K8RD 2EO9A 1PZUB 3NA9L 2YKLH 3H3PL 3UCRA 5CBEB 4YXLH 4POUB 3RWJB 1TJIL 1JYVA 1M7DA 5HVWA 3MA9H 1QBML 4K3GA 3LEXA 3D9AL 1FPTL 4JHBA 2QTEA 4QRUB 1JI1A 3EYUL 4EIGB 3F7YB 3VRJB 1NJ9B 2YEZA 2NY3D 1D6EB 1FZKA 2R1XB 5I1DA 4JRXB 4LGRB 1P2CB 5GS1B 1GOGA 1WZMA 4ZAKD 3OGCA 4CU8A 4OGXH 1AP2A 2HWZH 1I3VA 3U7YL 5LAXB 2NXYD 4H8WH 4R4FL 2X4NB 3LEYH 5FYJD 1R24A 3QQNA 5JQHC 5TPWH 3TNNB 4ZFFB 4HJGB 3FRUB 3I6LD 5GGRB 4G6JL 3PWJB 1F58H 1J0HA 3WJLC 1GC1H 4POYA 1F4XH 3V5DA 2FSEB 5JW5B 1T2JA 1ZHNA 1MCLA 3ZYIA 4BYHA 3QDHA 4DK6A 5JHDD 5D70L 5J1AA 4JO4L 5A2JH 3WKML 3CCHA 2PW1B 3U1SL 2H6PA 4AEIL 5KANG 3FQTB 1HXMB 3MNZB 1RZKC 4WW2C 4JREB 3TA3D 3EZ8A 3MUHL 4MD4B 2JIXA 1MOEA 4QRTB 4QRPB 4GRWE 4Z7OE 1X5GA 2AP2A 1MQ8A 2DICA 4PJCE 5TFSH 1YPZF 2NY1D 1SBSL 4QOKB 1RVFH 5E4IA 2EE3A 4ZUVB 2BRRH 4ZUUA 3R1GH 5I73C 3EYFB 1LILA 2BOBB 4NSKA 3IKCB 1LEKB 1S78C 1N8ZB 3QPXL 2VDOH 3D85A 1EEYA 5IMLB 4DW2L 3EO1A 2QL1A 1S7UA 3WFCL 3HAEA 4ZNCD 2G75B 4PLOB 4YE4H 1BZQK 1YMHB 1P4BL 2Y25A 5GGTL 1W0YT 1Q0YH 2BMKB 1KBGL 2WUBL 2FHFA 3O6LH 1SEQL 4LF3A 5LGJA 4JPVL 4FHBD 4OI8A 3PABB 2NY4C 3MRMB 2ZKHH 4G43A 3ZKMD 2IQAA 2IADB 1YPZA 1PG7W 3DSFH 2HP4A 2QEJA 1OW0C 3AY4A 2FJFB 4RFOL 5DD6B 2MCG1 4GRLD 1ITCA 3O4OC 4MJ4A 4HGMA 3FB7A 4PJGE 5D1QB 2FYYA 2HH0H 3V6ZA 4N0RA 1XF1A 4IJ3B 4ZO8A 1SM3L 5JNYA 4RWHA 5IROC 4P4KD 4RCAA 1HINL 1LQSR 1ZT1B 2VDLL 5GGVY 3TNMB 1ZLWH 4JFXB 5BRZD 1CFTB 3C8HA 4NDMA 2OS7A 4GKZB 5I1JH 2FR4A 1Q94B 2ADFH 3MFGB 1A1MA 2A6JA 5B38G 1LDSA 1NFDB 1SY6H 4Y5VA 2CUHA 2ARWA 3TT1L 5F3BB 5FF6A 5IW1A 4P46D 1Z9SA 2VWEE 2XRAH 3MOBL 4LSSH 5FCSH 3PV6A 1GAFL 1P4IH 4J4PA 2YKLL 2X89D 3Q0HA 5C07B 3VMOA 5DJDA 3N0PB 4YXLL 1HYRC 4XRCA 3IVKA 2JK5A 2V5SA 4JPKH 3SQOH 1REIA 3MA9L 3OKOB 4M6AA 4CMMA 5AG8A 2BNQB 2YS4A 4NQCA 1K5NA 1ACZA 3SBWC 1BECA 1CN4A 2EEAA 5I9QC 4IM8A 3MMEB 1CL7I 5E9DA 1VADA 3ROLA 1TMCB 4OUUA 1UKTA 2H45A 5DHVH 5DFVD 4OGXL 4KROB 1P6FA 1UWGH 2HWZL 2HMID 4HXBH 3RDTD 4JY6A 4GUPA 3RVTD 3BP6B 1WV7T 1KJMB 1V7NH 3BN9C 2B4CH 1F4WH 3N1GC 5TPWL 5LGHH 3VFWB 2DF3A 3ARDB 1F58L 1DN2A 4D0CB 1GC1L 2H26A 4L4VD 1KPRB 3K4ZA 4Y89A 5D2NC 1BFSA 3VWJD 4HMDA 1MJUL 1U8MB 3FT3B 5B39G 1LE5B 5FECA 3L9RB 1NGYA 3RX8A 4UDUB 3G6JE 1H8NA 1VACB 5D1XC 5HHPA 2AERT 1ADQA 3MBEB 1T83C 3G04B 3MNVB 1CDUA 5TFSL 3QZWG 5M94B 4WI4A 3HUJE 2BVUA 1IM9B 1RVFL 1R5IB 3RWIA 1YC8A 5IMKA 3AB0C 3CSYB 4OGAC 4P9HH 2BRRL 3R1GL 5ERWA 1P7QB 5D7IE 3QUXC 2HJFB 1W72B 4KMTH 3DUUA 2IAMA 2VDOL 2ZCKH 3VXQA 4KJQC 4S1DC 3PDGA 4QRRD 4WWID 1NBZA 5I8KH 2DQEH 3ARUA 1MF2H 2YD4A 2NMSA 4YE4L 5D72H 4UUJA 4N90D 3BSZH 3DO7B 4YO0A 3NCJH 1Q0YL 1NDMA 3O6LL 2CK0L 1T2XA 1TQCC 1K4CB 4FQ1H 4MS8D 2QLVB 3KYNB 3NIGE 4X98B 5JQ6H 3DSFL 2V9RA 1FYHB 3LHPH 3QI9C 4JO1H 4LCWB 4PJ9D 2VLRA 2NW3A 3LIZH 1WCBB 1XR9A 3ARPA 2HH0L 4P3DB 4YGAB 4TNWF 4K9EH 1OB1A 5T1MB 1FN4B 4A2LA 1ZSDA 3RVUD 4G42A 3V7AG 5I1JL 3L3HB 5KVGH 4XPBH 2ADFL 5B38B 4F7CA 1MCKA 1HEZB 1SY6L 2P24A 4LP4A 3CVHA 4DEPC 5C0BA 3TIDB 4W6WB 3V79C 4IIQA 3TBTB 4ONHB 2AEPH 4LSSL 2YD9A 3EJJX 1EZVY 5T3XL 4MQXD 3VXTA 3TYGH 1P4IL 4LSDA 5FM4A 2HRLA 2R39A 3ISWA 4QY8A 4JPKL 3L95A 3SQOL 3V8CA 2D0GA 1PYWB 1XH3A 1UGNA 4MWFB 4FQHB 3LQZB 5IUSA 5I1LB 5IHLB 2UUDH 2ZG3A 4OCWH 3GSNH 2A38A 1T7VA 3HI5H 4IRZH 4TNVK 4CVUA 2H2PC 3QJHA 1O5DT 4CNIA 5MEND 3BRGC 3FZUD 2N56A 1KOAA 2YPLD 4U2YA 2HT2C 1UWGL 3KJ4B 4HXBL 4I77L 4PG2C 5E2UH 3EHBD 3S96A 2VN4A 1V7NL 1BVLB 2B4CL 1F4WL 5LGHL 4ORGA 3ULVL 2MHAB 3VXSA 5DO2D 3QXAA 1F6AB 3G08B 1YMME 2XZAH 2VL4A 1I1FB 4F9LA 4PJ8D 1QLFA 4QHUB 5GRWA 4LBEA 3BXNA 3GSVA 5IVZA 2Q86A 3D2UB 3UEZA 2F8VA 5E6ZA 5HVFB 3DNKA 3PDOA 5FGSA 3OKNA 4YHIB 1MHEA 5DJCB 3DSNA 5D6DC 1H3XA 1R3LA 2AEIT 3MO1A 3P40A 5ISZA 2BERA 3MUZ1 4GOSA 2DLHA 4X5XA 1YEHH 