1EZLA

Crystal structure of the disulphide bond-deficient azurin mutant c3a/c26a: how important is the s-s bond for folding and stability?
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
b'AEASVDIQGNDQMQFNTNAITVDKSAKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AZURIN
publication title Crystal structure of the disulfide bond-deficient azurin mutant C3A/C26A: how important is the S-S bond for folding and stability?
pubmed rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ezlA00
1FFTB 4DP4X 1BYPA 3IN0A 2XUWA 3S8FB 1NWOA 2WSDA 2UXVA 2EIJB 2BO0A 4A2DA 3OM3B 1AIZA 2Y1AA 4Q89A 1JXGA 4NERA 2E86A 4G72B 2HLEB 1JZHA 3FYEB 1SDDA 2FTAA 4QLWA 2QT6A 1RZQA 1AZRA 3SBRA 1E67A 3CDZB 1GS7A 2CJ3A 1JVLA 4YSCA 1MDAA 1URIA 1XB6A 3IE9A 3OMAB 1BAWA 4Q8BA 2VW7A 2XX1A 4N4YB 1PY0A 1SFHA 2EIKB 2PPDA 3C75A 3MX0B 5A7EA 3NSCA 2HRGA 2TSAA 1J5DA 1CURA 4F2FA 4KNTA 2XWZA 4E9XA 4GP8B 2N0MA 2FQFA 4G7QB 4A66A 4DP5X 2VSKB 3G5WA 3QJRB 3WG7B 3EH4B 1GR7A 1ZV2A 4CSZA 3T6WA 3JTBA 4YSOA 1HFUA 3PAUA 4FA7B 2DWSA 3IN2A 2ZONA 3HB3B 3NSDA 2DYRB 3NSYA 4G70B 4BK5C 1M56B 1AG6A 5F7AA 2YAHA 1DYZA 2XVBA 3SBPA 3UAAA 1NINA 4E9VA 2BP8A 1GW0A 1T5KA 2I85A 2VM3A 2PLTA 3FU9A 2DY2A 2WO2B 5AKRA 1AOZA 2BP0B 4UF7C 1ETJA 3FQYA 3NJNA 1PLBA 1M57B 6PCYA 1E30A 1F56A 4W1TA 3QQXA 1GSKA 4AKPA 1SHXA 5I5IA 1B3IA 3V9EA 4KO5A 2PPFA 1IKOP 2HX7A 2HX8A 4UANA 4HZ1A 1AS8A 4YVNA 4KO9A 3PLYA 1J9RA 2I7OA 1JZJA 4KNUA 3S3DB 4YSPA 2PPCA 4YSEA 5D4JA 3NT0A 2Q9OA 2XLLA 2R7EB 3IBOA 3FQ1A 2ZOOA 1PLAA 2Y69B 3FS9A 4E9QA 4A2GA 1PZBA 1L9QA 1NIFA 1AANA 4KOBA 3NJJA 3OQRA 2FQGA 2YAFA 3CDZA 3NP3A 3OMIB 3FYIB 3ABKB 2TSBA 3EH3B 4YL4A 2FQDA 4EF3A 1OE2A 5D4IA 4L0PB 2IDUA 4AKQA 4HALA 1E5ZA 1NPNA 4G7RB 1AS6A 1PCSA 1W6WA 3PPSA 2PP8A 1SJMA 2BWIA 4HIPA 3RYMA 3NJGA 5B1KA 3N2JA 1EHKB 2YXVA 3GDCA 3TASA 1AZNA 2FT8A 2VSMB 1GS6X 3FSAA 5I6OA 1WS8A 2UX7A 4JHUA 1PMYA 4E9SA 3BQVA 2GIMA 4BXVA 1BQRA 2XU9A 2CAKA 4RH4A 1UATA 2XV0A 1DZ0A 1EZLA 1TU2A 1A65A 1QNIA 3ERXA 1OCZB 4JKNA 2HZHA 2BP0A 4HCIA 2FQEA 2ZWNA 1AR1B 2MTAA 5F7BA 2J5WA 3T6VA 4BWTA 2JKWA 3NP4A 2AZUA 5I6LA 4DPAX 4E9TA 1L9OA 3ASOB 2AVFA 1SNRA 4N8UA 4A2FA 1J9SA 2FWLB 4AX3A 1TEFA 4DP2X 2PCFA 1KCWA 2DYSB 1IBZA 1J5CA 1N70A 3PAZA 2R7EA 4M3HA 2H5UA 2P80A 1VLXA 3H4HA 2EINB 3FPYA 1R1CA 1JERA 4BDVB 3FSVA 3ZIYA 3EF4A 3ABLB 1X9RA 2Q5BA 1JXDA 2PPEA 1FA4A 3QPKA 2BZ7A 5TK2A 5B1AB 3X1EA 6PAZA 4KO7A 5D4HA 3UABA 2X88A 3WI9A 5I6NA 1KYAA 4YSUA 2A3TA 2QDWA 1PNDA 1PNCA 1BEXA 1L9TA 5TK4A 1NIDA 1CC3A 1OF0A 1ZIBA 1CUOA 2IAAC 1ADWA 3AG3B 3QJQB 1ID2A 3TBBA 1NICA 2W8CA 1BXUA 3AG1B 3UGEA 1OCRB 3DKHA 2YARA 2GBAA 1FWXA 4GYBA 4YSAA 1JZGA 2HXAA 1HAUA 3QJVB 3S3CB 4ZK8A 1ZDSA 1OE3A 2BHFA 1JXFA 2P80D 2CALA 1SHWA 1QLEB 4QKTA 2PCYA 3QJUB 3EHBB 1RZPA 5I26A 5FC9A 1BYOA 1MZYA 4KO6A 4HCFA 2GHZA 3D12B 3WNIA 3MBWB 5PCYA 5E9NA 3X1NA 3X1FA 2XYBA 5B1JC 1SF3A 5I6KA 4PAZA 3NYKA 2PP9A 2VMJA 4BXSV 1NIAA 4A2HA 2YXWA 1AACA 4DPBX 4GP4B 3NJKA 1CYWA 2XV3A 2H47C 2AFNA 1TEGA 5B3SB 9PCYA 1ILUA 2HX9A 1ASPA 4YSTA 4HCGA 1SDDB 3SQRA 1YLBB 3X1BA 1V55B 2CCWA 1PZCA 1JZFA 4BDVA 4BWUA 1JOIA 3EH5B 3QJTB 3OD3A 3TBCA 1SFDA 1IBYA 1NWPA 2RACA 2XXGA 2I7SA 3AZUA 5B1JA 5B7FA 4KOCA 2YAQA 2XXFA 4X4KA 2DV6A 3T6XA 1NIBA 4A68A 4E9WA 2IWKA 1IC0A 1ET8A 1KDIA 1GY1A 2JXMA 4M4RB 5AZUA 1M9WA 2VW6A 1NIEA 1OCCB 1ZDQA 4E9YA 1KGYE 2LLNA 1NDTA 1NZRA 2B3IA 1XB8A 3CG8A 1OV8A 1RKRA 3PCYA 2FT6A 1AQ8A 3ZX1A 4CSPA 3DTUB 3ZDWA 2J56A 4YSDA 1NPJA 3AW5A 4DP1X 1E5YA 3FPXA 1J9QA 4A67A 2VW4A 2XX0A 1A4BA 1PLCA 4GY4A 1X9UA 2J57A 2JFCA 2VN3A 1A4CA 4KNSA 1AS7A 3KW7A 4MFHA 4HHWA 1KDJA 5B1BB 1L9PA 1BXVA 1WS7A 2YAEA 2FNWA 2NRDA 4PCYA 1A4AA 4ENZA 2EILB 1RCYA 3T71A 3WIAA 3DIVA 2FT7A 3CVDA 3SBQA 1CYXA 1BXAA 2EIMB 1JZEA 1ZIAA 4YVUA 1OE1A 7PCYA 2UX6A 3FU8A 2YAOA 2J55A 3X1GA 3BVDB 2ZXWB 3CVCA 5I6PA 2QDVA 2YQBA 1AZUA 5B7MA 4UAHA 2DWTA 1JZIA 3FQ2A 2GB2A 4DP9X 1BQ5A 1ET7A 3WNJA 4DP0X 2FJSA 4G71B 3S3BB 5I5JA 2OV0A 3FSWA 3FU7B 2HRHA 1BQKA 3ZBMA 2IDTA 5IY5B 4A2EA 1J9TA 1AAJA 2IDFA 4FAAB 3S8GB 3WKPA 4DP6X 1ASOA 2XV2A 1GS8A 2X87A 4JHVA 1V54B 2AZAA 3X2QB 2IWEA 2GI0A 1GY2A 1TKWA 1KV7A 4K9JA 4WTQA 4NB7A 2QPEB 1JVOA 1W8EA 1AZBA 2GC7C 4YSSA 1N68A 3T6ZA 3NJLA 4BWWA 3T9WA 4TXVB 1SF5A 4GXFA 1L9RA 2AANA 3FT0A 3GYRA 5EHFA 5B7EA 2UXTA 1KBWA 3OMNB 1IUZA 1W6LA 4AZUA 3N55A 4GP5B 1L9SA 1NTDA 3TU6A 5ANHA 3TA4D 1KBVA 4W9ZA 2VM4A 2QPDB 1KCBA 2GC4C 1ET5A 3FSZA 5AFAA 8PAZA 1XMEB 2IH9A 1GYCA 2GSMB 1I53A 3V9CA 1OCOB 1WAEA 4AI7A 2OCCB 3U25A 1ASQA 4YSRA 3UACA 3WKQA 4DP8X 3NJFA 5I5MA 3HEIB 2CBPA 4DP7X 3PXLA 5PAZA 3IEAA 3CVBA 1WA0X 2PP7A 2B08A 2BWDA 2OJ1A 1PF3A 4F2EA 3ABGA 1AZCA 1WA2X 2MRYA 4P5SA 3NJIA 2W88A 4HHGA 2BZCA 4AKOA 2BW5A 4P5RA 2IDSA 5LDUA 3AY2A 4DPCX 4YSQA 1E65A 2H3XC 3NJMA 1MG2C 3UADA 3UAEA 5I28A 4F7KA 2YAPA 2IH8A 3FU7A 3QJSB 2WO3B 3NJHA 3H56A 1WA1X 1PZAA 1A3ZA 4NAJA 3L45A 1A8ZA 3PAVA 3KW8A 7PAZA 3CZUB 3ABMB 2IDQA 1MZZA 2UXFA 3NSFA 4WKXA 3H4FA 4E9RA 1QHQA 3ASNB 2BP8B 1OOWA 2CUAA 2PPAA 3AG4B 4G7SB 5I6MA 2UXGA 3GXUB 1PAZA 1V10A 1MG3C 1HAWA 1XB3A 2YAMA 2IWFA 1AG0A 3JT2A 4HAKA 1ZPUA 2BW4A 1ILSA 3AG2B
