5J89A

Structure of human programmed cell death 1 ligand 1 (pd-l1) with low molecular mass inhibitor
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
b'AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 1 ligand 1
molecule tags Immune system
source organism Homo sapiens
publication title Structural basis for small molecule targeting of the programmed death ligand 1 (PD-L1).
pubmed doi rcsb
total genus 28
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j89A00
4XPAL 1LP9A 1WWWX 4D0DA 2DM7A 5DJ8A 3ALPA 3HNVH 1ZXQA 2C9AA 2CLVA 5F7DA 1LP9B 4KV5F 5D70L 4DUXA 1YEDA 3HNTL 5D8JL 1MJ7L 4HMCA 4JANA 5DEZA 1NGYB 4JFHD 4J3WA 1FC2D 1WCBB 3HG1D 4LLUB 4KZDH 4MDJB 5CSGA 3RVUC 5ADOH 1P7HL 4M1GH 25C8L 1L7IL 4IOFD 3ARGD 4JLRB 1BIIA 5EFIA 4R2GB 2BNQA 4N8PA 2BVYA 1MCCA 3LOWA 3LSOB 4XCNB 5FAAA 1RUKH 1NGQL 5IBTH 3ZYOA 4P3DA 4AZ8A 3EDKA 4OZFG 1FP5A 1ND0A 3MCLL 3TN0C 1MCWM 5AEAA 1R3KB 4R7NA 2A77L 4Y5XB 5EC2B 2EYRB 1BLNB 3U48A 3NVQA 3KYOA 3PWUB 1J7VR 4OQ1A 4PRAB 5H35A 4Y2DD 1D5ZA 2J5LC 1LK3L 1FFPB 2WBWB 5F93C 2JJVA 1A9EA 3FCTA 5C0BD 3C60B 4HIEA 4O2FB 1JFQL 3SKNB 1XF3A 3BT2L 4MXQC 5C0CD 1KTKE 2X4OB 1CXIA 2B8OT 1Q1JH 1D6VH 1HKLL 2FX9H 1DSFL 4MA1B 2VDOH 3H7LA 1JIBA 4URTB 3TCLA 3GSNL 3X3FH 3FQTB 2R23B 4GW1A 5C6TH 5CLWA 1TIUA 1ZEAH 1BD2A 3G6JF 3ZTNL 1MCEA 1ZSDB 4M9PA 1CLYL 3QDHA 3VH8A 1DN0B 4AIZA 4AH2B 1J0ZA 4BK4A 5HGGS 3EYUL 4GSDL 3CH1B 4Z95H 2IAMA 4Y4HB 2VITB 2YD5A 4QXUL 1OTSD 4PJFA 1VGKB 2DQIH 5DGQA 2B2XH 2CKBA 3BGAA 3GBNH 3Q6GL 1WT5C 1M6OA 5F7MC 1NCBL 5A2KH 4U0QB 3QFDB 4PG2C 3HPLA 3O41A 1IGTB 4JO2L 4FZ8H 4NOFA 3T0EC 2VN4A 3BDYH 1CFTB 3F5WA 2VAJA 1Q9WA 5E24E 2Q7YA 4YWGH 4JGJA 2ATKA 3HZMB 3MV9D 4WENB 3IJSB 2MPAL 2BMKB 4Z8FH 3QEGH 4HV8B 3MGTA 3TT3H 5KTEH 3CCHA 3F12B 1LO0H 1Q0YH 3LSOA 4KQ4H 3WNPA 3SDAD 1FJ1B 5HI3C 4X7SL 1XGRB 5E70A 2BRQA 3TNNA 4K7PH 1QFWM 1AD9A 4J4PC 3F58L 2NPLX 3T65B 1YNKH 1OAUH 5A43C 4RQQB 3K80A 1NGQH 1KN2H 5E1HB 1S7SB 5LQBH 4JAMB 1CTOA 2KBGA 2HFGL 3UMTA 2ICEA 5ISZD 3NZ8B 4WW2A 4K7FA 1UM6L 1S78C 4N0YL 4X6BA 5HDQH 1AGBA 1CD0A 5ELIA 4H26A 3UBXA 4LLDA 4A6YH 4I18A 2F74B 2G5BB 4OLZH 4DUWA 5EIIA 4L9LB 4BFIB 4GUPA 4LHUD 2DLGA 1NBZB 3IJHB 4PR5A 3GMNA 4U1IA 4Z7UE 1OAYL 1TQBB 2JTDA 3OX8A 4NO2A 2G60H 5F6HI 1WWBX 4XCCH 3A0OA 5EBWA 5AWNH 4L29B 3ULSA 5GGSY 1X3DA 1QA9B 4HXBL 1ZOXA 2DQCL 3SDDC 2CR6A 4PJBA 3DYOA 3QO1A 4XP1H 4N8VA 2HTLC 1P84J 1HEZA 1CGSH 2OJEA 4JFDD 5DC4B 2CH8A 4HKZA 3QHZH 1T22B 3UPRB 1FVEB 5CD5D 2VXUH 4CKVX 2ZNWA 1U41A 2OL3H 1MJJA 2E6JA 1MWAB 2LE9A 2R2BA 4JKMA 5D96C 3SGJA 2A1WL 3CPLB 1YPZB 5MI0B 3WIHH 4LEXL 4I2XA 4OCSH 1R3JB 5D6CB 5F7EL 4JY4B 3QXDB 3GDBA 3GSXA 4KKBC 1N7ML 3OKLA 4YFDB 5D6CA 3NAAH 1PX4A 3MNWA 1JNJA 4KKAC 4PJBE 1I3RB 5HDBE 2B5IB 1S7QA 4KAQH 4UV4H 3BIKA 1EEZB 3L6FA 2N4IA 3QO0A 3M1BB 4PJGE 3V8CA 4UOJA 4K23L 1OAKH 3DRTB 1XGYL 3ARVA 5CZKA 1KCUL 3SKJL 3SDXE 5KSAD 3IDJA 5I15H 5IMKB 5D2NE 1T5XA 5I75B 4HPYH 1LP9F 3IFPA 4G6FB 3DTXA 1MH5B 1RU9H 4U2ZA 5I71C 2R4RH 4KJWD 4X0KA 2EDYA 2YKLL 3HAEB 2YK1L 4QHMB 3WS3B 1CGYA 2HJFB 3MYJA 3CDCA 3VU2A 2Y07H 4MNGB 4PGEB 4JFDB 1KJ2A 2FLRT 3I75A 3S35X 5C0DB 2F54D 1F42A 3HE7C 1A3LL 5EIIB 1T7YA 3UYOD 2X4NA 2YD6A 2HT4D 1F2QA 4PYGA 2H41A 5HY9B 1DUYB 2XKSA 4M6MH 4FQCL 1A0QL 1NLBH 4YXKH 1QEWB 2FGWL 3STZA 4C56B 2K7QA 3PIQA 1N59A 1UCBL 1JF6A 1A6ZA 1LE5B 3S8WA 4NKIH 2Z4QA 3EYVA 2XRAL 3WSQL 2VKWA 3EW3B 4HWBA 5FYLE 5KVEH 1KCLA 1U3ZA 1GYAA 3GK8H 1MCFA 2W9EL 1U3HA 4PJCF 2JCCE 4PTUA 1YY9C 4JRYB 1HE7A 3QXTA 3O8XD 1QLEH 3SE8L 1NEUA 5CSZB 3ZO0A 3QUZC 2DQCH 1G6RL 3MSPA 4ZUUB 4PJIF 3WN5C 5I73B 1F3JB 4JFQB 1YN6B 4KKAD 3GSWA 4W4NA 4OSUL 5FA4B 4YR6B 3SBWA 2XFXB 5HHME 1FL6B 3OL2A 3TPUA 5IF0A 3VXSE 4XPGH 1FIGH 4GG6A 2AXGA 2G9HA 3VXQB 3P40A 4AM0A 3EHBD 1A6AA 1DBKL 4OFIA 3HUJA 1JGUL 4PB0H 5HDOA 4JZOA 1QOKA 3T0EE 1UWGL 4TULH 5DS8B 3FQWA 3KPQB 3HUJF 4A6YL 4F33B 1MCDA 1EHXA 3QXUA 4POYA 1AJ7L 1SMOA 5IV2B 3QWRD 4MCZA 1JYNA 3QQNA 2AEWA 1RHHA 5F7EH 5H35B 5FCUL 4M5ZH 1KIQB 6FABL 1FIEA 1MIEL 5E2UH 4B50A 5CGMA 2R2HB 4LOUC 1PFCA 5T1LD 2HVJB 1U8PB 3VFPA 2MCG1 1FG2B 3MJ9A 2V5TA 4NC1E 5DJXB 2HH0L 4JY5H 1UADC 4NFDA 1UZ8B 2ZUXA 1ADQH 3U0PB 2Z8VC 2A6IB 3EFDH 3MRGB 5D1ZC 4UQ3B 1CGSL 4HS3A 4M7KH 4XNMB 3S36L 4Y1AE 5D7SL 4LP4A 3TO2A 5CP7B 2ID5A 4XWOC 1PKQB 1IQDB 5SWQB 1CICC 4WEMB 1OQXA 2R2EB 1H5BA 2BMKA 5SWSD 2H8PB 4ZOAA 3FRPG 3UJJL 4X4ZA 5DUBA 4OFPA 4OV6F 1T21A 2Z93A 5F7LB 1QLFA 4MD4B 1WQVT 4XB7A 1EV2E 3CX5K 4DWHA 4LHUB 3UTTE 1RFDH 1XF4A 3OR6A 1FZKB 4AEFA 2YD2A 2EEDA 1NDGB 4LGRB 1RZ7L 1T2XA 2E27L 5K9JL 1KC5L 4RNRA 1E4XL 3HHRB 1XCTA 4WU5B 2VXVL 3BN3B 1AGFA 1NQBA 1X6NA 5IMLA 5AG8A 3QRGH 1S9VA 1F6LL 2FIKB 2FWOA 1GAFL 4F7CB 3OXRB 3ARWA 1NKOA 3DROA 3DO7B 4S2SB 5FFLA 2GIYA 2I60L 4AJ0A 3LKOB 5DD3H 1RD6A 3GMPA 4IIQB 4EI5B 5DA4A 5F9JB 3H9SD 1EHLH 4L3EA 1CL7I 3FRPA 1CFSB 3WMSA 3TBWB 3GMPB 3T2NH 2AV7A 3V7MA 3O3DB 3MV8D 3OB0K 4WWID 1I85C 3HC3L 4HUXB 3IFNL 1YEDB 4OFVA 1BJ1J 4XPBH 1NJ9B 5SX4H 4WWKD 4G7VL 4HJGA 2HN7B 3LB6D 5L2KD 4JDTH 2HLFC 4K55A 4PRHB 3BQUC 3UTSA 4K2UL 2BVQB 2GJZB 4OCMC 4FXKB 3WFHA 1UWGH 3RKPA 1KJ2B 1S7XA 4I3SL 4GMSH 