1EZLA

Crystal structure of the disulphide bond-deficient azurin mutant c3a/c26a: how important is the s-s bond for folding and stability?
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AEASVDIQGNDQMQFNTNAITVDKSAKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the disulfide bond-deficient azurin mutant C3A/C26A: how important is the S-S bond for folding and stability?
pubmed rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords AZURIN
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ezlA00
3NJHA 2HRHA 1PCSA 2TSAA 1IBYA 3N55A 2YARA 3CDZA 3PAUA 1PZBA 1OE2A 5LDUA 4YVNA 9PCYA 3TBBA 1AZBA 5I6KA 2Y1AA 4YSSA 1IBZA 4DP4X 2IDQA 3ZDWA 2N0MA 2PP9A 4AX3A 1X9UA 1MZZA 3X1FA 4BXSV 4AKPA 3ASOB 1HAWA 4HCFA 1UATA 1CYWA 2DY2A 3WKPA 4K9JA 2JKWA 3KW8A 3NJIA 1PZAA 4W1TA 4ZK8A 3X1EA 1XB3A 1PF3A 2IDSA 1GYCA 2TSBA 3GDCA 5B7EA 2XV3A 3WKQA 1OF0A 4HCGA 1JXDA 2UXTA 1NIFA 1QLEB 2WO2B 2HX9A 2X88A 4ENZA 4BWTA 3S3BB 2GB2A 4F2FA 2WSDA 4W9ZA 2X87A 4KOCA 4KO7A 4QKTA 1BYOA 3CG8A 1JZHA 3JT2A 3V9EA 5I5IA 2AANA 1F56A 1R1CA 4RH4A 1PLBA 2LLNA 1N70A 3PAVA 4G7QB 3WNIA 1BAWA 4DP5X 2MTAA 1JZEA 2VW6A 4FAAB 2R7EA 4KO9A 2XXFA 2OJ1A 2FQEA 3GXUB 2WO3B 3NJJA 1CYXA 4N8UA 1JXGA 2PPAA 2IAAC 5B1KA 4GP5B 1V10A 2BZCA 2XV0A 4YSDA 3KW7A 4DPBX 1TKWA 3AG2B 1PNCA 3FQ2A 3BVDB 1A3ZA 2AZUA 2QPDB 3C75A 1ZIBA 1BXVA 1SDDA 3L45A 2YAPA 2PPEA 2YAQA 3ABLB 4WTQA 1V54B 3T6ZA 1AR1B 2FWLB 3EH5B 3DIVA 4BDVA 1DYZA 5F7AA 5ANHA 5B1BB 1M9WA 2YAMA 2FT8A 1SHWA 1JZFA 3WI9A 1URIA 1JXFA 1NICA 3NJKA 2VM4A 3IBOA 3AW5A 4A2EA 4Q8BA 1WS7A 3N2JA 2QT6A 1T5KA 5I5MA 4GP8B 1JVOA 2PCFA 1GS7A 4G71B 4YL4A 7PAZA 2CCWA 2FQGA 4HHWA 3FSZA 2IH9A 3QQXA 3SBQA 1KCBA 1KDIA 4E9SA 1DZ0A 2VM3A 2IH8A 1KDJA 4HCIA 3AG4B 3CDZB 4N4YB 5F7BA 4A2GA 6PCYA 1SFDA 3FPYA 3GYRA 4YSAA 1BXAA 3OMAB 2OV0A 1L9TA 4A2DA 4BXVA 1A65A 2VMJA 2YAEA 2GHZA 3D12B 3MBWB 4MFHA 2QDVA 3WG7B 1E67A 5B1AB 5PCYA 1GS6X 4DP1X 1GR7A 3AZUA 2EIKB 1BQ5A 2GC7C 1PLCA 