chains in the Genus database with same CATH superfamily
2DMKA 3FQNB 3H9YA 3SDCA 1J1OH 3FO0H 4NQDE 5EC1A 3TPUA 2J5LC 3ZL2A 3ARTA 3KVPA 4H88L 5KAQG 4IMLA 4PREA 1HILB 4N26A 5TD4A 1TF4A 2OMZB 3PNWA 4D0DA 3IPFA 3BLPX 4CILA 1T04B 4MYPA 1JWSA 1LEIA 2VH5L 3MMEA 2ZF9A 2B5IB 3Q2CA 4DVRL 1RMFL 2BS9A 1GZQA 3IJHA 5FYKL 4NERA 1KLFA 2OMTA 1NAKH 5FIEA 2UVEA 5JHDB 2DMGA 4CU6A 4KMTH 5DJZA 3ZDYF 2WQRA 4AZ8B 1OAKL 5AAMA 5F97E 2ZICA 1UA7A 3ARXA 1R3IH 4BBWA 3QRLA 2G5UA 3QDGB 2J20A 3WUWG 1PY0A 5KVGE 3GUTA 5A7EA 3EYUL 3UO8B 4PJXF 4F8QA 2R0KL 3GRGA 5BJTA 5IG7B 2WINB 3ALPA 3UBXI 2EVIA 4OLZH 3SY0A 2E7LA 1SVZA 3P3SA 1ML0A 3G5WA 3SDCD 2I25N 5HYSA 2NY0D 3KL3A 4OGQC 4TLKA 3NPZB 4FLRA 3T6WA 3FU6A 4GRLA 3D18A 5G55A 5D1ZC 4C4KT 1IE4A 5HYIA 5JOEA 4WHDA 3D3VA 4KRPC 4HS3A 3RWGA 5HY9A 1NCNA 1AG6A 2WUCL 4E9VA 2X4TA 4HIIA 4RGOL 4X5WB 1FFOB 4QYOA 4PYGA 1E2ZA 1TTAA 1TU2B 1XTMA 1SYVB 2QEJA 3NRQA 4JZJB 4Y5VB 4J3VA 4KROB 2BP0B 5DC4B 4ACTA 3FQYA 2EUWA 2C9UA 5FYJU 1D9KC 2HH0L 1B6UA 2KPNA 3A6CL 2ADIA 5JTWA 3CHOA 3LY6A 2CR3A 4LHUB 3MBXH 3EDKA 3IXTB 3JWOL 1DJSA 1YY9D 2EUXA 1HJBC 2CD0A 1TVHB 4LEXH 3BPCB 4ZQKB 4N90D 1L9NA 2K3HA 1YEWA 1RXLA 1DO5A 1ZLEA 2EXYD 4NWUH 5EBLB 5AYUL 2EACA 3RUGF 3WEBA 2ZCHH 1MW0A 1E27A 3C08H 5MEQB 1EJOL 4GRLD 5IWLA 1PLAA 1OAQH 1PZBA 1AANA 3DI2B 2QSTA 4J3OC 4I0PA 3D3VD 1K4CA 3K81A 1Z0NA 1SOQA 3TCLB 3FYIB 2BH0A 2RIKA 3QXAA 4UQ3A 4EO5A 1WO2A 3MNDA 4HS6B 1UGNA 3ULUC 3LJ3A 3MJ8A 2IDUA 2GT9B 1G9NL 4HS8L 1AS6A 2CE6A 1FSKB 4UTAA 3D9AH 4Y88A 4L3CB 2GBUA 4JGMA 5E1IA 5IESL 4DN4H 4JRFA 1KY7A 5B1KA 1QLFB 3DUUA 5DJ8A 5ABZA 2WN3A 4Q14A 4R4FH 2XDHA 3UJIL 3KYNB 2NY5H 2Z7WA 2XTSA 1IVTA 4Y1AE 4E9SA 4JDVB 1Q9KA 3WJJA 5EA0L 3WAJA 5D72L 5JHMA 4FTVE 2XU9A 4XNQB 4IRZH 1ZHLA 4LK4A 4NC0B 1J8HA 2R2EA 4DK5A 1UM6H 4BFBD 1QNIA 5J5EA 1EMTH 2DQFB 4PRAA 5DRZB 4PY8J 4M7JH 4I0PD 3VFGL 2XY2A 3UX9B 5D7SH 3NCMA 1C5CH 3VGAC 3HI5L 5F9WB 1AR1B 1T66C 4WWOA 4L3AA 3RFZC 5EU6B 2Q2LA 1YYLL 4ABVA 5AL0A 5AQ0A 2F53B 2HUEA 3QXUA 2Y6SD 3ARDA 2V7HA 1A4KA 3BMWA 3FFDB 1AZZC 1SEBA 1AQKH 2FWLB 2ATPB 4AX3A 4WWID 1U8LA 1MVYA 1QLRB 2PCFA 4MNGB 3R8BB 4TTDD 3KZ8A 1D7BA 4OFKA 3MCLH 4IDJH 3M6DA 1KXVA 3QEHA 3M86A 5FOBB 4ZUTB 2VDKL 4OFQA 4MJ5A 3UBXA 2Q5BA 4BHUA 2NDFA 5EU7E 4WU5B 3QYCA 3HE7C 1J8HD 5KJRL 5D4HA 3B9KB 4OZHB 1LO5B 2AITA 2PYFA 1EO5A 1QASA 4OCSH 4ODUB 3EXJA 1HZLA 3ZE0B 1KYAA 1F3JB 1N0XH 2QDWA 1B4JL 3MRQB 2VLRE 2IADA 3LNDA 3P77A 1QFUH 1A3LL 5KVGL 3ARDD 4U3SB 1MFVA 3QEUA 5AKTA 3BJ91 1E4KA 3TNNA 4LCUA 2BFVL 1JRHI 1PY9A 4WI2A 3WENA 4TUJB 3WDJA 1ACCA 4WHYH 5EF3A 1HX0A 2GBAA 2BC4B 3K91A 2ORBL 1G7JB 4PRHA 2HXAA 3UJJH 1U8MB 1FLTX 2ZP0T 3D50A 4A7SA 4AGPA 1JV2A 1D5ZA 4P9ML 4WSJA 3ZUNC 1J05B 2WUBL 5DMJB 3LEVL 1Q90A 3S0PA 1H3VA 3GSUA 3DO7B 3R1GH 4FNTA 1WQVT 5IVZB 2VMFA 1S4IA 5TE7L 3MRBB 4JFVA 4PV9A 2EYTB 4JREC 2IBBA 4ZFZB 4X6CE 4JN2B 4NS0A 4ONGH 4QKXB 4PTTA 2Q76A 5AYTA 2AFNA 4UQ2B 3ZHNA 4YK4B 5E0QA 3L48A 1I9RH 5TFSL 4L4VE 4YDVA 2W1NA 3BESR 3MCKB 1NOLA 3RY6C 3OF6A 5I8KH 1SDDB 3DMMA 3IPEA 1NMCB 3AXLB 5DK2A 2CIKB 2ODHA 4QHMA 3W2DL 1F42A 2DJ4A 3H3PH 4UM9B 1VHPA 1YEJL 4RETB 4PRHD 3QJTB 4D8PB 3LEXB 3BQUC 1H5BC 5D6CA 4FQQB 1RUQL 4P59H 3C5ZB 4G3YL 5D2LB 1Q0YL 2YQ3A 4E9WA 4A7TA 3L1EA 1X9QA 1GY1A 2YPLA 1J1XH 3OJDA 4HFWA 1H6FA 4DETA 1B90A 5IMLA 2PWHA 3ZMRA 5ISZB 1KGYE 2Z93B 4MMXA 2E5EA 4X99B 1XGQB 1SQ2N 3SE4A 3CG8A 3T0BA 1G9ML 2BCKB 4X8JA 3K6FA 3Q2LA 5EN2B 3A5VA 4AQ8A 3O2DA 3O0RH 2F19H 1E42A 2FK9A 1HHGA 3LKRA 4UT6A 2W0FB 4PRIA 1PLCA 3HR5B 3BVNA 4GY4A 3TJEL 3VFNA 4WTWA 5BW7A 2DQHH 2HA1A 3VI3E 3OF6D 2E3VA 3K5SA 3DMMD 4M7KH 1OSEA 2VMEA 1QSFB 4OTXL 1C7SA 3A6BL 1N3NB 4BV1A 3RPBA 1XIWA 2VJ8A 1L9PA 2A9ML 4EEEA 1FNLA 4YDLB 2FNWA 1RJYA 1T2XA 1AD9B 1DLHB 2H0EA 3B2VL 3OKMA 4XXCA 2HSIA 3B8SA 1NFIB 1NGWA 3EJPA 2PCXA 2YPLD 3QDJA 4WFFD 3V4PH 1FAIH 3LRSB 2E9WA 4JG0H 5L88H 1MLCA 3WFEH 3D30A 2YAOA 1T20A 4WNQB 5ANMB 1MREL 1DVZA 2VERA 3OAUL 3R7RA 3CXFA 3MHZA 1JP5A 3EFFB 4JY4A 1HI6A 4PRID 1I7RB 1XQ4A 2KZBA 4PJ7E 1BQ5A 3HRZC 2FJHB 2R69A 2WPGA 4LSUL 1OP5K 2YR3A 2FLRT 5ECGA 4JQIH 1QFHA 1ECYA 2Q8AL 4U2ZA 3TYFA 1HL9A 1KCRL 3FU7B 3IDNB 3R0MA 1G1YA 2HG5B 1UGKA 4JDTH 4JN1L 4XCYA 1XIWD 5TH2A 1ACXA 2VDQL 5FPIA 5KS9B 3T0EA 2BNQE 2RFXA 4PJCE 4GSQA 3C6LB 1E2WA 2DBJA 3BSZA 3BUTA 5C3TA 1JF5A 3BISA 4Z76A 2X6UA 1L0QA 1IGJA 3DX6A 1KJ2B 1Q94B 2IVFC 1CR9H 5E6UB 5CMAA 1I7ZA 3QDJD 1AXSB 1XCWA 2OZ4H 2WNGA 4M9PA 3GJEB 3GBEA 3GSNL 3ME0A 4K94L 1QG3A 2DWEB 3FUMA 4TULL 2Q7NA 2DKMA 2GQHA 1W8EA 3EUUA 4PY7A 4ACPA 1QI3A 3EFOA 3LS4H 4MA3B 3TN0C 4AYBA 5FF6A 3BN9D 1QNZH 4HPYH 4NLHA 5AVQB 5GJTH 1S7RA 3T4YA 2DLFH 4R84A 3QISA 5LUMA 1U3HB 5GHWH 3NESA 1W6LA 4FQXB 1ZLSL 3F62A 4L3FA 1TJIH 2EEXA 3P9MB 1O5DT 3T0AA 4OF6A 2NYYD 5KWYC 1UA6L 3F2LA 4EOWL 1GKEA 2KT6A 1XF3B 5BQDA 4XO4A 1HQRB 2C9VA 5D1ZI 5FM5O 3T0ED 4KPHL 2HLAB 2Q2EB 5K9JL 2YBGA 2EC9T 4X7SH 1RHHB 3FTVA 3OG4B 2NNRA 2ADJB 3HEIB 3PNRB 1INQB 4NO3A 4N0FB 4ATWA 2VDLL 1Z9MA 2IH3A 4XP4L 3E38A 3VXOA 5FHAL 3CLEL 4KHTL 1NC4B 4O51A 4YHKL 3WTYA 2YOAA 4I9WE 1ZA6B 4X7FC 5J1SC 3BC9A 4UDTB 3A21A 4L8BA 2FWSA 2I9LA 4M8RA 4PR5A 1AXTL 3BZ5A 3IFOB 4KXAA 4ZT1A 2XYCA 