5I6LA

Crystal structure of copper nitrite reductase at 100k after 2.76 mgy
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
332
structure length
332
Chain Sequence
DISTLPRVKVDLVKPPFVHAHDQVAKTGPRVVEFTMTIEEKKLVIDREGTEIHAMTFNGSVPGPLMVVHENDYVELRLINPDTNTLLHNIDFHAATGALGGGALTQVNPGEETTLRFKATKPGVFVYHCAPEGMVPWHVTSGMNGAIMVLPRDGLKDEKGQPLTYDKIYYVGEQDFYVPKDEAGNYKKYETPGEAYEDAVKAMRTLTPTHIVFNGAVGALTGDHALTAAVGERVLVVHSQANRDTRPHLIGGHGDYVWATGKFRNPPDLDQETWLIPGGTAGAAFYTFRQPGVYAYVNHNLIEAFELGAAGHFKVTGEWNDDLMTSVVKPAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title Serial crystallography captures enzyme catalysis in copper nitrite reductase at atomic resolution from one crystal.
pubmed doi rcsb
source organism Achromobacter cycloclastes
molecule tags Oxidoreductase
total genus 91
structure length 332
sequence length 332
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2016-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6lA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i6lA02
4JKNA 2PPDA 2FT6A 2YAPA 2DV6A 1V54B 4CSZA 1ZPUA 7PCYA 2PLTA 1AACA 4G72B 2EIJB 1DZ0A 1JXFA 3NJNA 2X87A 1BQ5A 5B7EA 1EHKB 4DP8X 2WO2B 5I5JA 3IN2A 1W8EA 1WA0X 1M57B 5EHFA 3MX0B 4KOBA 2GC7C 4P5SA 3H4FA 4NB7A 2OV0A 2GC4C 4A2DA 1SFHA 2GI0A 3FPYA 4P5RA 3TBCA 3FU9A 3ASNB 4A68A 1A4CA 4N8UA 3X2QB 3OM3B 5B7MA 4DP0X 1ASPA 1J9TA 2HX9A 3AG3B 5B1JA 1SDDA 2R7EB 2XWZA 3T9WA 4A2GA 1CYXA 5I6LA 2BHFA 2J55A 2CCWA 5I6PA 5I6OA 1AZNA 2DWSA 1AZBA 2WSDA 4UF7C 2YAHA 2GHZA 5D4HA 2XUWA 1L9PA 1OCCB 3WKQA 1E30A 3TU6A 2BWIA 3GXUB 1J9SA 5I5MA 4BWUA 1SFDA 4G70B 1IKOP 1GSKA 3IN0A 4KNUA 4KOCA 1A4BA 2YAFA 4PCYA 2CAKA 1E5YA 2BP0B 2H47C 4BDVB 2YQBA 4KO6A 4YSDA 3V9EA 2PCFA 4MFHA 3FPXA 3FS9A 2BP8A 5F7BA 4KNTA 7PAZA 3SQRA 1J9QA 3ERXA 1AZRA 1ET7A 1OCRB 2VN3A 3QJSB 3HB3B 1SNRA 3T71A 5TK4A 4CSPA 1PLCA 2FJSA 1RZQA 1HAUA 3NJFA 1URIA 1GW0A 2QDWA 1PZCA 2BO0A 3FYEB 1OF0A 1QNIA 4K9JA 3S3CB 1AAJA 4DPCX 4L0PB 2IH9A 2AZAA 3QJQB 1SJMA 2CJ3A 2IDTA 2J56A 1BXVA 2IH8A 4WTQA 1PZBA 3UAAA 1JOIA 1NWOA 4UANA 2GBAA 2H3XC 2YAEA 4E9SA 1OE2A 3X1EA 1XB6A 3X1GA 1L9RA 1V10A 3KW8A 4M4RB 1DYZA 4UAHA 3D12B 3OMAB 3NJGA 2FT7A 4E9YA 5B1JC 2FTAA 2HXAA 3FU8A 2R7EA 2WO3B 1A3ZA 3DIVA 3L45A 1MG2C 3CZUB 3KW7A 3FSZA 1PNCA 2N0MA 4HALA 1X9UA 2Y1AA 3N2JA 4YSPA 1VLXA 2XXFA 1BYOA 2XLLA 2DYRB 1XB8A 1MG3C 2DY2A 1KV7A 1KCBA 1WS8A 4HHWA 5I6KA 2BP0A 1J9RA 4BDVA 1A4AA 3JTBA 1OOWA 1W6WA 1NICA 1PZAA 3NSDA 1PAZA 2EINB 1CC3A 3NJJA 5F7AA 3X1BA 4TXVB 1IBYA 1X9RA 3EH4B 1NIBA 1ZIBA 3PPSA 4E9TA 4W1TA 1NPNA 2PPAA 3QQXA 2YARA 3QJRB 1JXGA 5PCYA 4QKTA 1NWPA 4YVNA 1RZPA 1KBVA 3AW5A 3PXLA 4DPAX 1W6LA 2QT6A 1ASQA 1UATA 1F56A 5AFAA 4DP5X 2YAOA 2FQGA 2Y69B 4DP7X 2ZOOA 4HCIA 4G7SB 4ZK8A 2VMJA 1RKRA 3G5WA 3S8GB 3QJUB 3X1FA 4FA7B 5D4IA 2PP7A 2QPEB 2YXVA 3WG7B 1L9SA 3ZDWA 3S3DB 3FQYA 3EHBB 3AY2A 1JVLA 1TEFA 3OQRA 4HZ1A 1PMYA 4Q8BA 2GB2A 1SHWA 5B3SB 3QJTB 1ILUA 1FFTB 2BW4A 2GIMA 1ILSA 2I85A 3PAVA 3DKHA 3TBBA 2JFCA 2IDUA 3NP3A 1BAWA 4YSSA 4KNSA 1HAWA 2Q5BA 4PAZA 5ANHA 5AZUA 1NPJA 3IEAA 1BYPA 1E65A 1NZRA 3H4HA 3NSCA 1ZV2A 2A3TA 1R1CA 1N70A 4DP1X 3SBRA 4GP4B 1QLEB 2ZXWB 3QPKA 4G7QB 4AKQA 3EF4A 3FYIB 2GSMB 3ZIYA 3NP4A 3WIAA 2X88A 1ETJA 2YAQA 2EILB 2UXTA 4YSTA 2XVBA 1PNDA 4Q89A 4BK5C 1JZEA 3UGEA 4FAAB 1L9TA 2FQFA 5I26A 4AKOA 1WA2X 3CG8A 1MDAA 1PY0A 4KO9A 3BQVA 4A2HA 2DWTA 1ID2A 1AR1B 2OJ1A 2VW7A 8PAZA 3WNJA 3NJKA 4F7KA 1AG6A 3UABA 5A7EA 1OCZB 1NDTA 1E67A 5LDUA 3PCYA 2QDVA 4AKPA 4YL4A 4F2EA 2JXMA 3RYMA 1ASOA 2VW6A 3X1NA 4X4KA 1IUZA 1ZDQA 1KYAA 1OCOB 1OE1A 5B1AB 1FWXA 2W88A 4JHVA 1BXAA 2XYBA 1N68A 1AS8A 1YLBB 5FC9A 2YAMA 2UX6A 1J5CA 1TU2A 3FT0A 4GXFA 5IY5B 4E9RA 3FSVA 1NINA 4HCFA 1JZFA 1ZIAA 1JZHA 2XXGA 2PCYA 3EH5B 5E9NA 2ZONA 2VM3A 1SDDB 2ZWNA 2EIMB 1QHQA 1AANA 3QJVB 4E9QA 9PCYA 4QLWA 1PCSA 4W9ZA 3AG1B 6PAZA 2EIKB 4JHUA 1AOZA 6PCYA 1NIEA 3IBOA 5I6NA 2CBPA 3NJLA 3T6WA 3WNIA 2I7SA 2HX8A 3NJHA 2QPDB 3TA4D 3ABLB 1AS6A 1WAEA 2RACA 4GP5B 2IAAC 3U25A 5D4JA 3EH3B 2J57A 1EZLA 4HIPA 4YSAA 1A65A 1BQKA 5AKRA 1BEXA 1PF3A 1E5ZA 1JERA 4GYBA 1ZDSA 2BZ7A 2UX7A 2MRYA 2VSMB 2XU9A 4ENZA 4A2EA 2PPCA 2PP9A 1SHXA 4GY4A 2IDQA 1NTDA 2XX0A 1AZCA 1PLBA 3UAEA 4AI7A 4DP4X 5I28A 2TSAA 3CDZB 4G7RB 4N4YB 4AX3A 2XV2A 2XX1A 4E9XA 1CUOA 4YSUA 3NJMA 1PLAA 1WS7A 5B1KA 2PPFA 2OCCB 1ET5A 1GS8A 2NRDA 1FA4A 1GS6X 5B1BB 2AANA 3NT0A 1I53A 1M9WA 2H5UA 1AIZA 2IWFA 1KDIA 1WA1X 2IDSA 4RH4A 2FWLB 4G71B 1XB3A 3AG4B 3FQ1A 3UADA 3DTUB 3CVBA 1RCYA 4YVUA 4KO5A 4BWWA 1ET8A 1ADWA 2HRGA 3ASOB 5I6MA 2PP8A 4DP2X 2UXFA 1GR7A 2VM4A 1J5DA 3JT2A 1IBZA 3ZBMA 3GYRA 2UXGA 2VW4A 2BWDA 2PPEA 3CVCA 1M56B 1GS7A 3H56A 3PAZA 1A8ZA 3SBQA 3FU7B 2XV0A 1OE3A 1JXDA 3FSAA 1NIDA 1CURA 4WKXA 4F2FA 2W8CA 4YSCA 1AS7A 1NIFA 1CYWA 1BXUA 2BZCA 3S3BB 3GDCA 1AZUA 2HLEB 2IWKA 2CUAA 3FQ2A 1JZJA 3AG2B 4A66A 1B3IA 2DYSB 3HEIB 3T6VA 1BQRA 4YSOA 3TASA 1KBWA 1KGYE 1NIAA 2CALA 3NSYA 4BXVA 2B08A 4HAKA 1GY1A 1SF5A 1TKWA 2E86A 4YSEA 3PAUA 3CDZA 2B3IA 3PLYA 1GYCA 2AZUA 3FSWA 2UXVA 4NAJA 3NJIA 1XMEB 5PAZA 4BXSV 2FQEA 4NERA 1MZZA 1OV8A 1AQ8A 1JZGA 1JZIA 4DP9X 2XV3A 3SBPA 3ABGA 3NSFA 2YXWA 3BVDB 3T6XA 4AZUA 4BWTA 5TK2A 4M3HA 2FQDA 1KDJA 3N55A 2IDFA 4GP8B 2AFNA 4DPBX 1TEGA 2AVFA 2IWEA 2VSKB 1L9QA 2MTAA 3AZUA 2P80D 4E9VA 3OD3A 3C75A 2HRHA 3V9CA 1KCWA 2FT8A 2JKWA 3T6ZA 4A2FA 3OMIB 4YSRA 1JVOA 3FU7A 1L9OA 2HX7A 2LLNA 2I7OA 4HHGA 3OMNB 1V55B 2P80A 3CVDA 5B7FA 1AG0A 1HFUA 1SF3A 1T5KA 3UACA 4E9WA 1GY2A 3WI9A 2TSBA 3ABMB 1IC0A 4EF3A 4YSQA 2Q9OA 2FNWA 2HZHA 3WKPA 2BP8B 3ZX1A 4A67A 5I5IA 2BW5A 3IE9A 1MZYA 3MBWB 4DP6X 3ABKB 3NYKA 4HCGA 4KO7A 3S8FB 2J5WA