5CILH 5IMMA 4ZTPL 3TA3A 1JRHL 1C5DA 1NMAH 4ZFZB 4C56E 1CIUA 4WTZA 5I1IL 1NH6A 4POZD 1JPFA 1SJHA 4R7NB 5I0DA 4YJZL 3VFSA 4PLJD 1K6QL 3ARQA 4J1UA 4TRPL 3BUTA 4ORGB 4QTHB 3ZT5A 4UNUA 1UB5A 3I3BA 4NNPH 3ZMRA 1I9JL 3RWGB 3ECBA 2XY2A 1CDHA 1KTLA 4Q6IC 4TSBH 1KPUA 5E99H 3OG4B 3MOAL 1DQDH 3OF6D 5HDLA 5EBMA 2HG5B 5EULV 4PYHA 2WLYA 2R4SL 1BQHG 3GSNH 1J8HB 1EDQA 4C55A 4KDTC 1J5OH 1UXSB 1GGUA 2VOTA 4ETQA 2B20A 4OKDA 3BESR 1OGAE 3I3DA 1AY1L 1Y6KR 3KXFE 1AR1C 4R96A 4OGAD 4OTXL 4OGYH 3K1DA 1G7PA 1FFQA 1I1AA 1J8HE 2R2BB 4PJ5D 1A6VH 4GKNA 4WUUB 3P9LB 4YX2H 4YDKH 4NJAL 4HWEL 1OD9A 4KGLA 2WMPA 1E4WL 1R3IL 2DTSA 2GQHA 1FNEA 1F90L 2HLAA 3TF7C 3SJVA 1G7LA 3T3ME 4YC2B 4N0UA 2OI9B 3EFDL 2X9WA 4IIQA 1X5GA 4PJFB 2DYPA 1WFOA 4OLVH 4W6XB 1T1YA 1IGJA 2DI8A 4AENB 2YR3A 1IBGL 2OTUB 3KPMA 3VDBA 4NDMB 1J12A 5IROA 5DFVC 2WP3T 2HT2C 3UTTD 2B4CH 1WZLA 2I27N 1RUPL 4I4WA 4PLOB 2GITB 3UJIL 1B3JA 1YNTA 5E1AA 5EN2B 3P3YA 4PTUB 1GC1H 1R5WA 4QYOA 1DQTA 1NFIA 3H9SA 4E0RA 1T6VN 2Q7YB 5TE4L 2IC2A 4BK5A 5JQ6L 4F58L 1RFDL 4OFDA 1U91B 4DCQB 4YNYB 4WHDA 1FBIL 4XRCA 5AUMB 1YNKL 1XAUA 2YSSA 1QFOA 4LLMA 1CQKA 4FMKA 5DRXB 2HJFA 3EHBC 3O6KL 5LQBL 2AXGB 3VXQA 5IHUL 4PRAA 3INUH 1IC4H 2XKNA 1OP3K 4YHML 4W68A 4HDIB 1GAFH 4P5MB 4G5ZH 1T89A 2NY5L 4HCRL 2D7NA 5E56A 4KK6C 1OQOA 2WUBH 3EJYC 4UT9H 2CK0H 2MWCA 2XZCL 5KSBF 3RWGA 1QFWI 2FEDC 2I9TA 1IGJB 3BUYB 3GUTB 1OWWA 2AK1H 3BDBA 1Q0XL 4KMTH 5KJRH 1CFNA 1I75A 3DUHA 5HHOA 4K9EC 4YC2C 5ID0A 3CVHA 2BVOB 5DJYA 5FCSH 4E41A 2HVJA 4JANB 1S8DB 1QNZL 1MCOH 4OGZA 3NTCL 3WNKA 2A73A 1GGBL 3NIFE 3N1MC 1X7QA 2OZ4L 1KEML 2H6PB 3RVTC 1MCHA 2GUOA 3VGGA 4Z7NE 4U7SA 5L2KB 5ISZB 4Z7VE 4MXVF 4OZHB 1JGLH 1T2QL 3O2DA 3G6AA 4CW1A 1NC2D 1SEBB 3IETB 4OGYL 1R3LB 2R0KL 1NL0L 3MRIA 1N4XL 1F13A 3KR3H 4LLQA 1EO8H 4OLYH 3UPCA 3QJHA 1DVFB 4NQEA 5CJ5A 1FN4B 3JSSA 4KUZL 4K3GA 4F7EA 2JIXA 5DEGB 5K9QG 5E6ID 1HSBB 5B3JE 1RJYA 1RVFH 3PHOB 5E00B 5EO1B 1T5WB 2OMBA 2WSKA 4OD2B 3TFKC 4GJTB 3KDMB 3EOTH 4J2XA 1XGYH 4G6JH 1N0LA 3DV4A 4JFEE 1INQA 2J12B 1TZIB 5K9QI 2EXWC 1J88A 4MD0A 1UQSB 2IFGA 2VE6B 1BVKA 1KFAH 2DQGL 1A21A 5FYJH 1GC1L 4LGSB 4C54A 4MJ6A 1OSPL 1INQB 3PGFL 5IMOB 3TWCH 3VXSB 2ZP0T 3QIBB 3UYRL 2YKLH 1W72B 4BSWA 3TIEB 2I5YL 3BW9B 4ONGH 1FAIL 4HUXA 3RDTC 3P9WB 5EA0H 2DLIA 4RMRA 4RMSA 4JQIH 5E9DB 4CMMA 3KLHC 4YIQB 1SEQH 2CSPA 4KJYB 5DZLA 4FQHA 1YY9D 3DGGA 2ICEB 2GTWB 1HCVA 2AJZB 5IT2H 3HI1A 1INEL 3ZKXB 4GSDH 4ODXB 3MRGA 4JREC 4LSPL 1T6WA 3L3GB 1NAML 3WKML 1X5JA 2X44D 1QYGH 1EEZA 4RAVA 3EKCA 1CVRA 4EDXB 2R2CA 4ZTOL 1QRKA 4OZIA 4ZPTA 3SE8H 3ES6A 4CVZA 3MNVA 4F58H 1U58A 4ZSOE 5D6DC 3BAEH 3VXSA 4YWGL 2F54A 1AQDA 5HVFB 4OIBA 2EIZA 4Y8AA 4KJQD 3DBXB 5CGYC 5JOEA 3FOLB 1YPZA 4XP6L 4TOYH 4M1DH 3DX9B 1NCUA 4PP2B 5AYUL 1ETZA 5J8OA 4HIIB 2BVUA 3BEVA 4PJAE 4I0KA 1EX0A 1UJ3B 5J1SC 1NGWB 1SJEA 5FGBA 3AS0A 4P2QE 3O3EA 1DQJB 4JFHE 3X11A 1WFUA 1NL0H 5HPMA 2NX5A 1ACYL 2XA8H 4BZ1H 1BBJB 3LEYH 1NSNL 1TZGL 4W4OA 1K5NB 4HT1H 1WCQA 4YFLF 2ITDA 3L3KB 5HVWA 2G75B 5E6IA 1MI5D 4GAGH 1KN4L 3FT3B 5E2WH 5EORH 5T1DH 5TQ0L 4BM7A 4NBXB 3LQAL 4JFFB 1AKJA 4D9LL 2FX9L 2FATL 4L5FL 4N0RA 3X3FL 3T1WA 2IBZY 5KAQG 3NABL 2B0SH 3FO9B 1A6UH 3A6CH 4X6CF 4YO0B 5HYQA 1ZHLA 3R06B 5D7LE 4YHZL 2YXMA 3VMOA 2EH8L 5DD1L 4UU9B 1IGFH 4YQXL 2ATPB 4Q9CA 4Z7WE 4NN5B 1HKFA 1RJCA 1IAIM 2A2QT 4U1HA 3MRRA 1N0XH 1JZ8A 5DJ2B 4NQDB 4XI5C 5BS0D 4IRSD 5E6ZA 3DHMA 1IGCH 1G9NH 1VSCA 3B9KC 1MY5A 1E4XH 3TZVA 4PGDB 3UYPA 3C08H 5DJ2A 4XBPA 1R3KA 3LQZA 1JJUA 4JPIB 3N1FC 2A0LD 3GKWL 4HF5L 4Z0BL 5ETUA 3CFEA 3DETD 4PJ7F 1NFDB 5FO7B 3PQYB 1N59B 3T4AB 3D85B 4O4YL 2AVGA 4R0LB 1IM9B 3FT4A 4PG9A 32C2B 1KFAL 2M1KA 3FO9A 3QBTB 4QRPB 5E2TH 4F57L 2QBWA 3WIFB 4FABL 4E5XA 1R5WB 4K8RC 3EYSH 1UM5L 5FGRA 1Y18B 3QDGD 4YDVA 2W38A 4Y2DC 4GKSB 3M17A 4O2CA 4ZS7H 4LSUL 4RFNC 4WEBH 1YEKL 3GIVA 2BC4B 5I71B 3NFSL 2AERT 5I19H 1IZJA 1JWSB 4KJPD 5C8JB 5D1XD 1A1OA 2XTLA 4BYHA 2RJMA 4MQXD 4ZNEA 5ACMA 3RA7L 3V52H 5FO9B 5F1IB 1U6AL 4MB5A 3ZHDA 3PHSA 3BXNA 3WYRA 3DLQR 1G6RB 2BY2A 4LLWB 3OTTA 4GAYB 3NCMA 3MV8A 1MHEB 3P73A 3A6BH 2F9BT 3QDMA 3EJJX 3PDGA 4NOBA 1N2RB 4U1JA 4U7MA 2G5BA 1YEFH 2ENYA 3S88L 2DKMA 2ZSWA 1HH9B 1MF2L 2IFFH 2YPLA 5B3NA 4TUKH 4PJBF 5IB3A 1ZT7A 3DVFA 2SEBB 4D9LH 3DARA 5DI8B 3VI4E 2EC8A 3VFNA 2R4SH 5MEOA 3P11L 3NCJH 3G5YA 3UAJC 3MTRA 5FKAA 2V5YA 3WO4C 5F3HA 4OCXH 1ZHBA 5HD8C 4M4RA 5FF6B 5TDPA 1HXMB 1H8NA 3TLRA 4PB9L 3OKEB 1G6RH 3FQUB 1I4FA 3IXTB 4YQXH 5GRJL 3GMRB 4HZAA 2BSTA 2DI7A 2DS4A 4OSUH 2ZG2A 3NIGE 1A1MA 1AGDB 3DUUA 2W65B 2XZAH 1D5XB 4C83A 3GM0A 1T66D 3T2QA 1WFNA 4HGWB 2M8XA 2A6KB 1R3IH 3L1OL 4KJYA 4LLQB 4LPVA 1NGWA 1EO5A 3UZEA 1U36A 4XP4L 3VFRB 2PXYC 3THML 3GIZH 5H37H 4Z18A 4WY7L 1HHJB 5C0AD 3LDBC 4QHKI 5ERWB 1J0KA 2VLKB 3RPIA 4L9LC 5LGJB 4M93B 1DDHB 1JUFB 5FYJD 5F7HA 1EBAA 4PJDA 4ZUTA 3Q6FA 4LL9A 2Y72A 4WEUD 2Z31D 1T1XA 4I0PA 1BREA 4XCFL 2BFVH 1I1AD 1B9ZA 3BZ4B 1M7DA 4OZIB 4NN7C 1KLUA 5E2TL 4ZFGL 2AV7B 2X1XR 1HWHB 1RZGB 5JQ6H 4KTEH 3RZCC 4Q6IA 5EOCL 3KS0J 4NGHH 1BQUA 2EC9T 4HMDA 1WTGT 1CDGA 5CJQH 4QRTB 4P46A 3VXRD 1KXQE 3WBDA 2FGZA 3UBXI 5D1QC 5JQHC 