4Y4HA 3STBA 3CDGA 2V7HA 4P9HL 5HI3C 4OD2B 2R1YA 2AJ3B 5BZDA 4KFZC 1RHFA 1ZVSB 4KMTL 2ZCKL 5CHNA 3MV01 4OZIE 2IPTH 4JFZH 3A6CH 5I8KL 1Z3GH 2DQEL 4HLZG 4IHOA 1EGJA 1MF2L 3O3DA 4LSUL 3SN6N 3VXRB 2VZTA 5D72L 3OKYA 1FORH 3DLQR 3BSZL 3RVWD 2BVQB 3K0WA 1JPGA 2VH5H 4XP1H 1OGAD 1EK3A 4PJBF 5J57B 4FQ1L 3PWVB 3MV8A 1Q72H 2CKBB 2OI9C 4HQQH 5FO7B 5CBAA 5JQ6L 4XMLH 3GGWB 4PLKD 3LHPL 4MA8H 4JO1L 3RZCB 4F7PA 4RWYH 1I85A 2D2OA 3LIZL 2IH1A 5H94B 3ET9F 5C0EB 5CJOH 3IRZA 3PWUB 4K9EL 4MNGA 1ONQB 4E41D 1TVDA 4BQCA 4Y4FA 5GGQH 4F3FA 5IGXH 3GMLA 5T1LD 3BHBA 5J0BA 1DQLH 1OCWH 2DYPB 3WIFB 1J1PH 4AM0A 5FB8B 4X9HA 5KVGL 1U8OA 1J11A 1LK3H 1SYVA 4Q9RH 5TDNB 4L5FH 4PJBA 3OKEB 3WFHB 3U83A 2MQ0A 2CDFA 3IAGC 4ODUA 4L8BA 1T21A 4NFDA 3MRDA 1B6UA 3CH1B 2IANA 3TYGL 3DTXB 4HS3B 4NZUL 4RAVA 4PRNB 4RDQF 5EU7C 3U0WH 3D3VD 5T3ZD 5D6CB 3UTQA 4R3SA 5DJAB 1ES0B 2ZJSH 4U1GC 2VXUH 4OCWL 2Z4QB 2BVPB 1CFSB 3GSNL 3HI5L 3DUSA 2O5XH 3FQXB 3QA3B 4IRZL 4JKLA 4PP1C 4NPYA 5AZ2L 1ZHBB 4N1HB 4Q2ZB 3TN0A 5DSCB 3Q3GA 5GIRB 3QEHA 5E2UL 2DQHH 2F53B 2W07A 4X9GA 1PLGL 5KZCD 4WEBH 4B53A 4MJIB 5HYJD 4LIQE 4V1DD 1UM4H 1D9KA 4N1CA 5L9DH 4Z8FH 4OFYD 3QH3A 4L9LC 4OCSH 4G8FB 2I07B 2XZAL 3ZO0A 5SWQA 4WVRA 4KGJA 3ZTJG 4ZPTA 3NFPB 2KZ1B 1HHJB 3KS0H 2O5YH 1QRNB 5AYUH 4JFDD 4D2NA 4NO0A 3HN3A 1YNTB 2L7UA 3RGVD 2X05A 5LVEA 1U36A 4K3EH 3T0XA 3SHSA 5JORA 3TFKC 1KIPA 4WI3A 3WUWG 4P2OC 2PN5A 3GO1H 3TBVB 4FMFA 3UDWC 2AEQH 3L3KB 5KSVA 2GITA 3WXVL 4KZDH 1CLZH 5IOPB 5F7HA 2IPTL 4JFZL 3T08A 3K80A 4BH7B 1AC0A 1Z3GL 3VGEA 4KI5D 1C5CH 1PZ5A 3ARBC 1FORL 3AC0A 2CO7B 1MFBL 3DUHA 2VH5L 4XP1L 5BVJA 4QT5A 5EBWA 4Y5XC 1MHCA 3BQUD 4R6UA 4P23D 1IQDA 1Q72L 1Z5LB 3HMWH 3ARGB 4HQQL 4R7NA 3DRQA 5HHMD 4XMLL 3P77A 3DVNB 4OKVB 4QTIH 4MA8L 1NCUA 2XQBL 3IDYB 1ZWIB 3SGDI 4IMKC 1DQTA 3VFNB 3D25B 4XCEB 4RWYL 4NNYA 2YUWA 4U1LA 1ZS8B 4LLUA 1TPXB 4TPRH 4UT7H 1J8HD 1J7VR 1DDHB 3FTGB 4JFFA 1YN6A 5GGQL 4WUUD 5IGXL 3BKYL 2OTUA 4NQCE 4JZJB 2R23A 3BIKA 1DQLL 1OCWL 1VENA 1CVSC 1J1PL 3T3PF 2YMXL 3CPLA 4Q9RL 4L5FL 1ZVYA 3DX7B 5E9DE 4CADA 5I16B 2KPNA 5CINH 2HJKA 4JDVA 4RGNC 5F3HB 2XWBA 5CWSB 4Y7MA 4M7LT 4MHHG 3PE9A 2OSLB 1NBYA 1AI1H 4QLRA 1GCFA 2APTA 4GH7B 2MTPA 4Y16B 3B8YA 2ZNWA 2PW2A 2BNRE 3UBXI 1QYGH 3TESA 5BZWA 4N0UA 2OR8A 5D71H 3F12A 5IMMA 3CFEB 1KTRL 4F80A 1I1YB 1H5BB 4Y5YA 5CGYC 2HT3D 2XZCH 4HGWB 1P6AB 3GHBH 3GSXB 3J8F7 1T1XA 3DMMD 4HIIA 4IMLA 3PQYB 1CLYH 2ZJSL 4TTDC 1DEEA 4L3EA 2E7LA 2O5XL 2Y7QB 2V5RA 4XGZB 2MPAH 5ESVA 1N5YH 3SEPA 4DKDC 4JZNB 3IGAB 4BKLB 2P49B 1LEIA 4M1GL 4UV4H 4RBPH 3AROA 1IFHH 4BSVB 1II4E 5TDPA 2DQHL 4NGHH 3B2VH 3JWDH 3K8MA 3RL2A 4E42B 2VZVA 3IJSB 4ZS7H 4WEBL 4PV8A 1R5WA 1UM4L 3U0TB 4Z8FL 3IXAA 3SDAD 1DQQA 4OCSL 2ESVB 4BA8A 3UYPA 1F2QA 4BQ8A 3OF6A 2PYED 1DUZA 4Z76A 1G7LA 4D3CH 4N0FB 5HYEA 5AZEH 3L3GA 2CDGB 3OKMB 4HHAA 2O5YL 2CSPA 3M17A 5AYUL 1JGUH 4OI7A 3WE6B 4XH2B 3H3BC 3F65A 4ODVH 5DJ6B 4U6YA 4K3EL 3T0EE 4I9WD 1K6QH 1M1SA 1QBBA 4G9FB 4QF1B 4FFZH 5HGAA 2P1YA 3WUWB 1AD0A 1YQVH 1J8KA 4NQDD 3GO1L 4LSRH 3VI4E 4PGBA 1FNGB 2AEQL 3H0TA 4XPFH 3ARED 5CEXB 3DIFB 4AMKH 1CLZL 3BP7B 2VQUA 2V2XA 4X99B 4YUEH 5FDWB 1RIHH 1C5CL 2P42B 2VKXA 2HT4D 4PJEF 5HHOD 2UUDK 2H2SC 3INUH 3BGMA 3LSOA 3TBYA 4YIQA 5E4EC 2PETA 5GRUH 2EDNA 5SWZA 3BJLA 3HI6H 3QRGH 3HMWL 2UY7A 3MFFB 3Q5YA 5C0BE 5AUMA 2ADGA 3FB6A 1D5BB 1JZ6A 3KLDA 2EH7H 2C9AA 4QTIL 1G6RH 1KB9K 4PS4H 2ITDA 2GYSA 3L3OB 5FO9B 2Z8RA 3O8XB 1B2WH 4TPRL 5E6IB 4LRIA 4EDXA 5KANI 2GJZB 2LV4A 4WWKA 5L7XH 3QIBC 5E5UB 4WI7A 1KLUB 1GOHA 4PJEA 1A9EA 2FCBA 5HHQB 4XCCH 1CFNA 2JB5H 1FNEA 4Y2DA 2DMKA 5I18H 4L8SB 1RK0B 5J6GA 4WV1A 2OL3B 3SKOA 4JFED 1AI1L 1PKQA 1S5IH 2NX5A 4P2CG 4MDIA 4DKAA 2YOCA 4IS6A 1QYGL 1X5XA 