2V9TA 5J1TC 2ITCB 2YEZA 3E3QE 2F7OA 1V8HA 2GBTA 2IMMA 4TSCL 5GQBA 5TF1H 5I66A 3CMGA 5E2WL 1UWEL 5I2IB 1JYXA 4DTGL 1BF5A 2A83B 4Q9CA 1TZIB 5L4MA 3RDTA 4P07A 3TZVA 1FDLL 5D7KD 4MCNA 3FQUA 7CGTA 4ZTPH 4WY7H 3SKOA 4WK0B 4I3SL 3ARFB 3RVTC 3IJ8A 4NGHL 3QUMB 4ODHH 2YC1B 5E1AA 3LXUX 1YJDH 5BS0B 5IJVA 4X8GA 3BZEA 1ILSA 3MOAL 5CU9A 1GPOL 2R2HA 2X4NB 2GK2A 2WSDA 1CTMA 5EOCL 1D5MB 1A1NA 3N43B 4MMZB 4OCRL 3VGHA 1Z3RA 1HVXA 3KDMA 4MZ2A 4K7FA 1HKLL 3MV11 1LMIA 3RJQB 1GGTA 1S7VB 2Y1AA 3UZQB 3EH2A 4AITA 3CFKB 1IMHC 3CN0A 3ET9F 3SDAB 4P48A 2XFXA 3JT0A 2K4AA 1OD7A 5FUCC 1RURL 1X5XA 3J8F7 3CDZB 3RDTD 3TZVD 4DKDC 5EORH 3U9UB 4UZUA 3PG2A 2YGQA 1JL8A 1MHPH 2J12B 2DQUH 3C75A 2PPDA 3IMWA 3NSCA 1AGCB 2HRGA 4JANA 1REIA 5HDLA 1ZANH 4PJDE 3ZE2B 5D7IA 3DX9A 2BP3A 1XAUA 4XHJD 1GR7A 4OCWL 2IFFH 4FQCL 1VCBC 1BD2B 1NUFA 2AJSL 3KPMA 3GI8L 3FB5B 5JQIB 1PKQB 1HFUA 1ROCA 5E8NA 2HRPH 4B97A 2WGXA 1TYRA 2ED7A 5E5MA 1J5OL 1OAUH 4WKZB 3WD5H 4X9BA 1JMXA 4G70B 4CC4A 1U8NA 4FMVA 2QV2A 2VR3A 5ESVA 1DYZA 1HZHL 3ZTEA 2NY3D 4KK9D 4JG1H 1UJ3B 3K2UH 1U8CA 2C4FT 3X3FL 5ICZA 1RZ7H 5LXVA 2YA2A 3C8KA 1GC1H 4DZ8A 2YUWA 3BWUC 2BVUA 2GITA 4NP4H 2DDQL 4N28A 4POZC 3W37A 1ZJAA 5LLIC 3FSOA 3IDMA 3ZDYB 2EQDA 5JW5B 1YMMA 5T3XH 5A16A 4K3JH 3V4VL 4R3SB 2XVLA 4YPJA 4GUQA 3AABA 2A0LC 4WFEE 4XX5A 4OGYH 3CDCA 1U8QA 1K3IA 1FUNA 1NBVH 3BUYA 2ERJB 1O6SA 1INDL 4X4XA 2JKSA 4FDWA 1A7OH 3CFUA 3FQ1A 4N3TA 2F1AA 5LWYH 1B0RB 4E9QA 2GCYA 4AQOA 3WU1A 3TJHD 1CFQB 4OV6F 4DEPB 4DIXA 1D9KA 1TNNA 3OC8A 1C8PA 2PW1A 1RU9H 2BINA 2XTLA 5FAAA 5DJ2B 2V5SA 3VDBA 4DGYH 3MX0A 2HFFB 3PXJA 1FRGH 3A0OA 2XICA 2VDPH 1J5IA 4YX2H 2BIOA 4PB9L 2Z4TA 2NR6A 1ZXQA 2XG5A 1RERA 1CT8A 4QTHA 1T7WA 1KEMH 4ABUA 3BH9B 3PP3H 4HIPA 1FH5L 3EBHA 1YMMD 2QSVA 5IMOA 1DVFA 3GDCA 3AB0C 4HIEB 4FJZA 3ZPDA 5BRQA 4X6DA 2ILLA 4HEPA 3N5AA 4PS7A 2X4QA 1TCRA 2Z64C 5EUOB 4KRPD 5A2IH 2Y72A 4LCWE 1LO2L 2R8SL 2ID5A 4QRFA 1D6EA 2CAKA 4GFTB 4XP5H 4EZKA 4Y9BA 4UB0L 1WZ1H 5D71L 4U1IA 4OJEH 1SOXA 4JMXA 1KPUA 1D9KD 3PL6C 2ED6A 2WLZA 4U3CA 1FC1A 2DWDB 2OL3A 4YXHL 3RUGB 4KQ3L 5LNEA 4KDWA 1SY6A 4QO1A 5JLZA 2HJKB 1LDPH 4FYTA 4BWTA 5CP7B 2YD0A 1M6OA 1P5VB 4ZXBA 4PJAA 4D9QD 1T5XA 4LKXA 4OCXL 4UYPA 4MWFB 1A7QH 2NR6D 2WV3A 3MA7B 5HVWA 2YSSB 4HPOL 4G6JH 2CJSA 2CDFA 2Y06H 4QRRB 3S5LG 3GXPA 3DPBB 4PMFA 2XFGB 4Z23A 2OSXA 1DVFD 3P1VA 1D7CA 3QUYB 3QDGE 4R0LB 1OALA 5HDQL 2P80A 3HZVB 2NW2A 4PN6A 2A6KA 3WE6B 1G7LB 1KB5H 2R56L 4ODVL 4W9IC 3SDDC 3ZIYA 3L5JA 4Y4KC 1KTCA 1L0XA 4ETQB 1CG9A 2V2TA 3ILPA 1U0QA 1URZA 5F7WC 4L0ZA 3HE6C 5DHDA 6PAZA 4KZEH 1WIOA 1DTUA 2F5AH 1U8JB 2IF7A 3NN8B 4WO4B 5CILH 5D70H 5EPMA 3IJYB 2QQQA 1QUNA 3WFHB 2CHXA 4LXFA 1TIUA 4XAKD 5J6GA 1CGWA 4BZYA 4QXGL 2YMXL 4H25B 4FFZA 2IFGA 4XB8A 2P4AB 3TBTB 4N20A 3MLVL 3LQZA 3F7QA 1KBGL 1I3GL 1OLLA 1P5UB 2HUHA 2Z8VC 4ICWA 4ZXBD 2ZOUA 1NQBA 1OB1A 1BZ7B 3UZEC 2NY6B 2NY4D 3E6HA 2BVTA 4OJAA 4YHIA 2C3VA 4MYWB 4Q7DA 4L3EE 2J1KA 1HAUA 4GKNB 4KY1H 4NO5A 1HNFA 1M7UA 4I13B 1WUZA 4ZUVA 3MRJA 5F6HI 5BVPH 2P80D 4W9CC 3W81A 5FYKU 3EHBB 4FFWD 2EECA 4PRPB 3GMPA 1M9SA 2X3BA 3KWWB 1XVSA 2ALWA 4G8IB 2XQBH 3CFDA 4BK5A 1QA9A 4EI5B 1I1YA 1FO0L 1GZPB 2O30A 4P9HL 3WSQH 3FUDA 3K1DA 2B7DT 2AF2A 3JWDL 3V0GA 4YQXL 2BXZA 1Z32X 3LQAH 4PJBA 4Q6IB 1LQBC 3ESVF 1IFGA 5E8OA 5BZZA 1YHPA 5JUEL 2EDFA 9PCYA 3J27A 3SGEH 1NFKA 3TPKA 1RZIA 1UYWL 4JO5A 4RISL 4X6BA 1LJMA 4U1KB 3WFBL 1JYNA 3JTTB 3PP4L 3TONA 3E2HC 1TYEB 1Q38A 3C87A 4C59B 4C55A 3I50L 1JZFA 4OVVA 1WWAX 2P8LB 1QHOA 3ZZSA 4OY9A 4K8RL 1EPFA 2IIJA 1DFXA 1N5YL 2ZG3A 3O0LA 1VGKA 4UBDD 2NTFA 2OMUB 3PABB 4NHCH 2JIXB 3FTWA 1X7QB 3JWOC 3MXVH 2AKRA 2IANB 3PV6B 4FI8A 4ZSOA 1I3RB 3D2UA 3GD1C 3L3KB 4RFOL 4KBPA 2B3IA 4PJ5A 2K3TA 1OTUC 5AUMB 1JPGB 1G7HA 3DUSA 1D2OA 1NOAA 2F74A 3RWIA 1I8MA 3RY6A 2AXWA 2P47B 3Q5TA 1JV5A 5DZOA 3ZK0A 2R0WL 5DFTA 1AGDB 3PWVB 4OH2A 2N56A 3FAWA 4K23L 4EI6B 3FCGA 2J57A 2VN3A 4XCEB 1H5BA 3FN0L 3OKYA 3DNKA 4FX5A 1AS7A 3G5ZA 1RJLA 1MJ7L 1RZKH 4O2CA 5EU6E 3UC0H 4XPFH 3NFPA 2WYZA 2F53E 3I02A 2ROYA 3SE3C 1BXVA 1YYCA 4BYHA 3DYPA 3LRHA 3V6OC 2FIRT 5DEGA 2EKSA 4NZUH 1URLA 1BOGA 1P53A 2W0KA 1H3UA 3QORA 4MNGE 3ZY7A 5I16B 2OSLB 2PTTA 5FKPB 3CHRA 5J12C 1GOGA 1Q1JH 4Y2DB 3CVDA 1H6EA 2EDRA 3KPOB 3UPRB 1PQZA 5MENB 1P4LB 4JKLA 4EVNB 3D2UD 1H0DA 5E23A 4DZBA 3ULVF 4PJ5D 3J7HA 4PI0A 2Z7YA 2CO1A 1K5NA 2WWKO 4B9KC 5T5FA 3D0LB 3BVDB 1P2CA 4D8OA 1AKPA 4GEJA 3KJ6L 3NIDE 4U6XB 4V33A 3ZSSA 1F4XH 6FABL 1N8ZA 4ECNA 3FFOA 1JZIA 4QTFA 4OZHE 3AY4C 5DSCA 4DP9X 1CD9B 5ICYB 1JTTA 3ZE0E 4FNLL 4UTBL 1IIIA 2JTDA 2XIIA 5DI8A 4KI1A 3X17A 2X38A 1LTXA 3HOGA 3V4PB 4BSJA 1UUSA 2IGLA 2NX5E 1UD3A 4LEEA 5HHOA 1BFOB 4LLMB 1CU4L 4HGWB 3APNA 4X98A 3CCHA 5I8OL 4HUVA 1E4XL 1PIFA 4RZCA 3BEWB 2W91A 4U1GC 2C7UA 3QORD 4QXUL 5IB1A 4X7DC 5GGTL 3MTRA 3EYFB 1TZHB 2NZ9C 3NACH 4QOKB 1GY2A 3SKJH 3ZZLA 2NUTA 2HKFH 5D7JC 3VQLA 1BQHB 3HRZA 1AZBA 4LLUB 5E2TL 3SPCA 5DEZA 4RQQB 3VXMB 3C60B 1CE1L 2A74A 5HYJA 1WD9A 2AEQH 3BCDA 3FT0A 3SD2A 5KVFE 5CJQH 4DAGL 4U6YB 4EXKA 1L9SA 5ANHA 3TA4D 4MDIA 2AMGA 2GC4C 2EC9U 1U8OA 1Y1UA 2H9GA 3BP5B 4GIOA 4UYQA 5DUBA 5IBUB 1CWVA 