5I6LA

Crystal structure of copper nitrite reductase at 100k after 2.76 mgy
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
total genus 91
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6lA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6lA02
5B7MA 2YAEA 1L9PA 3QJQB 1JZEA 2FQFA 3FSWA 6PAZA 1MG2C 1BXUA 4E9QA 3JTBA 4M3HA 5B7EA 2W8CA 2HX8A 3FPYA 4YSCA 5B3SB 3V9CA 2DYSB 2IWFA 1BXVA 3X1BA 1AIZA 3C75A 3UABA 1EZLA 3ABKB 3EH3B 1WS8A 1WA0X 4DP2X 1TKWA 1DYZA 2FJSA 3EH4B 4KO9A 5PAZA 1AG0A 6PCYA 4E9VA 2QPDB 4BK5C 2VM4A 4Q8BA 3AW5A 1X9UA 3WIAA 3PAUA 1MG3C 1AOZA 2GIMA 1A3ZA 1XB8A 1FFTB 2IWEA 4WKXA 1J5DA 1WAEA 4DPAX 1SHXA 1GS7A 1OCRB 4NAJA 2FQGA 1BQKA 3HB3B 1VLXA 2CUAA 3NSYA 3OQRA 2EIJB 3QJRB 2FTAA 2JKWA 1L9OA 3EHBB 3L45A 3FSZA 3S8FB 4HCFA 4YSEA 3IBOA 1A4AA 3ABMB 3ASNB 2MRYA 2X88A 1AZBA 2XX1A 4FAAB 4KOCA 4DP8X 3IE9A 1SDDB 3WNIA 4DP6X 1AG6A 3CZUB 4WTQA 3TBCA 2IDFA 1GW0A 2QDVA 3AG1B 4AKQA 1ID2A 4YSUA 4W1TA 3CDZB 1KBVA 4KNTA 3GDCA 4GY4A 4BWTA 3UAEA 1F56A 1PLCA 5EHFA 4YSPA 1OCCB 1J9SA 2OCCB 1J9QA 2VM3A 1GY2A 3T9WA 1JXFA 2IH9A 4QLWA 3QJUB 4MFHA 2HZHA 2AZUA 3TA4D 1SNRA 3CG8A 1NPJA 2R7EB 2XX0A 1E5ZA 2PPEA 1GSKA 5IY5B 1SHWA 3WI9A 2VMJA 5D4HA 4BXVA 2Q5BA 2BZ7A 3WG7B 1AS7A 4YSSA 2UXVA 2YARA 2YAMA 1JVLA 1NWOA 5B1BB 1V10A 3NSFA 1A4BA 3TU6A 1PZBA 2Y69B 2XV3A 4RH4A 2XXFA 1GY1A 3MBWB 3X1EA 2BHFA 5FC9A 1NDTA 2GC4C 3FQ1A 5I6NA 2JFCA 1SF5A 3SBPA 4A2FA 2LLNA 5B1JC 4TXVB 2AVFA 2H5UA 4GP4B 4G71B 3NYKA 4G7QB 4F2FA 4YSAA 4M4RB 2TSAA 4X4KA 2XXGA 1GS8A 1A8ZA 1E67A 3ZIYA 1RKRA 4BDVB 2PLTA 3AZUA 5F7BA 1UATA 2IDQA 3FU7B 5TK4A 2GHZA 4A66A 7PAZA 2AFNA 4EF3A 1HAUA 2BP8A 2XV2A 1BQ5A 1CC3A 3PAVA 1NZRA 1M9WA 2PPFA 2DY2A 3GYRA 4JKNA 1ILUA 5I28A 4YVNA 3JT2A 3FT0A 3NJMA 2PCFA 1AAJA 4F7KA 1L9SA 2OJ1A 3N2JA 2VN3A 2BP0A 2IDUA 3NJHA 1DZ0A 2QDWA 4YSOA 4DP1X 1ZIBA 1OCZB 1PZAA 4KO5A 1IKOP 1QNIA 2FT8A 1ILSA 2DV6A 3IEAA 2I85A 1NIFA 1W6LA 1ZIAA 1BYOA 3BQVA 2ZXWB 1PY0A 3PPSA 3ABLB 4NB7A 4YVUA 1JZFA 3WNJA 1XMEB 1IC0A 1WA1X 3S3DB 3S3BB 4DP5X 3FPXA 4ENZA 2NRDA 3FU9A 2FQDA 4E9YA 3G5WA 1RZPA 5I6OA 4E9WA 1KBWA 1ASQA 3NJNA 3FYEB 5B7FA 4G72B 3QJSB 9PCYA 3SBRA 2X87A 1E30A 4HHWA 4A2DA 5I5MA 2YXVA 1IBZA 1L9RA 2PPAA 3NJJA 1PMYA 2I7SA 1NINA 1JZHA 4G70B 1NIBA 2DYRB 4Q89A 3NJFA 1PLBA 4AKPA 1N70A 3T6ZA 2PP7A 4A2HA 1RCYA 1ASPA 4UF7C 1OE1A 1AZRA 2J55A 2FQEA 3S8GB 1T5KA 1AZNA 4JHUA 1ASOA 1ET5A 1PNCA 2MTAA 1ET7A 1PF3A 2IDTA 1GR7A 1HFUA 3WKQA 2XVBA 2WO2B 1BAWA 1BXAA 1JVOA 2BW4A 3PXLA 3FSVA 2ZONA 4GYBA 2UX7A 2YAOA 4PCYA 1AZUA 1TEFA 2BWDA 4UAHA 5ANHA 4FA7B 1OCOB 2J57A 1R1CA 5B1JA 1N68A 1NTDA 1SJMA 3FQ2A 4AKOA 1NIDA 3EH5B 1YLBB 1CYWA 3T6VA 1AACA 2GB2A 2HRHA 1A4CA 4HZ1A 4GXFA 3SQRA 3OMNB 2EIMB 2XV0A 2CJ3A 2BW5A 2GSMB 4HALA 3DTUB 4KO7A 1MZZA 3AG2B 2H3XC 4HAKA 1JZGA 3UGEA 1KDIA 5F7AA 2PCYA 4HIPA 1BYPA 3EF4A 2BZCA 2Q9OA 2YAHA 4G7RB 4N4YB 3ZDWA 4DP4X 2XWZA 3MX0B 4HCGA 2N0MA 1JXDA 4E9XA 1ET8A 4CSPA 2IH8A 4A67A 4A2GA 4YSDA 2IAAC 5B1KA 3H4FA 5LDUA 3OM3B 2IDSA 2YXWA 3OMAB 1AR1B 4GP8B 5I5IA 2QPEB 2HLEB 4P5SA 2UX6A 1FWXA 4E9TA 1EHKB 5D4JA 4NERA 4ZK8A 2BO0A 2FNWA 4DP9X 3AG4B 3FU8A 4DP0X 2Y1AA 4QKTA 1ETJA 1XB6A 2B08A 4G7SB 3T6XA 4KO6A 2BP8B 2DWSA 1J9RA 3CVBA 3FSAA 4HHGA 3T6WA 3FQYA 3QPKA 1ZV2A 4E9SA 2W88A 1IUZA 2WSDA 3QJVB 4PAZA 2ZWNA 2YAQA 2BP0B 2VW7A 2GBAA 2I7OA 5I6PA 3ABGA 1WS7A 1KGYE 1OF0A 3IN0A 1CUOA 4AZUA 3NJKA 1BQRA 2GC7C 4AI7A 1QHQA 3NJGA 3NSCA 3D12B 2UXTA 3BVDB 1AQ8A 1I53A 4E9RA 2H47C 3T71A 1FA4A 3UADA 3DKHA 5I6LA 2YAPA 2QT6A 3S3CB 1CYXA 5I6MA 2FT7A 3N55A 1NIEA 4GP5B 2OV0A 5TK2A 1URIA 5I5JA 5I26A 1ADWA 5D4IA 1AS8A 3AY2A 1SFHA 1OE2A 2XLLA 5A7EA 3V9EA 3ZX1A 3TBBA 4W9ZA 3CVCA 2CALA 2EIKB 3ASOB 3H4HA 2HRGA 4DP7X 1JOIA 2FWLB 2VW6A 2HXAA 2J5WA 3RYMA 3ZBMA 1AANA 2B3IA 5AZUA 2XUWA 1E65A 2CAKA 2AZAA 1IBYA 1E5YA 1AZCA 2VW4A 3QJTB 1V55B 1SF3A 2P80A 1KDJA 1BEXA 1NIAA 1M57B 3FS9A 4KOBA 2EILB 4N8UA 3X1FA 1WA2X 1X9RA 4YSRA 1J5CA 1SFDA 5E9NA 3KW7A 2E86A 3TASA 3U25A 4P5RA 3KW8A 2BWIA 3GXUB 3H56A 1ZDSA 1A65A 3PLYA 2UXFA 1KCWA 3ERXA 2YAFA 1B3IA 1SDDA 2PPCA 4BWUA 1OE3A 1V54B 1CURA 1NPNA 5I6KA 1KV7A 2IWKA 1L9TA 3OD3A 4DPBX 3NP3A 3PAZA 3QQXA 1ZPUA 2AANA 2TSBA 1JERA 5AKRA 3UACA 2FT6A 1PLAA 4BXSV 3X1GA 2VSKB 3CDZA 3DIVA 2UXGA 2CCWA 1TU2A 1HAWA 2PP9A 2GI0A 3AG3B 4HCIA 4F2EA 2PPDA 3HEIB 3WKPA 4KNSA 4DPCX 4YSTA 4YL4A 2CBPA 1AS6A 1NICA 2R7EA 2J56A 4KNUA 2HX7A 1J9TA 1OOWA 3NJLA 1OV8A 1PZCA 3CVDA 4A2EA 4L0PB 3NJIA 1GS6X 1KCBA 1RZQA 1M56B 1PCSA 1W6WA 4CSZA 4JHVA 2XYBA 3IN2A 2A3TA 4K9JA 3PCYA 1XB3A 2ZOOA 2JXMA 1L9QA 2RACA 2XU9A 2P80D 2PP8A 1JZIA 3UAAA 2EINB 5B1AB 4UANA 1TEGA 5AFAA 1JZJA 3NT0A 1PAZA 1MDAA 7PCYA 3NP4A 1NWPA 2YQBA 1ZDQA 4AX3A 1GYCA 1MZYA 1QLEB 2HX9A 5PCYA 4BDVA 3NSDA 2DWTA 1KYAA 3FYIB 3X2QB 4BWWA 3FU7A 1PNDA 3SBQA 1JXGA 3OMIB 4A68A 4YSQA 2VSMB 3X1NA 1W8EA 8PAZA 2WO3B
chains in the Genus database with same CATH superfamily