1IAIL 4GG8B 4X4XB 3RGVA 2MQ0A 3HMXH 1CIDA 1QBMH 1QVOB 2VDNH 3U83A 3D18A 4MJIA 2FBJH 3X12B 4S1DD 3C6LC 2NY5H 4HCRH 4JCLA 3WD5H 3BIBX 3IVKA 4EI6A 1WAAF 4LLDB 4GW5A 3BRDA 4F7TA 2J8OA 4OCLC 4UT9L 4KDVA 4K3DH 4L8SB 2OK0H 1DUZA 1FNGA 3CFDA 5DRXA 3O3BB 2EZ0D 2PW1A 4QHUA 2F54E 2EEBA 5C0JA 3HB3D 1NCBH 2AJ3A 1W0VA 3U9PH 2P8MA 4FFZL 5I8EA 1D6EB 2O26U 1OM3H 5T5FH 4RAUB 3AS3A 3DOSA 3OAUH 1ORSA 3TBVA 4K94H 4WFEE 2HKHH 3CC5B 5FGSA 5IESL 3TNNB 5E1AB 5EN2A 3BZEB 1J87A 3RP1A 2APXA 3E3QE 3IDNA 5MENE 4BQCA 2IWGA 5I19L 2JLLA 4H0GA 1YMMA 5E2VH 1DLFH 4APQC 3UBXG 1EEYB 4IRJC 5CEZD 4IHOB 2VZUA 2RBLA 4J6RL 4KMQA 3U30B 1BFSA 4I3RL 3LIZL 4OLXL 5JOPE 2R29L 4HFUH 3GJFA 2OR8A 3EDEA 4O58L 3PG2A 1YEEH 3MXWH 1IEHA 1MFDL 2EDTA 3CLFL 5FUOH 5A16A 2XQBL 2V17H 2VLRE 1EO8L 2GUOB 5T1KA 4ELMA 3EJZC 1MRFL 5KN5A 4OJFH 2FJHA 4TTDC 1CTNA 1HK6A 4CW1B 2CMRL 5FO8A 2LU7A 1S9KC 3SKMA 4F33A 1HHKB 2CKBB 2IG2L 4UT7L 4U1NA 4JFDE 4HEPG 2KZWA 3EFFB 3WXVL 3LAFA 3UCRA 1C5BL 3U79A 5ID0B 4GQ9H 2K9UA 2HKFL 3GSQB 1I8MB 3BFOA 3A6OA 3RAJL 1FZOB 2PCPA 4LRNH 4I5BA 4X5XA 1WBXB 4FG6D 5BRZD 3RIAK 1A9BB 4M03A 4PLKC 4KJWC 2NXZC 1JHLH 5CSZA 5I1AA 1BAFH 1DBJL 4LIQL 1E6JL 3DNKA 2J7LA 1AFVL 5BV7L 1I8KA 3GJFH 1DTUA 2LU4A 3STLB 2FJFB 1J0IA 4Y2OA 3S37H 2EO1A 3KPPA 3EOBA 2OM5A 5C0JB 3OQ3B 1I3RA 2EE6A 2VLRB 3ULUH 1QBAA 2H2PD 4OT1H 3QPXL 4R4BA 2Y7QB 4GKZA 4IOFC 2P43B 2BK8A 2CLVB 1D5IL 2DJ4A 4X6DB 3S97C 1E0OB 2DOCA 2J8HA 3ARBA 5ID1B 5HYIA 3T8XA 4XCFH 3NAAL 3ORJA 3WKMH 5KW9H 1WBZB 4IS6B 4OZFH 5GRZA 4FRWA 1OOAA 1JI2A 4HQQH 4ZTOH 3VXUB 4AQOA 1T66C 3IDMB 4Q9QL 5GRYA 4H5SA 1AGEA 2AJYL 3IFOB 2HTKC 3IFNH 5TDNA 2QHRL 3RUGE 4G9FD 1UCTA 3D69B 3BD4A 3ZKQD 3BDXA 4DKEH 1P2CB 3DSFL 3PV6B 1MOEA 1S7RA 3OKEA 4TOYL 3S7GA 3VFTB 3W9EB 5TDPB 3U6RB 5IVXA 1CT8A 3OHXA 2ZCHL 2VSCA 2HFEB 4U6YA 3DX7B 4ZTPH 2MCPL 2OK0L 3HZYB 5BRZA 4I2XE 5LAXB 3RWEA 1P4LA 1IKFH 1O0VA 3PDOA 1TDQA 4DZ8A 3MMEB 4LBEB 4Z7WA 4AK1A 4Q7DA 5FECB 2FO4A 4PRPD 1VEOA 4Z7QE 1EVTC 3TN0B 4WW2B 4QCIA 1VCAA 4XPAH 3SDYL 1XF2B 3LVEA 3BJLA 3V7AE 2APWA 4JKWA 5J12C 5CEZE 5B39G 4DN3L 1NUNB 3L3DB 4QRSA 1EAPA 3N9GH 5SX4I 4G7YH 1CGUA 4BH8A 2IH1A 2XRAH 3NIDF 4IRJB 4CN1A 3EO9H 5BQ7B 5GGVL 5DDHB 4PJDF 1MNUH 3MQIA 4YXHH 2EXYD 3FO2B 1LO2L 4J23A 1QPPA 5SWZA 4CNIB 1I8KB 4PLNC 3ULVL 4KI5C 4U1GC 5FM5M 3ARBD 5CBEA 1BM3L 3VWKC 3MLZH 3K4AA 2ARJB 3WEXA 2FB4L 1D5MA 4JDZB 4U1SA 4PV9B 1V7NH 5J1TC 5D7IF 4UINL 1OF2A 1G0YR 1YJDH 1NCCH 1LO4L 4HUKB 4AMKH 4R4BB 1YYLL 1AGCA 5CP3A 3VXME 2ZJSH 3L5IA 3S5LB 3OKNB 3TH2T 4ZFOL 2AEQH 1N5YL 3T8XB 4RGOL 2ERJC 3WXVH 2D7OA 1G7MB 2A83A 5JUEL 3FFCB 3MX0A 1R6VA 1MFBL 5IFAH 1LK3H 3UZQA 2FBOJ 3JWOL 2XQYG 3MNZA 1IM3A 2AJSH 4K3JL 1EJOH 3U0TB 5GRUL 5HHXH 1MHHA 1G9NC 3LKOA 1MEXL 5C0EB 4GRLC 4IMKC 1Q9KB 1ZA6B 1FYTE 1KACB 2VZOA 2GT9A 1JHLL 4YPGA 1GZPA 2DB8A 2IALA 5IW1A 3FN0L 5BV7B 1DBJH 5F7WC 2UUDH 5KVGL 2LAGB 5I76A 5ALCL 4UZGA 3BSZL 1PKOA 5AAWA 5FB8B 4JRXE 4YXLH 1G7JB 1ZEAL 4Z76A 4F9LA 5D71L 3O6KH 3UC0H 3UTOA 3PWVA 3N1PC 2XWBB 5IFJB 4E5XB 4QF1B 1V3JA 2C4XA 1XH3B 5IKCA 1T7XA 3ISWA 4M93C 3GI8H 4R96B 1ZS8B 4P99A 2GJ6E 4RZCA 4WTWA 4N8CL 1U93B 5EPMA 1SVZA 2IQAA 3CMOL 4MLIA 4KKLD 3M8OL 1CGVA 4LSTH 4RZCB 4P5TB 5I9QC 1NAMA 3O3BA 4PBXA 3SJVE 3A6BL 1NFDA 3ARDC 5JDSB 4Q9QH 3C09B 4DZBB 1QUNA 2I07B 4QXGH 4X9GA 1VGKA 2E8YA 3ECBB 3S35L 3PF2A 5GS1B 5EWIL 2P8LB 4U1LB 1CR9H 4JO3L 5CS7A 1HHIA 1N3NA 4NZUH 3VGDA 4RFEB 4WFED 1HILA 4PRDA 3TN0D 2LV4A 1U8LA 1DE4A 3RWFA 3Q48A 3P0YL 4PJ5B 3ZDYE 4AIXA 4EDWH 1UACL 4MDJA 4N90E 5TH2A 3ULVH 1CN4A 3RZCD 3ULUE 2UZXB 3HE6B 1KXTB 3D6GA 4P2RB 2Z92B 2IPUK 2DKSA 1SHMA 1K3IA 3WS3A 2P24B 1EXUA 4YEEA 1YJDL 4G6FD 3KJ4C 4ZODA 3GJEA 3QISA 2D7MA 4F8TA 3FB8B 4ENED 3V9FA 2ICWI 3QDGA 5I1HL 2EDDA 3KYOB 2ILLA 1C8PA 2V2WB 3K2UH 3B8YA 5I6XB 4X9HA 3P4MB 5DQDH 3D5OF 4WFGE 5TE6H 3UTZB 4IJ3C 1P7QD 3L5XH 4PFEA 2VDML 4BZ1L 2W0FB 5J9PA 1U0QA 1G1YA 1TZGH 4L3CB 3ME0A 4K71C 2BERA 1MEXH 3RIAF 5EO0B 4ZPVA 4XAWL 2NW3B 3BGMB 2CDGA 4PJHB 4XGZA 5BZWB 4Y2DB 3VCLA 4NNYB 3OGOE 3O2DL 2HYMA 4BKLA 3EIFA 1JWMB 3BIAX 3QT2A 1I1AB 2ENSA 2DIAA 3NFPA 2V9QA 3D39E 4PPTA 2HVKA 3G6AB 3I75B 2NY7H 4KY1H 3FAWA 1EEQA 1FFNB 1WVZA 5DJCB 2XT1B 2F54B 4RGMB 4L4JA 3H3KA 4X80H 1V05A 3AROA 3OZ9L 1U8MB 5IVNA 4PJCE 1X5YA 4DZ8B 4ODWB 4XMLH 1TETH 3DXAA 3NZ8A 2A9ML 2OXHA 3CVHL 5IGXH 1BZ7B 4N8CH 4MAUL 3VXTB 3ZDXF 3AB0B 1P4LB 3FJTA 3PDOB 1CLZL 2E7BA 1QRNE 3ALXA 2AJZA 1G9NL 5C0FB 1INDL 1I1FA 2NX5D 4KI5E 1MFAH 3QHFH 5KS9B 1CG9A 3MC0A 3EO1B 4JN2B 2ZCLL 3VGEA 2CDEA 2Z9TA 1S3KL 2OMNA 2YWYA 1JPSH 3CDGB 1QQDA 4P46D 1FO0A 3F7QA 1B4RA 3DO7A 2B1HH 3ARGB 3LV3A 5K9OA 3KHQA 4QTHA 4PJ9B 4XP9L 1PDKA 2GTZA 4YDLC 4OZIE 1FNSH 3LKPA 1NC2B 3ELAT 1RIUH 2WNGA 3VXRB 1E6OL 2JJSC 1JZ5A 1HXMA 2V9RA 4LSDA 5DURB 1AR1D 3CFJA 4KKCD 1OAQL 3DV4B 1OHQA 4RRPA 2A9NL 1UQSA 4S1DC 2MSPA 2BOBB 5L0QB 2NY1B 3VJ6B 5M95B 2APVA 4L3ED 2D4DA 3QYCA 3ZE1F 3RI5F 5I1LA 2BX5A 2BY3A 1H3XA 1HIML 1G7HB 1XGTA 4Q74A 4GAGL 1PG7W 1UH4A 3O11B 5DUMH 3ARGC 3PWJB 3CVHB 5T1DL 5I8KL 2FZ3B 4FOMA 4XC3H 3N85L 4NRZA 1A3RL 1YUHB 5HI4D 4LIQE 2UZYB 3GSRB 4TNVF 2DQDL 3ZKNC 4AIOA 