1EZLA

Crystal structure of the disulphide bond-deficient azurin mutant c3a/c26a: how important is the s-s bond for folding and stability?
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AEASVDIQGNDQMQFNTNAITVDKSAKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Crystal structure of the disulfide bond-deficient azurin mutant C3A/C26A: how important is the S-S bond for folding and stability?
pubmed rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ezlA00
1ZIBA 1CYXA 7PCYA 4PCYA 1GS6X 3OQRA 3UACA 1ETJA 3T9WA 2HX7A 4G70B 1BQ5A 5AKRA 3EH4B 1A65A 4GP5B 1AQ8A 1TEGA 1A4CA 3NJJA 3TBBA 5A7EA 4DP8X 1J5CA 4PAZA 3WNJA 3NSFA 2WSDA 2GBAA 4UANA 1AOZA 2NRDA 1NPNA 2X88A 1HFUA 4KO5A 1L9RA 1L9QA 1ET5A 3N2JA 3TBCA 3PAVA 4YSCA 4DP9X 1ZV2A 4F2FA 5ANHA 4DP1X 1A4BA 1NIDA 2XX1A 3ZDWA 2JKWA 4AI7A 1NTDA 6PAZA 1JZHA 4F7KA 3N55A 3UGEA 3ASNB 1ZPUA 4AKPA 4E9VA 3FQ1A 1OE2A 1BXAA 1E65A 4UF7C 4YL4A 1V55B 3CZUB 4HAKA 2ZXWB 1EHKB 4DP4X 1PCSA 4QKTA 3UAEA 1NIBA 3H4FA 2VSKB 3PPSA 3FU7A 2GB2A 4N4YB 5I6KA 5FC9A 3NSYA 2CBPA 3ASOB 2VSMB 1IKOP 1EZLA 3AY2A 1WA0X 2FWLB 3JTBA 4DPAX 2QT6A 5B7MA 2BP8B 3WKQA 2BWIA 1KGYE 4P5RA 1YLBB 3NSDA 3X1FA 5B1BB 3GXUB 1ET8A 2BZCA 3IN0A 3L45A 5I6MA 2BP0A 3AW5A 1FWXA 2OV0A 2UXGA 1KV7A 4K9JA 4DP7X 1NIFA 3ABKB 3OMIB 3ZBMA 4NB7A 2BW4A 4BDVA 1RKRA 5EHFA 1CURA 2HRGA 1AG6A 1CC3A 2OCCB 4CSPA 2BZ7A 3X1BA 1TU2A 3UADA 2EIMB 1M9WA 1J9RA 3GDCA 2AZAA 3EH3B 1BQKA 3NP4A 4HIPA 3FQ2A 5I6PA 1RZPA 1XB8A 3S8GB 1JOIA 1VLXA 2WO2B 3NJNA 4DPCX 1QLEB 1A4AA 1M56B 1V10A 2HZHA 3GYRA 4G71B 3TA4D 4YSSA 3S8FB 1ASPA 4WTQA 1PLCA 2E86A 4DP2X 2FNWA 3FYEB 5D4IA 4E9RA 1JZGA 2UXTA 4E9YA 2AFNA 2YAOA 2TSBA 4E9SA 2PPAA 6PCYA 3AZUA 1AS6A 1WAEA 2CALA 4YSRA 4YSTA 3PXLA 4W9ZA 3RYMA 1KYAA 1PZCA 1X9RA 2FT7A 4A2DA 2XYBA 3EF4A 4A2EA 3CDZA 2XXFA 1SJMA 2XUWA 1GY1A 2IDQA 4HCFA 2JXMA 4TXVB 1OF0A 2I7OA 2UX7A 2XVBA 4HALA 5I5JA 4A2FA 2IDUA 4KO9A 1KDJA 2PCYA 4NERA 5D4HA 1BXUA 2GI0A 3ABGA 2YAPA 4Q89A 2J56A 2HX9A 2X87A 1CYWA 1ET7A 2FQFA 3EH5B 3U25A 3IN2A 5I5IA 2J55A 4WKXA 3X2QB 4DP0X 1QHQA 1MG2C 2IDFA 3QJTB 3IEAA 2P80A 4HHGA 2PCFA 4N8UA 3DIVA 1ID2A 3DTUB 1PAZA 3QJUB 1AR1B 1FFTB 5B1JA 3EHBB 2RACA 3T6ZA 1AZCA 2Q9OA 4E9XA 4M3HA 1E5ZA 1KBWA 2YQBA 1MZYA 2HLEB 4KNTA 2N0MA 1R1CA 1A8ZA 2FTAA 3BQVA 1NWOA 2IAAC 2LLNA 4YSUA 1V54B 1F56A 1ADWA 1GSKA 1SFDA 2Y69B 2B08A 1JERA 1MDAA 2YXVA 2IWFA 1KBVA 1RZQA 1GS8A 2R7EA 2IWKA 3X1NA 3TASA 1OCZB 1AZUA 2IDTA 4FAAB 1ASQA 1AS8A 1NDTA 5F7BA 3SBRA 5AFAA 1JVOA 2GC4C 4G7SB 3JT2A 3S3DB 3FSVA 2EILB 1BXVA 1OCOB 1SDDA 5PCYA 3NJMA 1SF3A 2FQGA 2FJSA 2J5WA 4YSAA 5B7FA 1HAWA 1OE1A 2JFCA 3SBQA 4BXVA 2XV0A 3SQRA 3FU7B 4YSDA 1B3IA 3UAAA 2XU9A 1AANA 2BWDA 5AZUA 1NIEA 3QQXA 4X4KA 4GXFA 2VW7A 2FT8A 1NZRA 1OCCB 3PLYA 4P5SA 4GY4A 1NICA 1ZIAA 1GS7A 1JZEA 2GIMA 3CG8A 3FU8A 5B1KA 3NJKA 3NP3A 3T6WA 2PP8A 1RCYA 2GSMB 4BXSV 4DPBX 3T6VA 1L9OA 1SNRA 1KDIA 2GHZA 2HRHA 3NJIA 1GYCA 3NSCA 2P80D 3IBOA 2EINB 5F7AA 3QJVB 1BYOA 4E9WA 2BP0B 5B1AB 3CVBA 1UATA 3WKPA 2QPEB 4YSEA 1AACA 4YSQA 5I5MA 1N70A 3ZX1A 5LDUA 3FU9A 2YARA 4BDVB 1WS7A 3C75A 3FSWA 3S3CB 4W1TA 1JZFA 2HXAA 2YAMA 2W8CA 3WIAA 4M4RB 3D12B 4EF3A 4GP4B 1NWPA 3NYKA 3NJGA 8PAZA 1AZNA 2XV2A 5B7EA 2PP9A 4A67A 3FQYA 2VMJA 1AIZA 1E5YA 1W8EA 9PCYA 3WNIA 4ENZA 5I6NA 2XV3A 4DP5X 2CCWA 3ERXA 3AG2B 1BEXA 4E9TA 2YAEA 1KCBA 2VW6A 1J5DA 1E30A 4NAJA 2PP7A 4YSOA 1BYPA 2YXWA 2A3TA 2QDVA 1JXFA 2DYSB 3MBWB 1M57B 1FA4A 2MTAA 1NINA 2H3XC 1PZBA 2IH9A 4MFHA 5TK4A 2TSAA 1TEFA 3CDZB 3X1GA 3ZIYA 1IBYA 4A2GA 4A66A 3ABMB 5D4JA 1AG0A 2PLTA 2PPCA 3BVDB 2AANA 1ZDQA 2WO3B 1NPJA 4ZK8A 2AZUA 2H5UA 5B3SB 1PLBA 2Y1AA 3MX0B 1OE3A 3OD3A 1XB6A 4JHUA 4KO7A 2MRYA 1AS7A 1W6WA 1JXGA 2XLLA 1T5KA 2XXGA 1ILUA 2FQDA 5I28A 1SF5A 2VM4A 2VW4A 1AZBA 1SHWA 4HCGA 5I6OA 1ILSA 1JVLA 2DWTA 3TU6A 4BWTA 1L9TA 2VM3A 1WA1X 1PLAA 7PAZA 4DP6X 2HX8A 3PAUA 1CUOA 3FS9A 3NJFA 4Q8BA 2AVFA 3ABLB 3CVDA 4UAHA 4G72B 2FQEA 2DWSA 3V9CA 2ZOOA 1JXDA 3IE9A 1KCWA 3FSZA 2IWEA 1ZDSA 5I6LA 3CVCA 1BQRA 2J57A 5TK2A 1URIA 3T6XA 1PY0A 1L9PA 4YVNA 4QLWA 1OCRB 4F2EA 1NIAA 3OM3B 3V9EA 2DV6A 2UXFA 4A2HA 1I53A 4G7RB 3HEIB 4JHVA 1OOWA 4G7QB 5IY5B 3QJRB 2CJ3A 2R7EB 2OJ1A 2QDWA 4YSPA 3QJSB 2B3IA 1SHXA 2PPFA 1DYZA 3NT0A 1PF3A 1WA2X 1XMEB 2EIKB 3FYIB 2BHFA 4AX3A 1PZAA 1SDDB 2BP8A 2IDSA 5PAZA 2I85A 4BK5C 4AKQA 3X1EA 2YAHA 4AKOA 1AZRA 4KNUA 4FA7B 2VN3A 3G5WA 4HZ1A 4A68A 1L9SA 1N68A 3KW8A 1HAUA 2I7SA 2XX0A 3NJLA 3WI9A 3PCYA 1J9TA 2FT6A 2H47C 1JZIA 1IUZA 3SBPA 2CAKA 4JKNA 3PAZA 3FT0A 1XB3A 2UX6A 2GC7C 4KO6A 3OMNB 2IH8A 1JZJA 2YAFA 2EIJB 1BAWA 2BW5A 1A3ZA 4YVUA 1DZ0A 4HHWA 4AZUA 2XWZA 4BWUA 2PPDA 1MG3C 3FPXA 3OMAB 4KOCA 1E67A 3WG7B 2PPEA 2ZONA 3AG4B 3NJHA 3S3BB 3T71A 1PMYA 2UXVA 4CSZA 4GP8B 3FSAA 1J9QA 4HCIA 4KOBA 2DY2A 1QNIA 1J9SA 2BO0A 4GYBA 1GW0A 5B1JC 3AG1B 1ASOA 3QPKA 3KW7A 3QJQB 4L0PB 1AAJA 1PNCA 2QPDB 2Q5BA 1IBZA 2DYRB 1MZZA 1IC0A 2CUAA 3UABA 3H4HA 4BWWA 3DKHA 4KNSA 1OV8A 3HB3B 4E9QA 1SFHA 1X9UA 3AG3B 1GR7A 1GY2A 2W88A 1W6LA 1PNDA 2ZWNA 2YAQA 1WS8A 1TKWA 5I26A 5E9NA 3FPYA 4RH4A 3H56A
chains in the Genus database with same CATH superfamily