3UAAA 1I53A 4PCYA 2NRDA 3WIAA 1NIEA 5I6OA 2YXVA 2IDFA 1RZPA 5EHFA 7PCYA 2I85A 1BEXA 3QPKA 4NB7A 2HZHA 2DV6A 2GC4C 1RCYA 3TBCA 2XWZA 1E5ZA 2GSMB 3ZIYA 4YSUA 1ZV2A 4YSPA 3SBRA 2GIMA 2EIJB 1L9SA 1ZDQA 3PPSA 4TXVB 2DYSB 4YVUA 1ZPUA 3EF4A 1SF5A 3OD3A 1NPNA 5AKRA 3TASA 1OV8A 3IEAA 2FNWA 3UADA 2E86A 5I5JA 4CSPA 2W8CA 4G7SB 4HALA 2BP0A 4DPAX 2BHFA 1CC3A 2H3XC 4YSTA 1OCZB 3FU9A 3T71A 4FA7B 3DKHA 1W6LA 3CVDA 4E9XA 4DP7X 1TEFA 3DTUB 2QDWA 2BZ7A 2ZWNA 4G72B 1EZLA 3FU7B 2HXAA 5D4HA 2QPEB 2BO0A 2DWTA 2BW4A 3EH4B 1L9RA 3OQRA 2BWDA 4AKQA 4HIPA 2FTAA 3S8FB 1WA1X 1OE1A 2BWIA 2YAOA 3T6WA 1AZRA 2A3TA 1L9PA 3PCYA 3EH3B 1KBWA 1OOWA 1BXUA 4A2FA 4BK5C 2IWEA 4BWUA 1AZCA 4PAZA 2RACA 4DP2X 1JZGA 2IWKA 1IC0A 4A67A 3S3DB 5B1JC 4DP6X 3ERXA 4E9VA 2UX7A 4YSCA 2H5UA 1NINA 4G7RB 5E9NA 2R7EB 1IKOP 3SQRA 3ASNB 5I6PA 2AVFA 3X2QB 3HB3B 1BQKA 1XB8A 2VSKB 4YSOA 2DYRB 3BQVA 1MG2C 3T9WA 2FT6A 2ZOOA 5AFAA 4KOBA 2FQFA 4E9RA 2FJSA 4M4RB 1TU2A 1M57B 2YAFA 3FQYA 3HEIB 2ZONA 2DWSA 1OCRB 4F2EA 1JOIA 4HHGA 2AZAA 3FPXA 4UANA 2CBPA 2W88A 4GP4B 1NTDA 2UXFA 1A4BA 1KV7A 2UXGA 5TK4A 2PPDA 3UABA 1FA4A 1BQRA 1JZJA 2CALA 4P5SA 1W8EA 1J5DA 3QJUB 2UXVA 4A66A 1GY1A 2VW4A 4A2HA 1RZQA 1GSKA 4F7KA 2IDUA 3NJLA 2PCYA 1AIZA 4CSZA 3QJTB 2P80A 3X1NA 3U25A 1NPJA 2XV2A 2ZXWB 2XX1A 3NJNA 3NSFA 2Y69B 1OCOB 1N68A 1SFHA 1QHQA 1AS7A 4E9TA 3NJGA 3CVBA 1CUOA 1ILSA 5B1JA 2J56A 2XYBA 4GYBA 4AKOA 2B08A 1GW0A 1NZRA 2BW5A 3ABKB 3ZBMA 2PPFA 4WKXA 4YSQA 1PLAA 2IDTA 5I6LA 3OMIB 3WNJA 5AZUA 3UACA 3TA4D 1ET5A 5B7MA 2FQDA 2MRYA 5B7FA 5D4IA 3NP4A 2P80D 3NJMA 3QJVB 3NSDA 4A68A 1SDDB 4DP9X 2J5WA 3NSYA 2I7OA 1ET7A 4X4KA 4AZUA 4JHVA 1J9RA 2HLEB 8PAZA 1W6WA 2EILB 3QJRB 1AG0A 5TK2A 3PAZA 1SF3A 1ASQA 3H4FA 4G70B 3CVCA 1KBVA 4UAHA 3S3CB 3UGEA 1ET8A 4YSEA 3S8GB 1FWXA 2HX8A 4E9YA 1L9QA 1XB6A 1MZYA 2XX0A 1AANA 1WS8A 4YSRA 4AI7A 5A7EA 4KNTA 3T6VA 1MDAA 2GBAA 2UX6A 4KO5A 3JTBA 3FSAA 1AOZA 1AACA 2OCCB 1J9SA 1AZUA 1M56B 2YAHA 4JHUA 2HX7A 4BWWA 