3BXNB 3OF6A 3TA3B 1CI5A 2VISB 2EIBA 4XX1G 2NTFA 5MI0B 3TZVA 4M8QA 2HTLD 4UOQA 1I8IA 3FSWA 2AMUA 3WIFB 4M3KB 5DRWA 2WLNA 4AENB 2DMHA 2H9GB 3RWIB 1UWGL 5C97A 3MACL 4MA8L 5J5EA 3NN8B 2ERJC 1NGZB 2X09A 4DZBB 4UQBA 1LM8V 4N28A 4X6DA 4GRLA 3VFNA 1YO4A 5B3SB 2EVIA 3SE3A 4WUUD 4MAUL 3QUZC 3DVGA 4Y19D 3KLAB 5DJ2A 2COQA 3QWOB 3S5YA 3EYFB 3EH4B 3GBNH 3F5WA 4UDUA 1SXNA 4DN4H 4U3XA 5LN4A 3VAEA 5ILTH 2VLLA 3FDWA 2JJUA 2V37A 4U1SA 5TH2A 1D9KD 4I5BB 4WV1A 4ETQA 1FSKC 1KGUA 3GHEH 4JGMA 4NM8L 3KYMB 1IKFH 1HZKA 3TO4B 1C1EL 3NFPB 2FEEL 4JPSA 1O9WA 1G6RL 5HYFA 4BV1A 4DPAX 2GUOB 5J56B 2VAJA 1OCRB 4NAJA 4WHTB 2Q3ZA 1A2YB 3WBDA 4U6YB 1CK0L 1JK9A 3IKCA 3EO1B 2FNBA 2VC2L 3E3QC 2DH3A 1KCVH 4HFUL 2YGOA 3K72B 2WBJD 3VSQA 4CVXB 5AUMA 5ITFB 2UWEF 4DK6A 2N59A 2ED8A 3D39D 2H1XA 2X0UA 1EIBA 1QI3A 2LU3A 4QNPE 3DVIA 2OMTA 3T2OA 1ES0B 4EJ1C 5CBAA 3UAJC 4H8WH 4O2CA 3NEOA 4PS7A 4CDGC 5DUML 5ICZB 1F1AA 4PUBH 5AZEL 3FH7A 2G0LA 3MLYL 4L4TA 3H1ZA 3F05A 4PP1C 2R56H 1TZIA 4XOAA 1XAKA 2JI3A 5GRVK 3BPLB 4WSKA 1WEJL 4W1TA 3RY6C 4AYMC 2B7DT 4XN1A 1K8DB 4OJFH 4IBVA 5KSUA 3DMMD 5J6GB 3GDCA 2H0PA 4O58H 5KBMA 3U1PA 4ONGL 4YSPA 1NCWH 3X11A 4NHUB 1P1ZB 5EA0H 3F01A 4FFZL 1DDTA 3OHMB 1RZKH 3E2HB 4JR9H 2NY6D 2DM2A 2EVJA 3NK4A 3QJUB 4J6RH 4ZOAA 4YHMH 4PJ5A 2V5MA 3KHOA 1UFUA 4PTUA 5ERWB 2ZIDA 4KQ0A 4I18A 3SYQA 2NR6D 2P47B 3WI9A 2VMJA 3IJYB 2EDLA 5JMRA 1R3HB 3N1MC 4YPGA 4LSVL 5DA4A 4E0RA 4XXWA 4FQQA 3FK3A 4K8RD 1YNTA 4HWEL 4HEPG 3II3A 1HSAB 1L6PA 1T6VN 2GCYB 3WL9B 5JDSB 3B9KD 3ARFD 3AQXA 5ADOL 1NMCB 3EO9L 4OCSL 1U4FA 4FABL 2VB5A 2WQXA 4MNGA 3FXIC 2CU9A 1OGAB 4JO3H 3ZE2F 2B8OT 4ZW3A 4Y16C 3T3MF 2OJEA 2V2XB 3QH3B 3OL2A 4X9BA 1RXLA 4NAQA 4DFHA 5FR3A 1F86A 3V4VA 4B41A 1A1MB 4IMKC 4LLMA 2GTZA 3BD5A 3CSFA 3I6KA 4HJSA 4LLDB 2DIAA 4P23D 2NW3B 3ZIYA 3L4WA 3UYOD 2AEPL 2QKIB 1KBPA 2X7LA 1AD9B 1DJWA 1A3RL 1JWMB 3FU7B 3OXRA 2B5IB 3QORA 1QFHA 2J8UA 3V4PB 5A16B 3WXWH 2XWBA 2XV2A 4OFIA 4LRNL 1F6LL 3WJJC 5DHVH 4P2OC 4ONFH 4A7SA 4NI3A 3QWRD 4IHOB 3WAJA 1GIGL 3EOYG 8FABB 3EYUL 3S37X 5L4MA 2NTFB 4G6AD 4ZW5A 1NA8A 3LYRA 4M8QB 3V9FA 1I8IB 4B9IA 4ZXBC 5DRWB 2MCAA 2FEEI 4CDHA 4J27A 3OKMA 4K5MA 2J7LA 3CFNA 5KTEL 2O5ZH 1REIA 4JQXC 3DYPA 2AXWA 2L3BA 1KT2A 3HI5H 4HZLB 4MJID 3U79A 4GRLB 3VFNB 1QNIA 3OKEA 4L1LA 4L8DA 3DVGB 2CIKA 3ARWA 5DJ2B 1PY0A 5L88L 3AGVA 2A74C 3K6OA 3EYOA 2XWCA 4IGBC 3F5WB 2ZNXA 4ACTA 4DOHB 1JPTH 4M48H 4UDUB 3BGFC 2NZ1A 4U1SB 4MNQE 3QDJA 4WV1B 2HUEA 4P46A 1CF8L 1MHHA 1LWHA 1Z3GL 2Z6FA 3GM8A 4Q0XH 5L6YH 1AVAA 3SBRA 1KC5L 2VUOA 3BUDA 4EUPH 4X5PA 3ZT7A 3M1OA 1YRKA 3HMXH 3ARDA 1CO1A 3IVKA 2NQCA 2A9DA 4ZNCD 4U0QB 4DVBA 3IKCB 1JK9B 1FDLL 4LPVA 4UIMA 4XTRC 3QWNA 1GZHC 3UJTL 3D25A 4AQ8A 5T5FL 2WOYA 2VR8A 1K2DA 5IMMA 2E59A 5AW6B 5GRJH 5J1TC 5AUMB 3BUTA 3IKKA 1ZXKA 2BIPA 4PJAF 3R7RA 1BLIA 1UH4A 4PBWD 4M5YH 2IDTA 1DQDL 2IGFH 3MRGB 1FL3A 1QACA 2A83A 2OMTB 1NGPH 5CBAB 2I60H 4HLJA 4OZGA 4BCYA 4O2CB 4P5TD 2Y7NA 3PGCA 1A7PL 5CO1A 2I26N 5AVTB 4L4TB 1AKJD 1QRNA 3DETD 2BWDA 5BJTB 1TZIB 3EBGA 2R0WL 3SO3C 3ZDYE 1RZJL 5EORL 3RB5A 2XA8L 5JXAL 4AKOA 4N68A 4ZUVA 3FN0H 5TDOA 1UUSA 3S98A 5AYQA 2G0KA 5KSUB 3Q48A 3IU3A 4NQDE 1RJCA 4ZMVA 1AACA 1QFWH 2E3VA 5B1CA 2DBLL 3GLZA 1KNOA 1QG3A 2BRRH 3NDYE 4L9LA 4LPCA 1JGVL 1MEXL 1RUMH 2BVYA 1ZVHA 3CFCL 2OMNA 1FL5A 4PJ5B 3WY1A 4FMVA 4PTUB 3V0DA 1QPXA 5T1KD 5IOKA 1OM3L 4I18B 1LDPL 4GAGH 1BOYA 2DI8A 3P2TA 4DTGL 3FJTA 4WCYH 4PJDF 4E0RB 4P2QD 4FQQB 2BMKA 1YNTB 4G8EA 4PRHE 5KSBA 2ETWA 3MLZL 2PTVA 3L4XA 2ALWA 4GB9A 4XVTH 4QLRA 1L7IL 5GISH 4GXUN 1DBBL 5LO7A 4MNGB 4HUXA 4NQSA 5H2BA 4F57L 5BS0A 2OJEB 3MR9A 2ZX5A 2YXWA 3BH4A 4GP8B 4NO2A 2H0FA 3IDMA 5IQ9A 1PKQA 2NNRA 3D2TA 3V4VB 2VR9A 3L3OC 4LLMB 1RV6X 2GTZB 1GMEA 3I6KB 3K74B 1L0QA 4JDTL 3B2PA 4ZK8A 4N2BA 2RJMA 2X7LB 2IQAA 4Z3GA 2JH2A 3FU6A 5SX4H 5CGYD 3QORB 4RMTA 5HHMD 2J8UB 5CP3A 2XWBB 5KVFL 3PDDA 5L4FA 2EXTA 3EDJA 4HU8A 3QPKA 4TUJA 1Q8MA 4MX7A 1MRCH 5SX5H 5C0CE 1YECH 1KELL 3SDAA 1CGSL 1VESA 3MRMA 3VTMA 4LLQA 4B95C 1LHZA 2GBAA 3ARUA 3OKMB 4E9LA 3B5HA 3GMNA 4JM2C 1AY1H 1KT2B 4WY7H 1RPQA 3IN0A 2ZXDA 3OKEB 1EHAA 3JV5A 4L8DB 4S1RH 2CIKB 4AVIA 3NCEB 2ZOTA 1OAQL 3LEYL 3ZHDA 4HUMB 5DHDA 4F1ZA 5GRVL 3GNMH 1I9EA 4LHJB 3HE6B 3EYOB 4YDJA 4ZTOH 5D1QC 5LBSH 3UADA 5I75C 3BAXA 3L08A 2X6UA 5HTSA 1A1OA 4PJBF 3F6JA 2J1ZA 3QDJB 2FT7A 4KQ3L 4NP4L 4UV4H 4P46B 1MHHB 3SE8L 1OD9A 2CWRA 3H53A 5DZ9A 3RL1A 4NWTL 5C70A 2X3AA 1LTXA 3HI6H 3KS0J 4HCRL 4LF3B 4C56E 5LG1A 4PJHE 5DZLA 2VXUH 1KJ2L 3HAEH 2QQLL 1G1CA 1RH8A 2NY5C 3ARDB 4HPHA 4QOKA 4NFDA 2B3IA 1MI5E 2O5XH 2VN7A 1XH0A 3W39A 1F1GA 5EU4A 4UIMB 4DVBB 2AZAA 4LCCA 2G3NA 2W65A 3D25B 1VFBA 5IMMB 3QDMD 3WNPA 1DZBA 2R1WA 1RJZA 3ZU8A 1MIEH 3QIWC 4JVUA 3T4AC 1OPGL 1I9RH 4K8RL 3GUTA 1RMFH 3MLUH 3QEHA 4KKNA 2WNWA 2VZVA 1INQB 4LPTA 5EF1A 4XAWH 3MRFA 1FL3B 2A83B 2ZJSL 3TASA 1KTBA 2EVFA 4OZGB 2OZ4L 4PBVC 2GIYA 1QHOA 2Y2WA 2CDEA 3PGCB 1IGYA 4F80A 3TEZA 1SDDA 4BWUA 2K7QA 2ZKHH 4XAKD 1QRNB 1AMYA 1NCTA 3S8WA 3NP3A 6CGTA 4JL1A 1ZPUA 4HAFA 4N2DA 2J6EH 1CR9L 4KROC 4ZUVB 4JO4L 4AQ1A 5J6HA 3H3PH 4JREC 1LO3H 1T0MA 3G6JE 3ZTJG 4KY1L 4M6NH 3IU3B 4LHUA 4Z9KB 4GXVL 3WN5A 3DXAE 2F5BL 3CFKA 2JKXA 3LDBB 3EAKA 1UXWA 3MJGX 3RZCB 4PGZA 3V5DA 1KNOB 2XWEA 1U2HA 2A0LC 4L9LB 