5D71L 3ILQD 3C5ZD 3VXSE 3UTSA 4EN3B 5GS0D 4OAWA 3GHBL 1A02N 3MRIB 1U93B 3W5MA 1A3LL 4YAQA 1CLYL 2ADJB 1HWGB 2ZUQB 3VRJA 5SWSA 1NJ9A 1R3HA 1D5XB 5C3TA 5B3NA 4JRXA 2MPAL 5KSBB 1OT1A 4M00A 3K7UA 1N5YL 1DVFA 4M1CC 3DI2B 3ULSA 4F9PA 3HMXA 1I8MB 2EYSA 2X4NA 4NP4H 5BOZG 1NC2D 1PY4A 2R4SH 5JXEA 4UV4L 3TNNA 1IFHL 4X6CE 3FRUA 1CDBA 4NGHL 5ISZE 3JWDL 2WWMC 2ICCA 2AK4E 3QUYC 1EZVX 2R0WH 4ZS7L 4L4TB 5C0CD 3VXUD 4KRPB 4XTRC 3MXVH 2EDBA 4S1SH 2VLKB 2G2RA 4J8RB 3DROB 2PW1A 4D3CL 1X6LA 5CJ5A 5FDYA 5AZEL 2A77H 1MI5D 4YEFA 4EBQH 1F6FB 3BEWB 4QRTA 3NMEA 4Y1AA 4Q6IB 3TCLB 4JQXA 2FECL 3HI1B 3S3SA 4EDWH 1KPVB 1JGUL 4YK4C 4QOKA 4A6YH 4M6OH 4ODVL 2DAVA 4ZUVA 1K6QL 1VB9A 4FFZL 5E2VH 2XIDA 2BOBA 4U1MA 1YQVL 3BPOC 4LSRL 1X7QB 5DJXB 1LK2A 3IB4A 3WEXA 5ILTH 4AMKL 1YMHA 4ENED 1MCSA 4YUEL 5AD0A 3B6SA 1RIHL 4LLDB 2CXKA 4XHJD 5I1KH 3PABA 2PYFB 3INUL 5JDJA 1CTOA 3RWGB 5GRUL 5IEHB 2R56H 3LN5B 3QRGL 1HQRB 4Z7VF 5IEKB 4OFDA 1GSMA 4HUNB 5BQ7B 2EH7L 4NQEB 1G6RL 1KFAH 2DN7A 1JRHH 1KB5H 3ARTA 4PS4L 4WFFE 4JRYB 1B2WL 4ZNEE 3TNMA 1MLBB 2JJVA 1CFTA 3GMPB 4NIKB 4NN6B 1VFAB 2BY2A 3IDIB 3MRCA 3MJ9A 5L7XL 1BVZA 3E6FB 1AR1D 3SDDD 2BVTA 4LVEA 4JFYB 3C5JB 3OB8A 1EEZB 3BYYA 5HHVH 3C9NA 4LHUD 4LOUD 2VB5A 5I18L 4GW5B 4Z7VA 3U9PH 3SE4A 5HDOA 1KCSH 3L5XH 5D7JB 1PBYA 2D0FA 1KXQE 1S5IL 5C07A 5E99H 3C2SA 1OTTD 2DQCH 1BBJB 3DX6B 4M02A 1FO0H 4NZJA 5JHDA 2VDML 5DYOB 5C6PB 1SBBA 1LMKA 2WNGA 1A1NB 2OXGA 3RUGF 2JCCA 3RNKA 4GXUN 5E00B 3UPAA 5DHYB 4EQ3A 4FQCH 5DRWA 1JK8B 4HIJA 2ZOKB 4OQTH 5T3XD 5ENWA 2C4FU 4WW2B 4JG0H 2X4UA 1FZJA 2WP3O 4LSQH 1JV5B 5HDBF 2FX8H 3BP6A 1KJMA 1BM3H 4TYUA 3T0BA 1RZ7L 2R4SL 2R4RH 1Q9OA 1U8HA 2VIRB 1NCDH 3QIUB 4Q6YA 5I73B 2NY2C 2R0WL 5ANMA 2VLJD 3JUZA 3MACH 4OZFH 3MXVL 1ED3A 5I8OH 1KTLB 3RUGA 4PB0H 4S1SL 3U6RB 4OSUH 1U8MA 2H41A 3VFSA 4JFPB 4O2FB 2Q7YB 1YY8B 1YEDB 3GJFB 3UZVB 4UDUA 4X4ZA 4Q9BA 4WEUD 1BJMA 2A77L 1L6ZA 5F1NB 4AZ8A 3WS3A 4JFQA 2Q87A 4EBQL 3MBEA 1N2RB 3ULVD 2NY4B 2RQ8A 3MNVA 2M26A 5DWUH 4LCYB 5IVNA 5GGSY 3P4OB 2X42A 4EDWL 5IW6A 2KKQA 3OKKA 1R5IA 4A6YL 1WFTA 4M6OL 3SJVB 3K81A 3O4OB 4P4KA 3ZDXE 5E2VL 1W72A 3QDMB 5BRZA 5MEPB 1P9MA 3A67L 4B7IA 3EYOA 5ILTL 2AGJH 4NRZB 3NGBC 4JFFE 2J8UF 2FGZA 4MQSB 3BIBX 4XPTH 3D39E 3B2UD 4LVHC 3TH2T 3PF2A 4OB5H 3DO7A 4Y4KD 3ZKXC 3ZDYE 2UZXB 4P2QE 4NUGH 5I1KL 4P46A 3VG9B 5AYQA 4X98A 1QSVA 2R56L 4DK3A 2X89A 3B9AA 3BN3B 2XWTB 2RB8A 4EIZC 1UADC 1NL0H 2AJZA 5F7NC 4C56E 4LEOB 4JVUA 4Z18A 2EZ0D 3OAYH 1KFAL 1IQWH 1TJGH 1A4KA 1JRHL 3D69B 1KB5L 4XNYH 1C16A 2HFFB 4RBPK 4N0UE 5T1MA 5I76A 3UP1A 4DQOH 3O4LB 5C7XH 2FIRT 1LO0H 2J8UA 4J23A 1JMXA 3ALWA 3FFCD 3RHWK 2J8HA 2Q20A 4ISVB 3L3HA 4UBDC 2W9LA 5I9QB 1QA9B 3HR6A 1MSPA 2XTJE 4L3EE 3T3PE 3RDTA 1HEZA 5HHVL 4X6EA 5E5MB 1G9ML 1UACH 5E2JA 1CICD 3ARQA 3TIDA 1IE5A 3TBTA 4ONHA 3KGRA 3U9PL 3NCFB 5EC1A 5TF1H 1KG0B 3L5XL 5E08H 1AGEB 5E99L 2DQCL 5F6HJ 3RFZC 3OXRB 4XT1C 3U7AA 1YJDH 5MP6H 1PYWA 1FO0L 2GJ6B 1T5WA 1OTSD 1PVHA 2YD6A 4MWFA 3MLVL 1EV2E 4QCIB 3LQZA 2AV1B 1RZKH 4RIRA 3VWJA 5C6TH 5I1LA 4N8VG 4GW4B 1RAMA 4JFHE 2X4OB 2GHWB 3DGGA 4UU9A 4HPOH 4WHTB 1XZ0B 4N9GA 4OQTL 4PJDB 4FTVB 5D1XB 2E9BA 4JG0L 5I19L 1AGCB 5A1AA 3AY4C 1E27B 3KDMB 4LSQL 3VFMA 43CAA 2FX8L 2NTFA 3FHAA 3O45B 1BM3L 4ZUSB 1I7TB 3ESUF 4JANA 3V5HA 3KXFD 2NLJA 3GM8A 2R4RL 3UJJH 4XVSH 2MHAA 4QRRA 4JM2D 5J06A 4YDLB 2BVOB 4XCNB 3QUXB 3MACL 5I8OL 2EKJA 1MELA 2FD6L 2I9TA 5K9JL 1TJHH 5K33A 4QHUA 4LPTA 3ARYA 3SDYH 3FN0H 4HCRA 4OSUL 3RWDB 5B39A 2DM7A 5DJ0A 4HS6A 4Y5VC 3KPNB 1HWHB 4PGZA 3SQBA 4YHIA 1NGQH 3CJJA 3K2MC 4PJ9A 3V0AC 1H0DB 3U4EB 5I66A 5DWUL 3QZWA 4U1SB 2B1AH 5D2LB 5FOJA 3QI9B 5F97E 5L0QB 4J4PC 2WWKO 5J11C 3QEQB 4RFNB 4ZFZA 5T1KD 4UOW1 4OD2A 2WBWB 