5J89A

Structure of human programmed cell death 1 ligand 1 (pd-l1) with low molecular mass inhibitor
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Programmed cell death 1 ligand 1
publication title Structural basis for small molecule targeting of the programmed death ligand 1 (PD-L1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 28
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j89A00
3S35H 1FZKA 3ZE0E 4JO4L 4Z7OE 3MUZ1 2VDOL 2YBRA 1XCQA 3MJ9L 1I85C 4LMQE 1J11A 3QHZL 3UDWA 4KJYA 1N6QL 1CG9B 4M9PA 1IAIM 4XNYL 4AIOA 3SEPA 1FGVL 4HFWA 1FNHA 4NIKB 4FABL 5IFJA 2YKLH 3NZHH 1NFKA 3MRDB 1Q9OB 2JKXA 3HZKA 4F80A 4M1CC 4JFZL 3HLAA 4ZS7L 1T1WA 2BSED 3MRPA 4KGLA 4I2XE 3QCTL 5DJ0A 5L2JA 3DXAB 3VJ6B 2ORBH 1IRAY 1I8LA 5KANG 1ZVSA 4WW2B 4KI5F 1KCKA 3T0WA 3GSQB 1OW0C 2GJ6A 1P1ZB 5DVOA 1MFAL 2EICA 4OCMC 5GGTH 5HHVL 3BGAA 2JJTA 1S7UA 4F37K 3HNSH 4LCIH 1UM4H 4RFOL 3AROA 3EO0B 4LP5A 2P48B 4P46D 5E2WH 4N5UA 5C09D 2JIXA 4MAYD 3H9SE 1SM3L 5CD5C 3B9KB 3VD4A 1G0XA 2VN7A 3EJZD 5J6HA 3LQZB 3UO1L 1MH5A 2AS5M 4DVBB 4NN6C 3BKJL 4NZUL 4GAYB 4WCYH 3BESR 2BVQB 3GI9H 2DWEA 5ISZE 4LFHG 3TF7C 3S6CA 4N90E 5FCUL 1H3PL 2DQEL 4YDLC 3G08B 4L5FH 1BVZA 2EE9A 1O5DT 4G43B 1VKXB 3G5YA 4Q6IB 5DQJB 3U4EB 2DQGL 1YQVH 3QWRD 1DQMH 4UILH 3DX9B 5KVGH 1W0WB 5I17A 1TVHA 1F4XH 4P4RB 3MJ7A 2ENSA 5IV2A 2FO4A 5C0AD 4FP8H 4M7LL 2VUOA 4W6XB 3VH8B 3WFZA 2I07B 5L88H 1BQHG 3VFNA 3O2DA 4OGZA 3P40A 4YX2L 4U1HB 4PJ9A 3ZHKA 1A9EB 5HGHA 3DVGA 4EUPA 3F7VB 3LCYA 3UYRL 3EDEA 3ELAT 1LEKA 1GH7A 1KXTB 4R96B 3GO1L 4E41A 3MLTA 4ZS6D 2A74B 3GSWA 5MENB 1MIMH 3MRGB 3RDTC 3GUTA 3SDDC 3FN3A 4XPFL 4JM4L 3EKCA 3FB5A 2X4RB 4RQQB 4TVSa 2VXQL 2R1XB 4P57A 4DZBA 3V5DA 3Q5TA 1MCHA 1S3KL 5BV7C 3CUPB 3OAUL 4S1RL 3BP7B 3BIAX 4KHTH 2FIRT 2CLRB 1AFVL 1RPQA 3PJSB 5D1ZC 2R2BA 4P2OC 4FFZH 2EXWD 4NFCA 4HKXA 1AQDB 1EA9C 3T3MF 5F89A 4OGAC 5DMIL 1TTGA 2R0LH 3B2VL 3DI2B 5DJZB 2EYSB 1RFDH 1I9JH 1NC2B 4M02A 1XGPA 4D9QD 3W2DH 1KIPB 4JFEB 3TO4D 3UTZA 1DBBH 3UTQB 2GT9A 4JLRB 5FYJU 4G8FB 5CIPB 5GGUA 3S36H 2JCCF 2KH2B 2ZOLA 2FL5B 3FRUB 4JZNA 1PG7H 4L9DA 2CSPA 4IRJB 1D5IH 2E6JA 3E1F1 3GSNA 3IU4L 4E9LA 1F90H 3SN6N 5FECA 3QXAA 2JB6A 5IT2L 1JTOA 4KKAC 4YHLH 1A5FL 3HRPA 1RHHB 5IF0A 5EO9B 4P23A 3GSXB 1SVZA 2F53D 1KSRA 1F5WA 4MJIA 4L3EE 1AGEA 2BFVH 4YH6A 4WY7L 2AXGB 1KIRB 3MOAL 2CR6A 5CHNB 4P5KB 1AKJA 1BD2E 3BIBX 2YA2A 1B0GA 3O3UN 4GRMA 3VFUA 4XXDA 3MRHA 4Y5VB 5D72H 4NQDE 5I1EL 2VDRL 5SWQA 5GJSH 3FOMA 5SV4A 3X13A 3LEVL 1R0AH 1G84A 5I0ZA 2YD4A 1XF1A 2WWKO 2EH8L 3U2SA 12E8H 3C6LD 2Y5TA 4LRNL 4PGZA 3RVWD 2GCYB 1XF4A 3PHOB 4XI5D 4XAWL 3PWNA 4AL8L 4JGMA 4RMRA 3QCVH 1DEEA 2W38A 3BI9X 4MA8L 1IM9A 3VGGA 1E4JA 1K4CA 4JM2D 3JV5A 3PP3K 1B2WL 2PO6D 1AIFB 2NMSA 3NAAH 5EZOH 5M95B 1X5LA 4LAJH 4GG6E 4XCNB 5KSVA 1MFBL 5CEYA 4JDZB 1QFWI 1YYMH 4X0KA 4FTVE 4YBLC 1QKZH 3T04D 1EBPA 5JA9A 3PWUA 1F6AA 2X42A 4EBQL 5IVZA 5ICXA 1FBIH 1RURH 4JJHA 4QYOB 4XP4H 3MV11 2PN5A 3BZFA 4QTIH 4UUJA 1LDPH 1G1YA 2ICWI 1QNZL 2VNCA 1SBSH 3O3EA 3MUY1 1J87A 4E42A 5HDQH 3MXWL 4UMGA 2NY0D 4KK9D 5FGRA 1YEKH 2IG2L 2NXZB 3AREC 3KWWA 3U0TB 4NC2B 5DSCB 5C09B 2CLVB 2DLEA 1SJEB 3H3PL 2XA8L 2R0KH 1P6AB 2Z0BA 5FHBL 1J1PH 3U36B 3ZYZA 2GJJA 5DFVD 3BW9A 2DD8H 1CN4A 3CFDA 3ARBD 3WFDL 1PY9A 2BDNL 5E9DD 1T03H 1FRGL 5BCAA 5IW1B 4M1DH 3FO2A 1VSCA 3OJDA 1QYGL 4MVBD 3BH9A 2QLVB 3RWHB 5F3BA 4M7ZB 4GMTL 2AEQH 3CNKA 4AEEA 1VFMA 3EJYD 3M1BB 4Z7QE 1DQDL 3TA3D 2R1WB 5DVNA 4NN7C 2A83A 4PRNA 3CFBB 5IJVA 1KGCD 3FB6A 4JFQB 4WFHD 3BKYL 3ILQC 3RNKA 5MERA 3HR5B 1CE6A 5C0AB 1ZWIA 5K59E 1D9KC 3FTGA 4NT6A 3SGKC 4YC2C 1CLYL 3O2VH 2EDOA 4PRHA 4WI6A 3TEUA 4WFGD 5BV7L 5LQBL 1DQLL 2OL3L 4Y2DA 1EXUA 4NCC2 5E6IC 5D6CA 2HT3D 3I2CH 1I7RB 3MV8D 1AGDB 4PUBH 4K23H 4JJ5B 4NKDB 5LKNA 1E4WH 3QXVA 4OJFL 3QI9C 2R8SH 1AQKL 5BS0E 5DHVA 5EOCL 5IM7A 3UYPA 2HJFA 4KDWA 5JIPA 1PZ5A 3RIAF 4JRXD 4JFDE 5SX4H 2YD9A 3UTTA 2CJUH 1XGQB 4IMLA 3PQYD 5C2BL 2V7NB 5D93C 3IS0X 1OGTB 4XPAH 4X6CA 1G7IB 1H3XA 2PKDA 3ARFC 4U1LB 4LDLB 1S5IL 3RX8A 5E4EC 2VH5L 4DFHA 4U1IB 2E7LA 4FQHA 4HKBB 2ZPKL 3MRRB 5K9OA 3LEXB 3MYJA 5EU7E 1PGRB 5IIEA 2P8PB 3QFJD 4ONFH 1WSST 3VA6A 1K8DA 2P42B 3DECA 3QEQE 2AEPL 2VISA 3IDJB 1WIUA 3B43A 5F1IA 2EZ0C 2F15A 3AS0A 3WD5H 4OLXH 1I3UA 4G42A 1FGNL 5E2UH 1MI5E 1TLKA 4PJIE 3NCJL 2QL1A 4XX1G 2KUTA 1CDBA 1E27B 4RMUA 3DX7A 1I7UB 3VRJB 3UJIL 5GSVB 4IOFD 1IAIH 4RX4D 3X17A 3I3EA 3PUCA 4BFIA 5FDWA 2VLRA 2RAMA 4K3GA 1PKOA 4X9IA 1JHTA 4MX7B 1NCWH 2OI9C 2F53B 4OLUH 2HRLA 2V5SA 3RWGA 5EULV 1MREH 1TCRA 1JPTL 4Y19E 4PJXA 2EDLA 1F3DH 4HK0B 1TQCC 4XP5L 4X6DA 2VLKD 4MNGE 3JWDH 3Q3GB 4F7CB 1ZHLA 4X4ZA 3MREB 3DIFB 4PLJC 4K8RC 5TPWL 4AENB 3TFKC 3SDYL 1TJGH 1U8HA 4IRSC 2WLZA 2RFXB 5F3HB 3BEWA 3C6LB 5CZXC 1XGUB 5D71L 1JF6A 1RUPH 5DJ8B 4MLSA 1UEYA 3V8OA 2FECL 2O26U 4PB9L 3WS3B 5A16B 3ZL4H 3NH7H 4JM2B 5F8QC 4ORZC 5ALBH 1Q72L 2PO6B 5FKPA 1U8NB 4U33A 5I2IB 3BP4B 4JO4H 2VDOH 5JXAL 4WWKA 3MJ9H 3OKEA 4OZGE 3NABL 2JJSC 5CGTA 3QHZH 1QA9B 1N6QH 4MXVE 3U82B 1H8SA 4XNYH 1NJ9B 3VFTA 4PY8I 1FGVH 4MCYB 4P2RA 1HXMB 4TUOB 4Q97A 5I76A 4FABH 