3K80A 1SEBA 4JM2F 4XMKH 3TN0A 4ANKA 3BVNA 3RVXD 5FKPA 2VLMD 1O9ZA 4OF6A 1PZ2A 1WBZA 3PNRB 3TTSA 2ZTBA 3FTSA 4I3SL 4Y2DA 3MCYA 3CN1A 4WGKA 3VDCA 2WK2A 5IJKA 1LVEA 1N2RA 2Q8BL 4B9CA 1HOEA 5JPMC 3MMEA 4KZDL 4PIBA 3HZVA 3NJLA 2VL5A 3ARGD 2BMKB 4FTVA 3HJ0A 3PQYD 3ILQD 4G8EB 5KSBB 4KDVA 3RHWF 1NOFA 3B9AA 2ZOOA 4QCIA 4FZEL 3A67H 4WTXA 5DWUL 2YSSA 4GRWF 4FQHA 5EIIA 1QHPA 4KKBC 1P9MC 3OQ3B 4HUXB 4NQSB 3IRZA 5D1XD 5H2BB 5BS0B 3MR9B 2FWUA 4UT9A 1QFOA 1I75A 1U6AL 2NCEA 3IDMB 4NO2B 5B1AB 5IQ9B 1PKQB 3H2PA 4IMLA 2IH3A 4JS7A 5E5RB 5DHXB 5A2LH 1ZDQA 3ISYA 4FI7A 4JFOA 3VFSA 4X4YA 5EOCH 4KK9D 1T66C 1WD9A 2IQAB 2DWTA 4H20L 2QPFA 3ULVC 1EUTA 4LSTH 3O4LA 2JCWA 3FTGA 1JXGA 1QLEH 3C60A 3KNBB 1YVLA 1JVKA 4TUJB 4G5AA 4DUVA 1QX1A 4PJFF 1X9QA 1MVYA 3SDAB 1F3RB 1L9PA 1U3HA 2OP4H 4OFPA 1P7BA 2F53A 1XSIA 3GI8L 3B2UC 3MRMB 4LLQB 5JZ7C 3BZFA 5CN1A 4M3HA 4MZ3A 3H3KA 3E6HA 2W8CA 2L8AA 1CYGA 3MLTA 5IQ7H 3GZQA 5C3LD 1XR8A 4LXFA 3FQNA 3MRPA 3MV8A 1UH3A 1BXVA 2IWFA 5AW4B 1W2KT 2PXYA 3ABKB 2N7BA 2ZPKL 1WA0X 2VR5A 4YDJB 5L0QB 4Q97A 5L8LB 5GGVL 4U4BA 2FSEA 6PCYA 1A1OB 1QOKA 3CLFL 5DD0L 3S36X 3I6LE 4FX5A 3VWJA 1IM3D 1D5XA 1EANA 3F65A 3QQ9C 3RL1B 1S7WA 3W3BA 2YBRA 3KPOA 5FB8A 4M9PA 1FFTB 1T0PB 1J5DA 1WAEA 3UMTA 3QUZD 4XX5A 1DVFA 2VXVL 4JQVC 3MV9E 4ZFOL 4QOKB 3LIZA 2EC8A 1QSFD 3W39B 2W0LA 1BQKA 5EU4B 1I1RA 4LCCB 4I8DA 2W65B 4M5ZL 1VFBB 2YPVA 5C09D 2R1WB 1RJZB 4MLSA 2LW3A 5SWZE 1J10A 1KGCE 2WBXA 3GUTB 3QEHB 2E6JA 1N7ML 3MRFB 1EVUA 5IVOA 5B39A 2CM5A 3IJSA 2CDEB 5G4OA 3L13A 2QSTA 2AQNA 2A2QT 1BFSA 2CO6A 1IGYB 3D50A 3FO0H 3LKRA 2G4EA 3QQDA 1SDDB 4RGNB 2UUDH 2Q87A 1MRFH 3ULVF 2CKBL 2OULB 5DD3H 4UU9A 4NO3A 3VSVA 2QDVA 2FBJH 4ZW6A 4TNVK 1RU9H 1SMAA 4AQ1B 5J6HB 5F8RC 5CJOH 1T0MB 1GKEA 3MBEC 3H8NA 3QE5A 2XIDA 1NFKA 3ECUA 3GJFH 3WN5B 3CFKB 3O0LA 2NYZA 1UXWB 4MZRA 3V5DB 4MBOA 3U0PA 1FFPA 2B1HL 1SEQL 1AC0A 1SEBB 3TN0B 5I1CH 2VDML 3BVNB 2AJVL 5FKPB 3HUJA 5C0DA 2E7BA 2QFRA 1WBZB 5E2UL 3CG8A 4I0PA 3WGVB 4Q6IA 3ISRA 4Y2DB 2E6QA 2X05A 1N2RB 3TJHD 5AYUL 3MMEB 1M71A 3HZVB 2VL5B 2XN9E 3HHSB 4I0KA 1V3LA 4FTVB 3IMVA 1Q0YH 4NXSA 2ZWYA 1IGFH 4HSAC 4HUUB 2K3TA 3HPLA 4N2EA 4A1RA 4QCIB 3X3GL 1E2VA 4PYGA 2YSSB 1FNFA 4FQHB 5EIIB 4BGDA 1N67A 3DHJA 4XXCC 4B7LA 4EO5A 4MAZA 4PRNA 1ETB1 2XXFA 2BHFA 5FFGA 4O02H 3W0WE 4U1GC 4BE5A 1IC7L 4Q2ZA 1ZA6A 4JG1L 5F7FA 3F7LA 3HBGA 4IMLB 4KKZA 2IH3B 2IEPA 2DL2A 2VLRE 4JQIA 1J86A 3I50L 4JFOB 3VFSB 1IAIM 2WUBH 1T1ZA 1ZAGA 4X4YB 1UB6A 2XWXA 2KBGA 4KRNA 5F7BA 3O4LB 2IDQA 3FTGB 3MJ9H 3IXTA 3GXFA 3N40P 3C60B 4H25A 4NQVA 5EWIL 3AY4C 4JKNA 3PXJA 4XMLL 1U3HB 4Z76A 4OM1L 2F53B 1CLZH 1YNKH 5GGTH 3TYGL 3BZFB 4NNYA 2QTEA 1D7BA 1TT6A 3WHXA 2Y07L 3E6HB 4XWGL 3MLTB 1ZIBA 4Y5YA 5HDLA 2OR7A 4WI0A 3WENA 1XR8B 4N0YH 5FLVA 3NA9L 1YEFL 3FQNB 2Q2LA 3MRPB 3MV8B 3QRLA 3EXLA 1I3GL 1ZLEA 2PXYB 3QZLA 1GAFH 1F4HA 4XVUC 2CH8A 4CC4C 3LY6A 5DJDA 1XMEB 2EXWC 4B9FA 4YXLH 2FSEB 3OKLA 4FCAA 3CN3A 3KM2A 3VWJB 4E9YA 2KHAA 3HJEA 4ONHA 1TQWA 1D5XB 4FQLH 4K15A 1S7WB 2YBRB 3KPOB 4ABQA 5LUMA 4LSRL 1BG9A 1JRHL 5FB8B 1TSHA 2Z7UA 5I0DA 3OKOA 1B0RA 2F7PA 1DVFB 2HLFD 5KVEE 5AW8B 4G70B 4BZ1L 1NIBA 4Z7WE 5E8PB 4DK3A 5KS9A 5GGQL 3SYOA 3EW3B 4N0FA 4HJIA 4JM4H 3KPMA 1A21A 4NZUL 2BNQE 4MNQD 3VGAB 3WUWA 2IGLA 1A4JA 4FQPA 3C09C 2WQWA 4GSQA 3BC9A 3S88L 1ET7A 3HE7C 1QSZA 1JGLL 5B39B 1M2VA 4WWPA 5HI4C 3D52A 3KWWB 5IGXL 2XVBA 3PABA 2EJ1A 3IJSB 4NKDA 2CO6B 3LKRB 3SKMA 2NW2A 4JVPA 2Y22A 2UX7A 4PMEA 3B2MA 3N41B 4UU9B 4PUBL 5BUGA 4NO3B 4GS7B 3B1UA 3D09A 4XO4A 5D7SH 4QR7A 3FU3A 5JW4R 3AMLA 4CMHC 4IOFC 1CLOH 5ENWA 4FCHA 2E46A 3QFDB 2IPTL 4UQAA 3RIFF 1T3FA 1FFPB 3OMNB 1T4KA 2WLLA 4DK5A 1MFBH 3AS3A 4RMBA 1DLFH 3HB3C 3HN3A 3Q3GA 5C0DB 3HUJB 1WITA 1JCKA 3VFTA 4AJVA 1L7TL 2PCPA 3BAEH 3HG1A 4I0PB 4Q6IB 1EZSA 5ANME 3SHSA 1H9DA 3BAKA 5D7IF 4OUUA 3B7UX 2ZE0A 1W0YT 3CK0H 1VZHA 3H54A 3QFJB 2D03L 4QXUL 3UO8B 4JW3A 3UBFA 1PIFA 1SM3L 4NQDD 3HPLB 2EEAA 3R1GH 4YBLB 2UV3A 3NCYS 2DS4A 3NGBC 2B3RA 2X4PA 1OIOA 4PRNB 5DMJB 3QK0A 3H4FA 2GEQA 2FE0A 5HHVH 3ECVA 4Q2ZB 1ZA6B 5D1ZD 3UIZA 4KC3B 3VXRA 3QHFH 1TXKA 1KIQA 5B8CA 3MXWH 2K70A 4PLNC 4DGYL 3E80A 3BWAA 2QQQA 5CJ5A 1T1ZB 2MKWA 4XXDA 1UB6B 5GZOD 1QNZL 2BO0A 4PRHD 5EO9A 1MCNA 3AG4B 3AT8A 4G7VH 2AKRA 3IXTB 3T6XA 3L8QA 5CR8A 4QRPA 4NQVB 3AXHA 5DHVA 4LEXH 2EUVA 3FQYA 2D7TH 2DQJL 4CL7A 4AYFA 3RDTA 4Z76B 1A22B 1JRHI 2NMSA 4Q52A 4HJJL 5MP6H 4NNYB 1HE7A 4JRXB 4R90L 5I6PA 4LPYA 3WHXB 2NY2C 1CLYL 3KXFE 4Y5YB 4WI0B 2Y24A 2MFNA 2CBOA 5DLML 2F1BA 1J8KA 1J8HB 5IHBA 2F2HA 5IWLC 1TO5A 4Y4KD 1AHWA 3JBG7 4G8AC 4YHOH 2P5WA 4BSVB 4WUKH 4KRPB 4LOUD 3BW9A 5DJDB 4J3UA 5F2FA 3RAJH 5D70L 2UYLA 2H3KA 1KTCA 5C0CD 1MAJA 1B4LA 12E8H 5CMAA 2F7OA 4ONHB 1J12A 3UPCA 3D0LA 1JNHA 3MRBA 4NUPA 4PJGA 3W37A 3F85A 3QIUA 4G6FB 3EDDA 4PGBA 3AY2A 1BF5A 4QRRA 4KTDL 4EUPA 1TQCB 1B0RB 3SDXB 3HMXA 4DP7X 2KH2B 1GGCL 2VW6A 1FH2A 1AANA 1TIUA 5KS9B 1E65A 1FRGL 5KJ4A 2ZCHL 1FIGL 4N0FB 3KPMB 3ZUCA 3WTSA 4O9HH 3QJTB 1V55B 1VSCA 1HILA 3EBIA 5LQBH 3WUWB 3RHWK 1A4JB 3L1FA 4N9GA 3X1FA 3UZEA 1CICD 2CKNA 3N9GL 1KTLA 4C56D 