5I6LA

Crystal structure of copper nitrite reductase at 100k after 2.76 mgy
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 91
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6lA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6lA02
1X9RA 2B08A 3TASA 4HCIA 3FU7A 5D4JA 2YAMA 3PPSA 3UABA 4YSSA 2PP7A 4L0PB 3QJSB 5B1JA 3QJVB 5I5IA 2PP8A 3CVBA 1SF3A 5AKRA 1AG6A 5PCYA 3X1GA 3H56A 3ZX1A 1GY1A 1QHQA 4BWWA 1VLXA 2GI0A 1HFUA 1TEFA 5B1KA 4DPBX 3ASNB 1KDIA 1ET7A 1PCSA 8PAZA 1OE2A 3S3CB 3NSCA 3SBQA 3SQRA 1NINA 3WG7B 1F56A 1URIA 2DV6A 1NDTA 2FT8A 3CDZB 1DZ0A 1UATA 5B7MA 3HEIB 1AZRA 4KO6A 3S3BB 1WAEA 1J5CA 3FSZA 4JHVA 4AZUA 3OD3A 2PCYA 2EIKB 1L9OA 1A4CA 1AZUA 3T6VA 2VSKB 1AACA 2PP9A 2FQGA 1WS7A 2GHZA 1A65A 4DP8X 4FAAB 1W8EA 5LDUA 3ZBMA 2CJ3A 3PLYA 1SJMA 4E9QA 4G7QB 3SBPA 2XX0A 1T5KA 1E67A 3BVDB 1ZDSA 2XV0A 3FU7B 2IWEA 2GB2A 1ASPA 1TEGA 2P80D 3CVDA 4N4YB 2IDFA 2XV2A 4TXVB 1GS6X 2CCWA 3PCYA 3V9EA 2HX8A 1BQRA 2CAKA 2VM3A 4GY4A 2HXAA 4AKQA 1PNCA 1MDAA 1SNRA 1ZIAA 3T6XA 1SDDA 3QJQB 1JZHA 4NAJA 2J57A 2UXGA 4HHWA 4AI7A 2IDTA 2R7EA 2Y69B 4BWTA 1OCRB 3ABMB 2VMJA 1JXGA 2I7SA 4HCGA 5F7BA 1OOWA 4KNUA 1PLCA 2GC4C 4M3HA 1WA1X 4E9WA 2FWLB 6PAZA 1NWOA 1QLEB 3CDZA 4BXSV 2BP8B 4E9YA 4JHUA 2BW5A 1WA0X 2EIMB 1RZQA 2QT6A 2CBPA 4HIPA 2BWIA 1ILUA 3ABKB 4HCFA 1ETJA 4YVNA 1AANA 1XB6A 4DP5X 5E9NA 1BQ5A 3S8FB 1CURA 5B3SB 3NP3A 3NYKA 1ZV2A 2Y1AA 1FWXA 1E5ZA 1PY0A 2MTAA 2RACA 5I6PA 4UANA 2QDVA 4QKTA 2HX9A 3NJNA 1EZLA 3T9WA 2VW6A 2FQDA 3X1BA 1V10A 2JKWA 4YSAA 4CSZA 5I6KA 4DP2X 4F7KA 1CYWA 3NSDA 1L9PA 2GBAA 1KCWA 6PCYA 4G7SB 2JXMA 2XXGA 2PPDA 4GXFA 3PAVA 4DP6X 3S3DB 2YXWA 3T71A 1SHWA 4A67A 2UXVA 3AZUA 5I5JA 1M56B 4DP7X 2WO2B 3H4FA 1SFHA 2IWKA 1B3IA 4KNSA 2WSDA 1AG0A 4P5SA 3FT0A 1NIDA 2YAOA 2YARA 3OQRA 3C75A 2PLTA 1FFTB 1PF3A 1AZNA 1XB8A 1KCBA 4DPCX 1IBYA 1NIBA 2J56A 2YXVA 4YSRA 2IDSA 3NP4A 4CSPA 2XLLA 4PCYA 3NJJA 4A66A 1PLAA 3JT2A 3NT0A 1KBWA 4M4RB 4A2HA 4A2DA 3CZUB 4AKPA 1ZDQA 3NJMA 3FSVA 2X87A 1AAJA 1JERA 2OJ1A 2E86A 4DP4X 1ET8A 3EHBB 1OF0A 2WO3B 4E9RA 1BQKA 3ABLB 4QLWA 2XWZA 3FYEB 4WKXA 2ZONA 1CC3A 1ZIBA 3QQXA 4K9JA 3AG1B 4DP0X 1ID2A 2IAAC 1J9TA 4E9VA 4YSUA 1JZIA 4YSEA 3ASOB 2XX1A 1NPNA 1BYPA 2B3IA 4KOBA 1IBZA 2OV0A 3DKHA 3RYMA 4HHGA 3AG4B 1QNIA 2UXFA 1NWPA 3FYIB 3X1EA 1RZPA 2YAPA 2AZUA 2BO0A 4GP5B 3FQ1A 1AS6A 4HAKA 1BYOA 2HX7A 1BXUA 2N0MA 3N2JA 3MBWB 2YAQA 1MZZA 4ZK8A 5I6MA 3H4HA 2GIMA 1NICA 2IH9A 4DP1X 1BXVA 1IC0A 1KBVA 2W8CA 3ZDWA 3KW7A 1JXFA 1BEXA 3IE9A 4PAZA 2DWSA 4BDVA 2Q9OA 2J5WA 1KGYE 3QJRB 2I7OA 4YL4A 5B1AB 2GSMB 3UGEA 1SF5A 1JZGA 5FC9A 3QJUB 3GYRA 4W1TA 1XMEB 4A2GA 3OM3B 1KYAA 1PLBA 2LLNA 1MG2C 2PPEA 1KV7A 3AW5A 2PCFA 1W6LA 3EH4B 3FSWA 1GY2A 3EH5B 5TK4A 4KO7A 1A4AA 2EINB 4E9SA 4W9ZA 1N68A 1PAZA 4BDVB 3ABGA 3WNJA 3WIAA 4AX3A 3ERXA 1AS8A 3ZIYA 1MG3C 2TSAA 2CALA 2J55A 1AS7A 2ZXWB 3HB3B 2Q5BA 2FQFA 3TBBA 4GP8B 4YSPA 1L9RA 2BHFA 4RH4A 3N55A 2AFNA 1RKRA 1PZBA 4Q8BA 1M57B 4KO5A 3NSYA 2XXFA 1L9TA 2IH8A 3MX0B 2DYRB 1OCZB 3NJLA 3NJGA 1AR1B 2GC7C 1PNDA 2IWFA 2JFCA 1GS7A 3IN2A 4F2FA 5B7FA 1ZPUA 1W6WA 2AVFA 3FU9A 4N8UA 4G70B 1E30A 4P5RA 3T6ZA 2A3TA 1AQ8A 4JKNA 4KOCA 3QPKA 1NIEA 1A3ZA 2IDQA 1BAWA 2VSMB 1WS8A 1L9SA 2UXTA 5I6OA 1GSKA 5D4HA 2H3XC 4YVUA 7PAZA 1NTDA 2AANA 1HAUA 1JVLA 4ENZA 1GS8A 2PPAA 1PZAA 2AZAA 2X88A 3D12B 4AKOA 1NIFA 1RCYA 5IY5B 1AZBA 2FT7A 4YSOA 2BW4A 4YSQA 3NJIA 3PAZA 1IKOP 2XYBA 3U25A 2HZHA 5AFAA 1J9QA 3AG2B 3BQVA 3PXLA 4WTQA 3OMIB 4X4KA 5A7EA 4BWUA 3EH3B 2QPEB 1OE3A 1SHXA 2BP8A 5B1JC 3WKQA 4A2EA 4F2EA 4HZ1A 3DIVA 2VN3A 5F7AA 4A2FA 1L9QA 2FQEA 4MFHA 2NRDA 2BP0A 3UAEA 2OCCB 1AZCA 2H47C 4BXVA 3KW8A 1E65A 2QDWA 3NJKA 2R7EB 3UAAA 4DP9X 1XB3A 5EHFA 5I6LA 3EF4A 1A4BA 1GW0A 1A8ZA 1E5YA 1OCCB 2EILB 2PPFA 3FS9A 3FU8A 2VM4A 5I5MA 3NJHA 4YSDA 1TKWA 1X9UA 1OV8A 2XV3A 4Q89A 3OMAB 2DYSB 1PZCA 7PCYA 1J5DA 3NJFA 4UF7C 4NERA 3WKPA 1GR7A 3WNIA 1R1CA 5B1BB 1I53A 4NB7A 4BK5C 4EF3A 4YSCA 3CVCA 1JVOA 4GYBA 1SDDB 2UX7A 2ZWNA 2QPDB 3QJTB 5TK2A 3TBCA 2MRYA 1N70A 1HAWA 5I28A 4GP4B 1AOZA 3S8GB 3X2QB 1KDJA 4G72B 2VW4A 4FA7B 1FA4A 3PAUA 1ILSA 3X1NA 3TU6A 1J9SA 2CUAA 3FSAA 1MZYA 2HRHA 1ADWA 3FQYA 2W88A 1SFDA 3OMNB 3X1FA 1NZRA 3G5WA 1EHKB 2IDUA 1GYCA 4E9TA 2P80A 3JTBA 2FT6A 1JZFA 1NPJA 1AIZA 2TSBA 1V54B 1WA2X 4DPAX 3IEAA 3FQ2A 3GXUB 4YSTA 2H5UA 2UX6A 3UACA 3CG8A 4E9XA 1IUZA 1BXAA 4HALA 2ZOOA 3DTUB 1ASOA 2YQBA 5B7EA 2YAFA 5D4IA 4KO9A 3AG3B 3WI9A 3NSFA 3L45A 2FNWA 1JZJA 3FPXA 5AZUA 1CUOA 3IN0A 2I85A 1DYZA 1TU2A 3TA4D 2XU9A 1ASQA 1OCOB 3IBOA 2FTAA 3FPYA 3GDCA 1YLBB 5I26A 5PAZA 1V55B 2YAHA 1OE1A 2HLEB 1JXDA 2HRGA 3AY2A 9PCYA 1NIAA 4KNTA 4G7RB 2YAEA 2BZ7A 1JZEA 2FJSA 3UADA 5ANHA 3T6WA 4G71B 1CYXA 2BZCA 1M9WA 2PPCA 1PMYA 2BP0B 2EIJB 2XVBA 3SBRA 2DY2A 2BWDA 2VW7A 4UAHA 2XUWA 1J9RA 1ET5A 2DWTA 1JOIA 5I6NA 3V9CA 4A68A
chains in the Genus database with same CATH superfamily