2EKSA 2ZX9A 4FFYL 1DVFA 5KBKA 1FBIH 1J10A 1LDSA 3MRCB 4JG9A 3TWCL 5HVWA 2QV4A 3AY4C 5MEOA 3US1A 1YCSA 2NQDA 3QUGA 1IM3B 3V0JA 3WL9B 1FAIH 5KSAA 1BQ5A 3P9LB 1J05A 1BZ7B 4WGWB 1HNGA 4PVLA 3IFNH 3UAJA 4A2LA 2R1XB 2ZYSA 4U7KA 3W0WE 1OAZL 4Q9BA 4YR6B 1IFHL 1RZKL 3FQUA 3RWJA 1GXEA 5KW9L 1VFUA 2CK2A 5E5RB 4MDRA 4PBDA 3WLBB 2X88A 4LOUC 4JRXA 4WJ5A 4DCQB 2VB5A 3CUPA 3IMWA 5KUMA 1XH3B 3QXUA 1KTRL 2JI3A 1WFMA 3CBKB 3N2JA 1YG9A 4P2CG 3EBGA 3SY6A 2P7TA 4XP5H 1Z1WA 4QJ5B 3N85L 5MI0B 4X50A 2X1PA 1A5FL 4I18B 4A63A 5FFLA 5CJBA 3W37A 4RX4A 5BJTB 3SYCA 3P4NA 1D2PA 2WCPA 5CMAA 2UZYA 3RAJL 4W9GC 3U4EA 3CZFB 4MZ2A 2YWZA 4WCYH 1MCCA 4GKZB 1TZHA 5HI4C 2P45B 4Z18A 5FC9A 3LN9A 3VE0A 4PREB 4GQPH 4PLJC 4KJWC 3D39E 3O3DA 2ZCHL 1GCFA 4JKPH 3Q0HA 3AY2A 5DHYA 1ORQB 1GKOA 4W4OC 1DVSA 1ZCRA 2VDQL 4LKCA 1EVTC 5I1DA 4OGYL 3KYOB 3MBXL 1W8NA 3BC9A 1K5NB 3B6SB 43C9A 2DLIA 3L81A 2WQSA 5BUGA 1MCWW 1F02I 3QDGE 5JXEC 3DX1A 5B1BB 3IKKA 3QUMH 1EERB 1K8IB 2WZAA 3IN0A 4HKJA 4HKXA 2WXHA 2F54D 4HIEB 3RPKA 4JRYA 3SGKA 1QO3B 3NPZB 3IGKA 2V3EA 1YAIA 2WLIA 4NJ9H 1SHMA 4JPIB 1U93A 1WFTA 5HHOD 1XAKA 3B9VA 4YHNB 4PWJA 1JGEA 4U1NB 5KVGE 4AVJA 2DLFL 4RQQA 3LKNB 2IANE 4FQXB 4GKSB 5DEGA 2LLLA 1MW1A 3OHXB 1RZPA 3DPBB 4YAQA 5I24A 2XN9A 4W93A 1IFHH 1RZKH 2ODHA 2W60B 3GYRA 5SX4I 5K9QG 4O9HL 5C0CE 5KW9H 1ZGLA 4YSSA 4M8VA 1NAMA 3GLEA 4GXVL 5IW3A 3ZRCC 5C70A 5I6XC 2C3HA 4N26A 4O58L 3WFHB 4PJ8C 2AFNA 4H0IA 4OCLC 1XEDA 1ZE3H 1NC2A 3R1GL 5CILL 5GZOA 2RR3A 3DARA 1E2WA 2WUBL 3NH7H 3Q2WA 3FB8B 3ZQWA 1PS3A 4UV4L 1XSJA 4IRSB 2R27A 3CZNA 3RYMA 1KYAA 4H1LG 5GGQL 5E5MB 2VOTA 5TQ2L 2YA1A 2WYIA 3O2DA 3Q5TA 1NC4D 4I1RA 2HG0A 2W94A 2Y07H 1OF0A 1P1ZA 2J44A 4KUCD 1IGML 1MCQA 3MUZ1 4XMWA 3BAYA 4HUMB 4HX1A 4P2QA 1KXTB 3ABGA 3DUUB 3WKNA 2VLLB 1LQSR 2VDQB 4LARL 5DO2C 3QJHA 4B41A 1JF5A 3VD7A 3TF7C 4E68A 2IBZX 3T5WA 3MREB 5CZXD 1HEJC 4R8WL 4MQXC 1T21A 4YBQC 1INDL 2EKSB 2VDQH 4BH8A 3SDXB 5E56A 3IDIB 4OGYH 3I2CL 3MBXH 3ZUCA 3TJEL 1QBLL 3JWOC 5TE6H 5MEOB 3IEAA 4CKQA 1N2RA 1B6UA 4HUXB 5KSAB 4PQXA 1S7VA 5E2VH 2J2ZB 3P3UA 4JFDD 1CQYA 4M3HA 1X3DA 5HGBA 1KBWA 3QWRD 4OCSL 4P9HL 4R7LA 2QADC 2A9MH 3FQUB 2G5BB 4Y5YC 5DURD 2X89A 5I9QC 4P2OC 4PJIA 5F70A 2EXWD 1MF2H 2DQGL 4J1UA 3S6CA 2HFFB 4F57H 4DO5A 4WJ5B 4JRXB 4XPHL 3WLWC 5HVHB 2DLFH 3CUPB 4XR8C 1KJVA 5K39A 4XMZA 3BPCA 5JYLA 4NOFA 4PUBL 3I9GH 1CGVA 2P7TB 3TJHC 2W0KA 3F62A 4O9HH 2IWKA 3SD2A 4R2GB 3D2TA 3VFPA 1OSEA 4KKBC 1ASQA 4NQVA 3RFZA 4UT6L 5KVFL 2HJKA 1U8CB 3D34A 4AWJC 3JT2A 4QDGA 1XV8A 3MXWL 1OCOB 3P4NB 3CU7A 3K2KA 3R1GH 2J5WA 4OSUH 2UZYB 5E8NA 3TN0C 2WUBH 1KPRA 4XP9L 2AGJH 3TCXA 1QSFE 3U4EB 4G9FE 3DDFA 4ODXA 2FSEA 1BQHG 3ARED 3O2DL 1TZHB 4FD0A 4OLUL 1BM3L 3D2UA 2VM9A 2HSIA 3VE0B 3EO1A 1AANA 4HWUA 4GIPD 3CSTA 2IFFH 5EU4A 5GGQH 5TQ2H 3O3DB 2E74C 5DHYB 1FNSL 2ED6A 4LKCB 5I1DB 2GIMA 1T66D 2PYED 1A6ZA 1NCIA 2W9LA 5FO8B 1DL7H 3GJFA 3HE6C 4X6FA 1Z5YD 3ZDZE 4YEFA 2APTA 4HKJB 2EINB 5F7AA 4ATWA 4HKXB 4PD4J 1SXCA 2DJ4A 1EFXD 2UVEA 4HKZA 5B1AB 3UZEC 3MYJB 5C2BL 2NNFA 3RURA 1FF5A 2OR9H 3CPLB 4EN3D 2YARA 3GI8H 1U93B 3FBQA 5AVQB 5LXGL 3L7FA 3ZDXB 4F7TA 1MCBA 1JGEB 1FL5B 3ULAB 3BWZA 3BKMH 4RQQB 4RGOL 3HC2A 2BS8A 3RDTC 3ILPA 4OCSH 2IV9A 4P9HH 3NGBB 5E0QA 3K46A 4TSBL 5CS7A 1UT1A 1BF5A 4PLKC 5FW6A 2ZG2A 4KVCL 1U8IB 3ABZA 1MH5A 1ONQB 2WNXA 4HD9A 4I9WD 2CIIA 2FATL 2AMGA 3BT2H 2A5UA 2ENSA 4AIZB 2B9BA 1WBYA 1G7QA 1NAMH 1NC2B 3ATDA 2DI9A 4YFLF 1A1OA 3MGTA 4UDTB 5C0NC 4KU1A 1AD0A 2YXWA 2UWEF 2DYSB 4GFTB 1KYUA 4K9EC 4IMKC 4NO5B 4QRUA 4GAYA 1GTNA 4NC1C 3AXLA 3GSNL 3MXWH 4GIAA 4KROC 1AO7D 3EYUH 5T8IA 2LTQB 1TTCA 1P1ZB 4FNPA 4XP9H 1SEBB 4EI0A 4GQ9H 1G7LA 4HLZH 4YE0A 5GRYA 1UZ6E 5E6ZA 4HX1B 3PNRB 3RE0A 5IB4B 4LOUD 5IQ9A 2Y7QA 3GLZA 4PHZA 2GQHA 1LMIA 4RAVA 3QJHB 2JK5A 1KY6A 4QRPA 3GS4A 2XXGA 3QNFA 4ORGA 4BK8A 1T21B 1JV2A 3FRPG 4BH8B 2Y1ZA 3BGAA 4PJ6A 3ZHFA 3MZGB 2CRYA 1PPIA 4FZ8L 5KSVA 5CZVH 1N2RB 3GLAA 3QNZB 4XMPL 4JN2A 4QR7A 4CGUB 4L9LC 4HOXA 4XODA 1U3HA 5B39A 2RAMA 4RLDA 4DGIL 1UXSB 3JVFC 4UAHA 5D7LA 5SV4A 2YQ2A 4IGBC 5MENE 1FGVH 5EOCJ 3RRQA 2O72A 4WFGD 1QLEL 5HI4D 1LEGA 3L9EA 2PCPA 1RK1A 4L4TE 5LXGH 4ALAL 3WNOA 1UC6A 3J8F7 5D6DA 4PLJD 4KJWD 5EULV 4PB0H 4UMGA 4PJEF 1YYML 3VTMA 4DERA 1KJVB 1IIIA 1Z0MA 3N9GL 5K39B 3BPCB 5A2BA 4TSBH 2XG5A 3MGOA 1L0YA 2XSKA 5JXED 4QOKA 5G4MA 2JB5L 3GSXA 4FCAA 5KG9A 3VFPB 3TVMC 2DICA 4NQVB 5L88L 2FATH 3Q6GL 2HJKB 3QXVA 3UBFA 4YQXL 1N67A 2Q86A 2X38A 1X5IA 4FG4A 5KSBE 1PIGA 1YPZA 3B9AA 1KPRB 4M7ZB 1BDYA 3HG0A 1TNNA 1PBYA 3QZNA 4XBEH 4W4NA 2FSEB 3K5RA 3LIUA 3PWPE 1E8ZA 3QEHA 3VFUA 3GSNB 3VMPA 3D06A 4OCRH 3D2UB 2O5XH 1BOYA 3BGFB 1QBBA 4PRPE 3EO1B 2ZNWA 3QZPA 4ZBJA 3AQDA 5EU4B 1YN6B 5BRZA 2XX0A 1J9TA 4XI5C 3II3A 4P57B 3KDMA 3TBWA 1TQCB 4E5XA 4MNGE 3IRPX 4X83A 5FOBA 4PJ8D 4X6FB 3EBIA 2IQAB 3DXAE 3LSOA 2OL3A 2BNUA 2FO1A 1DZ0A 2ZOTA 1J8HD 3NZ8A 2XWZA 4HKZB 4W9DC 3ZKXC 3A4AA 2UUDK 1ZANL 3GJFH 1PX4A 2FLMA 1HXMA 4K3EH 3GRBA 3MRBB 1FJ1A 1DQLH 1RJLB 3OJVC 5T1MB 4FZ8H 4CVZA 5DTFA 3L7FB 3BIKA 4XMPH 4NLHA 4ZUTB 1QLRA 5EBGA 1J0KA 4F9PC 3Q6FA 1TQVA 2Z0BA 4FQQA 