3IGAB 5HHOD 1T22B 2X4RA 4GBXB 3WKQA 3ARVA 4JEGB 2VL5A 3TN0A 2B2XL 3RPIB 3CJJA 3FT3A 1EWHA 1BWWA 3VI4A 4PRBA 4TPRH 1CO1A 3OLEA 4P4KC 1F58H 3O4OC 2YKLL 1E4WH 4NO0A 5J13C 1TQUA 1WA2X 1YEDA 4G59C 4XBMA 1O6VA 2VR8A 3FQTB 5D2LE 5INDB 4XI5C 1L5GB 3VA6A 4XZ4A 4GS7C 4YDJA 3WO3B 3QCTL 5ISZE 3MV9E 5JOPD 3QJXA 3WIHH 5HYJD 5FO9A 1O7SA 3JVFC 3TC9A 3DJ9A 3BO8A 3JV6A 1JPFA 1MFEH 3L45A 3HMWL 4LEBA 4CC0A 2IDQA 2ZWLT 3HUJF 4DKEL 3HN5A 1QHQA 4OB5L 2F08A 3Q8EA 4M1GH 1X44A 3T2NH 4JFFE 1RH8A 2ARJA 5K9OA 3VTTA 2OULB 3TN0D 4P5MA 3TTSA 4ZZKA 4JPKH 3DETC 1CL7H 1WCBB 4NC1E 2VKXA 4P23B 5C2BH 1I1AC 1NJ9A 4JFHE 3IGFA 4N0UE 5FO8A 1L7IH 5DXWA 1T2JA 4ZW3A 1DBKL 3KYAA 4NO0D 4JDZB 2NLJA 1I1FB 3C09B 3CVHH 5IP4A 3OM3B 5EBWB 3TA3C 4J3XA 3DGDA 3FOMA 1DSFL 5HDRA 2G3XA 4YHOL 1NBYB 1G9MC 1IGFL 2XWDA 9CGTA 3B5GA 3G04A 5ANME 3K4ZA 3ZQXA 4L8DB 1OHQA 2G2RA 4AV0A 2GJZA 4YH6A 1E67A 1MAKA 4OGXH 2HLFD 3VWKC 1DEDA 4L2LA 4CKVX 5E8PB 3LSOA 3FU5A 5FDYA 4FFYA 4L9LB 1C12B 5I1KL 1Z9SB 2EEDA 4LHQB 4NKIL 3AU1A 3RWHA 1SPDA 2F5BL 4GP8B 2FD6H 3MI6A 3L95A 2AXFA 3ARSA 2J8HA 3D06A 3DURB 4OLXL 2FUQA 4BH8B 3KXFA 4LHUG 1I8AA 1YECL 4ZO8A 4GO8A 2BERA 4IGBB 3T0DA 1KELL 1AGFA 4WCYH 2LABA 4FA7B 1DBML 5ETUA 1MFCH 3KPQA 4P2RA 3NSDA 3SQOL 5BO1H 2Z1PA 2ESVA 3LEYH 1M1XA 4NDMB 4W9EC 4HC1A 3RVTD 1F6AB 1IGCH 2GSGB 4H4NA 4N0YH 5I1EH 1LEGB 2I85A 3CFQA 2DY2A 5DK0A 3TNMA 1AOZA 2Z31C 5KN5B 5C7XL 3MNMA 3NJNA 1SLXA 5DHEA 1PLBA 3EOYG 3MJGX 4I5BB 1CICC 1Q72H 2PTVA 4KDTA 3QI9C 5FOJA 4FTDA 3V9EA 2X3AA 4MRBA 1CGSL 1UA3A 5JQHC 5IHUL 3UG3A 1AGEA 1NFDA 4HZ1A 4NRYA 1V3KA 2GJJA 3E6FA 4AE0A 4KNUA 3V6FB 2CJUL 4MTMA 5EU7C 5C09B 3UTTA 1N64H 3KXFD 2HWZL 4XP6H 3PUUA 3O6FC 5HGAB 5KVFL 4OIFA 1N59A 4L37B 1ZJBA 4OJFL 4WFHD 4K94C 2FX9L 1L9QA 4WU7A 4P2RD 2JELH 2CHNA 4NZRH 5CCJA 2NDGA 1OGAB 3NP3A 5A2LH 4Z0BL 4WUUE 2TSBA 5IQ9B 4K07A 2C1PA 3L7FA 3BYYA 3SCMC 5DZVA 1KYOK 3B2UC 3GC3A 3BRFA 1NPNA 4Z3HA 2R0ZH 2IALA 4B96A 5C3LD 2HT2C 2WVVB 1WBZA 2KZWA 2ZXGA 3EOAA 4FQHA 5D7LA 3SDYL 5ESAA 2OCFD 1E8WA 4A39A 1B0GB 3CBRA 4FJ6A 4WWKB 4M7LL 3RL2A 3SKUD 1PGRB 1MRFL 2DEYX 3WO4B 2XWBB 1IGYA 5IFAH 5ITFB 4AEHH 1Q9OB 2CGZA 2HTLD 2H3NB 2AJZB 1D5BB 2MPVA 4WDIB 3KMDA 3NK4A 4YZFF 3UTTD 2GIMA 2NY1B 1FGVH 2VDPB 3DX4A 4M9OA 3S96B 4PEEA 1R0AH 2WJ7A 3FQWA 3OKNB 4G6FD 4HMCA 4KXZH 5D2NB 5BOJA 2XV0A 4ETYA 4XP9H 4JVPA 3P30H 1II4E 2HZHA 1FVDA 2WB7A 5D8JL 3SD5A 3WUWA 4MDRA 3RZCB 1MHEA 1FLRL 1G1CA 2V2XA 4O5LL 3Q6GL 3CSBA 3CK0L 5HYEA 2CIIA 4KKLC 3WEXB 4OU3A 5C0FB 3CFEA 5IT2L 1C5DB 3FQRB 2F7PA 5J3HC 4ZW8A 4NM4L 2K45A 4B41A 2NXYB 2AMUA 1CDIA 4KV5E 3WN5B 4QRPA 3MUY1 5H35A 3MNZA 3FUNA 2CO7A 4FULA 3O6KL 5D7LD 5I1HL 1U91B 4HWUA 4EDWL 3FTZA 4FYSA 5HYFA 5C0CB 3MRFA 5DQ9A 5ALCL 3D8MA 1HSAB 4N2IA 3RGVC 3DVIA 3L17A 4FI7A 5K5YA 5CZVH 3NFSH 4AY0A 3AUWB 4KZDH 4OGAC 3Q01A 3EYOA 2EYSB 3THML 3WXVH 5TK2A 4CRPA 4JJ5A 4CVUA 1UACH 4WHTA 2P5EB 2EIEA 4U6TA 4YHLL 3B1UA 1MWAH 4HJJH 4HISA 2D3NA 2IOOA 5A2AA 4FN0A 3FB8B 1CZ8L 2R29L 5DO8A 1OSPL 2MNJB 4JFUA 1KB5B 5AW3B 4AG4H 2HKHH 3AG3B 4XMKH 1XGZA 1NICA 1F41A 4DW2H 3ZTNL 3OGCB 2F7IA 4QRPD 4ZYKB 1G6RA 4QY8B 5ID1A 2W5PA 3CSGA 2EAEA 1MPAH 2W07A 2J88L 3TP4A 2G2PA 3A6OA 2EH7L 3MYJA 4AVJA 1A8JH 2WXGA 3LHAA 2A2QT 1V27A 3VXUB 3HE6A 4L29A 4FZ8H 5FA3B 1KJ2L 1DJWA 3HC0B 4TUKL 5E94A 2XG4B 1I9JL 2WQWA 3U9PL 4MZIA 4IIQB 4N87A 2PCYA 3APFA 4NI3A 5FA4B 3O2WH 1TLMA 3GS0A 4LLWA 2QFRA 1A9VA 2XQ0A 3HS0B 4HCFA 3RGHA 3RA7H 2D9CA 2AV7A 4XNUL 1RZJL 1YMHA 4IMLB 5JR1H 1S7QA 2DIBA 3VFPB 3H6JA 3WY1A 3PNWB 1HZKA 2E0PA 2Y07L 3GKWH 1JWSB 2EDYA 3JXAA 4GP4B 5CLWA 3NJKA 4P3CL 2H47C 3CN4A 1TEGA 3O6LH 1KLFB 2OMTB 5CJOH 12E8L 4YSTA 4HG4K 2D03H 3PJNA 3HPLB 4LLYB 1HIMH 5DJZB 3ZSTA 3LVTA 4UQ9A 5F3BA 2UY7B 1AI1L 3RP1A 1KGCD 4IHBA 3T8VA 3INOA 4POUB 3G08B 1RZFH 3LN4B 3VXNA 1PZCA 2CM5A 3B43A 4HIJA 3EH5B 4F33A 3HE6D 4I0CC 4P2OB 5BMFH 1AE6H 1G5AA 2ZX6A 3QC6X 4FFTA 1AGBA 1MXGA 1ZE3H 3GSOA 3L7EA 3JVGA 4XXWA 5HI5D 5E9DE 1IGTB 5G4NA 2HFEB 2QPSA 2VW6A 1YAZA 1XEDA 2VZVA 4TN9A 1W8OA 4BUQA 1RUMH 5EUOE 5FYKD 1KF9B 2GKIA 2EO7A 2LFGA 3VXQA 4R7DA 2X6CA 3GUFA 1X7TA 4S11A 5D96C 3R0NA 2ZIDA 3ZTJH 1JGEB 3D3VB 1NM4A 4IU3A 4R8WH 4HEMA 1GGUA 5EZJB 2UUDH 1C8QA 2N59A 3DSFL 1CTOA 3NAAH 1T1XB 4JE0A 2Y22A 2WXJA 1FFPA 3QZPA 1WWBX 3A67H 3RUGE 1AQMA 5KYYB 3UBGA 1Z3GL 2B1HL 1L6PA 3D52A 3KR3H 5ELIA 5AZ2L 3QUML 5IGXH 1WS7A 5DWUL 1AHWC 2NRDA 2O61B 1KZYA 2XKSA 1KXTA 3L4UA 1BSIA 4JFZH 3R18A 1M4KA 3DTXB 2XWTA 1OTTD 2ZOKB 4ZMOA 1CYXA 4GAJH 2CRIA 2F0CA 4QNPE 3ILQC 1PZUB 2G5RA 2IPTH 5I17A 5J11B 1EERB 2FJUB 4YEFA 4RMTA 3VXRE 5F9OH 4Z77A 3E3QC 5BZXA 1YEIL 4Y7MA 5I8EA 4Y5XC 1DBAL 2GB2A 1J1OL 1JHLH 3QXAB 4YPGA 5DGQA 3QG6A 4LNRA 4M7LT 4XTRC 3TO2A 4HVBA 2X41A 3VYOA 1NCCH 2DYPB 3EBGA 1OTUD 5A2BA 4Z7WB 1NAKL 1BBJB 3N42B 4MAYC 5IMKA 2D3VA 4LCYB 4R26H 1YNKH 3AY4A 3SOTA 3T1FA 1AYOA 4NB7A 4RAUA 3IDXH 1R3IL 5FW7A 4DF9A 4PRPE 2JTYA 5DQDH 4ZZFA 2K6YA 2YUZA 1MQ8A 3TO4C 3QT2A 1NCTA 5DS2A 4X5RA 4CDHA 3OMNB 1V7NH 2EDXA 4AZUA 3FXIC 3LD8C 4IJ3B 3VSQA 2W94A 1AHKA 2J6EH 2PR4H 5E00B 1MCSA 4NQDA 3HAEA 1B4LA 2VT0A 3AMKA 1XSKA 3JUYA 3ARDB 3ZMNA 2BHYA 2FJGA 