1A7RH 1IVLA 1VGKB 3CSBA 3D48R 4QRSA 4NQXB 4PJ7E 5B21A 3ULUF 1MJJA 4PRPE 2X4SB 1DBBH 1JI2A 4YHKH 35C8H 2MOVA 5KVMC 1KJ3H 1JHTB 4XX1G 4OB5L 5DMJB 4CW1B 1WICA 3OB0K 2W0FB 2X4RB 5FUCE 3QJFB 4NUGL 3PWVA 1CDGA 2EDOA 2CKBA 3MGTB 2OZ4H 3GSRB 5HBBA 2Y06H 3X13B 1ZXQA 3FO0H 4WFED 3GGWA 2I5YH 4TSCH 1I3GH 3RZCA 4GQPH 2CRMA 1CU4H 4QNPF 1NL0L 4BFIB 3I75B 1PKQE 1Q9WA 4OCLC 2NX5E 5C70A 2Q7NA 5FYKU 1IQWL 1TJGL 3OTTA 1ONQA 3B83A 3X12B 2ZUSA 2OTWA 4XNYL 1T22B 1FVDB 1T3FB 5EU6D 4HPYH 4JEGB 5C7XL 4HZLA 3UTSE 5JR1L 1F3JA 2DYPA 1X5KA 3GSUA 1L0XA 2IBZY 2N7BA 5FB8A 5MENA 3TYFB 4O58H 5TDNA 2YPLA 5F1IB 5SWSE 1RSFA 1FGNH 3WFHA 5FV2A 3AU1B 1TNNA 1VFMA 5KG9B 2QKIB 1UACL 4OLWH 3TZVD 3DURB 3T1WA 1KCVH 2VERN 1GZPB 3L7FB 1H15B 1FSKB 3WDHA 4PUBL 3DTXA 3U36B 4AIOA 4ZXBC 1BHGA 4IDJL 5E08L 2L7JA 2VTFA 1A22B 3S3JA 5KVEH 1JNHA 2IAMC 4PJ8A 1KIRB 1YJDL 5D9SB 5MP6L 5D6CA 1C1EH 5DJAA 1FV1B 4PD4J 1GGBL 3U30C 1RZKL 1FNAA 5C6TL 2AV7B 4N8VB 5GZNC 1YY9D 2BVPA 1CFSA 3K2UH 3MV7E 3PGCB 3FQXA 1JGVH 3MYZA 4QO1A 4P3WA 1CGTA 3QUZD 1FFOB 4LCUB 2NPLX 2ZUWA 3HE7B 3PGFH 3QYCA 2HLAA 4HPOL 1ZHBA 2EDJA 1G7MB 4Q2ZA 1WSST 4Y1AE 3GM0A 1MRDH 2VDNH 2F53A 2A83A 2EH8H 2WIIB 1KNOB 1J10A 1ZA6B 4HUXB 4U1KA 3OG6B 4HEME 4Y19B 4ZUWB 2UVFA 3UJJL 1FNSH 1X4ZA 2NXZC 4XVSL 5L2KD 4NC1E 3F8UB 2UVEA 3KLAB 5HGHB 1TNMA 2DIAA 2NR6C 4G8FA 2I07A 1OD7A 3AS3A 2W60B 5I8CA 3MRJB 1BAFH 1TJHL 1VDGA 4P3CH 1F8TH 3FN0L 3L3DA 2GTWB 2HKFH 5E1HB 5T5FH 2IMNA 5JPNB 4M61B 5I1HH 1PDKA 1TCMA 4ODXB 1S7WB 4O2CA 3TT3H 1HQ4A 1NGQL 1DLHA 3IDJA 5MI0C 3VFRA 1QO3B 4IIQC 1P1ZB 5SX5H 5IHUH 1RQ5A 1NGWB 3FHQA 3H3KA 5C9JB 2XPGA 25C8H 3MRPB 4KHXH 3TBVA 3BEVB 4APQC 4E41A 1UCTA 5DA0B 1A7RL 4AJ0A 1WZ1H 4KKBD 3QFDB 5CP7B 5EBLA 5T1LA 3U4BH 3P4MA 3H9SD 1KJ2H 3AFLA 3BO8A 3O11B 4D0BA 4YHKL 35C8L 3G6AB 5C09B 1KJ3L 2RGSA 2DLEA 1LGVA 4U7KA 5F89B 4KHTH 2AXJA 3V5KB 2QADC 4PJXB 4NRYB 4LLWA 1GXEA 1G1YA 3KPSB 2GQHA 4EZMA 1Z5LA 3ZL4H 5D7KD 1WTGT 5FYJE 2Y06L 3FO0L 4TSCL 4OKVA 2QJDA 1FYTB 1NMBH 3I6LE 1I3GL 1ZWIA 3D3VA 1CU4L 4NOBA 3D25A 2CLRA 5F7WC 1XGQB 1ZS8A 3HNTL 5KW9H 3TP4A 5A2FA 1RK1B 4HIEA 1DDHA 3FTGA 3W0WD 4F9LC 2OMNA 4HPYL 5JHDE 4HAFA 3JSSA 4MMZC 4N68A 4JZJA 2JCCE 4U6XB 5EO0B 1JPSH 1XF3B 3RI5F 3OXSA 3QIWD 3WIHA 1J1OH 1R3JB 2NW2A 3Q1SL 1OQOA 3DX7A 4MD5B 5J9PB 4MSWA 3KPLA 1A47A 5ID0A 4BZ1H 1FGNL 2HJLA 5I16A 2DKUA 3HS0B 2WK2A 2VNCA 1RJCA 5F3HA 4OLWL 5CWSA 2CLZB 4P2RD 4YEEA 2OSLA 1KCVL 5HYJA 1F3RB 1PJ9A 4Y4HC 2NZ9D 4KY1H 4OFYA 3V6OE 3RL1B 1MVUB 1KACB 1HHIB 2VAJA 1I1YA 3CXHJ 1BD2B 1QFWM 2J4WH 5MHSD 5KSAD 3GSXA 4NFBA 5ANME 1C1EL 4KDTA 2Y07H 3RUGE 1OHQA 5IB2B 3K2UL 1XIWB 1JGVL 2XQYG 5DLMH 3PXHA 5DXWA 4WDIA 3B4NA 3PGFL 4C4KO 1FL6A 1K8DB 3IGAA 1S7TA 2HTKC 2GSGB 4U3HA 3T1FB 1TVBB 1NMCC 1YEGH 2C3VB 4H5SA 3NFNB 4AL8H 3S36L 4XNZC 4BSVA 2R1WB 2XXCB 1MRDL 1UJ3B 2VR5A 2VDNL 4TUJB 2EH8L 1H3WM 4I18B 2IJ0C 1WIOA 1A7BA 3F7VB 1FNSL 2GY7B 4JFOB 4N5UA 1KELH 1Z2KA 1AD9A 4PY8I 4Y4FC 1ZLSH 1EEQA 5I30H 2J2ZA 4JN2A 2ICEB 2WZPD 3BZFB 3MRFA 3V2AR 1BAFL 3UJTH 5CEZH 4N8CH 5E1AB 5JDSB 4P3CL 4BM7A 1F8TL 3CZFA 5EBMB 4JZOA 1OL0A 4JLRB 3H7LA 1A7PH 2HKFL 2QQNH 3ARBB 5T5FL 5I1HL 5IFHH 1N3NA 1RUPH 2RR3A 5F71A 4F7TB 3RBSA 1XEDA 4Y5XB 4QHNB 3TT3L 1NEZA 4HFWA 4PRBA 2GFBB 4XH2A 1XF5A 4G9FA 4QF1A 1T80A 3HLAA 5F6IC 1MY5A 4M6NH 5GGSB 4KHXL 5IESH 4ETQB 3TVMD 1FNGA 2D31B 4WUUA 4E0RB 1WZ1L 4J3SA 4DVBA 2WW8A 1KJ2L 2GSIA 1FG2B 3BP7A 2Q3AA 2J8UE 4X99A 5FDWA 1W0VB 3QNYB 1A5FH 2QHRH 4KHTL 4UOW0 3G5VA 2BNUA 3KJ6H 2YBRB 1CFBA 8FABA 3JTTA 5GRJL 1J88A 4Z7WB 4OZGF 1Y18B 4RGNB 1UCBH 2D03H 1TETH 3ZL4L 2FJGB 1X6NA 1D5BA 2XA3A 5C08E 1NMBL 3B9KD 4LNRB 4UI2A 2KQNA 1D9KC 3FCTB 3KVQA 3DMMA 4L4VE 5KW9L 2ORBH 3N1PC 1AO7D 1XGYH 