3VI4E 2LTQB 1G7QA 4Y8AA 2HYMA 5AZ2H 4JFZH 2XQYK 4ZS7H 1U95A 1KUMA 2LAGB 3QCTH 4O2EB 2CIIA 2VKWA 2W91A 4K7PX 1A1NA 3BO8B 3C8KA 4XBPA 3FT2B 1FPTL 3DLQR 5CP3H 4I4WB 2D03L 3MUHL 3MO1A 3MLZL 2WBJB 1CLZL 1MFAH 3B2UD 3X11A 5HHVH 2HTKD 3SDCD 3WLBB 1AH1A 3VXSA 3RZWA 5EN2A 2NYYD 4RFOH 3ESUF 3VD3A 5J89A 3ARBB 1UB6B 5E9DB 2IH3A 4JPIB 5D5ME 4PPTA 5I74C 1MFEL 3LRSB 4HDIB 4KKNA 1G6RL 4X6BA 3HNVL 5C0JA 1SM3H 5C08D 3LN4B 4QRPE 5J1TC 1ORQA 3OWEA 5E8NA 3DROA 5AZEL 4MS8D 4OKDA 3BKJH 3BPLC 4DGVL 1KG0A 4NZUH 3O4OC 2UZYB 1U8LB 3QUYC 3QEHB 4J8RB 2H8PA 4PJCE 5FO8A 5MHSD 5FCUH 2DQEH 3BIKA 1JP5A 3V79C 4JRYE 5MEQA 3IDMA 3MLXL 2DQGH 2MJWA 4X5WA 3SKMA 5HVWA 3MNZB 3BUYA 2C5DC 2PETA 1X7QA 8FABA 3VXUA 2D7MA 2ICEB 1DL7H 4FXKA 4QRSA 3JXAA 1DP0A 1UZ6F 5JTWA 3IF1A 1YNLL 5D7LD 4K2UL 4ZUWB 2H2PC 2OR8A 2OSLA 2QADC 4KK8C 4OF7A 3O8XA 2C3WA 4M7LH 2PW1A 4NBZB 4F57L 4YX2H 3EHBD 5DD6A 5HI5D 4JRXB 1A6ZB 4NGHL 3UYRH 3S35X 4YDJB 2RIKA 4GAFB 1ZEAL 1VADB 3AAZA 3GO1H 4ODBD 5INDB 3PQYB 3SGJA 4O2FA 3P4NA 4LEXL 3QZWA 2IMMA 4YGVB 1C5DA 4MA3A 4XPFH 4JM4H 3T3PF 5D2LE 1NDGB 3TBSA 4KPHL 3B5GA 4G6ML 3QDGA 2X4TA 5ADPL 3OAUH 4S1RH 3L7EB 3HMXA 3SBWC 1AFVH 2OR9L 2YPKA 3CC5B 5F88A 5ALCL 5EU3A 2ERJB 1FP5A 2V2WA 3DTXA 4EJ1C 5D1XC 5DMIH 3MMEA 2VITA 4YO0A 3B2VH 1NGYA 4OD3L 4C56A 1JMXA 5E4IA 1X5FA 2XYCA 4PRDA 4X80L 3H3BC 3W0WD 5IESL 2BNRA 1FFOA 1IQDA 2A6IB 3BP6A 2C4XA 3CFKA 3RKDC 3V52L 2ZUQB 4GW5A 1NGZB 1CD9B 4NN5B 4K8RL 1VACB 2WQRA 1A3QA 1IKNC 1P53A 1EGJL 3QUZA 4PJBE 1TQBC 4GLRI 4YFEA 4GMSL 2NCMA 5JDSB 2P47B 2P5WD 1Q94A 3IU4H 5I8KL 2YK1L 3KPRE 3EYVA 5A3ID 5IT2H 4KK5C 1NBQA 1A5FH 2XY1A 1S7VA 4L9LA 5DGRA 1SEBA 3CVHA 4WFFD 1KEGL 1GOFA 4MJ6B 2FD6L 1UVQB 2VABB 1JYVA 4WY7H 4O5LL 3MOAH 4KMTL 4JFFA 5C07B 5KSAA 2ZG2A 3GRWL 1RK1B 4K7PY 5F44A 1R5VA 3QPXL 5F96L 2FIKA 2VDRH 1J86A 3LEVH 3SO3B 4NYLA 1I7ZA 4OZHF 2PTTA 3DV6B 2VMFA 2EH8H 3DX8B 4L4TA 4M9OA 1D6VL 3RY4A 5DJDB 4LQFL 4JFHD 1FFQA 1Y0LB 2ICWB 5DEFA 4LRNH 4S1SL 2YRPA 4LBEB 2YUXA 3D3VD 1FIEA 4YR6A 4XAWH 1QO3A 1L9NA 1JGDA 4J23A 4OZ4B 3NMEA 1XIWA 1B2WH 4M5ZL 2A1WL 3NCFB 1U3HC 3CCHB 3QG6A 3NPZB 4DEPC 4HV8A 4TOYL 2H2SC 1MFBH 2H9GA 3KPLA 3BD5A 5T1MA 3AY4A 1ZT1B 5E94A 2CDFA 3QZWG 4L8BA 4RA3A 5LGJB 3VXOA 5SWZA 3KPQB 4WUUB 1DANT 3ARGC 4I5BB 4CMHB 4EBQH 1LE5B 1NGWB 2GJ6E 1ND0A 3T77A 4Q7DA 1K5NA 2FJFB 4YIQA 1ZHNB 3RNQA 3WS6A 1QNZH 3PWLB 3ULVF 5D7JC 4AH2A 3MXWH 4P0DA 1F58L 2IC2A 2IG2H 4OZIA 1ZT4B 3KS0H 5TQ0L 1S7SA 2AJXL 1BJ1J 5GS1B 3H3PH 2XA8H 5C08B 1U8PB 4JDTL 5FHBH 3K46A 4XHJC 2QQNL 4CRPA 3CFEB 3S36X 3LKRB 4GW1A 3WFDH 2BDNH 3GI8L 1FRGH 3BZEB 1R3HB 2Y9RT 4ZUTB 4IDJL 1QYGH 5D2NB 4JQVC 4Q9RL 4GMTH 3CH1B 4Q74A 3JTTB 2O5XH 4OFKA 3ARXA 4HUMB 4HULB 1V05A 2C3GA 2AV1B 1QBLL 15C8L 2HFFB 2D31A 3ZTJH 5J11C 1BJMA 3BKYH 1S7TA 3K1DA 4OBRA 3L95B 3BZDA 2ATPB 5AEAA 1CXFA 5DK0A 1N0LA 1YEDB 2FZ3B 5DS8A 5IHZA 1CLYH 4HKJB 4NO5A 4BQ6A 1OP9A 5DMKB 3GKWL 5BV7H 4HH9B 5GXBB 5E5RB 5LQBH 1DQLH 2OL3H 4PREA 4YHKL 1TNMA 3O81A 5JW4N 3FONB 3HG1D 1DUYA 4HWEL 5FUCE 4UDUA 1A47A 4HJJL 1QZ1A 2X4PA 4OJFH 4E41E 2X1PA 2ZP0T 2F54D 1ZTXL 3UDWC 1MPAL 3OBAA 1AQKH 1EUTA 4HS8L 3ZKMD 1BPVA 1OVZA 3PWVB 1X5KA 3OR6B 3BHBA 4IEFB 3E8UH 3P77A 4R3SA 5EOCH 3RPKA 2KQMA 4L8SA 1MVUB 2E3VA 1CQKA 1KPRA 3IETA 2Q76B 1K2DB 4Y89A 3QQ3A 2QSCL 2XWTA 5C2BH 2A2QT 2Z92B 4QTHB 5CEZE 4NQCD 5D96B 5HGAB 43CAA 3ARVA 5A2IH 4OD2A 4HUWA 4NM8L 1HINL 1Q9LA 5FV1L 1E6JL 2VH5H 1I8LC 1JL8A 3KHQA 5INCB 2R9HD 3KLHC 5L2KD 4WI8A 2ZUVA 1EX0A 3QNZB 2ZPKH 1VFAA 2E6PA 3RL2A 1NFDF 4HHAB 2EE6A 2EKJA 3KG5A 2AEPH 2A38A 4J3UA 1S9WB 1YNKL 2JJTC 4TULL 3IFLL 3TYGL 1UXWB 2BNQD 4F7PA 1QFPA 5HSFA 5F6IB 3PNWA 3MQIA 5IB4B 1EEYA 4N8VA 1WTGT 4OF0A 4LCYA 4OCYL 4PRAB 5EU5B 1KLFA 3NCJH 2VL5A 2OJZL 1FYTD 5LGHL 2X4QA 1T1YA 3L3OA 3FOLB 2C1OA 2P5WB 3UJIH 1KB9J 1T0PB 3SY0B 2UYLA 1OLZA 1QQDA 3DARA 3TO2B 1WCBA 3NFSL 1RU9L 3PP4L 1CGSL 1NMCC 4ZXBA 3UROR 5JORB 2OZ4A 3UCRA 4QF1B 3T0BA 4DUVA 4I0PC 4BK4A 5DC4B 1JPTH 1GL4B 3L5IA 5F9WB 3QNXA 4HCRA 5H37G 4DKEL 2P46B 3G04B 4EI6A 4XP5H 5IMLA 4OQTA 2QJDA 3L3JB 1BZ7B 1VESA 1XF5A 3DRTB 5IMMB 1G0YR 4PBVC 3ZTNL 1RUKL 2DTML 5I9QB 5TPWH 5B8CB 4FMKA 4JZOA 3SDYH 2C3VA 1UCTA 1XZ0B 2XQBL 5ACZA 1A4JA 4AQ1B 3U30C 3QIWD 1UG9A 2XZAL 3O11B 3O45B 3D18A 5D71H 4EZMA 1CL7L 3MBEA 4ZSOA 4PB9H 1IAOA 4HGWA 4PJDB 2AJ3A 2NY5C 2R2HA 5FUCC 3L5WB 1U8QB 1GOHA 4GW4B 1Q72H 4KROC 1S78D 4L8DA 1R3JA 3VE0A 1A1MB 1X9QA 5JXAH 4LSRL 3H9SD 4IMKA 4Y4KD 3C5JB 3P73B 4GBXD 3TH3T 4FFVC 1CG9A 3Q2CA 2E9WA 3WFBL 4PJAB 2QQQA 4LCWD 1A6VL 5C0DB 4RFNB 1H3GA 1Q9OA 3MRDA 5HHME 1NKOA 3QPQC 4FNLL 1CDCA 1HHGB 3MLPA 3SE9L 2RBLA 1FPTH 5CGYD 5DI8B 3VJ6A 2D03H 3MA7B 5I71C 3U46B 3QJHB 1ED3B 1T22B 4WW2A 3MLZH 3Q5OA 3FB7B 1CLZH 3GSQA 4XX1E 3M45A 4PJGF 4PP2B 3U4BH 3S3JA 5DJXB 2J8UE 5F8RC 5FM4A 3B83A 4YUEL 4RRPA 4NZRL 3EO0A 1OTTD 1MFEH 2HP4A 3EYOB 5JMRA 1G6RH 3OKNB 3HNVH 5HHPA 1KELL 1Z9OA 3IRPX 3R8BB 1JUFB 3D39B 3CAFA 4C4KO 3D85D 3KPNB 1TFHA 3B9KA 5AZEH 5HDBF 3LQZA 5DMGC 4P23C 3HZMA 1HSBB 1CF8L 4DGVH 4DVBA 1MJ7L 2C3XA 4ZPVB 1YPZF 2VQUA 4GAYA 4D0DB 3G6DL 5I8CB 5LWYL 1NANI 5DVMA 2BVQA 4KU1A 