5J89A

Structure of human programmed cell death 1 ligand 1 (pd-l1) with low molecular mass inhibitor
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
127
structure length
127
Chain Sequence
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAALEHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Programmed cell death 1 ligand 1
publication title Structural basis for small molecule targeting of the programmed death ligand 1 (PD-L1).
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 127
sequence length 127
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 5j89A00
3CMGA 25C8L 2XV6B 3VCLA 1IAII 3ZT5A 1G7MA 2OL3A 2QKIA 4O2FB 3QJHA 1KF9B 5F3BB 1D9KC 4KROC 2ATKB 5F7NC 4MXVF 1GGYA 1A2YA 1RUPL 1F3DJ 3OZ9L 4LSQH 2PR4H 5AWNH 1JPFA 2ZCLL 3BGMA 1I8LA 2C26A 5DF0A 1JHTA 3D3VA 3T77A 3U2SA 3FJTA 4JFZL 4FQQA 3VRJB 1WK0A 1MPAL 4FXKA 4MWFB 2JF1A 3UTZB 4P9ML 3ULUL 3QPQD 4V1DA 4YHLL 2I60H 2VERN 2VDRL 4RDQF 1ZLSL 1ZWIB 2H2PD 3MRIA 2XKNB 3OX8B 5L9DH 1F90L 5KVDH 2R0KH 3VFUB 2X4PB 4NQSA 4QXTB 1VGKA 1RK0A 2L7JA 1MFDL 4UINH 2Q7YB 3QIUC 1I1AC 3V8OA 2X09A 4U1HA 2C3VA 3FO2A 3R06A 1FSKB 5JPNA 2DS4A 32C2B 2L7UA 4WHTB 5DUMH 5LKNA 1L0XA 3KYKL 3C2AH 4NRZB 4HC1A 4TVPL 2H32H 5HJ3A 4CNIB 1OQXA 2EXWD 3HZVB 2PW1B 3FFCB 3DETD 3CDYA 1CLOL 4OKVA 2ADFH 3WHXB 4U4BA 2RR3A 5EU3A 2IH3A 4BKLA 3OTTA 1AJ7H 3I3BA 5TE4L 1WFNA 2YXMA 1IGJB 1TNNA 3M8OL 2RBLA 3IJHA 3X17A 4BUGA 3T0XA 4OLEA 4HK0A 5IKCA 4A2LA 1U93A 1M6OB 3SOBL 3MLTB 2GFBA 4MLSA 4RNRA 3PWLA 1DUYB 4NQED 4LLQB 1RMFL 3RTQA 5KJRL 2PTUA 2VQTA 3U48A 4RBPK 3KXFD 1DFBH 2VLRB 4I0PB 1AGFB 4OCWH 5GGUB 1WZMA 2QSTA 2JJTC 4LIQL 3VWJB 4JY5H 5IB2B 2UY6A 1UXSA 4RZCA 4LLVB 1MFEL 3ROLB 3SO5A 3LRSA 3HI5H 5FDWB 1T5XB 5I1DA 3BN3B 4GG6F 5BOZG 2LVCA 1QEWA 1SM3L 4OAWB 2X4SB 5ICXB 4C56A 4NWTH 3CPLB 3T3PE 1VADB 4TRPH 3VGFA 2VNCA 3JVGC 4UTBH 1TCRB 1IT9H 3QPXH 4NQXA 1AIFB 3BJLA 1E6OL 3B43A 5D1QB 2DQCH 2YPLE 4OLXL 1NC2B 4K55A 4ZS6D 1H5BC 3DV6A 4PJIE 4F7CB 1BOGB 4M93B 2O93L 1KT2B 2I07B 1YEGL 1V3KA 5D7KD 1IGYA 2DLTA 4A2MA 4MJ6B 4CU6A 2CLZA 3DROA 4HH9A 4KUCD 4LSDA 2OCFD 1C7TA 2Y9RT 3QUXD 4I0KA 3N85L 1LK2A 4J3SA 5KG9B 4M3JA 2DDQL 2X4NB 4WUKL 1JV5B 4OM0H 2A9ML 4HIIA 3EJZC 4DCQA 4WDIA 4Y5YC 5C0AB 3LEYL 5D4QA 1MI5A 4S1SL 4WU5B 2JB5H 4IMLB 4PP1D 1ITCA 4LSVH 1FFPB 2BSSA 1U3ZA 5I75C 1J8HD 2ICEA 4XPBH 1JL8A 3V52H 1K85A 5CBAA 1DN0A 1HDMB 4NO5B 5ANMB 3KJ6L 3BO8B 3D87B 4FQXA 4KAQL 4DVBA 2JCCB 4ODTH 1S7TA 4PLJD 5FA4A 4AENB 3VGBA 1XAUA 5DJXA 3G9AB 1C5BL 1AO7A 5AYQA 1GHFL 3RJDA 4YZFE 3MPCA 4F7MB 3H3PL 3S34L 5KTEH 1AQDA 3FFCE 5E8DL 4NP4H 1RI8A 2R2HB 1P1ZB 1ZXQA 4JFEA 2PO6D 3R1GL 1VFBB 1F4YH 1B0RB 2NW2B 4MA7L 3KPOA 3HE7D 5DK2B 1L7IH 1OT2A 2EEBA 4O02L 1ZANH 5KVGH 2Q86A 3QG7L 1Z3GH 4MJ5A 4ZO6A 2QHLA 5GHWH 3S96A 3WFDL 3LKSA 3OMZA 4LVEA 1MWAA 1OGAD 3D0VA 4AT6A 1ES0B 2VLRE 2BNRD 4YR6B 4DZ8B 4PRHA 5FB8A 5E2WL 4C83B 4EOWH 2XKUA 4XNXL 1ACYL 4MNGA 3VI3E 2IAMD 4LGPB 1H8SA 4PJCB 5HYSA 1BAFH 4G9FB 5MERA 3LQAC 5I76B 4L8BB 5I6XB 1PFCA 1LE9B 5E94A 1BWMA 4JFPB 1OAUH 1KXTB 1ZVSB 3QRFM 2BZDA 4R26L 1TQCB 1ZLVH 2NY0C 1BEYH 5IEKA 4XWOD 4PJEB 3ARBC 1ZTXL 5EULV 5C71A 5MEOB 5LQBH 3EJYD 1EZVY 1OSPH 5ESQB 2J12B 1PKQA 1F4XL 4N0FB 2Y07L 4LEOA 1LEKB 1ZV5A 1HHIA 4LRIA 1ONQA 4Y88A 3TBYB 4RIRA 1N59B 4R4NC 5E2UL 2JK5A 1CICA 3BPOB 3CXHJ 3L3DA 3FAWA 5C8JB 1ACZA 4L3CA 5I1HL 4OZHA 2K9UA 4F2MA 4OFPA 4CVXB 2DLFH 1HSBB 1FDLH 3B9KC 1AH1A 3WD5H 4UUJB 3DMMA 3MJ7B 4XVTL 1GGBH 4JR9L 4NM8L 2J2ZA 1G7QA 2J4WL 4J7RA 4QRQB 1KIQA 4K3EH 4HHAA 5DXWA 3SDXF 5JDSB 4LCWD 1AHWC 2AERT 3WEXA 2Z31B 2H3NB 5ESVB 4L3EA 1B6UA 4AMKL 5CJQH 5D7IB 1GPOH 1GZPA 4J1UA 2VDLH 3REWA 1GGIL 3DPBA 5EIIB 5ID1B 4NOFA 4GQ9H 4X6FB 1TTGA 2YHGA 1A47A 5I9QC 2ZOLA 3V0VA 3OKYA 3U4BH 2RFXB 5JW3H 2AK4D 4R7DA 5LG1A 1RIHH 2ADJA 3HAEB 5HI3C 4F7TB 2JCCE 3WLWD 4O9HH 2W9LA 1QYGL 3NCJL 1JF1A 5DWUL 4U1MA 4QHMB 3SKOB 2AQ2A 2OMNA 3V6FA 4NZUH 4XXCC 1T0NB 2W60A 3WIHH 2PTVA 3MO1B 1J1PL 1NCDH 4PJGA 4ZUSB 5KSAA 1F42A 3GJEB 3UTTD 4HBCL 3REVA 4Q9RH 4B53A 1A6WH 4P9HH 1A3RL 4PJ9D 4NUJA 3TV3H 1FN4A 4ONGL 4RSVA 5F9DC 3VXNB 4RAUB 5EU5A 1YA5A 5DZOA 1QACA 4ODHH 4HS6B 5DUPH 1GGCL 2AABL 4HIXH 5FUOL 5IB5A 1G7HA 1ND0A 2HYMA 4GBXD 3FQRA 4ELMA 3QJFA 3QO1B 4NJAL 5ICYB 3WMSA 1MCSA 4MJ4A 4JPIB 4KDTA 5H35A 3ULVC 4OQ1A 2BMKA 2P8MA 3P9MA 3U4EA 5C09A 1BIIB 3MRKB 3D9AH 2FECI 3VRLF 4Z7WA 4FG6D 4QHNB 1CFSA 2R29L 3KXFB 3GSNA 5GIRB 4HS8L 2WWMC 1GRWA 4PJCE 1LP9A 4G9FE 1MVFA 1P9MA 1F3JA 1MLCA 5FUCC 3QB7C 5KVFL 4CN6A 3MACL 4BZ1H 1HH6A 4F3FB 4X4YA 1L0QA 3JV6A 1KG0B 4IMKA 1OTSC 1GL4B 2VAAB 1ZOXA 5F71A 4CDGC 5E00B 2I26N 4GUPA 4PJEE 1KELH 2YK1H 1XGRA 3QEUB 4FFWD 3O3UN 4P2YA 3SE9H 3MRFA 3T65B 2FX8L 2OTUB 3ZTNH 3QCVH 5C08D 4BH8B 2R8SL 1OAXH 1L9MA 4HS3A 4M8QA 4YXLL 5CBEB 1IQDA 3HR5A 1QQDB 2FB4H 3FN3A 3LIZH 5HTSA 4L8SB 5LGHL 5I1KH 2C4XA 3DECA 1FZKA 2X5PA 5DT1L 1AP2B 3C60D 4WTWA 2AEPL 3CCHB 2E7MA 2EDRA 4G42A 1SEQH 2OYPA 1RUKH 3J8F7 5ACZB 3WIIL 3T0ED 5GGTH 4NRXB 3MGAA 4XNZB 5E9DB 1J88A 1K8DA 4GS7B 3TF7C 3S36H 3HG1B 3QH3B 4O5LL 1WWAX 1G6RA 3RZCC 4UOW0 1ZE3C 3GRWH 2C9AA 2YN3A 1BF8A 1JTTA 2G2RB 