2XXGA 1ASPA 1OCCB 3FSVA 1X9RA 4EF3A 1AQ8A 2CUAA 1WAEA 1FFTB 3X1BA 1ETJA 1BYPA 1VLXA 3FU8A 4BDVB 2JFCA 2VW7A 3IN2A 1GS8A 1SHXA 4JKNA 5I6NA 3UAEA 1J9TA 3PLYA 3NSCA 5I6MA 2I7SA 5PAZA 1KYAA 2FT7A 1E5YA 1NDTA 2CJ3A 3V9CA 1SJMA 3EHBB 3FQ1A 1AG6A 2BP8A 2CAKA 3H4HA 3MX0B 1XMEB 1JZIA 3FT0A 2AFNA 3NYKA 3PXLA 5I28A 2PLTA 4DP0X 1RKRA 2PPCA 2Q9OA 1CURA 3IN0A 4QLWA 1PAZA 1KGYE 2HRGA 2XVBA 1E65A 3ZX1A 4E9WA 2B3IA 2EIMB 1MG3C 4KNUA 4DPCX 1IUZA 2JXMA 2XUWA 1HFUA 1AS6A 3SBPA 3AG1B 4L0PB 4GY4A 1L9OA 4KO6A 3FU7A 1V55B 4Q89A 1EHKB 1GY2A 4HAKA 1NWPA 3NJFA 1ID2A 1WA0X 1NWOA 4E9QA 6PAZA 3FYIB 2YXWA 3QJSB 4UF7C 2XU9A 3QJQB 1JERA 1NIBA 3OMNB 5B3SB 3FSWA 1PMYA 4KNSA 5I26A 2BP0B 2EINB 3ABGA 3AY2A 3OM3B 1OE3A 1TEGA 5FC9A 4DP8X 3IE9A 1NIAA 3T6XA 4P5RA 1A8ZA 3H56A 1A4AA 3AG3B 1ADWA 1PY0A 2XLLA 2BP8B 4M3HA 4NAJA 4GXFA 2YQBA 3NP3A 1KCWA 3TU6A 3FS9A 1PNDA 1QNIA 2VSMB 2PP7A 3CZUB 3X1GA 1AS8A 1NIDA 1YLBB 4HZ1A 1SNRA 2GI0A 1JVLA 1ILUA 3FYEB 1AAJA 1B3IA 1J5CA 1J9QA 2H47C 1ZIAA 3ABMB 3G5WA 3RYMA 2VN3A 2J55A 2J57A 1ZDSA 4NERA 1PZCA 2IWFA 2PP8A 1ASOA 1AZNA 1A4CA 1E30A 5D4JA 2Q5BA 1WA2X 3NT0A 1HAUA 5IY5B
chains in the Genus database with same CATH superfamily
2EADA 5DJYA 3B9KB 3HRZC 4D0BA 1KN2H 3IJSB 12E8H 5MERB 5B22A 3ARBB 1NFIB 1MCLA 1BIIA 5T3ZH 1Z5YD 2VLJE 4JN1L 2FGWL 3R8QA 5GZOC 1ZANH 2X5PA 3VFTB 5C3LD 3FQ4A 4RMTA 3H6JA 3H9ZA 3NRQA 2NY3B 4UQAA 4JCWA 5KOMC 2LTQC 3B43A 4TUKH 1OLLA 1AXSB 3QDGB 5INCA 4TLUA 2X1PA 3RWGA 1MZZA 1S7RA 3MNMA 5GRWA 1RUKH 4MXWH 3STLA 3SZ6A 3OKEA 5C0GA 4LT7A 4PFEA 4QR7A 3J07A 1LO2L 2EH7H 1HCFX 1A1OA 2L04A 1UM4H 3J7HA 2VSDA 4DGIH 1OTTC 1A9EB 5ACZB 5I15L 5MENA 4HS6B 1CD8A 2ENPA 1G9MH 2GSIB 4J27A 5LAXA 4UZUA 3UTPE 4Z3EA 4Z7VE 4HJUA 2VL5A 1K8IA 2UXTA 2OFQA 3T0EC 2ZOTA 4XCCH 4KKBC 4ENZA 3GSXB 5E2VL 4CNIB 1IKFL 2ZG1A 1PG7W 4OJCA 4K8RL 3ZHNA 3IAPA 2F7IA 3D33A 1C8QA 3VMPA 3QWRA 3QO0B 2ODHA 3T09A 4MS8D 1R1CA 3G5ZB 2HCZX 4Z77A 1DVFA 5JHLA 1XHHA 3GRWH 2WAHA 5MEPA 