chains in the Genus database with same CATH superfamily
4G8IB 2VN7A 1KBBA 2JELL 4M8QB 2Z9TA 3PWVA 5HI3C 4PRBA 2ZX8A 1QMUA 3MRRA 4UTBA 4ZQTA 1BAFL 4JN1L 4P2RA 2PYEA 4U1MB 4PV8B 4QPEA 4PJGA 3PJSB 3WJLA 2Y06H 1W8EA 3F6LA 2VWEC 3ZKNC 1FPTH 1EO8L 3DNKA 4OGZA 4P59H 5FGBA 4P4RA 5C0IB 1HOCB 3BH4A 3MX0B 1N0LA 4DWHA 1C12A 3IFOA 3H4FA 3ZE2E 4FI7A 1A6WL 2ICCA 1A3RL 3OL2A 3S37L 5L2KE 4AJ0A 3FU9A 2OMYB 1FVDB 1N3NA 5DURB 2HB0A 2JKLA 3UTQA 2AS5M 3OM3B 2ISDA 1I85A 1J5OL 1DJZA 2HX9A 2AK4B 5D1XC 3PHOB 4HWZA 1KYFA 2GJ6B 1WEJL 3TS8A 5JHMA 1T66D 4IBQA 2B14A 4QOKD 2GHZA 4OZIB 4GQZA 4ZX5A 1IC7L 4XO8A 4JANA 3S97C 2OSLA 3PG2A 1E2VA 4P5TD 1ZV9A 4Q6IB 4WCYL 2BNRD 1AGCB 2R4SL 2WBXA 3K2MC 3PL6D 2ADJA 3SHSA 4R2GB 4YFEA 5JHLL 3ZTJG 4WUUB 1J9SA 4HS6A 1FG2A 4JO4L 4Q9RH 5E03A 3T0EB 1IKOP 2Q76B 5HHQB 3MNVB 3KLHC 2FJGB 4KDWA 2CMRH 2I24N 3HAEA 5IHUL 5EZOL 4PLKD 5BUPA 1YNLH 1EXGA 2NNAB 2FBRA 4NOBA 1S9WB 4JRYA 4BQCA 4G59C 4AV0A 4LNRB 1J9QA 3QPQC 1DDHB 1YYML 2QV4A 2FH8A 2VLKB 2X4TA 3WJJC 3DGGA 3PS6A 1RAMA 4IDLA 5EF0A 5HHVL 7FABL 1LEGA 1HAUA 4PJEF 3N44B 1E5UI 5D2NB 1KTLB 1I8KA 3VYOA 3UYPA 3MJ8A 2C3GA 4EKXA 5DXWA 2EUZA 3PWPE 3ZL1A 1CDIA 3QIWA 5TJWK 2GBAA 2O5YL 3R0NA 5D7LA 3ULUD 1F41A 4AUJA 4EI5A 4MA8H 3WSQH 1RZJL 5CSZB 3X1GA 3ZKQD 3F7PC 4G43A 2WUBH 2D03L 1I9IL 2IXQB 3HLKA 2ZUTA 3JUYA 4XOAA 3SQOH 4L4VA 4B3VA 5D7HA 1QR1A 4Z8FH 1AD0B 5E2WL 3AVEA 4OLXH 1S9KC 1DLHB 3CU1A 2VMEA 4BFKA 3RL1B 4F33A 4TSAL 3KPQB 1I1YB 3PABB 4J3UA 4NUGH 3GS7A 3LEXB 5GISH 3ATFA 4JY6B 3BLKA 3RUGB 2IG2H 1KGXA 4OJAA 1M3JA 2QKIC 2R29A 1M71A 4XNZB 1EXHA 4ZOAA 3N2JA 4HIHB 3O3UN 4R5XA 1XD1A 4EVNB 2E7LA 1MI5B 4PWHA 5BS0D 5JIHA 3FFOA 1IT9L 2WNWA 3BZDA 1CG9A 3IDMB 4GEIA 1P84K 5FDWB 5LBSA 4WQOA 1J8KA 4ZFOL 4IGBA 1NGPL 2IAMC 4IDJL 1I3UA 3LS4H 3Q8FA 4XHJD 3I02A 5K5YA 1PZAA 5HHME 2F5BH 4KXAA 1JDDA 4FMVA 3TCTA 4EE2A 5C09E 3X1BA 3VXPA 5J3HD 3ZW3A 4ZO7A 1ZVNA 2YS4A 1D2PA 2N1KA 3OAYK 3P4NB 1MIEL 3V7MA 3VQLA 1MF2H 3KM1A 2JB5H 1LJMA 3NRQA 1G0DA 1WFTA 3AU1A 1HWHB 2DJ4A 4KKAC 5A2JH 1MCQA 4X4XA 5C2UB 4QKTA 5CIPA 4HWEH 5E1AB 2I07B 3VFWA 3QUMB 4MNHA 4UV7L 5EBLA 5I8EB 5TE4H 5CD3A 4K5PA 3NA9H 4OZGE 4PJBE 4ZK8A 3HG5A 3QIUD 3S96A 4ONGH 4PGDB 2NY4B 2ERJC 4NNPH 3S3DB 5FGSA 4NQCD 2FNBA 3HPLB 1A7RH 1AGDA 4NX0A 1JZ2A 3CN0A 5GJSL 1EXUB 3VNZA 1Y07A 5SX4H 2NLJA 2W07B 1GA2A 3WIFB 1TF4A 5SWZE 2MHAA 4NNXA 2X2HA 2MQCA 1JHLH 1H3UA 1HXKA 3BYYA 3M1BA 5F70A 1NPJA 1JGDB 1DBKL 4U3CA 4W4OA 2H9GB 3EKCA 3P4MB 2A3TA 1Y18A 2HPTA 4EO5A 3BWAB 1QLEB 1N0XH 1A9BB 2EH7L 2MIZA 2HT2D 3QI9B 4GS7C 3WIAA 4N9GA 2AJUL 5C0GB 2NZ9C 5AALA 3KGSA 2A6IA 5TQ2L 2FYYA 2EILB 1TITA 3KEHA 5DHDA 4MXQC 1FIEA 1BFOB 1EZVX 5DQDL 1J87A 4EDXB 1AJ7L 2WN3A 1I1AA 4GW4B 2ENQA 4K8RD 2H26B 1WA2X 3L2NA 1MDAA 5DYFA 4TPRL 1HQ4B 1S5HA 3PYCA 1E9OA 3ZRSA 4LCWA 4NC0B 1D5BB 4PS7A 4RGNE 3QHFH 4E2OA 5E8PB 4LHUB 1O9WA 3UIZA 3BKJH 1ID2A 5C0JB 2WAHA 2EDTA 4M62H 2NY2B 4PMFA 2LU5A 3CH1B 3BFOA 3QB7C 4NO3B 3T6QC 3IKCA 4NQDE 1LP9A 1E4XL 1ZD6A 3PCYA 1DBMH 2V8LA 4WGVB 4KRPB 3HC2A 3DMMA 3RYMA 4UQIM 1VEOA 3NJXA 3QXAA 1ZLVH 2VKWA 4JZJC 1ACXA 5E9DE 3REWA 5JA9A 3LKNA 4JFPB 4MLIA 3HS9A 5G4MA 4XAWL 4XT1C 4AC2A 3G6DL 4FQPA 4F20A 1H15A 5DC9B 4BSWA 4XE5B 1P6FA 4JN2A 5J9PA 5CN1A 5ITFB 3RVXD 5HYFA 4HSQA 2OZ4A 3O3EA 5EUOA 4HYTB 3LKOA 4UZSA 3HG0A 4AK2A 4L3CA 2VDML 1KZYA 1E90A 3MROA 2VR8A 3O2DH 1CBVH 4O2CB 2L8AA 4NWTH 3UYOD 2FWUA 2XWBB 4KKNA 5IJCC 3L1GA 5B38G 3V6FB 5SWSD 3HG1E 3O4LB 2I9LA 2V6HA 5IBTH 4JQIH 3FO1A 2OMWA 3NZHH 3OX8A 5CJQL 4ODSH 5F8RC 3OZLA 4ODUA 4ZUWB 3BIBX 4J27A 1NFDB 4ESKA 2UVFA 4FZEL 3MLUH 3S2CA 1W72H 4S1DD 4YBLB 4KHTL 4U3HA 2FIKB 5FYKH 1PL3A 3V0DA 3KCPB 4BQ6A 3P02A 4ZOCA 1M7XA 3R7RA 3T0DA 1WYJA 5I1JH 1HYSC 5D4JA 1IEAA 1U8PB 3B3BA 3HNVH 4XN8A 2WKOA 2H1XA 3FU6A 7CGTA 4FA8A 3SYOA 3LKQA 1X5GA 4JBSA 5I71B 3UG3A 3QFJB 5F3BB 4OLVL 4JJHA 4Z0BL 4HISA 2XPGB 1LE5B 1IL1A 4JDEA 2K45A 3BC9A 1KJMA 3TFBA 4AH2B 4DAGL 2D31B 3RRQA 4L8BB 2IDQA 1M7DB 1MWAH 3IDNB 1RFDH 3SPIA 1SHSA 1JDAA 2G4GA 4XC1L 4FABL 4N2CA 4NUPA 4J2XA 5HPOA 2AEQL 4AX3A 1J18A 4R0LA 4OFQA 3CFJA 4L4TA 2EH8L 2OCCB 3NFNB 3FJTA 1WV7T 2WXHA 35C8H 2H5UA 2RR3A 3WAKA 2GW5A 3X13A 1W0WB 2AJYL 5F21B 5GGSY 3RGBA 5FDYA 2C3XA 4L48A 2K3TA 4YHZL 1RCYA 3I9AA 1MW3A 4BH8B 1LXMA 3FZUC 2N4IA 4K3EL 3BUQA 3TN0D 1VEPA 5IMMA 2G2PA 3D85B 4U1GB 1ZHLB 1EHLH 2VDRL 3GXNA 3OXSB 4K7PY 2HMID 4ISVB 3EXLA 3VD5A 3ZL4H 2R4RL 3ZZQA 4JY4A 4CKVX 1S9YB 3NIDB 4IBZA 5DHVA 3P4OB 1DO5A 3D0LB 2Q8AH 3SY0B 3D4CA 3ZU8A 5IEKB 4J4PA 3BZFA 5DSCA 3NSXA 2N7BA 4P4KD 1G5AA 3FSAA 2BNQB 1Z9OA 3D52A 4QOKE 2IMNA 2FLMA 4DTGH 4XPGH 4TSBH 1MHHB 4WWNA 3UBHA 4ONHB 5I30L 1M1SA 3EDEA 5IW1B 5TDNA 5ICZA 2JB6B 3CZEA 4XGZB 2F7RA 5DYOA 4P9HL 3ECQA 32C2B 3GJFH 