4RQQB 4LSUH 4X4ME 5D2NC 4GKZB 4RMQA 5EN2A 1RUMH 1IAIL 3GK8H 3HPJB 3DYMA 4DKFH 4N9OB 3LEXA 4YFEA 2R2BB 2ZPKH 3H9SB 3KJ4B 4XP4L 3SPVB 5IBLD 5TDOA 3VFMB 5CJBA 3ARSA 4QF1B 3ZSSA 4BFIA 1HHKA 3U0TB 1NMAH 3UXFA 1FZJB 1M7DB 3GMOB 2BHUA 3GNMH 1VFMA 1ZLUH 3K80A 4MJ2A 4XHJC 4PR5B 2CUMA 4CJ1A 4Y2DD 3PF2A 1LK3L 1NAML 4QT5B 5IQ9A 4OB5H 3PHQB 2DMKA 4PJ7A 2VC2H 1KYOJ 3HE7B 4QHKJ 5KVEH 3HA0A 1HZHL 4UIKL 5CS7A 1A9EB 5A3ID 4NQEE 5D9SB 5E5MA 4YHOH 3KXFE 2AXGA 2XQBH 2Q8BH 1P84K 1O7VA 3EOBB 2JLLA 4HFWB 1K8IA 4KJPC 4MD5A 2IAMB 3DJ9A 4JE4B 2MNUA 2E7LA 2AK1H 4Q7DA 5DR5L 2FL5A 4JFDA 3IDXL 3QCUH 3CFCH 3QXUA 2HFEB 1KEMH 1MAML 3PGFH 4D3CH 4HWEH 3B2UD 5HGHA 1MRFH 1XH3A 4U1SB 3C9NB 1DLHB 2QR0B 3BPNC 4M7JH 4PP2A 1IC5H 4LKXB 3BN9C 1UWEL 3DX9B 1WCBA 1M05B 2BK8A 5K33A 1IAOA 1R3LA 5KANG 4AEIH 3TIEB 3GMLA 5JOFB 3OKOB 2W0FA 2BNUA 4JHBA 1CICC 2A74B 1U92A 4D0DB 1JGVL 5K9KA 4Z7QF 5D7KE 3T08A 3ARXA 4KI1A 1WAAE 4G6KL 1IGTB 3QAZC 4IRSC 1F8TH 5F7FA 4Y16A 4PRPD 1ORQB 5C0GA 3C5ZB 1G1YA 4NBZB 3RL2A 2ICWB 4GG6B 1XF4B 3VXTA 5FCUL 2CLVA 2W0LA 3OAUL 2AV7B 3MLZH 3O6FA 1KFAL 3TO4A 2GJZA 2EC8A 5IB1A 1OP5K 3NCEB 4NO2B 5E9DE 5KW9L 3ARQA 3BP7B 4AIZB 2D0GA 3I9GH 5FYLD 2A77L 3Q6GL 4KMLB 3O0RH 3RRQA 5DHYA 2NZ9C 2ZUQC 3JZ7A 1EBPA 4PJ5D 4ZS7L 5T1LA 4I0CC 4XNUL 5MEPA 4UILH 3M07A 1WFTA 2K1MA 3HI6H 2AJUL 1DBML 1MIEH 1J86A 2AJZA 1J8HE 2FIRT 3IKKA 3LHPH 4HLZH 1DANU 2NXYC 4MA3B 2QQNL 4ZUTB 2F8XC 2MFNA 4XH2A 1FNEA 2P24B 3LQMA 3T3MF 2MJWA 1T66C 2AK4B 2MQ3A 5ALCL 4KC3B 5IHZA 1CDGA 5IK3B 3MBXH 3MLSH 3NAAL 3P9WB 3MJ8B 3QEHA 4G8EA 3WFZA 1FPTH 3H9SE 3T4AB 3GSQA 1YECL 3W0WA 2OMBA 4IRJD 4U7MA 4LBEA 4JFHD 3VGGA 1XGQA 4YPGB 5TDPA 4ZFOB 3SDYL 3O3EA 2HJFB 4UV7H 3UTTB 1T4KB 3FQXA 3MV8A 2DQFB 3HNTL 3MRBA 5GGQL 2XT1B 4PJ9B 1F3DH 5EO0B 3DUSB 4P4KD 1WT5C 1KJMA 5I17B 1BVLB 4QYOA 3OB0H 4C54A 3CUPB 3O4LA 4OGAC 1NGZB 1N0XH 4JRXB 2DQDH 4GBXB 4KDTC 1XGYL 4CL7A 1AY1H 5GRUL 5AZEL 4WU7A 6CGTA 1NGXB 5JO5B 4JQVC 2Q8AH 3AY4A 3PP4L 4XBEL 4IS6B 1TVHA 5E99L 2VDOH 1OGAE 4YQXL 4UT7H 3S35H 3DV4A 3NVQA 5F3BA 1AKJA 3LS5L 2BNRE 3L5XH 5DUBA 3C5JA 1L7TH 1P9MC 1XCQA 1BM3H 3F6LA 4GQPH 1PW3A 1X5XA 5FYJH 4HPYL 3NTCL 4LHUG 1EUUA 1QRKA 5J1TC 3KPLA 3UTZA 3P77B 1I1YA 3OKNB 1J87A 4WV1B 1ZWIA 4OD1L 5FHBH 2NY4B 3OV6A 1SJXA 1MCJA 2O5ZH 2XKNA 3OX8A 1K2DA 3VFUA 3RWGA 4M7LL 2FBOJ 2VISB 4GKSB 2IBGA 5C08B 3P0GB 1RIVL 2Q7YA 3SGJC 2J6EA 5D1XA 3IXAB 4UAOC 2AI0H 4XXDB 1EJ6A 1AE6L 32C2A 5FAAA 1JP5A 4WHTA 1DVFA 4ALAL 3IDNB 3VGAC 4NRZA 5JXEC 1FVCB 2E9JA 3TT1H 4CNIA 1T2QL 4ZXBD 3VG0H 3C5SB 4XVUC 1OW0C 1KPVB 2NTSP 3T0EB 2V17H 1HXYB 4H25B 4YGVA 4EN3B 3K2UH 1NLBL 2MPAL 1PSKH 5DYOB 4MB4A 2W9DL 4LCWE 1JN6A 3O6LL 4NZRH 3CNKA 3EYSL 1IGJA 5I15H 1DDHA 4K9EC 3FB6B 4AYFA 1QFUH 1A6TB 2MHAB 5F96L 3MLTA 4PG2A 5CP7A 1DUYA 4LLQA 2D7TH 4KKBD 4TSAL 1Y6KR 1FG9C 2WWKO 1YC7A 3H3KA 4YDVB 3VXOB 1EAJA 3K3QA 2AK4E 4LCUB 4Y4HC 2DD8L 5EBLB 1DEEB 3G04B 5FIEA 5E4IA 2HVKB 5IB2A 2OK0H 4ZODA 5IGXH 2W65A 5CUSH 4RAHA 2ADGB 2VLLB 3ROLA 5FDWA 3LQZB 1ZLWH 5D96B 3NABL 4KHXL 2X6MA 1T2XA 3CH1B 3T2QA 2XACC 3DARA 3WJJA 5I2IB 4EDXB 5ICXA 2X4SA 5FHAL 2VDQH 3UTTE 4LGSB 5J57B 5J3HC 2HT2D 2IQ9L 1P4IH 1HEZA 4R0LC 2GAZB 1AIFA 2P8LB 5D1QA 2M2DA 2CDFA 4F57L 2VTFA 2UZYB 1Q0XH 1NC2A 3KWWB 2KL6A 4HV8B 4OIIL 1BOGA 3OPZL 1KT2A 3GBLA 2I07A 3D25B 3HZMA 3SKJH 3IU4L 5DEFB 3RDTC 4LLYB 4LVHC 5GZND 4E5XB 5KG9A 3KPMB 3B6SB 3MNZB 1ZSDB 2X4NA 1JV5A 5D7JC 5FUZL 3MBED 3RVVC 2EYSB 2AXHA 1V7NL 1MCRA 4BYHA 5C0AA 4L5FL 5GRYA 5D6CB 3PL6C 2D2OA 3SKNB 2H32A 1CZ8L 2R0LH 4NKIL 3BUYB 4HWBH 4WU5A 3TBWA 4B50A 3QNYA 3VMPA 4LAQL 2C5DC 2GT9B 5DJYB 4KZEH 4KJQD 5A40E 5J1SC 2NY2D 4LEXL 4XCYA 1H8OA 5C08E 4NO5A 4ERSH 5GS1B 5ANMA 4JG0L 4WW1B 4I4WB 4NNXA 1Q0YH 2JCCA 3BUTA 5TF1H 1F3RB 2LU7A 4R7NB 4AENA 2XRAL 3FO9B 3HC4H 4KDWA 4PRPB 1A7QH 4ZUUA 1AQKH 1EFXB 3BSZH 3OJDA 4JM2A 1A6PA 4JPKL 4MA8L 4WI8A 5SWZA 4J3OC 2NY3C 2DBLL 3MXWH 5C9KA 4XMKL 2NYYD 5CHNA 1FIGL 1YEHH 2HRPH 2J1KA 3TVMD 2R2HA 3T0EE 1JHLH 1P1ZA 3MR9B 3RWJB 3VD7A 5I8KL 5L7XL 4PTTB 4UV4L 3EO0B 1VFBA 3TCLB 5E95B 4PUBL 4Z77B 4JO2L 2A6JB 5DK2A 2VDKH 3BP4B 4PJ5B 4K8RL 3OXSB 2FATL 4XAWL 5H2BA 4TUOB 4ZTOL 1BQLH 2R9HC 3T4YA 3CFDB 3TJEL 1NLDH 5HVWA 2IPUK 2OTWB 4M6OL 3U9PL 1ES0A 4LDOB 2VMFA 4YR6A 2UUDH 5IQ7H 1M71B 2H26B 4J3WA 4C83A 4M6NH 4PJCA 5C0BD 4G9FA 4QXUL 5I76A 3VFNB 3GSOB 2XWTB 4HF5L 3V5DB 1S7WA 1UQSA 3MCLL 2VLJA 4MLIA 3SDXE 5IP4A 4JFPA 4LL9A 4NSKB 4X8JB 1ZVSA 5H37H 2HT3D 5D7LD 3WN5B 1MHPL 2DQIL 4D9LH 2VN7A 5CWSB 2XN9D 1C1EH 5HDQL 1NCAL 2YUVA 4PJEA 2NZIA 5FYKL 5MEOA 3RPKA 3UC0L 5LCVL 5BVJB 5MI0B 1IEBB 2EC9T 1AGEA 4N0FA 4MSWB 1LEKA 4LCYA 2R4SL 5FGSA 1IC7L 5C3TA 2OR9H 3TBYA 1E6JH 2FSEB 2FX9H 2ERJB 1N59A 4KXZH 4ZFGL 3AY4C 4DN3L 5E6ID 3L95A 4HFUL 2ORBH 4NHCH 4OLYL 3EOAA 4IDJH 3WUWB 4CVXA 2C3GA 1HSBA 4J6RL 1E4XI 2KZWA 5HHOD 1FAIL 3MJ7A 2OR8A 4LHUA 4G43B 1BPVA 4K7PX 2GTZB 3FAXA 4QRQA 4WEUD 3N50A 3QUML 2I9LA 1UWGL 2KDGA 3U46B 4DKEL 2Z31A 2H3NA 4GRWF 3HKFA 3MRHB 3CDCA 2EDDA 5ESVA 2OP4L 3EGSB 1FORL 2CPCA 1CI5A 1CXKA 5D7IA 5JTWA 5KS9F 3AREA 1Q72L 2IFFL 1MH5B 2P45B 1IAMA 5F1NB 5BVPH 2JJSC 1LO0L 3VRLE 4QWWD 