4D0DB 4Z7AA 1ES0B 4XXWA 1INQB 1FFPA 1CIDA 2AJSH 5DJ6B 1VFAA 1I4FA 1YCSA 4PWKA 2BNQE 5CXPA 3WUWB 3VTAA 2C4XA 3FO1A 4YSDA 4GNKB 4DPBX 3EO9L 3GJEB 4K3HA 1UB5A 2F8XC 3KPMA 4K3DH 4OVVA 4X9FA 2CJUH 3MFFB 3PL6D 2DLTA 3QR1A 4JLRA 1QTYT 2AZUA 4B0MM 5E6IC 5IR1A 1RJZA 1ZXQA 4UNVA 1HXMB 5DT1H 4UI2A 3MRFA 2ZOLA 3NEXA 4ZPTA 5DUBA 3MNWB 3M1BA 2CKBB 4BFJA 1TZIB 4AV5A 3QB7C 4YHZL 3S96B 3PWLA 3SDYH 2ENQA 3G08B 3IGAA 4BFGA 3EBHA 3HHMA 1HT6A 4FKHA 2BX5A 4DGWC 3EDJA 1JHTB 2XN9D 2VM4A 4IJ3C 3IBOA 3B3IB 5D7LE 4YPGB 3IDJB 4Q8BA 4N0UE 1AFVL 4JHAH 3MRRA 3D2UB 1J7VR 1LL1A 2D8KA 5I74C 1LO3L 1HHHB 4OIIH 2Q7YB 2W9EH 5KVMC 4PJFE 4LHQB 4U7KA 3U0WH 4ODHH 4UOW1 2P1YA 2VZOA 4G3YH 3KGTA 2EKSB 5BS0B 2EIBA 4JO4H 1GTNA 3GB7A 3FPYA 1B0IA 4FF9A 1BXAA 2XKUA 2N7AA 3LN4B 3QFDB 1WF5A 1J0JA 1M6OA 3PY9A 4XPAH 4JY5H 5I1EL 1HJBC 4Z7VA 1DQQB 3GSRA 2EO7A 5GGTA 3NA4A 1MRFL 4IYKA 4FC3E 1OAYL 1QRNB 2BERA 1DVXA 2R0KH 1NCBH 4G1MB 2IBZX 3WTSA 2YBRB 2WYHA 5CCKL 1NIEA 2IAND 4PJ9A 4LHUB 5I6OA 1BFVL 4IRSC 5EUKB 3TO4A 1F4XL 4HIXH 5I19L 3LVTA 3FOLB 2VDLL 3QPKA 1OP5K 3TLRA 4MCMA 1UEYA 3JYCA 2AVGA 2GFBA 2OX5B 1USQA 1JIBA 5EN3A 3P9WB 4XPBH 5JYMA 1NEZB 1MNUL 4ODUA 3K72B 3MLSH 3DVIA 3K3QA 3BPNB 1O7SA 2Q3ZA 5IHBA 1AXSA 4LL1A 2E27H 1QBBA 2MHAB 2IV8A 3K1KC 2QKSA 32C2B 2VNCA 1NCHA 2VLLA 3KPLA 1NEPA 1U41A 4OKVB 3OAZH 2YGQA 3O81A 3TBWB 4LFHG 4XP1H 3IGLA 2EVGA 3OJDA 5E0FA 2ENJA 1DBJH 4YL9A 2QDWA 1RQ5A 2LT9A 4N9GB 4ETYA 1PZ2A 2ZCHL 2BZ7A 5D4HA 1IEAA 1NCOA 4I87A 5I1KH 1KN4L 2LHAA 4GQ9H 4Y7OC 1K5NA 2QADD 3SGJC 4IW4C 2DQUL 3QRGH 3U9WA 3QUZD 2F15A 3BWAA 4LSVH 4TL4A 2P5WE 5A3ID 3RY6C 3O8XC 3BVNA 2WLZA 2NUTA 3S8FB 2HMIC 4Q74A 3O2VH 3TBYA 4YDMA 3K91A 4ZAKC 3NIFE 1EHNA 2P24B 2XTLA 3DMMC 2WQVA 1AZRA 1AXIB 3ULUL 1WAAA 4Q6IC 4UILH 3WLBB 1BFOB 2RQ8A 2X6VA 3CZKA 4JGUA 2IWKA 1JPSH 1IC0A 1JNLL 1EBAA 3F7KA 4HKBB 5FO7A 2UWEA 4FXKB 4WU7B 4ZUWA 1W80A 1XBDA 4Y5VB 1NEZG 1ZE3C 4NIYE 4F7MA 2NCEA 5TFSH 3HIZA 4WUUA 5AVYB 3QUZA 5DD1L 