1TSRA 3OG6B 4I18C 4FZ8H 2OXGA 4ZJ9A 3WHXA 1AYRA 3S4SA 3IYLW 4PJGB 2YJQA 4ZS6D 2NY1C 5IJBC 3QJVB 3JVGC 4DN3L 2D2CC 1SF3A 4M7JL 5JPNB 2VDOL 4PWHA 5GS0H 4GKZB 5C0EA 3F12B 2CLRA 3C60C 3H3KA 3II2A 4GS7C 2X4QA 1N2RA 2A4CA 1HFUA 2GI0A 2I9LA 1U8CA 3MLSH 5D7JA 5DHDA 5FYJU 2ZT9C 3B9KA 4U6VH 4YLBA 1IAKA 1I8IA 2Q8BL 1HNGA 4NNXA 3W82A 1SBBA 2ZJSL 4X98A 2Y0SA 2PW2B 1FFQA 1PEZA 3GBLA 3RVTC 2DV6A 5MP6L 1MCSA 4WGKA 2HT4C 1FVEB 3FL7A 5JDSA 4F2MA 3M8OL 5KTEL 3TEWA 3ARDA 3AY4C 3RU8H 2PXYD 5IVXE 3FB6A 3DGGA 4AZUA 3CIAA 2NY4D 1I1YA 3TYGL 3HFFA 1KPRA 4K3HA 1NMBH 4PRHB 4M1GL 4YDLC 3VD7A 4RMBA 4FLQA 1WD8A 4QRSA 3C2AL 4LQ1A 2FQGA 1EHNA 1YECH 5J6SA 3ECBA 3OKMA 4XP6H 2EE3A 5BS0D 1W8EA 4BZ2H 4BFRA 4ZYKA 2JCCF 3S4SB 5T1LD 3WHXB 1R5WA 3BN9D 4CC4C 5JHLA 3GUFA 5JPMB 1BZ8A 2VO8A 4DKEH 3RGBA 1XF4A 3HG1D 5LQBH 3BP7B 1AHWB 2X89A 3H3PH 3LH2L 5KZCB 5F88A 3CN2A 3LN4A 4TXVB 1A6VL 3PCYA 3AAZB 3QWRD 3PABA 4J3TA 4L5FE 4U3SB 4YBQD 5CWSA 5F7FA 3OGCA 3RNKA 1VZGA 1PG7X 3W0WA 1TQCB 4ANKA 3QJQB 2DQTL 3O2WH 1N5AA 4C56E 1RHFA 3AS2A 5KVDL 4R2GD 2R69H 2IDTA 4BWTA 1PFOA 3KPRE 3MR9B 1O6SA 5D7SL 3VI3A 5FYLD 1ML0A 3R0NA 5EC2B 3RB7A 4UDUB 3CVHA 5HYJB 4TULH 5I6XB 1RUAL 1N6VA 4APXB 5DMJB 1U2HA 2VISB 3WSQH 4JO3L 5CILL 1EZSA 4J3OG 4XVSL 1X4ZA 3TJHD 2BMKA 1JZ6A 3MGOA 4FLOA 1BZ9A 1MRFH 2YSTA 1BREA 3L48A 5TDOA 4M02A 5CP3A 2AK1H 1UCBL 5HJBA 2CRMA 5DA0B 2KLRA 4DGWC 1LEKA 2C9VA 3HHSB 1A4KB 3QK0A 1JGLH 3CDFA 1TKWB 4MAYD 5I6PA 3FOLB 3VFVA 3NCEB 5DO2D 3PF2A 1NUGA 3PWJB 3WKMH 4R4FL 3QUZD 3X1BA 4AT6B 4CSTA 1MH5A 1WFIA 1P4IL 3R8BB 3RA7L 3S35X 1LDSA 4WDIB 1TUPA 3H6AA 1ZANL 2GJ6D 1SQMA 4MQSB 4YPGA 4HUWA 4MA1B 1CD8A 2NR6D 1I3UA 1UXSA 1A6TA 4LLVA 1WK0A 3I3EA 1QSZA 3QUYC 3W0WE 3D25A 2JK5B 2XZCH 3CN4A 4IHBA 1B0IA 1FG2A 2IAND 3S3DB 3WIFA 1M71B 3PPEA 4JCMA 4WW2A 3RY6C 2ROXA 5E8PB 2OTWB 2ZKYA 4MJ6B 3AZUA 1QMUA 4J8QA 1SVCP 2BM3A 3ZN6A 1R5IA 4PJFF 4F5CE 2F2HA 5E4EB 5IBUB 4ZUWB 2QGCA 5JOPE 2AF2A 1G1OA 2ED6A 4OF0A 3TZVD 1XGRA 1OZUA 4PY7A 5EU6B 4K9EH 5L7XH 3G5ZB 4K9EL 5L7XL 1U8JA 3RJQB 4XN1A 2ZOLA 3AXHA 5GJSL 4JFEE 4XGZB 4M48H 2YKLL 5ERWB 3L5WB 4U6TA 5TH2A 5KANI 3G5XA 5ISZA 3BE1L 3HE6D 4ZMPA 4WO4A 3P73A 4U1HB 1FSKC 4GPVA 3GBMH 3LDBB 2VUKA 2AJXH 3EYUH 3LKOB 4BH8B 1S7XA 1XR8A 1ZDQA 3HLKA 5D7IF 5CM1A 4JFEB 2FATH 1IGML 1U8HA 4JM2D 4NP4H 3L5XH 3HR5A 4A7TA 4AG4H 1HOCA 3MFFA 2NNAB 2IAMC 1DLHB 4FRWA 2H0EA 3JV0A 3LQAL 4R84A 1OF0A 4NAMA 1OKEA 1IM3B 2B4CL 1BQKA 1OIOA 4KK8C 5KAQF 4H1LH 1KGXA 1E42A 1TJIH 3QA3A 1FORH 1FDLL 1XGZA 1G6RB 5DHMC 1Z3GL 3VI4E 8CGTA 2ZCKL 1YNTB 1CTOA 3MDJA 1DJIA 5DMKB 1Y6KR 1HZLA 1ZKAA 1ND0A 1IQWL 3EFFB 3QP3A 4HBCH 2FSDA 3MRGA 4PJAA 1MJUH 3NACL 4MBOA 2VXUL 4N0FB 1SXSA 3T1FA 1RZPA 2BO0A 3A23A 1EJOH 4LCCC 1BVKA 1F3RB 4TNEA 5T1MB 3C6LC 1BYOA 1S5IH 4PI0A 4LFHD 3ZW3A 3AGWA 4S2SA 1T1WA 5D2NC 1S7XB 2YQGA 2WVTA 4X6CB 1FZJA 2DJUA 4UM9B 1SXCA 1MF2L 1NICA 4G9FA 3TZVC 2BSBA 1Z9MA 3FUNA 2H26B 3O2WL 4D9QE 3IE9A 3KWVA 1C7SA 2N01B 3L6FB 2IQAB 2X1WL 3BSZH 1I9RH 4BV1A 4GT0A 1BIIB 2ADFH 3WY4A 5HD8C 5FC9A 1CGUA 4Y5VA 2MOVA 2WQWA 4JO1L 3CSPA 2E7DA 1E3XA 2A9ML 3WV0A 2VQUA 1KYAA 3B7SA 3QI9B 5CJ5A 5KS9F 3KL3A 3IFNL 4OIIH 1XGTB 2OQJB 5I0WA 1QBLH 4DQOH 2Y5TB 3S96B 1ZEAL 2GSIB 2YN3A 3POHA 5A3IC 3I85A 2GIXA 2MCPH 4YGAB 5K1VA 3GXIA 2CXGA 3WJLA 2KZBA 3RGVB 3VSVA 5TDNA 1CFVH 3ERXA 3EYVB 4DKTA 5IESH 1HSBA 2ZSVA 4DZ8A 3TJEL 1KXTB 2N3JA 4AWJC 4MD0B 2X70A 4Y16B 4O4YL 2IPUK 3TA3B 1BQLH 3TBTB 3V6ZB 2NQDA 1G7HB 1WC7B 1WRFA 3NSYA 2R9HC 2IH8A 3OQ3B 1WD9A 4ZX4A 5KSAB 1RUQH 1FFRA 1NJ9B 5K33A 4W6WB 2VMFA 4Z7NF 3T2OA 2OX5A 4B0MB 5ALBH 1U93A 1FO0H 2MOGA 4RDBA 4Y2DA 1NDMA 5DJZB 3BP5A 3GNML 3FU9A 4IKLA 4YBLB 5F8QC 1BF2A 1E4KA 1IC4L 3MLZH 1T1ZB 4WTXA 5CIPH 5FO9A 1MCBA 5HBBA 2NX5B 2CIIB 5T3XD 2WSPA 3WJMA 3FN0H 1JFHA 1L5GA 2J8OA 3NPSB 1C8QA 3DMMC 1EZVX 4NHCH 2OR8A 4XXDA 1AR1D 4JY4B 1VFBB 3CMOH 4YSOA 3SOBH 5CFAA 2JE8A 2R29L 3RWGA 1VCAA 3A67L 5HD8D 4Y1SA 2GEEA 3EADA 3MV7D 4YAQB 1YYMH 4KRPB 4QRQB 4G1EA 1J8RA 1QA9B 4FEMA 2YO3A 1BVNT 5DEGA 4DW2L 2WTOA 5E2UH 2R27A 3VI3F 1CFQA 1PZDA 4X0NA 5E2UL 3V4UL 3HN3A 3K1KC 3QI9A 3EXJA 1EX0A 1R5WB 4LMQI 5J11C 3WXWL 3TBSA 2VM4A 1IARB 4N5UA 1TKWA 1BPLB 4NWUH 4WUUB 4BE6A 1M1XA 1U42A 3A0OA 1PX3A 4LBAA 4GXVL 3WKPA 5CF3A 1TPXC 2F19L 4FXLA 4GRLC 5HGHB 4ENED 3PV6B 3C09C 3MOQA 1UQSB 4JHWL 3Q6GL 5T8IA 2YQ2A 3U0WL 2YEVB 2BFVL 3RIFK 1JNLH 3UDWC 4HS8H 1OP9A 2GABA 4KXZI 3JBG7 3U1QA 3QEQA 3FZUC 1FG9C 4JL2A 4K15A 1U8MA 4X6EB 2QSVA 3WKNA 4YWGL 3DYMA 3T0EE 3VWKB 4UDUA 4AGQA 1DANU 1I8AA 4EI6B 1R3KB 3RNQB 2W88A 4WEBL 1MHPL 2W65B 4P4KB 1M05A 4X8JA 3RZCB 4FQXB 1NUFA 1QNZL 5DVLA 1RUML 5GJTH 3IMUA 5JPNA 3NCBB 4N3TA 3QIBA 4KV5E 4JPIB 5HDBB 4S2SB 4H20H 2J6EL 3ATFA 5EORL 3QZMA 2OXGB 3GD1C 3VFSA 4HWNA 1Y18A 2I5YL 3ZQ9A 5IW6B 4P2RA 4ZD3L 1JZ8A 1N0LA 3DTUB 4QOKB 1V3MA 4JG0L 4FABH 2R4RL 4U3CA 1OAXL 3G08B 4MMYB 1JTOA 3OLEA 1R47A 2AJUH 4QLRA 4NAQA 1ZLSH 3UTSB 1HZKA 2J72A 4FQHA 4JE4B 5KANG 4MDRA 3PDGA 1D9KA 1F45A 1WZLA 2V3EA 4P99A 5A7BA 5FW8A 1NGYB 1RJCA 4PP1D 5HTSA 3G5VB 1GGBH 2PWHA 3FPYA 3NSJA 3E8VA 4LNRB 3O8XD 1I9EA 5PAZA 1DANT 2YAHA 3P73B 4MNHA 4U1HA 3VGAC 4H1LA 2FZ3B 5ISZB 1WBYB 3MFFB 4G7RB 4NOBA 4DESA 1WAAF 5AVRB 5EF0A 4U0QB 1U95B 3PGCA 2YFNA 4QTHB 3M07A 3X11B 4O2EB 3GSVA 