1IC1A 4F7TA 1YEIL 5IESH 3IXTB 1UKTA 3G9VA 2BNQD 4RGMB 1PLGH 1FSKC 3V6ZB 2YWYA 5CP3H 3W9DB 4R8WL 1F02I 4FQJH 4ODBD 3FB7B 4QHMA 3SKOA 3U7YH 4L9LB 1T0NA 4PRPE 4NYLA 4I77H 1GXEA 5TDNB 2HTLC 2DL9A 4ZUVB 4ZUSA 3AFLA 3CVHB 3GJEA 5EFIB 3RL1A 2PW2B 2BVPB 5I1LB 3FT4B 1NCUA 2CIKB 5TPWH 3RVWC 4GMTH 4OM1L 4HGWB 4U6VL 4WO4A 2FYYA 3UPAA 4BH7B 3T2PA 3DSFL 4JKKA 3VXNA 4CGTA 1UEMA 5FYLE 1E0OB 4F58L 4Z7VE 4YBQC 5JDJA 3H42L 4LHQB 2R0ZL 1R5WA 3VXPB 5DMKB 4PJ5E 5ICYA 4JPIA 1FV1B 3K1DA 3FT2B 3BE1L 3KPSD 4IRZH 2QQKL 2H8PB 3ZKNC 4DVRH 4I0PC 1CE1H 5JW4R 4NT6B 5DJAB 1FH5H 4APQB 5HHPA 4QHNA 1S78D 2EO9A 3VWJC 3KXFA 5DJ6B 4P59H 4NN5C 4PRDB 1CQKA 1N0LA 4GG8B 5DJ8B 4P48A 4UIMB 1CDYA 4JFHE 1FE8L 4OLZH 4PV9B 2EIEA 2VAAA 5DA0B 5E00A 4LSPH 4AIOA 5IB4B 1RZKL 2YSSB 3PJSB 2UZIH 2CKBH 3T65A 1X4XA 4IOIA 2OTUA 3LKPB 2ATPB 4M93C 1T89C 2ZJSH 1SBSL 4BH8A 3KG5A 4Q0XL 5IW3A 3FRUB 5IHUL 4JHZA 5FA3A 5IMOB 4XMPL 7FABH 1QQDA 4EDWH 2DM4A 5CCKL 5I1IH 2BERA 3WBDA 1S7XB 5GS0H 4LVNB 5ENWA 1YN6B 4UT6L 3MGOB 4HLZG 4XPTL 5I66B 4WCYL 3U1SL 3RAJH 3CSPA 3MV01 1DQJA 2OL3L 2HFGH 4MAYD 3CCHA 4PJAA 1F11A 5HHXL 3WSQL 5DD1H 1CDUA 4XMLH 3WIHA 4FABL 4RGNB 2VRAA 5E9DA 4N5UA 5HGDA 3W2DH 2XI9A 4K7PL 3IFOB 1KN4H 3ALPA 3HG1A 3QH3A 3DHMA 2CKNA 4X6EB 4EI5C 3ARWA 5J8OA 3AU1A 1MFCH 2ZCKL 2YMXH 4N9GB 5L8KB 5D93C 4CU7A 4TTGA 2IALB 5KSVB 3V5KB 1U3YA 2G2RA 2A0LD 4NZJA 4ZYKA 1ZHBB 2NY2B 3NCMA 2R2BA 3OKMB 3WXWH 5DD0H 1NUGA 3H9SA 3CLFH 4J3UA 2AV1A 3SPVA 4BQBA 1RZJH 1F4WH 2BC4B 4QF1A 2J88H 2FX7L 1I7TB 4YDJB 3U0TA 1FZJA 4E0RA 4M1GH 3GMOA 4TOYL 5B38G 5A2LH 4HC1L 4EI6B 2UZXB 3IKCB 4N90E 5EOQL 3IDIB 4BA8A 1TTFA 2P7TB 3BQUA 4PR5A 1FYTD 4LPUA 3MODL 3T2NL 2LTQB 5DJZB 3VA2C 1DQDL 4YDKH 2B1HL 4K2UL 4M4PA 4OI7A 1MEXH 3PHQA 5T3ZH 4XX1G 4R2GB 2CDEB 4Z7QE 3BKMH 5IJKA 4YXHL 1QR4A 5GZOC 3CVIH 5DT1H 5HI4C 5F7EL 4IM8A 3O3BB 1ZS8B 1AGDB 1A9EA 4EBQH 1KULA 3CH8A 3ULVL 4KUZH 4N8PA 1FRGH 1MCLA 3C08H 4GAGH 3EOBA 3VGDA 3CSYB 1OTTD 5A16B 1INQB 5ISZB 4QNPF 1F58H 3GI9H 5I6XC 3EYUH 2EH8L 2VJXA 4WTZG 1MAKA 3D18A 3NZHH 1YJDC 1KCUH 2AJ3A 1EK3A 1TQCC 1GIGH 2DYPD 2HFEA 1J18A 2DOCA 5GGTA 1E27A 1KJ2H 3GBNH 3KPQB 3UTPD 1WGOA 5IBTH 3AUVA 4U1SA 5FO8B 2XN9B 1DQLH 1DLHA 3C9NA 2QR0A 3PGDA 2DQEH 4LKXA 1Y6MR 4OD2B 3DX9A 5DJDB 3TIEA 4GRLC 3QZWB 3GRWA 4HUUB 1WTGT 3LPFA 1G9ML 5JOFA 1RPQA 3T3ME 4D0DA 1NC4B 1ZGLM 2CRZA 2BOBB 3BPOC 5E6IB 1FLRL 1VERA 1IGTA 3A6BH 3X13A 2VDPH 1WQVT 3K1KC 5CGTA 4UTAH 3C5ZA 5FGCB 3HR6A 3QHFH 1A7BA 5MP6L 4DGIH 5SWQB 2ICWA 4GG6A 4CDHA 1XF4A 1ZHNA 3UPRB 2AV7A 4J4PA 1CR9L 2IG2H 2VL4A 4FN0A 1E4KA 2BVUA 3NCBB 5C0ND 4NO2A 3WE6A 2A1WL 2QHRL 3BP7A 1S5HB 1NAMH 1E4WH 1U3HD 5T33H 1ETZB 4JHWL 4JM4L 1IILE 1I85A 3K46A 5FO9B 3L7EA 1CT8B 1EJOH 3QHTC 3MRQB 3QPQC 1QLFA 2F54D 5CZVL 5EZLB 1CGWA 4RAVA 2H2PC 1MNUH 5DD5L 1FG2B 5J7CC 5IVXF 1BFOB 4MA3A 4ZUTA 5BS0D 3AROA 4Y5VA 3DURB 2P24A 5D1ZD 4NKQB 3S3JA 3W39B 1RK1B 1IGFH 5BV7L 1H3PH 5SV3A 1D5IH 2NY5H 2APWA 1QFWH 4P2RA 5IV2B 1V5JA 3RGVD 4JB9L 1NBZB 2HP4A 4JO3H 2CK0H 2VLKA 1KV3A 4XP9H 2HJFA 4X80L 2EXWC 4XNYH 3DETC 4PJ9A 3O8XD 5EO0A 2YKLH 1CVRA 3DUSA 3GKWL 5TJWK 2C7UB 3E1F1 3P73B 3H0TA 3A6CL 1A7NH 5D8JL 3QQ3B 5HGAB 1INDH 4YXKL 1SEBA 1NGZA 1WZ1H 4FA8A 4JRXA 1NKOA 1JUFB 1RHHB 3L9RB 3FQUA 3GMPB 2ZCHH 4MDJB 1JGEB 2NXZD 4FOMA 3NPSC 1VPOH 5JO5A 1S5IL 3LRGA 2O5YH 1DJSA 3UJTL 4P3DA 1P84J 3ZTJH 3KPSB 5F8RC 5EOCL 5IW1B 4IS6A 1Y0LB 3WKML 3AS3A 3HZYB 2APVA 1MWAL 3WUWG 1H3VA 4Z76B 2QSVA 2HRLA 4GRWH 2EDBA 4MJIB 3CGTA 4XVJH 3ZMRA 2Y36L 1NUNB 2GJ6D 1AFVH 1IARB 2WP3O 3LKRB 5D7LE 3P77A 3RWIA 3M1BA 2XN9E 3JWOH 3KLSA 2YEZB 1OARL 5L6YL 4O58L 2X4TB 1KIPB 3ARDB 5DHVB 3WFEH 5EZOH 2VISA 5DHXB 5C0EB 4GKSA 5C0RL 5AD0B 1EXUA 4JZOB 3AVEA 4HKXB 3IXAA 4L8SC 4U3CA 3AS2A 4XXDA 5J13B 3QEQD 2CH8A 1IAKA 1KCVL 2VDNH 5JZ7D 1RFDH 4FQHB 5T5NG 4KDVA 3UZQA 2IBBA 5FGCE 2V5RA 4M48H 3IDNA 1NSNH 5HHOE 3VFSB 4M7LT 2P49B 3Q3GA 3D39B 3C5SA 3MOQA 2J8HA 4GS7C 1KPVA 3TN0D 3LZFH 1CBVH 1PY9A 4EN3A 4P9HC 4HIJB 4XP1H 5DYOA 3I6KB 2HFTA 2UWEA 3HPLA 4PP1C 3LVEA 2EXYD 5H37G 2LU3A 1XF5B 4UDUB 5KOVC 4R90H 3FMGH 3UJJH 2NY7L 4NJ9L 3FB6A 1A6TA 5CINL 2MHAA 5HVHB 2D0FA 2FGZA 1FZOB 1B88A 2PTTA 4EUPH 3EIFA 1CU4H 3SDAA 3WFCH 2IQAB 2MCPL 3VXOA 1MHEB 2NTFB 5FO7B 1QFHA 2VSDA 4LCUA 5CZKA 2EEAA 3G04A 1YEKH 1GAFL 5TH2B 1JNLH 2BY0A 2IAND 1JPTL 1RZ8A 2HVKA 4PLJC 1E4XL 3KJ4C 1DL7H 4KVCH 1UWXK 4L4VB 1IEAB 2WBJA 3ESVF 2ADGA 1ZHKB 2VLLA 2WW8A 3DWTA 4URTB 5EOTB 3IAPA 1WVZA 4S1RL 3LQZA 4DGYL 3CH1A 5I2IA 3KPTA 4EDXA 1B90A 2WUBL 4GRWB 4HUWB 2AEWA 5FM8A 5TGBB 4NKOB 3V79C 5KS9B 2GAZA 3WNMA 3QDGD 1JPGA 2P8LA 2PO6C 1C12B 1F6AA 4EJ1C 3TWCL 1FYTB 3GSRB 4XTRD 3HE7C 4HV8A 4JPVL 5I74B 3D25A 1F00I 1MFBL 1OWRM 2CDGA 1F4HA 1ZA6B 3DVNA 3KPSE 5DEFA 3V0WH 1YNLL 3WNPA 4L8DB 4LPVA 2ZNWA 4GKNB 3MA7B 4LLYA 1DEDA 3EDFA 4E5XA 4LOUD 4HMEA 4CVUA 2HJLB 2I9TB 3I6LE 1PDKA 2YUZA 3KPMA 2OTPA 3MNZA 3WV0A 1ZSDA 2IAMC 5TQ2H 1A0QH 5B4MD 3LKOB 1KB5H 2EYSA 4TSCH 3GSNL 1D5BA 3PWVB 4MHHI 4MXWL 3BZEB 1NBVH 4MJIE 2YRZA 5D6CA 3SKNA 4DQOH 1UFUA 1PG7X 2F8OA 2YD8A 4M1DL 4XWOC 5ADOL 1QFWM 4N0YH 3EJYC 5IFJB 4UBDD 1A4KB 5IBUB 4L4TB 2OJZL 