5E5RB 4PGDA 3QDJB 3VFVB 1E28B 3RNQB 5KVEL 3P0YH 1NANI 2VDMH 3N0PB 2XWJB 4F7MB 2W9EH 2C4FT 2WBKA 4KZDL 1YMHB 4U6HA 1IEAA 5FUZH 3F65A 3SEPA 1ZA3B 1QLRA 4RSVA 2ZPKL 1U3HC 3QNXA 4LCWD 4GKOA 5ANMB 1MF2H 2IFFL 5IWLC 3MOBH 4KK8C 4OF3A 2ADIB 5MEPB 4P9MH 1BF2A 1YZZA 4LF3B 2XN9A 3V7AG 4BQ9A 3C6SA 3CDYA 3KLSA 4G8GD 2YMXL 3I02A 3NGBC 3O9WD 4JFPA 1FLRH 1LGVA 1ZLUK 4Y4KA 5HYJD 3S37L 2X05A 1VACB 1IE5A 3EAKA 5CBAA 2DIJA 3L5WA 1FDLL 1WBYB 3V6ZA 5KVDL 2FNBA 1BFTA 2CO7B 4MXVE 4KU1A 4GG6B 4M02A 2NY4C 2R1YA 4JREB 3L5XL 3QPQC 4NQDA 2ORBH 3NCFB 5JPMA 1MCRA 4MD5A 3QDJA 3VFVA 4Z7VB 3UJTH 3MGAA 1G7IB 3UTQA 5JDSA 4JKPH 4WV1A 4OCNC 2OSLA 1WF5A 1INDH 3Q3GA 2ZCLH 3KPSE 3ULUC 1U3JA 3GUTA 5I6XC 4LRIA 1EEUA 5C09B 1S3KH 2AEPH 4FABH 3BZEA 3T1FA 1FH5H 1GRWA 3D25B 4JFZH 1OP9A 4RISH 3QIBC 1JHTB 2R0ZL 5IQ9A 4DK3A 4QHLB 3NACL 2QQLL 3DBXA 3F5WB 3NCCB 4G80B 4JFED 5ILTL 4DW2L 2EDXA 4PRIA 1CGWA 5KSBA 1WAAA 3GSVA 2F53E 1URLA 1H5BC 3MBXH 3TVMA 1A6WH 1ZLSH 5CEZL 1IKFL 1KCSL 1DFBL 2BNQB 1NLDH 2D0FA 1I7ZB 2AV1A 5CJQL 8FABA 4KJPC 3OKMA 1X5XA 1HXYA 1KJMB 3F7RA 4G6AC 3HMXL 3WFDL 3H0TB 3HLAA 5DMGC 4UTAL 4EZMA 1BJ8A 5EBLB 2XKUA 1A4JA 3BPLB 1U8NA 1T1YB 3HI6L 1NBVH 4JHWH 1VFMA 1IGMH 3G5ZA 1ES0B 5IMLB 4XHJD 3QCUH 4ZXBC 3SDDA 4XZUA 4FN0A 4R97B 4WUKH 3QDJD 2VISA 3MLZL 4Z7QF 4LQFL 5D70H 4ZS6D 5B8CA 5IB1B 4Z77B 4OM1L 3VDCA 1EBPA 5I2IB 3HRZA 2VE6A 4A6YB 3DJ9A 1VEMA 3U36B 2VQTA 2QJDA 2BP3A 4F7PB 2HMIC 1I8LC 4EOWL 5F9OH 5D7KD 4PJ8C 1UM6H 3W39A 4NQXB 3FQUA 4D9RD 3GGWA 2OBGA 3JVGC 1WUNT 3E0GA 3B3IB 2D9CA 4IRSC 4MZ3A 4RIRB 1LK2A 1D7FA 1MJ8L 4I3SH 4NQXA 1BOGB 1CL7H 2DBJA 4P2YA 1JRHH 4XNUH 2DQJL 1KB5H 1H15A 1MFDH 2JJTA 4L3AA 2V2WA 5FGCB 2YUWA 3O6FD 3UP1A 5AYQA 3HPJA 2YPLB 2GJZA 1HHHB 1I1FB 4HK3N 3QI9D 5IMMB 3LEXA 4GXUN 5E7BA 4NM8H 4ALAL 3D39D 2CUMA 1KB9K 1G9MC 2W0PA 4U1IB 1ZTXH 2J8UE 1CU4L 3MA7B 4BQBA 3RWHA 1H3UA 3WDHA 4P59H 2XOTA 2D31B 1IAOB 2O5ZL 4QOKB 4UILH 5KVMC 1J5OL 3MRDB 2MKLC 4KTDH 1B90A 1IAIH 4IDJL 1NFDF 3VXRA 1AY1H 3MUY1 4WW1A 1CQYA 2R8SH 3LRSA 5ESQB 5F88B 2FR4B 3CXHK 1KJ3L 3VG0H 1VFUA 1G7QA 1QBLH 1SM3L 4LIQH 3D9AL 5HGDB 2OJZH 1JGVH 5IBLD 2VDKL 5T3ZL 1MJJB 1FQ9C 4YZFE 1N6QL 4WI8A 4NO3B 5M94B 3PL6C 2OI9C 4G8FB 4WU5A 1EFQA 3CUPA 1W2KT 5D7IE 4B7IA 3QUYB 4KK6D 4PGCA 3VFPB 1QSFB 1S9XB 3OAUL 1I8IA 4YHKL 4L8DA 4NZDA 3PGDA 4Z7NF 5EPMB 1KJ2H 5DT1L 2HKHL 2XTJB 1ED3A 5T5NF 1QA9A 4EEEA 4ZNEE 2GFBA 1DCLA 1GIGH 3NACH 2ICWJ 3V5KB 5T1MB 4ONFL 3OX8B 1AO7B 2WM0A 5L6YL 1DBML 3VXOA 3TBYB 1MIML 1UACH 4U6HB 4LPCA 2C26A 1AO7A 3LN4B 4XNYH 1SJXA 2AJXL 2EDFA 3FFCE 4MD4A 5DVLA 3T65A 2Y07L 1Q38A 4KPHH 2XQBH 3QUKB 1J86A 1LO0L 3KLHD 2YRPA 4DKEL 4M62L 3UTSE 4H1LH 5CHNA 1S7TB 4GQPH 3T0WA 5T1KD 2XG5A 12E8H 2D2OA 2COQA 4XP5L 3U2SA 4C4KO 1MLBA 4M4PA 4YHNB 3P30L 3VXSD 1IAKA 2Q8BL 3OJDA 5IBUB 3FZUD 4F3FB 2BY1A 5DK0B 5CBAB 4OKVA 5BZDA 4Y19A 1U92A 3AM8C 3DX8B 4PLJC 3WNNA 3LN5B 4WO4B 4M43H 2X4NB 4X8JA 2VZTA 3QQ9C 2CRIA 1MHHB 1OTTC 1HHKA 4UQ2A 5DJZA 2X7LA 1MCNA 4UOW1 4QHUB 1AHWA 2DIBA 5IV2A 2LQRA 1FVCA 1KJVA 5D1QA 3OG6B 3QAZC 4M3JA 5DJZB 4KRPD 1D6EA 3SDYH 1H0DA 3O2DH 1CD1A 3VFOB 5AD0B 2BNRE 4LARH 2RCSH 2O5ZH 3NZHL 4JO4H 1GL4B 4LRIC 4J4PA 4TN9A 4XH2B 4BSJA 3B9KB 4MCYA 4ETQB 4G9FA 4C59B 4CMHB 5GZND 1WK0A 3PWVB 2R56L 1HQRB 3NCBB 4NO3A 5EZOH 5ITFB 5IOPA 3GSWB 1JZ4A 3U2SB 4F8QA 1X44A 2RGSA 5KOVC 2KQMA 4TQEH 3F7VB 3MRHB 2DQJH 1S5HB 2HAZA 1AE6L 4V1DA 4OLYL 4AQ1B 3ULUF 3T0DA 3TBTA 4H1LB 3MRJA 3ZDZE 4GG6F 4M61B 4NWUL 4HLZG 4HUNB 1LE5A 4G6ML 1YPZF 5C0EA 3RUGB 4PJIA 5T5NG 3T0AA 2ZOKB 4I3GA 5CJOL 3HZVA 1U3YA 1R0AL 1N7MH 3EOYG 1HN1A 1L0YA 1RZKH 2AKRB 4ENEC 5HGBA 4NM4H 1KJ2L 5DT1H 5BVPH 4P2QA 4LKXB 2VJXA 3IDYC 4OCYL 3ULVD 4M48L 4JO1H 3PWPB 5I1EH 4PIRF 3U46A 4HIEB 2WV3A 1RZ8A 4J3SA 5DEFB 5IW3A 3LS4H 3UPRA 2ESVB 3HR5B 1PYWB 3KPLB 2DQGH 1UYWL 1I9RL 2QLVB 1MWAA 5EU3B 3FN0H 4FZEL 1PZUB 3U30C 3HA0A 1Q72H 4MA8L 5SWZB 4APQB 5I15L 1KF9B 5TFSH 2X4RA 5IHLB 3V4UL 4S1SH 4KPHL 4HPYL 3V6OA 5FDWB 1T1WB 4GW4A 4L4TD 4H8WC 5CBEB 4P4KA 4X83A 2P8PB 9CGTA 4PRPE 1C1EH 4ODWA 1U95B 2H2SD 3H2WA 2QQNL 1S7QB 3CX2A 4MNGE 3ZE2E 1MJUH 4WI7A 5DA0B 1WBZA 1IFHH 2H3NB 1A1NA 3DURB 4EI5D 1XCTB 2ZG1A 1NBYA 3MLSH 2VZVA 5C0IA 3C2SA 5ESVB 3DURA 2RFXA 3AS1A 1ES0A 3KDMA 3NMEA 4L8SC 4RMVA 1WZMA 2CO6B 2YHGA 3BGMA 3V79C 3BKJH 1NC2A 1W72L 3HAEH 5D7JB 5I1KL 4Y2DA 3VCLB 4HJJL 4BJLA 1OTUD 1J0YA 3AM8A 4OM0H 2VXSL 2XXMB 2WIIB 1JPGA 1T7VA 1J1XH 2HT3D 1QLEL 4HV8A 3U6RA 3ARFB 4PGBB 4ERSL 1X5KA 5E8DH 3DHJA 5GISH 1N64H 3HMXA 5AYUH 1OGTB 5HHPA 5E2VL 2Y9RT 1ZHNA 3LKQA 1NANH 3H0TA 4J6RH 4QRUA 4GMSL 3QDGB 3PL6D 4RNRB 1SY6H 5BVJA 4QNPE 2C3VB 1ACYH 4OCRH 5FK9A 1XGPB 2HP4A 2AJSL 1AP2B 2CIKB 4X6BB 4U33A 3JZ7A 2X70B 4U1MA 3SY0B 3UBXB 2E3VA 3TZVC 5CUSL 3QWRA 5FYKL 2F74A 2YPKA 4UDUA 4JFOA 4JDVA 3QFDA 5ICYB 2QSCL 3GMNB 3LZFH 4E41B 1IKNC 3OWEA 2NW2B 2AEPL 3BO8A 5FCUH 3QDMD 4L3EE 2QQKL 4OZFA 4MNHB 4MQXC 1DBBL 3WKNA 1MPAH 3QIUD 4HKXB 3V0VA 1T0NB 1MWAH 4PP1D 1TVHB 4GXVL 1RIVL 2QSQA 3GEWB 1ODAA 5C09D 3O45B 3KPTA 4LRNL 2H8PA 1LD9B 3MLTA 5L2JB 2BNQE 5GGQH 4NRXA 4AH2A 1IGYB 2XPGA 4X98A 2DDQL 5I76B 4NIKB 