1PFCA 1WC7B 4JFOB 4KVNL 5JIKA 2AK1L 3G08A 3H9YA 3D0VA 5TH2B 4IJ3B 3AB0C 3MLXH 4ZTPL 4G43A 1VKXA 2QV2A 4X7FC 4PRHE 4Q6IA 1BBDH 5DQJA 3U4EA 1H15B 1J1OL 4ELKB 3N1FC 1KCLA 3VGHA 2OQJB 5E8DL 1W0WA 3DBXB 3ZKND 1YNLH 3DRQB 4K2UH 4P4RA 2HTLC 4M00A 2DQUL 2F54B 4J3VA 3VH8A 2I07A 5CMAB 4H0IA 5DLML 4U1HA 1UKSA 4NGHH 5IEKB 1A9EA 3UTTE 3BGMB 1ZEAH 3F7VA 3SQBA 1IEAB 4R96A 4NQCB 1JIBA 1MHPL 4LEXH 2A74A 2X70B 4WEBL 4X6CE 5DUPL 4UINL 5DD1L 3S3PA 5MENA 3MRGA 1MCBA 5L2KB 5AD0A 3MJGX 4KPHH 4G6MH 4LPVA 1IGJB 1UKQA 2X4RA 4RQQA 3ETBF 5ADPH 1ZXQA 2R1XA 4L3ED 4MHHG 3CUPA 1TTFA 2OR9H 2AQ1A 3BP7A 1FC2D 2EKSB 2CLRA 5C0FB 2UY7A 3PJSA 4WTXA 5ALCH 2VC2L 2BNQB 4YFDB 1AQDA 3PDGA 1KOAA 4OD3H 1LEIB 5GZOD 5DJZA 1AXTL 1FYTB 3V52H 5HYJA 2EYSA 3P2TA 3SQOL 2HVKB 4U1SB 5B39G 1NC2A 2Y23A 3NACL 4F15C 5I18L 5BJTB 1KIPA 4JFEA 2ICCA 3UTQA 2VLRE 3NGBB 2N4IA 4G8FA 5CIPA 1S7WB 4XTRC 4RRPG 3D48R 2FL5A 3FRUA 4GMSH 5D7KD 1ZKAA 4IRJA 5JPMB 4TNWF 3O2DL 5I8KH 2YK1H 3BQUC 1DCLA 4NJ9L 1DVFC 4GKSB 1R3KB 4PJXE 5GGRY 1KEGH 1HNFA 5TFSH 2FD6H 4LSPL 4DQOH 4X6DE 1IGYB 3HB3C 1EHXA 1RHHA 3PV6B 3C5ZD 5F21B 1D7FA 5IROC 2JCCB 5EO9A 3GSXA 1KJVB 4O5LH 4KMTH 4NWTL 1F02I 2AXGA 1KIRA 1QFUL 5DJYB 1L0XA 1QHPA 1HOCB 2GYSA 2VXTL 1SJHB 3QPXH 5F96H 2UVFA 3GM0A 4Y2DC 5CEZL 3MLYL 2XKSA 4Y5VA 4Z7UE 2W0PA 1T2QL 4D8PB 3B8YA 1NCAL 1D6VH 3ZKXC 3O0RL 4LQFH 1ZGLB 5DHXB 4XPTL 3KLSA 1RZKH 3H9SB 3JSSA 1UB5B 4MNQD 4Y4KB 3PHOA 3CZFB 3VH8G 4GBXB 1P84J 4FG6C 1ZHBB 4XNUL 2HLAB 2IAMD 4M5ZH 2A1WH 3OL2A 5FGCB 4OFVA 2WV3A 3WJLC 4OF3A 5BZDB 1NLDL 1YMHB 1AIFA 4K9EL 3EFDL 4LCWB 1ZMYA 4YXKL 4TOYH 4OF5A 1MJUL 4XCNA 5L8LB 1OAZL 5D8JL 4JDZA 1SMAA 4BSWB 1K8IB 1RZIB 4LKXB 3GSNL 4OUUB 2EDFA 4YBQC 1EPFA 1OWWA 4LLAA 1F3RB 3IXTB 5BMFL 2C9AA 2OR7A 4JN2B 4BUGA 3HPJB 4FS0A 5HI3D 1UENA 3UJJL 5IEHB 5M7QA 1T21B 5FXCH 4QYOA 3VXSE 4U7KA 4UI2A 1J7VR 3K2MC 1F58H 1FL6B 1PBYA 2XRAL 1KXVC 4U0RB 3OKMB 5TQ0H 4CBPA 4QHNB 4M7KL 2AJXH 4ZFGL 1CVSC 3U0TA 4P46A 1WICA 2X40A 5DSCA 5C09A 1JVKA 3LB6C 4JDTH 2CLVA 1NAKL 3KGRA 3ZE0F 4MAYA 3BP5B 1SJEA 3D85B 2EIZB 4AJ0A 1II4E 3KLAB 4DUXA 3U36A 1OTUC 4MB3A 4HWZB 3GI8H 4XVSL 4MZ3A 1KFAL 1QSVA 2NLJB 1CT8B 2X1WL 4G5ZL 3MPCA 1UA6L 2ARJB 2H32H 5IW1A 4FQXD 5T3ZH 3DUUB 3R8QA 4Y5YA 3GFUA 3RWHA 1VFOA 3EYSL 4WV1B 2V5YA 3QO0B 4X7CC 2BOBB 2G5RA 4Y4FD 1QBLH 15C8H 3M1BA 5IHUL 1HEZB 4B0MM 4WTWA 2R1WA 4NKMB 1IE5A 4UOW0 4MQSB 4OZFH 3WKML 2YHGA 3CFBA 3QWRA 3VXUE 2D7PA 3O3DB 3INUH 4JFQA 3DJ9A 3W11C 3HR5A 4RFEB 5EFIB 4PG2A 5C0AA 3GKWH 2VO5A 1TENA 3LMJL 2D0FA 3IRZA 3WIFB 4YHKH 1MI5D 4WWKC 4HWEH 1I7RA 2HVJB 3V7MA 1LO4L 1MAKA 4WU5B 4HJJH 1AGDA 4KUCD 4JJ5A 1MCRA 4NKDA 1ZTXH 1AD9B 1MPAH 3P9LB 4HS8H 3WCYA 4RGMB 3N50A 1CDUA 4KUZH 3FN0L 4NZDA 4PJ8C 3RPIB 4M5YL 1FLTX 1N2RB 4GQ9L 4M93C 4HD9A 3UTSB 3IDUA 2QSCH 4AEFA 1HDMB 4FRWA 1U8MB 3DETC 1XGQA 2EC8A 2NX5E 2DLGA 2VWEE 5EBLB 1OGTA 4NM8H 1CE1L 4N8CL 1E6JH 1G7IA 4U1LA 2MQ3A 2OLDA 1HHHB 4U1IA 2XPGB 1MFDL 4QLRA 4LLVB 4HKBA 1C5CL 4WHTB 4C56E 3LEXA 1DLFL 2YA1A 4JEGB 3QDMD 2P8PA 3CX5J 4FQLL 4QHLB 4KJPC 1CZ8L 2BNRE 4U1KB 1YNKH 4TULH 3IFLH 1J8KA 3IDJA 3WSQL 4ETYA 5HVHB 3RZCC 2D0GA 5A2LH 2ZSVB 4OFPA 3TO4A 3BOVA 2ZUYA 2PTVA 1EZVY 1HQRB 1FN4B 4OCYH 4N0YL 5T3ZD 4PY7B 3WNOA 2OJZH 5LGHH 5GS0L 2AXHA 4HC1H 2AJZB 1E27A 5C0EB 1I7UA 3VRJA 5GSVA 1M05A 3NFSH 1RU9H 3PP4H 1CGSH 4IHOB 2H26B 3DX6B 1IFHL 4RDQG 3HHRB 1WT5C 3C5ZB 3FQNB 5GSRA 4MX7A 4OKVA 2F53A 1S8DB 5DYOB 4NHUB 3VWKD 2EEAA 4DKEH 4JFFE 1X5ZA 1E4XI 2IBZY 3IJYB 4HK0A 3ULUH 1RUQL 4Z7VF 1DN0B 3ZTNH 3Q3GA 3L5HA 4F7CA 4NRXB 1RUKH 4YHPB 4JVUA 3U9PL 3MREA 3DIFA 4ORGB 3I3DA 3BDYL 1UACL 4L4TE 4OLVL 4AENA 3QULB 2GK2A 4Y4HD 2XZAH 3VGEA 2RFXA 5F3HA 3QEUA 1CL7H 3C6LA 5GRVL 1XGUA 4H25B 4MNQB 4XRCB 5DJ8A 3QXTA 4LKCB 3OB8A 5A16A 2IAMB 4JM2A 3SGJC 4JAMB 1JPFB 2DQTL 2PO6A 4LSRH 1U8NA 3AMLA 3VI3E 5I2IA 3BP4A 3PGFL 4QRPD 4GRWE 1PG7W 1QA9A 1BM3L 2M1KA 5SWZE 2UVEA 3WFBH 1NJ9A 3RVXC 3WUZA 4PGBB 1U6AL 4MCYA 1OP3H 2VWEC 5JIIA 1A6VH 3N1PC 2MHAA 1HXMA 4TUOA 4GS7B 2CKBH 4P5TD 1QSED 3HC3L 2KZWA 4FNLH 1YDPB 3SE9H 1QBAA 1YN6B 4O2EA 4ODTL 2UZXB 3BO8A 3FT2A 4PGEB 4HSQA 3RWDB 2D9QB 1IC1A 3LEYL 1ZA3B 4XNMB 1HKLL 2WBJA 1QSFD 3RVVD 4NQUA 1CLOL 4PLNC 5DGQA 1F45A 5C0IB 1H3UA 2BVPB 3QA3B 2NY4D 4UBDD 3WLBA 3QUZC 3G5XB 1GZQB 4F9PA 2NXYC 4YUEH 4NZRH 3RU8L 3ARBA 1UB6A 4NM4L 3BKML 4WI7A 5E9DA 4JPIA 5JXED 1KELH 4HDIA 3LRSA 4FQXB 3ULUD 2FH8A 3S5LA 4WFED 3VXRD 2R15A 2AJYL 4NC1E 3ULVD 1CF8H 4C55A 1OAKL 1MJ7H 4Y4FB 5F1OB 4M6AA 1FNFA 2DQDL 3TA3A 1QRND 3G6DH 5LWYH 4JDVB 1U8LA 2Y1VA 3QEHA 5KSAC 2APXA 5I1IH 2EDHA 3B5TA 2Y6SD 4JRWA 2NY3C 4KVNH 4Z18A 3CU1A 1JYNA 2NTFA 1X5HA 2RGSA 3BPOC 3VDCA 4ZTPH 3CPLB 3DV4B 1V7ML 3P11L 1J1OH 1MJ8L 3MNZA 2OJEB 3B6SB 5E8DH 3WE6B 2DQUH 4ZUWA 3VWJC 4DOHE 3E3QE 4LLYB 1XIWC 4HIIB 2FX7L 4GUPB 1YJDL 4PP1D 3IVKB 5DLMH 1DUZB 2A0LC 5I73C 2YC1B 4JRXA 4WNQB 1A6ZA 4YDJA 3AY4C 4XWGL 1VADA 5INDA 1MHPH 3DHMA 4WEBH 3PQYA 4LOUC 1BWWA 4PTUB 4W4OA 5DD1H 5DUPH 4KJQC 3BGFC 3E0GA 4YGVA 1EAJA 1IC5H 5T1KD 1ES0B 1NDGA 3AC0A 1IC7L 3WUWB 1GCFA 4XCEA 3QDMB 4R4BB 1NAMB 3L7EA 3WS6C 5CS7A 2AVGA 