2GT9A 5DJYA 1BBJB 1Q8MA 3FN0H 3S37H 3U0PB 2E7HA 2DWEB 3E6FA 4PGCA 4WW1A 3UEZA 4I4WA 4ZTPH 2AJSL 2PYEA 2AJYH 4M43H 4R7NA 4NWUH 4RBPH 5GGVY 5LAXB 5CIPH 7CGTA 4XCNB 1X5IA 5CD3B 1EFXA 1MFAL 2ZUUA 1RZFH 5L0QB 1I9IH 3D39E 3R0NA 3VXMD 1DQML 3EYVB 3NA9L 4GAYB 3RWJA 3B4NA 1U3HB 1GZQB 3EO0A 4NC1E 4MD4B 4KTEH 4Z8FH 1XCTA 1T1WB 2A6JA 4FXGB 1G6RL 4PV8B 4LCCC 4PJ5A 5DRZB 3FQTB 1FYHB 4D0CB 3FOLB 4QRTA 4JVUA 3B3IB 2P8PB 2B0SH 4R4FL 1P2CB 4F7PB 4R9HA 3GSXB 5GGVH 2OTWA 3MLXL 3FHQA 3TYGL 4CAGA 4R3SB 1U91B 3OHXA 4NO3B 5D71H 3BT2L 2PKDA 1M71A 2H26A 5I73B 1UM5L 3WLWC 5D1ZB 5HHMD 2QLVB 1BFTA 4HUXB 1R3JA 1SYSB 4L4VE 4JDTL 4U0QB 2DQUL 3VFNA 3VG9B 4K94C 3N06B 5J9PB 2VXQH 1KB5B 4X8JA 1OTUD 2W07A 1JRHL 3WN5A 4PY8J 2B7DT 3IYLW 4Z5RB 2X1WL 1FL3A 4PJ9C 1QKZH 4U6XB 5CWSA 4Z0XB 4DEPB 1A02N 2B5IC 5E8PB 5KS9E 4K7FB 2PYFB 3IJYB 4TPRH 4NUGL 1MRDH 4HWBA 1IEBA 2V7NB 1FYTE 5CSBA 4YFLF 4MSWA 3FQWB 4GBXC 2XTLA 3OKKB 5IVZB 1V3MA 2X9YA 3P0VH 3HMXH 2FSEA 1GCFA 1FGVL 4GSDL 2GSIA 5MHSD 3RVXD 3V6OC 3DRTA 4HEPG 3BEVB 2GTWB 4HT1H 3WUWA 1N6UA 4X7EC 3TH2T 5JW4Q 4Z95L 1NGQL 1IM9D 3D69B 2WQ8A 4FG6C 3ULUD 2WLYA 2QADD 5AYUL 3TBVB 1UVQB 4YHZL 4X6BA 5J4MA 4RMSA 1ED3B 5CIPB 1CXHA 4JGUA 1A64A 2GTZA 2YD7A 3LRHA 1U8MB 1B4RA 4Q97A 4LLWA 1ZA3A 4OFVA 1KBGL 3P40A 3U46A 3NCYP 3MRHA 1RIUL 3STZA 3EGSA 4WV1C 1YYLH 2NY4C 2HKFL 3NCFB 3OR7A 3U7WH 1PG7L 4FFWC 3F58H 3CD4A 2FDBP 4OLWH 4L4TE 5AZ2H 4OUUA 5DD3H 4LLAA 4TVPD 1I9EA 5F1NA 1U42A 4LMQE 1ZAGA 1OAKL 1JYXA 2VE6A 3UROR 3IXTA 5ITFB 4PTUA 5F72S 3HS0A 3MLWH 5FV2A 3V6ZA 2GYSA 1HINL 3W9DA 3T1WA 3C87A 1OAYH 2QSQA 1DP0A 5J0BA 4K23L 4L9LA 4JKMA 2Z8RA 2E27L 1DZBA 1D9KB 1BD2B 3C60C 4KROB 2R2EB 5TDNA 2VH5H 3CLEH 4ZUVA 3CVHA 3BESR 5HDQH 2PW2A 2BVPA 3FT4A 3UYPA 5DLML 2K7PA 5DJ0B 5I19L 2ITDA 3FRPG 2YXFA 3T0EC 4FZEL 3ZLQC 4BH7A 3BDYL 2CLRB 5HD8D 3RKDD 3TN0B 4U7SA 1JF6A 4JKPL 1DCLA 2QEJA 1P7KB 2FJGB 4L9DA 4XVSH 4YHNB 1NDMA 2F54E 3U79A 1FV1A 4M6MH 4DZBA 4WWKD 1PBYA 3VDBA 1S9XB 1CYGA 4P0DA 4F33A 5I0ZA 5CEZL 4NQDD 4TUKH 5EH1A 4NT6A 5C1MB 4APQA 1JCKA 4S1DD 5BS0E 3HFMH 1FCCA 1I1AB 5ELIA 2IANB 1G9NC 2C1PA 4GG8A 3O9WD 1QA9B 5DJ8A 5IBLC 5FF6B 1ITBB 4AEFA 3EFDH 4UIMA 4QTHB 4OTXH 5BQ7A 1AXIB 4P5KA 4P5TD 5DGRA 1H0DA 4PV9A 3MV11 3UO1H 4S10A 2ZUYA 4F8TA 1HWHB 4N8VG 1IQWL 2NNAB 3QCTH 2WQRA 5IB4A 4ODSL 5A2FA 4KKAD 4W70A 3EDJA 4U1LB 3FFDB 2YSSA 3PJSA 3V4PH 3QDGB 4Y2DC 2VR5A 4P57B 4HPOL 3MXVL 1TQBB 3LKPA 1IKFH 1C16B 2ATPA 5IVXB 1U58A 4W6WB 3A67L 5MENB 4WI3A 5IMOA 3LS4L 4LFHG 1JPSH 3VFOA 3LD8C 1FNGB 3LKQA 2FH6A 1QBLL 2KQNA 5EBWB 5A3IC 1NFIB 1YN6A 3MGOA 5FOBB 2GEEA 5I66A 3GHBH 1WTLA 4OFYA 5CP3A 4PJ8D 1FJ1A 5LGKA 3KPPA 5E2VH 1YC8A 4QOKD 4XCCL 5HDLA 4HUNB 1BJMA 3ABZA 4OD3L 1EUTA 4Q9QH 5J12C 1V3JA 2LVEA 3L5HA 3BP6B 4LU5L 3IFOA 2GJ6E 1U8HA 1X6NA 4AL8L 5MEQB 4X6EA 1KN2H 4N9GA 3B2UC 5KSVA 2BJML 4EXKA 3V5KA 4LVOC 2EDYA 1HOCB 1I3GL 1R5IB 5GS1C 1TZGL 2WLZA 1MRCL 5IT2L 2ED8A 1YNKH 2DQJL 3OKMA 5BRZD 3RPIB 2R1XA 3TBTA 4QNPE 3TYFB 3CK0H 3CFEA 4QGTA 2RHEA 4HMDA 3ZTJG 5HI5D 4JN2B 3LQAH 1RAMA 1BD2E 5SX4H 3DLQR 5B39B 4YDJA 5ADPL 2APXA 4UI2A 4W4OC 2X42A 2Z8VC 4KPHL 2VL5A 2BSRB 3IKCA 4OZGF 4Y4FD 1IC4L 3IDIA 4XPGL 5B3NA 4MDIB 1UKQA 3KS0J 1OHQA 2H1PH 4JFFB 3V4UH 5HYEA 2IWGA 1YMMB 1Z2KA 4PG9B 2VAJA 1CLZL 4RGOH 2CKBA 2CDEA 4H8WC 3WFBL 4AY0A 4RWYL 5EIVA 1ZS8A 1AGDA 1T7XA 4X4XB 3GHEL 1S7RB 3PNWB 2HMID 5IW6B 1C8PA 4GAJL 1PQZA 1INQA 2IANE 3GO1H 5ISZA 5HYQA 2VXSH 1QFPA 3MV9A 1T1YB 4U2ZA 2ICWI 2JJUA 1K3ZA 3KPNB 2XZZA 1ADQH 1Q9KB 3NOIA 1WWWX 5F1IB 4LSQL 2PR4L 5AWNL 5FO8A 5MI0C 3K4AA 2E7BA 5D6DA 3VWKA 4P4KC 3QDGE 4OD2A 3KYNB 1CLYH 2PXYD 1EV2E 5DJDA 5IVXE 4OLVH 3AMKA 3QZWA 1AI1H 5E2TH 3H9YA 5DK0A 4NKDA 5C86A 2I60L 3BEWB 1NC4A 2BOBA 4R97B 3GZKA 3CJJA 1WIPA 3BW9B 3BAEH 1UM4H 3GJFK 5E6IA 3ZSTA 5BMFH 1L0YA 1D5XA 2GSGA 5KVDL 4EUPG 5L9DL 2R0KL 4KH2A 3A6OA 1IM9B 4MS8D 5SWQA 1N6VA 3KPRD 4UINL 4KU1A 3UPRA 3MMEA 4DN4H 2NX5D 5A1AA 5DUML 3B2VH 1ETZA 1IGIH 3C2AL 1EBAA 4GXUN 3LV3A 5FO9A 4M7KH 4JAMB 2NY0B 2VR4A 5DQ9B 4XP5H 1N64H 3OSKA 3VH8B 5J06A 1PYWA 1OLLA 5EZLA 2ADFL 4CUCA 3QUKB 4W68A 3MOAH 1UB5B 3BPCB 5D7SH 5TQ0H 4IJ3C 5B8CB 1DLFH 3QUYD 4P3CH 3ZYIA 5LWYH 1FG2A 1AJ7L 4ODVH 1BFOA 2MKWA 3NIGF 4JJ5B 2AS5M 3MSPA 1R3HB 1H15B 4NGHH 3W39A 3MRCB 1RK1A 5IFHH 4M5YH 3U30B 3I3DA 5JHLH 2X7LA 5IV2A 1Y6NR 3QYCA 1HHGA 2DI7A 1DFBL 1CGXA 3FRPA 1BZ9A 4OCWL 3RZWA 5ID0B 4U1KB 4ZXBC 3S5LG 3C6LA 4JY5L 3LMJH 5K9QI 1F4AA 4TQEH 2F5BH 3VXME 4NHUB 3HI5L 4G6AD 1OPGH 5GGRY 2X9WA 1NH6A 3C8HA 3EBAA 1W0WB 4OF3A 3PABA 1KLFA 3P73A 1LWRA 4P46B 3OR6A 1F45A 1KJ2A 4NWTL 4DWHA 1YEJH 4TRPL 3QQ3A 5HGAA 4QRUA 1FC1A 4IIQC 1X5FA 1JUFA 4UTBL 4TYUA 4MDJA 2YPVH 3DVIA 3QPXL 1IT9L 4PBXA 1MUJB 2VUOA 35C8H 2P5WB 2DQCL 4KKBC 3VFRB 4Q2ZB 1OB1B 1SJEB 3HZYA 4ZD3H 3ARGA 4BQCA 2XWBA 1P4LB 4FP8H 5HHME 3TNNB 5IWLC 1FBIH 4MJIA 2X1QA 2Q6WB 3ZT6A 2UV3A 4Z78B 4N8VA 3IDJB 2F53D 3OJMB 2CO7B 2BXZA 1SHMA 3UDWC 4P5TB 1IZKA 4OM0L 2J8UE 5DC0A 1OP5H 2V7HB 5EC1A 3TA3D 3Q1SH 2YEZA 4WHYH 2VZTA 3BKYH 3B9DA 3T09A 2X4TA 1KIPA 3ARDA 4LSTH 3GBMH 3KGRA 5J6HB 5I30H 4JO1H 3QDJA 4NQCA 2BY3A 3VFVA 2JB5L 4P2OA 