5EC1B 5TE7H 1LP9F 4JHZA 5M95B 2YEQA 2CXGA 5T5FH 3SJVE 4HETA 1X6NA 3UTQA 4I4WB 5C70A 1P9MC 3JXAA 1HKLL 3IJ7A 1ZT4B 1SYSB 1YY8A 2FT6A 2ZOOA 4P3DA 4MXWL 1GGYA 1K3IA 1IFGA 5HVHC 1UXLA 2Z4TA 4JGMA 4M4RB 4QLRA 1RZ8B 2FO4B 2IG2H 1U8NB 5I82A 1RVFH 1P4LB 3SE9L 4JBSA 4PRPE 4FXGC 4EZMA 4N6QA 5DC9B 1U3HD 2BSTA 5EUOA 3MV9B 2A6KB 4X5LA 1LO4L 4XOEA 4HHGA 2LVCA 3JV4B 2NR6D 1AE6L 1XO8A 3DXAB 1I7ZA 4NNPL 4GIAA 4G6ML 3W9DB 3VXUD 1D2OA 1OT2A 3S7GA 5EIVA 1XCTA 3ZHLA 1UWEH 4Q4IA 5MP6H 3DPBB 3DVFA 4KUZH 5FHBH 4ZI8A 4WFEE 2EEDA 1A6TB 3RWGB 2PCYA 3MBEC 4JREB 1XEDA 4Q58C 3EYFB 1XH3A 3HJ0A 1OTSD 4I2XE 3UOAB 1H19A 3LH9A 1JWSB 2JI3A 2P8MB 2R1WA 4KUCD 3U7YH 3SY0A 1CFQB 3RWHB 2JJSC 3BQUC 4BSWA 1ILSA 1KB9K 4K3EH 3C6LD 1BVKA 1I9RH 1T5XB 1URZA 4B9JA 5C0JB 5ILTH 2O93L 2AJ3A 4PG2C 3D4GA 5GSVA 2DLIA 1QR1B 3D9AH 1A9EA 3CXHK 4M6OH 3SZKC 1W2KT 5ACZA 2DQGL 2E8YA 2JB6B 3ET9F 5GZND 1PGRB 2GSIA 3VO0A 3QYNA 3SQOH 3VGDA 1TZGH 4UU9A 3VXPB 2Z65C 3P3SA 4YNYA 4WHCA 5E6IB 4JRFA 2F74A 1CL7I 1PD6A 1RL1A 3E0GA 4HFWB 4I48B 3CXHJ 4AZUA 4MA3A 3I74A 5CEZH 4CDGC 5C2UB 4WO4B 1RZGA 2E6PA 1BQSA 4HSAC 5ANME 4OGYL 4U0QB 1VADA 5HDLA 4XCEB 3O6ML 2ZSVA 3NABH 1U4EA 1VRSA 1CN4A 4Z23A 4YHYC 1GIGH 1KBVA 2Y2TA 2OQJB 2VDOL 2Y9RT 2MQCA 4FN0A 1QASA 2N1TE 3DWTA 1IM9D 3COOA 1B2WL 3SHSA 1QQDB 2EXTA 5JLZA 4Y9EA 2X0WA 3QWOA 2MPAL 1T1YB 5I18L 1SMAA 5F1IB 4MX7B 2WWOA 5JO5A 4PJDF 3CFIC 3Q8BA 4QRUA 3DLQR 4HUCA 4PGDB 4U1IB 3RKDC 3FSAA 2LQRA 3IGKA 4LGRB 4NNXB 3D18B 1M56B 4XPGL 1WC7B 1KEML 2BCKB 2HX7A 2ZUTA 1G9HA 4G83A 3O3DA 4FG4A 1KYOK 4KTEH 2XJLA 3BIKA 2YO3A 1ASPA 4JGJA 5KYUA 1AQ8A 3M1BB 3T2OA 4JKMA 4F7PA 1I7RA 4OZIA 2YSSB 3UZQA 3HG1B 3ZDYB 1OGPA 2QJDA 5EH1A 5L2JA 2LU4A 4O2FB 1S9XA 4U3SB 1J9TA 3MLTA 1MJJB 4KQ4L 1I8LA 4IIQA 4QRFA 1MCJA 3L6FA 2VWEE 3GRWL 4WV1A 3MRRB 3Q43A 4Z7QE 1XCQA 3FCSB 1D7BA 4NM8L 5E4AA 3CX5J 3RB7A 5L6YL 3MRCA 1H3XA 2EDHA 4MNGB 2PPCA 3QUYB 5FYLE 4RMUA 1KGYE 2YN5A 4L1HA 4Y1AB 3RG1C 2B3IA 3OKDB 1MG3C 