3OC8A 2Y2WA 4EUPH 1G9NL 1JPTH 1RUQH 3VWJD 1VIWA 2XKNA 4YHNA 2CALA 4OSUL 4LEXH 1INDH 1RK0A 2E8ZA 1BQUA 2J5LC 3TP4A 4B9JA 4BXVA 5I0YA 1MFEL 3PAUA 2B1HH 4ZD3L 3BX7C 3WFHB 3ARBA 4R8WL 4YBQD 3BUDA 2UXVA 1NGWB 3B8YA 1OWWA 1JCKA 4NERA 5E8NA 5B22A 3EJSA 3LVEA 1CFNA 3WFCL 1JZGA 5LGJA 4R97C 1IC5L 3OPUA 2K0RA 1CU4H 1BQHB 1E27A 1XSIA 2N7AA 3O6FB 1K8IA 1PZDA 4ONFL 5E94B 1YEGH 4XZ4A 2G2RA 4QRAA 4QHUB 3EFFB 3ULUE 2B77A 2Q6WB 2P8LB 4N5UA 3HCVB 3QEQD 4FL4C 4O9HL 3ZYZA 2WXQA 5HXMA 5D1QB 3VXMA 1UWGH 4HFUL 4NXKA 3GMPA 1PG7H 2MTAA 4FQJL 1RUML 4JFZL 4OLWH 4UAOC 5EU4B 2WZPA 4I0PC 3K7UA 1RL1A 2KUTA 2NY7L 2WBJC 3AQZA 1TQCB 3GNML 5HGAB 5IKCA 4A2FA 4NRZA 4UU9B 1A6AA 2AXFA 2DQTL 3GSXA 3QAQA 1YMMA 1PQZB 3Q48A 2WVSA 4G5ZL 4DHLA 4WU7A 5MERA 3IMUA 5L2JA 4TRPL 5F3FA 1V55B 4XOCA 4YXLH 2NY1D 4M56A 4E9WA 4QRUA 5BS0E 1UWXK 1ZHNB 1DVUA 2TSBA 4FZ8L 4P06A 1JGUH 2BP8B 4A67A 3S88H 2BSDA 3VFRA 2BW5A 4N5EC 3SE9H 3GLZA 3RVVC 2XXMB 4UNUA 1K8DB 3EIFA 4JB9L 5JNYB 1D5MA 1BD2B 1NC4D 3MRNB 4WLCA 1ZPUA 3TBYA 7PCYA 1DLFH 4XVSH 2HTKD 3A6BL 4A7UA 4Q9QL 1Z9LA 1RP9A 3U0TB 3ZQXA 1MCEA 5B7EA 5I1CL 1BF5A 1XGRA 4RMVA 4HKJB 4L3EB 5IB1A 1CTMA 5KYXA 4BRJA 3KL0A 4FFWC 3B43A 4LKCA 1A47A 4CA4A 3EO1A 4EQ3A 2AEWA 1MCSA 3IWVA 4OF6A 5KYWB 1IFHL 1DFBH 3OHMB 3RY4A 4NWUH 5F7EH 4Z7QF 4NAMA 3RGVA 1F3DJ 4ABWA 4EAEA 5E0FA 3DK2A 2J7LA 1DBBH 2GQHA 3WO4C 4QXWA 4WI4A 1GGBH 1RPQA 2PR4H 3VM7A 1ZT1B 3RWGA 3CFEA 1OP3H 4PP2B 3WNLA 2K78A 1KJVA 4NQCE 4AJWA 4NN7C 1L9PA 2BH0A 1CDUA 1E30A 3CFCL 3D5OF 3RAJL 2VDLL 5AAPA 2J1YA 4MS6A 4FE9A 1UM6H 2DDQH 4HPYL 4BFIB 3BYTA 3H2QA 4P2YA 4AW4A 3B9KD 5CZKA 2VR6A 1TTUA 4P2QB 4EIZC 2G5BA 2CJTA 1A6PA 3GGWB 3LQZB 5IB4A 1I7RB 1R24B 4HHAB 4JREB 2P5PA 3QZWA 3OB0H 2DJMA 4ECNA 2WZAA 3ETBJ 4F8PA 5CN3A 4HC1H 1WH0A 1I7TB 3OBAA 3UZEA 3JV4A 2EO1A 1XR8B 2BIHA 3FH8A 5TK4A 3VM5A 4MJ4A 1RZQA 3EBIA 5EZIL 3I3EA 4AVJA 1KWKA 5K39A 3Q44A 3VU1A 1PZCA 2OW7A 1QNZL 2FX9H 4RGOH 3R7QA 5DURD 1CPUA 2AZAA 4JJ5A 2HJKB 4NM8L 3BQUB 2J56A 4ZFGH 1EH9A 5EO1B 3H9HA 1WJ3A 1J88A 1WK0A 3V8CA 3RPIA 25C8H 1SZNA 3WLWD 3MRGB 5HJDA 1I8MA 3QT2A 4PJIF 3SO3B 1QEWB 3SGKC 4OT1H 3D3VA 2BC4B 1H3PH 4HIJB 4NYLA 4QHKI 4WW2A 5AZ2H 1IJ9A 4CC1A 3KPOA 3D30A 5HYIA 3V0IA 4F57L 4CN4A 1JF1A 1PLGH 5GGVY 1VKXB 4MAYA 2C34A 4P46B 3MGOA 3MRMA 1PZ2A 4WUUD 4G3YH 2A99A 3T0ED 5TDOA 2JCCF 1KLFB 3V52H 1L7TL 4UUJB 3BW9A 3GZOA 4PRHB 4S1RH 4ALAH 5EU7C 4X8JB 2ZNXA 3I3DA 3U36A 4UILH 4BH7B 4ODHH 4XMVA 4WI7A 3UAFA 1FNSL 3OLDA 3KLHD 4N8CH 3KYMB 2OJZH 4YO0A 1KIUB 2VQ1A 1J1OH 5DQJA 4OCRL 4GW1A 3KDMB 4K7PH 1Z7JA 3QPQD 3POHA 2D7TH 4BCZA 5FFLA 2ITCB 2CDGB 5ALCL 2MPVA 5ERWA 1KIQA 3C5ZC 4ZS6C 3QUXA 5SWSE 1P5UC 2J20A 4H8PA 4LCCC 4UT6H 4JFFD 2I5YH 3PHQA 5B3NA 5E8EA 3ZE1E 2VO5A 5KVDH 1UASA 5DK0B 2ICWA 4RA0C 4G1MA 4A6YA 5MEOA 1BVKB 1K6QH 2VJXA 2AXHA 3QQXA 3NCFB 3OKDA 4HLJA 3QK0A 5F7WC 3SDAC 4M6MH 1B0IA 4XC3L 3VDBA 1HHKA 3IYLW 4PJHE 4R83A 5IK3B 1CD0A 1FP5A 1RZIB 1N7MH 1V3JA 4UB0L 3FUDA 1DANU 5FWQA 3PPEA 4DIXA 5IESL 4BSVB 3GRGA 2H32A 4F7MA 2DQHL 3KXFD 4OCLC 3BRDA 1IGIL 3US9A 3GZQA 5DD5L 4HJJL 1XF2B 4M4RA 4RDQG 4XTRC 2GT9B 3RBSA 3KH3A 1MI5D 5SX5K 3FQYA 2DBLH 1W72B 2WQWA 4WTZG 5AOIA 2MQGA 1NCWH 2Z31C 4ZAKA 1J8HE 3FKUS 4P5KB 3UOAB 4JPKL 2F54D 5EBWB 4XZUB 1U36A 4BV1A 1KTDA 3VMNA 1Z9NA 2X4NB 3HNSL 1UWFA 5DS2A 5ANHA 2IAMD 2V2TB 3DRQA 4KZDH 2AV7B 4OGAD 5F2FA 4LCUA 4FNTA 3GI9L 5BXFB 4XPFL 5CBEA 4Y2DC 1R1CA 3LXAA 2O5XL 3NK4A 4LLMB 5CBAB 4WW1A 2WQXA 4HJIA 2B8OT 5JLZB 3TVMB 4AKQA 1MWAB 2WQVA 3EYUL 3VFUB 4MJ5A 1CF8H 1NL0L 3U0PB 2W5PA 3OXRA 1YN6B 1ZVSA 3BSZL 2B0SL 4H13C 2EYRB 4OLZH 1ETJA 12E8H 1K2DB 5CINL 4ABVA 3V0WH 3BPOC 2XVBA 4KKAD 4JFHD 3LDBB 2VQ4A 1IB5A 4M7JH 5KYUB 3IFLH 4C56A 3PFQA 5C6PB 3IFPA 1HHGA 1FFNA 5I26A 4G42B 5C8JB 1V7NL 5ICYA 3DHJA 3PQYE 4YUEH 2DICA 4RIRB 1HE7A 3SCMB 2DRUA 2R8SH 1RUAL 5F7KC 2NY4D 4U31A 1NCBH 3N0AA 3UABA 2Q8BL 2R0KH 3F5WB 1CLOL 1E8ZA 1TYJA 3LRHA 1HILA 4PI0A 5F7DB 5IB3B 2JXMA 4K71C 1JI2A 3GB7B 4BZ1L 2Y7QB 1P4UA 5FF6B 5J4MA 3BH8A 3KGUA 5IHZA 2A6DA 2ICEB 4OZ4B 1UD6A 2B59B 3HUJE 2X44D 1U8NB 1TCRB 3S2AA 3TV3H 4D9LH 1XEUA 2XN9A 1IGYA 2YEZA 3CDGA 1BXAA 3I84A 4JO8A 4AGPA 4AMKH 1QSFE 2DN7A 4BHUA 1K3IA 2VR9A 3QI9D 2Z4QA 3IGUA 4WHCA 1LK2A 2RAMA 2AQ3A 3QDJE 1CE6A 4FFVC 4ELME 4J39A 1NLBL 3K6SB 5CLXA 3P77B 2FLRT 1A9EA 3B2UC 3R0MA 1FFOB 1TENA 3UC2A 5C0RL 3WE6B 2OK0H 3FSVA 2OCFD 3QA3A 1QACA 4G7VL 1DBJH 1SYVA 4BFNA 4I1PA 4AVKA 1JZHA 1CZ8L 2VLMD 3DX7B 3AFLA 4PVNA 5JYLA 4Y5XC 4EUPB 3WTTA 4LCIL 2F7IA 4LQ1A 4PU2A 2EIMB 1AANA 2X3CA 1A7QL 5JHLA 5D2LA 4XN1A 4HDIA 5ESAB 3R06A 1M6OA 3OMZA 4YAQA 1IQDB 1MCIA 6PAZA 2J8UB 1OGAE 2WCSA 2XQBL 3ZSSA 3QULA 4MJIA 4KU1A 1GGIH 3VRLF 3VWKA 3NMEA 3BIKB 4LMQE 4EIGB 4WV1A 2WGNB 4KRPD 1A5FH 5E70A 4JKMA 4HULB 3LKSA 3U4AA 4CU7A 2O72A 4TS6A 4F37F 3MNZB 1IV8A 4DESA 5FM8A 1ZDSA 3GXTA 1OP4A 2JKXA 4GEJA 2LVEA 1YUKB 4X98B 4G2AA 3RWJA 3BP7B 1IEBB 2X3BA 2DQFA 2GSIB 4GRWH 3OKNA 1AXTH 1FH5H 2AEPL 4PGEA 2WP3O 3I50L 5AOJA 1YEIL 3ROLA 4HSCX 4CGUB 5E2UL 4KK6D 1MCRA 3MBXL 1MHPH 2D0GA 3L4YA 1O5DT 2LAAA 3S36H 2OS7A 3UERA 4M1GH 4AL8C 4E9XA 5LKNA 1GYUA 5GGVH 5D6DA 1A1NA 3OQ3B 4Y4KC 5HHPA 2NT1A 3KPLB 5I75B 1FA4A 1OPGH 2AANA 