2MQ3A 1YN7B 5I2IA 1SMAA 2GJZA 3SKUD 5I1AA 5C0AE 1KLUA 2H8PB 3L3IB 3GJFK 1ZHKB 4WUKH 1JPSL 3B9DA 4ZYKB 3P2TA 3B9VA 4P5TC 4BELD 1J1OL 3GEWB 1T2QH 4GRWB 3JWNC 4BZ1L 4OZGA 5DEGA 2Y4SA 4PJCB 2NY6B 4L8SA 1RK0A 4JRWA 5DUMH 4WI9A 1J86A 5DVMA 1LO5A 5JW4Q 2EKSA 4MNHB 3ZDZF 4KY1L 3VGAC 2CR3A 2IH3A 3RWEB 2NY5C 4OZHE 4IOIB 4MAYD 3P73A 5HI4D 2YA1A 1IGCH 3W11C 5DRZB 2H32H 2PYEA 4CU6A 2X1WL 4YPJA 4GBXD 3MRIA 1U93A 4GAFB 2R9HD 2VITA 4WHYG 3QUMH 4N90E 2Y07L 1I7UA 4ZPVA 3TJHC 4HUWA 4XPAH 5JPMB 4NO3B 2AXGA 5DLML 4LKXA 5ESAB 3RTQD 3C6LD 1HI6B 4K94C 1KTDB 1E6JH 4L1DA 1I8MA 1YEGL 1JGDA 1WT5C 4M4PA 4AL8L 4PJGB 4NQDA 1TTGA 4N0YH 3LRSA 4M7ZC 5CP3A 1DR9A 5CZKA 4YWGH 4LDLB 1WC7B 2FZ3B 1RI8A 3AREA 4MJ2A 4HLJA 3H6JA 1FFPB 3QQ4B 5B3JE 1I7ZB 1KELL 5B8CA 1ZLSL 3ETBF 2D9CA 5I30L 2OX5A 3V6FA 3QULA 3UJTL 5CEZL 4N8CL 4XNMA 4PRDA 5HHOA 4MVBD 4AG4L 1I3UA 5HYIA 3V4UH 4G6AD 4G6FB 3OKLB 1A7PL 2QQNL 5FKAB 5IFHL 1MNUH 5CJQH 4J7RA 1RUPL 4Q6IA 3SCMB 3VE0A 4GG6B 3UPRB 3RPIB 2P8MA 4ZQKB 1HN1A 2LTQC 4I2XA 4BK4A 5GGTA 3H7BB 5F1KC 1BFTA 3GBMH 4M6NL 4PRIE 5FK9A 5ACZA 3MOAH 1X7QA 5DJXA 4Y5YC 3F5WB 5IESL 1DJSA 1YYMH 3DXAB 2APXA 2R2EB 1DQJB 1S7RB 4N9OB 3CSGA 2AQ3A 4KAQH 2E7LC 2HKHH 1BWWA 1A5FL 1A9BB 2QHRL 5MENE 1J0JA 1HOCA 5EPMB 2YPLE 3KJ6L 2PYFA 5LQBH 5EU3A 3RWGA 3CX5K 4JFEA 5IEHA 3MRQB 2YK1H 4I48A 3RIAK 1UCBL 2D03L 1TETL 5IQ9B 5IB5B 5BQ7A 5CMAB 3WL9A 2DMBA 5IQ7H 4X7SH 3P4NA 4YHPB 3C5ZA 5TH2B 4QNPE 4KI1A 5HDQH 5TQ0H 2CR6A 5DS8B 4JRYA 3CC5A 3MLYH 1M7IA 3LDBB 1T66C 3GMPA 1XGYL 5DT1H 5FHAH 3V7MA 4I1NB 2GAZB 5GHWH 3AM8A 5IG7B 1HHHA 5I0DA 1ZANH 3G6JB 3QO1B 3L7EB 3C5JA 4WUKL 4X0KB 2GK2A 3KYOB 1T2QL 1CXHA 1NC2A 1CXFA 3ZKNC 2NYYD 3HUJB 3RPKA 3VGDA 1EVTC 5HSFA 5D7JA 2LU4A 2ZWLT 3VXUA 4C59B 1K9TA 5D7IB 1IEAB 3PGDB 1S9YA 4YDVB 2BXZA 1XCQB 4F58L 3QUYB 2B1HH 1XF2A 1J5OH 1IGCL 5SX5K 5F9WC 3NTCH 3UPCA 1A1NA 4HC1H 5E00A 5IFAL 1OWWA 1A6AA 2GK0A 4G80B 3QUML 1MI5A 3DX8B 3VXMD 4XP4L 1JK8A 3TO4D 2GUOB 4XPAL 1OGAE 1N6VA 2ZOKA 3RNQB 3MGOA 2IBZX 2BFVH 5IVXE 3BKJH 4CVZA 3GUTB 5SV3A 1ZLUH 2DIJA 5BV7C 1JV5A 2FX9H 1A1OA 1E6JL 4JJ5B 3R06A 1U3HD 1T4KB 1QPXA 4YK4B 5KSUB 2GY5A 4OI9A 3BWAB 3QIUA 4N0YL 2CXGA 3HG1D 4YWGL 5ADOH 4CVXA 5HGDB 1EFXD 4MA3B 4R2GB 3W39A 4E41E 5JZ7C 2M8XA 1CT8B 3BPOB 3VWKB 1WUNT 5D96C 4MYWB 2W9DH 3IJHA 4LRIC 4WWKC 4YGVA 4QTHA 4JFPA 3S9DB 2C3XA 5FUCC 4YBQC 3CFBA 3VDAA 3SDCC 4ALAH 4TN9A 1LO3H 3I50H 4C4KT 4Q97A 3V4UL 3JV0A 5F1NA 1CD1A 3QFJD 4Y2DC 1MNUL 1RJYB 5CJQL 4G8IB 5FA4A 4PY7B 4ZOBA 5IM7A 1A3QA 1GHFH 3BUYA 2ID5A 3G5XA 3WFEH 3NCYP 1U95B 2ENYA 1ULVA 3HPLB 3T3ME 1OAXH 3GBML 4FMKA 5I74C 3QDMA 5MEPA 3MOAL 5T3ZE 4NZRH 1CDIA 3F58L 1JZ7A 1YYML 4M5YH 4K7FA 1IAKB 1ZT4B 4JKKA 3SDDA 5DMIH 3C5SB 3OX8B 1DBAH 3S97C 3MLPA 2Z91A 3ECBB 4KAQL 4GFTB 1CE6B 3JV6B 3I02B 2HKHL 1FH5H 3O3EB 1DVFC 1A6VL 3P11H 5LQBL 4F9PC 3TBSB 2YK1L 3BAEH 5JXEC 1R3KB 2MWCA 3PWNB 2BSED 3FOMB 4AT6A 1G9NC 4W4OA 5HYJE 5IQ7L 4X7SL 4V1DE 3SO3B 5HDQL 3D69A 5IMOB 2HFFA 1YMMB 3R4DA 1HHKB 4KVCH 3MLYL 2FJHB 3O4LA 3IU4H 1OTUD 4X6FB 4ODWA 5DVKA 2ZCHH 3HAEG 5DT1L 4ISVA 2E7HA 1EO5A 5GHWL 1OP5H 1ZANL 4F7MB 4JREC 4D9RD 4JFDE 3ULVF 3AS2A 5DMKA 4JQXC 3PIQA 1IL1A 3X11A 1BFVH 1L6XA 3WNLA 5BW7A 3QO0A 3FJTA 4AH2A 1KG0A 4NC1C 2VLJA 2MQCA 1J87A 1MCQA 5EA0L 5IK3B 2B1HL 5JXAH 1J5OL 4LLQA 4XVJH 3ORJA 2AV1A 5JLZA 3NTCL 4HC1L 1YUHB 4KI5E 5IIEB 2X4OA 2V7NA 4FG6D 1IGFH 4WHTA 1XZ0A 4I0PB 3L5JA 1H3GA 1QLRA 5C0NC 2P8PB 3AAZB 3PL6D 2BFVL 4HJJH 5EC2A 1FVCB 4O9HH 1AGCA 3BKJL 4K8RC 3VFPB 3T65A 1H3PH 4XZUB 5MERB 1E27A 2FX9L 5HHME 5JIHA 4J1UB 5F7YC 2A9NL 3QHTC 5D2LF 2YUZA 1I7TA 2X9WA 3KPOA 4PREA 2C26A 4QGTA 1ETZB 1M7DB 3EYVA 4XCNA 1J8HE 1IGIH 4WUUE 1VKXA 4HIHB 2W9DL 4Y4KA 2NY3C 