4KXBA 3GBNL 3HG2A 3AG1B 3JTTA 1AKPA 1ZHLA 4GAJL 4YZWA 4P46A 2E56A 1U95B 3BH4A 3L2LA 3UPCA 1GZPA 2XBDA 2ZUQB 5DO2D 1MH5B 4UQDA 1RQ5A 2BIQA 2CIIB 2WLJA 3DI3B 4MQXD 4YBQD 4G82A 3DTXB 1WBYB 1G7QB 3FB5A 3MGTB 2EUVA 3GIZL 2ESVA 4B9PA 3L95A 4IJ3C 4FG2A 1A0QL 3PHQA 2JB5H 2Q20A 4KH2A 4OV5A 2MSPA 3A4FA 3LEVH 4QRUB 4H20H 4RH4A 3RUGE 5L88H 4I0PA 3MC0A 2QADD 3AXLB 2A4EA 4YQXH 5IVNA 1OT1A 3NFSL 1BZ9B 4P2OD 5FGBC 4DO4A 2VQTA 2J3SA 3FFOA 4XE5B 1A66A 2NY5L 1B4TA 1UWGH 4KKAC 3WLWD 3MXVH 4PG2A 4PS3A 5FYJD 4RAVB 3O0LA 4N68A 1HEHC 1SN0A 2JK5B 3B7UX 4NN5B 5CP7A 3KYKL 2CJUL 3GHPA 2ICWI 3FN3A 4N2NA 1M3IA 4ORGB 3TJHD 1JV2B 2EDKA 1HKLL 4HU2A 3ULUL 1NFDB 4J3OG 2OL3L 2B5IC 4KKBD 3Q13A 5KSVB 2YLKA 4ZMZA 4MLIA 3LZQA 4FI7A 2FO4A 2PO6C 3L1GA 5D7LB 1SDAB 4KRMB 3TN0D 1XCXA 5KVMC 1ZANH 1Y6NR 4GRLA 3BDYL 1AZZC 2XX1A 3SO3B 4D0CB 1U6AL 2MCPL 1NTDA 1O9VA 1JZHA 2DQEL 2PCPB 1IVLA 4XVSL 1TQSA 3N55A 2EDOA 2F68X 3DX8A 5DVMA 1V55B 2GTWB 4NO2A 2ZXWB 4XGZA 3VYPA 5BOJA 2Q76A 2VSKB 5SV3A 2UZIH 1HINL 1E5UI 3OX8B 5AVZB 3SO5A 2QJDA 5DJDA 2R15A 2XG5B 1IFRA 1EEZB 3HE6D 3BIBX 4FLQA 4PR5A 4ZMQA 4QOKB 3GSXB 5KG9B 2HRLA 4Y2DC 3I6SA 3QQ4A 3CIAA 3VI3E 4ZX6A 1LXMA 4AGLA 2V0AA 5E1AA 2Q86B 1QX1A 4J6IA 1X5GA 2YJLA 1KJ2A 1YPZB 1KXVC 4MWFA 3T08A 1DANT 3TIEA 3HZVA 1A0QH 3QEHB 4XNYH 3CZGA 1JK8A 4MB4A 1BIIA 3IMTA 3N43F 1P2CA 2H0FA 3ZY7A 3FQTA 3RDTD 2O1AA 1NEZG 1WRFA 5KS9E 1NMBL 3H55A 4Y4FA 4BKSC 4NB7A 3KDMB 3MRDA 1VF5C 3HPLA 4N22A 2OYMA 2JKTM 3FN0L 4PLKD 4XO5A 4E5XB 2QKIC 3WTWA 3RY4A 4UQEA 5FOBB 4F37K 5DD6A 3X14A 3FQ2A 3JQOB 5DMJB 3NZHL 1CXKA 1DQVA 1E5AA 1ZJBA 3LSOB 4Y1AD 2OL3B 1M56B 3OL2A 1V10A 2BNUB 4ODWA 1N5YH 4B7LA 4WZ9A 3NZ8B 5DJYB 5C0ND 5G5DB 1ASPA 1HXMB 1DO5A 3HR6A 2CCVA 1FJ1B 2EKJA 2OL3H 4KRPB 4AM0A 1ZEAH 4L4VA 3BYYA 1NPUA 1E27A 4LGPB 4XNMB 4O2FB 2ZKWA 1QPKA 4R90H 1QLRB 2Z8WC 3Q6FB 3NAAH 4KROD 4J4PA 5LN8A 4MCNA 3U0TA 3DVNA 2H6OA 4W6WB 1WAEA 2C7UA 5HYJA 1ZHLB 2F1AA 1QI5A 3BDYH 3QA3A 5CEZL 4P46B 1U6AH 2MCPH 2DQEH 5FGCE 3JZYA 3TZVA 5FW8A 5ERWA 4UBDC 4XVSH 1GZPB 1U58A 2E3VA 5F9AC 4A2EA 2VLJD 2XXFA 1Y6MR 2PXYA 2YEVB 4FFWC 5EN3A 2R2EA 5A2CA 1I8UA 3SGDH 2HWZH 3FB5B 2DQHL 1HINH 1IO4C 3AUVA 2ESVB 1GAFL 1R6VA 4UB0H 4K94C 1MFCH 2H2PC 3L95B 2VXUH 4Z3IA 1BLIA 1NJ9A 3PHQB 1CYWA 4OV5B 3CVHA 1ET7A 3F64A 2FH8A 1JPTL 3QEGH 2AJVH 4HJJH 4F3FA 2JH2A 1Z9LA 4IGBD 2OP4H 4NQSA 4P5TC 1T83A 1ZV9A 1AC0A 3F58L 4LMQE 5EDXA 3OR7B 1R5IA 2JIXD 4GAAA 5B1JA 1M2OA 3ELAT 5AZ2H 2CBTA 4GKLA 4KKQA 3ZE0B 3L3GA 4L2YA 5CP7B 4HUUA 2D3VA 2KERA 1NWOA 2N3JA 1NOFA 1FQ9C 1PZUB 3NACH 4EBQL 3FN0H 2D3LA 2E6JA 1E6OL 1PFCA 3TVMD 1P9MC 3VM7A 2K4WA 5HGHA 1UJ3A 4LBEA 3NZHH 4AVHA 4D7PA 2FO4B 1Q0XH 1NDMB 4LZKA 1ZLUK 1ZLVK 2WCSA 4JKLA 1WHPA 2M83A 3BAWA 2DQFB 4F8QA 1OCZB 3B2UC 4XVJL 2CIKB 2EIZA 4PB9H 4BFKA 2WOBA 4G7SB 1EFQA 4YDLB 3OXRA 2QVFB 4FERA 1IM9A 3C09C 3K4AA 1FNAA 3T3PB 2KT6A 1EZVY 3DX3A 1FYTA 3GO1H 4NO2B 3QG6A 4YSAA 2ADIB 4XI5D 4F58L 4OD1H 1XD0A 2DM2A 3UP1A 2C3XA 3KJ4C 1S7XA 3I84A 3ZRSA 43CAA 5DJDB 2A9BA 1YEJL 3BN9C 1SXAA 3TYGL 2F18A 5LUMA 4QXWA 5ILTL 4AEHL 5KAQF 3V6OC 3FU8A 3T09A 2XBZA 3FQWB 4WFHD 1ZVHA 5E1AB 1ZHKA 3HRZA 3LYRA 3T6VA 4MWFB 3VXRA 3CXHJ 3SDCA 2HRHA 2GHZA 1HHKA 3HZVB 1XGUA 1ZA6A 5FYKD 3B8YA 5ICYB 4M9OA 1KJ2H 1UXWB 3NQKA 1HHGA 2NUPB 1T5WA 3FQTB 2DD8H 1UATA 3O8XA 4F8PA 3WKPA 4KX7A 2XT1B 2YD3A 4GMTH 2NLJB 1FZOA 2WXPA 4DW2H 2ZXQA 1ZWIB 1WG3A 2XZCL 2VXSL 1K4DA 2WD0A 3HPLB 4LVHC 4OFKA 4MHHG 4KUZH 2CMRH 3QCUL 3TO4A 1TETL 3QZWG 4U1MA 2YAMA 1F3RB 1E9OB 5DJXA 3NJGA 4V1DE 4AGQA 4ODWB 3O9WA 1MJUH 3GPSA 3SOBH 4PJGA 4QJ4B 2A74A 2MQGA 3FQYA 1E5YA 1SY6A 3KPOA 2CO3A 4M5YH 4NI6A 2LGNA 4EBQH 1HZKA 3BDBA 4AM0B 4L4VB 1E6OH 5AVRB 3AG2B 3QISA 5E99L 2OA9A 3FZUC 1OL0A 1QOKA 1KCLA 2GVYA 3HOGA 5HJDA 4A38A 1OAYH 4U6HB 3DVNB 4Y5XC 3U0TB 5E6IC 4G1MA 2C7UB 1X6LA 3JXAA 4MNQE 3LAFA 3K2MC 4XVJH 4BA0A 3QA3B 4M4PA 1WV7T 1NINA 4NO0A 3UTPD 4N1HB 4KKAD 1U58B 3CQPA 5EIIG 2NY1B 3FT3A 1PD0A 2PXYB 3NCYS 4GXUN 4U4IA 1S7TB 4X4ME 4F58H 3ZDZF 2IPTH 2HRPH 2WO3B 4BGDA 4L8BA 2AZUA 1V3MA 1HJBC 1GRWA 3RBGA 3OD3A 4ZW8A 4X98A 2WQAA 2XG4B 4G7YH 2EVIA 3C8DA 2B2XL 1YEJH 1T0MA 1XGYL 3TYGH 2FIKA 4P4RA 3QSKB 5ILTH 1SHSA 2FQDA 2PO6D 5D7JA 4AEHH 4F3FB 4HS8L 4G8IA 2VW4A 4NQSB 5I6OA 3B2MA 3BWSA 1YYLL 4N0YH 5HGDB 5I66A 3CVHH 3P3SA 2Y7MA 3IDGA 3BUIA 1VSCA 4N2CA 1FVEA 5ALCL 3W11C 2FQEA 4KVNL 1JXDA 4KDTC 1L4IA 1VFBA 2YMXL 4EDXA 4X42A 3KXFD 1KIUA 4HUUB 5GZNA 4UDUA 5FWQA 4X98B 2AF2A 4HG4J 1AQDA 5IUCA 1ESOA 5HHPB 4F9LA 1P5UA 2IF7A 4XB3A 3QCUH 4HMDA 1TETH 4MJ6A 4PW9A 4Y2DD 1HE8A 4ZQKA 5HGHB 4P07A 4LBEB 1MW0A 1SY6L 5DFAA 3A47A 3VXNA 5JOEA 4KQ4H 4OI7A 4NHCH 2DQTL 3OMZA 1NCGA 4N1CA 5AVSB 1WTLA 4TSAL 5GPRA 1JPGA 1DYZA 1TTFA 2EIZB 1PF3A 4CA4A 5DUBA 3C87A 3IDMA 3OXRB 2YPVL 2XY1A 1IM9B 2EEXA 5E99H 2BP8A 2EVHA 1FYTB 3QG6B 2YO3A 3HVDA 1WSST 3B1UA 1GGCL 1UD4A 2EIEA 1NBYA 1S7XB 2OMNA 3QUXA 4UNTA 43CAB 1F6FB 2G3MA 3PRZA 5DHEA 5E2UL 3IE4A 2R0ZL 2WYTA 4IYKA 3ROOB 5LNEA 1E5CA 5C0BB 1HILB 3EH1A 1U30A 3MLZL 5AW1B 5AEAA 3N42B 1QQDA 1BJ1H 2QADB 4ADIA 4GIOA 1BVNP 2J8OA 3HI1B 3HRZB 4AQZA 2YSSA 3VXRB 2RQ8A 4G80A 