1M2VB 4NZTH 4P2RE 4NM4H 3PABB 4TQIA 4NKDB 4ZG1A 4OTXL 3SKMB 5EO1B 2NW2B 4MXWL 1NOLA 1XL4A 2PPCA 4PLOB 4HUCA 5DFVC 3OLGA 1SLVA 2V7HA 3K3QA 1F2QA 1U36A 2QSQA 1X4XA 3JWDH 1S8DA 3TXAA 4ENEC 4LCWE 4KKPA 1HKFA 1CXLA 2AAVA 2NLJA 4X6CE 1E9QB 1ZSHA 4HH9A 5ENWB 1OP5H 3IT8D 4MA3A 4YLBA 4L05A 3GBML 3CXFA 5E08H 2CCWA 1R3KA 4YNYA 4F5CA 4YHYC 2WN3A 2W59A 1NBQA 1G0XA 3K1DA 3L4ZA 2N1TE 1T3FB 4KUZL 2WLLB 1OSPH 2VZSA 2XN0A 1SLXA 3QJFA 4H1LH 4GINA 4HA1A 2AABL 2F5AL 4DPCX 1FG2A 2IBZY 3Q3GB 1G9MH 3H6JA 3VFTB 3VD9A 2NSMA 1SQMA 3CE1A 3LRGA 1XTMA 2K6YA 2PCPB 3HG1B 3HNTL 3LH8A 4AGOA 2HX7A 1BM7A 2HSIA 2XKSA 3CBRA 4OUUB 1C5DA 1P4BH 3L1GA 4JZNA 1V5JA 1GCYA 2XJKA 5CLTA 4ANUA 1OP3K 2WO4A 3DXAD 1BP3B 2YR3A 3DV4A 4MDRA 1ESOA 2O5YH 1QP1A 2VAAB 5IIEA 2X4PB 2OKMA 1NPUA 3QUMH 3NCYP 3WO4B 2GSGA 3LMJL 2BSED 5AFAA 1X5KA 3VXRB 2AK4E 1KIQB 1PAZA 2X2YA 5TQ0H 5B8CB 3GTVA 2YIHA 4IKKA 4X0NA 4JJOA 3BWAB 4HD9A 4AX3A 4Z7IA 4XXDB 4MCYA 3SD2A 5EO9B 1F42A 4XNZB 5IFAL 2ZX7A 3JYCA 1X5FA 4FZ8H 3T0EE 2AKRB 1EPFA 2N0KA 5KVDH 1OTSC 2LAGB 1KGIA 3QAZB 1MFDH 2HFFA 1EHNA 2GTQA 3IYLW 4QRPB 3D6GA 3IF1A 3MN8A 2G3XA 1WZ1L 3LCYA 1G7QB 3UH8A 1QW8A 2P45B 4JHBA 5TE6L 1LO4H 4AYFB 3E8UL 5GGRA 3DUSB 1C08A 3KBEA 1UENA 3C6LD 3L6FA 1CTMA 5E1AB 4UINH 5FWRA 1F4YH 6PAZA 1YMMA 4X2UA 5D2NE 5GRXG 4H2AA 4RMRA 3JTBA 5E99H 4KK8D 2DLHA 2WQSA 4M93B 1SDAB 3G5YB 4LL4A 4EXKA 2EDMA 1DQQA 2OR8A 1AHWB 3H0TA 1BDYA 2P5WB 3KH4A 4FE9A 5GS3A 2LTQB 3ZXAC 2HVKA 3BW9B 3CC5A 2YRZA 3HG3A 1KIPA 4X7EC 1DYZA 4TQEL 2MNUA 1MJ7H 2UYLB 1WH0A 3B3BA 1MF2L 2V17H 1OTTC 3O81A 3D0LB 1JNHB 4JGJA 1ZGLM 3MRBB 4JZJA 2NY3B 4FDWA 4JKPL 4PJGB 3RVWC 3SJVA 3V0WH 3QIUB 3SPGA 1WFNA 4WHYH 1HINL 4G7YL 4QRRB 5J11C 4EUPB 4ZNEE 5F71A 5E4IA 4M3JA 4NBXB 4UT6A 4XMZA 1SVBA 1I3VA 1M05A 5DYOA 1JPSH 2ZWKA 5L9DL 3GLAA 4IRSC 4HIQA 1XXDC 1HILB 2A73B 4Y9BA 3I6LD 4PVNA 1JI2A 1JPST 4I77L 4N9GB 4UQ9A 2ZSVA 3WTTA 4AVJA 4LDCA 3S8FB 3BQUC 3MV7A 1KTLB 3WSQL 2KPNA 5AZ2H 1Z9SB 1IC5L 5DI8A 2EDOA 2ZF9A 4AL8H 3MV9D 5D71H 4RGOL 4D8PA 4DP8X 1FAKT 4I3RH 4AYBA 3WNIA 1LK2A 3ESPA 2V7HB 3QPQD 1TQBC 1I1YA 4L1BA 3IJHA 4Y2NA 2WKOF 2X6AA 2CNYA 1S8DB 4YSUA 2J6EA 2NLJB 5SWZD 1KGCD 4HH9B 4MA3B 2DMBA 3PGFH 4YNYB 1R3KB 4HV8A 5J13C 1XF2A 4NZ8A 2WXJA 3QJFB 1GYUA 2QADC 3WN6A 1JXFA 1BGXL 2PYEE 1ZLDA 1FG2B 3FULA 3SCMC 1HJBC 1HIML 5HGHA 2JCCA 1T03H 3ZE0B 3GSNH 4Y5XA 4HWZA 1A9EA 5A6LA 2Z8RA 4YFDB 1J5OH 1WD8A 1PZUB 1JV5A 1E28A 1IIIA 1Z32X 2B39A 3BP5A 4JZNB 1NM9A 2E7CA 1CGUA 5DHMC 3DV4B 2J8HA 3MX0A 3H42L 1UZGA 4LIQH 3NRQA 4YLQT 2YAMA 4KXCA 1AI1L 3FKUS 5F9WB 5HDQL 2H7WA 4OJAA 2VDNB 1NAKH 5C0IA 4KXZH 3L5JA 3ESMA 2GSGB 2YRBA 4BRJA 4A2FA 3VRIB 1N19A 2C34A 1NAMA 5B1JC 3MLSL 2IXQA 3FL7A 1U92A 4YSAA 3KCPA 1KBKA 2OZNA 1HT6A 2TSAA 4K3JH 5IHWA 2V7NB 2DQEL 3Q2NA 2C3GA 2XN9D 1DBAL 4MCYB 3QJOA 4BINA 3H9SE 2P1YA 5C0JB 5TJWK 2ENSA 2IV8A 1Q9KA 4TVPL 1S7SA 3IRPX 4OGQC 2WZPD 3P73A 2HFFB 1NBCA 1O7SA 2P5EA 4XNYH 4J4PC 4KDTC 1CC3A 2KDGA 1DEEA 1AO7E 2DY2A 4Y1AA 2XVKA 4HUVA 4JRYE 3IS0X 4RDQG 4NN6C 5GGRB 4X7SH 3W0WD 5I0XA 4LBEA 3L6FB 5BZWA 3SDCC 4F7KA 1L9SA 3KR3H 1KCUH 5C0BD 1E42A 1YMMB 1QBBA 2VLRD 3ILDA 3ZPDA 3LD8C 4Z3FA 1K9TA 1OCZB 3W57A 3FQ4A 2NY5L 4M43H 1DQQB 1RHFA 1V7MH 3H0TB 4WEMB 5F21B 3VG9B 1KJVA 1Z0NA 1A9BA 2HVKB 1J05A 1MHCA 3CC5B 1AOHA 3PPSA 4IDJH 1KIPB 1SDYA 3HC3L 5BRPA 1G84A 5E94A 1E4KA 35C8H 4ENZA 4YLCA 2J20A 1LO2H 3VQMA 4JZJB 1X6NA 3SJVB 4XB3A 1BVOA 3RIFK 5JTWA 3HBZA 5FYLE 1DFBL 2X87A 1E30A 5IHUL 4UOJA 2ZZUT 1UM6H 5GRUH 4Q4IA 4AYGA 1J1OH 1M05B 1CGTA 1OAUL 1H0DA 3QNFA 5D1ZI 1FVCA 2QKIC 5DYOB 2CD0A 4Z95L 5FGBA 4NPYA 3WHE0 4ZUUA 4UQ3A 3T1FA 3X14A 2DOCA 2PP7A 1DQJA 3BWZA 2LAAA 4GKLA 3U46A 3AU0A 5LGKA 3S8GB 3MODH 4WJG3 2ZSVB 1VENA 4XNXH 2Q7YA 1C5BL 3MV7B 1OAJA 4ZUTA 5A3IC 2R8SL 5GZNC 4KGJA 3CX2A 4MJJA 1YQVL 4ILDA 2DYPD 5DI8B 4D8PB 2CO7A 5J06A 4HJEA 2NYKA 3LEXA 1JIBA 2XICA 3LNFA 5D1QE 5EU6E 3UBHA 3ELQA 5KYUA 3IJHB 4ZI8A 1CTOA 2ZYHA 5AEAA 1SRDA 3DUUA 2BNQD 2Q10A 1VPOH 4X7DC 1FHNA 3GJFA 4NN5B 4DQAA 2JELH 1J0JA 2IQ9H 1XF2B 1XGYH 3GF8A 4GXFA 4M7JL 4P49A 1T04A 3RWGA 1BZ8A 1OZUA 1ZT1A 2E7MA 1MHEB 5AYTA 4TQPA 4L1SA 2GSMB 3QYCA 5HGHB 2JCCB 5JHDA 3LHPH 4HWZB 4XO8A 3RL2A 1A9EB 4M7ZB 1C8QA 1BQHG 2QVIA 3MA7A 1AFVH 1JV5B 1E28B 3BP5B 1WFMA 3J27A 5FGSA 4U7SA 2M2DA 4A2LA 5H94B 2WBWB 2ZUYA 3O9WA 4LGRB 4N4YB 4Z7UF 1DHKA 2CHDA 3TLRA 2H1LM 2ZG3A 3MX0B 5D9SA 2WQUA 3L2MA 3ZKXB 3EJCA 1FCCA 3JTSA 5C0IB 1QPKA 1FI8C 3AACA 4MQXC 1UXMA 3LS5H 4JFDA 3OMAB 4O02A 5DEJA 5G55A 5ADPH 4V1DA 3O6LH 4I48A 5DQJA 1VZGA 4M56A 5F9OL 3D9AH 1NAMB 4PGJA 2IXQB 4F20A 3EYQD 3KCPB 1HEHC 3HRZA 4XE5B 4HBCH 1NC4D 3AWGA 2IIJA 5FYJE 3D18A 3FT9A 4PVBA 2VDPL 5BMFH 3V6OE 1Q9KB 3MJ9A 1S7SB 1ZKAA 4G8IA 1XB6A 4G7SB 4P99A 5ABDE 3P73B 1TTRA 4WWOA 3SDDA 1GMIA 4PS3A 2P5EB 4OLZH 3FFOA 3DIDA 3C6SA 3CVBA 1DEEB 2WMPA 4KY2A 5CKGA 3TNMA 4Y1AB 4L3FA 5L7XH 2DTSA 2ICEA 2WSDA 4K7PX 1WPCA 1H3GA 1MW0A 4LBEB 1BZQK 1Q0XH 5BZWB 3TPUA 5AW0B 4Z5RA 3QBTB 5CN2A 5GGTA 2YFNA 2I7OA 1OCWL 2HUHA 4WK4B 3ZJAA 3M7OA 1TQTA 4I0CC 4N1CA 4PWIA 4D9RE 2PETA 1K5NA 2I24N 3VGEA 1KGWA 