2DM7A 2IGFL 3CC5A 2VC2H 4B50A 3GBML 4NQED 4BQBA 3SPVB 5GGVY 2YS4A 1AXTH 3MRLB 4Y7MA 1YYLL 5C92A 3SQOH 3FZUC 3NACH 2A6IA 5I18H 4U05A 1A4KB 1OP5K 4RX4A 4WTZA 1NGZA 3LZFL 1VACA 3DUHA 4OZFB 4NKQB 1YZZA 4N1HB 4LPXA 1DBJL 3O2DH 3OF6D 1MIEL 4NJ9H 3VWKB 3IDXL 5DJAB 4NC1C 5I1DB 2EXYC 3S5LG 2DL2A 4XBGB 4LSPH 4EUPH 3F6IA 4MJ6A 1UVQA 2IQAB 2NR6D 1FNGB 1BQLL 2VABA 3MV9D 2FEEI 3LDBC 1QFUH 4OCXH 4YWGL 2QSVA 3HZVB 4Y4HB 2GJ6D 2VXTH 5C07A 3W9DB 4YHZL 4M7JL 1RK1A 4CDHA 4QCIB 5CEZH 3QDJD 4ZSOE 3MLYH 3MSPA 3W82A 2XA3A 5JA8B 1BEYL 5FF6B 3HMXL 1OTSC 1T2QH 1T7YA 1S9KC 1FDLL 3TH2T 1NCAH 1WTLA 4PJIF 3DV6A 3O0RH 1C1EL 3DX8A 4HWBL 2LFGA 2L4OA 3E3QC 5D5MB 5DJDA 5JNYB 2JIXD 3LD8C 4XPTH 1Y0LA 5C0ND 2ICWA 4HK3N 4LBEA 4L8SC 2EC9T 4N0FB 2DM2A 2E7CA 4Z6AT 2ZUTA 2A6JB 3SHSA 4BH7B 4XNUH 4BQ8A 4KXZH 4Y1AD 5HHXL 2MQCA 4OZ4A 3PL6B 1CFNA 4P3CL 1NLDH 4OZHB 5CSZB 4K9EH 1MOEA 3EFDH 4MMXC 2FHCA 4YXKH 3CCHA 2GJZB 1MJUH 1OAZH 4FFYL 4LLDA 4P5TB 5D8JH 2NZ9D 1QSEB 4O00A 4MB4A 5CKGA 1U2CA 3D25A 3G6AB 1ZT1A 1A3LL 3GSNH 1N8ZB 1IAKB 5LGJA 3DXAE 4J7RA 3CVHL 3KPQA 4WUUA 4YZFE 5BMFH 2DS4A 1J0HA 3UJJH 4F33B 1PJ9A 1LE5A 1NGWA 1QSFB 2P1YA 4HPYL 3EYQD 4WO4D 2FJFA 1ZHNA 4PGDB 5E2VL 4NZJA 4Z0XB 1I3RA 2D2OA 3DMMD 3PWLA 1NGQL 2NY1C 2XRAH 2ZSWB 5F93C 4M7KH 2VYRE 1LDSA 4ZFGH 3KPPB 4PTTB 1SY6A 1MLCB 1OL0A 4Z76B 1NAKH 4P9HC 5GS1A 3OKYA 4ZXBC 4FQIL 5C08A 1U8PA 1RZ7H 3STZB 2DJSA 3VXRB 1KT2A 3CFEA 3ORJA 4MD5B 4N0RA 3LKRA 4XVSH 4U6YB 3QHFL 1KFAH 3PXJA 4G5ZH 1UA6H 3GGWB 3S34L 4PJ7F 3BZEA 1QRNB 1CK0L 4ZUTA 2AAVA 5HVFB 5D2NA 4JQXA 4CJ0A 5CEZD 3EYSH 3CH1A 3WKNA 3JTTA 1Z9MA 3BWAA 3MUGB 4JKLA 2AV1A 3WFEL 2HFFA 4Q58C 3WKMH 4EXPX 5L0QC 3L95A 1MELA 3MJ9A 2ATPA 3MBEC 4GKOA 1UWEH 3T0DA 1SMOA 1OCWL 5L8JB 1YEDA 2FZ3A 3NIGE 4HKJA 5JHDD 3IS1X 3LS4L 5DMKA 2UUDK 4HH9A 2W9LA 3BDXA 4JG1L 3H8NA 2CKBB 1WZMA 4IMKC 1QPPA 1LO4H 43C9B 3H9ZA 3SCMC 3FONA 2K9UA 1BZ9B 3BPNC 4O51A 2FATL 5MENE 3FN0H 3PWVA 4MQXD 2H45A 1BAFL 4M5YH 4N8PA 3OR6A 3OV6A 4GQ9H 4TPRL 4CKVX 5D6DA 5CP3A 1MVUA 4LMQI 5T1KB 2Q76A 1K2DA 3JUYA 3Q6FB 3I02B 2HT4D 3RTQD 3C2AL 2Z92A 4QTHA 5C3LD 1CE1H 3L3GB 4N8CH 5HGAA 4YNYB 3CFIC 4ZO6A 2D3VA 5INCA 3TPKA 1FL5B 3QJFB 1G9NL 4GFTB 2D7OA 1MFDH 1L0YA 4WW2C 4XVJL 2H1PL 4NQEB 3V5KB 1C5CH 3QNZA 1DLFH 1OD7A 3PV7A 1MCIA 4M1GL 1XH3B 4FQLH 5A2KH 1JN6B 1CZ8H 5L8KB 4HHAA 3W0WA 1A14L 3WSQH 5J57B 1S9WA 4R26L 1K3ZA 5A40E 4JFEE 2P43B 4DKFL 5GRVK 1UXWA 1ZLSL 5CUSL 1WBXB 1FZJB 2W0FB 1U91A 5ICYB 2UUDH 5IB4A 4RGNB 5GS0H 4PRAA 4CADB 5EU5A 1T20B 4JPKL 1Z5LB 3IXAA 4X9HA 3FOLA 2P5WA 5H94B 3KXFB 3QR2A 1UH3A 3TO2A 1IFHH 1LK3L 3K8LA 4NO2B 1KCSL 5JORA 4G6AC 5L9DH 1W8OA 3QG7H 4QF1A 3VFSB 2GSGB 5IQ7H 2ILLA 3MV9B 4YHOL 5DHVH 4YHYC 2XI9A 4QHUB 5JLZB 3AS2A 1MCFA 5HHMD 1RUQH 3G04A 1I3VA 1MCWM 2X4OA 5E03A 4Q6IC 1BZ7A 3L3JA 3MV7D 2ICWJ 5IMMA 3U9PH 3QDJB 4HUVA 5KAQF 1BQUA 3BDYH 1UACH 4EQ3A 5B8CA 5HHQB 4OLVH 1T04B 1XZ0A 1NC4B 3QQ4A 2CR3A 3O11A 2DI7A 3O45A 3D3VA 2I26N 1HZHL 4H5SB 4PJDA 4Y1AB 4LVEA 3HS0B 2FWOB 1U8QA 3L5WA 4GW4A 2DQTH 3WFHB 4PRPE 2VAAB 1Q9KB 3MNVB 3PGFH 1A1MA 5HXMA 3C5JA 3P73A 4XPBL 3NPSB 1BM3H 2DWDB 4BSVB 1U6AH 1MJJB 4P9HL 1GGTA 4PJAA 3LRGA 1KC5L 2OZ4L 3UZQA 4DN4L 2XWBB 3HC3H 3H0TB 4WO4B 2DF3A 4P9ML 3ARDC 3SDAC 4ODTH 1HHGA 2Z9TA 2FECI 5CWSB 4I3GA 5GS0D 4HCRL 2BERA 3DMMB 3RIFK 1BFSA 1U3YA 2E8YA 1GXEA 1AO7B 3MA7A 3LEYH 3U46A 3QJHA 5IMKB 1ED3A 1T22A 1HKLH 1BFTA 4KTEL 3QBTB 5C09E 1CLOH 1GHFL 1UXSA 4AIZB 1EAPB 2L0DA 4PP2A 2C4FT 1JF5A 3DSFL 2HFTA 3EZJB 1G7PB 5DJXA 4OT1L 2VN4A 4TTDD 4IRJC 3RU8H 1VPOH 4NM4H 5ANMB 1IL1B 3EYOA 3OKNA 1U42A 3C08L 3DWTA 3QUXB 3UTTD 5J1AB 2X9YA 1JUFA 3D39A 2AJSL 2D7TL 4POZC 1NCCL 4MQTB 1IZKA 3KPNA 3D0LB 2AJYH 3ISWA 1WF5A 25C8L 2A9ML 1TPXB 4KK6C 4V1DD 1OAKH 4KKBD 1HSBA 3C2SA 2ZG3A 2WWMD 2DQDH 1GGUA 2E27L 2YXFA 2VQ1B 2M26A 1N3NB 4ZPVA 4D0DA 4Y5XB 5I8CA 5F9OL 3GSVB 3BX7C 4JFOA 2I9LB 4H8WC 4APQB 5C0AE 4G6KL 4N9GB 3VFRB 1L9MA 3IDYC 1Z0NA 5TH2A 3OR7B 5CSGA 1V7MH 4OTXL 5JHDB 3P11H 3AM8A 1MJ8H 1PEZA 1YPZB 3RA7L 4ELKA 1PLGL 2ID5A 1CD8A 2OQJA 3DBXA 3FCTB 4KRNA 3DRQA 5GIRB 1F3JB 2EDEA 1BX2B 4LLMB 2F54A 2FX7H 4UAOB 1YJDH 2AI0L 4JHBA 4LQ1A 4P2OD 1A0QL 5CMAA 3V4PL 1UM6L 2K7QA 5IB1B 5IEKA 5KG9B 1NUNB 3WLWD 3BGMA 3RTQB 4FFWD 1IEAA 4NJAL 4NQCA 4EQ2A 2X70A 3ULSB 1U58B 5I8EB 3VFOB 5L2KA 1CFQB 3ME0A 3L3DB 1IC7H 1CDGA 2WNGA 1IGJA 3VXQB 1BJ1H 1N5AB 1V3LA 3NA4A 1QRKA 3HE6D 2IGFH 3NIFE 3MLWL 5C0FA 2KL6A 4D9QE 3GBMH 4H88L 4D3CL 2BNQA 3RX7A 5CBEB 3IT8D 3JWOL 4ODXB 2O61B 3F7QA 4P46C 1YYLH 1LEIA 2HFGL 4MAYC 3V6FB 4O58L 1JWSB 1FYTA 1VERA 2HVKA 4U1SA 3EJZC 5EA0L 4JFPB 2IALB 3QEGL 5BJTA 3LZFH 3UMTA 4I18B 1QR4A 5ILTL 4PY8J 1S7WA 3P4MB 2PCPB 1DBJH 2F53E 2PF6A 1MIEH 4Y5YC 3IDXH 5JPMA 4PRIB 1F97A 4GKSA 1R3KA 3EO9L 1MY7A 2CO6B 4GG8A 1IGYA 4L1HA 4RCAA 3MV7B 4OIBA 4K07A 3PV6A 5B38B 1BQLH 4OI7A 2JCCA 3FO0L 5CJXC 1KJVA 3LH2L 2CRYA 4YWGH 4PG2C 2B2XL 1BVKB 1UWXK 5DRNB 5DJYA 4YHZH 4PBXA 5C0GB 4M7JH 5FHAL 5GZND 3RKPA 1HOCA 1SJHA 1VGEL 1KB9K 2JE8A 4JR9H 1BEYH 3PG2A 3HMXH 4QHKI 4CU6A 1WFUA 1FDLH 1F4HA 3HZYB 4BKLB 2Y5EA 1C1EH 4HWBH 4D8PA 4TQEH 