3SDCB 3L54A 4NO3A 5IBTL 3PWJB 1PG7W 1XGUB 1XGYH 1ZA6B 4YVUA 3TM6A 2PWDA 3G3LA 2ERJC 4JO1L 1HHGB 1T5WB 4I4WA 4TUOB 3ZE2B 3O8XB 5J11B 1RMFH 1YYLH 1FZOB 1MHHA 4M56A 3BAXA 3EFDL 1ECZA 4UBDD 3HN8A 4POUB 2BNRA 4KOBA 2PTUA 1Z66A 4NGHH 4WHCA 5IV2B 4U1MB 2ZCLL 1OB1A 3HR5B 1TQTA 4FFWD 5ALCH 5J8OA 2JJSC 1H8SA 4XOCA 5DJXB 3UIYA 2YMXH 3UPAA 4PJGB 2A74B 2D2OA 3TS8A 3DVFA 1NDGA 2YN3A 2H2PD 5KSBF 3KPOB 1IC0A 5GGUA 1QFWI 1O6SA 1R3JA 3H4HA 3O0RL 4OZHE 1RPKA 1XTMA 1XZWA 3QI9A 4X5PA 3UBXB 3A24A 4PRAA 1F6AA 1I8LC 1BREA 1SY6H 3NN8B 5INCB 1CTMA 1EZUA 5DS8A 4P5TD 1GR7A 3JTSA 3B9KA 5K59E 1DVZA 3IU4L 5AB1A 1MCDA 3T2NH 4RRPM 2VXTH 2DQTH 1UB6B 2Y06L 4ANKA 1CXLA 1C12A 4TSAH 2W65B 2VWEC 4NO0B 1RK0A 3H9SB 1KEGL 4F92B 4TVPE 3U4BL 1AGBA 3AU1A 5HI3C 5EF3A 3RWGA 4XPGH 4LCYA 1F8TL 32C2A 2HX7A 4J3OF 2XN2A 2X6UA 2I9TA 1AQ8A 1TEGA 4L8BB 4PPTA 4WW1A 3FCSB 1J5CA 1ES0A 2VZ3A 1BZ8A 4N24A 3QAZC 2HG5A 4OFVA 2HVKA 1J0ZA 3O4OB 2J73A 1U0QA 4QLRA 2Y5TA 3VWKC 2R0ZH 1T0MB 2NTSP 3OKNA 3P4MA 2FIKB 3L3KA 3NSFA 4P4RB 5LAPA 4L8DA 3D07A 5D7JB 3MLZH 5E9DA 1NGYB 5JHLA 4G8GA 4GKNB 3B2UD 4KI1A 2PWFA 1WBZA 4IOIA 4OCXL 3IDGB 3PAVA 4AQ1A 1TQWA 4XBGB 4CU6A 1XGPA 3TXAA 4JO1H 4F2FA 4EZJA 4ZSOE 3VD0A 4Z7UB 5I0ZA 4BZ1A 1UA6L 1UOKA 3OZ9L 1VFBB 3MODL 2JKWA 4JG5A 1KIUB 1FG2A 2ADJA 1QPPA 4UDUB 2P5ED 1TFPA 3ASNB 2FE0A 2HUEA 3QUZC 1ZPUA 3OZLA 1AQDB 1HHHA 3EFDH 4PMEA 1JK9B 1E65A 3BN9D 1AIFA 1P5UB 2NXZC 4MJ6B 2I9LA 4HGWA 5E1HB 3PHOA 3H4FA 3RUGF 2Y36L 3BPNC 4BFBD 3HS0C 3EG9A 4FADA 1JBJA 4RFNB 3MV8B 4WW2B 5HPOA 1KYOJ 1JS4A 2A6DA 4X8GA 4XN4A 2VSMB 2VDPH 2AXHA 1IC7L 5DJ8A 3FT4A 1JWMA 2NSQA 3O0RH 4WI5A 5DUBB 2BSTA 3LQAL 1KTBA 5AWNL 4QXVA 5AVYB 5FXCH 5FGRA 4DPAX 5HYQB 1R3HB 2BP8B 2EDXA 3DECA 1KGYE 2OMXB 4IKNA 5C97A 5CBEA 1TSHA 3VRIA 3B56A 4NC2B 5FCUL 3QUXB 4IKLA 1R24B 5MERA 2QR0A 2OV0A 3AQZA 1TYJA 2XN1A 3WNMA 5ESAA 1KEGH 3WEAA 1RI8A 1WIPA 4WHDA 4LKXA 4BQ8A 2FLRT 3U4BH 3EW3B 3ZBMA 4L5FE 2APFA 2HRGA 2XNAA 1KCRL 1QQDB 1IC5L 4WDIA 1ACYL 4BHUA 5CCGE 1HI6A 5IJBC 3RZCA 1S7RA 4ICXA 1DBJL 4Y4HB 1R0AH 2DDQL 2YSSB 1F1DA 3OKLA 4G80B 2YWYA 4NO3B 3FZUD 4W9HC 1F4HA 5DWUL 4YHYC 2VLME 4HSAC 4DZ8B 5I0VA 3U1PA 4YC2C 3VG9B 1YC8A 4L3AA 2WINA 5E6ID 3F04A 3GNMH 2ADFH 1RZFH 3ELQA 1HYRC 3K4DA 4HEPG 1N7ML 4BZ1L 2G75A 4OCXH 5JIPA 3GINA 4FQJH 5EBMA 2BNRB 3CE1A 4ZMOA 1ZSDA 4PRHE 4OCYL 3AZUA 2JWYA 4IIQC 1M7IA 3LEXA 3A6BH 1QKZH 4UIMB 4J27A 3OZ9H 5IW6A 3MODH 3N44F 2FWOA 3VI3F 1S7QA 2ORBH 3BEVA 3HG3A 1TCRA 4HLEA 4JFUA 1D7DA 4ZNEA 1KACB 3EO0A 2BOLA 5GGUB 1E40A 1O6SB 1R3JB 1TVHA 4LPVA 1MAKA 4MCYA 1ETZA 1X5JA 4DKDC 3QI9B 3CDFA 4KO9A 1F6AB 4JFHE 2CJSA 5DEZA 3MX0A 3JTSB 2FHBA 3KG5A 4PRNA 5ISZA 3WFCL 5IQOA 5KS9F 1PKOA 3REWA 1EWHA 1TTAA 2A6JA 3VXUA 1C12B 4K7FB 1IC7H 3A22A 1OWWA 3OR6A 3U25A 3WSQH 4OFQA 3VSTA 1DJIA 2J55A 3W11D 4DP0X 3FH8A 4P2RA 5AWNH 1AGBB 3AU1B 4X7TA 5C08E 3WENA 1U92A 5E0FA 2FBRA 2NW2A 3RWGB 4LCYB 1EDQA 2JQZA 4JANA 3F5WB 4UAOB 2VZVA 2WXJA 1E4HA 3QJUB 1P4LB 3RA7L 3KJ6H 4DOHB 2I9TB 1X5KA 1GYWA 2P5WD 3AGVA 1RP8A 4JQIL 2BVTA 4PWGA 1ES0B 2G5UA 5L4IA 2HG5B 4FYRA 2HVKB 3QDJA 4DGUA 2YFOA 2Y5TB 3P4MB 3HG1E 1MFUA 2CO1A 3OAYK 4L8DB 4Z1PA 5E9DB 3BOVA 1MI5E 4G8GB 1IC5H 2K7QA 1ACYH 1WBZB 1CT8B 1JWSA 1ADWA 2Y69B 5EWIL 4JJOA 1DBJH 4NZRH 4IOIB 1PZDA 2DDQH 5CN3A 2MHAB 4FQPA 5JHLH 3BQUC 4W9LC 1RZQA 4U3CA 1XGPB 1CDHA 1U91A 3I3EA 1AGDA 2WSPA 4X4XA 5CP3A 3V4PA 1FG2B 3CFIC 3BD5A 2ADJB 2XY2A 4NQUA 5CKAA 2JSFA 1HHHB 1N7MH 4H0LC 4BZ1H 4DK6A 1AIFB 1MJ7L 4QRBA 4HGWB 5ANME 3PHOB 2JFCA 1JXJA 2XV0A 5FO9B 2XN0A 3D52A 4J7RA 4CC4A 3EG9B 5H94A 3QQNA 2AV1B 2EYSA 2A6DB 1EJFA 1OHZA 4QRRD 5DJ8B 4Q6IA 3P2DA 3FT4B 1NZRA 1P7BA 5C09E 1EBPA 3UO1H 2BSTB 1ZIAA 1PD1A 4ADGA 1U42A 1MNUH 2CDFB 2P28B 5I8EA 1VCBC 1T4KA 4OLEA 2OBGA 3E1ZA 5CBEB 1EQWA 3WFCH 5KJ7E 4RIRA 3QJVB 1BYOA 1HWGB 4E9WA 4YK4B 1DE4A 3LX9A 2X6VA 3QFJE 1FI8C 2QR0B 4IRZA 4V11A 2F19H 5FW7A 5MERB 4OBSA 3PHSA 3CVBA 5ESAB 1CBJA 5T3XD 1J0YA 4LKXB 5A6IA 2DBJA 3ALPA 4KV5E 4ZO6A 3TP4A 2XNAB 5EO9B 3RA7H 2NZIA 4WDIB 1DUYA 3DOSA 3RZCB 1S7RB 1NAKH 4M4RB 3LZOA 2D31B 3NCWA 4ZW5A 2VLKA 3HCVA 2XOTA 5LKNA 1EAJA 1RZJC 3L5XH 3T0AA 3PWNA 3U30C 1PVHA 5HBBA 2A7BA 1IBHA 5EO1A 2EVGA 3DMMB 4HF5L 2WINB 2VL5A 4MKTA 5B21A 3B9DA 4Z9KB 1KN4L 4PJ9B 2G75B 2AK1H 3GZOA 1UCTA 3R06A 3HLAA 5HI3D 3T0WA 5T1KA 3BZ4A 1FE8L 3NQIA 1M7IB 3LEXB 4FKHA 5D7IF 3D08A 3BFQG 4R9HA 4JFEE 5EORL 2YD1A 3LRHA 2FWOB 1ODUA 1LO3H 2VZ1A 3BEVB 3ILQC 4LGSB 1TCRB 5F6IC 1VKXA 2YRPA 3ZIYA 5AAWC 4A66A 3CZLA 3VWKD 2FNBA 2YD0A 1QUPA 5DK2A 1TVHB 4MCYB 4TUJA 1ETZB 4N1EA 2VR8A 1PY9A 3MX0B 5ISZB 4PRNB 2XDHA 1XB6A 1OY3B 2QEJA 3IDXL 2Y7LA 4D9QE 1Q9LA 3REWB 5L0QB 35C8H 2A6JB 5BQDA 3VXME 3VXUB 5BUAA 3OR6B 2F6AA 4XN8A 3KPRE 2D0FA 4HCGA 3SPCA 2JKJA 1U8HA 2XPZA 4S1RH 4BWTA 4X7TB 1U92B 3VFWA 2NW2B 2ZCKL 4JANB 3MRFA 1DDHA 4MDIB 5MP6H 3QUZD 4GJTB 4ELME 5HYIA 4HFUL 2K78A 3MJ9A 2Z91A 1U8NA 4JZJC 2NXZD 3V4UL 3V55A 5JXAH 2CXKA 2ITCA 1BSIA 2DWSA 3L9RB 3J2PA 3QDJB 3NEXA 2X1XR 3MRNA 2FEDC 4PRBA 5IROA 2PR4L 3S48A 3ZZLA 5C07E 5D96C 4BK4A 2R59A 3LZFH 3WJLA 4LAQL 1JWSB 5TPWH 2VR6A 1NBQA 5I1GH 1JHTA 