1SBSH 4PJXE 4AI7A 3KGSA 2DH2A 4O5LH 3L95A 1KJVB 2X4SA 3T3ME 2AV7A 3X3FL 1J05B 5HHXH 1G6RA 2BZDA 4LSUL 4QI3A 3ZLQC 4I3GA 2WVSA 2CHWA 4QAWA 2CO2A 5E94B 3KS0H 3MSPA 3S3CB 5I1IL 4YDIL 4MVBC 1KCSL 1NL0H 4JFFE 5J6SA 2QGEA 2F9BT 3O8XB 3VVVA 3BLPX 4FQLL 3CFQA 1S7RB 1AS8A 1XEDA 3KXFD 5AWNH 1RP8A 2XWRA 4W9ZA 5KJRL 5H37G 3IRCA 2ZQKA 1H0DB 2C9QA 3A6OA 4JB9L 1FVCB 4OI7A 1RIVL 4H88H 4YHNA 5AG8A 4NPYB 2XUWA 4ZUUB 4ZTPL 4UQ3B 3FUKA 3T1FB 5E9DE 3X14B 2Z3FA 3U46B 1DQJB 3VO0A 4RISL 2VKXA 5FUZH 1KDJA 4P5MA 5CF3A 5BVJA 3CZGA 3B9VA 2Q7YB 3S5LG 3O6FD 2GBVA 2HKFH 3LRLA 4ZUTB 5BV7B 3KW7A 1WBYA 1ETZA 1AGEA 5E6ID 3U25A 4ELMF 1XGUA 5BQ7A 3RU8L 4HEMA 4Z7QE 5IV2A 2Z91A 1QR4A 1GC1H 3LEXB 4R5TA 2O6CA 1RAMA 1MFAH 2VDLH 2B20A 1TJIL 3F7YA 1TENA 2YOCA 5KYUB 1Z5YD 4RWYH 3CCHB 1WGOA 3DUUB 3T3PB 4YQXH 1VAHA 4BFNA 5LJYH 3NACL 1A7BA 1YEKH 3GJFB 3DJ9A 1JD9A 1HKLL 2OTUA 1ZOXA 3O2WL 3WGUB 1UURA 3SY6A 1H19A 4P2RD 1T04B 4HS8L 4F2EA 2EXYC 3WKPA 3OSVA 2Y06L 4EZJA 4YL4A 5JHDB 4GH7B 4OW6A 3IGAA 3Q6GL 3MV11 2Z31D 3RL2B 4Y9GA 1JFHA 2JB5H 4ZRGA 2D9QB 4JFZH 2N56A 2B1OA 3MA7B 4HQQH 4TRPH 1OOWA 4HETA 1IAIH 4LCWD 2PMZA 1NFDA 2IAMA 4UI2A 1PZCA 1R3IL 2DB8A 4J3OC 1NBYA 3NZUA 2BINA 3O9WB 4MQSB 2OI9C 4M5TA 2FIRT 5D9SB 1KENH 1JCVA 2G60L 3TBSA 1FFQA 2VH5H 1S3KH 5LWYL 3JTSB 1EO5A 3CX5J 3FN9A 4JFDB 4O02B 3A4DA 3ALWA 3UO1L 1JDAA 25C8H 4V1DB 4I48B 4WEEA 1TEGA 5DQJB 4OZHA 4I4WA 3HTLX 4GOSA 1DVSA 3HRZB 2XBZA 4LLAA 4MBRA 3SGEI 3QYNA 2R2CA 2Z35A 5PCYA 5EF2A 1UWEL 3E9TA 3D18B 3I2CH 3ARBD 4ZW7A 5IVXA 2J3SA 4W9EC 4G8IB 1F02I 2XN2A 3ULUE 1PNDA 1T0OA 1PX8A 1E4JA 5DF0A 3RTQA 3SDDB 2A6KA 3SDYH 5IESL 1LE9A 2DAVA 3C6SB 5EZIL 2WMPB 1RSFA 5C0AA 3TNMB 1HESA 4K5PA 8PAZA 4KKLD 2QQKL 4IBTA 2JIXA 5HD8C 3HFFA 3SOBL 1BOGA 2NNXA 2V3DA 3TPUB 5I74C 4RA3A 4Z5RB 5JQ6L 5BO1H 2AK4D 2FQFA 5E8NA 2EDHA 3LKOA 3EUDA 3QUYD 4DUWA 4OKVB 3H7LA 3CGTA 4UT7H 2KLSA 1K5NB 3DX9A 1MY7A 4OLWH 4NX0A 3W2DL 4ECNA 3T0ED 2CUHA 4JO1H 2ORBL 3Q2LA 2BJMH 4DETA 3L95B 1FFNB 3BWSA 3C5ZA 4LZKA 2AV7B 1IX2A 4M7LL 3ZKMD 5KVEL 1G6RB 1QWHA 3R0MA 3K1KC 3D3VB 2H0JA 4DP2X 2B14A 3WFCH 2WD0A 4K5LA 5JOEA 4CNIA 3S3PA 1A7RL 3QEGL 3T04D 1ZV5A 1I1AA 2VC2B 2D7OA 5AOMA 5HGGS 4B60A 2J6WA 3TCTA 3TF7C 3QQ3A 3LRMA 2LQRA 3G6AA 3MYZA 1I7ZA 3RVVC 4NRXA 3B34A 1CXIA 4J3OF 5AKTA 1E2ZA 4YHNB 1Z9NA 2BLFA 3WMQA 5DC4B 5LDSA 2FX7H 4JHAH 2IPUG 3DSFL 1K8IA 4DQOL 5ACLA 2AVGA 4RNRA 4N2AA 4Z3IA 3VD4A 2XZAH 2BNUA 4KXAA 2K1MA 1DJSA 5EFIA 3BIKA 4OCXL 4P5MB 4Z7NF 1RK1A 4Y7MA 4XOCA 5BVJB 2G3MA 2FTAA 2HT2C 1NCJA 2YQ2A 3HNVH 2MPVA 4HCFA 1EJ6A 4YX2H 4M03A 3IBOA 1WBYB 4BGLA 3CV5A 1AGEB 5DR5L 1XGUB 4KV5F 1AZBA 5C2UB 5IV2B 2RQ8A 2Z91B 4HUNB 4HKBA 3SPIA 3VXOA 1ML0A 5EEUA 3CSBA 1YAZA 3F7YB 4PJCA 4WTQA 1RUQL 3PDGA 3QA3A 1OK0A 4HKXA 4AKQA 1ID2A 4TLKA 3VU2A 4LLVA 3U48A 3FT2A 4N2GA 2BIIA 2YMOA 3K81A 15C8L 2OTUB 3QUHA 1NCBL 5IJDC 4L0YA 2VR7A 2WTOA 3BKML 2DTML 2VKWA 5HYEA 4H1LA 3ZE1B 1THCA 2XTJB 3MTRA 3IGAB 5B4MC 1QTYT 1SNRA 4LSSH 4JPIA 4OM0L 4J3OG 2NY4C 4PJ7E 1TJGH 5IROA 1SLWA 3PWPE 4HOZA 5JIIA 5ABZA 2R2EA 1NFDB 2IAMB 1WZAA 4F7TA 5I9QC 2ZOWA 5LBGA 3ESVF 4R7VA 1PU0A 2OMYA 3S3SA 4NKIH 5BUAA 3SZ6A 4KH2A 4YSSA 2H41A 3N40F 3TBSB 4LCYA 1IJ9A 3CHSA 4YBHA 4XP6L 4RH4A 5FO2A 2PYED 3QUMA 2HVBA 4L3EE 5A40E 5G4NA 2AW2A 3GMOA 1CGYA 2JTYA 3UJIL 4CJ0A 2CUMA 4OZHB 3LRHA 4I4WB 1JZ4A 3CHXA 1S2EA 4BE6A 5HI5C 1C8PA 4M6OH 2Z35B 3VI3F 3H7BB 3LQAC 1E67A 1BAFL 2ZD0A 4X7CC 4AYDC 5IVXB 1EERB 1FAIL 4POZC 4U6XA 1EHLL 1RIUL 1UYWL 2A5UA 4D0CA 1NQBA 1T2XA 5TK4A 3RTQB 2A6KB 2YUZA 3KVDD 4MMZC 5GGUA 3NTCL 4OFYD 1LE9B 3ZR5A 4LLYA 5J8OA 5C0AB 1UGNA 3DURA 1KN2H 2JIXB 1BOGB 1URZA 2J8OA 1OAYL 2D7MA 4HPYH 5E8NB 4NLHA 2VCOA 1DN2A 2IDUA 3LKOB 3NG5A 4CJ1A 4KZEH 3K0YA 3L3KA 5C08A 2HPOA 3DX9B 1BAGA 5SWSA 3SSGA 1IM9A 3H9SD 1WT5A 3IBEA 3MVSA 1VGEH 3PP3H 1ILSA 3IEAA 3LKSA 3C5ZB 5I1JH 1A0QL 3NZHL 2R0ZH 1KJ2A 3U9WA 3ZDZF 2XYCA 1Y0LA 3MLRH 4XC3H 4TPRH 5T3ZE 1AO7D 3UC2A 2HKHH 3BEWA 4CNIB 3S3DB 3CFBA 4TNGA 3E7JA 4JFEA 4JRYD 4DP5X 5IJCC 5IOPA 1I1AB 3G5WA 1RZPA 2EO1A 3O2DH 4JY6A 4GJTB 5E56A 3VG0L 2WQ8A 3NCBB 4AIZA 4WJKB 3QQ3B 4OKDA 3OAYK 1XIWC 4Q6YA 1XH1A 3PL6A 1IBGL 1Y18A 1I7ZB 4NRXB 4R0LC 1E6JH 5GJSL 4OGXH 3R06A 4ERSL 1MFNA 1YC8A 1BZ7A 2DYRB 2APXA 4XT1C 1K8IB 4NGHL 4AEFA 4AKPA 2EYRA 5C07A 4RNRB 2FZ3A 2MPAL 2ZP8A 2BNUB 2GEEA 5EFIB 2HT3C 3BIKB 4R26H 1RK1B 1TQSA 4JHUA 3CVIL 5F3BA 3ME0B 3N43B 1S5IL 5KG9A 2DQDH 1IGIH 3V0GA 3P0GB 1KB5L 1DSFH 3II1A 4X83A 5FYLD 1U8PA 4XP9H 5E5MA 2VT0A 4Y0GA 1NLDH 4QXGL 2E6PA 1CBVH 2QL1A 4HKBB 4S2SA 1SBBA 2NY1D 2P8LA 4U1LA 1Z6JT 2AJZA 1GXEA 4PJCB 2YLHA 5EUOF 2DDQH 1GZQA 1IILE 3R18A 4IKLA 1Q1JH 4FQXA 3QA3B 3VFPA 3WE1A 1NMAH 1A7NH 4PJ8A 1ZHBA 3KJ4B 3KPLB 4LLVB 1GW6A 2X28A 4KJPC 5JHMA 3FT2B 1YLBB 2NYYC 1CYWA 3KCWA 5GZND 2ESVA 3RKDD 2GB2A 5I1DA 3DO7A 3VFWA 4H1LB 4BFGA 5HDBE 1XQ4A 3BP7A 1TZOA 2X42A 3QQ4A 4RWHA 5D1QD 5EU6D 4JPIB 4NRZA 3HN5A 3WD5L 1KY6A 4XP4L 2R2EB 4XMPL 1JF1A 4TSBH 4NRYA 4W9LC 4F7TB 3DHPA 1GZPA 3B3IA 3U0WL 4XP5L 4A6YL 2OMYB 2N0MA 4OI9A 4MD5A 4LCYB 4HC1H 4M8UA 3BGMA 3CZEA 4AUYA 3EFFA 