3IWUA 1A6ZA 3EYVB 4Y5VC 2EEXA 5CIPA 2Q8AH 3BPOB 1CFTA 1SY6A 4ELKB 1GY2A 2ZXAA 2QR0B 4R7DA 2HT4D 4E9QA 3L3IA 5TQ0L 1CVSC 1NA8A 2XNAB 1U91A 3QJSB 4YHZH 4O02B 1JERA 3GHBL 1OTUC 4RBPH 5FYLL 2KBGA 4JFSA 1MJ7L 3D1MC 2CJTA 3EOAA 1KIUA 4BRVA 1LK2A 1O0VA 3C6LC 3RUGE 1W0WB 3LZOA 2GG1A 3US1A 5F3BB 3D87B 1BZDA 4LLYA 1PY0A 1MNNA 3DXAA 3ZO9A 2GJJA 3AXHA 2BIMA 1C8PA 1A0QH 5DSCA 4NAJA 1WFJA 4GXFA 1EDYA 1O9WA 2ZCZA 4ZUVB 5HBBA 3FS9A 5DFWH 5JOFA 5IQNA 3VFRA 3MRLA 3VW3H 4HU2A 3ULUH 1SNRA 2GEQA 3ESUF 5FR3A 1IAKA 1MFCL 4L37A 5CJQH 3ETTA 4JFYB 1OSYA 5AKSA 4G6AD 2H47C 3VVWA 3PYCA 5DEFB 2EC8A 4OZFG 3DROA 3GMLB 4E41E 5AVZB 5BQDA 4LCCB 3CBKB 4HP5A 4BA8A 1TT6A 4UT7L 2V5YA 4WI3A 2N7SA 2XOTA 1NGQL 1HAUA 5B8CC 2WWKT 2ZOKA 4ZMYA 2E59A 1EAOA 3FFOA 2J4WH 1V3KA 2XTJD 4FL4C 4FULA 4C59B 1M42A 1YNLH 4B95C 4R9HA 1TQBB 1KACB 1XXDC 4OGYH 3VXRE 1G7PA 5FX3A 3UXFA 3VXMB 1GZQA 2GY5A 4DP4X 4WO4A 1T2XA 2GTWA 1QLFA 3KCPA 2FJGB 3T5WA 1DVYA 5CINH 2FHFA 3HG3A 1HAWA 4RZCB 3C5JA 2VR3A 1PLGH 3NJIA 2VXSH 5L4JA 1XCWA 4JAMB 3U9PH 2R4SH 3SE3A 4RIRA 4MX7A 5IB5B 2HKHL 2B7DT 2ARJA 4HS8H 4AXWB 4A7GF 4DFIA 2P8LA 4ZO6A 5LAPA 4A6YB 3ULVF 1LO3H 1MCIA 4KVPA 4KTEL 1GCYA 1Q72H 2X1OA 4F2MB 2ZF9A 2OMUA 3GXTA 2WO2B 4XMWA 5F7DB 3OKLB 2BSED 1JS4A 3IETB 2RR3A 1P5VA 1UYWL 3HBQA 2H32B 4QRRD 1GYWA 3U7YL 2OSLA 5AENA 4JPIB 5CBAB 3JWNC 2X87A 3O2VL 2QHRH 4ZNCD 1U8HA 3FT2B 2C34A 3P9LB 1BYOA 3CG8A 2NDGA 4W70A 4WNQB 4FABH 3HS0B 4OFPA 1WIPA 5M7QA 2FZ3B 2EUXA 2Z4QA 2F8IA 4K7FB 4CILA 4KK6D 3UZVB 3MCG1 1RUPH 1G7LB 1GMIA 3OSKA 3Q48A 4W9JC 4JM4L 2YEVB 3KPNA 3D39E 2BSCA 3FONB 2XV0A 4F9PA 5MEOA 1SY6H 1N9PA 3LNFA 5GS1C 3FQ2A 4S2SB 2XIIA 3BVDB 4PJEB 3DGCR 4G6KL 2E75C 4FFWD 4MMYA 3RJDA 3SIKA 4FQ1L 3DPBA 3TIDB 5KSUB 3GSUA 2YAPA 1V54B 3KZ8A 3DIVA 4MXVE 3MLSL 1R3KA 5GRVK 3SKNA 3RVTD 1S7VB 1XWVA 1YYCA 2BS8A 3ROLB 3K6DA 4JQXC 4PJGB 2FT8A 2Z8SA 2EUZA 2FH8A 5EBWB 1URIA 1JXFA 4P5MB 1F97A 1E4KA 4P4RA 1WS7A 3K2KA 3FBQA 1MWAH 3N2JA 3C60A 5I5MA 