3KPRE 3OR7B 4Q0XL 4EIZC 3MXVH 3QUKA 3L7EB 5CEZH 2NXZD 1ZHLB 1CLYH 2EH7H 4OF7A 3B2UC 4Y4FC 5SWSB 3WO4B 43C9B 5DO2D 4JCMA 1B2WL 3IRZA 3P4OB 3MRLA 2C3XA 3HPLB 3O41B 4TTGA 1UB6A 1CE1L 4ELMF 3OB8A 3BZDA 4BFGA 3GBNL 2IGFL 2R1XA 1MJUL 5FYLD 3OGCA 1IFHL 2ZKHL 5LWYH 2IPKA 3WFEH 4QLRA 3T0BA 5GJSL 1DLHA 1NC4D 2XIDA 3NPSB 4OZ4A 4XCYA 4Y4FB 2X4QA 5CIPA 1IEAB 4LMQI 5F9DC 4X8JB 1NUDA 2HRPL 1K4CB 1EPFA 3VWJC 3L3JA 3AREC 4PY7A 1JF5A 4WUKL 2DQFB 3FQXB 3RTQC 4X98B 4BZ2L 5GGSB 1ZVSA 3WEXB 3AAZB 3TYFA 3TPKA 4YE4L 5JOFA 2B1HL 2DQFA 2VH5H 3FQXA 4Q6IB 1KCRH 5L88H 5J6GA 1CXHA 5LJYH 2AAVA 1EMTL 2OCFD 2VIRB 4YLQT 5IMKA 1KB9J 2BDNL 2D0HA 2EDKA 5KSAC 4RFNB 3L5WB 3I50H 1IC4L 3PHQB 1OWRM 4NJ9L 3QEQD 1OSZB 1BP3B 1ORQB 3TH3T 3VW3H 3X3GL 3T2OA 1T83A 3HS0A 3HMWL 3R1GH 2EDHA 5E8NA 2R1XB 4KVNH 1OCWL 4GKNB 1KG0A 4F9LC 4JFDA 3DI3B 4E42B 3PL6A 2DWEA 1DDHA 4ZAKD 1P6FA 1UEYA 3C2AH 4MAYA 4DFIA 3OJVC 3Q6FB 1Z6JT 1GHFL 3MRPB 3TA3D 1JZ6A 2OP4L 4NM8L 2W60B 3S88H 5HHMB 3V5DA 1TXKA 4NN6B 1QSFE 4JN1H 2DQDH 3QIBD 5JXEA 1J8HA 1K6QH 1DBBH 3DRTA 4LOUD 3VI3F 3W0WA 4LAJH 2MJWA 3IDMA 5IP4A 1A4KB 3BX7C 4LQ1A 4D9QD 1BIIB 4X9BA 4P5KB 1X5HA 1KV3A 5EU3A 4BSVA 5E08L 3GNMH 4XP1L 3FOLA 2C3HA 2CLZB 1NC4A 3CU1A 1P5VA 4K3HA 2SEBA 4PRHA 3VG0L 3SGEH 4P5TD 5FM4A 3QHZL 3X14A 4XB8A 3ARED 3K3QA 5CWSB 3BH8A 2AQ2A 4GLRH 1C08A 3QXVA 1KENL 2VLMD 3WIHL 5JMRA 4JZNB 3WCYA 2HFEA 4U6YB 2C7UA 1KT2B 1MAKA 1P7KA 4OZGF 4OGXH 3C60D 4TSAH 2Y7QA 1G0DA 4GKZB 3UO1L 3OKOA 3TBSA 4NN6C 5L8KB 3TJHD 3JTTA 4GAYA 4TVPD 4G9FE 2ZOKA 1XIWC 3QDMB 4KGJA 4GXVH 3BYYA 3EZJB 4EN3C 1QRNA 3P9MB 4O00A 2C5DC 2CRZA 2KPNA 2IBGA 5JOFB 4M3KB 1T03H 3WJJC 1RUAL 5MP6H 5FOBB 4BKLB 4RFOH 2VQ1B 2X9XA 2W0FA 1A4KA 5J9PB 5CINH 2ZNXA 5KVFH 1IQWL 3SDXB 4RDQG 2ICES 4ZFGH 1EGJL 2VR5A 3BWUC 3SKJH 4GKSA 5EOCH 1UJ3C 4BZ2H 2B4CL 1ZHBB 5EBWB 1FJ1A 1QR1A 3IT8D 2BJMH 3D39A 3M17B 4KZEL 3E6FB 3QULB 4WHTA 4LSQH 4CJ1A 4DKFH 2ZOLA 2P5ED 3MV7D 1XIWB 4JFYA 5EU4B 2L4OA 2PNDA 1OPGL 3HCVB 4MAYB 5KS9F 4GXUM 5DUML 3ZTJH 4XXDB 3RX5A 1UA6L 2YZ8A 1YEGL 5DURD 2FRGP 1FBIH 2QADC 2E7HA 4E41E 3ZDZF 4OGAC 4Y4KD 3WFEL 3FOMA 2YPLD 4LLWA 5LAXA 3KYAA 1WIOA 2DQHH 3WFCH 1YPZE 5C71A 1U8OA 3DGCR 5IJVB 1P1ZB 3HFMH 4GRWE 3ILQD 4PREB 1IM9A 4Y5XC 3MV8B 3P73B 4DFHA 1MVUA 4FP8H 4X6CA 4MA7L 4WCYH 2OP4H 3QDGE 4U6XB 4ODBD 5F9AC 5ICZA 2VH5L 5L88L 1T0NA 4PRPA 4JN1L 2UZIH 5JW4R 3IJSA 1DP0A 4MZ2A 4OZFB 1XGRA 5DJ0A 3JWDL 5JXED 4RAUA 4RWYL 4M1DL 3TJHC 4KVCL 3SO3B 4G8GA 1H3TA 3QEHA 3O9WA 5C2BL 5HJ3A 1K8DA 3X13B 1KNOA 3WFZA 3W11C 4WUUE 4YAQB 4KKBD 4XXDA 4AG4H 3MLUH 4LP5A 2F53B 3FO0L 4H1LG 4LCUB 2NXYD 2XNAA 3V5HA 5KANI 2V17L 2FO1A 2XWTA 5CCKL 5J56B 3DIFB 4OQTH 5D7KE 4JQXC 1NMBL 1KYOJ 1XGPA 3HS0B 4KHXH 4TULL 4DK6A 2VDPH 4PGCB 3QZWB 1MCSA 1EHNA 3QDME 1A64A 3LB6C 5F6HJ 5HHOB 1FNGB 3CFDB 4FFYH 4U6TA 3OJ2C 3HG1A 35C8H 2EDEA 3LQAH 4Y5YB 1B0GB 4Y16D 3KR3L 4LEOB 2MQCA 1BBJA 5C09E 1W8NA 2EE2A 5TE7L 3L3OA 4L8DB 1K5NA 4XT1C 3K8KA 1V5JA 1MHCB 1H3PH 2NZ9C 5EZIL 2V2XB 1BX2B 1X4YA 3B9KD 1KLUB 4CVUA 1NBQA 2H26A 5T3ZD 3CC5A 4JQVA 1BJMA 2X1OA 1VESA 3VFMB 2P4AB 5I1JH 4WTZG 2Z91B 1P6AB 4GG6E 1L7TL 2GJ6B 3PP3H 4UIMA 4LCWE 4XHQA 4NO0D 1RZKC 3OAYK 5GGUA 2CKBH 4ODUB 2CGRH 5DLML 3QXAB 4IRSB 2A6DB 3OPZH 5C70A 3RY5A 4R26H 3BPNC 2P5WE 3V5HB 3BVNA 3NPSC 2QSVA 2F19H 1IMHC 3PGFH 2X70A 4U1MB 5I17A 4MNGA 4WO4D 3X14B 1OPGH 5J1AB 3OXSA 5E8PB 2FHCA 3BN9C 4J4PD 4J12A 3S4SB 4AL8L 4TVPL 2OJZL 1ZANL 2P7TA 3MREA 4O2EB 2P8PA 1MRDH 2DTML 3ARSA 5ITBH 4KRPB 1PJ9A 3QCUL 1TVHA 3ARRA 1YQ2A 3QNZA 1G7LB 2VUYA 1IQWH 4GBXB 3BP4B 4I48A 3BIKB 3EYFB 4D8PA 2LAAA 3BPLC 1WCBA 1LEKA 4Y16B 4RDQF 5DD3L 2X4UA 4P4KD 1PYWA 3KPLA 4OM0L 5FDYA 4ZO7A 2AP2A 4ONFH 5F9OL 5CGTA 1A3QA 5JW5B 3C6LA 1YEGH 1MCJA 2A9NH 1BGXL 2Z8WC 4Z0XA 4X99B 3S34L 3FQRB 4DOHE 4AG4L 1B88A 2QKIA 2CQVA 5C0AB 4JY4A 4X4YA 3OKDA 1OT1A 1FL3B 1UKSA 4HWBH 2N7BA 4D9RE 3O6FA 3WUZA 3P30H 4FS0A 2W65A 5GS2H 5C9JA 3KPRD 4Y1AB 4KDWA 2H45A 3N85H 5KSUA 1NFKA 1ZHKB 4YHIB 2Z0BA 3K4DA 5C9JB 3IXAB 1CWVA 2VRAA 3RVVC 3ARDA 1NKRA 1QRNB 3P9MA 1SBSH 4I5BB 4X5XB 3HC4H 3ZKSD 3ABZA 3RDTD 3MBEB 4NUGH 3UZVB 1F3RB 5D7JC 3V4VL 1G9MH 4OAWA 4R4FH 1LP9E 3BH9A 4P4RA 2D31A 3FO0H 4R97C 5D2NC 3VXMD 3T0EB 5JA9A 5JW4N 5IB5A 4PJ7E 4CMHC 1N6QH 5IMOA 3KPPB 1RZIB 4AMKL 1F4WL 1OL0A 1CT8B 2EXWD 3OHXB 4ZUVA 4G6AD 4HAFA 2F19L 3KAAA 2DL9A 4WW2F 3GIZL 3QFJB 3MRJB 4D0CA 4C57C 1IZKA 3ZE1E 3RVXD 1A6TA 4NQCD 1MCWW 5ETUB 3MRNA 4OF5A 1MI5A 5CHNB 3ZDYF 1A1OB 5EU6A 1BVLB 1AE6H 1MRCH 5C09A 3HI1B 3VXUE 5IIEA 4F7EB 2VZ3A 1XCQB 4UV7L 1UGNA 2ATKB 3CAFA 2NYYD 3CX5J 3OAYH 4UQ3A 4IMKA 4HKBB 4HCRA 1A02N 3V95A 5FGBC 5GS2D 3EYOB 5LGHL 1A9BA 1HZHH 3LHPH 1RMFL 1NCWL 4MA1C 4HBCL 3GBML 4WWKC 4JFZL 1Z5LA 3V5KA 4NM4L 3WIIL 5BVPL 3HN3A 5CP3H 3F62A 2NY3D 5IB3B 5C07D 2FEEL 1ORSB 3TBVB 2VC2L 1VFAB 2QQLH 4LU5L 4CN6A 1TZIA 3QA3B 1R3HB 4I77L 5DUBB 5K59F 5HTSA 4NBZB 4ONHA 4QOKE 4MDIA 1KNOB 4P2RE 2ZOLB 3C60C 3QXAA 4IRSA 5FYKD 4JM4H 3GSNB 3WD5L 1CYGA 2O5YH 3QPQD 4YPJA 3SO5A 2NY4D 1AI1L 3B5HA 2QEJA 1T4KB 3HNSL 5FK9B 1DFBH 2V5MA 4AYFA 3FZUC 1HSAA 3GMOB 2DQEH 5H37G 2R9HC 1OW0A 