3QAQA 4XGZA 1CN4A 3MJ6A 2LOEA 2X4RA 4ZFQA 2PPCA 5GXBB 4N5EC 2BP0B 1XCWA 3BH4A 4KU1A 3VWJC 3ZDZB 5KSBA 4NRZA 1KFAH 1CE1H 4L4TB 3QXVA 1J5HA 4PY7B 2VXSH 5EU6A 4ENEC 5LXGL 4ETQA 4FNUA 3FTXA 2APXA 1BJ1J 1JG9A 2VYRE 1SY6H 3DK2A 1LYQA 1J86A 1F8TL 2DWYA 5DZOA 2J1ZA 3MBEC 4KHTH 3G6JA 4YZFF 3WUWA 1CB4A 1MFEL 2A99A 3AJ7A 5AAMC 5D6CA 3J8F7 1TNNA 3KVDD 2AQNA 2EE0A 3NJVA 1AGDB 3LKPB 3VXTA 5E94A 1D5MB 1AGCB 1RUAH 3FHAA 1KUMA 1OVZA 1W15A 1QEXA 1ZAGA 2VLKB 4MVBC 4DWHA 2Y2WA 1F56A 2DWEA 1OAYH 3N41B 3T77A 4YIQB 2JNZA 4CMHC 3DJ9A 1EXUA 4K94L 4QXUL 1OAQL 1OF2A 2E7LC 3BWUF 3M7FB 1I1CA 5KVFE 1T3FA 3IRPX 1CE1L 1KFAL 3GSNH 3QWNA 1MWAB 1XL4A 2R1WA 5MERB 4HSQA 4JFVA 2H2PC 1PG7H 3QDJB 3SCMB 4UV7L 5D7KD 4EOWH 2GTQA 2YA2A 2IJ0C 3WO4C 3UCRA 5C6PB 1T5KA 3RL2B 4L05A 2IPKB 2P5ED 1OB0A 2ZAHA 3PE9A 3VXQA 5JQHC 3Q06A 5F89A 1UM5L 4AOFA 3HHSA 1FYTB 1BD2A 2EP6A 3IB4A 4XN4A 5DDHA 1WBZB 3L9BA 1W72H 2ZD0A 3R0MA 4PCKA 4WFEE 2E76C 2CCWA 5J13B 5DLML 3RGVC 3H9YA 3WHE1 4M7LL 1IRAY 3WN5C 3DBXA 4JZOA 5A2IH 5T3XL 1PNCA 4OM1L 3KPSD 4ODVH 3K71A 4PB0L 2FH6A 2LU7A 5JHDD 2OS7A 1VFAB 4HULB 2EIEA 5AOZA 2HKHH 1F0LA 1QI5A 3VI3B 2C26A 1L3NA 2YEZB 5I1JL 1GZHA 2NXZC 5L6YH 1P7HL 3ORJA 4H40A 3CXHJ 4XCNB 3TJPA 4AQOA 3DRTA 2HVJB 3REWB 1L0XA 1RQ5A 3VGDA 4GQRA 1ORSB 4XP4H 1GIGL 4JJ5A 2WXIA 2UY6A 2NW2B 3IDMA 2VR4A 1RUMH 5FA3A 4Z7NB 2BP8B 3DC0A 4WI7A 3RWHA 1DQTA 5JOPD 1TDQA 3L54A 5TE7L 3DRTB 3D30A 1K2DA 4JO1H 4BM7A 4U1NA 3OJDB 1MCJA 2O6PA 5DD3L 3RHWK 2CGYA 4Q0XH 3BYYA 3JV5A 3C5ZC 1MUJB 1EMTL 2LFEA 3QDGD 4NNPL 5DURB 3ZZLA 4DK3A 1Z5HA 2O5XL 2Y1AA 5DFVC 3VH8A 1N67A 1R24B 2DLFL 3F7YB 1AHMA 1LE5B 1QPPA 3T9WA 3VRIB 4JHWH 4DFHA 2VQ1B 1I9JH 5HVFB 2VJ8A 5I1EH 2WO4A 4KKCC 4MKTA 5IFAL 4HJUA 4ZXBC 4M93B 4F57L 1BAFH 4Z95L 1WHPA 3S3JA 3LOWA 3V4PB 4MWFA 4DZBA 4RZCB 3O3DA 4DOHB 4PY8J 5EU5A 1QR1A 2CDFA 3QNXA 2EYTA 1IL1B 2PPDA 2X4QB 5FDWB 2B20A 1JGVL 2WJ5A 5C0EB 4BGDA 3GPEA 4XPTL 3FFDA 3HG5A 5IMOA 4L8DB 1FL3A 2FD6H 2XA8H 1JF6A 1OHZA 1YYCA 4NNXB 1X5FA 2A6IA 5D1QC 4JO3H 5CU5A 3BLKA 1LP9E 3DI3B 1I3RB 4G9FD 2XWDA 4N9GB 4KXDA 4AQEA 3U1SL 4CNIB 4Z7NE 5D7SH 5JXED 3BKMH 4Q74A 4NDMA 1BAGA 1E28A 1JRHH 5B21A 5CLYA 4CL7A 3WO3B 1XGQA 3HNTL 4FERA 1MQKH 4ZS6C 1OB1A 2J56A 4RAVB 4X9BA 1OCWH 3BKJH 1AGBA 1KLGA 2ZP8A 3SOBL 3GM8A 3NP4A 5CN3A 1F58H 1OLZA 2MSPA 2ROYA 5SWSB 5KVEE 5AD0A 2YXMA 4NHCL 1B4TA 4V2CB 3U30C 2VL5A 4G6AC 5E7BA 2V5YA 1VADA 3FSVA 3VDCA 2NY6B 2CGRL 4KGLA 2XG4B 3UROR 1E27B 2YRLA 2O26U 3V9FA 3VMNA 4F91B 4LKCA 3IXTB 4KXCA 3MLYL 5ADOH 1BX2A 1DUYA 4E9RA 5T33L 4IRJD 5ALBL 1N19A 3UTPE 4GIPD 2EDLA 2J8UB 4PV8A 3V6OC 2ATPA 2XPGB 1MVYA 2IGLA 4XNBA 3WDIA 4OD1L 5FGBA 1EAQA 4N2IA 3V6FA 1ULVA 2KDGA 1MJJA 5LG1A 3BZEB 2NY1B 5FYKL 3QDJE 3SGEI 2X0VA 5AW1B 2MPAH 2OZNA 1GSMA 2VABA 5ID1B 4YDJA 1HL4A 1U8LA 1JP5A 4XCEB 2CK0H 5FO2A 3RWEA 3S88H 3ULVE 3BPNC 5EEVA 3RTQA 4IK7A 1G7JA 1QI4A 2NZIA 1QAWA 1VAHA 1YUKB 2ENYA 4FQHB 3VGAB 4FF9A 1MIML 2XWBA 5HHME 1ONQB 2O61A 3K6SA 3QUMA 5IB1A 1P4IH 3RA7H 2IGFL 1KCUL 1BQHA 4OLZL 5E4OA 2Q9OA 5I16B 1FVDB 3MNWA 2WVSA 1IE4A 2WUBL 3T8VA 1SM3L 3INOA 3LNIA 2GSMB 4YUEH 3MZTA 5ETUB 1D9KD 1KYUA 1TVBB 4LLMA 4KKLC 1EGJA 1NFDE 5I0DA 2ZG1A 3GMQB 3QPQC 2DKMA 5GGTH 1AP2A 4HOZA 3PQYE 4PJ5B 4PJ9C 2DLIA 2HAZA 4YBQC 3VI3E 3KPPA 3HZVB 4POUB 3GSUA 5FFLA 3RVUD 3NFNB 2GJPA 3DTXA 1H5BB 3IJEB 4ZFGH 1S9WB 2JELL 2NYYD 5J0BA 3KYKH 4JM2B 5EU4A 5F7EH 5FK9B 1X5KA 1T89C 4LAQH 4OGAD 5ABDE 3AGVA 4GQQA 4D9QD 1CCZA 4WZ9A 3MCKB 4PIRF 1FZKA 3B3BA 1MWAL 2EDQA 3VXME 3WEXA 3O81A 2BK8A 2Z93A 4Y19A 1LK3L 4LOUD 1KGJA 2EECA 2WYIA 4RFOL 1GZPB 2EZ0C 3G6JE 4QGTA 5IUSA 1CFQB 3QFGA 1U8IB 3D69A 3MACL 4G3YH 4UUJB 5FHAL 3EHBC 1MCEA 2CK0L 4F8NA 1HHIB 4KOCA 5DI8A 1BQHG 2IDQA 2XWRA 3JWNC 1TR7A 5DEFB 4YVUA 4UIMB 4N3UA 3STZA 4NQEA 5LBSL 3CAFA 1IEHA 3SQBA 4G42A 1CDCA 2X88A 2Z7WA 2NLJA 1VEMA 2R0KH 4EKXA 2WGXA 1WZ1L 2R0ZH 3U25A 3NABH 3QIUD 4KITB 3MROB 2XETA 4KI5C 1DBBL 3AG2B 3WE6B 1TITA 2C4FU 2V17L 4X80H 4F2EA 2I60L 1Q9WA 4HPYH 3MRRA 3QPQD 4MAUH 3LEXB 4OCXH 4HK3N 3QUYB 4N22A 1R0AL 2CGRH 4Q6IA 5C86A 5IFHL 1BW8A 2F53A 3O41A 1J05B 2HFGL 3W9DA 3ZRFC 2JCCE 1DSWA 2OMXA 2R7EB 4OCLC 5BRZD 3CU1A 2P9RA 4OY9A 3EF4A 3M46A 5H2BA 5KYUA 4ZAKD 4ZMNA 2G3MA 3T0VA 4OZIA 4JRYB 1U93B 3A6CH 5JPNC 2JB6A 3F7LA 5GGVY 3NAAL 4X2UA 1ZLWK 2C3VB 1VACB 2A1WH 2CKBL 2ORBH 4LARL 4M9PA 4MAZA 3VXSE 4NO3A 5I1KL 3DUUA 1B4RA 1D3CA 1J5DA 1RU9H 3UZEC 2GPZA 5D96C 4XP1H 5DS1A 3MA9L 1KYOK 3GS7A 3WNIA 4KVPA 5DK0B 4KJPC 4PJ9B 3HI6H 4TRPH 3QJOA 3WEBA 4UB0H 2COQA 2X4NA 3RQ3A 2ZUYA 3CHOA 4Y2DD 2QPDB 3TBCA 3O11A 5CEZE 3RL1B 1LO3H 1A64A 3DBSA 1G87A 5D2LA 4NZRL 5J9PB 5IB2B 2C7UB 4G72B 1NC4D 3QIWB 5IB2A 1X6LA 4GSQA 5DUBB 4UTAH 3EHBD 6FABH 1OZTG 4R0LC 4QOKE 4M3JA 2BOCB 3GSXA 5FGCB 4QEGA 2C1OB 2Z35A 4UOW1 3JTBA 4U49A 5HY9A 2NZ9C 4YC2B 3IF1B 3CWGA 3HFMH 3E7JA 4OAWA 1Q94B 4UB0L 5E1QA 1KSRA 4TULL 2B1AH 3K8LA 3BIKB 1V7NL 3PIQB 4CUCA 2C3VA 3V0WL 3CG8A 3LEYL 3UYRL 2X6MA 4HD5A 2R8SL 1KOAA 2EDWA 3HUJA 2C9RA 3GI8H 1INDH 4WFHD 5HSFA 3SKMA 3O3DB 4M5TA 5A40E 3ARGC 5B7EA 4ZQKB 3VSTA 3ATDA 1QTSA 1W16A 