3UGXA 3ATAA 5EU6D 2Z4TA 4BKLA 4YSPA 4X4XB 4HF5H 5BUPA 3FB7A 3O81A 5JPMA 1IZJA 4W6XB 4J3UA 2G5RA 4OH2A 1R4XA 1KN4H 2OYPA 3GJEA 4PCTA 3PL6A 4W81A 3OZKA 1JNNL 1L0XA 4N2FA 1P69B 5CP3H 3V4PH 2AEIT 4RDBA 2WN3A 1D9KA 1YMHA 2ZUUA 1WFOA 1FE8H 3R7RA 3LNHA 5DJ2A 4Z7VA 2YKKA 1AGEB 4A68A 2EYSB 3KGSA 3GRWA 3CV5A 1H5BA 2VE6A 4I89A 4JR9L 2AKRA 3FQNA 4ZUUA 3K1DA 3RQ3A 3T04D 2H47C 3BUBA 4LLWA 1K6QH 4C8XA 4HU8A 1QTYT 3MLRL 2GIYA 1SXNA 3LXBA 1T4KB 2QPUA 4JVUA 5T3ZE 2A9CA 3EOTH 3MCG1 4ELDA 4ZTOL 3IDXH 1BF8A 2BW5A 3W0WD 1F58L 4EMZA 2DMKA 4NM8L 4RIRB 5J3HC 4ZX4A 1DE4B 2VKXA 2XZQH 3ECVA 2PPDA 4O4YL 4BWUA 4Z7QB 3E2HB 5G55A 1GGUA 1E67A 1HVXA 1NCHA 3GMLA 2OW6A 1KT2B 3MJ9L 4J3SA 3V0WL 3WO4C 3WN6A 1SN5A 4IRZH 4ELKB 2A0LC 3SIKA 1KIQA 3MRQB 1J9QA 4HFUH 1DUYB 5KYXA 1I1RA 4Y2LA 3V4UH 4C47A 1GW0A 3QYCA 1CJYA 4ZFOA 2A1WH 3HCVB 4A7UA 2CNZA 3MLVL 2UYLA 4OB5L 3D4CA 2DYRB 4RMUA 2QGEA 2PR4H 4NUJA 3CLEL 5GS0H 4WU5A 1CICB 3S5LA 1CG9A 1E9QA 3IXAA 4HK3N 5FX3A 1S9VA 3SCMA 3ECQA 3W2DL 3ZL4H 3R06B 5GSRB 1GY2A 5KBNC 1IX2A 3HLAB 1MCIA 4Q14A 1JTPA 3BZ4B 4U05A 5T1KB 1PNDA 4YFLI 3CHXA 1OAXL 1IGYA 5E9NA 4PMFA 1H6FA 2ATAA 3K72B 4ZMPA 3D39D 1OGTA 1Y0LA 3QDMA 4FNQA 3OAZH 4P2AA 1Q9KB 4MRBA 4KZEH 1JNNH 1F11B 5DK2B 4UCFA 1IBGH 4W9EC 1OD9A 3EH4B 5AW9B 3QDGD 3C60C 1AVAA 4C4KO 3ECWA 1NUDA 2VDOL 3WD5H 4PAZA 1MIML 2GEQA 5EEVA 3OAUL 4QWWC 3DBXA 1I9IH 3FK3A 3MLYH 3C2AH 1WYJA 4FC3E 3BQUD 2XFXA 4JR9H 5E2TL 3KCWA 3RY5A 4NQXB 1BVOA 1U8HB 2A73A 2FUQA 2JKNA 2GJ6D 3MRFB 5BV7L 4XOEA 5A6MA 2IAND 4S1QL 5KJ4A 2Z91B 1KYDA 1F58H 2NX5B 1U8NB 1NGWA 2CUHA 4S0SD 2E7HA 2B1HL 1M1XA 3ZJAA 5C0CD 4I1PA 4OZHF 3MJ9H 3V0WH 4AI7A 3MRNB 4WF7A 2EC9U 2H1XA 4TUKL 5HY9A 4PRBB 5FYLH 2P1YA 5SX4H 1S9WA 1ZT7A 4BSWA 5KVDE 5K59F 5I71C 3J7HA 3DRQA 4U1LA 2M2DA 4J3OC 3UAEA 2LU5A 2F9BT 4DGYH 5GGVL 1WDAA 3IXTB 1QWUA 4M48L 3ZTNL 2GB2A 4N4YB 2QTVA 1WZ1L 3TA3A 3MLVH 3DO4A 2ZWSA 2FX7L 2C9UA 3VX1A 4OB5H 3TIDA 3F7VA 3AU0A 3CLEH 2QSTA 1OP3H 1PG7X 5JPMB 2J1WA 5FOJA 1E4KA 3TEXA 4MQ7A 4PD4K 3MVSA 2V9TA 2ZOWA 2F5AH 3NCXA 4JX0A 4NZDA 1NKOA 3HZMB 4R7NB 1D9KB 1YMHB 2BZCA 4X5LA 3VRJA 4BFIA 1MKFA 5GIRA 3WDJA 2FR4A 5DJ2B 3HTLX 1B4LA 5D9SB 4Z7VB 2BC4A 4ZYKA 3MLUH 1XCQA 1J0HA 4MAZA 4U6VH 3GEWB 1H5BB 4ZUUB 3VJ6A 4BV1A 2AKRB 3FQNB 2VDOB 2G0KA 2Q7YA 1T04B 3CFQA 3LXUX 3QWQB 4BCXA 4XB7A 4LLWB 1EJOL 3GRWH 1K85A 1KLUB 3GGWA 1KTDB 2VDOH 5DMGC 2CG9X 3S8GB 1MIMH 4YZFE 3C5ZA 2I60L 2Z1PA 4DPCX 4XCEA 1A4AA 2FB4L 2XIBA 3ES6A 2FZ3B 3K7UA 4X5RA 5EZIH 2H1PL 3D0VA 4JPQA 1H3XA 4QYAA 5BV7B 2E86A 3GMLB 5AZEL 1C16A 4E9RA 1VENA 3ILQD 5BV7H 1IQWL 1KIQB 2P9RA 3MRPB 2NYKA 4AV4A 2CLZA 4S1QH 2XWJB 3CJJA 4FA6A 3VXQA 1X5YA 4L3EA 5BVJA 1IE5A 2VISA 1PZCA 4JDTL 1W80A 2FT7A 3CN3A 2UYLB 4TUKH 2G4GA 4IRJA 4HT1H 4NUJB 2VQ4A 1SJMA 4BSJA 2APVA 5I1CL 3DGDA 1CG9B 1KZYA 4FNRA 1E9QB 3IXAB 3DC0A 5FFOA 1S9VB 3SCMB 3LNFA 3SDXE 2EH7L 3RHWF 3K0YA 4AM0Q 1QSFD 5GQBA 4G9FD 4M48H 4H8PA 3VGBA 1MPAH 2HCZX 2F54A 4QNPE 2I07B 2PW2B 1MCOL 1UZGA 4MB3A 2ITFA 3ZT7A 1IGYB 4NCC2 4O2CB 4RZKA 3QR1A 1Y0LB 3EDEA 1U8QB 3QDMB 3GPEA 1ANUA 3GM0A 5CD3B 3HMWH 4CADA 4DQOH 5GGSA 4N8UA 2FEDD 1AOHA 4JRXE 4GS7B 5CWSB 4OIFA 4YHKL 1EIBA 1CR9L 2GTZB 1RUMH 3DBXB 4AEEA 3RILA 1I82A 1TZOA 4LB8A 2XFXB 4L37A 2CSPA 5IVXA 3AT9A 3BHBB 4WWPA 1MSPA 1OTSC 3SD5A 4TRPH 2DQIH 4JZOB 3STZA 2IV8A 1XVSA 3DK2A 1XCWA 5HHVL 1A9BB 2AERT 3FO2A 4ZMLA 1VFAA 4OFDA 1YN7A 1H19A 4B9IA 1C08B 5FUOL 5AZEH 3N06B 5D93C 1TVBA 1QTPA 2IH3A 5AVUB 2MPVA 5HY9B 2HFEA 3QRGH 1R5VB 1V5JA 3NABL 1BECA 4BSWB 5JO5A 4NBZB 5JW4M 4U1LB 3DRQB 4WSGA 1KB9K 2ENYA 1F86A 5JIIA 2JV6A 1TT6A 1GHFH 1PIFA 5J9PB 1UD3A 4AYBA 2J5LB 1QACA 4G3YL 4HUWA 2QV2A 2YR3A 5AZUA 3F7VB 4ENEC 2FD6H 2XTJB 2EEDA 5LN4A 1FCCA 2F58L 2DEYX 3QE5A 2VW7A 5E8PA 5I1CH 5J3HD 3Q05A 2ZUYA 3BKYH 4MQ7B 3PLYA 1J5OH 4NFCA 3SDAC 5I6MA 5B38A 2N4IA 5DRXA 5FA4A 5FDWA 3VWKB 5GJSL 5B8CC 1QTSA 2J12B 1JF6A 3VRJB 4BFIB 3ZDXE 3QWRA 5ITFA 3UG3A 2A0LD 4KX8A 1XF4B 4WNJA 2FR4B 3A3YB 1GCYA 3UTSA 2NY0B 5E2WL 3Q2NA 3RZWA 4ZYKB 4LSPL 5JMRA 3E7JA 1XCQB 4HUCA 2O93L 2ICWA 2Z6FA 4UOZA 3VJ6B 1RU9H 3VXOB 1EV2E 2LFEA 2VO5A 2VXVL 2Q7YB 3DSFL 5K9QI 3ESNA 2ADYA 1O75A 1CIUA 4JFFA 3ARFC 5TGBB 2WUCL 2DKMA 4OD3L 4PJ5D 1S7UA 4TQHA 2B4CC 4JY4A 2NUTA 4XMKL 3D12B 4EF3A 4GP4B 3C5ZB 1CR9H 5MEND 1MFVA 1TJIL 4QRAA 4XCEB 8CGTA 2CK0H 2VQ1A 1YEGH 1JRHI 2PP9A 3ES6B 3NFPA 2ZOKA 4X9IA 5KVFE 3D0VB 4YHOL 4P0DA 4ZQTA 4L4TD 4GINA 4X0KB 9PCYA 3SZKC 3WIHL 1C16B 1RPQA 2EH8H 2XV3A 2GJRA 2LAAA 4NQQA 5EC2A 4IBUA 2EDRA 5T5FL 2KQNA 3EOBA 1T6WA 4YBLB 3U48A 2CLZB 3QIUA 3VXQB 4WQOA 4FQ2L 3MNZB 4L3EB 1YJDL 3WO3B 3C60D 4MQTB 1L5GA 5FUOH 1XGRA 1WT5C 1PZBA 2BSRA 5F3HA 2XHNA 4IRJB 4QWWD 2DOCA 2LABA 3WXVL 1IT9L 2J6EA 4GBXC 2PPCA 2JLLA 4JCMA 2BIIA 3G6JA 4PIBA 1W2KT 4PS7A 3T4AC 4OZFG 3PWPD 3CLFH 2ATPA 1OSYA 4DZBA 5D5MA 4KMTL 1W6WA 5DD5L 4KV5F 4E42B 1FIGH 1MHEA 2C9QA 4W9IC 4XC1L 2DF3A 2F58H 5E1QA 1RL1A 3PQYA 3UCRA 1H3GA 3O45A 1EHLH 3MV9A 5KANG 2NDGA 2DWTA 3KWVA 2OMVB 3WFEL 2WIMA 4H7VA 3NOIA 2H2SC 4AE0A 4CADB 3CXFA 3WN5A 5GGSB 3IJHA 4JDVB 1PZ5B 5GJSH 5BNXD 1HNYA 4Y7OC 5BS0A 1KG0A 1I1FA 5EZOL 