5L0QB 4NKDA 1SEBB 5DJYB 5JNYA 5KSAC 5I0ZA 2ZZUT 2DL9A 3T0WA 5I5MA 1JI1A 5F1IB 5F9JA 3LZQA 1RZ8A 4NJ9L 5B8CC 4JG9A 3BP4B 5IM7A 4FFZH 3QEHB 4B50A 1XSOA 4GQPH 3DBSA 2OJ1A 2GTZA 3V0WH 4U3HA 3I3EA 4M48H 5DYOA 4PGBB 5DTFA 1R47A 3NJIA 1AH1A 3L2LA 4M56A 4GW1A 2H4EA 5H2BB 3VGBA 2WXNA 2IANE 2WZ6A 3FCSA 2D4FA 1W16A 4PWGA 2XOTA 5JW4N 3FONB 3POHA 5KBNC 3EAKA 3HHSA 3UAEA 5I28A 1EVTC 3G6JF 2PYFB 3FUJA 3MBXL 4P9HC 4TQIA 4ERSH 2WLMA 1K8DA 3JWDC 5I1LB 1YEGH 5IMMA 4LEXL 4NQDD 1FNEA 2IADB 2WWOA 1V3MA 1QKZL 4HWZB 2ETWA 4FLOA 3C08L 2PNDA 4C4UA 1OAQL 3QEUB 1MHHA 1B0WA 2PO6B 3TNNB 4YDKH 2FIKA 4YDNA 1ZHBA 1OQXA 2YA0A 5ACZB 1EHNA 4GSDH 3O9WC 4BSWB 1LEKA 1HE7A 5SWSA 3IS1X 4K8RC 1FFTB 1VZIA 5E24E 4KK5C 1QQDA 2WXRA 5DRNB 4PTUB 3D9AL 2Z92A 1EAPB 4DN4L 5C0EA 5EH1A 5MENE 3II2A 1VFOA 4NUPA 3FHQA 3MRMB 2VR6A 4CJ1A 1EAOA 4R2GB 2X7LB 4R4FL 1TQCC 4XPTH 2AAAA 2E86A 4TOYH 3WBDA 3TVMA 4G42A 2NY5L 3U7WH 2HLEB 3PGCB 3FYEB 1QUPA 4H13C 1NCAH 1OPOA 2Q76B 3QIWC 1OANA 1RZGA 4XWGH 1AFVL 4IRZL 4YDVB 1R19A 1I1AA 2WWMD 1S46A 1WBXB 4NN5B 5GPRA 2VW7A 3ATBA 4XCFH 3CVHB 3KWVA 1EMTL 4M7JL 5BZDA 1R5WA 4N2BA 3AAZA 1TJHL 2GYSA 1C5CL 3HUJB 1NKOA 3L5WA 4U33A 5SWSD 1ZGLB 2DQTH 1IGMH 3AT0A 4FNSA 2I32A 4P57A 5D6CB 1DQLH 2VN7A 3BD5A 4RAVA 4XO9A 3SDXE 1AQKL 3JTBA 1XH2A 4BCXA 4L9DA 3GMRB 3OJDB 4O4YH 3WNMA 4ZDHA 2X4UB 5IMLB 2MOVA 4QEGA 3GHBH 4MMXB 3U4BH 1QEWB 1YPZF 5ID0A 1JF6A 3MCLL 4IDJL 5AB0A 3UAAA 3UBHA 2P28B 3VXME 5AD0B 3TVMD 5AKVA 5FGSA 1LE9B 2UV3A 4CU8A 1IC5L 5HI4C 1CTNA 1HHGB 3LKRB 4IBZA 4MX7A 1I1AD 1F56A 1JZ5A 3IRZA 4L0YA 1R24A 1SHXA 3VFUA 3TF7C 5HGDA 1EEYA 3KPTA 3V5DA 3DUHA 2A9NH 4KO5A 5CCGE 4OCSL 2DJSA 2ENSA 4IS6A 3NEXA 4F7MB 2IV8A 1C7TA 2ADGB 3PLYA 1OTSC 4CKQA 2WIIA 4LE8A 4B27A 4FADA 3IJ9A 1JZJA 5LBSA 4BQ9A 4PVNA 1QFUL 4AL8H 2C8NA 2CO2A 3OC5A 1UVQB 4RGMB 3KL0A 3NZSA 5CIPH 2R7EB 1KBPA 3ALXA 1QO3B 3IKCB 2Z31A 5DR5H 5BQ7A 2CLVA 2IPUG 4YX2L 2FVNA 4FHBD 1AO7B 1A6ZB 4G9DA 3AQYA 4KI5D 1T20B 2FQGA 3EGDB 3JZYA 4S1DD 4M8QB 3UJJL 4HF5H 2HKAA 2WKOF 5CF3A 5CGYC 5T5NG 4YL4A 5E5LA 1OE2A 4HKZA 3U0TB 3UAFA 4CW1B 4ODSH 5D4IA 3IM1A 3BUIA 1TETH 4WI7A 2CLZB 2H32A 1I8LC 1G6VK 3MNVB 4KROC 4LF3B 4LVEA 4Y19B 3V5HA 4GH7B 3QQDB 3WV0A 1WWWX 3ZO0A 4WZ9A 4HYTB 3ZMEA 3ILEA 4QAMB 5GGVH 5IV2B 1GMEA 4XCYB 5GRVK 3X3GH 4F58L 5G5DA 4ONGL 6CGTA 1ZT7B 4JL2A 2ENYA 2RFXB 4M6AA 4WW1B 3T8XA 3G6AB 1KJMA 3QARA 1PMYA 2BNUA 1I9RL 1IGJB 3FTYA 3EJZC 5HSFA 1XL6A 4X9YA 5JO5B 5I8KL 4M29A 3LPGA 5E1HB 1UD8A 5AOMA 2GVYA 1SEQH 2Z31D 1SN2A 2OR7A 3ECQA 3SCMA 4Q0XH 5DRXA 1J86A 1OM9A 1EXUA 1X4XA 2FX8H 2FQEA 5GGVY 3B1TA 5EZIH 1RIHL 2CUIA 4WNJA 3RY4A 3T4YB 1UCBH 2A9BA 4IRJA 2R4SH 4LCCB 5D7HA 1UKQA 4ZTOH 1TTRA 4W4OA 2IEPA 2CZNA 2O5NA 1PX8A 3L3GB 3OAZH 2PCPA 2X1PA 2ZKHH 3SSGA 2NNFA 3U7AA 3WMSA 1HNGA 4TUOB 1TPXB 4F7CA 1T89A 4QXTB 2HVBA 4M6OH 1CXEA 2H5UA 2X42A 1IEAB 4BA8A 4YS4A 2F19L 3SPVB 5D93C 1VLXA 3W57A 3HFMH 2EINB 4JS7A 4XMZA 2DQHL 5F7KC 3VU2A 4L4VA 1IC7H 4M7KL 4PRDA 1JNHA 5E6IC 1OHZA 4GRWF 2MQ3A 3A4FA 4LNVA 3SCMD 1T0NA 3DGCR 3TBWA 5L2JA 5M94B 5L4JA 2FHCA 2XWEA 5DWPA 4F1SA 3GBMH 5IF0A 1SDYA 3TIEB 1ANUA 2OMWB 2HT3C 5TE4L 3LX9A 2WZPA 4PIRF 1QLEH 4XNBA 3NQKA 3FZUC 4DO4A 4WHYG 3H6AA 4AMKH 1XF5B 1AQDA 2GG1A 1HOCB 4IRJD 5EULV 5F9WC 1W0WA 4KFMA 1CC3A 4MXVF 4A38A 1OF0A 3V4PL 1FAIL 5I66B 3ABZA 3ZT5A 5L88L 1JDCA 2AI0H 5CN3A 2A4ZA 4FQIH 2Y7SA 1BGXH 2H7WA 5I1GH 4ZX6A 5ENWA 2GHWB 5AYQA 1CQYA 4YSAA 4KMLB 2VZOA 1JAEA 4GRWH 3FB7A 1MWAB 1ZDSA 1Y0LA 3DDGA 2J4WL 2CALA 1AOHA 4QKTA 5HHME 4JO2L 3IVKB 5AALA 1P6AB 4LLVA 4OT1H 5CJBA 4Z6AT 2RALA 3BZEB 3F7VB 4L4VD 4JQIL 5DD6A 4J6RH 3VI3A 2R2HB 4YDZA 3F64A 1AIFA 4JDTL 5C09E 2H1XA 1CDYA 1JF1A 1A1NB 4LLDA 1IKFH 2PP9A 3O41A 5BUGA 5FWRA 3HS8A 2WQXA 4OZ4A 1DANT 4ZUWA 1WHOA 2WZPD 2ZUUA 4DQOH 5IW1B 3IRCA 1M2VA 1CYWA 2D2OA 4PP2A 1XZ0A 3NFNB 3N44B 1CR9L 1OGAE 1UD4A 2JB5H 2NY3B 1ILUA 1WG3A 2OZ4L 2XFXB 3CZLA 2WLLA 2UUDK 3GBNH 4ADJA 1RVFH 2HRLA 4NOBA 2UWEA 1LD9A 3VFVA 3LS4L 1ORQA 3QPXH 4JFSA 5DQJB 1XCQA 4OGAD 4IBUA 3N9GH 3QZOA 1DBJH 2A1WH 1WVZA 1JOIA 5GJTL 2O5YH 3L9RB 3D0VB 5GHWL 3QUZA 3PGDB 2QADD 4JGNA 3F7YA 4JANB 4B5ZA 4MQTB 1VADA 2HPTA 1CVSC 2YD4A 5KZCD 4APQB 1S7TA 1H8SA 3MLPA 3BGMB 2RJMA 3M17A 4AXWA 1BCIA 4OKVB 4JFEA 2KLRA 1ZGLP 4PJ9B 1RK1B 2ZWYA 1LK2B 5CP3A 3FCTA 2J56A 3LS5H 5D2NE 3ZDWA 4NUGH 5B4MC 2X9XA 1LP9A 4KVCH 3R4RA 3FPXA 3MLYH 4H26A 1U8NB 1W0VB 4A67A 1SDAB 1IEBB 1PJ9A 2ZKWA 4FYRA 4UUJB 1X9UA 1ZVHA 2JFCA 2XJLA 4AQAA 3QNFA 2P5WD 4YK4C 3FC8A 4DKAA 1JN6B 2GITB 1FZKB 5BV7H 3AGWA 5LBVA 2WXLA 5I30H 2FL5A 4W4NA 4R96B 2FB4H 5B22A 4FG6C 3HG2A 5DURD 3IDMB 1YNLH 3T71A 2BS71 3QUZD 2BY2A 3NCJH 1NDGB 5C0CE 1JMZA 5TF1L 4OF3A 3MODH 1JGDA 4OIAA 1GCYA 3SBQA 5K9KB 3OPZH 2H6PA 3W0WB 3ARWA 1YA5A 5BOPA 2QQNH 4X4XB 1F8TL 2GK0A 5KSBF 1E9QA 3FU8A 4ZTPL 4JFED 4WY7L 1M3IA 4OLVH 4YC2B 4ADGA 3CVCA 3I6GB 1YN6A 2FZ3A 2ZUWA 1BQHG 4NPKA 3PXHA 1YJDL 3U36A 2WP3O 1MHCB 4BIKA 1Y07A 3NOIA 3GNMH 3ZKMC 4PJGA 2FGWH 4HUNB 4YXLH 4LCVA 3LH9A 3JYBA 2OJZH 5KEZA 3FSWA 5ESQB 4F7TB 4K3DL 1CFSB 2WLIA 3CMOL 3MRRA 3VX0A 1G7MA 1I3UA 4UILL 4BFJA 3QR0A 2PR9A 1OOAA 2ZXDA 