1ZGLA 5D7IF 4ZS6C 5DR5L 5L7XL 1EEUA 2XXMB 3L7FA 2JK5B 1AP2B 3H9SA 1UB5A 1PAMA 4Y4KA 4DGIL 4LLQB 1GGYA 2W60B 3CZFA 2WSKA 4GBXA 3OKKB 4NNYB 5HHXH 1JK8B 1ZHBA 1DBKL 4P3CH 2HLAA 2WBWB 1ZLVK 1J8HD 1HI6B 2X10A 5BZDA 5B3JF 2AK4D 1YMHA 1H5BB 4PFEA 5E7FA 5ABDE 4LCWA 2P45B 1MWAB 4FFYH 5T33H 2EEBA 2EXWC 1A3LH 1VCAA 4BSWA 4N5ED 1K8IA 1RZIA 4J3TA 4LKXA 5BZWB 2GSIB 4OUUA 5T1DL 3IAGC 4UNUA 3OX8B 4NN6B 5DZOA 1Q8MA 3IXTA 5IOPB 3VXUD 1B0RB 4JN2A 3HPJA 1I1FB 3TO4C 5IEHA 4LK4A 1T21A 4XBEL 5E2VH 3O8XD 2UWEB 4KRPD 1NGQH 2E9BA 1UCBL 4UNTA 4CN1A 3H7BB 2VUYA 4UV7L 1QHOA 1FL6A 3WO4C 3OKMA 5E9DE 5I1KL 1KJ3L 4QHNA 2FEDD 4H8WL 1AHWB 1RJZB 4ZDHB 4FQIH 3ZT6A 4LLWA 3BP5A 3D85A 2EIZA 2CK2A 3KLAA 4G9DB 3ARYA 3QHFH 4V1DB 4HWZA 4PJEF 4D0CB 1JZ7A 1E28B 2J2ZA 4WJ5B 3S34H 2W59A 3WN5C 1CT8A 2GI7A 1CK0H 3RVUD 2ARJA 3GB7A 3DUUA 1BF2A 4MDJB 4WFHE 4UOJA 2NX5D 2IFFL 4WW1B 4WV1A 3QO0A 2BOBA 1FNAA 4LGPB 3WFEH 2X6MA 4GRWH 1HEZA 5DTFB 4LNRB 3UBXB 1T7WA 5IHLB 4KWUA 3T65B 4C56D 1IGCH 3SDDB 2IF7A 3BAEL 3C6LC 3O3DA 3RVWC 2BNRD 2MOVA 4XI5C 5EZJB 5EFIA 4RFEA 1OCWH 3LS4H 3D9AL 4JM2C 4LSVL 4P2OB 2PO6C 4TNVF 2VL4A 4ZUUB 3WIFA 4LRIA 5DUML 1KIQB 4JRXE 4K3DL 4W6WB 4U3CA 1FNSL 2HVJA 1Y6MR 3PQYE 1AD9A 5EBMB 3P9LA 2FATH 5HYQB 2MWCA 1BAFH 3LSOB 5KS9F 4TPRH 1JGLL 3RPIA 4U4BA 1N2RA 4HS6B 3UTSA 2LTQC 1C12B 2FHFA 3A67L 3NIDF 5I1AB 4FA8A 3C2AH 5JUEL 1JGVL 1U8MA 4I77L 5EBLA 3GBNL 3FFCD 3HE6B 3QAZB 1N6UA 1G9NH 1JI2A 3K2UL 4OLZL 4XVJH 5H37H 2EYRB 1HHHA 2H1PH 3QQ9D 2NY0C 4HUXB 1KB5B 2XPGA 4KK9C 4QHMB 3VG9B 3VXMD 4LLVA 4M1GH 4WHTA 1DR9A 3CXDL 5IBLC 2ATKB 1CGYA 4HH8A 4LL9A 4QHLA 5E6ZA 1A14H 3PGCB 4OCLC 4U1KA 4R26H 4F9PC 4DKFH 4XNQB 1ZLSH 5CUSH 5DFVC 2ZSVA 3RVTD 1B6UA 1HQRA 3B4NA 1FN4A 2O93L 4PY7A 4JPKH 4PLJD 4MVBC 1QACA 5D9SB 1V8HA 4AK1A 2AJZA 4G6JH 5C0EA 2PYED 5DFTA 1A2YB 3EJYC 1J88A 4X6CF 2PR4L 2YKLL 1LK3H 5I1HL 4IHOA 3GMQB 3TA3C 2H26A 3DX6A 1KCSH 5AAWA 1TIUA 4XB7A 2VIRB 2VR4A 3C5ZA 3FQNA 4YHOH 3VXNB 1S8DA 5DYOA 4NHUA 3HI6L 1Y6NR 3WXVL 5K9KB 5C07E 3RY6A 2Q3AA 3IJYA 2O5YL 1Z9SA 1T5WB 3T09A 1DN0A 3THML 2AQ3A 4NRXA 4YHPA 2BCKA 2HT3C 4ORGA 4YBLB 1UM4L 4G80B 3JV6B 3F12B 3QULA 4F8TA 1CTOA 2IADB 2J4WH 2ZUSA 2R2CA 4R7NA 1CCZA 4Z7VB 1HZHH 4H25A 4K3HA 4MNQA 4XRCA 5FYLD 3GMPB 1N64L 3Q6GH 4R9HA 2DOCA 4LKCA 5F7YC 2IAMA 2WQ8A 1J8HB 4JAMA 1JPFA 4X4YB 2AK4B 1F2XK 2ITCB 4WCYL 1BVLB 4PJXF 3AREB 4JVWA 4XPBH 4X6DF 2XZQH 3R06B 1VFBB 5IB2B 3K1KC 4FHBD 4P9HH 2BNUB 4WUUE 4PGBA 1KC5H 2OZ4H 1BFVL 4DN4H 1NCTA 5KANI 4ESKA 3MJ6A 4OCWL 2ERJC 4P9MH 3JV0A 1YDPA 1CLCA 2OBGA 1YN6A 4HCRH 4KRPB 2B0SL 1K4DB 3FB8B 4PGEA 3RWDA 4MAUH 2J5LC 4F3FB 1XGYL 4KTEH 1ZA3A 3DI3B 4XNMA 1GHFH 2AV7B 2DMCA 3TP4A 4IOFC 1EK3A 3ARUA 4NN5C 2R0ZL 5FB8A 5C08E 3RHWK 5C0IA 3DSFH 4HZAA 2BVPA 3O9WD 3QA3A 5IK3B 3G5XA 4OT1H 1GZQA 3OGCB 1D9KB 5LCVL 2W65B 4YC2B 3KJ4B 4YDKL 4U1NB 3C08H 1V3JA 1GZPB 4FQXA 2I27N 2BXYA 2X2YA 5D2NE 2AJSH 2D7TH 4JKPL 4XNZC 1NCCH 4GXUN 5E6IB 3V4VL 2BJML 25C8H 4UU9B 5MHSE 2A9MH 5GS2H 4MD0B 1VB9A 5KZCD 3BMWA 3V4UL 2Y36L 5TDPB 1M7DB 4Y4FA 5HHNB 3LN9A 5FV2A 4LSUL 1ODAA 4NQXB 2BP3A 5JMOC 4JDVA 5F9OH 2PXYD 1U8KB 3QXWA 4DJMA 4NC0B 1H9VA 4G6KH 1I9JL 2QR0A 4FQ1L 5D93B 3SO3C 4OTXH 1A3RL 3W2DL 3CPLA 3DV4A 4TYUA 3ARFB 1FCCA 1DBBL 5FUZH 5E4EB 3RA7H 1PLGH 1UQSB 3LV3B 3KNBB 5E24E 5F7FA 1MI5A 2OJEA 3B6SA 3GHBL 5HI4D 1PG7L 3WE6A 1PD6A 3G9VA 1NUFA 4PR5B 1JGUL 3LPFA 2AI0H 4HIIA 1A0QH 4GUPA 2ADJB 3IVKA 4OQ1A 3V4PH 1KJ2B 1A9BB 1DUZA 1UM6H 3GIZH 5FEBA 2R39A 3MRCB 3ZT5A 3P0YL 1AY1L 2APVA 2YC1A 5SX5H 5HHOB 1B4JL 2Q87A 2PW2B 3EDJA 4NJAH 1MSPA 2YUWA 2K1MA 4PTUA 1FZOB 5DJ6B 5GRZA 3FFCB 5MEPB 3LN5B 2NTSP 3MX0A 1DQTA 2HJKB 4CMHC 1ES0A 3UPRB 3VXMB 4OB5L 3RBGA 3WUWA 3O3BB 4MXWL 3B2UC 2OI9B 3QDMA 4R4BA 1NAMA 1GGBL 1CICD 3SDCC 4G8GD 4CL7A 4KK5D 2NYYC 4H88H 4D3CH 1FJ1B 5J8OA 3JWOH 1ZVHA 3SPVA 4JZJB 2FX8L 4P5MA 4EXKA 2H32A 5DJCB 2HFGH 3A0OA 3O41A 4O58H 4BJLA 3MRLA 1A1OB 1O7VA 4FQCL 3JWDC 5GS2D 3DURB 1N0XL 1JFQL 2P5WE 5EA0H 4UT6L 3UAJD 4ETQA 3QEGH 2PYEB 4MS8C 1A4KA 2EECA 4WFFE 5ILTH 2DICA 4HLJA 5J12B 1WITA 1WZ1L 1SYVB 4OZFA 5D2NC 3GSRB 4JQXC 4I3RH 5DO2D 2PTUA 3N1QC 5F71A 3CX5K 1JMZA 5DJAA 3VWKA 2SEBB 3V6ZB 5I1DA 4JPWL 3EO9H 4XBGA 5ID0B 3EDFA 2FGWL 1RIHL 3WV0A 4NO0D 2FGZA 3FO0H 3FFDB 3DXAD 4R7DB 1LDPL 2IQAA 3LH2H 1FNGA 1SBSL 2B2XH 3FO9B 1INQB 5FHAH 1U3HD 3RWFB 3SGDH 3U0PB 3X3FL 3HZVA 4GKNB 4JFHE 4Y4HA 5GGSY 1VGEH 4LSSL 3W9DA 3WL9B 4R8WL 4QCIA 4YDIL 2DI9A 2NW2B 3EHBC 2FO1A 5FF6A 2UY6A 5HI5C 4HS3B 3ZO0A 5ELIA 4PJDE 5DC9B 4OCRH 5EC1B 4TUKL 3WNLA 5DR5H 1ZSDB 5D5MA 5EB9A 1EEZB 5JNYA 3C5SB 1TJHL 1TMCB 4QRPA 4DGIH 4N0FA 3T2NL 2AEQL 3R1GL 2A6JA 2DQFB 1EDQA 1DBKH 4BH7A 1F42A 5FOBB 1IJ9A 2EDTA 1CBVL 1IVLA 2IBBA 2P7TB 4PJAE 5CSZA 5D96C 4EI5C 1W0YT 2Q7YB 1JNNL 5CIPH 2G75B 2GJZA 4X7EC 1WLHA 4PJFF 5C6TL 2LE9A 4P5TA 3FRPA 1QSEA 3MV01 1C5BL 4LSQL 3QIUD 3G6AA 4K71B 2EH7L 2OS7A 1IT9L 1N8ZA 3CU7A 5T1DH 1T0NB 5K9QG 2WK2A 4HC1A 1LP9F 2XKNB 3BPLB 3WUWG 3O4OB 5C2UB 5HBBA 4F33A 5DC0A 3RI5K 1QSFA 4L3CB 5MP6L 4XBEH 1XCTB 1YEGL 4ACPA 5F6IC 4NWUL 4PGDA 1S7QB 3TNMB 1UCBH 1QFWL 4FMFA 