4EKXA 5LBGA 2HA1A 2YEZA 4EKJA 3F7RA 3KAAA 1CDHA 4LRIC 3H2WA 1KCKA 4TPRH 1JZ2A 4U3CA 5TDOA 3CIAA 4Z6AT 5AAPA 1P7KA 1L0XA 1DZ0A 4DKEH 4QHKJ 3V0IA 1KTLB 2BVOA 3CDZB 3HR5A 4GRLD 2ITFA 4K5NA 5D7SL 1AMYA 3NPSC 2P5EB 3OWRA 2LAAA 1MHEA 1ETA1 2K7QA 3E8VA 4LNVA 3SKOB 4MFHA 5E9DD 3UTSA 2E5EA 1KBBA 4UQBA 5PCYA 1TJIH 1GS6X 1JNNL 2W59A 4ZPVB 2VZVA 5DMKB 4ZUSB 3MV01 4CVUA 2HJFA 1L7IL 2KS0A 3TEWA 2BCMA 1I53A 2NNFA 4RGMC 4BFKA 4F9PC 4HEME 4XI5D 5IMOB 1W8NA 4ZFQA 1OCWH 5K9KB 1ZLUH 3T0XA 3UP1A 1IC1A 1Q38A 3NZ8B 4OGZA 3VRLE 5CJXA 1JRHI 2A7BA 1ZGLP 2NSMA 2A74A 2CM6A 4K7PX 4Q9CA 1T4WA 2FIKB 3FH8A 4NQTA 5I16A 2WM0A 2EP6A 2WN3A 4JFFE 3ZRSA 1IGTA 1S9XB 4XODA 1A6WH 3TN0C 2NSQA 4JO1H 2DYSB 4P2RE 3EF4A 2Z35A 2BDNL 4HA1A 4NWTL 3MA7B 1QEWA 1FYTB 4LHUG 4YHOL 3FUHA 3PGDA 4MVBC 3OKYA 5D93C 2YRLA 2VUOA 4KDTA 1IZKA 4ZX3A 3RPKA 2DQIH 5JXAH 5DMGD 4QRSB 2VN6A 5GGQH 4HS8L 4AQ1A 1W16A 2BHFA 2BIIA 4ZFZA 3I9PA 1A21A 3FU3A 4XVJL 3N85H 3FKUS 1G6VK 3FU9A 3T71A 3JTTB 5GGRY 1AGEA 1V7MH 3QEHB 4X9HA 2XYCA 3MKGA 4U6VL 2VDNH 1OIOA 3UYRH 2IFFH 2XSKA 1A14L 2RGSA 5EU7C 1O6VA 2JIXA 4P5TC 3MLZH 2V7HB 2B1AL 1D9KD 4G8GD 1MIEL 3KL5A 3C9NA 4Y9GA 4OD3H 2RMNA 1IFRA 1KCLA 2FTAA 4H44C 3UBXB 3ZT6A 1YPZA 3MV8B 4H8PA 4TVUA 1MCOL 4M48L 3U2IA 4P57A 1J48A 1P9MA 2J73A 3IJYB 3KNBB 4YAQB 3TTYA 3UTSE 2OXHB 1TZOA 2R0LH 1L9PA 1IAOB 4X5WA 1VF5C 4K94L 1LK2B 5EWIH 1OOWA 3NIGE 3SKJH 4BWUA 1DTUA 5D7IB 5HGDA 4KQ4H 4UM8B 4WEMB 3TZVD 1KPUA 3WMQA 3L7EA 2AI0H 1NGQH 3QZNA 3WLWD 1UZGA 1JF1A 1JWMB 4K07A 5T3ZL 4DP6X 2YA2A 5DJYB 5E4OA 4N0UA 1OF2A 1C5BL 1T03L 3V4PL 5KBLA 3KPNB 3SQRA 3EBAA 4YS4A 4DN4L 4ZMTA 1J5OL 3SCMD 3UJJH 5BUPA 1JBJA 1E50A 3LQAH 1EO7A 1RUKL 2AJXL 5DJAB 3BQVA 4PJCB 3RTQC 1ZA3A 5JHDA 2NY5L 2K7PA 3SDDC 2CIIA 3T9WA 2BRRH 1WT5A 4L23A 1U3HA 4WFFE 3HAEH 4M8QA 1MPAH 2GBVA 3P3TA 1UD4A 4LESA 3VA6A 4FZEL 3LN9A 2YS4A 4YLQT 2BNRB 1MH5A 4LQFH 2IPKB 2HSIA 1YEKL 4CRPA 1MWAL 2HKHH 2YUXA 1WHOA 1KIPB 2ZONA 4LPXA 3SEPA 2W0LA 