4Q6YA 1IAKB 4V1DD 3GJFB 2BVOA 2NMSA 4JJ5A 3MLVL 5FOBA 2EC9U 4YDLB 3W5MA 3U1SH 1U8HA 2M26A 4I9WE 5BXFB 5CKGA 1EHAA 4RMQA 1MUJA 1MCPH 1JVKA 1YUHA 2R0WH 2HRLA 1RZJH 1ROWA 2F58L 3QUYC 4G8IB 4HGKC 1P9MA 2Y06H 1FFRA 3SJVB 1IAOA 3ZYIA 3O4LA 4QWWC 4DEPB 1ZAGA 2ZSVA 4K9EL 4XNXL 5EZJB 3SN6N 3C8KA 4MMXC 1KPVA 2KH2B 2E7CA 4P2QD 3C5ZB 2MQ3A 4UMGA 1X9QA 1PGRB 1YMME 3QNXB 2ZUQB 3DO3A 2VERN 1NAKL 3IDGB 4KUCD 5BCAA 1S5IL 1CFBA 5ECJE 3WNOA 4RGMC 4HAGA 4LDOB 1NGZA 2N7AA 3SQOL 4OLEA 4ERSH 5I1CL 2X4PA 4JRXB 1GH7A 5E8DL 4P3WA 5FKPB 5JXAL 4G6MH 2HT2D 5SV3A 1A5FH 1ND0B 1C5DB 4NZTL 4ZFZA 3F7YA 4YUEL 3VGBA 1JPFB 1NGXA 1H9VA 5DMYA 1DQLH 1SQ2N 2NR6C 4ODXA 4XNUL 5IFHL 1BBDH 4ELKB 3FQNA 1UB5B 1SJHB 5EU6D 4K8RD 5DHXB 3MZTA 3WJLC 1BWMA 2Q8AH 2VABA 4PJEB 4FQXB 1T20A 3VFWA 3TO4B 1RUAH 5MP6L 5J4MA 3GO1L 5GRVL 3NBNA 3H42L 2P8MB 4GLRI 3RNKB 2ADJB 3SKOA 1OLZA 3MV11 1NBYB 4UBDC 2QR0A 2QTEA 1HCFX 1RMFH 4P59L 2NXYC 4NCC2 5GRWA 3GJFK 1QKZL 4O9HH 2PYEA 3MRKA 5H2BB 4KZEH 5F89B 2Z31B 3EYUH 1YDPB 3I6GA 1JF1A 1RUQL 4HWZA 4W4OC 3QEUB 2Q76A 3D2UD 3VI3E 2X4RB 1QACA 3GSRA 8FABB 1JGVL 5GSVB 3BWAA 1UXWB 2VSDA 5BS0E 5AZEH 2D7TH 4H8WH 4NKOB 3B3IA 4ZXBB 3RFZC 4WFFD 2ZUTA 3QRGL 1HYSC 2DBLL 3IETA 2G2RB 1ZWIA 2VDQH 1JWUB 3NFNA 4P9HH 5SX5K 3TM6A 5D6DA 3U9UB 3FFCD 3J7HA 5JIKA 4UB0L 2V5RA 3DVGA 4E9LA 5JO5B 4FTVA 3WV0A 3QEGL 1U8QA 3RWIA 2YOCA 32C2A 3SDCC 4PP1C 1M05A 2ZKHH 2J8UA 5DMJB 2DWDA 5LWYL 3U9PL 3JVGA 3W2DL 2WBJD 4QRQA 3BRGC 5L6YH 1V3LA 4P5TC 1ZT7B 5I9QB 4W81A 3RGHA 1X7QB 4IM8A 3OMZA 3GMQB 4P2RA 3ZZ1A 4X5WA 3PHQA 1A7OL 5D4QA 4Z78B 2YZ1A 4F3FA 3W81A 2EO9A 1FE8H 1T1ZA 5T33L 2HTKD 4FHBD 1NGXB 5IVOA 3MREB 4M62H 1RU9L 2XPGB 4O2EA 4APQA 1CDYA 3FHAA 1OLLA 3IXTA 5ADPL 3MLVH 3WXWH 3TEUA 1ULVA 2XKNB 4ZQKB 2V2TB 3QRFM 3OKMB 1NPUA 3QJHB 4HFWA 4NQEB 5CILL 2XTJE 1ZLWK 3MCKB 2B39A 2P5EA 3MV7A 5AZ2L 3R1GL 3WL9B 4D0BB 5TE7H 4DVRL 1KSRA 3BPOB 4KVNL 3SE3C 1H0DB 3T77B 4DKAA 5GZOC 2B5IC 4F80A 2GHWB 1BFVL 3E6HA 5FYJE 1UFUA 1Q9WB 4XPHH 4PG9B 1A7RH 1QO3A 3NIDE 3S3PA 3MV9E 4LCCB 5K33A 3LQAC 5BMFL 1GZQB 4XZUB 3VXPA 4QRPA 1YN6A 3UPAA 3MOBL 2FX8L 4LLVB 1RQ5A 2VXTL 3K8LA 4TVPE 3NABH 1RJLA 2VN7A 1YYMH 4NKDA 1T2JA 4HS8H 1ZHNB 3LKQB 4V1DB 4U3XA 4AM0B 1R24A 5JXAH 3TBTB 1WIUA 2PYED 2AJVH 3RGVC 5K9KB 4JG1H 2E9JA 3GNML 1K9TA 3F6LA 2VLKD 4AIZB 1KCVL 1R24B 4HS6A 4JGUA 1H3VA 4B53A 4X6EA 3C09C 4L1DA 3H3BC 3MCLH 5FA3B 1XGTB 2ORBL 4LAQL 4XC1L 4S1RL 5I1GL 4JZJB 4EBQL 1XF3B 2P48B 4UV4L 5CZVL 5DK2A 4OBSA 5DQ9A 3GO1H 2NW2A 1UH2A 4Y7MA 2E7MA 3GSUA 5TPWH 1J10A 1AXSA 2YA2A 3Q5YA 5J12B 5CJXA 2GFBB 5FXCH 1AIFB 2BZDA 1N6VA 1KIRA 3SE9L 3BT2H 5DJ0B 4IRZH 5C0CE 3BISA 1J8KA 1QLRB 4WI2A 1EMTH 4L8BB 3AXLB 1KTLB 2BDNH 3O4OB 5HJ3B 3BZFB 2WK2A 5E5UB 4MNQE 5B21A 1UVQB 3HUJB 1DSFH 1CGXA 4NJ9H 2EDQA 4P4KB 1N6UA 1IC7H 3MA9L 1KULA 1X5IA 1HQ4B 5DMIL 1LK2B 4P46B 3D0VA 1QFUH 4TUJA 1ITBB 1VADA 5DRZA 1CVSC 5EU6B 5TFSL 1H15B 1H8SA 3QUXD 4LFHD 2R0LL 3S3SA 2DBLH 3QQ3B 3DMMD 4LGPB 1GHFH 4G5ZL 3CFKA 1DANT 2GCYB 2Q1EA 5IVXE 1Z9SA 5I8CB 3QXDA 3O2VH 2B2XL 1GGTA 4JPVH 5AZ2H 1Q9OB 2VLKA 3RPIB 3ARBC 5EIVA 4L9DA 4G43A 1EH9A 3PDDA 1LMKA 5JA8B 2XWJA 4Y19D 4J3VA 1MCOL 1T3FA 5E03A 4FP8L 4KROB 1F02I 1QFHA 2UVFA 2CDFB 5DYOB 1MAML 5I1KH 1TNNA 2R69H 3EGSA 1T5XB 3B5TA 4PRHD 5HGDA 5GGVH 1F58L 4QRPD 1HEZB 4WGVB 4EQ2A 1AO7D 4TUJB 1YYML 5DJ6B 4OF0A 1OTUC 1UWXK 2DL2A 4N0CD 2Z31A 2A6JA 4G9FB 4PRBA 2YD4A 3I6GB 3G04A 1LDPL 1I1AC 1N4XH 3MFFA 2XG4A 1FNEB 4HWZB 4NP4L 4ZNCD 4MYWB 3PUCA 5T3XE 4ZDHB 3IJHA 3SCMC 1S9WB 4JM2B 1A7NL 4HC1H 5DHYB 1TPXB 2R15A 4G42B 4TSCH 3RL1B 5C0RL 2WBJB 5D1XB 2ZJSL 2P46B 4L29A 4PJXE 5HDQL 2JK5B 3BE1L 5DQJA 2VDRL 3DV6A 4KHXL 4CU6A 3GMMB 3HZVB 5J3HD 4YEFA 5FYKH 4X6DA 3T1FB 1AXTL 1BQSA 4FQXA 3BXNB 4X7FC 3L3HA 4LLYA 5CD3A 4TNWF 1JNHA 4P4KC 1NCWH 1HOCB 4OIIH 4JN2A 2CRMA 1FVEA 3HPJB 3O4OC 5HYFA 4RFEA 5DJ6A 1S8DA 4G6KH 2RAMA 4R8WH 3CDGA 4IDJH 1VADB 4NQED 2BCKB 4JG1L 4EIGB 4JE4B 3TNMB 1G84A 1KCVH 4HWNA 5EU7E 3WN5A 3IAGC 1PQZB 3G08A 4QRRB 1YDPA 2QKIB 4OI9A 1SYSA 4NQEE 1QFUL 2BSRB 1FFNA 3S4SA 4OZHA 2DWEB 5EOQH 4PD4J 5IB2A 3FQWB 4JFEB 5HGHA 5J89A 4FXGA 4DVBB 1XF4B 1NDMB 2PETA 3O3AA 3FONA 4HULB 3D1MC 4A2MA 1NDGA 3GI8L 1P69B 1KJVB 5FO8B 4LBEA 3RHWK 3T4AA 4HLJA 2F5BL 3WS6A 1G0XA 3R8BB 1YEIH 3MCG1 1HH6B 4KI5F 4XNQB 4ODTH 2QR0B 3RUGA 5HI5D 1YEHL 3RPKA 1CLOH 4XP9H 2AQ3A 4D8PB 3RY6C 3ZHLA 1EHLL 1FORL 3R4DA 1RIUL 3AGVA 5HVHC 5K93A 3QEQE 2JKXA 5GGTH 1LEGA 3PABA 2DLFL 1CFNB 4KVCH 4RCAA 3S35H 3GFUA 2GY7B 5FYJU 2A6IA 4NO5A 3MR9B 5IJKC 1T0MB 1KCUH 4V2CB 1I7UA 4ZUUA 2ITCA 3NH7L 4OUUB 1BD2B 5TQ2L 3BZFA 1CBVH 3ZE2F 5C7XL 2H32H 2WWKO 4IDLA 1ZLWH 2EXYC 5A1AA 3ZT6A 3WIHA 3IKCA 1HQ4A 2NLJB 3CSYA 4JVPA 4KTYA 3U4EA 3MRBB 1L7IH 1NAMB 2F5AL 3LKRB 5ISZA 3VJ6A 3UDWC 2P44B 3C9NA 5I8KH 1QTYT 4NYLA 4LF3A 3EFFA 1XGQA 1NMCB 3MUGA 1D5ZB 3CMGA 3LKRA 1MELA 4MJ4A 1MRFH 4UNVA 5C86A 4B7LA 2Y6SD 4PY8I 1CICA 4MGXA 5C0RH 4BA8A 5I8CA 1IT9L 3R0NA 1J1OL 4Z7OF 4OIAA 3NIFF 3X12A 3PGDB 4YXKL 3L9RB 2BSSA 3MOAH 2VDRH 3L7FB 1B0RA 1UENA 4O5LH 4IOIA 2CK0L 3M45A 2ESVD 3LN5A 1DUZB 4ODHL 5TE6L 5FA4A 5HYEA 