1BZ9A 1MPAH 2BY3A 5JIPA 3QUMB 5I15L 1WFUA 2IDSA 4MJ6B 1AR1B 2CBTA 1HNGA 3U6XA 1E9PA 1UFGA 2ARWA 1WFIA 5AQ0A 2IOIA 3LRKA 3RUGB 3ZL2A 1FWXA 1PDKA 1EHKB 2HH0L 5D4JA 1KCRH 2NX5A 3IDXL 5F1KC 4TYUA 4U6XB 3VD1A 2XVGA 4EDWL 2YMTA 2D31B 4LLYB 3A6CL 4LASH 2L4OA 2ZXCA 4MD0B 4U2ZA 4X80H 3DURB 2O61A 1FHGA 4B50A 4QYOA 4XH2A 1EMTH 4LDOB 4LESA 3MRIA 3BPOB 2OYPA 1Z2KA 5C8JB 3A47A 1JZ6A 1INEL 2VW7A 2DLGA 1AJ7H 3L3KB 5FYJD 1Y6NR 2ZXAA 5C08B 1UA3A 5SWSB 1H6TA 1IM9B 1CDUA 4X4XA 3UG3A 3LKSB 3MXVH 1X5IA 2EYSB 4MCMA 4QHPA 5M95B 4HXBH 2NXYC 1U8HA 4Z7VF 1KJ2B 3BDXA 1U41A 4LVHB 3HW7A 4N0UA 1Y0LB 4YBLC 3RA7H 3S3JA 3ZT6A 4EIUA 4F91B 1U95B 2R2HA 3BEWB 3OAZK 1KXVA 4JFEB 5IOPB 5DUPH 3N0AA 4NHCH 5T33H 4GQRA 4KQ4L 1XCWA 2YD6A 3B7SA 4D2NA 1UWFA 2PR4L 4AIZB 3Q5YA 2OMBA 3LNDA 4FL4B 4D9RD 2YUWA 4PJ9C 3PL6B 3QUXC 1Y18B 4LBAA 5K1NA 4ZQKA 2F74A 4ATTA 5LKNA 4ZMOA 1F8TH 3RNKA 1G1YA 3R06B 3ZBMA 5C2BH 1BZ7B 3NIGF 4PY8J 2YO3A 4PRIE 2EYRB 5C07B 3IDYB 2FJHA 3O2VL 1ROWA 1MDTA 2VLJA 2CK0L 1AZCA 3FUIA 4JKKA 2XIBA 3FH8A 4KOBA 5F3BB 3ARVA 4JFFD 1ZVSA 3UMNA 5KG9B 1R75A 4K23L 4AUUA 3QO1A 4AJWA 2DLIA 4XNXL 3IMRA 1U8PB 4AQOA 5IJBC 5E5MB 2HFGL 3N41F 4Y8DC 2QMKA 4S2SB 1ZS8B 5I73B 2P8LB 3NIDE 4HSQA 4U1LB 2AJZB 4FP8H 2VXQL 1GZQB 2OR9H 5E9DD 1F45A 1A8JH 4FQXB 3VFPB 2HRLA 2HRPL 2FHBA 4PJ8B 1ZHBB 1E50A 2J88L 4ZD3L 3S37H 3ZYZA 2RBLA 4CBPA 4A7QA 4MA1C 1RI8A 2IPUK 3S7GA 1P5UA 1N4XH 4PP2A 2ESVB 5I1DB 3DO7B 3VFWB 2GI0A 1BD2A 3ULVH 5FOBA 3NAAL 1Y6KR 3P2DA 4EN3A 5IMLA 2IFFH 3ES6A 3NIFF 3G08A 2HP4A 4OCYL 1W72L 3QQ4B 1MFVA 4JJHA 3R4DA 4M4PA 4NRZB 3BKJL 1J0YA 4H26A 1CZ8H 4UTAL 4GUQA 4K71C 2C7FA 4HDIA 1T1YA 4MJ5A 2Y1ZA 4HIEA 5D2LA 1JF1B 3L16A 1OV8A 4NRYB 4CBZA 5CEYA 1GZPB 1NCUA 3B3IB 4GQ9L 4PCSA 5IBUG 3N3EA 4RDBA 3QI9D 3PCYA 1XB3A 4MD5B 3TGXA 3NBNA 3EFFB 1B0IA 1BZ9B 3EJRA 5EU5B 4YDLB 2AQSA 1IU1A 4Y4FD 5D93B 4DFIA 1E9PB 4A7UA 1TPXC 3NABL 4KVNL 2P26A 1PDKB 1YUHA 1XR9A 2PUQT 2OSYA 3LH2L 5ELIA 1DN0A 2CLZA 4XHJD 2Y36H 4FEMA 3ZIMA 5ECGA 3K8KA 2JJSA 4UYQA 4ZS7H 4S11A 4AG4L 1X4ZA 3TH2T 2XBTA 3HOGA 3VXTA 1T5XB 3HPJA 4DVRH 4PJEF 1MCQA 5FCUL 4P5TB 2JB6A 2O61B 3ZDXF 4IQHA 4QYOB 2HLAB 2YKLH 3LZLA 4MS8D 3WJLC 3MBXL 4KK6C 3MRIB 3Q8FA 1IKNA 2I5YH 4K9EC 4OJEH 2BFGA 5FYLL 4JPVH 4G11A 5IBLC 2Z4TA 1U93A 4X4XB 3GMMA 5JUEH 2ED9A 2HJFB 1KB9J 4JAMA 3AUWB 5HVHC 1JUFA 4PRPA 5CIPB 4E41E 5L2JB 3HMWL 3BN9D 3ULUD 5C7XH 1U8HB 4TV3A 4O5LL 4ZS6C 3P0YL 4N0UB 5EN3A 3TVMC 2GK0A 4NCDA 2YPKA 4FG6D 5HD8D 2R2HB 1OQOA 2IANE 5CINL 2AJXH 3S5ZA 4AMKL 2WB7A 4XBEH 4BK5C 3NRPA 3WO4C 3GK8L 1EJFA 2WVUA 3IFNH 4NFBA 1ZLUH 3SDXF 3TV3L 3WIAA 3T4YA 3W9EA 5AL0A 4KITB 1A6UH 5HYJE 5LVEA 3LTVA 2IWEA 1DVZA 1J8SA 2DWYA 2EE9A 3MCLH 2F74B 2WUCH 4KHXL 4ODWA 4ZQKB 3L4UA 1SY6L 3RFRA 3RNKB 3EO0A 4KTEL 4OCRL 4L5FE 4OLXL 2FJHB 5D1XA 2VLJB 4NNPH 5T1DH 1QBAA 2N4IA 2Y6TE 2NXZC 4X5XB 2X2JA 2CKBB 3U1SL 3UGUA 3KDMA 3SOTA 5IREA 3SE4C 1FYTE 3OQRA 3QEQE 1ZVSB 2JKWA 4FG4A 3AQDA 3QO1B 1ECYA 2P43B 4K2UL 3V6BR 2W9LA 3QXWA 4M93C 3VQ2C 3TPKA 2EH7H 4HEPA 1AC6A 2UWEA 4DP6X 4YBQC 5HYSG 1WFTA 3IDGB 4ZMLA 1GW0A 2K9FB 2TAAA 2ZT9C 2A9CA 1UA6L 2VQUA 5AAPA 2X5PA 5D7LE 1V3KA 3F04A 4JLRA 3X13A 1IC4L 4DEWA 1NMBL 1P5UB 4PP2B 4X4MA 1LO0L 4G3YL 4R97C 2DLFL 1OCCB 5GS0C 1BD2B 3AT0A 5FOBB 3BKCH 1TTGA 3LVTA 1ZK5A 4EN3B 5IMLB 3ES6B 4DGUA 1KMGA 3G08B 5IMKA 3BD4A 4YZFE 5EH1A 2D3LA 3M1CA 1Q0EA 1W9XA 2FWSA 1U8LA 2X89A 3BGAA 4HLEA 5JOPE 4H26B 2EABA 2CGZA 2FBOJ 4HLZG 4YL9A 4HDIB 1T1YB 4MJ5B 4HIEB 4Z7OB 1UD8A 4MDIA 5D2LB 4OZIF 5CEYB 1N0XL 2LHAA 3P0VL 4RESB 3O3BA 4XODA 5FYJL 2C9SA 1GPOL 3GS7A 5KUMA 2PCXA 3VXUA 5C0ND 3CVHL 3VRJA 4B9GA 3FO2A 1IV8A 2XPYA 3HG5A 4FXKC 1A4BA 1WP6A 5I1KH 2D2OA 2ED6A 2Y69B 1VJSA 1UT2A 4QRQA 3LHAA 3AREA 3OZ9H 1NCGA 3DBXA 1QSFA 4TUOA 5C3TA 3EOTH 1NOAA 4FQCH 3BN3B 3PWPD 2N01B 5C09A 2K8MA 1DQIA 1BMZA 1YUHB 1XR9B 4QHUA 2QV2A 1DN0B 3VM5A 2CLZB 3U30B 2HT4C 1Z5LA 3HS9A 4TOYH 3IMBA 3IPBA 1N26A 4A7TA 4DKAA 1PLGH 4LCIL 2AFNA 4CU7A 3VXTB 5DZVA 2ZKMX 5L4IA 5LB1A 2F54A 3HPJB 1QW9A 3L2LA 3B2VL 5KSAD 3PAVA 2JB6B 3D4ZA 2IF7A 1KGJA 3EBHA 3MUJA 4QHKJ 5DMIH 4YXKH 5JHAA 2Y23A 1OALA 2OCFD 1NBZA 1NUNB 3CU1A 5KSVB 3VXSA 1KXQE 2XOTA 3QIBC 1NUGA 2VRQA 5T1LD 3CC1A 3N44F 1RIHH 4KZCA 4P4RA 4P9ML 5C6PB 2AQTA 3KGTA 3QHZL 3GXMA 3GMMB 4HWBH 3PE9A 1IKOP 4JAMB 4OJYA 4PB9H 1JUFB 4PRPB 5JR1H 1IEHA 2I85A 2J72A 4NDMA 3WIIH 1NIFA 3APCA 3UAJA 1W6LA 4MRCA 4LFHG 4TF4A 1DBKL 2GK0B 3ABLB 3TWCL 2YPKB 4J3WA 5I30H 5ISZE 5F9WC 3MRRA 2FH6A 1KYOJ 1YYML 3GHBH 1EAQA 3KLKA 2OK0H 3RY6A 3T4YB 3W9EB 3BRFA 4HU2A 2Y25A 4XWOC 9PCYA 5I8CA 4XR8C 1CF1A 2WKGA 1TF4A 1HCZA 3B5GA 1ECZA 3EO0B 3EJPA 5CNHA 1ZANH 4N0CC 3Q1SH 5D1XB 4EAEA 5T3ZD 5I5RA 1EXHA 3GO1H 4MAYC 4G1EA 4NQEE 5E8DL 3KDMB 4EZKA 2FQEA 1A02N 4EEEA 2UVFA 3PP4L 1DVQA 2WXPA 1WFOA 3T0BA 4R7XA 4NQCA 4PRDA 4BA0A 5I19L 5CLXA 3RX5A 1TZAA 2XY1A 4LU5H 3DTXA 2BW4A 2HFTA 4HKZA 2YAOA 4WLCA 1M4KA 2UWEB 4Y16A 1F6FB 1CL7L 4PJAA 5HI3D 1J1XL 1EDYA 2JQZA 3VG9C 5ANHA 2HT3D 1TFPA 2KT6A 4ZQTA 2XI9A 4IMKA 3SKJL 1JK8A 3X13B 5CJQH 4M7KL 4ABWA 4A7GF 1XGRA 2ZX8A 2FHCA 5KZCD 