4M5YL 5KSUA 1VSCA 3MUJA 1FUNA 3LSOB 4B7IA 1JZJA 2DQMA 3T8MA 4FXGC 5FCUL 5CP7B 3BQUA 3ML8A 2HN7B 5KYXA 5EUOB 3QJZA 1UWXH 1LD9B 4P5TB 3RPKA 2Y72A 5JR1L 4XAWH 1HSAA 2HLAA 4GKSB 5AB0A 5IFHH 3P9WB 4P9ML 3LH2H 4YX2H 5FYKE 4YFLI 2D3NA 3BO8A 4G8IB 4K9EC 3P77B 3CCHA 5KBPA 3I50L 2GCYB 1ND0B 4JKMA 3CN1A 2SEBA 2BVOB 1YEJL 4WHYG 2A6DA 1HILB 3TN0C 3VCLB 3SODB 1WUNT 2WN2A 1CYXA 4WW1A 3BPOC 1G6RA 2QADD 3NA4A 4IDJH 5LBSA 1RIHH 3WHE0 1ET5A 2JJWA 2NY0C 5DEFA 4NX0A 5E0QA 3SPCA 4XP9L 3FU7A 2HT2C 4P2OD 1ACCA 4L3EB 3J2PA 3WKYA 5BOPA 2Y25A 3O6KL 4XNYH 1AO7B 2E8ZA 5BOZG 4GW5A 3P9MB 3BP6B 1DJZA 3J7HA 1H3PH 3HE7D 1I3GL 2CSPA 2HLFD 3QJFB 2B2XH 1JN6A 5E5MB 1BBJB 1GY1A 1IGYB 4ZTOL 4G3YL 4F8PA 5K9QI 3L9YA 2P8LB 3ASNB 4N2HA 5I8CA 4AGPA 2CLVA 4MJIA 3DVFA 2W9LA 5AUMB 2ZX9A 4D9RE 2X53A 1PQZA 2YMXL 4W9JC 4WK4B 3BRFA 5DHVA 4TL4A 1FHNA 2KQNA 2Y7QB 3FCSB 3O3BA 2H2PD 4JHBA 4OKVB 4X6CE 4BSWA 4OFYA 2DQJH 1K6QL 1RVFL 1AZRA 1E3ZA 1XXDC 4B5EA 4G5ZL 4MXVF 5GZOD 4GB9A 4DKFH 3OKDB 5FOBB 4O02B 3V0EA 3D50A 2E7HA 3TM6A 5AVSB 4JO2L 4K7PL 4OKDA 3D3VB 4QRTA 1NL0H 1XZ0B 4K8RH 4G8EB 5G5DB 2X4OB 5GGSY 3FT9A 3WU1A 2WLLB 4GINA 3WTWA 3ATAA 2BOBB 4ANUA 2RA1A 5B8CC 3PLYA 3GO1H 1CE6B 1CLYH 1U8OA 5JQIB 5I16A 3N50A 1NAMA 3WLBB 3CQQA 2G30A 5KBDA 1HXMA 3HN5A 2VLJB 3WNKA 1KZYA 4HH8A 4FG6C 2BIQA 1K3IA 2GB2A 5MEQB 1EXUB 3SPHA 4N4YB 5TFSL 4PP2A 3EJCA 5K1JA 1CD1B 4UTAA 4Z0XB 3K80A 2NY7H 2VDOB 5TGBA 2N7BA 4PI2A 3GSRB 5C1MB 2BNQD 4FHKA 3AS1A 4GY4A 1AGDA 2AQ3A 2ICWB 3VXTB 3MV9D 1MDAA 4PJ8D 1DSFL 2O61B 2Q8AL 1Q8MA 1JWMB 4AQAA 4K7FB 3E8UH 3MNVA 5K1NA 4PJXA 1JXKA 3C5JA 4HMCA 2Y69B 2ZQKA 2TAAA 4BA0A 3PDOB 1OCRB 2IBZY 2K7QA 1J8HB 4XNMB 2OYLA 1RLWA 2Q7YB 4NZTH 3LRHA 3EG9A 5F7BA 2W07B 4PJHA 3MV8E 2GC4C 1RK0B 3K2UL 2OMVA 3MLXH 5T1KB 4OGYH 1G7IA 2Z91A 3DLQR 3LPOA 4E9WA 4LSPL 3LXBA 4BCXA 3WIHL 3CIQA 3HMXH 5AW7B 5KS9E 1NOAA 4MJ4A 2GJ6B 3C5XA 1FN4A 1XT5A 2BW5A 2LU3A 3HC0A 2EIMB 4JO8A 5EH1A 2VM9A 2F68X 4Y5XA 3ABKB 4HCRA 1WBYA 2RAMA 3KCPA 1XB6A 1XGYH 5IM7B 4PCTA 4DP5X 2X09A 5C6TL 5DJDA 4QRPB 4TQEL 2QV2A 1ADQH 2BFGA 1TSHA 4UANA 1JPTH 1AVAA 1EZLA 3KBHE 4C83A 1K72A 1INEL 4O51A 4EZMA 4FKHA 1TZ8A 4ACTA 1YEJH 1DLFH 1BECA 4OJAA 2R8SH 3DVGA 2GKIA 2A9BA 1SXAA 4M8RA 5IMMB 4PRIB 5C08A 4TSAL 5FPIA 1OO2A 5F88B 2GFBB 2FHCA 3LVTA 3VWJA 4UT9L 3B2DC 2VLRE 1XIWC 4KTDH 4QXGH 5ID0A 5IBLC 4FQXC 4ORZC 4FADA 5CEZL 2M26A 2WXOA 4PRPD 3G3LA 3LD8B 1HQ4A 3S98A 1RIUL 4ALAL 1HYRC 1EHLL 3ZHLA 2ICEB 4DP7X 1CR9H 3D34A 3Q6GH 4HJ0C 4JRLA 1DQLH 3NFPB 5C0AD 1SMAA 1ACXA 3KGRA 2DLHA 3MOBH 4KNSA 4L8BA 1BVLA 1QFWM 4XPGH 3J27A 4AYEC 4AQ8C 4F93B 1EBAA 5JYMA 4E41D 4G6JH 1LO2L 3QORD 2AMUA 3HNSL 3C75A 4LSTL 1C16A 3WDJA 4I0KA 4B9ZA 4OV5B 2YUVA 2A6JB 5GGRB 4HIHA 4DZBB 1NFDF 3U4BL 5ICXB 3E8UL 1DHKA 2FYVA 5EBGA 2OJEA 1NIBA 3NGBB 1TZHA 4NO2B 3T8XB 4NQED 4ZMZA 2AAVA 3PWLB 2C4FT 2E6JA 2QQKL 3VRIA 2DIEA 5E1IA 3BH9A 4L9LA 4ZAKA 2V5TA 1MI5E 4ZTPH 5KW9L 4O58L 3U7WL 4C56B 4G7VL 4WK0B 2VKWA 2Y36L 5IG7B 4Q7DA 1TU2B 4WWOA 4ZMQA 2Z8SA 1H3WM 2P5WD 5DHVH 4BQBA 1WT5C 1IKFH 1JV5B 1OLLA 2PF6A 3MMEA 1SGKA 4HGWB 3L1OL 5EU6E 2BPBA 3QXAA 1GH7A 4BGLA 5HPMA 1QQDA 2BS71 3KPRD 3BDYL 1VF5C 1V5JA 2WLJA 4GXUN 5DLLA 3FT3A 4YHNA 1KCVH 3V5HB 5GS2H 3B37A 5MEPA 1A3RL 4WIQA 1HQRB 1VZIA 3Q5YA 1JZIA 3APMA 1P84J 1XR9B 3N40P 4AQ1A 3QZNA 4TVPH 1BYPA 1WH0A 2WBJA 2OV0A 4POZC 1VFMA 3QE5A 3RX5A 3JWOC 3B2VH 2IGTA 4YE0A 1QNIA 1ORSA 4M6OH 3OAWA 2VZVA 4IEFA 3ARPA 1G9MH 3GNMH 2IC2A 2HFGH 2UZYA 3DUSA 4W4NA 4ZW8A 3OG4B 2J4WH 3CLEL 3T4AB 4ZTOH 4KFMA 2QSCH 2VWEE 4I1NB 1FN4B 2ZUQB 3PRZA 4PUBH 1U58B 4URTB 4H25A 4LLUA 1OP5H 1WG3A 2O5NA 4QRRB 3FB8A 5CEXB 1FO0A 3LIUA 4Y5YC 3ENEA 3T3MB 3M88A 2ATAA 4NQXA 5FHBH 5HJDA 5IROD 1UA7A 1BD2E 3FQUB 3T0BA 1V27A 3VXQB 2RH0A 4PJGE 2QPUA 2FWOB 5C09D 1ZGLA 5ESAA 2WBJB 3VG0L 1FP5A 3IFNH 3GQFA 1NM4A 1OXYA 3AW5A 1HWWA 5BVPH 3GBNL 4ES8A 3FSWA 3I2CH 1BZDA 4P2CG 4KO7A 2LGNA 1PY4A 3GF8A 3I9GL 3LZRA 4LFHG 1ZS8B 5D6DA 3ZKNC 3RUGE 4HPHA 4P23A 2AEQH 1U2YA 4K3EH 3GSNL 4MRBA 3LHAA 4YXKH 2WP3O 4IBSA 3CZEA 5BV7C 3JV6A 2VDKH 1A9EB 2Q5BA 3KYOA 1WFOA 2OSLB 3WIHA 1HYSD 3QG7L 4DUWA 4PJDA 2C8NA 3TT3L 2Y5EA 3GI8L 1N4XH 1A9BA 1MIEH 3SDYL 1MF2H 1TQVA 5EUOE 3ZUNC 3UMTA 2J1XA 2E75C 5LGHH 1AMXA 1MSPA 2UWEB 4R26L 4POZD 2EUVA 2X1PA 3NJGA 5D6CB 4I18A 2YOAA 2JCCA 4FNRA 4M4RA 1KCLA 4JLRA 4Y4HD 5B7FA 1F90L 2CDEB 5AVUB 3P54A 4FTDA 3DX3A 1A7NH 3G04A 3PUCA 3QZOA 3D85D 4G70B 2WXKA 4J6RH 4PP1C 5BS0A 1PX8A 1YEFH 3FAWA 2OTPA 1U95A 1JPEA 1TIUA 1JWUA 3K6FA 3TP4A 2A77L 4PLKC 3FCSA 3GZPA 1IQWH 4OKVA 3WMSA 2OP4H 2FH8A 3P0GB 2YFOA 4KDWA 4YK4B 1KGIA 1DEEB 1JGDB 3OPZH 4NO5B 5INCA 3U9PH 4ENZA 2AZAA 1SYSB 3DROA 3EZ8A 3QJXA 3G5VA 3ZT7A 1ZHLB 5KSBE 1YN6B 3SDCB 1X5LA 4OZGF 3QIBC 4UINH 4YSQA 3IMWA 3PAZA 1QEWA 1DVFD 3QULA 1A7RL 4JE0A 4DF9A 1CDJA 1XH3B 3EKCA 1OE3A 3VXSD 1MIMH 4MQTB 3MCG1 4A2MA 1A6UL 3FTVA 2ZWLT 3QEHB 1NLBH 2LU4A 3B5TA 1YPZA 3NK3A 3PWUA 4P2QD 2I07A 3QQ3A 3MYZA 1E7UA 4KY1L 4TQ8A 2YPVA 3S8WA 1O75A 3LIZA 1EV2E 4HEPG 2V33A 4MMYA 1PD1A 3FCGA 5EU6D 4AYSA 1IILE 4PJEE 1GCFA 3KAAA 4MNGA 1ZLDA 