4LESA 2W91A 3L3OC 5DR5L 4L0YA 4LGSB 3GUFA 5IJDC 3FOMB 3K46A 1R19A 3VH8G 4HPOL 4QT5B 1BECA 1NDGA 5HGDA 1KN4H 4J3SA 3ARUA 4GG6B 2H6PB 1EZUA 1E4KA 1EGJH 4OIAA 3O6LH 4DGIL 2OR9L 3L5XL 4B97A 4ELKB 3AJ7A 4Z0XB 4NQQA 1T7XA 2FBJL 2C3HA 3BEVB 3F83A 5DFWH 5IUCA 4XP4L 4UDTB 2Z7ZA 1J0JA 3HOGA 1HYSD 4JPWL 4ZFOA 1XIWC 4PJ5A 1FO0B 2Y5EA 4JX0A 3NFPB 4ADJA 3BHBB 5IVXF 4F2FA 3LRLA 4R5VA 4DUXA 3GMNA 5CEZH 4H8WC 4OGXL 2V9QA 4HCRL 4K0OA 3VXUA 1SOKA 4MS8D 4HK3N 3TV8A 3VXTB 1M3IA 2IOIA 2BNRA 3VFTB 2OTWA 7TAAA 1ZSHA 1JPGB 2FJFA 1ZLWK 2PTTB 4MA3A 5JW4N 1OY3B 3ZY7A 2A4ZA 4K2UH 4ANVA 3O6KH 3TWCH 2HG5A 3ROOA 2J4WL 1PW3A 3KNBB 3BLPX 3SQBB 1G6RL 5T3ZD 1U2HA 3F6IA 1LEIA 3CFNA 2IPUG 3HHSB 1Z9SA 3D2TA 3HR5B 4OQTH 3JTSA 4K9EH 4BQ9A 3JZYA 2XN0A 4HXBL 4ANUA 2ARJA 2VLJB 3PFUA 1XWVA 3VXQA 2VIRA 5E6ZA 1AFVL 3T6XA 1QSED 2Y5TA 3CAFA 2DQCH 2AK4E 1KMGA 3I9GL 2X7LB 2ZQKA 4H44C 1JZ3A 1CFVH 5EF3A 3LHPH 2LVCA 2FCBA 2GJPA 4MVBC 4HIEB 1NKGA 3LH2L 4OTXH 4RAUB 3N85H 4OZIE 5AW7B 4GQRA 4TQEH 2ED8A 5EMYA 4TQHA 3B5TA 4Z1PA 2C4FU 5CHNB 5BUGA 5JOPD 4WUUE 3GINA 1P6WA 2ADFL 3T0EE 3MRDA 4MHHI 4KKRA 4A7QA 3LRSB 2EKJA 2ATKB 3DSFL 4F8OA 5CF3A 4QHLB 3VI3A 2F1EA 4LP4A 2P80A 3CVDA 3N6YA 1NCDH 2MTPA 1YNTA 2CXGA 4N85A 4Y5YA 4Z3TA 4POZD 4ACPA 2X70B 2CIIA 4NUMA 4DN3L 1MCBA 4EN3C 1QRNA 1R0AH 2XETA 3JTTA 1TZAA 2VLKE 4K23H 4KPHL 1IFGA 5GGSB 3HNTL 2DL2A 4IU2B 3RP1A 3SE8H 3WUZA 1WP6A 3S8FB 3RU8L 4O51A 4Q4EA 1ZVYA 3CHXA 4PG9A 4PUBH 5D2NE 4OCYL 3NABL 4MCMA 2GCYA 2PLTA 2YBRB 3O6FD 2EIJB 1GJUA 3ZR6A 1JXFA 1OP5K 3UTTD 5FR3A 3DPBB 2WXFA 1N2RA 1YNKL 2BSTA 2QL1A 1WA0X 2P8MB 5D1QD 1C8QA 4H2CA 3BESR 1NAMB 1EHXA 4JPIB 4P5SA 2EECA 4JHBA 4NJ9L 5L6YL 4RMUA 3ORJA 4R96B 5EN2A 4IMKC 4OFYD 4CW1A 2Y07H 4Z7NF 2C9SA 1M7IA 4I4WB 1PPIA 3ML8A 4H0HB 2G3NA 2UY7A 5H37H 4ZW5A 1J0KA 4G9DB 5B7MA 4I0PD 1MW2A 2OFQA 2WBJD 4DP0X 3FO9B 2CJUL 1TQTA 4LOEA 2ADGB 2BIPA 2X1PA 2XWZA 3RUGE 4QXUL 4Y4HA 3GSNB 3V0VB 5I6LA 1NBVL 1U8KA 2WWOA 3P3RA 5I6OA 4J2QA 3MCKB 3GIVA 1MI5E 4F1ZA 2ESVA 3U6RA 2VTFA 3DSNB 5I1AB 3CVIH 5IJBC 3SPHA 3F85A 3T65B 1BMWA 4CUCA 3QNXA 2HT3D 1UGKA 3PDGA 4K5LA 4N1EA 4N0UA 4F9PA 1Z3RA 3OKKB 1CXIA 4KXCA 4WRLA 2RCSH 4KTDL 4U7MA 1GSMA 3SKMA 4KH9A 3AS3A 1NOLA 2AKRA 4LO9A 3ZDXF 2ZG3A 5HDOA 3RVVD 3GZKA 4ZNEE 3O9WB 1CFTB 2C1OA 3BUYA 1GYAA 3RZCB 4Z7QB 1TZIA 2Q86B 4B0MB 2X89D 1ZEAH 1SJHB 1UCBH 4AE1A 4BE5A 1V5JA 4OU3A 3TBWA 1KULA 1MCPL 5C70A 4AQ8C 3Q6GL 4L3ED 2VN3A 3JWNC 1JHTB 4WEUD 5TD4A 1WE5A 3FONA 4HF5L 5JW3H 5TDPA 2FJSA 4AJVA 2N0KA 2CKNA 5KVFH 5LAXA 2VERA 4FFWD 3WUWA 3LN5A 1NCIA 4KVPA 2F9BT 3VCLA 4O2EB 4JFHE 5KVEL 3BVXA 4DPCX 5AB2A 2D7MA 4YK4C 1CI3M 2FL5B 3PWLA 4D94A 1UB6B 2B9AA 1LDPL 1YEHH 4BGLA 4OZHA 5TH2A 5ACMA 4K55A 4HIQA 2ZUSA 1DCEA 1P7QD 1OE2A 1CICC 4GMSH 1BVLB 3T4AC 1L9RA 3WTUA 3CZSA 1RZFH 4HZLA 3MJ7A 3SSGA 1KEML 5D7JB 1INQB 4IRZA 4BGDA 3F62A 4FKEA 5FX3A 3EYVB 4Y9BA 3NJVA 5B1JC 3O3BA 1DEEA 4OZFA 3WEXB 1FE8H 2EE6A 2FTAA 2A6KB 1IM9D 2A6JB 4LGRB 1ZTXE 4OFIA 5FGCB 5BZWB 3TJPA 4P05A 5J0BA 5KVGL 5JQIB 2FYVA 3N41F 3DOSB 5DS8B 3A67H 4G7YL 2NUTA 3BPLB 4H88H 4RX4A 4P2QD 1JPEA 1YEJH 4LSPL 4HG4J 4P9ML 4OKVA 2G9HA 4ZO9A 1VLXA 4F7TB 5K59E 3KS0H 2M83A 5DDHB 1DJHA 3VQ2C 1L6ZA 1AXSA 1BLIA 2XY1A 1F02I 1XGYL 4N6RB 3LH9A 2YGNA 4WDIB 4PJIB 5I6KA 2G60L 1MNUH 2IFFH 4OLUL 1JNHB 3B83A 1HEJC 3T0BA 3JWOH 1U8QB 4YGVB 3RL2B 1SQMA 3NCMA 4KMLB 4HD9A 1U8LA 3BQUD 3FHQA 3MTXA 3VAEA 1IBYA 2HCZX 3FO0H 4OF0A 4BUGA 2HAZA 4LASH 1F86A 2F7OA 2JCCB 5T1DH 3GMQB 5I1LA 1HXMB 3D39B 4B9IA 5BRZB 1FL5B 3QJRB 3UTPD 1CDGA 3UO1L 1WC7B 5KANI 3V5HB 3M86A 2LU3A 4EQ2A 4PWIA 4P46D 4XO4A 5CP3A 5AFAA 1S7VB 2AI0L 2LABA 1D5RA 4I18C 1ZT7B 3LEVL 1RJZA 3WKNA 4Y9EA 5I2IA 1VFBB 2ENPA 4HUCA 1B3JA 4PRHD 4ZOBA 3K8MA 5AVRB 5GRYA 1XFPA 1FV1A 1BZ8A 1YQVL 1L9SA 2D9QB 3NA4A 4YHMH 2E3VA 2X9YA 1E0OB 4M93C 3LRKA 1IIKA 1RZ8A 2IGFL 5I1IL 1YEFL 2OL3L 3H3BC 5LWYH 2DQGL 4AQAB 3U9WA 4WFHD 5HGGS 2D73A 3HE6C 1TG8A 3ELQA 1P53A 1JZ6A 5IHLB 1HHHA 3RZWA 3MLRH 4L05A 4X99B 1F0LA 5KJ7E 5AZUA 3LXBA 5J6GA 2DJUA 3IEAA 3O4LE 1YA5A 4PTUA 4JEGB 2NW2A 2DB8A 2W60B 2XN2A 3C5ZD 4MASA 4ZS6D 3V4VH 5BVJA 3K4ZA 2CO6B 2J2ZA 3C2AL 4YDJA 4TOYH 1RULH 4GRWB 4J8RA 4LLAA 4W9DC 1A7PH 2QVKA 1HSAA 1L9MA 3DV4A 5AVWB 4HUVA 5CP7B 4OFVA 1NFDE 3BKCL 3S35X 1U8IB 3SB3A 3C5XA 4NUQA 4YSTA 4LVNB 2YEQA 3W1ZA 2X6MA 3U83A 2FQFA 3CFTA 3G5YB 1DQML 4DUWA 3DI2B 5GS1C 2CK0L 3TIEA 5JIPA 3IAPA 3IETA 4QXTB 5T1MB 4JRXB 5T5NF 3OKLA 2JI2A 1DHKA 1OTUC 5EEVA 3BQVA 3QFJE 3W3BA 4PCKA 1FFPA 3EGSA 1DJYA 3WNJA 1FGVH 4N0CD 2FLBT 4XTRD 3S5ZA 3SDDC 5I0ZA 5GGRY 4GMTH 3OF6A 1DVTA 4HIXL 4LT7A 4U1LB 1DE4B 3STZB 2UZPA 1M4KA 1NM4A 1DUYA 2ATPA 5KSAB 4GAGL 1X6NA 5D70L 2VW6A 2D3VA 1UH3A 2E4TA 2EYTA 1OCOB 2DAVA 2A1WL 3WXVH 1PY9A 1RIUL 5ACZA 1PD0A 2OMVA 3IRZA 3FQXB 5FHAH 4PRPB 4PQXA 3QRBA 3IE4A 2HJFB 2P4AB 5JPNA 3L1FA 1SUJA 3HPJB 1NBQA 4WHYH 2YD1A 3DV6A 5T3ZE 3TVMD 1UWEH 5HVHB 3VWJA 1WFOA 3EUUA 2WINA 3W11C 5HPMB 1OAZH 4KAQL 3HBGA 4HEMA 3PUUA 3RVTD 3BAEH 1JZFA 1I1CA 4NO2A 4XMKL 5IQ9A 1OZTG 3N1GC 5AVUB 1GOGA 3JWDC 3VFSB 4TVPH 1DQJA 2W92A 1HU8A 4XO5A 3ZT6A 4ZUTB 4ONOA 3NIDE 3ARGB 4NT6B 3A21A 5IMKA 3GLEA 2DWEA 4WTXA 2QADC 1YEEH 4JM4H 