4Z0XA 3O9WB 2D4FA 4UV7H 3AVEA 3MC0A 5EWIL 1PX4A 2B7DT 4UNVA 1YA5A 2ZSWA 5I1KH 1KJ3H 4KI5E 4H8WH 2VRAA 3KPPA 4PTTA 4KDTA 4Z76A 4ODUB 5LXGL 3D39E 1NBVL 5BVJB 1UGNA 4NKOB 3STZA 3VXRA 1FVDB 3K4ZA 4MD5A 3FAWA 1CR9L 4OI9A 4XPAL 4U6YA 2AXFB 4K94L 4OZFG 4XC1L 5F9WC 3GGWA 4NBXB 1QRNA 2VLME 3U7AA 2OXHA 1ZVYA 3ARRA 5TQ2L 3MZGB 2IFFH 3LKPB 3WNKA 4DUWA 2X4SA 1A6TB 1ZLWK 5B4MD 5I9QC 1A6UL 3MUGA 5B8CC 5C8JB 3NOIA 3QUMH 4PJ7B 4QY8B 4OZIF 3BAEH 1FFNB 4XP6L 1P9MA 1NC2D 1J0IA 5IVOA 4OD1H 4FQ2L 1MF2L 2DIJA 1KV3A 4X6FB 3BWUC 4OM1L 2F54E 3EYUH 3D9AH 4GXVL 3MZTA 3EUUA 4LSVH 3CVIL 5C0RL 5DUMH 1JRHI 4K3DH 2CKBA 1FNSH 4PJBA 3F58L 1OARL 43C9A 4MB5A 3S88L 4OLUL 1BZ9A 4NQCE 5EDXA 5GGRA 1U3ZA 1SY6L 4QRQB 1JGLH 4OIAA 1MCCA 3HUJB 3MCLL 4P3DB 5LAXB 3JWDL 1JNHB 5T1KA 2BVTA 1L7IL 3Q6FA 3I02A 5JUEH 1JGVH 4I77H 3GBNH 1L7TL 2BXZA 5HDLA 1X4YA 3FRPG 3L3GA 1CICB 2DL9A 4YNYA 1ZLWH 3MRJB 2ZNWA 5FCSH 4G8GB 3K2UH 4OLZH 3NCEB 5F1KC 1FL5A 2BNQE 3QJFA 4S1DD 3WIIL 3KAAA 4NQEA 3V5KA 3ZE2E 4YFLF 4J4PC 1C16B 3QYCA 1XH3A 1JN6A 2VXUL 1EHAA 1FYTE 2JTDA 1JCKA 1FAKT 1G6VK 4YEEA 1WK0A 1CXIA 4B7IA 1WBXA 2VDPL 4EN3D 2W0FA 5ICYA 3T3ME 3GJFB 1D5XB 3T0AA 2P8LB 4KRLB 4CADA 3DOSA 1AD0B 1T20A 2BVUA 4PRPD 3OF6A 1Z5LA 4Q0XL 2PR4H 4X99B 1ETZB 5AZ2L 5I1HH 1FV1B 1BLNB 4UOW1 3QHTC 1KULA 4NO2A 2WMPA 35C8L 2CLZB 3OB0K 4NO0B 3VFSA 2JCCE 2GSGA 5EIIB 3MV9A 3HI6H 5CEXB 1S9YB 4UTBL 4QHUA 3WXVH 2FCBA 5JLZA 3DPBA 1U3HB 4IJ3C 3SJVD 2O5YH 4QRTB 5IVXF 1M7IA 4QXUH 3THMH 1KN2L 4XCYB 3T08A 3QDJA 4X5LA 3V0WL 4R90L 4DZ8B 5HHQA 4M6ML 1LO5B 3D2UD 5J3HD 2N56A 2NXZD 4OF8A 1NC4A 4FXGB 5KSBF 4R97C 1R3IL 1YY8B 3O2WL 3QPQD 4FQJL 1N64H 1PDKA 4H5SA 4MXQD 3PWJB 1L0QA 4K7FA 4Y1AA 3WIHA 3HS0A 1X5XA 5FGCE 3WFHA 4LCWE 2VAAA 1Q9KA 3MNVA 1QR1B 3RX5A 2R9HC 1TZHB 4ZD3H 3QIUB 3MOBL 3OB0H 1F13A 4BSVA 4I3SL 2VZVA 5J4MA 1MJJA 1BFVH 4MA1C 3TN0C 3WJJA 1D6EB 4UQ2B 4RBPK 4OCWH 3H0TA 1DL7L 4WO4A 1ZK9A 2B0SH 2W1NA 2WUBL 2VJXA 5CWSA 1HH6B 3DMMA 4LPUA 1A7QL 1ORSB 1OY3B 1MHEB 2W0LA 1XGYH 5FK9B 5IMKA 5HTSA 2N7AA 1FG9C 2IJ0C 2R0ZH 5J11B 1FE8L 4LVHC 4AIZA 3NGBC 1EAPA 1Z0MA 1XGTB 2VDQL 4MDIB 7FABL 2ZCKL 5LCVH 3MJ8B 1M7XA 2YD8A 3RP1A 2ADGB 5TDOB 5JIHA 4YDKH 1ZAGA 1W0VB 5IBUB 3K4DA 2D0HA 5ANMA 1IL1A 4JKPH 3QUXA 5J1AA 3V4VH 2BJMH 1JF1B 3PXHA 3D0LA 3EOAB 3V4UH 4EKXA 4X4MA 2Y36H 2CMRL 2C26A 2YWZA 4LSUH 2VQ1A 4RISL 1N3NA 3RHWF 4WW2F 2VLLB 4Y5XA 3QIWC 4RBPH 4WIQA 3GSVA 3STLB 3K0WA 2I9LA 1RIVH 4FQ1H 1QPXA 4APQA 4N9GA 3VFRA 3KPSD 1A3RH 5DJ0B 3OR7A 5EU4B 5JHDA 1X44A 1S78C 2YN3A 3ZDYE 4G9FD 1QD0A 1YPZA 3GHBH 5ICZB 1EHLL 1VEMA 4Z8FL 4Y4KC 5DMYA 1X5IA 4GBXC 5GIRA 1JGUH 4LLMA 1BX2A 1YNTB 1HK6A 3C09C 1YMMB 4KRMB 4LPTA 3HC0B 4KKCD 2WW8A 5IMOB 4U49A 5ESAB 4AEIL 2BX5A 3UTSE 4QEGA 5FM5O 3Q0HA 1P69B 1AY1H 3P0YH 5IB1A 2DQJL 2WANA 1B4JH 5CLWA 3RTQA 3S96B 4M43L 5HVGB 1N26A 3D1MC 2CGRL 3ULSA 2PYFA 1U58A 5CGYC 3VFOA 1UWGL 3FQWB 1CFQA 3L3DA 1CXKA 4NOFA 4OB5H 4WHYH 3B9DA 1INEL 1QUNA 4MXWH 4F2MB 2VDKL 3VXQA 4I0PB 1GGBH 1N5AA 3M17A 3BQUD 4HJGB 3W5NA 2EDXA 3NIGF 1PY4A 5KVDL 1RK0B 4EN3B 2FX8H 5CBEA 5CINL 4ODXA 1OTTC 2O61A 4BZ2L 4FQCH 5JW4M 4ELMF 5D7KE 1N0XH 1JWSA 1JFQH 4UT6H 5J6GB 2FDBP 4J2XA 4PRPB 2A6DB 2X7LB 4EUPG 1JV5B 4MZ2A 4JFPA 1OQXA 3H2WA 2IALA 1FL3B 3U30B 2Z8SA 5IWLA 4I18A 1WZ1H 3QUMB 1HYSD 3P4MA 3DYOA 4OCSL 1AXSB 4L4VD 4D2NA 4X9FA 4JPWH 4KROB 1LO3L 2AQ2A 1RZFL 3QDHA 5TDNB 2FGWH 3SJVB 1RIHH 3GBLA 3MV7A 2BMKB 5B38A 1OQOA 1VFUA 3FMGL 3MR9B 3ZKNC 4HIEB 3X3FH 3D2UB 2DLTA 1BVKA 5DRNA 2WBJD 3VGBA 5C0GA 4LSSH 4R8WH 4BZ1H 4YDIH 4MSWB 3VGFA 4N0UB 4MNQE 1JYXA 4LRIC 3RY5A 1T80A 1W2KT 4MCZB 5BXFB 4UZGA 2J8UA 3HZYA 4BKLA 5C7XL 4TUKH 4DAGL 3S98A 4RGMC 1FFRA 1MRCL 1N7ML 1TJHH 1WUNT 4HUNB 4U6XB 1OW0A 2JK5A 1AP2A 3T2NH 4LLQA 3R1GH 2W60A 4DGYH 2O5XL 3OKKA 4NNYA 1HIMH 1CBVH 3NCYS 4DKDC 4NNPL 4OIIL 3F7YB 1Q9WB 1HI6A 1JNNH 3G9AB 1H5BA 2L7JA 4HZLB 5D7IB 1HSAB 5C6TH 1MWAA 1C5BH 1WQVT 4LSQH 4YAQA 1G9ML 3HCVB 2EH7H 1IT9H 3GMRB 3N9GL 5A2FA 5BZWA 1FO0B 3ESVF 3LKSB 5GZOC 4MJIB 3PDDA 3OX8A 5GRYA 1Z9LA 4YXLL 5GS3A 5IOPA 3G6JF 5HVHC 1B0RA 5MP6H 3X14B 3U6RB 1YEGH 5DEZA 1I1FA 4AY0A 4U0QB 4NWUH 1FFPB 4PBWD 1FC1A 1R5WB 1QFWH 3WHXB 2OTWB 2UWEA 3P9MB 1U0QA 5EWIH 3H7BA 4JO3L 5HD8D 2B5IB 5IR1B 3E8UL 3AB0B 4WUKH 5E1HB 3TESA 4HXAH 1P2CB 1AHWA 1RJZA 5LXGH 5DURD 1EHNA 1NBVH 4ZDHA 1DE4B 3SE3C 1CDHA 4LCUB 5E5MB 3QXUA 1EO7A 1NMBL 3C5ZC 1CR9H 4HIJB 2ADIA 4G9DA 4V1DA 2OMBA 4D0CA 4K94H 4XC1H 1E28A 1TETL 4KKLD 4WJ5A 3RI5F 1A6WL 4B53A 1FH5L 1E6OL 5TQ2H 4JREB 1O0VA 1X5YA 1ZOXA 4IS6B 4HQQL 4ONHB 1CGWA 1MFNA 4WW1A 1A6UH 1NMAL 2H6PB 4NFDA 4PJEB 3KPSB 5B38G 5AAMA 2QEJA 3U48A 5DTFA 4LNRA 3UBXA 4G9FB 5T3XD 3T65A 2BOCB 4XP6H 3SDDA 3OG6B 4FQ2H 1MF2H 4JVPA 5EZJA 4OM1H 2V7HB 5BOPA 3H6JA 4ZO9A 4GXVH 1RUML 4KTDL 3CVIH 2X4NB 2IAMC 5C0RH 3ZE1F 4E42B 4P2OA 1RJYB 4ZUUA 2ZKHL 1KIQA 1J05B 4NNXB 4G8IB 3VXTB 3F58H 1OARH 1MCNA 3VFGL 3S88H 4NCDA 2R23B 1N6VA 1UZ6E 2YN5A 4KJPD 5EBMA 5HYQA 1SY6H 5DVLA 5C9JB 1R3LA 3QISA 3LSOA 3MCLH 3RZCD 3VDBA 2YOCA 2CD0A 4HS6A 1ZGLM 1L7IH 4GS7C 1C12A 3LKNB 1FSKC 5I1AA 4J3OC 2ZNXA 1A7PL 3QDME 