3MJ9H 5DDHA 4FQXD 1I7UB 2PTUA 3VG9C 3PGCB 3HZKA 2IH1B 2GAZA 3MLRL 3Q0HA 1QSVA 3MLTB 3GSOB 5DMKA 4M1GL 3F12A 1V3KA 4GRWH 1FLRL 1UH3A 4JQXA 5SX5H 3B43A 4F37K 1L4IA 1LD9A 2DQTH 4ONHB 1U42A 5DHVB 4YX2L 3P2TA 5HI4C 5D7LA 3H3PH 3QFJA 5FYLL 1U8JB 1XZ0A 3CXDH 1RHHB 3FHQA 1AQKL 1JGUH 4U1GB 2W9DH 4XVJH 3VG9B 1FNAA 1F4WH 2BVQA 4JKPL 4CRPA 2QSTA 1X6LA 3PNWB 3IKKA 3CUPB 2ARJQ 1ED3B 2AK4A 4LPUA 5CJOH 2WUCL 5DRNB 5GSVA 2YWZA 1RZKL 3SBWC 5HHQA 5CJBA 2KUTA 3LV3B 3EYOA 5JIIA 3W82A 4WU7B 3KJ6H 1ZA6A 2CXGA 3EZ8A 2XQYK 2I26N 2D9QB 4R8WL 3RUGF 5DTFB 4EXPX 5J7CC 5JHDB 3DVNA 1M1SA 3FO2A 1M71B 1CFSA 2VDOL 5CINL 4N90D 1I7TB 1LO3H 4PJEF 3B6SA 5B4MC 2QHRH 5JHDA 5BV7C 3DX6B 2NTFB 4ZS7L 4C4KT 4EXKA 3QIUB 1Q72L 4MA8H 3MYZA 5EOQL 3BKCL 1IGIL 3ROLA 4DKFL 5FYJL 4NRYA 2JB5H 4O51A 3DXAD 4N1HB 5A2JH 1OSPH 1G7PB 5IB1A 2D7QA 1MFEL 3G6JE 3VXMA 2QQNH 3KPNB 1WSST 2V9TA 4HPOH 4X99A 4O02H 3CZFA 1UA6H 3EO0A 3GJEB 4ZXBA 1FFOB 4F7TB 5C0NC 2WBJA 1E27A 2EYSA 2Z8SA 2V7NA 4RMTA 2M2DA 2YPVL 4NC1C 4RIRA 2DLFH 1INEH 4ZQKA 2V2TA 4MA3A 2F8XC 1PY9A 1KB5B 3GRWA 2CUIA 5EBLA 3I2CL 4XXCC 5SWZE 1G6RA 3N50A 3O3DA 4ODVH 4BFBD 4DN3H 5GS1A 3P11H 4HJJH 3IAPA 3WS6C 1F4AA 2ESVA 3TT3L 5KTEL 1WBXA 3BN9D 2VXTH 1MNUL 5HHMD 2VXSH 5C08E 5DZNA 4PRHE 1OVZA 4HS8L 1FGVL 5IEKB 4RGNB 1YC7A 5MENA 3OAZH 4XMKL 5C6WH 1WWCA 2JJWA 1A22B 5C07A 3K0WA 1JF1B 2QADD 4F2MB 5HYSB 5I2IA 4YDVB 3P77B 3VFGH 1J8HD 3LEVH 1RI8A 5HHNA 1EK3A 1OSZA 2UWEF 3KYKH 4QF1A 1KN2L 2D7PA 4G7VH 3V8OA 3QUXC 4OCWL 1YYLH 1JMZA 1N5AA 2DM3A 4FMFA 1NCTA 3SE4C 2DJSA 2VLRA 2OL3L 1EJ6A 3NN8A 5KN5B 1FAKT 2XICA 3QI9B 4UV7H 4M1CD 4ELKA 1GOFA 3MROB 3QDAA 5DD0H 1PBYA 5FO9A 2J6EH 4HGWA 2H26B 1T20B 3LEYL 2BRRH 1CDIA 3MO1B 1EGJA 2ED8A 4OD1L 3LH2H 1DQLL 2YRZA 4FQXC 4PBWD 4U3CA 3K8MA 1A4JB 4QGYA 1A2YA 5D1XC 1TPXC 4M5YH 4IOIB 1RIVH 1AGEB 3IFOA 2MHAB 1K4DA 1WEJL 4XMPL 4NO5B 1OAZL 2R23A 3OKKB 5F89A 1CZ8L 3I6KA 1OTTD 1KELL 1W0WB 5MEOB 1VDGA 3UTTB 1J1PL 1RZIA 1RJZB 2O5YL 3PWNA 4XVSL 4PTTA 2APBA 2CKBL 2KL6A 3A6CL 4DW2H 4R26L 4JZOB 2NLJA 5JW4M 3BKCH 4QWWD 2LVEA 4PTTB 2P24A 4JVWA 3QUYD 1BHGA 1G9EA 2V7HA 3BQUD 3AFLA 2FJHB 3MCKA 3V6FA 5DFTA 5FA3A 3WLBB 1EZVX 3C9NB 5GHWL 4GG8A 4X4XA 1KGCD 5MEND 5CEXA 4KWUA 2R0WL 2UY7A 2BY0A 1HSAB 3GMOA 1GIGL 1JGDA 3OJDB 3ILPB 5DK0A 2Y36L 5J11B 2JJUA 3O4LD 4Y5VB 5DJXA 4QRSB 5EWIH 3ZDXE 2RQ8A 3VD4A 4NPYB 1BVZA 1IBGH 1B0RB 4M7LL 3CCHB 1IAMA 1RJLB 4CNIA 3QCTH 5T3XL 2Q7NA 1RZJC 3O45A 1KBGH 4FQQA 4IOSD 5D8JH 4PJEE 3AY4A 1FHGA 2G5RA 4DN4H 4CJ0A 1K8DB 2XYCA 5E4IA 2H2PC 4O02L 1PZ5B 3QEHB 3BD5A 1BGXH 1DEEB 1MCKA 1YEEL 2XN9B 3KLDA 3HCVA 3S34H 3C5SB 4G8FA 4OJFL 1A7NH 2I9LB 1BJ1H 5EO9B 5T33H 1ZLUH 4X9IA 1X5AA 3WL9A 15C8H 1QSFA 1S9XA 3CSPA 4MQ7A 5GGRA 5TGBA 4X6DE 1JL8A 3KPSD 4CAGA 1PEWA 3LMJL 5B22A 1CL7L 2GK2A 4HK0B 5D2NA 2XZQL 4MS8C 1FSKB 1MJ7H 3GK8L 4PJFE 4CDHA 1CFQA 2RCSL 2W0KA 5LCVL 5TJWK 5I8EB 4U1KA 3MRDA 3QO1B 4KDTA 2BNUB 25C8H 2YN3A 5ALBL 4AEIL 2JELL 5LBSL 3QA3A 4I0CC 3MODH 1T1XB 4I0PB 5INCA 4TUKL 3RIFF 1UZ6F 1OAZH 1CU4H 3LEVL 4NUGL 3V4VH 5ICXA 4Y16C 2J8UB 4X6CE 4JG0L 1OGAA 3VWJA 2PO6A 2E7LC 5D93B 2NY0D 1J1PH 2FJGA 3JV6B 3CSGA 5JR1L 2A6DA 4PS4H 2PYEE 1NGPH 1OGAB 1BQLL 3D0LB 3VWJB 3IS0X 5GSRA 3MRCB 4H88L 3CFBA 3DECA 4YDIL 3UJJH 4RMUA 5H8DA 5HYJE 3VFRA 2CD0A 3T0XA 1ZGLP 4ZDHA 3H9HA 5HHVL 4EVNB 5CMAA 2GCYA 3KPOA 1LEIA 4GW4B 4OD1H 1FL3A 5HPMB 3DROB 1DBAH 5K9OB 3KPOB 4RMWA 1M7XA 3D3VD 4M8QB 5I8OL 2CLRA 4G43B 4NQDE 4OZIF 1OW0C 4LLYB 3BPNB 1UKQA 5FHAH 4MJIE 2AJYH 5DYOA 3RZCB 5EU5B 4HHAB 4I8DA 2ZG3A 1RV6X 3GBMH 4HBCH 2XNAB 3VGFA 1DQQB 3CGTA 3NA4A 4IMLA 1DEDA 1F6AB 5C92A 4QY8B 5KOMC 2VISB 4PJHA 1UKTA 5DR5H 2XWBA 1WFTA 1QSED 4GAJH 4DN4L 3BKYL 3BVNB 5DVKA 4DGYL 4HIXL 3V6OC 1KPRA 5E8EB 2Q87A 1CXLA 1AGBB 2RB8A 3TT1H 2VZSA 3NFPB 3F7YB 4DAGL 1JPTH 4IHOA 4YBLC 5C0BE 3VH8B 4M61A 2CPCA 4HK0A 1C5CL 3VFTA 3PP4H 3TZVB 1CDUA 5C8JA 4LSVL 1OGAD 3VWJD 1ZGLA 2Q8BH 1MHPL 4N9GA 1CK0H 2P8LA 1OP5H 3QUML 5IEHB 1JYXA 3QZWG 4DZBA 1TJHH 3K74B 4HSQA 2HFFA 5BMFH 3I9GH 4NHUA 2CK2A 2FX7L 1I1YA 3QNYA 4GS7C 1R5IB 3RL2A 1ZVHA 4JPVL 3ARFD 1IGTA 1LO2H 4HUVB 4O2FA 1H8OA 1FVDA 4ZAKB 1AXSB 1OM3L 1EFXA 3I6KB 5DRWA 3T08A 5IUSA 3P0GB 3MJ8A 1NFIB 4FFVD 1KXVC 3BMWA 3MODL 5DJDA 4I9WD 2HWZL 1CGTA 1A6AB 1OAUL 1V7NL 3FTGB 1NCCL 2H2SC 1LO4H 4JFQA 7FABL 5F7YC 2NY2B 2XZZA 4QXWA 3SE3A 4ORZC 4N1CA 2ARJA 4P3CH 2NZ9D 3VGAC 5I1GH 2R56H 3SQOH 2KKQA 2LVCA 3TESA 2YA1A 1BD2E 1PKQE 2JCCF 4R7DA 3DYMA 4ESKA 3RWCB 3FFDB 3AMLA 2UY6A 3MROA 5F1NB 5HI5C 5GIRA 2AXFA 4MAYC 3BPCA 4X7CC 4XNQA 4MLSA 5ENWA 4NNPL 3TV3L 1LEGB 3PABB 4J3UA 1CFTA 1JE6A 4LASH 5C1MB 3VA2C 3R06A 5ICYA 2K3TA 4P0DA 1GOGA 2PR4L 3SE4A 3QB7C 5DRWB 4Q2ZA 3C5JB 1CF8H 3OKYA 4UDTB 2VLLB 4GMTL 3QUZA 1JMXA 5T1MA 4HUUB 4OCYH 1EUUA 5B8CC 4QHMA 5EDXA 4OQTA 5DD6B 1NGPL 5D71H 5JZ7D 4KK8D 4U7KA 3QULA 5EBMB 1IGIH 4Y5XA 5EC2A 4ELMB 1RUMH 1JV5B 2OS7A 3ARFA 4PGBA 2J6EA 3DMMA 1XEDA 5E7FA 2X10A 3B9AA 3G9VA 4HIHA 1ZWIB 3O2VL 1QSEA 5BV7H 2W1NA 4NT6A 3IDXL 3MRFB 4L4TA 3WFBH 1JPTL 4YHIA 4N5UA 2W0LA 4C83B 1C5CH 4HIIA 1U8OB 2P5WB 3QFJD 5E6IC 3DSNA 5A2FA 2UYLB 2HJKA 