2V4LA 4X8JB 4Y7MA 4PJ8A 2FBJH 3DJRA 2YZ1A 1X9UA 3NBNA 1MI5D 3CVHL 3KR3H 2Q3AA 4JM2F 1ZT4B 4YDKH 3TH4T 5DK3A 1NEZG 1EEUA 3LKRA 3QI9C 4R5TA 2MWCA 2WQXA 3KHOA 4RMSA 5SX4H 3LZNA 3OAUL 4FJ6A 2JKRM 1IIKA 3SKMB 1IZKA 5LCVH 4AGOA 3PGDA 4DN4H 2FWUA 3MRCA 1R6VA 4UOW0 1S7TA 1TCRB 1U41A 1QI3A 3T0AA 2Y22A 3L2NA 4AL8L 5EDSA 3NIFB 1GYCA 4JMXA 4JQIL 2P80A 4KROC 4BK5A 3KPTA 3R06A 4OZHB 2ZX7A 1JZFA 3KS0H 3T2NL 1M9SA 2TSBA 5JXAH 3U4EB 3X3FH 1JNHB 2X7LA 4HAGA 1LK3H 4GXVH 4Z7UF 2WTRA 1IUZA 3EYOB 5DWUL 4M7ZB 5D2LB 3FBQA 4Z7OE 3SDXB 1NFIA 3DGCR 1E9PA 1BMGA 3EJQA 1I8MB 4GAYA 1Q0XL 2AK1L 2HUEA 2EYSA 3EW3B 3L45A 1MFCH 3TH2T 5L8LB 4RMVA 1SZNA 3VMOA 3EGSB 4Q0XL 1NCAH 5GQBA 3EH2A 4IU2B 2VZTA 3UBXI 5KJRL 5J1SC 3R7RA 1N9PA 5F9JA 4B9IA 1NEPA 4NQSA 2YQ3A 4FL4B 4WGVB 4FD0A 3GXPA 4A7QA 3PUUA 5BV7H 3WFCH 3A4FA 3N44B 4QR7A 3NMEA 4PG9A 3E6FA 2Q7NA 4QUOA 1BZEA 3U46A 1P6AB 1FH5L 1H15B 1MW0A 3QUKB 3U48A 3GHEH 2GIYA 2VDPL 3IFOB 3BPOB 3D4ZA 3CMOL 5KUKA 2ZXBA 3QJHB 3U4AA 1W72A 3ELAT 4LT7A 4PCSA 3C2SA 4N2OA 5HYJA 1P4LB 4OZFA 3L95A 5DRZA 3EOTL 1TVHB 2DRUA 2D03H 4MJ2A 3TBTA 2Y2YA 3V6ZA 3LD8C 1FRGL 4QCIB 1L9MA 5F3HA 5I5RA 4HZAA 4R5VA 4HSCX 2DWXA 4Y4FC 5DLMH 5GZOC 4JHAL 5HI4D 1GGIH 3WENA 4G42B 3V95A 2L7JA 3DK0A 4FNQA 1KDIA 5ANMB 4XRCA 2CR6A 4HF5H 5A6MA 2JB5L 2HPOA 3C08L 1G7HA 1WC7A 3OAYH 3PWVB 5ESVB 3L2MA 3TA3A 1BJ1H 5F7NC 1CICB 1NDTA 3NEXA 2FSEB 3NRFA 4OM0H 3CFDA 5DI8B 3VNZA 5DUJA 5AAWA 5E6IB 4AM0Q 1YEGL 4WWPA 3BDBA 4GAYB 4LASL 4OLWL 3S3BB 1S9XA 2F18A 2D31A 2OI9B 5LWYH 1FYTD 5GGSB 5I71C 3TJEH 3OD3A 5F70A 4XBMA 2LE9A 2E46A 3AT8A 4F7CA 1LD9A 1Q90A 2JCWA 3U0PB 3O4LA 1A14L 4L4VE 4U6VL 3CXDL 5DJXB 3ME0A 2DMKA 1ACZA 1FZKB 1KPRB 1GOFA 3VGHA 1CZ8L 3OHXA 4AYGA 2X6AA 1DSYA 4CMMA 3UAJD 4WSJA 4KUCF 4Z76A 1ETZA 1HHKB 4R8WL 2XFXA 4F7MA 5F3BB 4RBPK 4KGJA 5DJAA 2D2OA 4P5MB 5F3BA 3UCQA 4V1DE 1NKRA 3DXAA 4K2UH 4JVUA 1H5BA 3IJEA 1J11A 2XZAL 1MCPH 1NCNA 2P48B 2WOYA 1OSYA 4KKQA 3B9KB 1WFTA 5F7HA 1OAZH 5C0BE 1OTTC 2X41A 4ADGA 2DQFB 1INQB 2VZOA 2UVFA 4OZ4A 4TTDD 4CSSA 1ZGLP 1G7LB 4PJ5A 3LQMA 4R97B 3ZDYF 5TE6L 2JQMA 4JZNB 2XTJD 2CK2A 1OEZW 3QRLA 3QNYB 12E8L 4MS6A 4HHWA 1RD6A 5DMKA 2QVFB 4FC3E 5BRZA 2E7BA 4PJBB 5CJQH 5C3IA 4XBEH 3QWOB 1NA8A 1QP1A 5E6UB 3QEUA 1VGEH 2JKJA 5K9JL 1UM6L 4M3HA 5HYQA 2AGJL 1MFEH 2ADIB 4NZUH 2EVHA 3GK8L 1CICA 2CGZA 5I30L 3QUMB 3Q5OA 5IB1B 4HBCL 4DVBA 1OGAA 4LVNB 2F74A 3ULUH 4KZDL 2BSSA 2NZ9D 4TSBH 5I1LA 1WA0X 1A7OH 2CBPA 3MFGB 1J0IA 5F6HI 4E5XB 5KAQG 4MJJA 3U36A 1MNUH 2PMZA 4GEIA 3A6OA 3LZFH 3LXAA 2MTAA 3BMWA 3KXFB 4XCEA 4LBEB 1HL5A 2HX9A 2B3RA 4PRPE 1UB5A 3OR6B 4CRPA 5JXAL 2EDKA 5IFAH 2VLRD 3T2NH 3L95B 5DRZB 2XWJA 3NESA 3MRDB 1V05A 4Y4HA 5BS0B 1CYWA 3DSFH 3NSDA 4JN1L 4PVLA 5I1AA 4RESB 2TRYA 5E2JA 1HCVA 4PB9L 2ZOLB 4WI6A 1IFHL 3D3VD 3T0EA 1ZVYA 4NKMB 5IQLA 5T1LB 4I7ZC 3ZDYB 1T7XA 1YZZA 2FATL 3BH8B 1UUSA 1JDDA 2RR3A 4I18B 2IIJA 1H15A 3KPOA 5HHOD 3U0TA 3SGEH 1H3XA 1D2PA 2YXWA 1KLFA 3OKOB 4PTUA 3AUWB 3IU3B 2OR9L 4ZMWA 1J5IA 4EVNB 4IIZA 1U21A 4RCAA 5FO8A 2NXYD 4WSKA 5KWYC 2J1WA 1A5FL 1QFWI 1J1PL 3A24A 3DJZA 1FFTB 4PG2C 2P5WE 4M7KH 1A6TB 1AZNA 1KJ3L 3UX9B 2X10A 4L23A 2VWEC 2BVYA 5I8KH 2O30A 1BXXA 2YXVA 4PS7A 4YSRA 4OM1H 2UWEF 1MH5B 1ETB1 1GYUA 4GAJH 4PJ7B 1AD0B 5IP4A 3QFDB 4N2EA 1NGWB 1OAUH 5HDOA 2X2IA 1C5BL 4WENB 5E2VH 1E6JL 1GYWA 4Q4EA 3M86A 1G0XA 2XXMB 1X9LA 4GRMA 4JL1A 4UTBH 3Q3GA 5IJDC 3HPJB 4H5SA 3ILPB 4JUSA 5D7KE 4AH2B 2H0FA 1YHPA 2E86A 1JNLL 2EEXA 4DW2H 4GRWE 3HJ0A 4LPTA 2IAMB 4EJ1C 1AGEA 3N43F 2WO3B 4EZLA 3P9LA 3F7VB 2GK2A 2UY7B 1BSIA 4AMKL 3MRIA 5DJ2A 3OPUA 1E8YA 5CEYA 4CW1A 2AITA 2K70A 2QL1A 4EDWH 1QSFB 3CSTA 4H0LC 3T4AA 3VFTB 4YSUA 4NWUL 1CT8A 1ED3A 1NEZA 3ASOB 3CBKB 3QFJE 4CJ0A 2CO7B 2B3IA 4ZNEA 3WNLA 3T0DA 4JFZH 3D87B 2DD8L 4QXUH 2RCSL 2V37A 3TCLB 1BZQK 4N0CC 4B3VA 1TQUA 2WVVA 4MMXA 3X1EA 3HZKA 5FS5A 3QWRA 4NKDA 3D07A 3BW9B 1U3HD 4XWGH 4UQAA 3MR9A 2O72A 3C5SB 2PO6C 4NXKA 3VXSA 1E4XI 2N0MA 4B27A 1QFUH 4FCAA 3WEAA 2Z4QA 4ONOA 4E2OA 3CPLA 4GSXA 4OZGE 1MHCB 5LGHL 3GSOA 5FA3B 4BKTC 5FYLL 2FR4A 2Y07H 3ZDWA 1UZ6F 3CBJB 4ZUUB 1T6BX 4F8LA 5H94A 4F8TA 1QABA 3CX5J 4X5XA 2WLZA 1DQML 2GJZA 2W94A 3BT2L 4ZYKB 5DVMA 4PREB 5IB4A 3TBYB 4PH8A 2VAAA 2I7OA 3DVNB 3FJTA 4NC0B 1F1DA 5D7IE 3BT0A 2C9SA 4D9LH 3C5SA 1UKTA 3BHBA 4K07A 2D3LA 2W0PA 3WUZA 4G6KH 4AYBA 3OHXC 2IBGA 4A2GA 1CIDA 3OM3B 1YEHH 3QULB 5E6RB 3RFRA 1PLBA 3H2QA 3SKNB 1SJHB 4BZ1A 1CFVL 4APQB 2CUIA 1NC2D 5I18L 3VFNA 4JANA 1T4KA 4B9JA 2D7MA 3TESA 1O7DC 3TT1L 1NOFA 5JO5A 2X9XA 4HIHB 4K3DL 1ZA3B 4BDVB 3ABGA 3RVVC 5MENE 2IVFC 3ABZA 1UOKA 2P3YA 5KVGH 1OHQA 2ZXWB 1AFVL 4NO2A 2FQFA 3T8XA 4O9HH 3PHOB 5F1NB 1L6ZA 3FH5A 2J21A 4QWWD 2ILLA 1RKRA 2PW2A 5DMGD 2P1YA 4P2QA 5FKAA 5FYKD 5EOTA 1VADB 5F7MC 1DFBH 4PUBL 2ZAIA 1BWMA 1OCZB 4ZAKC 4HZLB 3WLWC 1F11A 1IGTA 2BSTB 2E9IA 2IWFA 1X5AA 3GSQB 3MLSL 5MHSE 1QPKA 1XIWD 2W60A 1OB1B 5CZKA 2HJKB 1W6WA 1MCCA 3FFCE 4U3HA 4EI5D 4JO4H 5C0IA 4N8VA 3V0FA 4H88H 4HBQA 4LSSH 5D1QE 3UO1L 1HK6A 2D0GA 4Y1AD 3U2JA 5C8JA 4ZO9A 4MA7L 5IK3B 3E2HC 1TYJA 4YIQA 3FO0H 1F13A 4W9HC 