4NOBA 4AM0B 1L7TH 1HYRC 1JE6A 2BVYA 1U2HA 5C07D 3VD7A 5GGSB 3IAPA 3BQUB 3HE6A 3MA9L 4FXLA 5JPNB 1DVFB 5KS9B 2Q6WB 1S7XB 3WIIH 1EEQA 2EYRA 4LASL 4HUXA 1KB5A 1MY5A 3T3PE 4QHMA 3GNML 4Z7UA 5T3ZE 1U92B 2VXUH 1NUGA 5DD3L 3JWNC 1JWMB 2YUZA 2ATKA 4HFUL 3PGCA 4OLEA 5AUMB 4ERSL 3DGCR 1U8OA 5AG9A 2XN9B 4XNQA 3LPGA 2VDPH 4NT6B 4PYGA 5K93A 1IGTB 4QXGL 1DLHB 2ZUWA 4FQXC 4YK4C 2DLHA 4L4VB 4Y16D 5D9SA 3PDOB 2DKMA 2NY7L 4Q0XH 3ALXA 3ZDZF 5B22A 2MNUA 1A2YA 4P99A 3GMQA 4DVRL 35C8H 2VR9A 1GJIA 2HJFB 5EU7C 1SEQL 3WXWH 2VIRA 1RZKC 4WUUD 3VXNA 4UTBH 3NN8B 3RWCB 1KNOA 4KAQL 5K9KA 1TDQA 3RFZC 1SHMA 2V5TA 1KN2H 2Q7NA 1B9ZA 5DQ9B 3P3YA 5T5NF 3U4BL 3V0WH 1I8KB 4R90H 4EDWL 3MRIB 1P5VA 4M6MH 3UBXG 1C7SA 1MCSA 4K7PL 4F7MB 4G80A 3TNNB 1PQZB 5KJRL 3JV6A 3N85L 1QG3A 3F12A 4YFLI 3FJTA 3RUGF 2IADA 1R3IH 2XOTA 3O2WH 1HHKB 4FQJH 4Z7VA 1CFSB 1Z2KA 3R0MA 4W81A 3GMPA 2V9RA 4JGJA 4LSTL 4JN1L 4UQ3B 4OZHE 1FQ9C 1J8HA 4YHIB 2DM4A 3JVGA 1F8TH 2AK4A 4X4YA 2GUOB 2ITCA 1J18A 1QSEE 4F37F 2YD7A 3AS1A 2P44B 3R06A 3MOBH 4YGAB 4RNRB 5FYKD 3TBTB 5IB2A 4I3SH 4ZOEA 3T0XA 3WNMA 5D1QD 2BNUA 4HIXL 4NPYB 1BBDL 3C6SB 3GMLB 1QSFE 1KIUA 1RULL 2WUBH 4TSAL 1AJ7L 3SGEI 1A7QH 1K4DA 4K55A 3IDNB 3FB8A 1XR8B 3F62A 4JM2F 1OAYL 4PD4K 4F3FA 2WIIB 3QIBC 2AV7A 1FE8H 4DN3L 1IM3B 1PYWB 5DURB 3ULUE 3HA0A 5IUSA 2VDQH 4BUHA 7FABH 3TBYB 4WFEE 2F9BT 3VXRE 2ZCKH 5IK3A 2NW3B 3ULVE 4X8XA 2JJWA 3L6FB 3HRZB 5CKAA 3OGCA 3TJEL 1URLA 5JOPE 2W65A 4IOIB 1QRNE 4U1NA 4IRZL 3KYMB 1YUHB 1GZPA 2G60L 2XFXB 2GAZB 3X3GL 4N9OB 4UU9A 2NX5A 2FR4B 1NGXB 4MD0A 2CMRH 2L7UA 5GHWH 2Q8AL 5TDPA 1M7DA 4RISH 4HWBA 2OP4L 4PB0L 4PJ8B 4NQXA 4M93B 4JPVL 4Y4HC 4R4NC 1U8KA 4G7VL 1NLBL 3BN9D 3CDFA 2ITDB 1SQ2N 5F6HI 3WNNA 1OB1B 3O6FD 4P2QD 1G1CA 5I75C 3L9RB 4H26B 1EHLH 1UQSA 3LV3A 2JJUA 3EDDA 4Z8FH 3KNBA 4FZ8L 4XH2A 3L3IB 4WGWB 1Z3GL 5DEGB 1JTPA 1T6VN 3MLUL 4PR5A 4BH8B 3UJTL 1I9IL 5CILL 1QP1A 5TFSL 3RZCB 4AEIH 2ADJA 4DQOL 2ADFL 1KJ2A 1A9BA 2DQJH 2IH3B 3MRCA 2B4CC 4P5TC 1JNLH 2PW2A 4M43H 1KTRL 1UJ3C 3ZHDA 2CGRH 3OJVC 4L29B 1FZOA 4QXTB 5DJ6A 3IU3B 3FFCA 3F7PC 4P49A 4BELD 4CMMB 1UWGH 2Y7QB 3EO1B 4JY6B 3LN5A 4NFBA 4NQSB 4NQEE 3P30L 1INEH 2VDKH 3VXMA 2W9EL 3VFPB 2R69L 3RVVC 4PJHF 4ZG1A 3IKCB 3BXNB 5FO8B 1K3IA 2NY4C 4UBDC 4LCCB 2FNBA 4BFGA 5KVDH 1RZKL 1FJ1A 3MNWB 3OXRB 2VZ3A 5CINH 3TT1L 4ODVL 3EOYG 3BN3B 2APFA 4JZJA 1OSPL 4UIKL 4RGNE 5DJCA 4BZ2H 4CN4A 1QFHA 5JXEC 1S9VB 3ULUC 1A1OA 2C1PB 2LQRA 3D69B 4ONOA 4Y16B 5DD5L 4CW1B 3ULVC 1IBGH 3C60D 5IQ9B 3KXFE 1ZLUH 2BY0A 2PYEA 2X9WA 5B21A 1AGFB 1NEZB 5C0CB 1EVTC 1SYVA 3EBAA 2X4UB 4OCSH 3GSRA 1MAJA 3MV9E 5L6YL 2Y6SC 2YD1A 2HA1A 3DO7B 4RWHA 1SVCP 1LO3H 1TZGL 1UH2A 1KEML 3W81A 1RZFH 2P49B 5ID0A 3GMNB 4O2CB 1MCWW 4PYHA 3QDJE 4I0CC 3FFDA 4R7DA 5F7DB 3FMGH 1P9MC 4GLRH 3FO9A 1C08B 4IOSD 1INQA 3U0PA 3RWFA 4GKNA 1WAAF 2C7UB 3WL9A 3AS3A 4PP1C 4WI9A 5IFHL 5JZ7D 1NAML 2NW2A 4WI2A 4FQPA 3EGSA 3MMEB 4HS3A 1BBJB 3I6LE 4YO0B 4Y1AE 1PG7X 5C7XH 5ETUB 4DAGH 4KI5D 3T2OA 1M4KA 4M03A 5EC1A 4YDVB 1MRCH 1ZSDA 1N7MH 1OD9A 3BP6B 3ALPA 3C5SA 2DLIA 3D39D 5T3ZL 3T8XB 3L3HB 1LWRA 2FBJH 2DIBA 4OFIA 1YEJL 5E2JA 4RMWA 2DQFA 5CSBA 5FOBA 4NNPH 2GITB 4OIIH 5D1QB 3TZVD 2VLMD 2Q7YA 4TN9A 2Y4SA 3RBSA 2G75A 4FQQA 1G9MH 3INUL 5EU6D 2AERT 2J6EA 3N9GH 3BJ91 5E1AB 3WMSA 1T0NA 2CDGB 5MEOA 1AO7E 1PVHA 1ROWA 1T83C 3OAYK 4Z7WF 4YXLH 2XKNA 2CPCA 3CK0L 4PJFB 1TTUA 1NCDH 4L3CA 1XCTA 2NY3B 3TNMA 2FIKB 4LEOB 2GHWB 3O9WA 4JO3H 3HAEB 2KZ1B 5DZLA 4R2GD 3DHJA 3PHSA 1I7ZB 4KUZL 1LP9B 2MKWA 3RWEB 4JKMA 5ANME 4XC3L 3GHEL 1NCUA 3TJHD 4ODUA 5DEFB 1NKRA 1D5BB 4LIQE 5BVJA 4YR6B 1NMBH 4NKOA 2A6KB 4X4ME 1HH9B 5TF1L 2NY2C 4G6FD 1FVDA 2NR6C 3VWJB 1UM5L 1TETH 3V9FA 5CD3B 1A6WH 2AXFA 3VRLF 2VE6B 1FH5H 1E6OH 5KVMC 5B3NA 2CQVA 2YEZB 4HV8B 1PEWA 4YHNB 2PXYA 2RB8A 4HBQA 5I73B 4HQQH 3KPLB 4KVCL 1BIIB 3CXHJ 3LKPA 1NMAH 3KVQA 5HDOA 5HDBE 1A6TA 3MBXH 3O6FB 1YEFL 2W07A 2MCG1 5E5UB 4C4KT 2B4CL 5JHDE 3BGFB 1NCNA 3OAYH 3H9HB 4P2QB 5C8JA 4PJ7A 4QY8A 1YPZE 3STBA 4M4PA 1FFNA 5C0NC 4BM7A 2Z31D 2Z93B 4NCC1 4HC1L 4X6FA 1RUMH 4KTDH 4X83A 3SBWA 1IARB 3PF2A 4AH2B 5GJTL 3FHQA 5I1LB 1YEEL 4O02L 5AG8A 2ZKHH 4HAGA 3MRQB 4C57C 4OZIB 5HPMA 1XAUA 3VFGH 2EE2A 4OAWB 5F1SA 4KH2A 1DFBL 3IGAB 2NZ9C 1JI1A 2HKHL 3NPSC 3QT2A 1OSZB 4QRQA 2EDNA 5DXWA 3HUJA 3ULUL 4P3DA 3FT3B 3WJJC 5LAXA 4M48L 4GO6B 1JNHA 1A7PH 3ULVL 3EYQC 1F2QA 4WO4C 3HR6A 3MA9H 2R4SL 3QNYB 1CICA 2IBGA 3DMMC 3MRJA 4G8GA 4QHKJ 4C54A 4LASH 2X1OA 4HJ0C 4YPGB 3QWQB 4PJ9C 3BVNA 4GRLD 3GNMH 2D31B 4Z5RB 2EDBA 3KPTA 3QDAA 3QO1B 4RMSA 5DD3H 7CGTA 1C16A 4G7YL 4HFUH 1WEJL 4ERSH 5DRXB 4DTGL 3RIAK 3LDBB 3DNKA 3C60B 2A73B 32C2B 4P4KD 3KPOB 4QXGH 3ZZ1A 3GJFA 2P5ED 3V6OA 1A02N 1D5XA 1EFXB 1G7HB 2P8LA 3OHXB 1AD0A 5JW5B 2NY7H 3GM8A 5EUOB 1TPXC 4PRIE 2X4PB 1J12A 2EYTB 4X99A 2CUHA 1ETZA 2CKBL 4ZMAT 1FV1A 4DVRH 3VFVB 4Z9KB 2NY6D 1BLNA 2EDYA 3MV7E 2IWGA 4L8SB 1KPRB 1SEQH 4Y5XC 2CLZA 4NO0A 2XTJD 3DXAA 1DSFL 3P4LA 4POUB 2CXGA 4HXBL 1Q38A 2RQ8A 3QQ3B 5CEXA 1S9YA 4IDLA 1KYOJ 4KAQH 1K6QL 2E7MA 1OWRM 3QXDB 3ZDXE 2AKRB 3GZKA 1U3HA 4QRTA 1P1ZA 5F7LB 4K9EC 3TYFB 