3NGBB 1F4HA 1NC4D 2VXQH 4Z7QF 1VERA 3MLXH 4MB5A 5H37H 1B0RA 2ED8A 3MLSH 4ALAL 1LO3L 3I50L 2NXYC 5I1DB 4KXZH 3LN4B 4RMUA 5L88H 3NCEB 3OGCB 1AP2B 1H0DA 1P5VA 5HHNA 2D9QB 3U4EA 1GGTA 4GLRH 3CAFA 5D2LA 3SE4C 1J18A 1GHFL 5FM5M 3RKPA 5JW4M 5E8PA 1R24B 1G7QA 2H1PH 4A2MA 5J3HD 4NN7B 1OAXL 3ZHLA 4U0QB 3V5DB 3MRHA 2ZP0T 3FFCA 4NZRL 3O41A 2A1WL 2F54D 3QNXA 1CDCA 1JHTA 4L8CA 1NAMH 5DMIL 1WBXA 1DBAL 1NGXB 4CW1A 1DUYA 2W0FA 3CCHB 1QOKA 1OY3B 3D18B 2W65A 1CICA 1GZQA 1FH5L 5F21B 5ID1B 2NY1C 2HN7B 4R8WH 4KROC 3P11L 3Q48A 3B5HA 4NZDA 2PO6D 4OZGE 4X6BB 3BAEL 4BQ9A 3MRNA 2IPUK 2FH8A 1AFVH 4YHYB 4ZUUB 4NQTA 2VMFA 3N1MC 1UXSA 4NSKB 2OQJA 4KVCL 4DGYH 3GSQB 1EEYB 2CD0A 2ZUXA 1S7UB 3HAEB 4ODBD 3KPRD 3B3IA 1OPGH 2ZCHL 3FT4B 4P4RA 3IXTB 4CKVX 2QSTA 3TYFA 1Z6JT 3LKNA 3KHOA 3ZKMC 1MCOH 4CU7A 3AU1A 3VGHA 4LF3B 5TE7H 5LGJB 5JHLH 3C2AH 3MBEC 3N9GH 4G43B 2IQAB 1CBVH 3DURA 1I8IA 3KXFA 1BFVL 4I9WE 3GSNA 1H15A 4W70A 4GJTB 4P4KC 3FB7B 4NQDE 2AQ2A 4M4RA 1U58B 2FYYB 3ZDZE 3QWOB 4Q9QL 5L8JB 4LKCB 2CK2A 1P9MC 3GZKA 2EO1A 2VZUA 5JXAL 4MXWH 4XVJL 1A7OH 2PTTB 3V0WH 3BN9D 1QSED 2F19H 3T8XA 4NDMB 1RZJL 2Z31D 1FFOA 4LCUA 2FR4B 5J1TC 3HE7A 4LLMB 1A1MB 2K9UA 3QWRA 2A6JB 4P46C 4BSWA 3LVEA 4F15C 4HJJL 5J1SC 1F4YH 2OK0L 1Q0XH 5T1KA 2WIIA 2LQRA 3UXFA 5GRVL 1ZA6A 4M7JH 4BH8A 1JBJA 5ICXA 4I2XE 1J0KA 4HUUA 4XRCB 1JMZA 1U8KA 1Q1JH 1A7QH 2JK5B 3LCYA 3M07A 2GW5A 2VL5A 3NPZB 4CMMB 4HV8A 1TTFA 3MRJA 4K7PY 4WGWB 4NQCB 4OGAD 1K5NB 2VXQL 3S37H 4E5XB 3TH4T 1K8IA 5CLTA 3QAZB 3D6GA 5DFVC 5E9DB 5IWLC 2HMIC 1QEWA 3FONA 4PJXF 4KJQD 3RVTC 1S7WA 4D0DA 5L88L 3O6FB 1QSZA 4RAUB 4JY6B 4GUPB 4JFEE 4KJWC 4N1EA 1NGWA 2BNRB 4TRPH 3D0VA 2AW2A 5FO8A 4O02L 1RURH 4IBLT 1AQDB 4MMXC 3CUPA 5D7LD 3PWPD 3VWJC 4YHNB 5EN2A 1LO4H 3G6AA 3SDXF 1NAML 4YNYA 1C08B 2XN9E 2F5AH 4OBRA 3V5KA 5FECB 4YJZL 1MHHB 4PJXA 4NRYA 1NGYB 3TZVA 1H3UA 3KPSA 5HHPB 2VN7A 5FFLA 4R8WL 1QQDB 5F1SA 3ARFD 3EBAA 2J12B 2LFGA 1FYTA 1NCCL 2FNBA 2HAZA 4IRJB 2BSTB 1N0XH 3LQAC 1AFVL 4M8VA 5C0CE 1ZLUK 3VXUE 3GBLA 4FFWD 3DUUB 2IAMB 4DGYL 3JZ7A 3VXQB 5DRXA 3SDXA 3KAAA 3U30B 1F2XK 1KSRA 1OPGL 1B4RA 2I60H 2DM3A 4Z7UE 1YEFH 3CFCH 4YO0B 4UTBH 1R3JA 2V5YA 5J9PA 3KPMA 1MCOL 2SEBA 5BXFB 7FABL 4P5MA 3I9GH 4PJ9C 3C2AL 5JHLL 5E8DH 3N9GL 5ACMA 1CBVL 3T0EB 1IGJA 4NKIL 5I15H 2H2PD 3BPCB 5L2KA 1UZ6E 2NW3B 1AXIB 3GSWA 3NACH 1OD9A 2VOTA 1MVUA 3A0OA 3GMRB 1XR9B 3T2QA 1V3JA 3RVUC 1BD2A 3EJZD 1DN0B 4X9BA 4OF6A 1OB1B 1BZ9B 4MNQD 3QEGH 5DTFA 1A7OL 5E56A 3V0WL 2Q3ZA 1ZSDB 2F19L 1JZ3A 1OAZL 4LL9A 4JJHA 1XIWA 2WINA 1U8PA 2VLMD 1LP9E 5LCVH 5IB1B 3CZJA 4F7CB 3CDCA 4ZUTA 3T1FA 4Z6AT 2AQ1A 2C3VA 1F4YL 5C0BB 5MI0B 1Q0XL 4QRQA 1UJ3A 3RZCC 1INQA 2P7TB 1A6WH 3VXTB 4I18A 4M7JL 2DRUA 2AJSH 2ITCA 3ULUC 3H9SA 4QY8B 4LQ1A 1Q1JL 1A7QL 3L95B 1F45A 1XH3B 4XWGH 2IALB 3S36X 2YC1A 3BZFA 5FIEA 3E1F1 2OJEA 1HE7A 1QTYT 5HI3D 1V3KA 4HW6A 3FZUC 3S37L 4H1LH 3PWLA 1N64H 2QADB 2PF6A 4CNIB 4G5ZL 2X40A 4QHNA 1XR8A 1MRCH 2GFBA 1YC7A 1MCHA 1IARB 2GEEA 1GL4B 1E4WH 4TRPL 1FE8H 5DC4B 3WDJA 4RNRA 2ADIB 1IGMH 4ORGB 1RURL 4ETQA 5CEZD 2MSPA 3VXSB 4E0RA 4PJ8C 3QXAB 2EE9A 3SOBH 4PJIF 4DN4H 3P3YA 1KLGB 1S9XA 1ADQH 4S2SA 1URLA 1LO4L 3QIWA 1QLFB 3UX9B 4S1RH 5GSVB 5HPMA 3BXNB 3EZJB 3GSVB 2F5AL 5IVZB 3S6CA 4U6HA 3PDOB 2RBLA 4GRWF 2YPKB 4U1NB 3OG4B 2EIEA 5IV2B 3MO1B 3FAXA 5ISZB 1OM3H 4F37K 2AK4B 4X5XB 4EUPH 3CDGB 4R7DA 4EJ1C 5KSAA 1N0XL 2DB8A 2VLJE 4LLVA 2QSVA 2R1YB 5BZDB 2G60H 4PJIA 3EO0B 1QPPA 3CVIH 5GRVK 3WNKA 2I27N 1YZZA 3EFFA 2CO6B 5HJ3A 4D9LL 3RVWC 3SGJA 1VCAA 1RD6A 3L3IA 2EYTA 3BI9X 4IHOB 1FCGA 3O3DB 3QXTA 4X5WA 1SJXA 3S4SG 2I60L 3T04D 4ZYKA 2R8SH 1YEFL 4UTBL 1JPGB 5D8JH 3LKSA 1YEEH 2HFTA 4PLKC 4H88H 3MJ7A 5E7FA 1X5IA 3I9GL 