1WS8A 1ZVNA 3OL2A 1UADC 4OVUA 3VWJB 3GMOB 3LN9A 1DVXA 2V6HA 5I82A 3O0RH 4IRJC 5EOTB 3VXPA 1T21A 4JM0A 1SUJA 3BKYL 4A37A 5IY5B 1S9KC 2OAAA 1FL3B 3SB3A 3E1F1 3VXUA 3KYMB 2VDPH 4U1KA 1B88A 3NIGF 1IKOP 4PGJA 1EGJL 4FNLL 2YMTA 3T2PA 3BQVA 1F11B 4MB5A 4WTQA 5J1TC 1OSZA 4MXVE 1Z3GH 1NMAH 4QTIL 2OULB 1IL1A 4ZW3A 3DO4A 3HHRB 3O4LE 2J6EA 1QACA 2R0WH 5FF6B 2H1PH 3L4UA 3FOMA 3NG5A 1QKZH 4DGYH 4P3DB 3KCPB 3WEOA 1PY9A 3HG3A 3V4PA 3IU4L 3EO0A 4NJ9H 1FO0B 2W07A 5G4MA 1UJ3A 2BP0A 5F9DC 4MZRA 4D2NA 5I17B 2K4WA 3LQAH 4QRRA 3B5HA 4LK4A 5JHMA 3WS6A 1TJMA 2HJFA 4AC4A 1MJUL 5E6IC 3DSNB 5CIPB 2K6WA 1U58A 4HS6B 1R3IL 4LU5H 5E4IA 3GJFA 3G6DH 1GGTA 4GG8B 5FGSA 1G7IB 4S0SD 3S35H 1ZK9A 5IGXH 4ZPVB 4LPVA 3VMPA 3AABA 1QSVA 3BISA 2Y7LA 2K45A 3BVXA 3VFUB 3S37L 4UF7C 3KM2A 2O5ZL 3KCWA 1AHKA 3TNNB 1H6FA 4X5XB 5F1OB 3DHJA 2VGLM 2CBQA 4HS3B 2WKOF 1UXWB 4LRIA 5KSAD 3PP4H 1A3LL 4JJ5B 1C12B 3KWWA 4JFDA 3OTTA 5CSBA 5F44A 4QHNA 4E0RA 4L2LA 3KR3L 1N0LB 2YR3A 2AXFA 1PL3A 5CEZH 1KDJA 2VW4A 4QXGL 3KPNB 3VAEA 1AXTH 4JFUA 1D5ZB 3QDHA 2WC7A 3CFBA 4AZ8B 3L5HA 3KBEA 1F97A 3IMRA 4WNJA 1XZ0A 1ADWA 1TXKA 3QUXB 4X42A 4FFWC 5T1DH 1AYOA 1ZTMA 3FQXA 1Z2KA 4DERA 1QRNB 1T0OA 1Z9SA 3SKJL 3BVNB 2ZZUT 1AIZA 1S9VB 3DBXB 5D1ZC 4ODTL 4F7TB 5AG9A 1TZIB 3MTXA 1MW1A 1NEZB 2ITDB 5EF2A 4UYQA 4DPAX 5F7UA 2J2ZA 5I23A 1RUQL 3ARUA 3K4ZA 2L4OA 2ZUWA 5D1XC 2XY2A 5IHLB 4XOBA 3SDCD 4Y9FA 1A7BA 4PJIF 5D7HA 4NQCD 3EDJA 3NCMA 4EPSA 5JLZB 3PWPD 5AWNH 1SPDA 1LEGB 4HIQA 3CDGB 2CO6A 5IIEA 4OTXL 1PJWA 1O6VA 1DQQB 3UPRA 5CCGE 5I15L 1EZUA 2XU9A 1H3TA 2CJSA 1BVLB 1KB5L 2UUDK 4NM4L 2L3BA 3GDCA 5AB2A 4JKLA 1BLIA 1TQBC 3FQRA 3WUWG 3X12A 4M43H 1QFWL 2DQGL 1PSKH 3S5ZA 2ADYA 1A6UH 1QTPA 3AWFA 4RA0C 4AIZB 5GGSA 1S9XB 2FJSA 4UQ3B 1OAKH 1A7RH 5K69A 2HB0A 2LABA 3TL5A 1I1RA 4YO0B 2FSEA 2WAQA 1TJGH 4NENA 4HYTB 4Y4FD 2ITFA 2BWDA 4PWEA 4PJ5D 1RP8A 3AS0A 2R69L 4A68A 3BZ5A 5HHPB 3MU3A 4JKKA 5EBLB 4YXHL 4KTEH 4RNRB 4L0PB 5ILTH 3PHQA 1JHTB 3ZKND 4ZW5A 1I85A 3CVBA 3QEQD 1FHGA 3TNMA 1M42A 1M7UA 3H56A 3GJFH 3GMLB 4K2UL 3VXOA 4UDTA 3CCHB 1ZJBA 4YHLL 4P4KD 1X3DA 2CDGB 1KIUB 3MXVH 3U83A 3VFOA 5AW3B 4WHCA 5AYQA 5B38B 3L2LA 3QCTL 1PAMA 4XZUA 1NINA 5K9OA 2WJ7A 5EUOA 4HIEA 4O2EA 1MELA 4FG0A 5J8OA 3DO7A 3L7FA 5LUMA 3JWOL 3DURB 2ZKMX 5E2TL 4Y1AE 1TTCA 2DS4A 3HMXA 4G5ZH 1HIMH 1DQJA 1YECL 5C9JA 1MCFA 1NDMB 3ZTJG 2R1XA 4XT1C 3K7UA 2C1OA 1IVTA 2EIKB 1DJXA 1UWGH 4DEWA 4FN0A 1A6AA 1QUNB 2ZCLH 4GIAA 1YEWA 2WYZA 3SCMC 4LASH 2GHZA 4OLWH 3V52L 4NPJA 5HDQH 4L1HA 4Q56A 2CJ3A 3QYCA 1ZA6A 2F74B 4FXGA 3VYOA 3T3MF 4GRWF 3GBNH 4TS6A 3W38A 4EZKA 2G5UA 3VI4B 4WI8A 4DKEL 1GAFL 3QORA 2CCLA 2XV0A 3Q2NA 2NT1A 3NIDB 1DDHA 1QW9A 1QFPA 3QR2A 4XZ4A 4YN3A 4E5XA 5JZ7D 1QD0A 5L4JA 1EEZB 4R96A 2G4GA 1GGIL 4Y5YA 2IDFA 4Y9CA 1GS6X 4FQJL 3NCYP 3ZTEA 4A6YB 5C71A 4DVBB 4PRPA 4KMQA 5E9AA 3V4LA 5CO1A 1Q1PA 3THMH 4CU7A 4L4TD 3QUYD 5CR1A 1CTNA 2PYFB 4RGNB 4ZI8A 1CU4H 1P5UB 2K1MA 2OMXB 2R7EA 1FNSH 3O9WD 1KBGH 3ABMB 4TVPD 5I9QB 2KT6A 4V11A 4HEMA 4GI8A 3OKDA 4JRYD 5FOBA 4L0ZA 1FGVH 4GMSH 2M83A 3P40A 4FXKC 4JFWA 2CO1A 3O45B 1U4EA 1WA1X 3QIBD 4GMTH 1QFOA 4WNQA 3DA0A 2H26A 4MJIE 4JDEA 5H2BB 1YNLH 5HJGA 1PDKA 2HG5A 4X6CA 1PFCA 2J20A 4DO5A 5KBNC 4OVVA 4U6HB 2IEPA 3UL4A 3HAEG 4W93A 4Y9GA 3HMWH 4G9FE 3SE6A 1BQ5A 1D5IH 2D0FA 3BQUD 4LQFH 3S8FB 1DBKL 1UGKA 3RWCA 2JI3A 4M1CC 1HDMA 5MI0C 2EVJA 3GXMA 4I1RA 2B1AL 4HIXL 5D9SB 4YLQT 2X3AA 2NY0D 5DJXA 4R4FH 2YOCA 2WPGA 5D1ZI 3QVAA 1F4YH 1RJZA 4WCYL 1JHTA 5EUOF 1MCWM 3O3EB 4RNRA 4GXUM 2CXKA 2BJML 1WEJL 3EBHA 1DBAL 3O2DL 1RZFH 3P3TA 2D31B 4UT6A 3ZYIA 4UOQA 1OQXA 4DP6X 4OZIF 3BDXA 4NZRH 2AABH 3CQPA 2E6PA 4PS4H 4U6XB 4LCYB 1KXQE 4IGBD 2V9UA 2YD9A 2JJTA 2HWZH 3UG4A 4L3CA 3UG3A 2WK2A 2WSDA 2VC2B 4Z7VA 4X4ZA 4F2ME 3MA9H 4IBWA 5JHDB 2YUZA 2DEXX 1LO2H 2C4XA 2QZQA 2NY2D 5INCB 4ZNEE 5HDWA 5KYXB 5L8JB 3APNA 1Y1UA 4XP5H 1UKQA 4BZ2A 1K85A 1I4FB 2GQHA 3EAKA 3GXNA 3UYPB 3L5WA 1FIGL 2IDSA 3NFSL 2XLLA 3V4PH 1E9QB 1WO2A 3F2LA 5DJCB 4K73A 3KPRB 5L2KD 4JM2A 2CKBA 2HP4A 2Y1ZA 4ZFFA 1H6UA 4QHKI 2XQYK 4UT9H 3TV8A 4BIKA 5KSAC 4FLHA 1KC5L 2AJ3A 4XXCC 4DGIH 2QADB 1A9BB 2V5RA 2WQRA 4HEPA 3SBWC 3MCLH 1IGIL 4MXQC 4Z5RB 2H32H 5E8DH 3SE9L 4J3UA 2IXQA 4OGYL 1XF5A 4TQPA 4LP5A 3ATEA 3ESUF 3V0VA 2BOCA 3GSXB 4U0RB 3UOAB 3WIFB 1JZ2A 1Q0YL 4HKBA 2XWZA 3JWDL 4ZFZB 3CQFA 4TQEH 2FUQA 3NCYS 4NUPA 2OZ4H 1NQBA 1A7PH 4AXWB 4RFNB 3D39E 3DYPA 4G8GE 3MGAA 4DSYA 3M8OH 3GBEA 1EHXA 3HBZA 4PJ9A 4TNWK 3MLRL 3E6HB 3HMXL 2EE6A 2B9BA 2UXFA 3EO9H 3GKWH 2CBTA 1BIIA 1A66A 3DX8B 4L29B 4GP5B 2BX5A 5DZVA 1IAIL 2Q8BH 3K4AA 2PO6B 1VACA 4KJQC 2HX7A 1KB5B 2G75A 4KRPC 2CPUA 2Q76B 4PLJD 4PJCB 3DMMD 4DPRA 3HRZB 4S1SL 3MBWB 3W57A 3T65A 4G9FB 1E4WL 3H4HA 1W2KT 2J8UA 3N9GL 4PQXA 2DOCA 3W2DL 2F53B 3W9DB 4FULA 4BFGA 2VDLH 4NQDB 5FDYA 4EUPH 3N0AA 4Q6IB 3RPIB 1T1WB 5C2BH 5IB3A 2V2XB 4XO3A 1TJHL 5ENWA 5FO7A 1KGYE 2QKSA 3KYNB 3K3QA 5LGJA 1TJHH 3MRRB 4MBRA 4YL4A 3V55A 2E7MA 2ATPB 2XPGA 3MUGA 5GGVH 1BGXL 5M7QA 1JMZA 4FKKA 2UZYB 3HNVH 3TO4A 3VXOB 3S2CA 4JS7A 2F54B 4PJ7F 2L7QA 5KUMA 3P0VH 1XSIA 