5C0EA 4LSVL 4M8VA 5AD0A 4JZOA 1C5DB 2FO1A 1EVUA 2PCPA 4JO4H 2W0KA 4LVNC 3FHAA 1HCVA 4XPBL 3V52L 4POZD 2A6DB 5K93A 5GZNC 3F8UB 3QI9A 2PETA 1X5AA 2X1XR 4XCFH 4DW2H 5KVMC 4PJ8B 1EH9A 2P5ED 1TVBB 5E56A 3MBEC 1RVFH 3VFSA 5JQHC 4ODTL 1ZEAH 1TJGH 3MREB 4QOKB 3W81A 4QY8B 3D39A 4JRYA 3QUZA 4TVSa 1A7RH 5JW4N 4IOFD 4HIJA 1NCBH 1DE4B 3I6KA 1JFQH 3VXRB 4NN7C 3CZJA 1XF5A 4JCMA 4I3SH 5KTEL 3UTSA 2VOTA 1WBXA 4NP4L 3O45B 1I8KB 2CMRH 1FZOA 1RURH 2N7BA 1IRAY 4KJQC 4F9LA 1F4YL 4TVPE 2I5YH 2NY2C 3PDOA 2IQAA 3TT3H 1PZ5B 4QEGA 1MHEA 5FO7A 1YZZA 4JG1H 5K59E 1L7IL 5TH2A 2FJFB 2WP3T 4NCDA 1ZANL 5KVGL 1G84A 4P3WA 1Z3GL 4L4VA 5GHWL 1ZHKA 1XGTB 3RQ3A 2XZCH 5AG9A 2NY1D 2YRLA 2FEDD 1URLA 4EOWL 1BAFL 2BFVH 2F15A 2DQTH 5DD6A 2Z92B 5GGRB 3TVMC 1MOEA 1QTYT 4Y4FB 3RVUD 5D5MF 3MRDB 1X5ZA 3T3PF 1C12A 3GMMB 1FYTA 3RZCB 1OAUL 3GSRA 4LIQE 2HJKB 3AM8A 3I6GB 3SE8H 1UC6A 1G1CA 1BEYL 1IE5A 3B8SA 3QIWD 5LQBL 1OSPL 4JZNB 2CIIB 4LKCB 4L8DA 4GKNA 2GCYB 3MA7A 5C0IB 5GS0C 2HJLA 5BW7A 2I9TA 1EGJH 4HJGB 5FECA 3BISA 1QUNA 3LKOA 4XAKD 1MQ8A 3PWVA 5L8JB 3BZEA 3L6FB 3U9UB 4GW5B 4RISH 2DLFL 12E8H 3UBXB 1FDLL 4M5ZH 3WD5L 2D31B 5C6WH 2HT3C 4HKZB 1HILB 4G8IB 1GGBL 5HDBF 3VD9A 1WZKA 1X5KA 3DI3B 2JJWA 4OCXH 4D8PA 4PJHF 3S36X 4K3EL 1MCCA 1X5LA 1A4KA 5IHBA 5INCB 1F13A 4WHDA 4L4TA 4YHIB 1Q9OB 1W0YT 1JNJA 1FLTX 4NQVB 3RP1A 3U0PA 1DQTA 3MV7B 4QTIH 4G6MH 2DWEA 5CJQL 2EZ0D 3GMQB 4EUPA 1GPOL 1U36A 1X44A 2VDLL 4N0RA 5E6IC 4GQ9L 3W9EB 5DRWA 5LAXA 1JWMB 4G7YH 5GGSB 1P7QA 1MAJA 2XIDA 3U4BL 1PZUB 1GC1C 5JW3L 1RIHL 5C0CB 3EO9H 5IVOA 4O9HL 4F80A 2CGRH 4QOKE 5FM5M 4CN1A 1FFOA 3A0OA 4RMUA 3H9ZA 2GUOB 3EYVA 5B39G 3HI1A 4NZUL 2EDXA 3WIHL 3R8QA 2FO4B 4LGRB 3DOSA 1NCDL 4YZFF 4NCC1 3O2WH 1LO4H 4MD4A 4QRRA 4Q9RL 5C07D 1CE6B 3RFZC 1T1WA 4FXGA 1A6WL 4KQ4H 2PNDA 4P9HL 3GM0A 5DRZA 5DQJB 3TV3L 1XIWA 1GOHA 2R56H 1HYRC 1DSFH 2P8PA 4ODHL 5IB3A 5DUPL 1P2CA 4F7PA 1V7MH 4HIXL 3GSXA 2R1YB 3QUYB 3DUUA 1XGUB 4QWWC 3GGWB 4R3SA 4PJFF 3JTTB 2WUCH 1UM6H 3QAZB 1LHZA 3HN3A 2VUYA 1NUDA 4IRSB 4BELD 4MMXC 4P23A 3D9AL 3S5LA 2RJMA 5A2KH 5IOPA 3X14B 4X7SH 2I24N 1PGRB 1KB5A 1MVUB 1VEOA 5F7HA 3HMWH 1N8ZB 4Z5RA 2FHFA 1MELA 4Z0XA 5DRXB 5E8PA 3MA9H 5C0FB 3IJYA 5F97E 3HRPA 4BZ1L 4N0UB 4HUKB 3EZJB 4MNQD 4BM7A 3MRGB 4UT9H 2AJXH 2ZUQB 5C7XH 3OKKA 5GSVB 3CDFA 5IVZA 4J2XA 1NGPH 3FOMB 1KELL 2YK1L 4ISVB 3MYJB 4F9PA 2MQCA 1CCZA 1TVDA 3PHOB 3ESUF 3SE9L 5BXFB 1KLUA 3BEVA 2GTWA 4ODXA 3MNVB 3Q5TA 2ZUWA 3IAGC 4RFNC 3F12A 5EA0H 3ZTNL 4TN9A 1C08B 2ICES 2N7AA 1CFQB 3QCVL 4JN1H 5CILH 5JIHA 3TBVA 1S78C 4YGAB 1UVQA 1OAXL 2X05A 5E1AA 4Y4KA 2FB4L 1CF8H 5CIPA 3LIZL 2MOVA 1A14H 2A6KB 3AS0A 3EO1A 2EEDA 4HUMB 5I1KL 4OZGB 4P2QD 5EUOB 2AJVH 2F53B 3LSOB 1QFOA 2O5XH 1UJ3A 2YA1A 3G6JF 2R1WA 1OD9A 1SEQL 1QSEB 1RUKL 3ARVA 5BO1H 5I1JH 1NGWB 4XPAH 5GGTL 3ARDC 3TA3B 4K9EH 3ES6B 3D2UD 2ESVD 1C7SA 1WF5A 4U3XA 3S36L 2WAHA 3VH8G 1T0MB 3MV7E 3FCTB 5DDHB 2B4CC 5ITFA 3GRWL 3X3FH 5J13C 4XC1H 1KTRL 1MCPH 2DQUH 3KDMA 4LSUL 1DQQA 4KXZI 3GMNB 1HQRA 2NY5C 1D9KA 1BD2A 2R2EA 4MD0B 5JW5B 1RUML 3GK8L 4MAYC 3KPRE 4PRBA 4DKFL 4C4KO 2P5EB 2ZPKL 5DJ0A 4JQIH 2IADB 3EKCA 2NX5E 4CU8A 1T22B 4KQ3H 2D9QB 2CLRA 3FQNA 1K4DB 5E5RB 3TN0A 4NC1C 1LQSR 1D5MA 5FOJA 1NMAL 2A9NH 1MQKH 1P7KA 1EHNA 3GNML 4YHNA 4OF6A 5HVHC 1GYAA 1BJ8A 5LGJA 1DTUA 2D03L 4ACPA 4MX7B 4OT1H 2A0LC 4RX4A 1EAPA 3HMXA 3U36B 1LO3H 4OB5L 3K4DA 2D7MA 5FKPB 4GRMB 2VC2L 1I1AA 3D85A 3O2VH 5KVEL 3K8KA 4QCIA 5T1DH 2IANA 3S35X 1PY4A 1IKNA 1LO5B 1JWSB 1QA9A 1Y18B 4YHOL 2Q76B 4GXVH 5ABDE 2NY1B 2XQBL 2Q8BL 1S7QB 3PQYB 3SDDD 3X11B 3NCYS 2YA0A 2MQ0A 4AQOA 4OBRA 2NNAA 3G5XA 1CWVA 3RKPA 4L8CA 3VXUD 1HXMB 4U1LA 1X3DA 2AK1L 3FFDA 2HVJB 1RULH 3JWOC 3TJHD 4P57A 3QCUL 3CFCL 4GOSA 5I74C 1C16A 1KEML 4NFBA 4Y89A 1CGYA 3PGFL 4D3CL 5MENA 4HWEL 1MRFL 3K2MC 4OCNC 2VLMD 3O4OC 1N5YH 4M7JL 5T5FH 4ZUWA 1IC5L 1FNGA 1WIOA 5EBWA 4JHAH 5FOBA 4XWGH 1W0VB 5BW7C 4Y4HB 3STLA 1OTTC 1JHKH 43CAB 3BD3A 3DIFA 1YY8B 3WNLA 1U8OB 3EFFA 4OZGE 1F8TL 3PDDA 3BP6A 2HTKD 2VN4A 4XCEB 2F53E 4OFIA 5MEQA 2MCG1 3MLZL 1U2HA 1QSEE 1A1MB 3QIUD 4HEME 5IM7B 3I9GL 4H1LB 2X1PA 1BBDH 5ETUB 4MCYB 1HOCA 3BH9A 3O0RL 2EDKA 4Y1AA 5DC4B 3KS0H 2X4UB 2ADIB 4UILL 4OI9A 5E7BA 3HI6L 3RPIA 1Q94B 3PWPD 3TYFA 1MIEL 3LHPL 4OZFB 4LVHB 3MCKA 4PREB 5EOCJ 3ECBB 4JN2A 4I2XE 4K8RD 1JI1A 4U0RB 3EYOB 5L0QC 5B39A 1AD9B 2EYTB 2OQJB 5EZJB 5AAMA 5D7JB 3MBXL 2P5EE 3MLSL 2EDTA 3E3QE 4O51B 1FPTL 5C0NC 3H7LA 2BSRA 4Y5YA 1CK0H 1U3HC 5E8EB 1U8JB 1F6FB 2CJUH 4O00A 2FR4B 4MDIA 2V9QA 3SHSA 3VFPA 3FONB 4JFFA 3VA6A 4UV7L 2XY2A 3FKUS 1YMMA 4AIXA 1CTOA 5C07B 2B2XH 4PRNA 4OZ4A 5CZXD 3DHJA 4ZFZB 4WHYG 3WJLC 4Z7UA 1YMHB 5ESAB 1S7RA 5I73C 3RWEB 1N0XL 2DQDL 2Y23A 4K3DH 5D1ZC 5FYKD 4ZMAT 5IW6A 4DUVA 1H9VA 1AY1L 4UOW1 2Q8AL 1UCBH 4J23A 3VG9C 2NLJB 3VDCA 4YBLB 3P4NB 3BZ4A 3QIBD 3QQ4A 3RGVC 3ARFD 1N4XH 3SJVA 2VDOL 4UT7L 3S35L 3L5XL 4NOBA 1L7TL 4NO0B 4WENB 3QXDB 4DEPC 1BM3L 1Q9KA 4KKCD 4ZAKD 3UBXG 4NBXB 3NFNB 3VE0B 5F1IA 3O8XC 3MUJA 3P2TA 4WRLA 3X12B 5BJTB 3MJGX 5FGBC 5FYJL 2CUHA 4ZSOA 3KYNA 3AGVA 3SKUD 4RFEB 5DEGB 5HHQB 2NXZC 3FT3B 3BEWA 3HRZA 2J6EH 3JV4B 