3SDXB 3ZMEA 3WGUB 4KI1A 1NCUA 4JHUA 3U7AA 2BNQE 4XP9L 1C5CL 2R2EA 1R46A 1SQ2N 4XBEH 3HZMB 2MPAL 3SDCA 1B2WL 2MKLC 1JF5A 2YPVH 1JGVL 2CRZA 1EVTC 3IDGB 1LDSA 2RHEA 3E6FB 3GF8A 1FLRH 4H8QA 2ROXA 4UTCA 1A4KA 3KE0A 3SDYH 2IAAC 5JOPE 3DJRA 4MSWB 1BQLL 2NY0C 4QTHB 3ME0B 4N25A 1OD7A 1T83C 4M7KL 1OTSC 1XGTA 2XU9A 5IOPB 1G6VK 1HI6B 3MLZH 3F7KA 3FH7A 1NCOA 2VDNH 1UA3A 3EHBC 4MD0A 3BGMA 5GGQL 2A2QT 3MXVH 4JG0H 4HGMA 1S7WA 4JHWH 3QJZA 2BHZA 2QTVA 3IJEA 1OAQL 1MCCA 3WTXA 4FFVD 3TL5A 3B2UD 4HT1H 4UQ3A 3TO4A 1OGTA 5D6CB 4GUOA 1Q0XL 3SBWA 3MXWL 1K4DB 3Q7JA 3NT0A 5B1BB 1Z32X 2F5AH 1AIZA 4NZUH 4Y1AA 2JTDA 5EIQA 4FFYL 1K5WA 5IBUB 5GZNC 4MMYB 4W4NA 5D1QE 4HLZG 5FA4B 1KYUA 1EV2E 2Q0ZX 3O11B 3GMLA 3N06B 3NEXA 5D71L 4GAJL 1QFUH 5AYTA 3CLFL 3HS0C 4PRAA 2B2XL 3TH3T 3HE7C 3GMOB 4U3SB 1G0YR 2HFGL 5MP6L 2OQJA 5BOZG 1JN6B 2UXGA 4PJ6A 4PJGF 4ZUUB 2X6CA 3RTLA 4FHKA 5CSGA 5D7EA 5L8LB 3SBQA 2Q87A 2C9XA 1F18A 1OE3A 4PN6A 2PO6C 1NIDA 1MQ8A 2J88L 5KEZA 2NW3A 4BFEA 3QJFA 1AS7A 1JUFA 1NIFA 4N2HA 4UT9L 4XNUH 1FAKT 2F68X 5CFHA 4V11A 5LDSA 2Z0BA 3IS0X 1RJYB 2WWMC 4HV8B 1JTPA 4DT2A 1S7RA 3D34A 2F53D 4LLYB 3D2UA 1KB9J 3N3EA 3EFOA 3HMXL 2HKHH 1BD2E 4A66A 1BJ1J 1FRGL 2QQKL 3DLQR 4H2AA 3ZZSA 1OL0A 3JBG7 3WIHL 1U8OB 1LVEA 2X05A 1IARB 2NQDA 4U1JB 3GI8H 4Y4KD 1GY1A 4L3EE 2EP6A 4CSTA 1DJXA 2OAAA 2XDHA 1GYCA 1E9PB 2APXA 5CLZA 5ABZA 1X5MA 2WLLA 4BFOA 3AWFA 3WS3A 4S0HA 3SD2A 2DIJA 3DROB 5IJKC 2X53A 5L8JB 2DIEA 2ZOKB 3BVDB 2DH3A 2LAGB 4L9LC 4RAHA 2WVVA 3T2NL 5KBDA 1EEYA 1BHGA 1R6VA 2ZYRA 3EFDH 3S5LG 1OAKH 1P0SE 2GKIA 3L95B 4FKHA 3BAJA 4H26A 4LPTA 5F93C 3WTVA 4X4MA 3SJVD 2O5ZL 4WEBL 1QZNA 1QLFA 1HXYB 5D1XA 5EPMA 3T04D 1KCWA 2IO5A 2JKWA 1TJIH 3O8XC 4TF4A 4DQOL 1N4XH 5BO1H 2MFNA 3T0WA 4P2QE 2HX7A 4D0BB 1AP2A 3BSZA 4D7PA 1JGEB 1IAMA 4Z9KB 2JI1A 3PP3H 1HFUA 1T5KA 3M7FB 3WL9B 5E4AA 3LH8A 4B5ZA 5CFAA 3TEZA 1SMOA 1MLBB 2Q9OA 4DW2H 3HC4H 1GGYA 1ESOA 4N2NA 2ORBL 3TFKD 3VTTA 1ETB1 2E4FA 3QVAA 3TYGH 4Z95L 4JS7A 4KZ0A 1B9ZA 1CB4A 2HUEA 4GKOA 4GRLC 1NDMB 2WYIA 1F4WL 2VLJD 4LEEA 3D0VB 4L1BA 4AWJC 5GS0H 4L1TA 3ZTJH 4I2XB 5C0AA 3NJNA 3GUTB 4JM2C 1TTFA 3QWOB 1NH6A 4LHQB 4PGBA 3AXLB 8FABB 4PIBA 4JFFA 2VDQH 5ESVB 3CFDB 4ZSOB 3RTQC 1CR9L 1H0DB 5JDSA 3UTPE 3FQNA 4BZ1A 2ZXDA 3NGBB 4NO0A 4HGWB 2H3NA 2D3LA 4L29A 1N67A 1T2XA 4DK6A 3P3YA 1A2YB 5D1ZC 1QYGL 1A14L 4A2DA 4IJ3C 3TBCA 3VB9A 3LTVA 4AL8L 3S98A 4A68A 1DANT 3EOBA 1FNLA 1R34A 1UD5A 5FHBH 5KYYA 4WSKA 1ASPA 2AK1H 5FCSH 4LAQH 3IDJB 3FUFA 2HTLC 1UA7A 4GXUN 3FB8B 4PRHE 2BHFA 5BV7C 1IIIA 1JK8A 2UUDH 5AVZB 1U4EA 2AJSL 3CSYA 2CRYA 2P3YA 4M5YL 4F1SA 2DIBA 2HT4D 1XAUA 4UTBH 4JKKA 5C0FA 5F1NA 3WXWH 1TTBA 3OKEA 2VDOL 5I8CB 2QKIA 3UAJD 1NMBH 3LNDA 2Z92A 4EN3D 1K85A 4NKMB 5I1GH 3VGHA 3B7UX 4HUWB 4NZTH 1EX0A 5I6XC 1GYWA 4KVNH 4WHTB 3LNEA 1UH2A 3IDXL 2D4DA 1F4YH 2DKUA 4FX5A 1YY8B 1SEQL 3KYKH 5EG6C 3SQRA 2RB8A 1MCNA 1MPAL 1E3XA 5GRWA 1N5YH 1NBYB 1J86A 2WN2A 2JLPA 4H8WL 4Q14A 4RFOL 3W0WE 3NACH 1UACH 1QTYT 2X6BA 3K2UL 1Q9LA 4UDUA 1MDTA 1A7OL 5I0XA 4F7CB 3KPNB 5DJXA 1T0OA 4Z7UA 2ZG2A 3H42H 4WFED 2J44A 1U3JA 1LMIA 1QW8A 3TJEL 1N64L 2VN6A 1F97A 2H41A 3G6JB 5FFGA 1M6UA 1IGJB 1EANA 2YAEA 3ZTEA 5ADOH 3ZDXB 2ITDA 1CLVA 3CE1A 1CO1A 3KW8A 5AOLA 4JGUA 5JXAL 5AW5B 2HFEA 3KLSA 3FCGA 3HAEH 5FYKE 1FH2A 2AMUA 1QPKA 2QR0B 2W9DL 4PV9B 3SIKA 4A7VA 2X1QA 4OJYA 4JNXA 3INUH 5L4JA 4MCYA 3VE0B 3MZTA 1KGJA 1MG2C 1U58B 3CN4A 3H2WA 5EU6A 1T1ZB 4MX7B 3O9WD 2VR5A 4QRPA 1RHHA 3DO7A 3E8UH 1DVXA 4NN6B 3ZLQC 3RZCD 3OV6A 2PCPB 3BVTA 3HLAA 5E6IB 2XXFA 1VGKB 3B5HA 5LVEA 5EEUA 3TT1H 5HHOA 5DF0A 2H0JA 3HRZA 1EFXA 1OF2B 1UHVA 2C1PA 1KENH 1X6LA 1XV8A 4WI9A 4MMXC 2WZ6A 1OALA 3OGOE 4FFTA 1XGUB 2OMZA 2AF2A 3D9AH 5ECGA 1WBYB 2UYLA 2CKBH 1PAZA 1HN1A 5JR1L 5IWLC 2UY6A 2AQQA 4BZYA 4AVHA 4FNLL 4HCRA 2XWXA 5A16A 1JD7A 3QPXH 1TZHA 2A9NH 3CHQA 1E43A 3BWUC 5ANMA 4KI5F 1HX0A 1JXGA 2MCPH 5D7JD 4DOHB 4WY7H 3T3PB 2A74B 2R29H 5C0BA 1IGMH 5F6HJ 2ZX9A 1PD1A 5FPIA 3C60B 1MELA 3I75B 1UATA 1UZ6F 4OB5L 4L2LA 2HN7B 4AYDC 3FTSA 2ZUWA 3N42B 4HFWA 2F58H 2FO4B 4X7SH 5IB5A 1G6RA 4HCIA 3I6KA 3N1MC 4MA1B 5LBSH 1OANA 4NRXA 1L3NA 3G5WA 3MC0A 2W94A 4PV1C 5FUZL 3VGAC 3DURB 3I9PA 4FQHA 2X40A 3QORB 1DEDA 1S3KL 4QF1A 2X41A 3I85A 4Y1SA 3BZEB 4JZJA 1X5HA 1T4KB 4LU5L 5GRUH 2KL6A 5F9WC 1I1RA 1YEWA 1YPZA 5J06A 5H2BA 3MLXL 4YSSA 1KPUB 2CUIA 1QZ1A 2WKOF 1UQSA 2FJHB 3GSQA 2Y6SC 4JFYA 5C08A 4PW4A 5HYSB 3NIFB 2XJKA 3B37A 1NZRA 3CCHA 3M46A 3RVUC 3DX8A 3QG7L 1DL7H 2C9VA 1V7ML 2VDNB 3QPKA 3DIFB 1UD4A 1X5IA 3H0TB 3D39D 3NP4A 5HI4C 5BRZD 2J8UE 3VFNA 3K5SA 2X9WA 4FQ1L 3VG0L 4WFGD 5C0EA 2DYPA 4N2KA 1JJUA 1K9TA 3S34L 1YO4A 4BK5C 4PJDB 3HKZA 3Q2WA 4LSRH 4JCLA 1FIGL 3P9MA 4IIQC 2Y23A 1IGTA 4FTVD 4KROC 4MMZC 4XPBH 5FA3A 3BPNB 5J1AA 1T1YA 4KO9A 3V4PB 1X9LA 3FUJA 1KBPA 1GXEA 3FN0H 1UJ3B 4B9PA 4TV3A 4D3CL 3R18A 5F89B 1UZ8A 4XBGA 1Q1JH 4FCAA 4UBDD 4YHIA 2VLRA 4DF9A 5IV2A 2B15A 1HH9B 3IAGC 1E67A 5DRNA 3SGJC 2W9EL 5JOFB 1RVFH 2RTTA 4XCCH 4LHUG 3MA9L 3KLAB 1VADA 3GXMA 1CL7I 1ZANH 4PB0H 4KFZC 1HVXA 2I9TA 3IJYB 5I5RA 3CXDH 5EORL 2BY2A 4MNQB 4F8NA 2V7NA 1I1FA 1AE6H 1F90L 4BUHA 3ZRFC 1LO3H 1AQMA 1LK3L 5DEGA 4RWHA 1HWWA 4NIKB 3QXVA 