3OGCB 4Y4KA 2F5BL 1GY2A 3HZMA 5A2LH 3S4SG 3GO1L 1S8DB 3VQLA 4PJ8B 4X50A 4FA6A 1N68A 4J4PA 1UT1A 3UJIH 3OKKB 1SM3H 3L3JA 1H3PL 2CKNA 4YBHA 2NTSP 4WGWB 4NLAA 1FBIH 2BP3A 2WY3B 1KBBA 4KK9D 1J8HD 4LSDA 5H4YA 3TCXA 4YSPA 4OF6A 5C8JB 3BJLA 4PJCF 2Z31A 2WTPA 3T4YA 3PWUB 1MOEA 5E51A 1K6QH 1SXBA 1YN6A 3SDCA 5HHQB 1PYWA 5IHHA 3FHEA 1P9MC 2WQUA 4OLVL 4X83A 4QRSB 5GRZA 4ELDA 4CILA 1L6XA 1LO0L 1HZHH 2JFCA 3FTGA 4F2FA 1KIRB 1ZPUA 3UH8A 2ARJQ 4MWFB 2DWDB 1DO6A 3KBFA 1FVEA 1PD6A 4LVNC 4UZGA 3QPKA 4AM0A 1CFNB 3KE0A 3VE0B 3PXHA 3RTQD 1BAWA 1QLRB 4JY6B 4Q58C 1B6UA 2P7TB 2UXTA 3E2HB 3QUZA 4I85A 2WQAA 2KC0A 5IHWA 1RPKA 1AHWC 5DC9B 1BCIA 2AERT 2EYTB 3ISRA 1WUZA 1MLBB 1S9WA 2ZKHH 3MC0A 5C0RH 3O2DA 1GS8A 1ES0A 1CG9B 1RHHA 2ZWSA 1NIFA 4NT6A 2LAGB 2BW4A 5KN5B 4HC1A 4KQ3H 3CXHK 1TQCC 2XYBA 4WO4D 4CA4A 5AFAA 1Z9SB 2MCMA 3U9WA 2ICEA 3NQKA 2GY5A 5A7EA 3S2AA 1E6OL 2AQTA 2E9BA 3SPIA 3D25B 4RBPH 4QAWA 1NCCL 2IH1B 5B39A 3GMMB 3V0WH 5KBLA 3V10A 3I50H 3IMTA 2FX7H 1D5ZA 5DC2A 3GWJA 4XNUL 1JI2A 3QDAA 4HJJH 3CZNA 2YPLB 1HL8A 3ALWA 5D2NB 3CC1A 5C08E 5EU7C 4GG6E 3LPWA 2DEYX 4P59H 2OCCB 2WZPA 5FR3A 3FN9A 5HP5A 1RPQA 2GJZB 2XY1A 3IJSB 3L8QA 1F5WA 5TPWL 5I6LA 1XB3A 4TYUA 1OPGL 2H32A 3GRWH 2AV7B 4AYFA 1SXZA 4D7PA 1OCWL 3BKJL 4YHZL 1YEIL 4RETB 3L9RA 4J8RA 3UJTH 3RKPA 2B7DT 1LEKB 3F7QA 3DHUA 4LHQB 3S0PA 4PGEB 3VB9A 1UA3A 4QJ4B 2VZ1A 4WV1B 4Y5XB 2ED7A 3D7PA 2O93L 4Q9QL 4FYQA 1BJMA 1J0JA 1DN0B 1OAKL 3L1FA 2BMKB 4LRNH 1CO1A 1LO4L 3IFPB 3OJMB 2XA8L 2AHIA 3MJ9A 2J88H 3ULUC 2H6UA 2VITB 1MLCB 2BS8A 2J5LB 3MN8A 4WV1A 3CDYA 1CT8B 1ED3B 1O6SB 1OQOA 4KXZH 4LSQL 1KJMB 1YEIH 4NQVB 3EZJB 4LCIH 3QT2A 4N2GA 1SVZA 4ALAH 2FLRT 2F6AA 2UY7A 4EEEA 1LM8V 1NCBH 2QBWA 1R5VA 5C0JA 5GRWA 4EI0A 3IDGB 1JWMA 2F08A 2GSGA 5E4EC 3FRPB 1RZIA 1YC8A 3QQ4A 4YXLL 3DPBA 1T5WB 5CGYC 5TGBB 3ZQXA 2B14A 1FNSL 5DA4A 4IRSC 3L9RB 1NGPL 4LQFL 1GHFH 4NN5C 3EJUA 4MDJB 4P2YA 2QSTA 4YL9A 1ZHBA 1AD0A 4ONHA 1UJTA 3D5OF 1KTCA 4KO9A 5HPMB 3OR7A 2VLJA 4X8GA 4MVBD 4U2YA 2HJKA 3X14A 1XXFC 1HHGA 4FXKA 3WS3A 1YNLL 1MFAH 1WTGT 3MRPA 2WLLA 4DAGH 2NNXA 3CH1A 1P53A 2R2BA 3N04A 5DJ6B 3FH7A 4YHPA 4F7EB 1CI5A 3ZUCA 3AU1B 3AXLA 1PJ9A 5BQ7A 1MCHA 5L88L 4Q52A 5CINH 4R7LA 3TN0B 4QTHA 2HYMA 3S37X 4MJ5A 3V52H 3X11A 3IAQA 3OX8A 3Q1EA 1N12A 2XVBA 1QR1B 1U9KA 3NIGB 2FZ3A 4JFTA 1MXDA 4MXQD 2E7CA 1K5WA 1JFQH 4NRZB 1X9RA 2J6WA 4V1DD 2CLRB 1JV2B 4I0PD 5GS1A 3HOGA 1IMHC 1S7QB 5D4JA 5IVOA 1DQDL 3I6KA 1XEUA 4NIYE 3H9SE 3NSXA 1NC4B 3H53A 1KYFA 5HHOE 3FZUD 4GW4A 4GO6B 3RWFB 3L3HA 3TBVA 3LRSA 5DYOA 3VVVA 3L4XA 1FE8H 2WWMD 3ARYA 3KXFA 5TFSH 1HJCA 5B1KA 3S36L 4L8BB 4UV7H 2CMRH 3TBYA 1EBPA 3GDBA 5HGBB 3SBQA 1KEGL 1NGYA 4Y5XC 2GITB 5C92A 1IGFL 4XNAA 4DEPB 3AREA 3DVGB 4N20A 4Q4IA 3UBXB 2VRQA 1QBAA 2A74C 2FT8A 3E3QE 1M7IB 1ORQB 4XHJD 3ARWA 5DTFA 1OGAB 2EDHA 2VDRL 3FB7A 2FR4B 2OMZA 4YZWA 1OAQH 2SEBB 4JG1L 4KX9A 5HYQB 4J2QA 4KKBC 4MMZB 2ITCB 3D85B 2VSKB 3LNDA 1MRCL 5AW4B 2IOMA 4U6YA 3RJDA 4FKEA 1FCGA 1SJMA 3CX2A 4G7QB 3I6KB 5C3TA 3SYAA 1F2XK 3BZ4B 1IGFH 5TDPA 2XTJB 4ATTA 2W65A 5AAWC 1I3VA 4YHKL 4AENB 5T5FH 3T65B 3SPVA 3EFOA 1SY6L 2YK1L 2ZSWB 2V2XA 1U8MB 5L0QC 2N4IA 2HX8A 4NO0A 3RHWF 1D5RA 4WU7B 1J9CT 4HKJB 2FBRA 4LCVA 1W0WA 4ABUA 2MPAL 3WY3A 4M6NH 5AWNL 1LGVA 1UZ6E 1D7BA 3L17A 3WE1A 3MLTA 3PP3H 4O02H 1P5UC 4PWKA 1COBA 5AZ2L 4H5SB 5E99L 3INUH 2VDQL 1MY5A 1YYLL 4P57B 3RWJA 4I8DA 3FF7A 1S9YA 4XVJL 1Q0YH 4JGNA 1PLCA 2VZ3A 3HRZC 4TVPE 4AQAB 4ONGL 2DQIL 3SGDI 3SKJH 1PZ3A 2ICWA 3WFHB 1NDGA 1M7DA 3CDZA 3H2WA 3O11B 3OGOE 3UTTB 3WLBA 2N56A 4KJWC 5FGBC 4Z0XA 4B9YA 5KSVB 4AL8C 3OZKA 1MXGA 1HVXA 1CYGA 43C9A 2ICWI 3ZKSD 4W9IC 1NFAA 4F33A 2YKKA 3RDTC 1VERA 2DLTA 4ZMTA 1USZA 3ARBC 3FT4A 1ODAA 3GMRA 3US1A 2YEQA 4AVIA 3IM1A 1U8OB 3MKKA 5EORH 3QCUL 1KIQA 3EGXA 4PD4K 1KJMA 2V3FA 5D4QA 4DP2X 3BKML 1FNEA 1I4FA 3HS9A 2UZPA 1BF5A 2DJSA 4HUKB 4UMGA 2VLLB 3GIZH 4ZDHB 4G7SB 3BAWA 5IEKB 2AK4A 3ZE2F 1YUHB 5DJCA 1UKSA 3PJNA 3WJMB 5BJTA 4RGMB 3PGCB 2VH5L 2R2HA 3SHSA 2NSQA 4XPTH 1SBSL 2NYKA 1LWHA 1MVUA 3P9MA 2WIIA 1EIBA 5A16A 2WO2B 2AXWA 3F7KA 5FX3A 2CA4A 1X7SA 5CUSH 2IWKA 3KVPA 3WIIL 4OB5H 1O7VA 1RZFL 5I76B 5BUGA 1NJ9A 5J5EA 2XZQH 3IDIB 3V7MA 1YY9D 1LHZA 1BAFL 4Z95H 4ZMVA 3TV3L 2AV7A 4AYFB 4OGQC 2VDNH 3LIZL 1JRHI 1UWEL 3WS6C 4C47A 4F7PB 4J3VA 1RL1A 4R4BB 1AE6H 3Q6FB 1UJ3C 4Q2ZA 3MUZ1 4PJ7E 2OMTB 4XBGA 3RZWA 1I8MA 5LG6A 3APDA 4P2OA 3O0RL 4R4ND 1GZPA 4A2HA 1BOGA 4A2DA 1PZ2A 1E6JH 1PX4A 2KYIA 1L0PA 1B2WH 2BXYA 4Y5VB 4E41E 3VWKC 7FABH 4GO8A 4UOJA 3QIBB 4NQUA 1LO5A 3LY6A 4K3JL 4TNGA 4PU2A 3ZE1F 4H88L 4LSSL 3UO1H 3ROOA 1L9NA 2NQCA 1UM4L 4DUVA 2OLDA 4XODA 4BFKA 5DRWB 2AEPH 4DTGL 2J25A 1NGQL 4GSDH 4OJDH 1AZZC 4JDTL 4X4YA 1U3HB 1JPSH 1KBGL 3SKUD 5J1AB 3TO4D 1SOKA 1QHPA 3QIUC 1NCCH 5DK2B 1DFBL 4P3CL 3AG1B 4IBZA 1IT9H 3Q8AA 3VFPA 1HNYA 2X0UA 5DK2A 1T2QL 3RVUC 3NZHH 1Q94A 2HG5B 4MJHA 5C0BD 4G8FB 2QVTA 5D93C 1HH9A 1G7QB 4KOBA 1I7ZB 5EO0A 1OM3L 5C0GB 3Q2CA 4BKLB 1A25A 3HZVA 3HUJB 4S1DC 2OXHB 1BFOB 4RGNC 3I6GA 5HGAA 4GFXA 2J73A 3OXRB 3MRFB 1KIPB 4PRPB 5E6ID 3H9HA 4BUHA 