3MLVH 4HX1B 5FHBL 4WFGD 2YOCA 4JDZB 4MZ3A 2O5ZL 1MHCB 2DJ4A 1BOYA 4AG4H 1FNAA 4TULH 4D0BB 4C55A 2AI0L 2EYRB 2VKWA 4KUCF 4XAKE 1K5NA 3IDUA 3TPUB 3C2SA 4JANA 2ITCB 5C0JB 5CGYD 1LEIB 5D5MB 1MCKA 4WUUD 4O2CB 3TT1L 4JAMA 5DQ9A 3I02B 2ZUVA 3ARBA 3VG0L 4ZQKB 3VI4F 3VH8A 4QLRA 5IMLB 1UA6H 3QUKA 2V17L 2VB5A 4MCZA 1UB5A 3BPCA 3K2UL 3JWDC 3QEGH 3N1MC 5EBMB 3D2UB 1PSKL 2W92A 5EU6A 2HKHH 2ESVB 4FQIH 3U0WH 4PYGA 4NZRL 3L3OB 4XPFH 4JJ5A 5IEHB 5JIIA 5EO1B 5I15L 5JW4M 1H15A 3TBSB 3MRCA 4XZUB 1QFUL 4D9QD 3S97C 3L1OH 5JZ7C 4NC0B 1OGTB 5I16A 2D7TL 3SCMD 2XWJA 3B9KA 1BIHA 4U1JA 5GJTH 3BXNB 1OAZH 4U1KA 2Q87A 5GRWA 2OK0L 1HK6A 1VSCA 5CMAA 5IGXL 5CUSL 4MQXD 2HT4D 4NHUA 4PJHB 3TN0C 5IG7A 3S88H 2Z35B 1ADQA 1RJYB 1AHWA 1QRND 1W0WA 2OBGA 1NEUA 1QO3B 1T7YA 4P46A 1I4FB 2EXYC 2VDQL 5ITBH 5CD5C 3HCVB 3L3HB 4PS4H 5C07E 1QZ1A 1IGCH 2Z4QB 1P4IL 3DVGB 1S8DB 5T1KD 3H7BB 2P5WA 3IFPB 1SMOA 4TTDD 4H88H 1Q0XL 3UTQB 4Q2ZA 1OB1A 1SJEA 1WC7A 2ED9A 1UXWB 1P4LA 4PRAB 3SKJL 2EKSB 3GSUA 3P4OB 4YDIH 5K9JH 1IKNC 5EU4B 1FQ9C 1IFHH 3TNNA 4XXCA 5L88H 1G7PB 1BZ7A 5CLWA 4Z78A 1HI6B 3IDJA 1QFWI 3NH7H 1S7VB 3ROOB 3BIBX 3MRLB 2YPKA 2FCBA 5JA9A 5F88A 1JZ8A 2GY7B 1TQBC 4MNQE 1E4JA 5J6HA 4XTRC 2IPKA 2R0LL 5KAQF 4HWBL 4X0KB 5BCAA 3SQOH 1C5DA 5AUMB 4PJFB 1EA9C 2Y5TB 1WWCA 1FGNH 1AGBA 3UYOD 4MZ2A 1ZLUK 1JNNH 2A83B 4ZG1A 4KZEL 3D3VD 4LOUC 4HDIA 4F7EB 4WFHD 4U33A 4M62H 4ERSL 4U1GB 4PGBB 4L4JA 2E8ZA 4PJ8A 1HH9A 5DMYA 4V1DD 1Q0YL 15C8H 1TVBA 4NNPH 1R5VA 1JWUB 5TF1L 5B4MC 4NN5B 3AMLA 1I3VA 1BECA 4A6YH 2V2XB 4QY8A 4YFDB 4OV6F 3OXRB 2E6QA 4P2QE 3HC4L 5D5ME 3CFJA 1A7QL 3OB8A 1AQKL 3BSZL 1DE4A 2BVOA 1QSFB 1P6AB 3VXRA 5HYJD 1NEZG 3I75B 4WIQA 5BZDB 3MXWL 5HI3D 1HSAA 4KGJA 5I8CB 1YEHL 4MA1C 5J6GA 3F7YB 2HRPL 2HWZH 4RA0C 4UBDC 5FGRA 4YX2H 3O45A 4HXAH 1JHLL 1I8KA 3QFJA 3C8KB 3EYFB 4FFZH 1XR8B 3WYRA 5F89B 2ESVE 2XPGA 3H6JA 4PJDA 3DI2B 1PZ5A 1JBJA 1G7LB 1B0GB 2VDKL 1LEGB 1D6EA 1AGCA 1VCAA 3MNWB 1TFHA 3PHSA 1BQLL 2K3TA 1NLDL 3PWPB 5CSZB 4GAFB 4E9LA 1XGTA 1CD9B 4HKJA 2P42B 2XZAH 1KEGH 2KQMA 1YJDH 5IQ7L 5E7FA 1S7SB 4M6NL 5HDBE 4JREB 4NZTH 4ZOCA 1PKOA 2J3SA 4U1IB 3H3BC 3G6JB 4PJHE 3ULVD 4Z18A 1BFVH 1RJLA 3V7AG 4S0TD 1YEFH 4KMTH 3RTQD 3GMMA 3MJ9H 1ZVHA 3RX8A 4KZDH 3RZCA 5JUEH 2HJKA 3I6GA 4EI5B 1T20B 5D93B 1YY9D 4D9LL 1C1EL 2YR3A 4KI5F 1TNMA 2WNGA 2OM5A 4Q74A 5CFHA 3F5WB 2CIIA 4LKCA 5D2NA 2GCYA 3GB7B 3MRRB 4LMQI 5C0IA 1CFVH 4C56D 1U8IA 2OR9L 1XT5A 1E6JL 2B39A 2FX9L 3OKDA 4G9DA 2OJEB 1SY6H 4FFYH 4HJGA 1UH4A 5KSUB 2ORBL 1I1FB 4NHCL 2IPUG 3L6FA 4IDJL 3WDHA 4GW5A 2FJHB 4X8XA 3QIBB 3UBXA 3ARFB 5JMRA 5FXCH 4KRPD 4BFGA 4A6YB 2LV4A 1OTUC 4HKZA 3BH8B 4R6UA 1A5FH 1HILA 2AXFB 4G8IA 3OKLB 1TJHH 3F7VA 3OL2A 3OKEB 3FB5A 4G8GA 4ZAKB 2LE9A 2HN7B 4AM0A 1T3FB 2XFXB 4FMKA 3SE3C 5INCA 5EPMB 4YHIA 1Q9OA 3QDHA 5KSBA 1MCEA 4NQVA 4LLMA 5DFVD 4YBHA 1T03H 4R97C 3MV7A 1NAKH 3HAEH 4PJFE 3GMQA 5GRXG 2VLME 3MUGB 4Z6AT 1KTLA 3X3GH 4FQ2H 1DUZB 4K7PY 2E6JA 5BVPL 1SMAA 5GGSA 2QADC 1MI5D 4PJGF 4QRSB 3BP5A 3G08B 3U7AA 1CXFA 1OVZA 2YS4A 5C0CA 5IESL 3IFNH 4YHPB 3RNKB 1MLBA 4PRID 1PLGL 4FQJL 3EAKA 2GUOA 2XG4A 3U7YL 3W11D 4D9RD 1U8KB 1XF3A 2FO4A 4I77L 3WO4C 4EVNB 1QSFE 4YE4H 3BPLB 3UJIH 1CE6A 4FQXD 4H0HB 5TPWL 4GMTL 5DQJA 2VDMH 5B8CC 1MJ7H 4Y8DC 1T5WB 1BGXH 1N3NA 1G6VK 4Z7WF 5GRJH 2R1YA 2O26U 4ODUB 3K74B 1AO7D 4GRLB 1XGUA 1T2JA 3GGWA 5HHNA 2IF7A 1LP9F 3U30C 1RY7B 5ILTH 1P6FA 2APTA 1N6QH 2ZP0T 4IRZL 3PWPE 4DVRL 4IRSA 4JFED 4IEFB 1CE1L 1B6DA 1EGJA 1FH5L 1NCCH 3X14A 3SCMB 3RWHB 3I50H 2MKLC 3V5HA 1N8ZA 3G5ZA 4QRPA 4Y8AA 4P59L 3G6JE 3DRQB 4ZO7A 4LDLB 4M61A 4N0UA 3RKDC 4P46C 1G0DA 1HHHB 1NGYB 3SGEI 1QRNB 4OLZL 4W81A 3Q6FB 4PRHD 5GSVA 3MYJA 4LSPL 1KJ3H 4WWKC 1EO7A 3PHOA 4KJPD 5BXFA 5E8OB 2UZIL 2CKBL 5T1KB 3DNKA 3MNVA 4ETQB 1T04B 1C08A 4S1DC 1CFQA 2ZG2A 2ZJSL 5DJCB 3KLAA 5FYKE 4I18B 7FABL 4EDWL 3G5YB 1AC6A 5I1IL 1MY7A 4OGZA 5GS0L 3ZKMD 3O9WC 4UNUA 3HC0B 1A4JA 3GSWB 1U8NB 4HXBH 5T3XD 5INDB 5EUOA 4G6JH 3RAJL 3QWRD 5DMIH 4UDTB 4ONHB 4P5TC 4XGZB 2HFGL 2F53A 3NZ8B 1EHAA 1N5AB 3LSOA 4LP4A 5DD1L 3RWFB 4XMLL 1QSEA 4KI5D 1NGWA 4KKAC 3D1MC 1I9JH 3W2DL 1WT5A 1YEDA 2XY1A 3LH2H 1WBYA 2DKSA 1KN4L 4KY1H 2VQ1B 1D6VH 1G7MB 1NFDA 1HIMH 3LN5A 5A2IH 4X6DF 1T0MA 2VXVH 1U8LB 3RWDB 5JLZB 3DMMD 4UQ3A 4WFED 3RUGE 3ZE0F 1MFCL 2KH2B 1A3LH 2YMXL 3NPSB 4JQVA 2R69H 4CMMA 4WFGE 4NQEB 4W6XB 5D2LA 3BVNA 1JPFB 5E5UB 1PEWA 3GMNA 2IPTH 1JHTB 2DLIA 3T77B 1R3IH 3BRGC 4PJ8C 4MD0A 1HHJB 4L3ED 5JW5A 3QO0B 1FO0H 4RWHA 4S0SD 4U05A 5F93C 1VDGA 4YHMH 3WXWL 5DD0L 3CLFL 1NEZA 5EU7E 3HZKA 3MRIB 3TCXA 1RZJL 3N9GH 1K4DA 1F4WL 1SYVA 4WVRA 2J88L 2BX5A 4NQSB 4WUUE 1TPXB 2X4OA 1J0HA 2X89D 1RK0B 4M1GL 5HYJB 5D70H 4E42A 4BSVB 4KKLD 4U1HB 4KK6D 1A6VH 5CEXB 4HBQA 3R06B 4MX7A 4Z7VF 4F15C 3D48R 1Z9SA 3O11A 2AXJA 3U36A 4YDKL 5KSAD 1MEXL 3IS1X 3IU3A 5F1SA 3SGJA 4GRMA 1NJ9B 5T3ZL 3C09B 5IFAH 2V2WA 4L29B 3BKML 3ELAT 3C6SA 3CVIL 2LQRA 1JWSA 2P4AB 5HI5C 4EBQL 2HFFB 3QUXB 4KTYA 5L2KD 1Y18A 5EU3B 4OZIF 3GDBA 4KUZL 5JXEA 1FRGL 2DWDB 3PQYA 1S7QA 4KHTH 3C08L 4GAGL 1A1OB 2FLBT 1KOAA 3IJHB 1F58L 3GI9L 4Y4FC 5DMJB 3EYUL 4HK0B 5DSCB 