3IU3B 4NQSB 3HC0B 2BNRA 1OAKL 4K8RH 1X4XA 4D2NA 4NZJA 1TVDA 3MJ7B 3V0WH 3U0TA 3LEXB 2FEEI 4JHAL 1W0VB 2V7NB 5FM8A 5K59E 3UJIH 4P23B 4X6DF 3EYQC 3GMMA 2BNUA 5E6IB 3A67H 5HPOA 5F3BA 3O9WB 5DJAB 5EU5A 4P23A 3WJJA 4Z6AT 1J11A 1WC7A 4NFCA 4JFFA 3Q1SL 1Q9LA 4X7EC 2BXYA 1KYOK 3CFJB 4NZRH 3LIZH 4I3RH 3VMNA 1XIWA 3MXWL 4DAGH 1GGBH 2OJEB 2FD6H 2IPTH 5EUOB 3ARXA 4QRPE 1FE8L 4JDZA 4XI5D 3NFSH 5KS9E 2RR3A 5D9SA 2CLZA 3GBLA 1ACZA 4P3CL 1DQJA 2MTPA 4FQHB 3BE1H 4OZHF 2WUBL 1P1ZA 3RA7H 3V52L 3PQYE 5D1ZA 1Q8MA 4KHTL 2EYSB 3FQRA 3QQ4B 4GRLD 4C56D 1AXTH 2YD8A 3WSQH 4GRWF 2YEZB 5JOPD 1I1CA 4WU7A 4HKJB 4H25B 4I18B 3L3DA 4NFBA 4PJXA 2VLLA 5EOCJ 1NBZA 4PR5B 5E2UL 4ZPTB 1F4YL 5JXEC 1YC8A 4YBHA 4Y4KC 2VUOA 4KK5C 1FV1B 2CLRB 2GJ6A 4UIMB 3VFWB 4CVZB 1JHTA 3DMMC 1T21B 3CSBA 3VFMA 1CZ8H 3QIUA 2GKIA 3ESVF 4HXAL 3RNKA 5IVXB 1GPOL 2DJUA 3EOTL 3EO9L 3CLEH 4FQJL 1LWRA 3P4LA 1A7QL 4NC0B 1MSPA 3QHTC 1K8IA 4XBEL 5D7LB 4GRWB 5DRZB 5I30L 1U8IB 2Q3ZA 1HQRA 5D9SB 1QD0A 4M1CC 4LVHB 3I6LE 5EU6E 5TDOA 4ACPA 1TVBA 2F8OA 1RUML 2VL5B 1KJ3H 2Q76B 4S11A 5GRJH 1RAMA 4Z95L 4Q0XH 4LVNC 1NGZB 5IOPB 1QBLL 3QCVL 1J9CT 2XTJC 3LS5L 5BW7A 3QZWA 4JJHA 1KLGA 2EE9A 2P47B 3O81A 2NTSP 1G1CA 1MIEH 4ODTL 2AK4B 3TJEL 3L5HA 2ADGA 2ED7A 3VRLE 2R1WB 5T1LB 4KROD 2J3SA 5F7FA 5C0CB 4RGOH 1ADQL 3V5DB 3PL6B 2VR9A 1R5VA 1K4CA 2EIDA 1JTOA 2C3WA 1KPVB 1WZ1L 5H94B 1MFBH 5A3IC 5IFAL 4CL7A 4P2QB 5J06A 1AKJB 1R5IA 4LSPH 4S1QH 3W0WE 3BRFA 2CIIB 2P5WD 1VB9A 3DSFH 3QCTL 1NAMH 1I7RB 5HGAB 1RK1A 2MHAA 4D3CH 4NDMA 5I1DA 1Q0YL 4KQ4L 1W0WA 4X7SH 5ICZB 4NPYA 3TO2B 4TPRH 3Q1SH 2HTLD 5MHSD 3AUVA 1YECH 1O7VA 2NY5C 4Y4HD 4NO0B 2VL5A 4P23D 5TF0A 3PGCA 3U7YH 4ZOEA 4JFFD 2BHZA 1J0JA 4ZOBA 4F9PC 3QH3A 4YR6A 3QUMB 2QQQA 2FD6L 3F7VA 3MRHA 4FQIH 4X5LA 3MLYH 3KYMB 1JV5A 4V1DE 3HNSH 4XP5H 5IT2L 2BOCA 3AU1B 5D7LD 1TLKA 1SY6A 1KGCE 4N0YH 1DVFC 2VTFA 3L95A 4LCUA 4LPYA 1FVCB 4FXGB 3ESUF 4JHAH 3N9GL 3SKNA 4GBXC 3T2PA 5KZCD 1I8LA 2F58H 2QV2A 1JK8A 3EDJA 2C3GA 3QG7H 4HKBA 4JFOB 2NY2C 1F4YH 4CVWA 1DQQA 4EUPH 5E9DE 4FQ1L 2OYPA 5IB4A 3FB5B 4ZYKA 4Z76B 2ZPKH 1UWEH 5JPNA 3L3GA 5E2WL 5EORL 5TQ0H 5C2BH 1CR9L 2VKXA 4PJ9A 2YBRB 3WN5B 2VQ1A 1LNUB 2DAVA 3I6LD 1YMHA 3MR9A 3QH3B 4QO1A 2ZUVA 4AT6A 4LVHC 1WIPA 3G6DH 2FR4A 4KI1A 4XBEH 1OGTA 3RVXC 2V7HB 2W9DL 1G7QB 3OR7A 4Y19E 2PTTA 5I1CH 1FYTD 5DD1H 5CJ8A 1P7QB 3UXFA 4HDIA 4P5MA 3HKFA 5A2IH 1KIPB 1MI5B 2JK5A 3DPBA 3RY4A 5FV2A 5I1IH 3O6FB 2B1AH 1A6TB 2UWEA 4NQCE 3TGXA 1AD0A 4G3YH 5I66B 4X7TA 3JWOC 5E9DA 3S5LA 3KYKL 4I0PC 3RWIB 2B7DT 1GJIA 2VXQH 4OCWH 3SY0A 1KENH 3VXMB 4NWUH 1EAJA 4YGVB 1CXFA 4N0FA 4YBLB 1EFXB 2KZ1B 2BNRB 4MQSB 4I18C 4H25A 4HKJA 3RWHB 3U4AA 3UO1H 2H9GB 3K4ZA 4Y5YC 3W5NA 1FSKC 4HUMB 4L8SA 4UT6L 1CFQB 1L7TH 4BSVB 4WFFE 1JYVA 2CDEB 1FNFA 1T5WA 3OKKA 3L3KA 4R90L 3SDCD 1A7QH 4QRRA 3KPSA 3W9DA 1T04A 5L2KE 3ARGA 5DWUL 3BHBB 4EI5A 4MMZC 4XAWH 4NQDD 5BS0B 1T04B 1Z9LA 3GMRA 4S0TD 1RUQH 1CD8A 5FUCC 1D6VL 3ET9F 5IBUG 1E6JH 4HIXH 3FT2A 4U31A 1YECL 3W39B 1N0XL 3QJFB 3MRCA 1KCSH 2W92A 3V4UH 4AL8H 4XH2A 4OI7A 3K46A 3M8OH 1F90H 4LSUH 4WEBL 4BSWB 1ZANH 5ACZB 4HC1A 5C0GA 1M7IB 3O9WC 1HH6A 5J0BA 5C07B 1MRDL 3UTSB 4Z0XB 1OD7A 2NY0C 5IHUH 2PN5A 3MPCA 4WHCA 3RZWA 4FA8A 3QQ4A 2HA1A 3MRQB 2AABL 1MY7A 3T3MF 4LVNB 4RAVB 4EUPA 1ZVYA 4GUPB 1IGML 2VABB 3DXAE 2YEZA 1TJIH 1OY3B 1BFOA 1IQDA 1S7VB 3Q6GH 5J11C 1JWMA 4F15C 2IJ0C 5F8RC 1BMGA 2Y36H 4RA0C 4MA7H 4L3EB 3BOVA 5EU7C 2ZUUA 4OM1H 1RULL 3EGSB 1C12B 4XBGA 1UVQA 2GY5A 3BJ91 3KWWA 3AY4C 1RUKL 5DGRA 2EKSA 3TYFB 1RZ8B 4I1NB 4GO6B 3ZYJA 4CU7A 4K7PY 1XR9A 1O7SA 1ZLVH 1CBVL 2X4PB 4JRXA 3KPNA 4ZUSB 2GSGB 3C5SA 3G6DL 2P5EE 3MV7E 5FKPA 2JCCB 3D0LA 2VL4A 3LKNB 1J05B 3IB4A 2MCPH 4HH8A 5F8QC 5IVZB 3MRLB 3P4OA 1A47A 1KG0B 1ZS8A 1VA9A 4G42A 3FB8A 5IK3B 5CCKH 1GGYA 3QG7L 1S9WA 1QHPA 5C2UB 5EH1A 3JV5A 5E9DD 4LKCB 5F9JA 1BFVH 4G8IA 4P2CG 4HG4J 2MKWA 4XP4H 2V2XA 3IDYB 4UQ2B 3CFEB 1WEJH 3NPZB 4XMPH 2Y5EA 1IGYA 2R9HD 5M7QA 1B6DA 4G8GB 3GRWH 4OF8A 4GBXA 4LDLB 4ODHH 1FO0L 2IANE 4CBPA 3PXJA 1DE4B 2J5LB 4I4WB 2CR3A 3B9KA 4MCYB 4N1EA 5HYJB 1YJDC 4MJ5A 1HILB 4PJ5A 3RQ3A 4X7DC 2RHEA 3TP4A 1XGUB 5E94B 4ZFFA 4NSKA 1JGLL 1T2QH 1UZ8A 4P23C 5FGCE 1T0MA 4PP2A 3QUXB 1KPRB 1RZFH 4UDTA 2IANB 4AEIH 5DXWA 5ITFA 2YN5A 5DVMA 4G8GE 1F11B 1KTDB 3LN9A 4PRIB 3FQTA 5J1AA 4KTEL 5BOZG 1H3WM 2CGRL 1I3VA 3B83A 4P9ML 1FZMB 1MVFA 4JG0H 5F21B 4Y5VC 1S7UB 4XRCB 5AUMA 5FYLH 3TVMB 1F11A 3P77A 4LSRL 2X1QA 1DUYA 1MFNA 2YMXH 5K9JH 2IPKB 4FQLH 4WO4A 3UROR 3THMH 3ULVE 2ICCA 2RIKA 3GMLA 4LHUA 4M6AA 4WY7H 4Z5RB 2ADFH 4NWTH 3WHE1 3ZSTA 1I9IH 2FBJL 3VRIB 4KH2A 3PWPD 4NHUB 4WI4A 4M7JH 5LGHH 1ZA3A 2C1OA 4K3DL 1Q94B 3UJTL 2EDRA 2GW5A 2P49B 1UXSA 2DLHA 5F7KC 5ITBL 3MO1A 2P1YA 1YEJL 4I77H 3IDNB 4JFXB 3HE7B 4X5WB 4OLUL 2HMID 2XN9E 3MJ8B 1YQVL 2NCMA 3CNKA 1I3GH 4QXTB 2VAAA 4QOKA 3QP3A 5IESH 1L9MA 2P45B 3DWTA 4LSSH 3CZFB 4R9HA 4EN3A 1S7UA 3QR2A 4JB9L 2Z35A 5GJTL 5GS3A 3QIBA 4OD3L 2BNRD 1FNLA 5F97E 4JFYB 1R5VB 2AABH 4GAJL 4QKXB 4U1SB 3DV6B 2G75A 4IJ3B 5HHOD 4HPOL 1AP2A 2C7UB 4D0BA 4E41D 1JYWA 3MLPA 5C0GB 2C1PB 4JZJA 4HJ0D 4TNWK