4FN0A 4JY4A 1P4LA 3R0NA 4RRPG 4PP1D 3H2WA 5FGCE 4KKCC 4XNZB 3ZYJA 1K2DB 4F7PB 3NACL 5C0DA 5EZIH 2IH1B 4XNQA 5ESQA 5DRZA 3RVVD 4PGEA 2W0PA 5JIPA 2CUIA 2FLRT 3GB7A 3QEGL 4NYLA 4Y4FB 1BZ7B 4ELMA 2IFFL 3CVHH 4K07A 1JJUA 3BHBB 1Z9LA 5JPMA 3I6GB 5DQJA 4GAYB 4AM0B 3QDGD 5ALCH 5ESAA 5EO1B 1HI6A 5LCVL 5CD5C 1MIMH 2CDFB 2XA8H 5DJ2A 4ODUB 5INCB 4L8BB 3EYSH 1T21B 3VRIB 3QPQC 1U8LB 5HD8D 3MRDB 1ORQA 3BH8A 2IQ9H 5EU4A 1KB9J 3IDYC 5TE4H 3TVMA 2FZ3A 1A6WL 2B0SH 1SVCP 3UMTA 1KCUH 2AJSL 1TPXC 3QQ4A 4KZEH 3UTQB 3TFKD 4XWGL 4R3SB 3FFCE 1WLHA 4JZJC 3BRFA 4P2OD 2F74A 4KH2A 4NT6B 2E8YA 4PJAE 3VXNB 1QZ1A 1MREH 3DUSB 5C0GA 4GXVH 4Y0GA 3MQIA 3OKLA 2N7AA 1N64L 2X4PA 4NPYB 5CIPA 4NQVB 1DE4A 3E3QE 1NFIA 1EEUA 4NNXA 3SCMA 5DR5H 2EXWC 2X10A 5DC0A 3SKJL 1MRCL 4OT1H 3TN0B 3Q3GB 2Y36H 2AABL 3QEHB 3JTSA 1BBDH 2ZCLH 1E4WL 2EDEA 3GNMH 3U46A 1FE8L 1QLEH 4ZG1A 1AO7A 5CEYA 3T4AA 1Z0NA 1IGML 1VESA 4OGYL 1D9KB 4WCYH 2C5DC 3QH3B 5F7KC 4KDTC 3V6BR 1K3IA 4DN4L 1YEKH 3ALPA 5F8RC 1ADQL 3UAJD 5SWQB 5HGGS 3QDJD 2EDXA 5C2BH 3C60B 4S1RL 1G6RA 3G6JF 3P30H 4JE4B 4CJ1A 5C0FB 1JYXA 4NO0B 4HS8H 4LSTH 3KXFE 1I9IH 4MAYA 5TH2A 1KIPB 4ZOEA 4HG4K 4PRAA 1EGJH 1HH9A 4GBXA 4JKWA 1N6QH 2G60L 5KSVB 1NDGA 3CVIL 2NCMA 2VYRE 4M9PA 1CL7H 4UNTA 3RTQA 2FATH 3DYPA 4EQ2A 1UQSA 3L7EA 3C6LA 4NKDA 2R8SL 4NO2A 4M8QB 5BVJB 3O3BB 4QT5B 5EBWB 1YEEL 2V2TB 1MHCB 4Z78B 3JWOH 4H88L 4TTDD 5F70A 1IQDB 3EOBB 3Q6GH 5J6HA 4R7NB 4OM0H 3DRQB 4IRSB 3PGDA 4M7ZB 4X9FA 4NNYB 5EZIL 4U1LB 2X2YA 4LLUB 4WO4D 1RHHA 3BOVA 2R0ZH 4DKEH 4JFFB 5KVDH 1DANT 1YN6B 3IDGA 2X1XR 3D39B 1WEJH 3CVHL 3S5LG 3EDFA 1Z9OA 3M1BA 2R23B 2GUOA 2DQGH 3BIKB 3ZT5A 3LV3B 4P2QB 3RNQA 4U2ZA 3WHXA 5ALCL 3GUTA 4HFUH 4CADB 2HJKB 4JDVB 2VR9A 3EYQC 1MIML 4WFEE 2XA8L 1JNNH 1T4KA 1KEGH 2XWBB 1BQUA 4N5ED 3EYSL 3W82A 4C56B 1N7MH 2IQ9L 4AIZB 4FXLA 4LGSB 5TE4L 2HT3C 5HGDA 1AXSA 3WLBB 3O8XC 4N0UB 3DMMC 3PHSA 1KCUL 3VWKA 3WMSA 1RZ8A 5C0JA 1CQKA 2VSCA 3F12B 5IHZA 5EU6E 2LU7A 4Y5YB 1XGRA 3RAJH 4P57B 4KZEL 2CIIA 5A2LH 4JHAH 1JZ4A 1T1XB 4R4NC 4A6YA 3F62A 2R2HB 4XP9H 1ITBB 4MDJB 2X4QA 2UV3A 1E28B 1DEEB 2XTJB 4L3EB 1MREL 3THMH 4B0MM 1BGXH 4TULH 3ZHDA 5GRZA 1DBJH 3F7QA 3I2CH 3OAUH 2EICA 4L8SC 5DR5L 1CGWA 2VQ1A 5C6WH 5ITFA 2BOCB 3KS0J 4OT1L 1HNFA 4HGKC 1U95A 4OV5B 1BBDL 5TDPB 2ZCLL 3RL2B 4R96A 3GNML 4PJFA 1QLEL 1UKQA 2R2BA 2BJMH 2VO5A 3UTTD 3BZDA 4ONGH 5JW4R 4PV8B 5DJYA 2JB6A 4WCYL 1NAKH 3RWCA 1DBKH 3IXAB 3NN8B 4XCYA 3NFSH 1DQQB 5LXGH 1YEKL 1MWAH 2ZUQC 4LHQB 3CLEH 1DUZB 3LRHA 3SDXE 4Z76B 4ELKB 3I02A 3ZE0E 3L3GB 1KB5A 3P30L 4HHAB 3M17B 1AGBA 3T2NH 4P99A 1C7SA 5E2TH 4FQQA 3JXAA 2NY5H 3QIBD 4TVSa 1JTOA 4YQXH 1R3KA 4HS8L 2ATKB 4R97C 4XP6H 2EDYA 4ZS6C 4G8GD 4JHZA 4LSTL 4U6YB 1I9IL 3RQ3A 4GKNA 3AREC 2CLVB 5L2KE 1AD0B 5GJSH 4KRPC 4J3UA 2ZOLA 1HHKA 1MVFA 4PGBB 1N6QL 4OZIF 5B8CC 5F9WB 3VXMA 1EJ6A 3F6IA 2HT4C 1RFDL 4K94H 1CL7L 2WAHA 2FATL 4F7MA 2RCSH 3BZ4A 4Q6IC 2VISA 2DI9A 3LSOB 3BGMB 3TBYB 1E4KA 3VMNA 1HIML 3JWOL 4RMSA 5BV7B 1TDQA 4KQ4H 3Q6GL 3O2DH 3O3UN 5AUMB 2ADGB 4OM0L 1EFXA 3FB6B 4HSQA 1CF8L 4XB8A 4KK5D 5EO9A 2FO1A 4M1CD 1AHWA 4PJ7B 4OKDA 4OQTA 4YFDB 4PRPB 4OZIA 2GT9A 1V3LA 1U3JA 2R0ZL 1VPOH 4DKEL 1BQSA 2QR0A 1C12B 1J0IA 5KVDL 4EDXB 1WEJL 3CFDB 3DECA 4QXWA 4WWKB 4BZ2H 3QFJA 4Q7DA 3L1OH 2DQGL 5CZXD 4TVPH 3WO4C 1A9EB 1GPOH 3VXRE 3VFPA 4RMQA 1CFNB 4XZUA 4OZFA 2UWEE 4Y2DB 4HFUL 3W9DA 5D7KE 5F44A 4F2MB 1YYLH 1MCJA 2DQDH 4JAMA 1JNNL 4WV1B 5E94B 1KEGL 3SKOB 4P2YA 3MUJA 1N7ML 3ILQC 1PKQB 4RMRA 2NX5B 3C5ZC 4XWOC 3WXWH 4FFVD 4MDIB 1ETZA 4IS6B 5I74B 4EI5B 3MCLH 3X3FH 3W0WE 4H25A 1PSKH 4NN6C 4RA3A 4HIHA 1AY1H 3UTSB 4OAWB 1WZKA 4JHAL 5FYKH 4YAQB 4FRWA 3AM8C 4OCXH 3RA7L 5SWSB 1R3HB 3CGTA 5C92A 