4NQCA 5IBUG 2OLDA 3SIKA 2Q0ZX 1F4AA 5IR1B 3DBXB 4YDLC 4NC1C 2XV2A 3PQYD 4NWTL 1U4FA 3D4YA 1DVFB 3UXFA 3WIFA 4XNDA 1P7KA 3CPUA 3VSVA 2X4QB 1NCJA 4BM7A 1JXJA 3IJ7A 1F0LA 4IW4C 2ARJQ 3EJRA 4ZX3A 5JW4R 5C6TH 1M2OA 1MHPL 2DQUL 1XT5A 4XVJH 1A4JB 3P0VL 2YD5A 2OJEA 5DMKB 2AANA 1ZANL 2RQ8A 3D4CA 4DEWA 4YAQA 3MRGA 2WD0A 1IUZA 2ZX5A 4FLHA 3QDAA 2IFFL 4HX1B 2CSPA 1A6PA 3SYOA 1E40A 2IH9A 3LZLA 4GRMA 4I9WD 2KLTA 4I4WB 4ZXBB 5JIQA 1I4FB 3TV3H 2H6UA 2HRPL 1WAEA 2ATKA 3U6XA 3APMA 3ILQD 4YSRA 3U25A 2IBZY 1OAUL 2NY4B 4NQCD 2CDFB 1DQQA 1EHLH 4DP7X 5EO1B 2IC2A 3C6SB 4G1MA 1DUZA 3K6SA 4FQ1H 3K2UL 4OI9A 3U0PB 2B08A 1RZ7L 3DOHA 1FNSH 2BWDA 3V7MA 4JRLA 2NW2B 1GC1L 1QAWA 5C0DB 1N8OE 2FSEB 4Y16B 4OBSA 4BQ8A 2Z8SA 4OFDA 4O2EB 3EJYC 1G6RH 2BXYA 2SEBB 3AUVA 4P3DB 4DPCX 2JJTA 4K3JL 3MN8A 1HEZB 1E65A 3WAKA 4H44C 1RZJC 2IQ9H 3PDGA 4OGYL 1E4XI 4KUZH 4Z95L 1RUPH 1RK0A 1QUNB 3KGTA 4QHKI 1NBVL 5J6GB 2B15A 4FQXC 4B95C 3DO3A 5D5MA 4ZQTA 1E43A 1U9KA 1A7OL 3D3VE 1TZGH 3GBLA 4QRSA 5CN2A 4LRIC 1AMXA 4W9LC 2EDKA 1R3JA 2DJMA 4J27A 4MXWH 4RNRA 4CVWA 1XB3A 2MMXA 3LV3A 4LPCA 1LYQA 5ERWA 4ZUUB 4CSSA 5IEHB 3AG2B 3HBQA 4X5XB 5C0GB 4DGYL 1FO0A 1RIUL 3IN0A 5F89A 2VDPL 4N1CA 5E8EA 4R4ND 3GSRB 2FBOJ 3O6ML 1BLIA 1KEML 2J3SA 2NNAA 5F70A 3CFDB 1QA9B 3BAEH 1MF2H 4HUUA 1HXYB 4KRNA 4Z18A 4YBHA 5F93C 5F7FA 2DQGH 3S35X 4N9GB 5F6HJ 5JHLH 2YEVB 3T4AA 3EKCA 4WHCA 2YJLA 4KGLA 4PJBB 5CLYA 5I1IL 1SN5A 4IEFA 5E8OB 2ITDA 3G6JB 1MDAA 1GRWA 3LRMA 3S4SA 1WZ1L 2ZSVB 5HHNA 1KB9J 2XJKA 1JSYA 1CURA 2XWZA 4Z7QB 4G7QB 3SQBB 4A66A 4MJ6A 1FL3B 3QJRB 1LDPL 1NAMH 2OMYB 2QR0A 2EDDA 3TT3H 2NTFB 4Z7WE 3KLHC 4B0MB 1A7QL 2JI3A 2Y7MA 1A1MA 2Z3FA 3QIWA 4Q9RH 4G6JL 2Y06L 4MMZC 1ND0B 4W6XB 1TOXA 2LOEA 4PJ5B 4JHAL 4RLDA 1AMYA 3MRKA 4HWBA 3SBWC 2YAHA 4FXKA 4R7XA 4BZ2H 1GW0A 4WFED 3AXHA 1SOKA 2MIZA 1KB5L 2WZ0A 3K72A 2QKIC 1FORH 3OGOE 2CKBH 1IKNA 4S0HA 4LCWA 4LPYA 1JWMA 1S3KH 2NSQA 3DX1A 4WI9A 1E4HA 4KZEL 3FQNA 2WAHA 3AADB 2F5AL 1B3IA 2YWZA 1IBGL 4XX1E 4O2CB 5CILL 5D70L 5CEXA 4D3CH 4PIBA 5LDSA 3QNYB 2OMZA 3V0AC 5AAPA 1YAIA 3U4EB 2EKSB 4H8UA 5E2JA 5ABAA 1T04A 3VO0A 2DIJA 3L1OH 3ZOAA 5F7DA 3KBFA 3NH7H 5DS8B 4NNYA 1SJEB 5JHDA 3QIWD 4C58B 4AZ8A 1H0DB 4L1SA 2ITEA 2J7LA 43C9B 3FBKA 4R5XA 4DUWA 1WIPA 1K5NB 5BRZA 4KY1L 3C5SA 4X4YA 3CD4A 3VDCA 2B16A 3EXLA 1VDGA 5BVPL 3MXWL 4FL4B 3ATDA 1WFOA 1NCOA 1YPZB 4EF3A 4TVUA 5JXAL 1UJ3C 1RP9A 4OUUB 5KJ4A 4L0PB 5IG7A 4LCWD 4F9PA 1U3YA 2XQBL 5CIPB 4OFYA 3QUXA 3EOBB 4XCCH 2N7BA 2DICA 3RQ3A 2BZDA 4JY5H 4LSDA 1SJMA 1HCVA 5GGTA 4Z3FA 1DSWA 3Q1SH 3V95A 2GEQA 2P46B 2FT8A 5DA0B 3LQAL 3TH3T 1PL3A 2APSA 4G8GB 3CU1A 1DFBL 4Z7OF 4LGSB 3NEOA 4MHHG 2VCOA 4ELKB 3I74A 2ERJC 1E0OB 3DX8A 4M5SA 3HAEH 4KK6C 4X5WA 3KWTA 1FFOA 4JKPL 3OJMB 5HI4D 2ODIA 5JHDD 1TU2A 3SPJA 1SYVA 4JZJA 4Y5VA 4JKNA 1I8LA 5MEPB 2BP0A 4YBQD 4FERA 4HK3N 5BRZD 4DEPC 5F1OB 4LDOB 5MEOB 2D3LA 1T4WA 3KWXA 3P40A 3IRPX 1HEJC 5HYJB 3MZGB 3QCUH 4AJYV 4NHCL 1TR7A 4JR9H 4EIUA 4OZFH 5IHZB 1HDMB 1OP4A 3E0GA 1OTSD 3ASOB 4JFYB 2BSSB 4LHUA 4MDIB 2X6VA 1P84J 3IXTA 1UT2A 3ZDXB 2XACC 3BN3B 3QUXD 4OFYD 1U8OB 3CLWA 3ZYZA 5HI3C 1TVHA 4DP2X 5IB2B 2H9GB 3BPCA 3OKLA 4ZQKA 1OGSA 5AKSA 4HU2A 2VGLM 3L3OC 2J43A 4S0SD 5CHNB 5MEQA 4A7UA 4MJHA 1NOFA 4UT9H 5DDHA 1OT2A 5C71A 4LBAA 2EUZA 3QZMA 4OZIF 1R1CA 3FT3B 4R7LA 5CGYD 3TCLA 3VI4B 1UT1A 1U93B 1RZKL 3ES6B 3UC0L 4XPFL 4QXVA 2FEDC 1PX4A 1YEDB 4HS6A 3UABA 3ZO9A 5IQOA 1MIEL 3KPNB 3ARRA 2GT9A 4WFFE 3QFGA 3WNNA 2BY1A 2YPKB 3QQ4B 4NZUL 3TWYA 1F4YH 5LGHH 1Q1JL 4JUSA 1ACYH 1F90H 4I3GA 2EC8A 2F6AA 1ZS8B 3L2NA 3QPQC 4GW4A 3UTSB 4UT7L 1ZIBA 1CUOA 3JV6B 1JPFB 3GXMA 4LHUD 4MXQC 1A6UH 1K3ZA 3K5RA 3KM1A 3P3YA 4K5OA 4TVPD 5EO9A 4CVZB 2WC7A 2GIYA 3AG1B 3DIDA 2KC0A 1JNLH 2PWDA 4JDVA 2NUPB 4PRIE 4TLSA 1JE6A 5DJCA 1BMGA 2VNCA 2DWXA 3MVSA 4W68A 1F4XL 4XNQA 3V0JA 3BKYH 1GHFH 1MCHA 3QUYC 1QLEB 2EE0A 3MR9B 5DRZA 1IAOB 2BNRB 3VFTB 2N7AA 3VRIB 2J2ZB 3PWLB 5FO8B 1VZHA 1UASA 3NQIA 5DVLA 5EU6A 4E42B 1WBYB 2NLJB 3B6SB 1DBBH 4QTIL 4XB7A 1EANA 4JJHA 2IGFH 3LN9A 3FFDA 1J48A 3BPNC 3WXWH 1FG9C 5CUSH 2ATPA 2ICWJ 4GRWB 4A2HA 1QLRA 2YXWA 3OX8B 5HDWA 4MNGA 1XGPB 2OR8A 3B2XA 1VENA 1C16B 3SKJL 4WW2A 3MJ7B 4ZW5A 2HKFL 3B8YA 5CEZH 4HJEA 4YDIH 2I24N 1D7DA 3SQRA 4YLCA 2GSIB 4OLEA 3V52H 5FOBA 4TQHA 2NY6C 4ZUTA 4AEEA 2OK0L 1A6AA 1NGQH 4Y19E 1ZLWH 2E9GA 2YMOA 1EEZB 3J2PA 2G5BB 3LNEA 2AEQL 4WU5A 4ELMF 3B5HA 2APVA 2NTSP 1T7VA 2XXFA 4KOCA 5CJQL 1HH6A 3FJTA 4RX4A 4XZUB 3AU1B 3RWHB 2APBA 3B9KA 4JFTA 1LO5A 4OZHA 3MTXA 3GSXB 3L95B 2HT3D 4ODUA 2J1ZA 2IH1B 4NENB 3KS0J 2FBJH 4JO8A 1AR1D 1F3JA 3KXFB 4JDEB 2LVEA 3MRQA 4X9HA 2YGVA 3I3BA 5CZRA 3T3MF 2Y2WA 1KTBA 5A2JH 4JHBA 3SN6N 4EI5C 4PPTA 4U3SA 3OVUB 1AGFB 1WLHA 1TYJA 2R9HC 1CXLA 1G1KA 4X0NA 1QACA 4AQ1A 3KPQB 1HHKB 4P2RB 4TUJA 1M1XB 2BC4A 1R3HB 1E6OL 4TS6A 1EXGA 1G7JA 4TPRL 5LNGA 4FG4A 1F1DA 1ULVA 1E4WL 3F5WA 2XBTA 2H2PC 1U8MA 4HHWA 4HU8A 2ZX9A 4M7ZC 1KDJA 5IBLD 3WTVA 1J05A 1MCWM 3DO7A 1H3GA 1WAAF 4XNYH 2BOLA 4DGIH 3KLQA 1QABA 5AL8A 4Y9GA 5IVZA 3VD2A 2N0KA 3ZKSD 3M1BB 3ETSA 3GJFH 3MRBA 3P4OB 4JO3H 5D7KE 3ARBB 1SHSA 1CGUA 2EYTA 