3WELA 4J3OD 3M46A 3BAJA 4XCNA 4QYOA 3ZYOA 4LCWA 4PJAA 5DDHA 4JNXA 5IGXH 5GS2H 1THCA 4L37B 3L4CA 5IVXB 3V0DA 2WB1A 4IIQB 4MCZA 2WUCH 3SKJH 4OD3H 3T6XA 4TPRL 5F96L 4TOYH 3D9AL 3V9EA 1QBML 3KBHE 4G7RB 1KGCD 1OM3L 3STZB 3WIIH 1TJIH 2D7QA 4APQC 3FO2B 4JFTA 4FTVB 1VFAB 5CBAA 3O4LB 1OD7A 2Y3AA 1YN7B 4UZGA 4YHOH 2D7PA 3U7WL 5I30L 3B7TA 1AO7A 1TVBB 2AEPL 3JWNH 3NT0A 1WC7B 4UQ9A 2FEEL 3U4KA 3HE7A 2HFEB 3AS2A 3H0TB 4AX3A 4XO3A 1SYVA 5DUMH 5ALBH 3RTQA 1BBDL 2APWA 4FQ2H 4DFIA 5T1DH 4LP5A 3DETC 4DGVH 1E4XI 4GUQA 5JIHA 4G5ZL 5M94B 2L7UA 5IVOA 4PHXA 2Z0UA 1E5BA 4AGNA 4LDLB 2J6EL 2E6QA 4WWNA 5DMGD 4OI9A 3JYCA 3G5XA 3NJLA 5DHXB 1VPOL 3NTCL 2DRUA 3ARSA 5E8PB 4X80L 3IETA 3WXVH 4P5KA 4ELMF 1G9NH 1IT9H 3BI9X 2VCOA 2CAKA 3FFDA 3S4SA 5B38B 2LU4A 2WIIA 1AQKL 1JMZA 2YRLA 3G6AA 5FA4B 5FDWB 4RWYL 3MU3A 3OTTA 3FT2B 2AJ3A 4YDJA 1MFEH 4LPTA 1YNTA 3KNBA 3VXTA 5DD5H 1HHIA 1O6VA 3UTSB 5F9JA 4S0HA 1E0OB 2R2BA 3T2OA 3Q5OA 2X7LA 3WFEH 4DESA 4AXWA 3MO1A 2HKAA 1LE9A 2C8NA 1BQUA 4LASH 4DHLA 3UTQB 1TPXB 4HS6A 4W4OA 1ETA1 4XXCC 2DTMH 4K7PL 1Q9WA 1OTTC 5EZOH 3RWIA 1OOAA 4JY4B 1DJWA 2JE8A 1IU1A 2NUTB 2WY3B 2GJ6B 4JREC 4DIXA 3WJJC 2YUXA 4U6XA 5J5EA 2VQ1B 5DC4B 3GXTA 1XSIA 4NZTL 1HU8A 2HA1A 5J89A 3CFKB 2APSA 3REVA 2R4SL 3D3VB 2WP3T 4LF3A 4TPRH 2AEQL 5F96H 5KYWA 5IQLA 4A55A 5EC2B 3SDDA 3O41A 4H26B 4EI5C 3EOBB 2QTEA 2L7JA 4GSDH 3O6ML 3QIUB 5GXBB 1TO5A 1AYRA 4XPFL 1A22B 2DLGA 6FABH 2WKGA 3U7WH 1L5GB 1XGRB 2J1ZA 5HXMA 1ZIBA 3MBEC 2QLYA 3BUYA 1NGZA 1P4IL 4E0RA 1XD1A 3AVEA 5D71H 4XNAA 2G3ZA 4I3RL 5IJDC 1JI2A 1OSPL 4G1EA 3GSOB 1ZMYA 1FLTX 1BBDH 1A65A 5F1OB 2BIHA 1NFDE 1TKWB 3LEYH 3ETSA 5IHBA 3CX5J 4M1DH 4AYDC 4JFQB 3UEQA 2ATPB 3ISRA 5DTFB 1OTSD 4ZW3A 4DZBB 2J4WL 2J6EH 4J8QA 5D5MB 4CN1A 3SKMA 2R2HB 4DKFH 3ATFA 1I75A 2WSDA 2FX9H 4LCUA 4N0RA 6TAAA 4X80H 5D7LE 2DM4A 4AUYA 3PQYB 2GJZA 3O45B 2UUDH 3CH8A 1SBBA 1AI1L 3WN5B 2Y7SA 4M7LL 4KFZC 3WEMA 3LDBB 1IARB 2YLHA 1KG0B 1HIML 1H0DA 2D7MA 3QRLA 4WWKA 2VH5L 1ITCA 1K4CA 5CJ8A 3UBHA 4JPKL 2Y5QA 2FCBA 4ISVA 5CINL 4QYOB 2WPGA 4LCWB 2ZKYA 5DDHB 3WGUB 3VQ1C 1P53A 2UZXA 3BW9A 2WWKT 3O3AA 1F5WA 3FQ1A 1OE2A 3VFOA 2XYCA 3EO9L 4QOKE 1I85C 3BEWA 2AJXL 4ENED 3EGXA 1G9MC 3UP6A 3SDAD 4QTIL 2JI2A 2B20A 1WCBA 4XMVA 4WENB 3HUJA 3Q06A 1YPZE 3WUZA 3E38A 3UC2A 4NZTH 3ZZQA 4QHUA 4QAMB 1A7QH 4FI6A 4QHKJ 1B4RA 2AEQH 3BESR 3MN8A 3QQDB 5ETUA 4P2OA 1SYVB 3WKQA 4ZX5A 1FDLH 4HJ1A 3RTQB 5J7CC 1MOEA 1HCVA 1A7NL 3C12A 1VFOA 3ARFD 3P11L 1OW0C 4A7VA 1XR9A 1E2VA 5ADPL 3TBTA 3ULUE 4LPCA 4Q9QL 2D7TL 2VZUA 3ABKB 1P4IH 2B1AL 3FU3A 1UWFA 2L04A 2WYZA 3L1OL 1GOGA 5IFAH 4PGCA 3SJVA 3QORA 3S4SB 3L3DA 1DBBH 2WIIB 4B9JA 2BNQA 3G6AB 2ZUTA 3H6JA 3H3KA 1ML0A 2AJ3B 3P0GB 1XXDC 1XB8A 4OJAA 3TN0A 3NK4A 5IZ7A 1YNTB 4M5SA 3NJNA 5CF3A 5I1IL 2HZHA 4AEIH 1HHIB 3K80A 4JAMB 1VDGA 2IGFH 1DDTA 3AXHA 5CZRA 4QAWA 4X9GA 5C0RL 4O5LL 5F9JB 4HJEA 4NRZB 4MAUL 2R2BB 4B0MM 3CFCL 2H6PA 4KY1L 4AXWB 2R1WA 4M7LH 2AEOA 3LIZA 4BK5A 4H2CA 4PJBA 5D1XA 4WAFA 3V4VA 3WAKA 4I3SL 2IC2A 2ITEA 1EZSA 2VH5H 3RWIB 3V0IA 4R0LC 2B3RA 2XZAL 1WFNA 4JPKH 3ZMRA 5FV2A 4GBXD 5CINH 5LO7A 1QRNA 1I9JL 2ESVE 5CNHA 5KTEL 2EO1A 3GKWH 4CVXA 1N9PA 2A6IA 2WBXA 3REVB 1X5AA 4LF3B 2X4OA 5KYWB 3MCLL 3SDDB 3WY3A 3BE1L 5JIMA 3BZDA 1F4YH 1GMIA 2Z34A 4QTIH 2YAPA 4UT7L 2H2SD 2KDYA 3SSGA 2WLNA 1UUSA 1OGSA 5SWSB 3RDTA 4K5NA 1MHPL 5DD1H 2FQFA 1UWXK 4MD0A 3ZE0E 2TRYA 1M7XA 2E4FA 4HJSA 4HW6A 3LKRB 1DZBA 3BUYB 5IWLC 3JVGA 4E0RB 2P80A 4G1EB 4YZFF 4D0DB 5IMOB 4JGUA 4Z23A 2CLVA 2BSED 1NCAL 2PR9A 3T6ZA 5I1HL 2Q9OA 3P11H 1A7NH 4I77H 4ODVL 4FG6C 1XCTA 5FHBL 1KNOB 3WO4B 2NT0A 2PN5A 2IQ9L 4NQEA 1N0LB 4YH6A 5F3FA 4Q9QH 1J11A 1CFSA 1TZAA 2D7TH 3G5VA 4K5PA 4LCUB 3P3YA 4APQD 3L1OH 4IMKA 3CN1A 1JZ2A 3OB0K 2GJZB 1T89C 3BKCH 4GMSL 1QLFA 3HI5H 3VMNA 5IEKA 2VRQA 4AUUA 3OXSB 1HT6A 1GSKA 4U7SA 1FO0L 2IWFA 1K3IA 1H0DB 3T3PE 4LL9A 5CEZE 2AABH 5EIQA 4PJ5B 5J12C 1RJZA 1MQ8A 4C56D 4CNIA 2D3NA 4RGNB 4V1DD 1F3JB 4PJCA 4MAUH 3CFCH 2ZAHA 4Z3EA 3SBRA 3DETD 1I7UA 3BD3A 2FAUA 3BW9B 1JVOA 3O3AB 3SDXF 3VWJA 4MBOA 4Y19B 3NJMA 4HIXL 3BEWB 3DV4A 3TT1L 3EGXB 3LS5L 4QNPF 5H37G 4U7MA 1HZLA 2LLGA 5FF6A 4ZFGH 5IEHA 3BSGA 3LKSA 3NESA 3T0EB 1WCBB 4MNQD 4QHLA 2MH4A 1VGEH 4HEME 3QXAA 1S5IL 3QQ9C 1WZMA 3KR3L 3U36A 3B8SA 3FUMA 5KTEH 5J1TC 3Q2CA 1E7UA 1JTTA 2FECL 4Y9CA 2ZUSA 1VESA 1QSEA 1JGVL 4LCCC 5CR8A 3TNMA 5ETUB 3ZN6A 2JIXA 5D7KE 1CL7I 3DIFB 3P0VH 1L9OA 1NANI 1H8OA 1YEFL 4JKKA 2IG2L 2BY1A 2EE0A 3TL5A 3MLWL 1O7VA 1MHPH 5HDQH 1E4WL 1OTTD 4WGVB 5DJAB 5L8KB 4U2YA 1I1YA 4H0GA 4PCKA 3TBTB 2CM6A 4XOAA 4ZT1A 2QPEB 2VDLL 3TTYA 5I5MA 4LSTL 4BFJA 5TF1H 3TVMA 3T0BA 1Z9PA 3SJVB 3QORB 1NMAL 4HQQL 5DUJA 4HC1A 3WE1A 5CN2A 4OJFL 3C5JA 4GEIA 2BNQB 1LP9A 1Q94A 4L4VE 5FHBH 1UH3A 3WIAA 2VDNL 4KKCC 2IQ9H 1SOSA 4Z7IA 5CJOL 1X9LA 2EDJA 3LKPA 4EI5D 1VFMA 2JCCB 2X6CA 3BZ5A 1TMCB 5L8LB 1FO0B 4YO0A 4HJUA 3MLXL 5K69A 2H6PB 4Y4KD 4ECNA 1E8XA 1BEXA 1RZIA 2R1WB 3CGTA 3MBED 5D1XB 4ODUA 1DUZA 3LRMA 4AMXA 2ODIA 4M7KL 1CFTA 1QFWL 3LIZH 4TLKA 2EQDA 2CO6A 4KXDA 3CQFA 1IAMA 3V4VH 4AENB 1QRNB 4M9PA 1CDGA 1UCBL 3D25B 4B96A 4U1JA 3ARZA 