3L48A 3QG6A 5TE7H 4JO1L 1TJMA 3F05A 5INDA 2E56A 1XGQB 4GG6E 2L7UA 3U0WL 5JORA 1NBZB 1XXFC 1VHPA 3KPRA 1I3GH 1JMXA 2P5WD 1QBMH 3APCA 1HHIA 2R23A 4NKOA 3B3IA 5E1QA 4JRXD 3SOBH 3VXRD 3G08A 2NY6B 1OM9A 1PCSA 3MUY1 3AG1B 3B8SA 2VMFA 1I7UA 3DETD 3GSWA 1OTUD 2CBOA 5K9JL 2N59A 4ZTEA 3IBOA 2CNZA 3MRHA 5E99L 1ADQH 3SY6A 1S8DA 4PS4H 4HEPA 3A22A 1I9RH 2YPKB 4OD3L 1WFJA 5KSAD 3QWRD 2C4FT 4H1LA 5EOCH 2G0LA 3PJNA 2OZ4H 4ETQB 3KYAA 3FFDA 3IS1X 4GYBA 5IFJB 2IALB 1II4E 1ML0A 1Q94B 4JDZA 4PRPD 1KIRB 3KPMA 4IMLA 2F74A 2VITA 4QXVA 4XNXL 1FNHA 2ZP9A 4ZMOA 4GY4A 2DQDL 4FCHA 2Z93B 3NCYS 1U8MA 1E7UA 3HG4A 5DMKA 3VI4A 3QHZH 2D7PA 1YY9C 4P57B 4TNWK 2OJEB 4XCYA 5FKAB 3B56A 4I13B 3W11D 4KZEH 2VLJE 2VZSA 3IGLA 3VJ6A 4MGXA 3ILQD 2VH5H 4RFEB 4CVXA 2YSSB 4M7LH 1GS8A 1TO5A 4PJAF 1MCOH 1VZGA 1ZHBB 4AYMC 4LRNH 1BOGA 3ARGD 5ABAA 1B0GA 1KDIA 3SODB 4Z3JA 4KJWD 3N9GL 4JFQB 3UTTA 1JNNL 1EEQA 4AGOA 1YJDC 4X80H 4NZJA 1OB0A 5GGRB 2TRHA 1WGOA 2BSSA 4ZZFA 5I8OL 2ADIA 5EU3A 2YD6A 3QCUL 1WBXA 3MV9B 2PKDA 3KL3A 3JZ7A 4LFHD 4QRBA 3SKNB 5BUAA 3KL5A 4QY8B 5IFAH 2NY0D 5AWNH 3IU4L 4TNGA 2W8CA 3TZVC 2R1XB 4NIYE 4NNYA 2HVJA 2P43B 4K7PX 1EAQA 4X83A 4BHUI 1JPSH 2ZKXA 1FHGA 5E08L 3QXWA 2FEEL 5T33H 3RWHA 5KJRH 4AQ1B 3PWPA 4R90L 4WI0A 3DX9A 3F6JA 2VL5B 3RWFA 4I77H 3L7EB 1OLLA 5GRXG 1T20A 3E2HB 3PWVB 3GMRA 4PRBB 3U7WL 1NUDA 2FD6H 1CMOA 1WZMA 3MRRB 4ANXA 2B08A 4P2RB 2PYEB 4F92B 3CBRA 2X89A 5ADPH 2JIXB 1T7YA 2AZUA 5DWUL 3ARYA 5EIVA 4B95C 1AOHA 3DC0A 5GZND 1DQQB 4U6HA 4P4RB 2XC8A 4NCC2 1N0LB 1IKFL 4J6IA 3SBPA 3IFOB 4WFEE 5JQ6H 5GIRA 1Z3GL 3IPEA 1PSKL 2VXTL 5TQ0L 2ZOLA 5KVDE 2OL3A 2VXSL 5DUPH 5EZJA 1N3NB 3HE7D 4U1SA 4AMXA 3UTQB 3O3DA 3BN3B 3VD7A 4I3SH 2XQ0A 3GBDA 5DMIH 1MAML 3PUCA 2C3WA 2VR4A 1QUPA 1UXSA 1U3NA 2BSRA 3G7TA 4R7VA 1BQHG 3LXUX 2PO6D 3A4AA 5ISZA 1JYWA 3OKYA 3QW9A 4K4KA 1UT1A 3V9CA 2O93L 4JANB 1BWWA 3WN5A 3IMWA 1NSNH 3V9FA 3JWDL 4B6ZA 5F0JB 5LB1A 2VNCA 4EXKA 3FU7A 2ADJB 1MREH 3DX6A 1WIUA 4HS6B 1FG2B 1TXKA 1BVNP 4YNYB 4I85A 2OX5A 5IQLA 3FUIA 4Z7QE 3MFGB 1H6EA 3CMGA 1JYNA 5FYLL 3FNKA 3ZK0A 3WI9A 2B1AL 3HAEB 5EWIL 1PGRB 4WW2F 4JHZA 2VR7A 3L2LA 3LQMA 2BOBA 2WMPB 4JRYB 4ZX3A 3QJOA 1OAXL 2X4TB 4N3TA 1CDHA 2FX8H 3DGGB 1U3ZA 4DN4H 2PPDA 5H94A 1CFSB 3LPPA 1V54B 3E9TA 2NNRA 1I8KB 2XTJC 3MJ8B 2X87A 2Y5QA 3QIWC 4RZKA 3V2AR 2XQYG 4DP8X 1ITCA 4RFNB 5K9KA 3IN2A 4MAUH 5T3XL 3H9ZA 1ITBB 2ZWKA 1D6VH 5D7LB 5HGHA 3GHEL 2R56L 2DEXX 4EI5B 1E50A 4Z3IA 4Y8AA 3FQUA 4DKEL 2JJWA 2CG9X 4NB7A 4XMTA 3E1ZA 2CKBB 4G43B 5EBGA 1SFHA 2GI0A 1WZ1L 1CE1L 2XG5A 2W0KA 4LSTH 3GS4A 1A4CA 3SGKA 3QC6X 4CJ1A 5FGCE 5GZOC 4L4VB 3QFDA 4HAFA 4MZ3A 1QR1B 3C8KA 1ZA3A 1HWGB 3SGDI 3V5KB 1S9XA 4F33B 3ZE0B 3LMJL 1AZNA 1UYWL 2QFPA 4G6JH 3RIFK 4PJEA 5LCVH 4EKJA 4JY5L 4B27A 4F93B 2ZE0A 1M71B 2WB1A 3C5SA 2GHWB 5GGTH 1ROWA 4WEMB 1XCTA 1TU2B 3AAZA 3TU6A 3RG1C 3BIAX 3WAJA 1CG9B 3J7HA 4PJCA 2KH2B 4PJIE 5I5MA 3RFZA 5FM5O 5I17A 5LLIC 3IN0A 3IK2A 4IGBB 4MLSA 3ZGHA 4IBVA 4L2YA 1CJYA 2YQBA 4NCC1 1E4HA 2VM9A 4WAFA 2J6WA 3I02B 4WWKC 4MBOA 3I6GA 5CU5A 5L7XH 1Y6MR 2NSMA 5F7BA 2DLTA 4FULA 3WMSA 3LD8B 4XPTH 2FIRT 2E27H 2FRGP 2JCCE 3C5ZA 4MB4A 4CU6A 3VXPB 1P5UA 1SNRA 4NQXA 3U2SA 3D39E 4LCCA 5BRZE 4N9OB 1M1XA 5JPMB 3BKML 5CILH 4WFGE 1QBAA 3NJFA 3RTQD 3LXCA 1JP5A 3CSTA 3IMSA 2G5UA 2HP4A 5LXGL 1OF0A 4X4XB 2IH9A 4GAYA 3CZJA 5CIPB 4F58L 2BHUA 5I9QB 3VFWB 4UQBA 3SDAA 2IDTA 1FF5A 3ECUA 4MNHB 5D1ZD 4ANKA 2DQUL 2QZ5A 3LHAA 4FTVE 5EBLB 3UBXA 2F7PA 5CD3B 1JYVA 1TQWA 1NCHA 2MMXA 4PJ9C 3SKJL 5M7QA 5J1TC 1GTNA 2DMHA 2KZKA 2W80C 3LNHA 4CDGC 1E6OH 4XP5L 2AQSA 4E9LA 3E6HA 1UKQA 3DARA 3OMAB 4O2FB 3RPBA 3S96B 2H2PD 3ATDA 1DSWA 2FT7A 4NO5A 3UBGA 3MZGB 4QLRA 3Q2NA 4ZUVA 4QMEA 4XRCA 1TVHA 1AGDB 3AUVA 4YQXH 2NLJB 4GSDH 4JQVC 1HNFA 3CZUB 3C6SA 2Z31A 2MHAB 4NN5C 2YC1A 1VEMA 4FFYA 1G9EA 2XRAL 1A1OA 1UOVA 5JUEH 2MQ0A 3M1BB 4YSPA 3RA7L 2WZ0A 4FOMA 5ALBL 4YHYC 4MXVF 4GRWE 4HS8L 1Y18B 1E4XI 2ARJQ 1E8WA 4P07A 2CHDA 4HHWA 1F58H 2Y3AA 1NJ9A 4Y2DA 4YC2B 3CSGA 5DQ9A 3N91A 1QABA 1H3WM 2FHBA 1MAKA 4ZFQA 4YDVA 2A6IB 2FYYB 3FCUB 5IQOA 2PW2A 5AQ0A 5IGXH 1MHEB 1ICTA 1MCKA 1I1AB 1JS4A 4UT9A 2JSFA 3EOAA 4JRXE 3U4KA 3VA2C 3HA0A 5FS5A 1L3WA 3P73A 1S5HB 1DBAL 1E9OB 4LCWB 2N01B 3GM0A 4MJJA 4DSYA 4AC4A 3HMXA 4PTTA 3AW5A 4WI3A 2JF1A 2A4CA 4HMDA 3N40P 1IBGL 1P4BH 4Z7VB 1YYLH 2Z6FA 4XX5A 3V10A 1A1MA 1JV5A 3BISA 3WIHA 1MOEA 4IS6B 1LP9B 1XL6A 3NZ8A 3QO0A 2VMJA 4GB9A 3R8BB 2FSEA 4WO4C 2ZXQA 5C07A 5KBPA 3DMMB 1F5WA 2FEDC 4JAMA 3OSKA 4Q0XL 2AHIA 1CL7H 2EDKA 3QXAB 4PRPE 1RUPH 2IADA 3BOVA 5E6ID 3REWB 3TTSA 4YDKH 3O45A 3LKNB 1U3HC 1AXIB 4Z7WF 1YC7A 1U93A 1VB9A 1H15B 1KXQE 1PBYA 4BSWB 4R4BB 4KI5C 1QFWL 5J9PB 2AGJL 2AERT 3O3EB 5EUOB 2PWEA 1IMHC 1D5IL 4N68A 3LKOB 4UQAA 1F1GA 2WVTA 4L3CB 4FQQA 1C16A 1GCYA 1O75A 1K72A 1R3IL 4OCXH 4JL1A 3VGBA 5BV7L 3KJ4C 4TVUA 3P30L 2I9LB 1JHKH 3D7PA 2QQNH 4AYFA 1AI1L 2JLLA 1NEPA 3FO1B 2D0HA 2OMWB 5CMAA 3SDXE 2A73A 3OX8B 3U1SH 1EJOH 2IEPA 3L1OH 4Y5VC 4Y5XA 5EOQL 1GJIA 3FT4A 1BYNA 1KJ3L 2ZD0A 3L8QA 3GSUA 4ODUB 43C9B 3C60D 1KB5L 2GYSA 4G8EA 1L9TA 5FEBA 3BSHA 2BRRH 3OAUL 2P5EA 4C83A 3CC5B 1BGXH 4QHNA 5BPPA 1PX8A 3H2PA 1GZQA 4E41D 1QASA 1IEAB 