1AGEB 1NFDB 3B9KD 3OV6A 2IGTA 4FZEH 1MFEL 4ZFZA 3BZFB 1NEUA 5F7NC 3E6FB 1IAIH 4M5TA 4Z7NF 2Z7ZA 1JGVH 2UX6A 2YD7A 1UUNA 4UQ2A 2FGZA 2J55A 4QRBA 2LR4A 4M1GL 1JGUL 4YIQB 3L3DB 3QWOB 5IB4B 3PJSB 3MCKA 3SGDI 5BV7B 4HKXB 2ICEC 5DC0A 4WU7B 3AXLA 3RIFF 2E75C 4NT6A 1J0KA 2CIKA 4ZD3H 1CL7L 4UM9A 5G4OA 5C2BL 3FHEA 1L7IL 2XSKA 1NCDH 4D8PA 3H0TB 3ISRA 5DVKA 4FQQA 4MZ3A 1E8XA 3C5ZA 3PPEA 4QR7A 3CVHL 4U6VH 1JVKA 5D2LA 3W39B 4F1ZA 2JQZA 2E47A 3COOA 5FYLD 5ISZA 1SGKA 4RAHA 1ZSDA 3M1CA 2Z93A 5ADOH 1XGQA 1A1OA 5L4IA 2AZAA 2K4WA 4Q4EA 3ZVVA 5EU5B 2BCKA 5IHBA 2ZPKH 1IGYB 1QRNB 5EN2A 4JNXA 4Y2DC 3UZVB 1KV7A 5LAXB 1SMOA 4M6NL 4WUKL 3WGVB 2OP4H 2V5TA 1KB3A 2W0FA 2YRLA 4G1EB 3HR5A 1N5AA 3TM6A 3LKQB 4GXUM 4MBOA 4GKZB 4P4RB 4PJHF 2BFGA 1GGBH 4GXFA 1QSFA 3SJVA 2FD6L 4YOKA 3FT9A 1U3JA 3B7SA 4GP5B 1IQWH 4LLQB 4UM9D 3FUIA 2V2XB 4FG6D 3ZRSA 2XPYA 4M00A 1OW0A 2Q86A 2MH4A 5DJDB 1S5IL 5JDJA 3B2PA 5LGKA 3C5ZD 3GPSA 4H0IA 5DZLA 1NFIA 1KG0A 3FU0A 3JV4B 4WCYL 4OD1H 2AEPH 1B9ZA 3MNZB 2VZ1A 3CVIH 5ISZD 4YO0B 1WFMA 3KLKA 2F15A 1HN1A 4JZOA 3SKNB 5DQ9B 1QX1A 1GYVA 1IGCL 4PGEB 4N0YL 4U0RB 5I1EL 4F3FB 3QGVA 5KJ7E 2VXQH 2NCEA 5E6RB 5GS1A 3DV4B 4F2EA 2VR4A 3F58H 3EFFA 1GAFH 1WTLA 3VD9A 5GGRA 1Q72L 4URTB 1I7RA 2CHWA 3ESOA 2FJHA 3IAQA 2XHNA 4MAZA 1F13A 4ONHA 1U33A 3C60C 4WHTB 4ZUSA 1QSFD 3FU7A 4LSSH 3SJVD 5H8DA 2HG5A 3F6LA 1MJ8L 3NJHA 4Y89A 4ZS7L 4FA6A 4ZMAT 5KS9A 3GI9L 1J0YA 4J4PC 3KPRB 2RGSA 3UDWC 1N64L 3PHQB 3C6LA 3QRGL 4XP6L 4NQEB 2R69L 5EUKB 2Y36H 3WS6C 5JZ7C 4ONOA 1IAIM 1Q94A 3S5ZA 1OQOA 2CUAA 4G7SB 4GT0A 1JDAA 5ID1B 1G6RB 1DJHA 5C97A 3H2WA 4NCC1 1HAWA 3GJEA 3ZKXB 2YAMA 2W07B 1JUFB 2NNXA 2MCPH 3GEFA 4L29B 3LXBA 5CKAA 4L18A 3QUKB 4DP4X 1W0YT 3OLDA 4KJPD 5ICXB 2XUWA 3H42H 1CDUA 1U3HA 2R0ZL 4ZFGL 4ZMZA 1KENH 3QZWB 4HT1H 3DX3A 3H9SB 2V5YA 1MUJB 3QCVH 5JA9A 3P9MA 3W0WE 3QIBC 3TWCL 4LRIA 1PSKH 1YNTF 3MLZH 3QAZB 2J25A 1S7QB 3ZHKA 3N1PC 4AIZB 5IFAL 5FB8B 1TFHA 4AEHL 3CPLB 2ZKYA 1HQRA 3CZNA 4UINL 4UTCA 5I74C 3T2PA 1FYTA 3G3LA 2AJUH 2HLAA 3OXSB 4PH8A 3LZFH 1A64A 1RHHA 3C6LD 2ADJA 3VD5A 1INQA 4MVBC 4MQXD 4N0FA 2KERA 3IE9A 1B2WH 2OXGB 3QHZH 4XP9L 2X6MA 4OAWA 3P30L 4OFIA 1DCLA 1NC4A 1J5DA 1KV3A 3DO4A 4E9XA 2JV6A 3EJYD 4A7GA 5DCCA 1J10A 5C0RH 1XGYH 3GHPA 3MQIA 5AW7B 2VWEE 3GSOB 3IFOA 4P23C 3A4AA 4LP5A 1F5WA 5F21B 2FBRA 1U3HD 2VISB 1R5IB 2ITCA 2YIHA 3DSNA 5IW6B 1WFNA 3PAUA 1M6UA 3C09C 5I2IA 3HBZA 2NY2B 2DWSA 2FO8A 3IN2A 2A83A 2PUQT 3MV01 1TZIA 3Q05A 4NZTL 2OTWB 4S0TD 2EDWA 1RD6A 3VXQB 1I85C 1XH3B 2RCSH 3GSVB 4YWGH 2QMKA 1ED3A 5CZVL 4PJEF 1YUHB 3GXIA 2X4PB 1FYTD 1FVEA 4H1LH 4L4TB 4KZDL 3ARFA 1YJDC 3QUMA 5AKRA 3U83A 2XN9A 2J1XA 4IU3B 4UF7C 1NAMB 2WVUA 4XN2A 1IB5A 5BS0A 2Z7UA 6PCYA 3GK8H 3WXVL 4XAKE 2ZOTA 2JH2A 4UV7H 1UACL 5LJYH 1NMAH 2PPFA 2X4NA 1NC4D 5DFWH 1MWAL 4L9LC 2HX7A 5H94B 4MMZA 3BW9A 2MJWA 5L8JB 1J9RA 1QZNA 1I7UB 4MGXA 4ZNEE 1ECZA 4L5FH 4Z0XA 3MJ9H 1S7VA 3UZQA 1G0YR 2HKHL 3CFKA 4XOBA 4DW2L 1NANI 3Q9PA 2CKBB 1K85A 3SDAA 2QTVA 2IBZX 3R19A 4HA1A 1S6NA 4L8SB 4KMQA 5AB9A 4A2GA 1MPAL 3AM8A 2IXQB 4HJUA 2GFBB 3EFDH 5AW5B 1FFNA 1BPLB 2H26B 3P11H 4PGZA 3CDZA 2YAFA 2WQ8A 4FZ8L 4Z77B 4KKQA 3U9UA 5GSVB 3UOAB 2PW2B 1X5FA 5CBAA 3ARFD 3O2WL 5I8EB 1YEHH 1AGCA 2XN9D 3GSWA 4FP8H 2C9AA 3DGGB 1NC2B 1E5ZA 4G7RB 4P46B 5BS0D 4ICXA 2LTQC 4YPGB 2ZXEB 3QG6B 5HVHC 4TNVF 5DHVH 3PPSA 1FV1A 5JR1L 3DARA 4APXB 1BD2A 4E41B 4TNFA 3TO2B 2AJYH 3GKWL 4I18C 3FB5A 1IM9D 4UMSA 1PKQA 2FNBA 3WJLA 4MCYA 3LHPH 5FECA 3O6LL 4HLZG 3WGUB 3CDYA 4WKZA 5CJOL 3SY6A 2D03L 4X6DF 1LWHA 4A55A 3D2TA 2AC0A 1HIML 1QHPA 1A7NH 3SDAD 1DQVA 2BVOB 2ZUVA 4J3OF 1UATA 1F4HA 2VO5A 3V7AG 3VQ1C 3KDPB 2XN0A 5I1CH 1BOYA 5DZPA 1XGUA 4LDCA 3TBYA 2DPKA 3LDBB 1E9OB 4XMLH 3ULUF 5BMFL 1AE6L 2IV9A 1GIGH 2W38A 5JW5A 5C2UB 2ZOWA 5KANG 3BKCH 3OG6B 4LAJH 1BZDA 2Q3AA 3V0VA 2BSEA 2OXHA 2WWNA 3HAEB 3WDHA 3ATEA 3WKMH 5J4MA 4PJBE 3ARGC 4PJAF 3G6JE 5GRWA 1BD2D 3RVWC 3HRPA 4WWKC 2M26A 4GMSH 5IVXF 5JNYB 2QSCL 4FD0A 1BZEA 4KRMB 3WO4C 1FP5A 1B0RA 4R8WL 3CAFA 1ZSHA 1CFQA 4MKMA 1K6QH 3NAAL 3VCLB 1TSHA 4Z7QE 3ULUH 3DV6B 4OZFB 3VDAA 3F6JA 1C5BH 3A67L 2NY1C 2EE2A 4HH9B 4UU9B 1M7DA 3MDJA 4JJOA 3CQQA 4OD3L 5D2NC 5DJ2A 4Z7OB 2HFFA 5IGXL 3L4VA 1QFWH 2F58H 3BEVB 1W72A 1N2RB 3WI9A 3WFCH 2W65B 4JFZL 3N41F 4ZSOE 3UMTA 1WPCA 3RZCC 4DPRA 3S37H 3C5JB 4PJ5E 4RBPK 1K4DA 4L23A 4N8VA 4RIRB 4NXKA 4GAJL 5F72S 3C12A 3OAYH 2C5DC 4HIEA 4N6QA 4EIBA 3KLLA 2BSED 2NXYC 3FB6A 2IPTL 3WN5C 1FNEB 4LL1A 3QXDB 5INCB 3BDXA 4PG9A 2IAMB 5F9OL 4QHLB 5I71B 1CD1B 1X5MA 3TFKD 2B1OA 3AWFA 4XBEH 1CJYA 3RG1C 1YYML 2NNCA 3WY3A 5BUPA 1UB6A 4S10A 5SWSB 5CGMA 1QPKA 1MW1A 2GHZA 2DWDA 3RUGA 1FI8C 1J0ZA 4V1DB 3P4NB 2HJKA 4KH9A 1TQBC 5CP7A 4OZIB 1NCCL 1P5VA 2EEFA 2ZKMX 5HI3D 4F15B 3MA7A 4F7PA 1CF1A 3RWDA 2YSSA 4IRZA 2OL3L 4QRRA 5HPMA 1OLZA 2FWOB 3KVDD 1SZNA 3DPBA 1KIQB 3V6BR 4FCAA 4R26L 1YNKL 2BWQA 3FT4B 1L9MA 4R0LA 4U7MA 2Z4QB 3IDXL 1YLBB 1YPZE 1RZGB 1FNGB 1G7LA 1TMQA 3SZKC 2W9EH 3WE6A 5GGSY 1J5HA 5DQDL 1QWUA 2VITA 1KNOA 3TBCA 4ETQA 4EE2A 1IILE 5C6PB 2I7SA 2FEDD 3LZOA 4HWBH 4JRWA 1DLFH 4A68A 1UM4H 1U8JA 3ZKND 3NN8A 4ILDA 