1CE1L 1T7XA 3MGAA 4HD5A 3MFFA 3FL7A 3FMGH 4FNUA 3ZDXF 2X4OB 1JGUH 5C2UB 3H9HA 1IBDA 3HC4L 3LPFA 1PLBA 2RFXA 4BUQA 3DK0A 4W70A 1N0XL 4Z7WA 4QO1A 1QATA 1S5IH 3KR3H 3QIBC 3GB7A 3N41B 1ZVSA 5FUCE 3RNKA 4QHNA 1MVYA 3OKOA 1CLYL 1T5XA 4N2KA 4QT5B 3UX9B 2VM3A 4M6MH 4IHBA 2IO5A 9CGTA 5TE7L 5LNDA 4GT0A 2VABA 3QWNA 3PAUA 2IG2H 2B59A 2VDLB 3CK0H 3NJFA 2QKSA 2GJPA 1C1EL 3MLWH 3VFGL 1XCTB 3CAFA 2PMZA 1E4WH 1OAKL 2AJUH 2YK1H 1QSVA 4NQEB 1R5WB 1CFSB 2VDLH 4LLMA 3G5VB 2ICEC 3SBWC 5I1LA 3BUDA 3O6FA 3MOQA 5IB3B 2VDNB 1BQRA 4NQDA 1NMAH 3WYRA 2RA1A 4M61B 4GOSA 1IBFA 2I5YH 2WGNB 4GW1A 4OJFH 4RVBA 3RWCA 4GG6A 1SXZA 4R26L 5LGJA 2OJZL 2VDNH 2YPKB 3ZTJH 1HQRA 5ID1A 1QFHA 2A38A 3QZLA 4HIJB 4WO4C 5CJOH 1FYTE 2CXGA 2N7SA 5IY5B 1RJZB 3KPQB 2EYRA 3HJEA 2IAMA 5D1QB 4PJCB 4YDNA 2IMMA 3KH4A 3HAEA 3MLXH 4P4KC 1I7UB 3RPBA 5LGKA 4JG0L 1WA2X 3VWJB 4L1SA 3FYIB 3W39B 2VZOA 5DMYA 5CIPA 2W07A 1HL8A 4LOFA 1TITA 3VB9A 5C0BE 3DV4B 4A6YA 3O2VL 2XA3A 3QH3B 2PTVA 3VU2A 2FUTA 1KYFA 1QFWH 5FF6B 1FH5L 1G0DA 3VH8A 1M7DA 1SXSA 1MFBL 4JO3H 3G04A 4LSSL 4UIKH 3VXRE 2ZOUA 3U36B 1H3TA 1SLXA 1OANA 5JDSA 3OHMB 4TVPD 4X6BA 5EBLA 4LIQH 5BQ7A 5H35A 1E9PB 1IGCH 1QSEB 4JKNA 3SBPA 4LMQI 3DO7A 5LB1A 2ARWA 4GRMA 1XXFC 3U4AA 3UG4A 3ZE2E 4U0QB 4F7EB 4DUWA 5I8KL 1WO2A 3GK8L 5JR1H 5J13C 3NBNA 1N0XH 3CSBA 4ZDHB 3TOPA 1O5DT 3DGGA 4MHHI 3KXFA 5CO1A 2OULB 4Y5VC 3IYLW 2JKXA 3MNWA 4YNYB 3MLTB 3D85A 1PGRB 2AP2A 4UTBA 5TE7H 4FXGB 2KS0A 4KBPA 1A7BA 1M4KA 4PJGE 5D70L 1T6VN 1MFAH 4I85A 3TFBA 4NKDA 5DXWA 3C5JB 2C9VA 3B3IB 1C1EH 1Q94B 3KLKA 5LVEA 3QUYC 1OAKH 3KYNA 2Y6TE 5CU9A 4DGWC 4IU3A 4HC1H 2PKDA 1TIUA 3O6LL 4HHAB 2Z35A 1JI1A 3KLAB 2QPDB 1BA9A 5AYUL 2R69A 3U82B 4YO0B 2FWUA 4MMXB 1UZ8B 3R0MA 1F2XK 4UTAH 3AAZB 5LG1A 1YNKL 3HNVL 3DKHA 3H9SE 1WE5A 1BZDA 4ODUB 1DUZB 3AG3B 3MACL 4RCAA 3GS7A 2W88A 3GSUA 1CFTB 1U41A 5FDYA 3T4YA 4Y2OA 3VD3A 2OAAA 4JPWH 1X44A 4ZTPL 3UTTB 3H8NA 4I5BA 3IF1A 3ZHDA 4YDIL 4LHUB 1ZS8B 4FG6D 4U1JB 4H0HB 1V7NL 3HLKA 2SODB 4ZOCA 2HJLA 2MKWA 3OQRA 3MFFB 4B0MB 4RBPK 5D6CB 3CSFA 1LK3L 1GZQA 4NZJA 1SLUA 3M7OA 4TS6A 1DJHA 3H9HB 1L7IL 2RFXB 3BYTA 3M8OL 4L8SB 2C9AA 5D1ZI 3CC5B 2F08A 2WAHA 4LSSH 5F1SA 3K2UL 1A7PL 2QFPA 1ZLSL 1D5IL 1QNZL 1G87A 3GB7B 3RNKB 1RP9A 4QHNB 3ULVL 3OKOB 3ARFB 5FYKH 4LK4A 4DN3L 1T5XB 1PY4A 4Z7UE 1HH9A 1NUNB 1HFUA 4GQRA 2P26A 2FYYA 5IB1B 3VD2A 2WC7A 1BFSA 2Z3FA 2QVMA 2VDKL 2VABB 4KTDH 1ACZA 4G9DA 4HH8A 2BWQA 2NNRA 2B59B 1JFHA 4AQEA 2YFNA 1AHWA 4UTBL 2FWSA 3VGAC 3H42L 4KY2A 2VLMD 4LLMB 2V33A 2J25A 3COOA 3GD1C 4Y88A 2LE9A 1WITA 1CGXA 4IDJL 5I1LB 2E9BA 3BLPX 3MV8E 3O6FB 2KBGA 3C9NA 5F7KC 5D70H 3QQ9D 4NQDB 2WQUA 2PETA 3UBXG 4MAYA 4MJIA 4GW1B 4XO4A 3FUHA 4P5TA 1PCSA 4DP4X 1XT5A 5GGVY 5LGJB 4TNWK 3T6QC 4ERSL 4PRHD 2HFGL 5C7ZA 5ID1B 5L2KA 2DWEA 2EDTA 3O6LH 2BS71 3QIWC 1DJSA 2CDGA 3VMOA 2EYRB 1ZA3A 2IAMB 3ASOB 3HAEB 1LK2A 3KS0H 2X4SA 1KB5A 1NFDF 2O6EA 1YNKH 3P9MA 5C0DA 3S37L 5CIPB 2W07B 2K45A 5B7MA 3WUWA 4NQCA 4P5RA 3HAEH 4MA7H 2X2UA 3II1A 4JFHD 4XWGL 4QRTA 1P9MA 3FTVA 1E42A 1EAQA 1VEOA 3MOBH 5CIPH 3EDFA 4R4BA 4ZTPH 3RWHB 3VH8B 1M7DB 2BP0A 4A6YH 3ARVA 2XWBA 1UTDA 3KBFA 4KKCD 4KX9A 1V7NH 3ZKQD 4EDWL 5AAPA 4X6BB 5EBLB 5H35B 3FH7A 5C08D 1LK3H 3DO7B 3I85A 5D7SL 3WS6A 4GRMB 1TU2A 1T7ZA 4KKNA 4AMWA 1L7IH 1OP9A 1NCTA 4NPJA 3M8OH 2F1BA 1YEWA 5F0JB 1WUZA 2WM0A 3K2UH 4V33A 1CDCA 3VD4A 2BNRE 3WTVA 2VDKB 4G71B 4U1GC 4MA8H 3ULVH 1D5MA 3MNWB 4XC3H 3HG1D 3QXWA 3D85B 5DHMC 3QPXL 5I73B 1NCDL 4CW1B 3EYVA 2B39A 4G6KL 3RVUC 4B95C 1MI5D 3H6AA 3TBYA 4E9SA 1KPUA 6PCYA 2AQ1A 4JFPA 3D18B 3HNTL 5GRXG 3S96B 4APQB 3L2NA 1YPZF 2MPAL 2WZPA 2O30A 2OW7A 4R4FH 5GS1B 4NN7B 2C5DC 5MI0C 3C6SA 5EPMA 4EZKA 3PGDB 1HESA 3GHEH 2PW1A 3S3JA 1BQSA 2O6FA 4G8AC 4I18C 5D2LB 4Z0BH 4IDJH 2IBGA 4C56B 4NNXA 4WV1A 2LOEA 4P99A 3QIBD 3I6GA 3GTNA 1A3RL 4X5XA 1UD6A 1G7JA 5C6TH 2R69H 4NERA 4ERSH 2LW3A 1WEJH 1FORL 3ULUF 1OTUC 1KB5L 2DH2A 1TTRA 2X87A 4CSSA 4I5BB 4DOHE 2I69A 2BSSB 5J6HA 1CFMA 1I7TA 4PJFA 2OSWA 4H8QA 1T0PB 1E90A 3BVTA 2HJLB 4JRWA 5C09D 3K71A 1J1XL 1FV1A 4LLVA 4Z3GA 4YL9A 3EGSB 4XWGH 5E9DE 1NLBL 1JDAA 1C8PA 3LMJL 4G8GE 3VGGA 2VN7A 3UYPA 4HBQA 5AW4B 4GW5A 4NWTL 4FI8A 2V8MA 3RHWK 2ZYIA 2NXYB 4EDWH 3QULB 5E6IA 1MHCB 2PCFB 3NCJL 1A6AA 4WO4D 1ODAA 1BJ1J 2LLNA 4XVUC 4F5CE 4YSUA 1HH9B 4P2YA 3K81A 5D7SH 2FYYB 3PJSA 1B2WH 4JM2A 4L8CA 2FSDA 1RZKC 4P4KD 4G9DB 4LSRH 4YGAB 4FQXC 4YWGL 4ZUWA 4Z3HA 1JCKA 3OHXC 1TYEB 4AQEB 3EGDA 2AXJA 4P3CL 4XMLH 3GSQB 5CHNB 4C83B 1AHWB 2EDMA 4QRQA 3W56A 4WLCA 3BRFA 2X4TA 1F3DH 2RMNA 3OGOE 4FHJA 1ZE3C 1AS8A 1GYVA 3FTUA 4G6KH 5F8QC 1A7RL 2GC4C 1G7IB 5PCYA 4RAHA 4K94H 4MAYB 4MJIB 2VJ0A 2ZWLT 4BFNA 3L5WA 4Y4KB 4FYSA 3ATBA 1FFPA 4RMRA 5L2KB 2GTQA 4U1KA 3ZE0F 1YO4A 4IRSC 1A6VH 2V2WA 2JJTA 4JFED 1ZA3B 3LPOA 2QZ5A 5CEXB 2I25N 2ZX5A 4YMPA 2WNGA 4QGYA 1OLLA 4GXFA 1FZKA 1LK2B 4NM4L 5CJXC 4AJWA 4B60A 2X4SB 4F8OA 3SY0A 1KB5B 4UOW0 2PNDA 3P9MB 5F1IA 1USQA 3Q44A 5H2BA 4NQCB 1T4WA 3ZXAC 1U3JA 1YUHB 2P5WA 4DKEH 1MRDL 1WWCA 1FORH 2OYKA 5DMKB 1KB5H 4NKOA 4OKDA 1A9EA 3WE6A 5KEZA 1ZT1A 1L0PA 4U0RC 2ZAIA 4R4BB 2ZX6A 2KI6A 