5KYNA 1IFHH 5TQ2H 2VLRA 1BOGB 2BCMA 4D9RD 5KVEL 1UH4A 3N1QC 3PGFH 1QLFA 3GGWA 3VW3H 1CDBA 1KENL 1JNNL 2EH7L 4DP1X 2Y7NA 4A38A 4AE0A 4XMPH 4YDVA 2JH2A 3ILQC 3ZE0E 4BRJA 3JXAA 4NUGH 2G2NA 3C60D 4FQCH 1DLHA 1NUNB 1KYOJ 1SY6A 3QJRB 1JZDC 4P46A 5IESL 4NLHA 3VXUD 1M6UA 5H37H 4AEHL 2AJYH 4RGMC 3QJUB 1OD9A 4TNFA 1JNJA 1WITA 4KROB 1HT6A 1KG0A 4FLRA 3IJ8A 3KJ6L 3UJJH 2R23A 4E42B 4W81A 4XMLH 4WHYH 4ZX3A 5E1AB 5EOQL 2PCFA 3BAJA 5L2KB 3ZYJA 1EDQA 4AEIL 4HIEB 1D7CA 3BEWB 3L3IA 4JB9L 4WJG3 4HCRH 3JWNH 4J1UB 4WHTA 4FFVD 4AX3A 5FO9B 5EIIG 1ZLVH 5KYUB 4J3OH 5EO9A 4HXAH 5TH2B 2A4ZA 2ZX6A 2H8PA 4K71C 3U46B 1HU8A 3DXAD 1B0GA 1R34A 4K94H 1QSEE 3HC3L 1HHHB 1LNUA 1P5VB 3JTSA 3LEXA 3HLAA 3VWJD 4ORGA 3RBSA 2KBGA 1S78D 2CDGA 4K7PX 1SXNA 5F9JB 2EDYA 1KCUH 3FCUB 1WIUA 2J43A 5IR1A 5E5UB 4AEIH 1I1AC 1SEBA 3MA7A 1UTDA 4Z3JA 4A7VA 1IKNC 4FYSA 4N8UA 3WO4B 3CSFA 3AY4A 3ZZ1A 2NLJB 4MSWB 4OGXH 1BJ8A 1HSBB 2ZSVB 3L4ZA 4RAVA 3T09A 1VEPA 5IVXF 1U8NB 3O3AA 1F8TH 4DCQB 3IJ7A 4JX0A 4UIMA 1GSKA 2BNRA 1OGAE 2DJMA 2DQHH 2DZEA 5EN2A 3ZHKA 2WZ6A 2WVUA 3EYOA 4GI9A 4OI9A 1E28B 1JVLA 1OY3B 3CJJA 3EOAA 1WVZA 1G9NL 1BLNA 4NJAH 4KZEL 5CLWA 3DMMB 4EDWL 2Z93B 4RGOH 3B9DA 3KEHA 1TQBB 4LKXB 2RFXA 1CXKA 4ZSOA 5CCKL 7CGTA 3VU1A 4Z5RA 5BOJA 5KZCD 3GLEA 2JJVA 1N8ZB 3ARFA 5AW2B 3IGKA 4PVBA 1KTRL 1T0PB 4WW2C 3DO3A 4MNQD 1VA9A 1BZ9B 5C97A 2F1BA 4LXFA 2B1HH 4LEXH 2O5YH 3ALPA 4NWTH 5HHOB 4G82A 1KXQA 2FQEA 2X44D 2JXMB 2AJSL 4MFHA 1KT2A 3T3PB 1D5BB 2ZSWA 4QWWC 3O6FC 4APXA 4N0UA 4D0BA 1B4JL 4PRDA 1BMZA 1CDHA 2H47C 3KW8A 1C5BH 1ZV5A 3NJKA 1NSNH 1XGUA 2H6PB 4E36A 1OCCB 2EEFA 1MCIA 2QEJA 3C87A 1AXTL 3IDNA 3R1GL 5I5MA 1Z5YD 3ARED 4JG0H 3NJHA 1S5HA 2V8MA 4QRAA 2XV3A 1NGXB 3S5LA 5GGRY 2DYSB 3KGTA 3LXCA 4P3CH 1MUJA 4FI8A 3PABB 3L16A 1IU1A 1YMME 2X4TB 4GNKB 1K2DB 3QUXD 4K0OA 4NB7A 2HRPL 2P42B 4ODXA 4XOCA 2K8QA 1N5YH 2QSQA 4FTVE 3TURA 3P4OA 4WWNA 4ETYA 2EC9T 2UX7A 3K6SB 4PRNA 4FDWA 2YD1A 1CLOH 3EBGA 3PJLA 1N70A 2HLFC 4ZT1A 3IDMB 4NYLB 1AC0A 3APCA 2F0CA 1JCVA 3SZKC 5INDA 5ESQA 4QPEA 3TU6A 4MCYB 4XCNA 3N44F 3ML9A 1F3DJ 3N42F 3VGGA 1WP6A 1NZRA 3G5WA 4PW4A 4XO4A 3UYOD 1AI1L 3MZGB 1JGVH 1HDMB 2CHWA 3TBVB 3BJ91 5G2NA 2WLHA 3QR1A 2D3JA 3RTQB 3NQIA 5FLUA 3GMNA 1JV5A 4HGWA 1XAUA 5H35A 2BJMH 3HAEA 2NXZB 4OZHE 1ZLVK 4BH8A 4YSTA 5A6LA 1UD3A 2PXYC 4NBZB 2XN9B 4M7ZC 2VR7A 5IV2A 2H45A 4LPYA 3N1GC 4YDJB 4YHYB 2OK0L 3LB6D 1UOVA 4YE4L 1N64H 2CU9A 2QLYA 4PN6A 4RFEB 2OMWA 1XH0A 1N2RB 2I9LB 3O9WC 3ARDB 5CN1A 2DLFH 4JZJA 5ACMA 1II4E 2YD8A 4JQIH 1JBJA 1OGPA 1X5IA 4K7PY 4U1KB 2I32A 2V7HB 5ALCL 2VIRB 4K23L 2FEEI 5ICZA 1I75A 2R2BB 3WSQL 1KMGA 4OJFH 4IS6A 1BFVH 1G7MB 4TNVF 5DZLA 5FV1L 1A4JA 4LIQE 5DD0H 4IBTA 5CSZA 4OJCA 3Q5TA 1CZ8H 1NIAA 4N68A 2QZ5A 4KBPA 4WW2B 3GXDA 4ZODA 5IBTH 5IK3A 4B9GA 3WMQA 5EWIL 4HJ1A 3MNDA 2PN5A 4Y5YB 5JW4R 2DY2A 4IU3B 2R9HD 4AEHH 4P23B 3G9VA 3ZE2E 4JKNA 5SWSA 2B08A 3LZOA 3IDYB 3RLSA 4LHUG 4FQCL 1C5CL 2ZKWA 3D52A 3PPSA 5C08B 4J12A 4Q9RH 2YPLE 3B83A 3NTCH 4ODVL 4CN4A 1E90A 4N8VB 4MB4A 4CVXB 5DGRA 2D7TH 4O5LL 3B56A 1NGZB 4P5KA 4L3FA 3T6QC 3EJYD 2IFFH 2ZOUA 5DHEA 4FFZH 1HC1A 1RZKL 5TD4A 1I1FA 1MREL 2Z92A 3B9VA 3WNOA 5DJDB 1IFRA 3D51A 3X13A 2VIRA 1C08B 4UM8B 2NCMA 3CFKB 4J3WA 5IV2B 1URIA 5KSBB 1GAFH 3OJ2C 4XB7A 4YR6A 5IVZB 1DZ0A 1NAKH 4M3KB 3OKNB 2ZWKA 4NN6C 3UO8B 1F41A 1WAEA 1J5CA 4JHVA 2Q20A 4GW1A 3ZQWA 3MRHB 4KC3B 1AXSA 5JW4N 2EE9A 4NJAL 1DQMH 3FAXA 1WISA 5FW7A 3RWDA 4RMWA 1NGQH 1J1OH 1DBML 4LP8A 3F6LA 1KTLB 1UA6L 3W9EB 5C0DB 2PR4H 2D4DA 5BZZA 4TLKA 4TUUA 2IADB 4WJ5B 4AGNA 3U7YH 4WEUD 3SN6N 1OP4A 3GLAA 2UY6B 2LR4A 2WZAA 3GSOB 1AKJD 4IKNA 5FUCE 2HJLB 5EEUA 1TEGA 4OJFL 4X5LA 1HQRA 4B41A 5C2UB 2Y3AA 2ADFL 3E38A 5MEOB 1C9SA 3RWHB 1Y18B 5G4NA 3F6IA 5HJ3A 3C6LA 2ED9A 2EZ0D 4IGBA 4JKPH 4PJXE 4YHMH 3CUPA 1YJDH 4XN2A 2X9WA 3L3KA 1KTLA 5C0DA 5SX4I 1Q38A 3MV9E 4JPIA 2VDRH 5GS1B 4HXAL 2VZSA 5JOFB 2V2WA 3UBFA 2VMJA 1IC5L 1TJGL 1AXSB 1CG9A 3BCDA 3QXDB 4Y16D 3ZHDA 4M6ML 1BD2B 3V8OA 4XO9A 1KB3A 3DHMA 5IJCC 1OTTD 2VO5A 3TCLA 2CM5A 5J6GB 1YRKA 1YNKL 4UT7L 1AI1H 1JZ3A 5LN4A 5I0YA 4BXSV 2GUOB 4MQ7A 3HN8A 4AG4L 4TMPA 2YD4A 1MFDL 5DWPA 4Z7UB 2F53E 2VDML 5E2VL 5GRXG 1KCRL 1ETJA 3ISWA 4YVNA 2XN0A 5F89B 5JOFA 3NP3A 3IJYB 2KKQA 3ECWA 4QYAA 3V7AE 1QZ1A 4ESKA 1NGZA 1FDLH 5AAMA 4GLRI 3GZQA 3OAUH 2IAMA 1OF2B 2BNRB 4I88A 1HEZB 4M48L 4M7KL 4HOWA 4IGBB 4YSAA 3SE4C 3BIAX 4MSWA 4GRMB 3FU0A 4OFVA 1BOYA 5KVMC 2GBAA 4NFDA 1IM9B 2OMYB 3GJEA 4BYHA 3DIFB 4I77L 2L7UA 3L4VA 5IKCB 4QHNB 4G8GB 1JS4A 2XXGA 4G1EB 4LOVA 4JREB 1EO7A 1J1XL 4JEGB 3V4VB 1N26A 4X9IA 1A47A 4HS3A 1L3WA 2AQRA 3A47A 3QZPA 3QUMH 2LTQB 4O51B 3V0HA 1DEDA 2D7PA 5D8JH 3KLDA 5LNEA 5JW5B 2VLMD 3ARBA 1NBZA 2EEDA 3FTWA 4AUYA 1DL7H 4Q9BA 3T5WA 4HA1A 4OZFH 1B3IA 3LVEA 1OM3H 2H3KA 1LEIB 3RURA 4RQQA 3P77A 4KDTC 4OCNC 2NQ3A 4MNQA 4PJ8C 2Z0UA 2VDQH 3BRDA 2V8LA 4JFYB 2WINA 4JPVH 1WBXB 4D0DA 3FCTA 2IANB 2ZWZA 4HKXA 5TJWK 2EXWC 4DTGH 3QYMA 5ITBL 3OKOA 4QYOB 5IVZA 5SWQB 3ETBF 2W0LA 3NZUA 3OSVA 1BQUA 4L8SA 1UB5B 1NANH 2PWDA 3OR6A 4A66A 2NXYC 3TO2B 3KS0J 3US0A