1BEYL 2XWTA 3VD0A 3GRGA 4NOFA 5E6RB 3VXQA 5IMKB 1X6LA 4WEBH 2R15A 4PH8A 1L9MA 2WLIB 3EOBA 3WJJA 3EJTA 2CJUL 1U8LB 3DOIA 4QD2E 4P2OA 3RB7A 1UZ6E 1S9XA 1JF6A 2X9XA 1QI4A 4KK5D 1YEEL 4OB5L 1P69B 1YYLL 4ODVL 5DD1L 3UGEA 4QJ5B 4MDIB 1G9EA 3S36H 5F7AA 1WZKA 3CTTA 3O3BB 3PHOA 2CDGA 4ZXBA 3DVFA 4UM8A 3VGBA 3VXUB 4UZUA 1Z9PA 2K9UA 3O0RH 2KLTA 2ERJB 4JQXA 3VRJB 3FF7A 3FO2B 3ULUL 3S4SG 2XRAL 2Q86A 3PWLA 5JNYB 3QUZB 4F15C 4QRQB 4F7PA 2FWOA 3QP3A 3PHSA 4OGYL 1IQDA 4PJDA 2CQVA 3ZKNC 4ELDA 3DBXB 1RURH 1GH7A 1QSFB 2YK1H 2A74A 4FNLH 4TUOB 4IGBA 5E70A 4PJIE 4F1SA 2IG2H 4I9WE 4YAQA 1WLHA 2PO6C 3G9VA 1TLMA 1DQTA 4J2QA 5C09B 3VDBA 4QHUB 3ZGHA 3SGDI 1FSKB 4XP1H 3ZTNH 2QSVA 2IOMA 2YQ3A 3DIFA 1Z5LB 4FC3E 4QHLA 4XMWA 3RPIA 3ZE2B 5TD4A 4KXDA 1HU8A 3NPSC 2D0GA 4DP0X 4JDVA 4EMZA 2R2BA 4JKWA 2H2SC 3COOA 1BPLB 3MUY1 5JPNC 2F54B 2EDXA 3KD4A 3JWOC 3J8F7 4F24A 1ADQL 1U30A 5J12C 1O9VA 2BFVL 1GZHA 4RVBA 1NBZB 5HGBA 2EE6A 5LGJA 1JNJA 5CAYB 1CE1H 3I3BA 1F0LA 3SD5A 4JMXA 3VXSB 3VW3H 3DHMA 1CLCA 5GHWH 4KBPA 4P4RB 2F0CA 1CWVA 2J5LC 3WEAA 1M42A 3QG6A 2BSSB 3R7QA 5AOKA 4FQ1H 4U3HA 1X44A 4TN9A 1ZV9A 3RURA 1T2JA 1CUOA 4GXUM 4DGVH 5EDXA 1PD6A 5JW4N 5KYWA 2UXTA 5ALBH 1AQ8A 4J3VA 3MRRB 3MNWA 2WNGA 1YPZF 2WV3A 3KEDA 4B9JA 1CVSC 2G3ZA 3CFUA 1MFCH 1JGUH 4X50A 1URIA 3DTDA 5I26A 1G7HA 1HYRC 3VJ6A 5I8CB 4OT1H 3WFEH 4WWKC 2P7TA 1MFEL 3VSTA 3EUUA 3BH8A 3C12A 1MCPH 1CL7I 3US0A 5EF0A 3S34L 4PJBA 3CFEA 2ALAA 3P54A 3G7TA 2QHRH 1MN4A 1O6VA 3G04A 5D72H 1DJXA 4G1EB 2OYKA 3FQUB 3SY0B 4Z8FH 2A1WH 4Q56A 4R26L 1A66A 1TTAA 2N3JA 3MU3A 3U4KA 4NQCB 4TUKL 1WV7T 2BSBA 1COBA 1JMXA 4H0HB 1FO0H 4PRDB 1CBJA 5FO7A 5ICYA 5A2FA 2FHFA 4TNEA 4EOWL 1O75A 3CJJA 2VDQH 3GXUB 1A65A 2DQUL 2UXFA 4BZ2L 3DTXB 1Z9MA 3LVEA 4HKZB 4RSYA 4PRID 4Y16B 4PJAB 2CGRH 1EDQA 4NWUH 4YDKL 3UTZA 3D2UD 4J3BA 3F7RA 5BV7C 3L3OA 3P4MA 1CDIA 1JK8B 5E2TL 4HBQA 1TNNA 1XGRB 1KFGA 4ODSL 2XWTB 4F7EA 3ETBJ 3QXVA 5IM7A 3N06B 1SXSA 2UZIH 3QXAA 4HCIA 2C9VA 3VXQB 4EI5C 2G5RA 5ID0A 4WF7A 3TFBA 3L3HB 2B2XH 5D7JD 4IRJC 4P2OB 2CBPA 1PSKH 1A6WH 1JNNL 2AJSL 2NZIA 5I8OH 3AGWA 4KJWD 1J9TA 1D5BA 4MZIA 3CUPA 3PHOB 4ZXBB 1RUKH 2CDGB 3STBA 4UM8B 4PLJC 3DX7A 4JHVA 1OTUC 3IN2A 4HW6A 4JM2A 3LQMA 3V52L 4Q4EA 2CCLA 4NO0D 4HC1A 2JXMA 1W8OA 2Q86B 3ZQXA 1T1XB 5TE4L 5MENA 3PWLB 3GFUA 4GKOA 3SB3A 2BWQA 2PP8A 4F7PB 2I9TB 2FWOB 2R4SL 3M8OH 1IQDB 4PJDB 1RJYB 2Y2TA 4N87A 3EFOB 5FHAL 2A74B 4IGBB 1BQLH 5DJXA 4EBQH 2NDGA 4YAQB 4LARL 4RMSA 1I7TA 3BGFB 2W9DH 5EDSA 3NT0A 1N8ZA 4GBXC 4P2CG 1A14H 2BY1A 1QWUA 4Z3TA 4DEUA 3DIFB 4B5ZA 4BDVA 4QHLB 3RPIB 4WO0A 1ZRUA 4JDVB 2X3BA 2R2BB 5CZVH 3N85L 2F8IA 3OXSA 4JG5A 3K0WA 4PV9A 5EOQH 1FL6A 2VDRL 5CD5C 2WGXA 1Y6MR 3JT0A 5FA3A 1QFUL 1PBYA 2JJWA 3CN0A 1HX0A 3PRZA 5T3ZL 1CFVH 3ATBA 3VWKD 1JAEA 2B0SH 1ZGLA 5LGJB 5HGBB 3FZUD 3QJQB 4JFUA 1OXYA 4GMTL 4HMDA 2DL9A 4R2GD 4BCXA 4RFOH 2GJZA 5AVRB 1KJ3L 3VTTA 5J3HD 1V27A 3QIWA 1OGAE 3MLWH 3T4AA 3TFKD 3ZHKA 3QG6B 1ZTXE 3BKYL 4BFBD 3QDHA 1WHPA 4ORGA 1CFMA 4IW4C 4PJFA 1JZ5A 5IB5B 1G9NH 2F19L 3WEMA 4OIFA 1F3JA 3CBKB 5KYWB 3MNWB 2R1XA 5CZXC 4N9OB 5I24A 2CZNA 3QC5X 3SO3B 1MQKH 1N64L 4N8VG 1P84J 2AQ3A 4J23A 4Q8BA 4GFXA 3OJDA 3VJ6B 1G7HB 2OAAA 1A3LH 5JXEC 3PPEA 3CXDL 2P7TB 3BH8B 4NQDB 2ADFH 3V5HA 43C9A 2YXMA 5F6HJ 4PJBB 5I66A 3QPXL 3CSPA 3CFEB 2J73A 3K4AA 4OLVH 2CRYA 2A6JA 3G04B 2IAND 2CUAA 5I8KL 4X6DE 32C2A 1SXBA 2WLZA 4U1HA 4LP8A 5I6XC 5D1ZB 4HX1B 1XCXA 5JPMA 1KEGL 1OHQA 2GJPA 4DKEH 1M6OA 4QEGA 5FO7B 5HYJD 5ICYB 1OO2A 5FUOL 1P4UA 3KLHD 1X7QA 3MUUA 9CGTA 2CMRL 3QNZB 3IE9A 1P9MA 3QXTA 1ZLWK 2AGJL 3MOAL 3OPUA 3SKUD 5F6IC 2YSTA 3CXHJ 3UTZB 2DJSA 4ETYA 1Y1UA 3L3OB 5LNEA 3P4MB 2LT9A 2XXMB 1FYTD 3QEQD 1OGTA 5LAXB 5K9OA 4URKA 2ROYA 4RBPK 2BERA 2AHIA 3HLKA 1MREL 4F7EB 3Q01A 2EH8H 5EHFA 5IM7B 3KLSA 5EUKA 1H6UA 3QXAB 1TTCA 4W4OC 3IFOA 5ICXA 5ID0B 1UWXH 2BIOA 4EI0A 1N5AA 2YJLA 1MCSA 1XZ0A 1P84K 2F08A 3FO9A 4JG0L 4M5SA 2XVLA 1EZVY 1YAIA 4WO4D 4ZW8A 1E7UA 2MCG1 1D5BB 1YEIH 3CUPB 5D7LD 2EQDA 2VO5A 3DX7B 4UCFA 4APQD 4WFGE 3V4UL 3ZQ9A 4XCEA 4JM2B 4L4TE 5E51A 1IO4C 4FFTA 2JXMB 2QSCH 5MENB 2I32A 1PZBA 1F4AA 1IZJA 4NEHB 3CZKA 1GY1A 1MWAL 2NUPA 3VFGH 5DJXB 3IAQA 5JOPD 4I1PA 2NY0D 2X4TB 5I75B 1I7TB 1XSJA 2V6HA 3AS0A 3ILPA 1N8ZB 3CHPA 3QFGA 1ZTXH 3DO3A 4IYKA 4GRWB 4BDVB 2WSPA 4FFYH 3F00A 4NIKB 1FPTL 4OFDA 4PJ5E 5FYKL 3O6KL 2E9GA 3OXSB 4PV9B 1QBLL 4A66A 2W9EL 1FL6B 3C2AH 5FA3B 1BQ5A 4ZX3A 1DO6A 3RGVC 4N8CL 3GYRA 1H3XA 3NFNA 5H37H 1MCWM 3BFOA 2R69H 4A38A 2ZICA 2OA9A 3U4BL 2BP0A 2GJZB 4MS6A 4YZWA 4MNGE 3QIWB 4GMSL 1CGXA 3T4AB 1BVNP 4P4KC 1HSBA 3FUHA 1CDYA 2DQCL 4R7DA 5E95B 4ORGB 3CU7A 4PJFB 3K2UH 4QXTA 2DQGL 4MJHA 1WIPA 1F3JB 2GJJA 3KJ6L 1FGNL 4GW1A 4DJMA 1RFDH 2R1XB 4EKJA 4LOVA 5E8EB 3L1OH 4PS4L 4PN6A 2J8UE 3JVGC 5GSVA 4KROB 4Y4HC 3FYEB 3OJDB 4JREB 4G72B 5IB1A 3MBEA 4E5XA 1JDDA 5T5NG 3G6JB 1AXTL 2EEBA 1BWWA 3MOBH 2ENQA 2VDKH 3V5HB 1EJOH 43C9B 5DD5H 4ZAKD 1MNUH 3EJJX 4LOFA 1L3WA 5I66B 1KLUB 2OS7A 5TPWH 4UNIA 1UJ3C 2A6JB 5ISZD 3M1BA 32C2B 4HMCA 3FCUB 4K3DL 4U1HB 4B6ZA 3TF4A 2J55A 4LPUA 4LSQL 1G7JA 