2H4EA 3FBKA 2BP0B 1H15B 4JFWA 1PYWA 2KZ1B 1XL6A 1BZQK 2XWBB 3VXMD 4D9QD 2F7PA 3L13A 1TJGL 3QUYD 1RPUA 4X2UA 4AYID 1AACA 1YSOA 2WVTA 1DVFC 3MUY1 4YSQA 3KPRD 5C7XL 3DUHA 1JPSH 3DURA 1J1XH 3N6YA 3OAYH 3T3PF 5KSAC 5EU3A 3ZUNC 3OSKA 1GIGL 1CK0L 4C58B 4I0CC 1YECH 2D9CA 4NWTH 3UAJC 5AG8A 1YY9D 5AW5B 5HD8C 4OM0H 3V52L 5AD0A 5IUSA 3T8MA 3V0FA 3NCJH 3BRDA 2NDFA 2VLRB 4PGBA 4POZC 1A6UH 3MYZA 2DEWX 3EYVB 5C0AA 5C07D 5A40E 1Z2KA 2J72A 2YZ1A 3DPDA 3TBYB 5HVHC 3BVVA 4X5QA 1P84K 1KEML 3R0NA 1NEUA 3PDOA 4ZNEE 3ZU8A 4I88A 1H6UA 4IJTA 1WIOA 4ESKA 5AG9A 1JXFA 2DWYA 1M57B 2O5YH 3C6SB 5EPMB 5E7FA 4H5SA 4R2GC 3AS1A 2PW1B 1CLOH 2BVYA 1EUUA 4MXQC 2XPYA 5ISZE 4XXDA 3D50A 3CCHB 1FFQA 3WNKA 4NNXB 3HS8A 4WV1B 3ABMB 1EGJL 3VXUE 5D4JA 3I6GB 4XZ4A 3BO8A 3RVXC 4X5XB 4A37A 2AANA 2D9QB 2EDFA 3NG5A 4XP1H 4JFYB 2Z92A 3L5IA 2VJXA 1HH6A 4JHUA 4LLUA 4UOW1 2BHYA 5C0JA 4WUKH 4ABWA 1LD9A 3QZBA 4HMCA 4OQTL 4PJFB 4TNVF 4NM4H 4FGMA 1J7VR 1QHPA 5LCVA 3QDJE 2YGQA 1XH2A 2XVGA 3K91A 1FV1B 5JPNA 5IF0B 3K71B 5IHUL 4PV8B 1CQKA 1MRDH 4K55A 4LRIC 5IQNA 4UU9A 3S36L 2CGZA 1HTYA 3RLSA 4BA8A 2P4AB 1DFBL 5T3ZD 4AV5A 2ZOOA 4GW5B 4S0TD 1B9KA 1ND0A 4J3WA 5BRPA 5C7XH 2IWEA 1LYQA 4M7LT 4Z6AT 5D4QA 3QIWD 1N8ZB 1RAMA 2BPBA 5C9JA 5DVOA 2DB8A 2SEBB 2FHCA 3PJSB 2H3KA 2MOGA 4IKKA 4JM2B 4P9HC 4F2MA 4L8CB 2LFGA 4YLBA 5IR1B 1HCZA 1X7QA 3ARUA 4HOMA 1I53A 2C1PB 2MOVA 4KAQL 1UADC 2ENJA 2X3BA 2NQ3A 3NGBC 5F6HJ 1YQVL 4IBLT 4YBHA 4DVBB 5D55A 3DI2B 3RX7A 4MA1B 4QD2E 4YDVA 1SBSL 2FGWL 1CS6A 1YAZA 1KEMH 2IDSA 4HETA 1MWAL 5IOPA 5JORA 2C4FU 3QXDA 4L2LA 5GZOC 2CR6A 4ZW7A 4BM7A 1FFPB 1QW9A 1IM3D 2WXKA 2KQMA 4U1KB 2Z7UA 2B0SH 2OSYA 2V2WB 4B5ZA 1I1CA 1JYXA 3MLSL 4M5TA 4X5WA 5E1GA 1RFDL 1LJMA 1FZKB 4L18A 4ZMYA 4PS4H 1BF2A 2ZWYA 3KLDA 4Z7QE 3ARPA 1GA2A 2LTQC 4D7BA 5F1IB 5H2BB 2X9WA 1JZJA 1NGPH 3RVUD 2YAFA 3WE6B 1A9EB 2YXFA 4K3DL 1ZT1B 5LCVL 4RRPG 3QO0A 3D05A 4HHWA 5T1JA 3EYSL 1PYWB 5DF0A 3TO2A 3X11A 1HSAA 4LP8A 3BMVA 3V95A 4KOCA 4XNUH 4AGPA 4MGXA 4XNQA 3I75A 4WUUA 3T71A 3NFNB 2IPKB 4K7PY 2I24N 4QUOA 3K5SA 4UINH 5EU3B 2HKHL 4ZS6D 1LDPL 1SMOA 3BFWA 4LQFL 4ODHL 1UVQA 2Z8VC 4YX2H 1XH1A 2WLLA 3B2XA 1NCCL 2PWHA 2X4PA 4UQBA 5AD0B 3UPRA 3I6KA 3DHJA 4NEHB 4AY0A 4LPWA 1OTUD 4Q9RL 4PGBB 1FVCA 3VFNA 1G4MA 1R3LA 5DQ9A 5C0AB 2QSCH 3N42F 2W92A 5ABDE 2RD0A 5LQBH 2Q3AA 3S7GA 2QMJA 3FOMA 3GXPA 1GMEA 2YPLA 3PDOB 1XH0A 3GZQA 3H85A 3LRSB 1YQVH 3VXSA 4WHYH 4MA3A 1JNLL 3GIVB 4H5SB 4FQ1L 1MWAB 1OAJA 3ZE2F 7PCYA 4HCRA 1Q72H 3BO8B 4APXA 1CGSL 5F7LB 5HPMA 4M7ZC 4XVUD 5MEQB 2F7OA 5A7EA 1IFGA 4WI0A 4DP8X 1FNLA 3JUZA 1U8KB 4YDKL 3BPOB 1S7SA 2R0KL 3BGFC 3X3GH 3MLSH 4DF9A 4FQXD 4UM8A 4U49A 2NX5E 4PJGF 3E8UL 1LEIA 3L4YA 1OF2B 1C5BH 5BOZG 1TQCC 5JPNB 1OSZA 2X2HA 3MAWA 2A77L 4UU9B 2Y23A 3KPSA 3E6FA 4NZ8A 5LCVH 5HHXH 3IGAB 5I1KL 1ND0B 4YS4A 4IRSD 5CXPA 2OMZA 5DR5H 2YA0A 1KLFA 5C9JB 4H1LA 4F2MB 2HKHH 1LDPH 2ENPA 1X7QB 4LQFH 3UMTA 1XL4A 3U2IA 5E5LA 2EC9T 2P24B 1YY8A 3F7YB 1TO4A 1KCUH 1OZUA 2CKBL 4I1NB 1AJ7L 4HJIA 1J8SA 1NCNA 2CBPA 4GAGH 1YNLH 2EDBA 4AYMC 1Z9SA 2ZUQC 1QG3A 4YDVB 1EXHA 4ORZC 1NKRA 1PW3A 5CCKL 1XF3A 5IFHL 1DVFD 1OAQL 3VGDA 5IOPB 3LY6A 3QXDB 5CN1A 5I0XA 3TURA 2X3AA 3WY1A 3L45A 2R1YB 3C08H 3F83A 15C8H 4AYFA 1FUNA 1G6RL 2G2NA 5F7DA 5KSAD 1FWXA 2XIIA 4Z7UF 3KBPA 4FQ1H 1KV7A 1PSKL 2L7QA 2WANA 4X5WB 4OLXL 3UAJD 4WNSA 2ED8A 3OLGA 4A7TA 5HD8D 5TJWK 3FOLB 2QQLH 3WEBA 4NPYA 3LD8B 5CAYB 3V6ZA 1IAIM 2VDMH 3B7RL 2QVKA 4OFYD 4ABQA 4POZD 5JHBA 1NLDL 3GI9L 4PTUA 4JRXD 4TNFA 4M1GL 5C0CA 3QO0B 4UQAA 4WW2F 3RI5F 3PGCA 1WIUA 4NN5C 3TO2B 1HSAB 3VAEA 1G5AA 1P6FA 2ITDA 4KGLA 4UZUA 3INUL 3C8KB 2C9XA 2DJMA 4JBSA 4IMLB 5FB8A 1CPUA 4R2GD 4X6DB 3I75B 1FLRH 4MXQD 4WUUB 3VFMB 1JF1A 3P40A 4WO4B 1Y18A 4G6AC 5E94B 4XCFL 2A2QT 1EA9C 2AQSA 4P05A 5K1JA 5IJVA 4RX4D 2G4EA 1I31A 3NEOA 4EJ1C 1HZHH 3RVXD 2CALA 4U4BA 4HSQA 1UVQB 4PV9A 1FCGA 2X4PB 3QG7H 3UPRB 3I6KB 1M2VA 5FO2A 3SO3C 1BQHA 2EE9A 3AB0B 3CDZA 3LRGA 5EBWA 3LRLA 4AJ0A 2BJML 1FVCB 3T1WA 1R3LB 2IXQA 5DQ9B 4OLWL 4PFEA 5D6DC 4A2FA 2CKBB 1YEIH 3AC0A 1IEBA 5DLMH 2YPLB 3BSZA 3D33A 4Q89A 3EOYG 1F0LA 1PJ9A 3VXSB 4LDOB 3TGXA 5C6PB 4MA3B 3EXLA 4ZODA 1LMKA 3WCYA 2ZP8A 5AAMC 1TR7A 3IN2A 3A0OA 3RL1A 4M03A 4WKXA 3LHPH 3K0WA 4J2QA 5BZWA 2IDFA 3E80A 1MJ8L 4JRYD 3QDAA 1G6RB 2BIMA 1KTLA 2ZXGA 3P30H 3T1FA 4APXB 2C1OA 4JEGB 5HPMB 4LEEA 1FFTB 3EHBB 4Y5VB 4J8RA 3CFEB 4WI0B 4E9XA 1E5ZA 4HCRH 2WQXA 1ZTXL 1MZYA 1PSKH 1S7SB 4JFOA 3O6KL 5IK3A 4AE1A 5I75B 2ZF8A 2NY5C 1JYNA 1LEIB 1JTOA 1BPVA 3LJ3A 2APBA 3JV4A 5CZXC 4OTXL 2OXGA 4L48A 4H40A 1OSZB 2FL5A 2B08A 1IC1A 2YXVA 3BAIA 5F44A 2ZT9C 3KPSB 3E6FB 1D5XA 5EUKA 3ULUC 2MKLC 2BSCA 4M1GH 4JHWH 1UQSA 1NC2D 4JB9L 4Z3JA 5GZOD 1MCHA 4WNQA 3D69B 2Q3XA 5ESQA 4FAAB 1GL4B 4L3FA 1LO4L 3K8KA 3C6EA 4KRPC 4HFWB 4JFZL 2DKUA 2OMZB 2YGPA 3FSVA 3S3PA 3CXDH 1JHLH 3ME0A 1JRHH 1KLFB 2FQGA 2XTJE 3KWWA 4XCFH 2EVJA 3D48R 3S35X 3NRQA 3Q8AA 3UC0L 1LWJA 1YY8B 4L3CA 4KQ3L 4X9YA 4H1LH 3B4NA 2EYTB 1SMAA 4P46C 1LVEA 5GGRA 3FQRA 3RIFF 3BVNA 4P2QD 1UOVA 1BFTA 2AQRA 2BJMH 2HAZA 3L7EB 1SYSA 1Z9SB 1EANA 3BSZL 1RY7B 4OLWH 4P5SA 4PRIA