4HVBA 1O6VA 2XZCH 3UJJH 5KW9H 5C7XL 3NRFA 3NAAH 1BZ9A 2C9AA 2ZWZA 3HHMA 1QTPA 3LKQB 3QORD 5CJOL 3T5WA 3K6DA 3QCVL 1XF1A 1KC5H 1MCLA 5BJTA 2GVYA 4MKTA 1FLTX 1IL1B 5B4MD 4JDEB 3NH7H 1KJMB 1U91A 2CBTA 4DK5A 1GRWA 1XVSA 4FQCL 4MXWL 3TC9A 3CFIC 3ARSA 3ZQWA 2APWA 3BT2L 1Q0YL 3LZQA 1IUZA 2WOYA 2XWJA 3VRLE 1NLDL 1E8YA 5JA8B 4RRPM 2AXJA 4R0LB 4JDTH 1JF6A 2RA1A 5FB8B 2H4EA 4XCFH 4KBPA 3RVUD 1FGNL 1GZPA 1FBIH 3CFJB 4L4TB 3REVB 2APFA 3OC5A 4HOZA 2YAMA 1L6PA 4UTAL 1T0NA 3THMH 2UX6A 5F96H 3X13B 1J5CA 1RH8A 2DMCA 2JNZA 2CWRA 4WTWA 5EH1A 5EU5A 4GQ9H 2V0AA 4ZMTA 1T4WA 2WQ8A 4TUJA 4M8UA 1BBJA 1EWHA 3EW3B 4PJXF 4KK5C 3N50A 4DKFH 2CXKA 2BVQA 2JELH 4S1SL 4XVTH 4EOWL 2BDNL 3IMTA 4X6BB 5IMMB 1A3LL 1QHQA 2FO8A 1BAFH 4AK1A 4JN1H 4LIQE 4KROD 2EDYA 4ALAC 4JY4B 5L88L 1WG3A 5DHVB 2F1BA 3JV5A 2AJZA 3WKML 5I6NA 1EO8H 1DVFC 2L3BA 2NR6C 3OJ2C 2QHLA 3Q8EA 2HX8A 2V3DA 5TF1L 1FZOA 1XIWA 3S35L 4EN2A 3SJVA 3MKGA 3S37H 4C8XA 4V1DA 1O9VA 1W9XA 3FU0A 5DZAA 1KFGA 4P23C 1EHNA 3T8VA 3X14A 4CSSA 3QDMA 3QP3A 1L7IH 2LFEA 3LV3B 4MNQD 1I31A 2OSYA 3FB5A 5EC1B 1WEJH 1SVZA 2YKKA 5TDNB 5ICZB 4DEPC 4P49A 2XA8L 4PBVC 1CLYH 3P0GB 1AGFA 2Z35B 1NTDA 2XX0A 4U1NA 1IC7H 2XKNB 3ARBC 4HQQL 4YHNB 1RK0B 4WCYH 2XBDA 3OLEA 2O61A 2YQGA 1W0VA 1G7LB 1XGPB 2VLLA 5B8CC 2KPNA 3W5NA 2W59A 1KJ2A 4WFFE 3T2LA 1CFNB 2VC2L 5LGJB 3ARWA 4PJ8C 4IBSA 3TA3A 5IHUH 3WEBA 1YNTF 1E27B 4UM9D 3BAXA 4OJDH 5DO8A 1K8IB 2Y4SA 4U6XA 2NX5B 4RH4A 5DC2A 2BRQA 2G2RB 3T8XA 5ILTL 2Y06L 5BRQA 2X4PA 2KMWA 5KVFE 1T03H 3LCYA 1YYMH 1G0XA 1FPTL 2VDKB 4JFTA 3QZPA 4WI2A 3ZQ9A 4O5LH 4X7EC 3VXMB 2QVTA 5HHVH 3GMPB 1E5AA 7FABH 4K3GA 2HLAA 4HJGA 2VM4A 3WNPA 1TYRA 3POCA 3CBJB 3P3TA 5IKCB 1XT5A 2A9AA 1SN5A 4FHJA 4O02A 3VQMA 2VN4A 2L7QA 1A6AB 1S78D 2AXFB 3S9DB 3F7YA 2V9RA 3GSXB 1U33A 1YMMB 2G3XA 4AEEA 5I1DA 4L8CA 1JXDA 1G1YA 1QQDA 4Z3GA 3DTDA 3F65A 4YX2H 1ZE3H 4PJFF 5AVSB 3KPPA 5MERB 4FFZL 3WNOA 5E0QA 4M1CD 1RZJH 5L2JB 4AV4A 4QRUB 2D03H 5IMOA 1I9IH 4B50A 1IAKA 4NQVA 1A6UL 4KRLB 3P2TA 3AB0C 3B7YA 4HUMB 3VFRB 2RGSA 3FW6A 2D3JA 1YY9D 4TTGA 5DWPA 3UDWC 1IILE 4TSAH 1BQRA 3AREC 1D5MB 4I2XE 4BE6A 4GAAA 4PLOB 2CMRL 4HWBL 2G75B 3RWCA 3TBYB 3UGXA 3UROR 1J1XL 1TFPA 3WD5H 1YNLL 1VZHA 2ODHA 2VQUA 4ZSOE 3PLYA 5HJBA 1CIDA 2X9XA 2YUZA 3VB8A 1SM3L 1XGRB 3W37A 3UC0L 2F1AA 2YR3A 5KYXB 1RK1A 3KYOA 4PW9A 1TEYA 4QAMB 2NXYB 5GS0D 4PP1D 1XGZA 1NGPH 5FWRA 3EO1B 4PGZA 4B41A 4XCNA 3WTSA 2XV3A 1S7UA 3RGVC 1F4AA 4HKXA 5DEFB 3NSFA 4ADGA 1MFBH 2ROYA 5DD1H 3DXAA 1EPFA 5FGRA 4QO1A 1GYVA 2DW5A 4IMKA 5KS9B 4TUKL 4M6OH 3B2DC 1F8TH 1MIEH 1TEGA 2WQRA 2AV1A 4LDOB 4LSDA 3SGDH 4JZNA 5DZJA 3WSQL 3ZTDC 3PF2A 1BMZA 1XO8A 3OD3A 3CFEB 4PIRF 3RWGB 2WUBL 4X6DB 1KJVB 2LTQB 1AHWC 1DN2A 3CN1A 3DYPA 2TAAA 4OCSH 4MD5A 4UV7H 2IQAA 3BDBA 4ZMYA 1WGVA 4TL4A 3MBEB 3ECWA 3OLIA 1L9OA 2LR4A 3D69A 3FTGA 5E5UB 2GJRA 1MJUL 5J56B 5IF0A 2G5BB 2XFXA 2VZUA 4K5MA 3C6LC 5J13B 3IGKA 5IB4B 4P2RD 2DF3A 2PYED 3QEHB 3QZWB 2NZ1A 3DHPA 1S7TA 2H2SC 3RDTC 3EGDA 3WN6A 3MLPA 1CGUA 1CDJA 1F3JA 5B3JF 1XCQA 5GJSH 1YEDA 5H35B 5F71A 3QRGL 5F97E 3JV4B 2NPLX 1OAUL 4X5WA 5DHMC 1LO0L 2X4RA 5K39B 1DZ0A 2F5BL 3APNA 1DBKH 1AKJA 3G6JE 1PIFA 3DJTA 2HKFH 4HKBA 1Z0MA 4JJ5B 3MV7D 4K7FB 4TSCH 1MIML 3ZDXE 3H9HB 3MLVH 5HDBF 2XNAA 1H19A 1EZSA 2PXYC 3RPIB 1D6EA 2HLFC 2EH7H 2EE2A 4H0IA 1S3RA 4CNIA 4JPVH 4X9YA 5EIIA 1I8MB 2EABA 2CA4A 3PGDA 4OVVA 3K91A 5D93C 3D3VB 3MLWH 5EBMB 5TQ2H 4WW2B 1CICA 5IHBA 1C5DB 3T4AA 3RWDB 1AGBA 1H5BC 1JF1B 5FECA 4MAYB 4G8GA 3L08A 2EAEA 3MRMB 3E3QE 2R0LL 3GXIA 3MA7A 4MB3A 5B1JA 4TPRH 1QVOA 5TDOB 3LSOA 8CGTA 2WXOA 1BZ7A 4K5OA 3BW9B 5KWYC 4UF7C 1LHZA 3U36B 1YJDL 1BA9A 1HK6A 3H3KA 1XTLA 4FG6D 1ZMYA 4LOVA 4YO0B 4JRYD 2VQ1B 4R7DA 5DQJB 4GW1B 1CK0H 4AYGA 1SFDA 2Y7MA 1E4XH 4G70B 5I16B 2AAVA 2KBGA 1P69B 4KNUA 4YHPA 1HEZA 1JHLL 2Q3AA 1R3JB 5ERWB 2PCFA 1KIQB 3QNYB 3VGFA 2NCMA 3PDDA 3QUXB 4L1LA 3BP6B 4XAWH 2HG0A 3PHQB 4JUTA 1SVCP 1FNEA 1OCRB 3WMPA 5E8EB 2WTRA 3QIWD 3TO2A 5EDXA 3EH2A 4CSPA 1N0XL 5D7LD 4KQ3L 3EGXA 4EI5D 2ICWB 4XPHL 2YPLA 4G1MB 4A6YB 4DOHE 5BQ7A 3T3PE 5J12C 5MEOB 3OKDB 3IJHA 4WWPA 4P5MA 1HHKB 5IFHL 1MJ7H 3QQ9C 1SJMA 3DJZA 4TVPE 5E1GA 1QP1A 4L4VD 3ZT7A 4PI2A 4N26A 3JWNG 5T5FH 5AENA 5DJZA 2H32B 2WLIA 4XWGL 5T1LD 4DH2A 1ZRUA 3QEUA 4F7MB 5GZOD 5CJQH 4OJCA 4IEFA 4M4RB 4RCAA 4I18A 2CR0A 3S3SA 4G80A 4AUUA 3WU1A 3GFUA 1KNOA 1T3FA 4FZEH 4ZAKB 1TJGL 4NQEA 1EMTL 3S7GA 5FM4A 2E46A 3BP4B 2R7EA 3D8MA 1HEHC 3QUHA 1L5GB 1LL1A 3T0XA 3SGEI 4IGBD 3FSZA 2WLJA 3NIFE 1KTDB 4Y2OB 4AJYV 2VDPB 3HE6A 5GXBB 1NCCL 2XLLA 3COOA 2DIAA 4OLVH 1T7VA 2B5IB 1MJJA 4Y16C 2EDOA 3GM8A 5CBEB 4WWKD 3KVQA 4OLEA 3D18B 4WHDA 3TTYA 4WW1B 1W0YT 4MDJA 2JMRA 1A6ZA 1XBRA 5DGRA 1ZVSB 4XC1H 5EZLA 1GPOL 4N2EA 2K4WA 4ODTH 3P0YH 4PJDE 4FABH 2BVOA 1MRDL 1CC3A 2AEQH 4PD4K 5F7AA 5L4FA 3FFCA 4OZFH 4C56B 1Q90A 2R69L 1AYRA 1HHGB 1ZIBA 5JW4R 2P5WA 3B1TA 5ICYB 1WZLA 1DCLA 1FSKB 3KGRA 5IOKA 3SPGA 4I5BA 4ODSL 4D2NA 1JD9A 3VXRA 3QUYB 1NWPA 4YVNA 4PY8I 4YHZH 1R3HA 1UVQA 1KB3A 2CCLA 2EADA 4K3EH 2VUOA 2LW3A 4DP7X 3LB6C 2G3MA 3SDDA 3AGVA 4AGQA 1RERA 1I9JL 4L5FE 5DVOA 3HNVL 2VDRH 1CT8A 2JXMB 2QGEA 1BFTA 2O5NA 1RXLA 2APSA 3BN9C 2R4RH 