5IKCB 1OW0A 1U93B 2Y1VA 1HXMA 3NZHL 3MRMA 5C09D 1KCUL 2HVJA 2XXCB 5HSFA 3FN9A 5JIPA 1GIGL 1QRNE 3RTQB 2XA3A 2XQYK 3GEWB 1CGVA 2AGJH 1P4BH 4CVZB 2EDQA 3CZFA 1A1NB 4WHCA 1KJ2L 3GBNL 4FRWA 5IBTL 1DQLL 5GRVL 1J8HB 2DQEL 3P9LB 4RZCB 3IRPX 1JYWA 3LRSB 1W0VA 1FNHA 1GH7A 2HMIC 1CD8A 3ZE1F 3SE4A 4Y4HA 4C56B 2KKQA 3H2WA 2SEBB 3BWAA 3T8XA 5C6TH 43CAA 2ARJB 4LASH 4WEBH 1U8OA 2HG5B 5C2UB 3A6BL 1HNFA 1FO0B 2VDPL 4UTAL 3NIFF 3QHFL 4DGIL 5GS3A 4XCEA 1TLKA 1HCFX 2IG2L 4RMVA 2D03H 1QLEH 1KCSH 4R0LA 2ARWA 4YO0B 5JIKA 5IM7A 4N1EA 2GITA 2PO6B 1WLHA 1E4WL 1NANH 5T33L 2CLZB 2FHBA 4HH9B 2PXYC 2R0WH 1EJOL 1CGSH 4OCYH 5LBSH 1XFPA 5J11C 2X4UA 2ADIA 5F7DA 1ZGLP 1MNUL 1Q94A 4XRCA 1OGAB 3RDTA 2YC1B 4DTGH 3D3VE 2BNRB 4XHQA 4K94H 1T1XB 1MI5B 4WFHE 3TM6A 3EYOA 1AD9A 5EZJA 2OQJA 1QSVA 5F9JB 5D7JA 5T3XH 1IGFL 1H3PL 1A6UH 4PRIB 1D5IL 4O51A 2NY5L 4LQFH 2BSSB 1QFWL 2CRMA 3VMOA 4H5SA 1KPUA 3PL6A 5E8EA 1U8JA 5T1MA 1NCWH 4JO3L 3SDCD 2FR4A 1OOAA 2CK0L 4JY6B 1DN0B 4XP9L 3JUYA 1ZT7B 3FONA 5HYJE 4KKNA 5BV7B 4POYA 3I2CH 4AEEA 4XNYL 5C07A 4UB0H 4FQXB 3B9AA 2YKLL 1S7TB 5SV4A 3RJQB 3QUYC 1HWGB 5F21B 2Z91A 3N1GC 1A7NL 4X83A 5AEAA 1XR9B 1YMHA 3HUJF 5ESAA 1INDL 1AO7B 1WZ1L 2FH8A 4OJFH 2ZCHL 3IDGB 3NMEA 1VPOL 1T6WA 1X5YA 3MRNA 2O5YL 2NLJA 3P4NA 1S9VB 4MHHG 1KGCD 2X40A 1H3XA 1UADC 5FYKU 2ENYA 4NO0A 1OF2A 2F8VA 4LQ1A 4NBYB 2G5RA 5FK9B 3NFNA 3VE0A 3VI4E 2BRQA 1N2RB 5SX4I 4G6AC 3X12A 4XVJL 3WCYA 1YEEH 4LCWB 1AFVL 2LAAA 4AT6B 4RFEA 4YIQB 4HWUA 5DEGA 1CS6A 2G9HA 1FCGA 4LCCB 2QSCH 3FT3A 3JWOL 4MNGB 3JV4A 1T7VA 5E08H 4HX1A 1AD0B 3BWUC 1NL0H 2YRPA 1KPRB 2NR6D 3KLHD 2JIXA 3ZE2F 1B4JH 3WFEL 4JFDD 1U0QA 5HY9A 2HLAB 5EZOL 3AXLB 4C56E 1UEYA 4D0BA 1J1OH 2C3WA 1QOKA 2VDNL 3IJSA 1RFDL 1QD0A 1Q1JH 4MGXA 1KJVB 1PKQB 2ITCA 2Y5EA 1LEIA 4OIBA 4M48L 1NSNL 1ONQB 4LSRH 5DTFA 1W8OA 2B5IB 1TETH 3I02A 3HE6D 3TA3C 3VJ6A 3ZHDA 4JDVA 2YPLA 3LZFL 1CBVL 4Y16D 4L3CB 4HJJH 4F2MB 4XP1L 1M4KA 2X10A 1GGTA 4PJIA 5DURD 1A7PH 3L3OA 4R90L 5IEHA 1CDJA 3DMMB 3FMGL 4MQSB 3O6FD 3UJJL 3TO4D 4WGWB 2BOCB 5I18H 2YWZA 2NY3D 4TUJB 1KIQB 4O2FA 1O0VA 1OGTA 3H9HB 1CU4L 1WZLA 2ATKA 3BIKB 4HHAB 4POZC 3WFCL 1G9NH 1R0AH 3PP3K 5DO2D 3ZKXC 4YUEH 1MI5E 5GJSH 3BXNA 1YEKL 2GY5A 5T1LD 1JNLL 3E3QC 4L3EB 4PRIE 1CFTB 1A22B 4LCIH 1T80A 2F58H 3REWB 1EO8H 1DL7L 4KVCL 5CEZD 2W0PA 3RVTD 2MWCA 3CIQA 4IOFC 4D9RE 3VRJA 2Z35A 3V0VB 4MWFA 2YBRB 3T0DA 3O2DH 1MREH 1M7IB 2OLDA 1XZ0B 1MCOH 1S3KH 2CSPA 1S8DA 1YPZF 2X4PA 3W0WD 3H7BA 3HHRB 4PD4K 4QXTA 3V6FB 2IGFH 3THMH 2JJSA 3UTQA 3UYRH 5IROA 3RIAK 1AO7E 1I9RH 4LRNH 3GJFH 5J56B 3MV8D 3P4OA 3HAEG 4B41A 2RAMA 4E41D 5EU4A 4NUJB 1VACB 3MRJB 3V0WL 4JFEE 5EU5B 2NY1C 3C60B 2FEDC 1G7PA 2N4IA 4ORGB 5L2KB 3O4LD 5HHVH 2AW2A 5IB5B 1ND0B 4KK8D 3HZVA 2PW1A 1U8QB 2OS7A 3FFCA 5TQ2L 1CIDA 1A0QL 2GKIA 1KB5L 4TSCL 3WHXA 3WLBB 2M8XA 1LVEA 1NBVL 3ROOA 3RVUC 4FTVD 4M1CD 4PB0H 6FABH 5I1CH 2R39A 2P8MB 2ZSVB 4YFLI 4DQOL 5F3HB 4Z7WB 1AKJD 3BZFB 4V2CB 3GMRB 3TPKA 4N0YL 1M6OA 1RZIB 3QIWC 4MNGE 5AUMA 4PJFA 5SWSD 1LP9B 1YDPB 4OCRH 1F3JB 1MLCB 4B0MM 3BDXA 2VR9A 2A83A 4I0PA 2VLRA 3SE4C 1AGFA 5GGUA 3FN0L 3S37L 4JM2F 3F7RA 5H8DA 3VWJA 3JV6B 4PGBA 4ZTPL 4X98B 4HIHB 4LLVA 2JE8A 3NBNA 1JWUA 2AJYL 4M43L 4I13B 1XGRB 1SBBA 2V2XA 4NWUL 1T5XA 3QQ9D 1PKQE 2BHZA 3SDXB 1KLGB 4OAWA 3RU8H 4ENED 3CFBB 5T3XE 3CPLA 1VADA 1JGLH 2E7CA 4LPCA 3BD4A 1KENH 3S6CA 5FYLH 3TLRA 5LXGH 4PIRF 2DQGH 1QSFA 2LFGA 1RZFL 3I75A 5BZDA 1TCRA 5D1XD 1IQDB 1I9IL 3HR5B 5I8CA 4OF7A 5DZLA 4KI5E 3PWUB 3NGBB 3C8KA 3EYFA 1XR8A 4Y2DB 1T7ZA 2VABB 4CKVX 5F89A 1DVFD 3HC3H 4HJ0D 1Z0NA 4F7CA 4H8WH 4HWZB 3B5GA 4NC2B 3RHWK 1T89A 4KTEL 3TP4A 5KN5B 3N1QC 4Z8FL 4WFEE 2EZ0C 2LABA 3OF6A 1B0GA 3V6OE 1LEGA 1T0PB 2F5AH 3MNWA 3MFFB 3LD8B 4MJ6A 1NDGB 4NFDA 2B0SL 3PWPA 1AR1D 4U0RC 4U49A 5GGVL 2KZ1B 2XXMB 3GJFB 3PUCA 3H8NA 4O4YH 5D71L 3QHZH 5ACMA 1FHGA 1G6RB 1S7SA 4L3EE 1NQBA 2FNBA 1DBKH 1RQ5A 4ZO9A 4U1IA 3G6JA 5F9OH 5J12B 3BJ91 3UTOA 4LARH 4BQ8A 3UBXI 1UZ8B 5GS2D 2VXQL 2B8OT 4IMLA 5IJVB 3SDCB 2DTMH 1FFPA 3TIDB 3B83A 4EI5A 2BVEA 3IFLH 4N0CD 4IOSD 4X6DB 1T20A 1QKZL 4LDEB 2Z8SA 2WM0A 4TPRL 4LVOB 4Q6IC 1MRDL 1HDMA 5F1KC 1KTDB 3GB7A 5C92A 2FECL 5ACLA 3BO8A 1WEJH 4NQUA 4PJGE 3P0VL 2OXGA 3HMXL 3S7GA 5DK3A 4BFIB 2OJEA 1U95B 3GM8A 4OGYH 1UJTA 4YBLC 5KSUA 1I1FA 2VZ3A 4XP6H 3BOVA 1KC5H 4HT1L 5D1QD 4AK1A 2FJHA 4LNRB 3ARFA 5L2KE 2GW5A 1TJIH 4F7MA 4A6YA 3BH8A 4ELME 2AXFA 1T83C 2IC2A 5F7KC 2GI7A 2CR6A 1OCWH 1CXLA 2HN7A 3S4SB 1T3FA 2XFXA 3TH3T 2D7NA 1B0RA 4RDQG 1VFUA 2NW2A 5EPMA 5C09E 4P99A 4Z7VB 2DKUA 4ZOBA 4Z7WE 2AXGB 4XPHH 5ALBH 1YYLL 2WZPD 2ZUSA 1LP9E 3U7WL 1K8IB 3F58L 3MUGA 4OLWL 4U2YA 5C0AD 3T0WA 3LKNB 5AZ2L 5DD3L 3NPZB 4DZ8A 4JQXC 5GQBA 4QRSA 5I1EH 3G08A 4JFDB 2IH1B 4OZIB 1CTNA 3CVHH 1FFQA 4YHPA 3RNKA 3MLWL 3EHBD 5DGQA 4L8BA 5HGHB 1UB6B 3GSVB 1OAYL 3BKJH 1LE9A 4IRJB 3F7PC 4PP2B 4P2CG 1OL0A 2G60H 1JYVA 1R3LB 2VH5L 4MAUH 3CLEL 4EVNA 2ZOKB 2DIJA 3GMLB 4FNLH 2WMPA 5ESQA 1SJVA 5FV1L 3BYYA 3RY6C 5K9KB 3HE6B 3MJ9A 4JRWA 4P4KB 3CSBA 1DBBH 3ZHLA 4JFYB 4X9IA 2E9WA 2X44D 4ODUA 4GRLA 4JM2D 1OY3B 5SWZD 5DURB 4XVSL 2YUXA 3NA4A 4RA3A 