4XCYA 5I16B 4EDWH 1WFOA 4K7PH 5AYUL 4DZ8A 4N8VG 3X12B 1LO5A 5KJRH 3N85H 4L8CB 3SKUD 4FXGA 4Z7NF 1E4XL 5IVXB 1YY8A 3CDYA 1LE9B 5DK3A 3ARDD 1T1ZB 3PWJA 1FVCB 3KPMB 4LSTH 4JN1H 2HT4C 3REVB 3RTQC 3T1FB 1T3FB 3TZVB 1FG2B 2IH1B 3RGVD 3CZJA 5KSBB 3NFPB 4WEMB 1PZUB 5I1IL 4JCMA 2E9JA 5EU6B 2C4FU 2CRZA 1TZHA 3N06B 1BJ8A 3QIUA 3HI5L 3SDXF 3IFOB 1BQSA 5IW6B 3IKKA 2DI8A 3WDJA 4HIXH 2XICA 5IB5B 5CJOL 2IAND 3NVQA 1D6EA 4UQ2A 1PX3A 1ONQB 3DX9A 4J1UB 1RULH 4EI6B 3NCMA 2VZUA 3ABZA 4TSAH 3TVMD 4JQVA 3NTCH 5E00B 1AJ7H 3TCXA 2UWEE 1HH6A 1S5HB 5KBNC 1OAYH 1ORSA 1Y6KR 4R2GB 1MHEA 5FK9A 1I1RA 2AJVL 2VSCA 4YLQT 5IBTL 1R5IB 4DN3H 4QNPE 5DWUL 1IGML 5IWLC 2LU3A 4I18C 1XGTA 4XWOD 4MDIA 3MBEB 5J13B 4V1DE 1CI5A 4G6FB 3TJEH 3VRIB 3MJ8A 3K4AA 1Z6JT 2ADGA 5HYSB 5TDOA 3UTSD 4PJ5D 1W0VA 4IRZH 2BRRL 1IC5L 2Q3ZA 5IB3B 1NL0L 2H41A 2G60H 3VE0B 3X3GH 1NUDA 1JHLH 3WIHL 1JF1A 1KLGB 1IQWL 5TE6L 1BOYA 3SCMB 1IGIH 3EOAA 2Q8AH 3BPNB 5J0BA 2OP4H 4PB0H 4JPVH 3CLEL 2VLLA 4G7VH 1NLBH 4UV4L 2JELL 3STLA 3B9EA 2HMID 3MLRL 2Z31B 4NDMB 4P59L 5DHYB 3O3AB 5EU4A 3BFOA 4JLRA 3EW3B 1MCJA 2CXKA 4FZ8H 2M8XA 5ICZA 1NANH 3B5HA 2WZPD 5HY9B 5B39B 2XIDA 1HCVA 1Z3GH 2EDKA 4A6YL 2VDLL 5DT1L 3MLUH 5FGBA 3UJTH 1OM3L 1I9IH 1YNTA 5CILH 1YMMA 2X05A 3HC0A 2ADFH 5IMOA 1H5BC 5KAQG 5ESAA 1PW3A 4AEHL 1OGAD 4RAUB 3W9EB 5HHPB 2LVEA 2B8OT 3OXSB 2CUMA 4PLKD 3S96A 4OCXL 3CMOL 5CHNA 5GS0C 4P5KA 1T2JA 3HZMB 4JO1L 3WFCL 3P30H 3FQWA 4LIQL 4GRLB 3QRGL 2W9EH 2R69H 4F2MA 1I1YB 4I0PA 3EOBB 4LPYA 5TE7L 1MHHB 4YHYB 5C0BD 3SO5A 1FLRL 4HJGA 2UV3A 3IJSB 4D9RD 4TTDC 3D0VB 3O6ML 2GCYA 1RK0A 1DBAL 3TT1H 2EDJA 4ODVH 2HRPL 3LKQB 3MFFB 4P4KB 1OSPH 4UIKH 4EN3A 1AHWC 5HGDB 2P5EB 3ZLQC 4OFDA 6FABL 1XF3B 4IM8A 1BGXL 4QRUB 3NCYP 3ZMRA 5DD5H 5J6GA 2APBA 2A6DA 1MCEA 2X7LA 4PRPA 1JV5A 1QLEL 4KKBC 5AYQA 4X7TB 1DQJB 1FL3A 2WWMC 2E7LC 2NY6B 5F70A 4ZUVB 2GK0B 3QUMA 1GYAA 2A9NL 2OM5A 1BMGA 5ESVB 5L6YH 1T89A 5IBUG 1AXSA 2XTJB 4ELMB 1RHFA 1TZGH 1KEMH 1I8IB 2IPTL 1RVFH 2X41A 3BMVA 5TDNA 5JO5B 3SJVA 1QSZA 5AD0B 2BMKA 3ZE2F 1NEUA 3VMNA 3VDAA 4JHAL 3MR9A 4NO3B 4HIEA 4I48B 1AR1D 3CDGB 3D2UA 1T66D 1JZ3A 5FIEA 5IFHH 1WIPA 4MSWA 4Z7OF 2AGJL 1NAMH 4Z7VE 4N0UA 4XMLL 1RZ7L 4YHML 3D87B 4QRRD 4MCZA 5BXFA 3ARDB 3SDAB 1MEXL 3WLWC 1CD1B 5GPRA 3CSGA 2FEEL 2AW2A 1J8HE 4FFWC 5HYJB 1T0MB 2AK4E 3RGVB 4HLZG 5MI0C 4U6XA 2CRMA 1YEJH 2YPLD 5I1CL 3S37L 4X6EB 3OZ9L 4Q9QL 1RUAL 4WU7B 3F7YA 1Q9WA 2DRUA 4CVXB 4HW6A 4U3HA 2IANB 4JCLA 4R0LB 3HE6C 4HZLA 5D7IA 1HSAA 3QAZC 2QQLL 3EYFB 4XCCL 2WBKA 2KQNA 1T7ZA 2ED8A 3HCVA 3VG9C 3TVMB 2V5MA 4GAJH 1ZS8B 1UWEL 3GMRA 1FO0A 1UZ8B 1MCQA 3LKSA 4MMZC 4U1GC 1WBZB 4KZEH 1IZJA 3CK0H 4QGTA 3X14A 3U6RA 4GSDL 4CVWA 1FFPA 1R5WA 1QVOB 1ULVA 2DKUA 4N1CA 2OTWA 4M4RA 3WHXA 1AGCB 3P9MA 3MCKB 3J8F7 3T0ED 3LVEA 3IDYB 5IR1A 4Y0GA 3V0VB 4XC3H 4PJ5B 3GHEH 2HFEB 3G6JB 1BWMA 1P2CA 2BHUA 3F6LA 2MCPL 1DE4A 2XG5A 5EC2B 4LCUA 5TF1H 2V7NA 5E5MA 4XXCA 4HIJA 1UM5H 1RZJH 1ACYL 3MRRA 2F74B 4QO1A 5GZNC 1YJDC 3WHE0 1U93B 2Y07L 3B8SA 4S2SB 4KVCH 4IS6A 4ONHA 4QWWD 1Y18B 1LEGB 1YEFH 3LQAC 2H6PA 2B4CH 3T4YB 5I6XB 1MWAL 4PJEA 3KPSA 5JOFB 2XXCB 3U83A 4G9FA 3LPWA 2BOCA 5AWNL 3T2PA 5SX4I 3TT3L 1WCQA 2D9CA 4CUCA 4ZFOB 3DVNB 2V7HA 3RQ3A 2LV4A 5E8EB 1ZANL 5GJTH 4RMTA 3QCUL 4KV5E 3RWJB 2X4NA 1YEEH 4O02H 5F97E 1QLRB 3EFFB 3JVGC 4LVOC 1RJYA 2DJUA 5L9DL 3QG7L 1OGAB 1J05A 1DFBH 4G8IA 4NNXA 3VXTA 4XVUD 4P46B 3SKNB 2FBOJ 5HHOE 5IQ7L 1OP3K 5IBLD 2HKHH 2PNDA 2R23A 4MAYB 4N5EC 3DYPA 4XHQA 2EDRA 4XAKD 5EO0B 3OG4B 5C9JA 3ZKSD 1OF2B 3FFCE 4YXHL 4PV9B 5TF0A 4M48H 3PP3H 3VXME 2B1AL 3ULVH 3LKNA 3ILPB 3FO1B 4AM0A 2E8ZA 4ZNEA 2R4SH 4Y5YB 3O8XC 4I9WD 4KRPC 5GGSA 5C0BB 3BQUA 3SE4A 1W72B 5JPNA 4R4FL 1DVFA 1BHGA 1A6PA 1E4KA 1S7XA 2Q6WA 1WJ3A 1IAII 5KS9A 3GDBA 2BY2A 2CDEB 2YSSB 4ZTOL 3ZDYF 2FEDC 4ZOAA 2EIEA 4G7YH 3WS3A 1U92A 3QWOB 5FYKU 2BSSB 5IROA 1JWMA 1WEJH 4HG4J 4JKWA 4DTGH 3JZ7A 5TE4L 4G3YL 2BC4B 5AUMA 5GGVL 2OMNA 2CUIA 2PYEE 2XN9A 5SWSD 1LO2L 1JTTA 3KJ4C 3HN3A 4W70A 1RJCA 1IGTA 3RVUC 1DLHA 3I50H 3GK8L 3TWCL 2NPLX 3PL6D 2VXSL 4L4VA 3TIDB 3PDOA 4LDEB 2VKXA 1J0KA 4GQPH 2YD3A 4NQVB 4URTB 1UH4A 2DTSA 1DSFH 1X6LA 4ZFZB 4HXBH 3ZT7A 1X5JA 1K6QH 3JTSB 3NN8A 4I4WA 1QEWB 3RWCA 4PRBB 5M94B 3MUJA 3WJLA 4DK6A 4ZAKD 4Q2ZB 1KBGL 5DQ9A 4QRRB 1WFNA 1I8KA 5AYUH 5FYLE 3LY6A 1I1AD 3MRIA 2XTLA 4F7MA 1VPOL 3HNTL 5DRZB 3TNNA 1PQZA 3HTLX 3ZKQD 1KB5L 3A6BL 1E4XH 4L9LC 4GG6F 1Q0YL 3LN4A 1HHKA 5KW9L 1CFSA 2DLFL 3TO4B 1BFOB 2YPLB 1IMHC 3MGOB 1HWGB 5JOPD 4UQ3A 2QSTA 4B41A 1O7SA 1I7TB 5KTEH 3S3SA 3WO4B 4YHIA 5IG7B 2AABL 3CDCA 2GUOA 1DBMH 4J8RA 3RUGB 3AXLB 1M05B 1SYSB 1CS6A 3QQ9C 4C58B 3HI5H 1T5XB 4RNRA 1CGVA 3TBTA 3QUKB 5GSRB 5CJOH 2JF1A 4OKVB 4Z77B 2HT2C 4JY5L 5KVFL 4NPYA 3MRFB 3ROOB 2IEPA 2BRQA 3AMKA 1MHCB 3WN5B 3C6SA 3GMLA 2G9HB 2DDQL 2ICEA 2VZOA 3RVTC 2V5RA 4JZJC 3I85A 1HWHB 2FSEB 3T0EB 3IDNA 2AJVH 1XR8A 5IBTH 2WIIA 5DWUH 4JO2L 1IGMH 3WEXB 3S7GA 1IM3A 3LQAL 1PYWA 2F8XC 3QEUB 5J12C 2VERN 3TBYA 3M8OL 1H3WM 2NW3A 3L6FA 3HRZA 4Z7QF 4CU8A 2BRRH 1U8JB 2OK0H 1NL0H 4IOIA 5FA4B 1RQ5A 2J1KA 3IAQA 3RWIB 3QRFM