5KN5B 4MNQE 3MLYL 3BH8B 3M88A 1QEXA 2A6DB 5IHZB 4CJ0A 4FXGC 1R75A 2ID5A 3QH3A 2KDGA 2XN9B 1IGYB 1NFIA 3CDGB 1OEZW 3VH8B 1ZGLA 3VXSB 3CK0H 5JOEA 1YEKH 2GIMA 2Z4QB 5AUMB 3DKHA 2V7HA 4TNWF 1JWUA 1RFDL 1UXLA 4RMRA 1XH1A 1SJEA 1CE6B 4LLWA 2I60L 3IJSA 1W8OA 4WKZA 1A9EB 4DFHA 3WY3A 1ZLUK 3QA3B 1YMHA 1N70A 1NPUA 1SYVB 3QE5A 5JO5A 4ZS7H 1I1AD 4P9HH 1IJNA 3NPSC 4FTDA 4ZYKA 1G9NH 3EF4A 4BCYA 3TEXA 4G6AC 1SOQA 35C8L 4UQCA 4OSUH 2EIZA 5I1KH 3LZFL 4JZOA 4LCWD 5D2LB 5DJ6A 3CX2A 4YAQB 2YAQA 1M6OB 1LWRA 3R06B 2MCG1 2EICA 1TTGA 4ZD3H 1JAEA 2UXTA 4Q97A 2BY1A 2DLFL 4LPCA 3QULB 1KEGL 4BA8A 4NC1E 4MJIB 1V8HA 4CAGA 3MOAH 3VWKB 2CO2A 3Q8AA 3WFCH 2ZTBA 4XNMA 1PY0A 1IC5H 1ODUA 1I82A 2BIMA 4WV1B 4U1KA 5JZ7C 3P11H 3STLA 2CCVA 3DMMD 4MZIA 5J5EA 4OGYL 2RALA 4WO4D 3WJMA 4F7KA 1DTUA 2FEDD 3GBML 4O9HH 2X4OA 4PY7A 2EUWA 4XCEA 4HFUH 3RWJB 2O26U 5EF1A 1MFVA 1T83A 2X0WA 2UZYA 4JFZH 3RVWC 2DQFB 2Q7YA 4MWFB 2KLSA 1JNLL 3RY6C 3GNMH 2NY7H 4TSBL 3OKNB 1LWJA 2XWEA 4KI5D 5FYJD 4CC4A 5EEWA 4PGEB 1U30A 3ROLB 3U48A 2DQTH 3KEDA 4BKLB 2F18A 4IOIA 5K9QI 3AT8A 4G5ZH 4JHVA 4PH8A 2GJ6A 3DJSA 4TRPH 2IANA 1WAAE 1A1NB 1UD3A 3KPSA 5HHPB 1JPTL 1RUQL 3UXFA 2H0EA 4ZTPL 1XH2A 4FZ8H 3FT0A 5DZ9A 1AGCA 5MI0C 2SEBA 5IY5B 3Q0HA 4PCSA 1NDGB 5HGDB 1REIA 4JB9H 3DK0A 3PDOB 4ZW6A 2ZUVA 5E9NA 2ZONA 2VM3A 3IMRA 3ATEA 3BD4A 3MV9E 4NDMA 1CU4L 3VRJA 1UJTA 2JKJA 3A6BH 4X50A 3HS0A 2DH2A 4X9FA 4Q9QH 4MQXD 1ZK9A 2NNAA 1QO3A 4W9ZA 2ZCHL 1DDHA 1AOZA 2DWYA 4ZFOB 5JXEA 4BEIA 2BSEA 3ZVVA 3BD5A 4QRSB 2JCWA 4F15B 3ABLB 1P2CA 5EEYA 3GMNB 4HLZH 1IFHH 1SLWA 1XDTT 4OJEH 1A65A 4M3JA 1MRCL 5KYNA 3ZYJA 4J3OD 3LN4A 3QRLA 2BNRB 2ZUYA 3PL6B 2OTWB 1SOSA 1T89C 3ULSA 1YN7A 2FJFB 4OH2A 1TMCB 4MA3B 5CSZA 3VSUA 5C92A 2E7HA 4P2RE 4L4TD 2MJWA 2PYEE 2HG5B 2CO7A 3BO8A 4LFHG 1PU0A 3HC0A 1OSYA 4L8SC 4Y7OC 1F6LL 4G9FD 4KK9C 4QTIL 4DP4X 1LEIB 3CFCH 4LRIC 5DEJA 2VDLH 3LIZL 3KR3H 1AD0A 1Z9SB 3SE9L 1ETA1 3PXHA 3QQ4A 4HPYH 4EMZA 2Z65C 3RL1A 2OR7A 5IIEA 5EEXA 3KPQA 4H4NA 5IVXA 1F2QA 1NCAL 3PE9A 4L9DA 1DQLL 2ARJB 2XPYA 2KQMA 2CBMA 3VXQB 1BLNA 2VIRB 5ACLA 2IWFA 1UM5H 2BMKA 4L18A 2H0PA 5IJKA 1SXCA 4Y9CA 4A1RA 4L9LA 4HAGA 4J4PD 1RPUA 2BHYA 2MCMA 3VD1A 1T5WA 5EZIH 3TYFB 5DFTA 3QBTB 1BIIA 4HG4K 3HVDA 4AT6B 3ZBMA 4NWUL 5IBUG 1QNZH 5F7EL 1IQWL 3JT0A 3B2XA 2BWDA 1PJWA 3MRDB 4JK0D 2BCKA 2P24A 3P4NA 4EEEA 3O8XA 2NZIA 4P23D 3RIFF 2NQ3A 3EJZC 4Y5YC 5C0CA 3VI3B 4NCDA 2PR4L 1AR1C 1MQKH 4GO6B 3V7AE 2X4SA 2OI9C 3MRIA 3MFFB 3IF1A 2CIIB 4JRYE 3HN3A 4H8HA 4AY0A 4F57H 1DQVA 3KVPA 1QRNB 5ABDE 3VG9C 3JTTB 1X4ZA 4EI6A 3ARBD 2OTUA 1KYOJ 5F0PB 2FE0A 3IM1A 4TN9A 2YWZA 2EC9U 2CA3A 1L7TH 4O51B 1KCUL 5CZXC 3WTYA 4PG9B 1SBSH 3PV7A 2WBKA 3O4OB 4GRLA 4C4UA 1SF5A 1PTZA 2IBBA 2EVIA 2NYYC 1XBDA 2EACA 3WBDA 3CFBA 2J1ZA 4QRRA 4OCRH 1N2RB 5D7LE 5F6IC 4HC1L 4IBYA 3CSBA 2BSTB 4JM2A 4XPAH 3VXMD 3NVQA 3NIGB 5AVYB 1E28B 2WZPD 2W81C 4L4VE 2A38A 1FG9C 2FX9L 5EN2B 4CW1B 4I3GA 5J11B 5C6TH 2UY7B 1BV8A 1LGVA 2BZDA 2FQDA 3L4CA 3N55A 1WUNT 1YMMD 3ZE0E 25C8L 3AXHA 1F3RB 4JKLA 3PNWA 2BX5A 4Y4HB 4TQ8A 4YZWA 1S7SB 2VDMB 2GITB 3GIVB 4XC3H 4ZQKA 2ESVB 3U6RB 2FBOJ 3FL7A 4F9PC 4X6CF 3QNXB 2V5TA 4UB0H 4Z7UF 4N0UB 2A5UA 4R7NB 1BP3B 2H26A 1SY6A 1NAKL 2LLNA 2DQHH 3SKMB 1IGIH 1AQKH 2AKRB 5JW5A 2JKRM 1EK3A 2AJVH 1JPFA 1D5BA 3Q2LA 4HJJH 4S1RL 4ALAL 4OFKA 2C1OB 2YBGA 4APQC 4I1NB 1KB5A 3LPOA 2OKMA 4ZNCD 3L9EA 1TZIB 2C7FA 3TNNA 5AB0A 4JO2L 3RX5A 3CH1A 1B4TA 3V55A 4JPKH 3TBWB 1FYTD 1Z5LA 3N1PC 2H6OA 1OWRM 4KK8C 1PZUB 3FONB 2NXYD 5TDPB 1G43A 4U6YA 5FW7A 1GCFA 1XH0A 3HNSH 2P8PA 3K71A 5LAXB 3WUWB 3LN5B 3VCLB 2GBVA 3UPAA 2VR3A 4EZLA 3RGVD 3FRUB 1BQ5A 5DD0L 3KS0J 3GI9H 3BWZA 3PWLB 1TTAA 4OZHB 4Q56A 5TH2B 4LPVA 4NRYA 3HG2A 1TLKA 5I73C 5MEPA 3EYUH 3Q3GA 2VZVA 3C87A 2B0SH 4M6ML 2OV0A 3AQXA 3MJ7B 4P5RA 3TT3L 1RU9H 2NTFA 4O2CA 2J21A 2D2CC 3WO3B 1N7ML 3T08A 3O3BB 1DEEB 4KX8A 4OZFB 1ES0A 5IROC 3V6FA 3X2QB 4DKTA 4JGNA 3W9EA 3TPKA 3U4EA 3QZMA 3P1VA 4UTAA 4C47A 2NUTB 3SGEH 3ECVA 5DHEA 1RUAH 1DUZA 4OKVB 4IOSA 4X9BA 5AW9B 4CKQA 2G9HB 1N10A 5BW7A 1OCCB 2DBLL 2Z8RA 2R1YA 1HS6A 1QFOA 2Q8BH 3C6LD 1AXSB 5HDBB 4ES9A 1AC0A 1U8JA 2VDRB 2K9UA 1WUZA 3GTVA 4N1HB 3BRFA 3AC0A 3HKFA 4MMXA 4UWQB 3F12A 3GBEA 3J07A 4PRDA 2EDRA 2CRIA 1LE5A 1U8LB 1VFAA 5DC4B 3WENA 5I0WA 3KBPA 4AH2A 3LVTA 5IWLA 2D31A 4LCWE 1MCDA 5FOBA 1CF8L 1OARL 5DHYA 1GW0A 2DQJL 2QDWA 1YPZF 2HLFD 3ZE1B 4YZFF 1HNYA 1KACB 4YWGH 2AEIT 3D3VD 3S3CB 1NLBH 4Z7VE 2Z91A 5E00A 5C0RH 5DLML 1EA9C 2C4XA 4Q9CA 4G7VH 4MAYD 4ZBJA 1AMXA 1LP9E 2X4UB 3UG4A 2DM7A 2Z7WA 2H3XC 2XV6B 1SXAA 5IR1A 2V17H 3II2A 5I2IB 3N04A 1RJZB 3RNQA 1KG0A 1E4JA 4E41A 2WCPA 3GKWL 4QYOA 3NJGA 3KJ6H 1FV1B 4MJ6A 1AGEA 1UB5A 3DBXA 3GBNH 1JZ5A 5I1EL 3APFA 3D48R 1RZ8B 3T77A 2JJVA 1UH4A 4Q9BA 3QIBC 5EUOE 5C0NC 1EAPA 5FYJE 4X5XA 1A0QL 1HHHB 3OXSA 4IKKA 2K8MA 1TIUA 4AEIL 1UZ6E 5EC2A 2FX7H 2ZICA 5J6GB 1BIHA 3QUXD 3VO0A 5IEKA 4HUNB 4PTUB 3KAAA 4Y1TA 4D9LL 1F1DA 2NW2B 2BNQA 2Y7OA 5BVJB 2J6EL 4AMKL 2CHNA 2IVFC 2J2ZB 3I9IA 1HHJA 3QUMH 3APDA 4YDJB 1Q9KA 4Q2ZB 4FEIA 4AYEC 5CSBA 1NBCA 4GI8A 2GUOA 4J8RB 4MJHA 3MN8A 1FDLH 1HSAB 3DV4B 3HJ0A 1R5VA 2P42B 3D08A 5IBLD 1YEIH 2FO1A 5JMRA 3AS0A 5E2UH