3VFWB 4QHUB 5C8JA 3O6FB 4M6ML 3I85A 4G8FB 5IB1B 1LO2H 2ZKHH 3N0PB 4TUKL 4UUJA 1SY6A 4DK6A 4HGKC 3HFML 3INUH 4Y19D 1LE5B 1WSST 1BFSA 1F5WA 5MEPB 5DMGD 1OD7A 1I8MB 5TE7H 5JDSA 3OJVC 2GK2A 3AB0C 3EFDL 1HHHA 4OTXL 3IVKB 1W72H 3Q6FA 1S9WB 3UO1L 4PLOB 5ID1A 4X6DE 3TH4T 5EIIA 3ZE0E 1FNEB 3V4VH 3QCTL 4X6FA 4G9FD 4CJ0A 1BWWA 4G8EB 3WDIA 4X4MA 4IJ3B 2IJ0C 3V4PL 5E8OA 2RFXA 5IROC 5T1KA 4U6YB 3W0WB 2VLJD 4FQLH 3SGKA 3HAEA 3NFPB 4PY8I 4ETQA 1IKFL 2M26A 4ZPVB 1T04A 1INEH 1UCTA 4OLUH 4PJAF 5TDPB 5CKAA 3TC9A 1JPSL 3FQXB 3G5YA 4NIKB 3MV8B 4RRPA 4N68A 4U3HA 4E41B 3HNVH 3MO1A 3GSWA 1U8NA 1KJMB 4BSWB 1KGCE 3DTXB 3GHBL 4QYOB 1VHPA 4ONHA 4XGZA 4HQQH 4ZXBB 3BKCH 5E2VL 4RAUA 4WU7B 4Q9QL 4HS6A 4JPWH 1PAMA 2VZUA 4FTVB 2RGSA 4L1DA 3TJHC 2VQ1A 3QO1A 1TVHB 5IF0B 3VD4A 1EFQA 1F97A 3IDYB 3DV4B 4IIQB 3RWDA 1U8LA 1KN2L 1AKJB 3HUJB 5DUBB 5JLZA 3C5JB 4KVNH 5EORH 3B8YA 1XCQB 4LHUD 5C70A 4N8CH 2YD1A 1BIIA 3MRKA 5SWSB 1D5ZB 4NQEA 1PG7W 3ZKQD 4GMSH 3PE9A 3FO0H 4U1GC 4JFDE 2Z31D 3GIZH 4GW4B 5EB9A 5GIRA 4OZIE 5FKAB 5IR1B 1HHJA 3KPLB 3QO0A 1C5CH 4NDMB 5TE6H 4AQ1B 1YNKL 1I1YB 3ARED 3CK0L 5K9QG 4X7TB 4NPYB 4F3FA 3LQAL 5F8QC 5I71B 5DS8B 1KG0A 2HTKC 3MOBH 1K2DB 3SO3B 2MMXA 2DLHA 3RWGB 2YD5A 5DRNB 4CMHC 1LDPH 4PB9H 4R96B 3QEUA 5HYJA 1CGUA 4H0GA 4BSVA 1FNLA 5D1XB 5CEXA 1W72B 2VXUH 3BMVA 1JGUH 1ORSB 2NQCA 4M7ZC 1MCNA 2K7QA 3WHE0 4W6YB 1RJZB 1DVFB 1YYMH 5CBEA 2H1PL 5CJXC 3V4UL 3ZE1E 1NJ9A 4RGOL 3MROB 4F37K 4L8SA 1WAAA 4L29A 1T21B 2OSLB 4WO4D 5F70A 5CEYB 3IRZA 1AP2A 5GISH 4I3RH 2HFFA 3QUXA 4YGVB 1EERB 4K8RC 3NIFE 1JN6B 2DWDA 2E9IA 4JREC 1LDSA 1A1OA 3MBEB 4FQCH 3BI9X 5ACZA 2NMSA 2BY2A 3GO1L 1DDHB 4NRXA 4TNVK 5D72H 2HA1A 5FCSH 2VXSL 5CEZE 5DSCA 4TSBH 2ZUTA 3TGXA 4ETYA 3DYOA 3ZO0A 1CD0A 3PWJB 5CP7B 1ZGLB 5DVNA 1WICA 3MLRH 5F7YC 4NN7B 1ADQL 2EE2A 4CVZA 2EH7H 5HYFA 1A1NA 4OFKA 2FGWH 4RQQA 5CZXC 1J8HA 3P3YA 4OIAA 4GKZA 2W65B 3P9LA 4OI8A 3W0WE 2XA8H 1CG9B 1CLYL 5DVOA 1Q9LB 3HPJA 4OLVL 1VGEH 1AI1L 5E2TL 4XC3H 2SEBA 1GC1H 3MUY1 2J5LC 3MV8E 5IHLB 4XT1C 2ARJA 3BAEL 1UM4L 4E41E 5BMFL 4OCSH 2HG5A 1HEZB 3QIBC 3VFMA 3ARFC 4G5ZH 1FO0A 5F7LB 2CDFB 1M7DA 4WNQB 2EDJA 3O4LE 1TXKA 4KKCC 4ZAKC 2GK0B 1JZ2A 3BX7C 3HZMB 1OQOA 4JFQB 3TVMB 4YO0A 4DN4L 4FTVE 2PO6A 3B2VL 3PGCB 1YPZB 4QT5A 1IGIL 3E8UH 3IAQA 4M7KL 3TO2B 3HUJE 3HE7A 3EDKA 4XP5L 1UACH 4GKOA 1N64L 2RB8A 1IBGH 5SWSE 3MOAL 5D7SL 5TQ0L 5E9DD 5D9SA 1DLFL 4P3CL 1J0ZA 1OGAA 2YC1A 3WXVH 5FM5O 5LWYL 4Q9CA 4ODVL 3IF1B 2H32B 2BNRA 3HG1D 3NACH 1HE7A 4S1QH 4WTXA 4L1HA 1T1XA 2B20A 4KWUA 3QRGH 4HFWA 4NGHL 4H20H 5HBBA 2IBZX 2IAMA 5F9JA 2DQHH 5C0BB 5IFHL 4M5YL 4MQTB 4PRIA 3OGCB 3TBWB 5JHLL 4DJMA 2DIBA 5EU7C 3QNYB 4YK4C 8FABB 5CGYC 3CFIC 3VW3H 2LU4A 3MLYH 2AEQH 4N5EC 2W91A 5D7LB 3BPLC 4JY6A 5TFSH 3VDAA 4XCYB 1ZT7A 1N26A 3LMJL 1MSPA 4OF0A 4NNXB 4TQEL 2F5BL 2QBWA 1AXTH 3JUZA 3H9SD 1OPGL 1M05A 2D4FA 4FZ8H 4HCRH 4DAGH 3ZE2E 3OKOA 2YZ1A 1X7QB 1XR9A 1YEJL 2A74A 4FQ1H 1Z5LB 4ZUUB 3ZYOA 3OJDB 3LDBB 4JM2B 5SWZB 1YQVH 2YPVL 3IDGA 3NFSH 1UENA 4HAGA 3FTGB 5CHNB 3BQUD 35C8L 1ORQA 1S9VA 3SCMC 4YWGH 4JKWA 5HHOB 4ZD3L 2E8YA 3ALWA 4FP8L 5FK9A 4Y19B 4AIZA 5H2BB 3K4ZA 1N2RA 1FBIL 2HT4C 4MQXC 3T4YB 4BZYA 4OCLC 4LCWA 1JI2A 5DHVH 3S4SG 2XZQH 4YIQA 1GGUA 4M4RA 4CN4A 2ILLA 2YD9A 4LCCA 3Q1SL 1AD0A 2B4CH 3BKYL 1KPRA 3SGKC 4TTDC 4LSTL 3GBML 5I30L 4JO1L 3QDAA 1QHOA 1S7WB 1UQSB 2AK4A 3AS1A 2VLJB 2HLAA 4I18C 3AXLA 5IK3A 1U2CA 2EDNA 2BNQB 3MJ8A 4X6CF 1RZKC 1JTPA 4QXGH 4JO4L 3T4AA 1U8PB 4YNYB 5HPOA 4PLKD 3TNMB 3UMTA 1KJVA 2C3XA 4C58B 4YPGA 4ZFOA 1AGEB 2IMNA 2DICA 2UWEF 4LCYB 3UTTA 4JVWA 4XCFL 1T4KA 3QWRA 4DW2L 2IFGA 2OZ4H 2DQFA 3O3DB 1RVFL 2A38A 2Q3ZA 1ZEAL 1TJGL 2W9EH 2BRRH 5I17A 1FVDB 3L95B 3S98A 2RCSH 1A7RL 1BVLA 3LCYA 5GSRB 1YPZE 2DM2A 3EOAB 2FBJH 3CUPA 4AEHH 1NCBL 1BQUA 3C5ZD 4GBXA 1JFQL 4YHYC 1TZIB 4Q9BA 1MIMH 1NGXA 4I3SL 3UPCA 4J4PD 3V6OA 2BOCA 3OAYK 4LHUB 2CMRL 4TUJA 1RURL 1RUAH 1I8LC 5C0AE 3H9HA 4RFNB 2ID5A 3BIKA 5SX5K 2I5YL 5EDXA 1MF2H 3CMOH 3TT3L 1G7JB 1OM3H 2I9LB 1QP1A 2Y06H 4JG1L 4WI7A 1RUQH 3DBXB 5C0BE 1CFTA 3FL7A 3SKMB 3AREB 3FB8B 4L3AA 3DX7B 3ILQD 3KR3H 2XZCL 4CVWA 1TPXC 1R3KB 2YBRA 4LLDB 3OKNA 4BZ2H 4UNVA 1M7IA 4WV1A 5ANME 4MXQD 5JXAH 1DBAH 2X89A 4RFOH 1B2WH 2BFVL 2DQTL 1XZ0A 4ONOA 5DA4A 2G75B 4P2RD 1RU9H 1RD6A 5DJ2B 3MYZA 4ZS6C 2ZSWB 3WO3B 2Y4SA 1WFUA 5C08A 3G6AB 2VLKD 4NYLB 3SE8L 3C09C 2CUIA 5SWZE 4NM4H 3ULSB 2F19H 3RL1B 3VXQB 1REIA 1VACA 3MRJA 3QUXC 2DRUA 4WO4B 2FYYB 1H8NA 5CAYB 1FVCA 1TIUA 3C60A 4ORGA 5L2KA 4MAYB 1NKRA 1EGJL 4JRXD 4NZDA 2VZ1A 4OGXH 1U8QA 1R5WB 1WBZB 3E2HC 4JFOB 2H2SD 3EOTH 4Y19E 3CXDH 3WLBA 4YLQT 3VU2A 3T0EA 1HXYA 4H25A 3O6KH 2AQ3A 5JOEA 4RISL 4K07A 2WSKA 2FHCA 12E8L 4WI6A 2ZSVA 3RTQC 3OAZK 4M5ZL 4M9PA 2J8UF 2DF3A 2W38A 5F3HA 5HHPB 2COQA 3BZFA 1YY9C 4C57C 4U1NB 3GMRA 3G6DH 1RZIA 4OCXL 1U9KA 1YDPA 3RBGA 4KJYB 4YDVA 2VLJE 5EBLA 1DEEA 2BNQE 4QTIL 4G6ML 3F65A 4X98A 4U6HB 4HIHA 1CVSC 5EBGA 2NY4D 3ULUF 1MHHB 4G7YL 3SDXA 1G9MC 1FIEA 1KLGA 3CFBA 4KRPC 4IOIB 2QL1A 3EO9L 1QLRB 2CGRL 1K6QH 5FA3B 5EG6C 2GIYA 1FL6B 3PXHA 1A9BB 3PWUA 5DQDH 4D94A 1BMGA 4Y2DA 5ENWB 3O2DA