1YEHL 3EDFA 5I18H 5JPMB 2C3WA 1I9IL 4WI8A 1ET5A 4FG0A 3ZYOA 1MCHA 2AITA 2G5UA 1M6OB 4JCMA 5K1VA 1PF3A 4OIAA 4B5EA 4GNKB 3A4EA 1GR7A 3RWJA 2WHVA 2MCPL 1X7QB 3WFHA 3VI4F 3QDJE 4QTIH 5EU7C 4POYA 3TURA 4U3SA 4XXCA 4FA6A 4JHWH 1LO5A 4DO5A 1NC2D 1AHMA 2FYYA 3HG0A 4NQED 3W11D 1RP9A 1SJMA 2JJTA 1OGTB 3AAZA 4I1NB 1PG7W 4M8VA 5C0BA 4DN3L 3HI1A 2ICWI 1U42A 5ES4B 5C0FB 3QULA 5FW6A 1WJ3A 1E5BA 5EUKB 1UACH 4A2MA 2E5EA 2BS8A 5I1HH 4HZ1A 3IFOB 5ICXB 3NQIA 4B9YA 4UQDA 1BIHA 2XZCL 3TS8A 3A6BL 2C3VA 1QEWA 3IGLA 3AB0C 1N5AB 1AIFA 1XZ0B 3FO9B 3TT1H 3AY4A 4L18A 1KV3A 3FT4A 3HG2A 5TDPA 4PPTA 4OCLC 4NJAH 1DVUA 4OZGE 5CCGE 4TULL 5DCCA 4JPKL 4K94H 4KKAC 3ZHFA 4XCEB 4DP4X 1QRNE 4GI9A 2NY7H 1G4MA 1X5MA 2XQBL 5D5MF 5ALCH 4J8QA 1BQUA 3HFML 5FKAA 3SKNA 3AUVA 4GQQA 3US1A 4U1MA 4LE8A 2AMGA 5D7IA 3DOSA 2NUPB 2CG9X 2FGWH 3B2XA 4G5ZH 1YJDC 3RJDA 4CC4A 2P52A 1LP9F 2ZP0T 3ILPB 1E3XA 1TYRA 2AQ1A 5JHLA 5LGYA 1DJIA 3JWNE 3NZ8A 4X8CA 2WXKA 5AVUB 4YXHL 4TSAL 3OB8A 4UTBL 2HTLC 3Q7JA 3L9BA 4NUJB 4Q7DA 5FGRA 2ICES 2NPLX 2DYPA 1I85A 2BSDA 2XZQL 3NFNB 5KSBE 2QEJA 3QJVB 5LGHH 4H8VA 3HG4A 5DT1L 1KLGA 5J1AA 5KVGE 2ZWNA 4I9WD 3WXVH 4XO3A 3AITA 2BP0B 3WMPA 1T7XA 1OARL 2PWGA 3NPZB 5BS0E 3JZYA 5K69A 5CR1A 3K5RA 4MJ2A 5L2KA 2MMXA 1HSBB 3INUH 4P0DA 3HE7A 1OF0A 4HWBA 1Z9LA 1PKQE 4R7DB 3EH1A 2VERN 1D9KC 2PR9A 4QXTB 1HJCA 1R24A 3O11A 3QZBA 5E2VH 3NSCA 3MRHA 4L5FL 3P3RA 4UAOC 5D96C 4GW1B 1BBDL 1FLRL 2MQ0A 2BS71 2Z4QA 1FH5H 1Q94A 2QT6A 2F8OA 1NIEA 5GSVB 5IB1B 1GJUA 3MBEB 4PWJA 4R84A 2X9WA 1OE2A 2WBJC 4GKZB 4N1EA 5FF6A 3ETSA 2CALA 3FTVA 1YY9D 4F2MA 1YEGL 2WQRA 3MZGB 5F44A 1MJUH 3DJTA 4KMQA 3RVUD 3WEOA 4WQOA 3ECQA 3NEEA 3UG4A 3CZJA 3ZY7A 3FTXA 2EZ0D 1G7JB 2XG4A 4K3GA 1HXMA 4N8UA 5LN8A 4U6HB 1F1DA 4EE2A 3X12A 2FEJA 4J3OH 3RWJB 4W6YB 4ZO9A 5CBEA 4ZMAT 4HSCX 3WFHB 1CI3M 1R19A 3TA3D 3KW8A 3IFLL 3G5XA 3T65A 4HYTB 1HXKA 2FK9A 3PLYA 4GW5A 3WFBH 3OKKA 4U3SB 3DMMC 5DSCA 1LO5B 4OSUH 5TF1L 4G6KL 5I1GH 1EEQA 3MC0A 2A77L 1D5IL 2FB4H 3GZPA 4GI8A 1UKSA 1VFOA 5DJYB 2FYYB 4BUHA 1T2QH 3PAZA 1XSOA 2YC1A 2VDOL 2NY6C 5EBGA 2DQ6A 3AAZB 4JFXA 5B3JF 4QOKE 5C0BB 3HI1B 3H55A 3OLIA 1EGJL 2AXFA 2VLRB 3QULB 4NSKA 1KN4L 1TU2A 4WU7A 4JFSA 2NR6C 2ZKYA 1MJ8L 5I23A 4XB8A 4DKFL 2PPDA 2JKRM 2C3VB 1QEWB 2GBUA 4TSCL 1W91A 2AK1L 1Q38A 2VXSH 1AIFB 4UIKL 2IALA 4D3CL 3L7FA 5CGBA 4C47A 3B9KC 3FT4B 3ARFC 2MTPA 3LXBA 4UB0H 5TDPB 3TO4D 2R7EA 2Q3XA 4BKLA 4ZFGL 2YMXL 5D8JH 3VM7A 1JP5A 5JIKA 3IDYC 3HHMA 1OAKH 1EAJA 3JWNH 2Z7ZA 5BRZA 1UKTA 3CVDA 4RGNE 3NJIA 5FHBH 1RUAH 3NFSH 5DMYA 4FLRA 2A3TA 2WLKA 3MOQA 4YOKA 4GEJA 5FKAB 3SKNB 3W56A 4EI5D 4ALAH 3DX6A 2OXHB 4P23C 5IWLA 3S48A 2AJYL 3CLEL 4U1MB 1TZ8A 5D7IB 3RUGF 3DOSB 4U4IA 1N6QL 1ZT4A 5KVGH 4ZODA 1B9ZA 4CSSA 3L9YA 1A7QH 1LK3H 4QMEA 3PIQA 1FZOA 3HS8A 2R51A 1JDCA 5IFHH 4R9HA 2R4RH 5F96L 3K4DA 5HGDA 6FABH 3LIUA 2FH8A 5C0RL 3NZ8B 4PW9A 1KEMH 3QC6X 5IEKA 5EB9A 1RLBA 5JIDA 2Q7AA 2AS5M 1BFVL 1GHFH 4BWWA 4CKQA 3AQYA 3SBQA 3M45A 4LRIC 3OMIB 1NFIB 2DYPB 1WQVT 3QS3A 4FTVE 3QCVL 1I7UA 2X1PA 5J1AB 1KLGB 5T8IA 1R0AL 4EZMA 2WVTA 3DUHA 1JZEA 4GBXD 2H1PH 4FEIA 4ZMPA 4E9QA 1BM3H 4F3FA 4IRZL 1DEDA 1FFOA 3C09B 4ATWA 5L2KB 5AVQB 1BFTA 4L0ZA 3F58H 3HE7B 5C0GA 1BG1A 4WI9A 3RGBA 3U7YH 1F58H 1N6VA 2KKQA 4XPGH 2DYSB 1R24B 3OR6A 3O11B 4P05A 5KYXA 3MRHB 3HZKA 5E23A 4EZLA 1DL7H 4WSJA 3UCQA 1WAAF 3D85D 1TKWA 2FJSA 3HC0A 4H4NA 2Z4QB 2VERA 2GG1A 1Q94B 3O4LE 3FMGL 3SQOH 4YDLC 1Z66A 4LGSB 3ZYJA 4Z78A 1CS6A 4CMHB 1XV8A 2C7UA 5DQDL 3NCCB 1OGAD 1YZZA 3STLA 2MWCA 4MHHG 1E27A 4ZOEA 5FF6B 1R3LA 2RCSL 4LCUA 1HXYB 2F53E 4YHKL 1RUPL 4F2MB 4Y5VC 4L4JA 3U1QA 4XI5D 3TC9A 4ZUSA 3HB3B 2ZXEB 3ZZLA 3C5SA 4HVBA 1A47A 4KKCC 3SE9L 3CMGA 4M1GH 5DO8A 3UTTA 3VE0B 3MV8E 2XG4B 4FJZA 5MEOA 4A37A 3PREA 1HXMB 4GRMA 4JFVA 3NDZE 2A1WL 3X12B 3DETC 5F9AC 1BFOA 5CBEB 3T8VA 3IMUA 3OF6D 1AQKL 3G5XB 4BFJA 1FO0L 3T65B 4EI6A 4GW5B 3NGBB 3TZVD 3OKKB 1NCHA 4FAAB 4ODHL 2EP6A 5DSCB 4N25A 4XCYB 4JPWL 2YBGA 4N2MA 3MRKA 2V5YA 1OAZL 1AG6A 3CZUB 3MREA 5D6DC 4K7PH 1YA5A 3U6RA 2YC1B 4GRLD 5CJ8A 5DRNA 2F58L 3RI5F 4XCFH 4RGMC 2AK4A 3AM8C 2AXFB 5I8EA 3G9AB 5CD3A 3CQPA 1OAXL 3LQAH 1M3IA 2WYZA 3KDPB 1TU2B 2Y9RT 4GY4A 1G7LA 4NSKB 4WU7B 4BWTA 4ES8A 5HPMA 2JQMA 2P9RA 1MUJA 1JXJA 2VM3A 3MA9H 4A6YA 1FNSH 5J9PA 5IHLB 1AQDA 1G0DA 5E7BA 4QLWA 3D5OF 1QLRA 2IALB 3CIAA 4RRPG 3F6IA 3Q8BA 1HK6A 2MIZA 4PB0H 1LL1A 1FCGA 2XFXA 2R7EB 4R3SA 4BKLB 3KBFA 1A6WL 3WTVA 2DZEA 4AC4A 5BRZB 3GINA 2WYIA 1S78D 1XTLA 1KTRL 3OB0H 2NY2B 3MRJA 4Y7OC 1JFQH 4KX9A 3MLXL 2DMCA 2FR4A 4Q9RL 1HZLA 4NZRH 4BFKA 2VTFA 3DX6B 3WKNA 4GI6A 1IFRA 1Q9OA 2QGDA 2XDHA 4LHUG 3ROOB 3SGKC 1NCDH 5CKAA 3U4EA 3BT2H 4HKJA 1UTDA 3RBSA 1NDTA 4CVZA 2VZUA 4DWHA 4WVRA 1MHPH 5DFWH 1MCEA 1FZOB 3PIQB 3NYKA 4G7QB 4JY5L 2H6PA 2EDFA 2WBKA 4HJ0D 3HUJE 5IEKB 4WFGD 2X3CA 5F70A 4L4TD 4XVSH 2DICA 2NZ9D 3UDWC 1QEXA 4OVVA 1F41A 4D9LL 1XGTA 2DI7A 5H8DA 1EDHA 1SOSA 4UWQB 2WGNB 3FQRA 2Q0ZX 1I7UB 4OZ4A 4B9KC 2DEYX 1NCIA 3JT2A 4IRSA 1KFAH 1UD3A 2CHXA 4N0RA 1QYGL 1A4KA 5CCKH 4F3FB 2RA1A 1H3PH 4BH7A 2NSXA 1NDMA 3V6FA