4WO4A 4BFNA 2CPCA 4PS8A 3RVXD 5AG9A 4NZFA 3WFHA 1VPOH 1A25A 2LLNA 4G8GE 1OB0A 3ZTJG 3HS0C 1PG7H 1WZMA 4RAVB 5GRZA 4H25A 4NEHB 5EC2A 1FCGA 3QPQD 1OV8A 4HUWB 5DT1H 2NY0C 3TBTA 4RZKA 4DJMA 2CQVA 3LPOA 3DTUB 1P5UA 1SJHA 1EGJH 4YSDA 1NKGA 2G60H 4C8XA 1BZ7A 4DP1X 3K8MA 2KS0A 4BD4A 4QRRD 2WXOA 4D7PA 4FFZL 4G5ZH 5EBGA 1YEFH 2HT4D 2X4OB 3INUH 3LRGA 4GKNA 3V0WL 4M48L 5AOLA 3VTAA 5LAPA 1Q0XH 5HYJE 3K2IA 3W11D 2K70A 7FABH 4PRPA 3KWWA 3ZDXE 3VFUB 3B5TA 4G8IA 4EI5A 1SM3H 4XMVA 4P2OC 3F7RA 4EN3B 4IS6B 1GZPA 1KACB 1NLBL 4WO4D 4IBSA 3LQAC 4KGJA 5E03A 4BFEA 1I31A 5C0IA 1YY9C 4ELMB 2E7LC 4XWOD 1F1GA 4Q6IA 5D1QB 2IBGA 1CK0H 1ETZB 2VAAB 5E5UB 3RIFK 3WEAA 5EOCJ 2EXYC 4YDKL 3MUHL 5IOPA 3VI4E 1CXIA 4U1KA 3JTTA 1QVOB 5I0VA 4GSDL 2QFPA 4JHWH 2OQJB 2NY6D 2PXYB 4F8NA 4G9DB 15C8H 3KCPB 3GJFB 3VSUA 2E4TA 4FFVC 5JIPA 4M3JA 1E7VA 5TGBB 4K0OA 4QAWA 4EDXB 1MCOH 3X12B 4JG5A 3I6KA 4HKZB 2V7NB 1U58B 3REVA 3EW3B 1OP3K 3AACA 2OMUA 1IVLA 2JIXA 3EHBD 1X7QA 3LPWA 4NM8H 3UTSE 3ZU8A 4IJTA 3PUCA 4PRPD 3PV6A 2NZIA 1I3RA 3WKPA 3L3KA 3F7LA 4C83A 2ZYRA 4XPTL 4JHZA 4TOYL 1CFNB 2D4DA 2D7MA 5AVZB 1OWWA 3U7WL 3TFBA 1Q9WB 5LVEA 5C0ND 2IWEA 3PY9A 3QRBA 4XWGL 2BNUB 1AGDA 3TGXA 2L04A 1ZHNB 3PWVA 1A14H 3K2KA 4KTYA 2IDCA 4NFDA 1MFDL 5CSBA 4EI6A 5IHWA 2ZCKH 3NJLA 5EOQH 5FO7B 3ATFA 5J11C 25C8H 1RZKC 3T3PB 4HJ0D 2QZQA 4Z7NB 5IWLC 3H9HB 1EO7A 5DRXB 1DQMH 1EEUA 2Z6FA 2F1BA 2DQTL 1IGML 1Q0EA 1DQLL 4I0PC 4P8QA 4Y5YA 3ESPA 4DOHB 5GRXG 3WYRA 1AY1H 4GUPB 3RIAF 4IRJB 1XMEB 2X28A 2OSLA 4O4YL 5FKPA 4Z3GA 3V9CA 1OCOB 4Y2DA 1AXIB 2JIXD 4KX9A 3UTOA 4PGJA 2Y6SC 3KPOA 3UPRA 1QSZA 1ASQA 3BUPA 1X5KA 1F86A 3AS1A 4NRZB 4EVNA 4Q58C 5HDBF 2Y7QB 2OFQA 5FUZH 5LQBH 3D0LA 1Z2KA 3N6YA 2QVFB 4OJDH 3FO9B 3OSVA 2QLVB 2IQAB 4C4KO 5F7YC 5DD3H 4JM2B 1UOVA 3WJJC 1MW2A 2Q87A 5ICYA 2DZEA 2A9NL 4P2AA 3PAYA 3QUGA 4K7PX 5T5FL 1X5JA 1MG2C 3HN8A 3KXFE 4NZ8A 3WLBA 5L2JB 4F7KA 3G5YB 4K2UL 1BFOA 4GLRH 4BQ6A 3R7QA 4HGWA 2V8MA 1INEH 3KGUA 1A3ZA 1NGYB 4IJ3C 5DRWB 3UG5A 4RDQF 3BEWA 4PJHB 4P2RE 5F44A 5KBLA 3LIUA 1W0WB 4G83A 4PJ8B 4Q52A 3PHSA 2BP8B 4Y2DD 2P3YA 1TZHA 3ARDC 3F84A 4QOKA 5I1AB 1MCKA 1UZ6F 5EFIB 2VZSA 5GZOA 4HBCL 2BVEA 4HF5L 1BQHA 4LLUA 2E7DA 1ZPUA 4X83A 2KBGA 3CTTA 1G4MA 3FB7B 1GKOA 4RQQA 4S2SB 3C60A 1TNMA 2VXSH 4FG0A 4ODSL 3NUKA 1KXVC 3ZZ1A 3AFLA 1TETL 1TEYA 2EIJB 2BO0A 2XBDA 4Q2ZB 1NFDE 3NCYS 4U6YA 2QTEA 5DMGC 3WS6A 3X3GL 3BP5A 1JF1B 2OZ4A 4LLDB 2X0UA 1YDPA 1KJ3L 1GH7A 4MA1B 2HVKB 2P42B 1YQVH 5KBMA 3B83A 4M6MH 4GBXA 1M2VB 4BFIB 5AEAA 1ZT4B 4PP2B 5ALBH 1DL7H 4XOEA 4U1NB 2WBWB 1J11A 3RPIA 3UMNA 2P5WB 1SEQL 2QHRL 2KKQA 2WLLB 3VJ6B 5DF0A 1NBQA 3FULA 2A6DB 4QOKD 1E4KC 4TSBH 5J89A 1ORQB 3FQTA 1FHNA 2P48B 2N0MA 5EZIL 5GZOD 5INDA 1L5GA 4PLNC 1UURA 3CHSA 2F18A 3MLSH 5DURB 2VSKB 2FRGP 1UCBL 3BWZA 1CGXA 1Z5HA 2R4SL 3C60D 5D7LE 3QIUB 4ZTOL 4CGTA 4GB9A 2B4CC 3CXDH 1FH2A 2VN6A 3F7YB 1T3FA 4ODTH 5E6SB 3UTZB 3S36X 2ZSWB 1PBYA 3LZPA 3ZGIA 4MB5A 2OMNA 2VLLB 3DXAA 2ZKHL 4B7LA 4YSOA 1H3WM 1T0MB 3DROA 3VVWA 3M17B 4AXWB 4JFEB 2DM2A 2P49B 1AC6A 4NSKB 3NGBB 3SBPA 4H0GA 1NINA 2YLHA 1PDKB 2RR3A 4R2GC 3VXTB 1T5KA 1LP9B 5T3ZH 4GBXD 2WO2B 3HFML 1A7RL 2H41A 4H26B 1PCXA 3DX0A 5JIHA 1IC7L 4GKSA 3CN1A 4C47A 1M57B 1ODAA 1WCBA 1HWGB 4I48B 1NGXB 1KFAH 4NN5C 3DMMC 3GBML 3ZRCC 3JV0A 1UADC 1TJGL 4JDZA 2VLJB 1I1FA 4PG2A 2WBJB 5E2UH 5I15H 4BA0A 2ATAA 3P3RA 4XE0A 4PBDA 4AMKL 3PQYB 5FUOH 5F7UA 4YSEA 3CFTA 4H1LB 1I85A 1NBYA 5L9DH 4XHQA 2BP5M 3BH4A 1TTCA 2MOGA 2K7PA 3APDA 4D9LH 1JGDB 2J5LB 4FQIL 3DXAD 1X3DA 4MB1A 5FW8A 3V4UH 1BGXL 5I1GL 3WTXA 2Y69B 4L8DA 2CR6A 3BD4A 1E7UA 4MVBD 4MMXC 3O8XA 1IC1A 1R6VA 5E8PA 3VU1A 3W1ZA 4RSYA 5ECJE 1OF2B 3BWUF 4ZMQA 3ZQWA 4L9LA 1C12A 1Z9SA 4OT1L 4AQ8C 4TNVK 1N10A 4YHZL 2R1XB 4DNLA 2EH8H 2DN7A 4PJGB 4ELDA 2XXMB 1T21B 4AK1A 2KQNA 3KPRE 2W80C 3RKPA 4PJEB 5BW7C 4N8PA 3FUHA 5DC9B 4NQEE 4BH8A 1IKFL 2KQMA 2CXKA 1NCHA 5A1AA 1G7MB 1PLGH 4HWEH 4M5YL 4DQOL 4IGBA 1XIWC 4X9IA 1SHMA 3SE9H 5I6OA 1XWVA 2UX7A 3MLRH 4X7CC 2H0JA 1KGCE 2JB5L 1CIUA 4IKIA 4FKEA 4ODWB 3WIFB 4NDMA 3GBNL 4XXCC 4GI9A 1RVFL 1P7KB 2DQ6A 1LEGA 4M93B 2NQ3A 3QPXL 1I7TB 1J18A 4AW4A 3ERXA 1G7PA 3WY2A 1DBJL 2A1WL 5KN5A 3O8XD 4AQEB 5CFHA 2O5YL 4I5BA 3H9SE 2VERN 4CSTA 4X80L 4LQFH 4XNAA 1JFQL 5IVOA 4JPSA 1PG7W 3BN9C 3GM8A 2DQIH 1FE8H 5AOKA 1EJ6A 3EYVA 2WLJA 4PB0L 2J72A 3K74B 4AYEC 3UO1L 4CA4A 5FEBA 5EF1A 2NYYC 3VRJB 1G7QB 3BDBA 4YDMA 2LHAA 3LS5L 4NUGL 2XPGA 2EVHA 2OI9B 1P4BH 4KVCL 2W60A 5HGAA 4IGBD 3AVEA 4L37A 2O72A 3KG5A 5I19L 2K8QA 3LXAA 4UOQA 2P45B 5I0WA 1TJXA 3W9EB 2X0WA 1OGAA 4G1MB 3V10A 3K6SB 1KLGA 4A6YH 1N6QL 2YSTA 5B39B 1Z9PA 1RUAH 5IQ9A 4N68A 3VD0A 4G9FB 5H37G 5L6YL 5F7HA 1ORSA 5I30L 5GGRY 5HD8D 2FB4L 2L4OA 1YNLL 3HZKA 2CK2A 3VXPB 4E2OA 1J8KA 3NCJL 2P7TB 5JHAA 1BEXA 1B0GA 1P4UA 1E2VA 2A77H 3H9ZA 3MODL 3I9GH 3G9AB 4WEBL 3OPZL 1ADQA 3K0WA 2VUYA 1JD9A 3SGEI 3VMOA 1QRKA 5ITFA 1Q9OA 2QQNL 2VIRB 2VR5A 3H3BC 5D5MB 2H3NA 2AJZA 3ETBJ 1D5BA 1PW3A 1R3KB 1VFAB 2Q7AA 4HEME 4OLVL 4HFUH 4HG4J 4B9ZA 4TSAL 3GTNA 2X6BA 4K3HA 3S96A 3OZKA 4NQQA 1TPXC 4KH2A 4RNRB 3MYZA 4HSQA 4QHKJ 4U1HB 1AR2A