3THML 4J3XA 1BGXL 1DP0A 4TULL 3ZYOA 3BGAA 1DBJL 3LN4A 3WV0A 5K93A 1DVFB 4UT6H 3I2CL 5I8EA 2OR7A 1TZHB 3OAUL 3ULSB 2C7UB 4P2RE 1UWXH 2DBJA 4UINL 2QQKH 2EYSB 4X7EC 3STLA 5CKAA 5D7JC 3ABZA 1R6VA 2MMXA 1GH7A 1HYSC 5MHSE 4MA7L 2BJML 1CXKA 1MRFH 4ONGL 2PNDA 2I9LA 1RZFH 3MRLA 1ACYH 1NAKL 4PJIE 3FMGH 5J56B 3MV7B 1DBKL 4ZO7A 3NFSL 1MWAL 2G2RB 5BS0D 1NGXA 1MLCA 2XKNB 4LP5A 3CLEL 1MCRA 1X5JA 3D18A 5ID1A 2HN7A 5DUPH 4JGUA 4Y1AB 3T2NL 2NY5L 3WNPA 4YQXL 4X6BA 3SE9H 1NGPH 4XP6L 3QIUC 3HZVA 4QHLA 1BJ1H 4WNQB 4TNWK 5HI5C 3RX7A 1RMFH 2DM4A 3HRZA 4U1MB 5GSRA 5GJSL 2FHCA 3GSQA 1I8KA 1LK2B 3WKNA 3WEXB 1KCRH 4ENEC 2XWJA 1YDPA 3R8QA 4OZ4B 3RX5A 4XAKE 4LVNB 3FT4A 1KULA 3IXTA 4ELME 4K94L 1IBGH 1UB5B 3PL6A 2R29H 5FUOH 5AD0B 3B6SB 3OMZA 3D0LA 5FAAA 1AQKH 2RCSL 2PR4L 1G7IB 2EDQA 1RJLB 5F9OH 4AY0A 2VUYA 5LGKA 3GRWL 3ZMRA 1IAMA 2X70B 4KQ4L 1MCBA 3VA6A 3O2DL 2FEDC 1GIGH 1KEMH 1U58A 3JVGC 3QWOA 2EXYC 4LKCA 2BHUA 1OAYH 2PTTA 1AR1C 3SDDC 1VPOL 2VAAA 4RMWA 3HZKA 1MFEH 3MRCB 2NY3B 3V95A 2NY2D 4LLMA 5IB3A 2YSSB 4ZAKB 4Y88A 4TVPL 2VZ1A 1NPUA 1GPOL 2YRLA 2NXYB 5GS0L 3VG9C 3C9NB 4QKXB 2YD7A 4NZTL 4DZ8A 3BESR 1YYLL 2DQDL 4Z7VB 2D7NA 2WQRA 3RY5A 2NZIA 1T0MB 4W4OC 2D7MA 3FL7A 2P5ED 3ESVF 4I4WB 2F54A 3KLHD 1AO7E 4JO2H 3MCLL 3LN9A 3X3FL 5JHDB 1PSKL 2AKRB 1AY1L 5INDA 2JCCB 3RNKB 1JWMA 3LRGA 5FYKL 4E5XA 3HMXH 5F72S 1J0ZA 4OCXL 3TA3B 1LNUA 5DRWB 2JE8A 4HIJB 1KENH 1IC1A 2PO6A 5A43C 5ENWB 2NY1B 2APVA 3O6FA 1A3RH 2X4UB 4UT6L 1FZJB 4PTTB 5FM5O 4RAUA 4JQIH 5BW7C 5A2KH 3SGDH 4H8WL 2QQKL 2AJVH 2BNRA 1LD9A 3LEYL 2QQQA 1Q9OB 1U8HB 2P5WD 2BSSA 5C08D 1TCRB 1T1WA 1AQDA 5F88A 3EGSB 3BGFC 2HRPH 4NKMB 1F4XL 5ANMB 1MRFL 4YHNA 4P49A 2PXYD 1ED3B 4KJPC 1RZFL 3RUGB 1ACYL 3FMGL 3BE1H 3VGBA 4OFIA 1C08A 1TIUA 2B4CC 4MXVF 5C0AD 4ORZC 2XY1A 3VFSB 3QEUA 4J3VA 1MHHA 3ULVC 4FQPA 1GGUA 3PQYE 4ZFOL 2KUTA 1UT9A 3ARXA 3WS3B 1QQDA 4NFCA 4JFQB 5DUPL 4GRLB 1H3TA 3O9WD 3IAQA 4FQJH 3SGEI 4ZDHB 3D1MC 5K9QI 3SE9L 1NGPL 5IW6B 3OKKB 3J7HA 2HFGH 3CIQA 4IRJA 5KAQG 2JIXD 2BSTA 2LE9A 4P4KB 3VI4F 1HH6A 3VFTA 4NC2B 4YDLC 1QSEA 1RMFL 5BRZB 1J9CT 1NEUA 1T89A 2EIDA 3B2UC 2Z31A 3O6MH 3EYOB 1KCRL 2Y9RT 3HPJB 4DCQA 1IBGL 5EBGA 1S9WA 1ORSA 3I85A 4P9HC 2R29L 3D85D 5FUOL 5BXFA 1AQKL 4PLJD 3MV9D 4P46B 3G5ZB 1CTNA 4F15B 1HZHH 2ZKHL 4OCMC 5D5MF 5F9OL 3T0EA 1CFQB 1CLOH 3BPCA 43C9B 5E95B 5L0QC 4RFNC 2AJZB 1GIGL 1KEML 3GMRA 3SE8H 1E4JA 32C2A 4K3DH 1DN0A 3VD9A 1A4KB 3V4PH 1C16B 1BZ9A 1OAYL 2B39A 5I76B 2ICES 1HILA 4DVRH 1UEMA 2J8UB 5DMYA 3MZTA 1MFEL 1NLBH 4MQ7A 4XNUH 3BH9B 2VDPH 3DI3B 1YNKH 2BY1A 3E3QC 5HYSG 1CICC 2J3SA 5MEQA 1QHPA 5IB1A 4K9EC 3RDTB 1HSAA 5D5MA 4X6EB 2E9WA 1JNLH 2W38A 1A6TB 2XRAL 3O2VH 3GIZH 2P7TA 1OF2B 2DMCA 1JVKA 4MD0A 2WSKA 5EC1B 3BWUC 5D7LA 1OTSC 3PWPA 4ONOA 4L4VB 4PRID 2I24N 3H9HA 1N5AB 4DOHB 5E8OB 4PJFE 3QP3A 3U82B 4AEFA 4QYOA 1T5WB 2IALA 1IAOA 3VWJB 4RIRB 4OUOA 1FP5A 1WIUA 1AGFA 3WS6A 3LKQA 1KIQA 2IWGA 5EH1A 3RJQB 1INEH 3EFDH 3HMXL 1W8OA 3DGGB 4UU9B 1KENL 3ARFA 3GMOA 3TF7C 4N9GB 1J0YA 1F90H 1A3RL 3VD5A 4LCCA 3HE6D 3VFMB 4OF7A 43CAB 4JQIL 2NTFB 4X6CF 1FSKC 2AJVL 3IS0X 3S37X 5BVPH 4JANB 3V5HB 1PQZA 2AAVA 2NLJB 5BO1H 4NO5B 4OZHB 2ADIA 3TBWB 2B7DT 2QV2A 2Z35A 5IFJA 4QRRB 2HRPL 4KV5F 1KLGA 4NQSB 3GMQB 4RZCA 3LAFA 3BPNC 2I9TB 3VXME 5FGBA 5GSVA 2FLBT 2DLFH 3HE7C 5B39B 5DJ0B 4HS6B 1ZGLP 2Q8BH 3FB8A 2X1PA 3U4AA 1RZIB 3QDAA 2YPKA 4U1NA 1MAJA 4PJ9B 4LSVH 1W72H 4FQJL 2E6QA 1TITA 4KRLB 5T33H 5IV2A 4X6CA 5I66B 4Y8AA 3QZWB 3HG1E 2AK4A 1UH2A 2HFGL 3CD4A 3B9EA 2FWOB 4ZFZB 3EIFA 3K46A 4MNQA 4LASH 1AH1A 4QRSB 3EO0A 1O7VA 1MJJB 4NBXB 3S88H 3O6ML 5HXMA 3RP1A 4L4TE 4ZXBD 3TM6A 1I1AD 3HZMB 4RFEA 3OQ3B 4UILH 2VDRH 3NCJL 1X44A 1B88A 2HG5B 1NGZB