3GTTA 5DHMC 4AEEA 5IQ9B 1I9EA 1RK0A 3DARA 4JDZB 1SBBA 2QZQA 5E5RB 5GZNA 5HJDA 3UDWA 4HF5L 5CZRA 3MBXL 5T3XD 4M6ML 1T20B 2XT1B 5C0CB 2Q76B 3D06A 5D72L 4XPGH 3BUQA 3MJ9A 1ORSA 2VW4A 4MAUL 4YXHL 1EWHA 5JIMA 5SX4H 1HSAA 2Z31A 3NJLA 1NDMB 1INEL 3HMWH 3BAEL 3IKCB 4RAVA 2PTTA 4RESB 5C0DB 3Q8AA 5BJTA 2DJSA 3N91A 5CO1A 3RX5A 3GM8A 2DM7A 2XBZA 3CLEH 4PREA 2HVKA 3O6FA 4QGTA 4K5OA 4JHBA 3LD8B 3NUKA 4UM9D 4P9ML 3RTLA 2I24N 2G2RB 4MXQC 1I4FB 1K6QL 1Z3GH 3RVXC 5I6XC 1IV8A 1THAA 2F2HA 2IDTA 1OCWL 3NIDE 1ZLVH 2Z8VC 4I89A 1Q1PA 1JGIA 3QIBC 1DSWA 3TZVA 1A66A 2P5PA 1HCVA 4NPJA 1O6TA 4FQ1H 4L4TE 3CDFA 3WIHH 2AV1B 3V5DB 4G6FD 2MKWA 3NSDA 4DP9X 2J5WA 3TT3L 4BD4A 5HYSB 1U8JA 1A6WL 5G4NA 4Y4HA 1V7NL 2HMID 1J9RA 3UYPB 3O3UN 1B0GB 3IDGA 4PGEB 1J11A 4AIOA 1LO2H 4NC2B 1BGXL 3BH9A 2WGXA 3GI9H 1FZMA 4IJTA 3BDBA 3GHBH 4G80B 3IJEA 4NPYB 4KXAA 2R2BB 1JYNA 1MJ7H 1L0QA 5E7BA 4L8DB 3PWPB 1TJGH 5CZVL 2XFXB 3HHSB 4WHYH 4KNTA 3UO1H 2HVBA 1JZ8A 3QFJB 1DLHA 4K2UH 3GUTA 4NO2B 3B4NA 3KPSB 1J9SA 2RHEA 3UBXI 1JHLL 4Q2ZB 2ZOWA 4X7TA 3UTZA 4AYDC 1JZ3A 3AUVA 3VMOA 1HQRB 3G6JE 2BXYA 2QLVB 1NPUA 4XPAL 5E7FA 4F5CE 2KLSA 3L9BA 2Z31D 2VR5A 2AK4B 2LTQB 1HEZB 4MJIE 4WEBL 5E8NA 3OSVA 1JZ6A 3FOMA 3O4LE 4JKWA 1MFCH 1O6SB 4FXTA 1NUGA 4ZSOA 1OGAB 3CVIH 2ZYIA 4XVTH 3NDZE 1MAML 2NX5A 4UNTA 2R2EA 5D2LF 2BP8A 4UZGA 3Q2WA 2EO9A 2Z92A 1TYRA 3EO9H 3FU5A 1KNOB 3QQ4B 5AVTB 3VGAC 5MHSE 3HI1B 4OQ1A 1GGBL 5FKAA 5FK9A 3U4KA 4CW1A 4DCQB 4L3EB 3TEYA 2ATPB 3IDYC 5AVXB 2NNAA 4ZJ9A 4JM4H 2EDMA 4MJ2A 2AEIT 3BKML 4DPCX 1JN6A 1GVIA 1Q9KB 3KJ4B 3PWJB 5C07E 2H41A 2Z34A 3AG1B 4IIZA 3VGGA 4Q0XL 1M05A 2CLZA 2NYYC 4KXCA 2NY5H 1E5UI 1GC1H 3ARGC 3IDMA 3SDYL 4ABWA 3IVKA 4J1UB 3VXRA 2PW1A 2XA8H 5D70L 1DQIA 3MDJA 4DW2H 2IPUK 4KQ0A 2CDEA 5HHME 2YRZA 2Q8BH 2OMNA 4ORZC 3ISRA 4XZUB 4XP1L 5DCCA 2Z93A 5MEPB 3GRWA 4EIUA 4EDXB 5IEHA 1LDPH 1H6TA 1FG9C 1T2QL 3B2UD 3CCHA 3I50H 5DVLA 3ABGA 2NY6C 4KRMB 1IL1B 2I69A 5HDBE 4HF5H 1NIAA 1V7ML 4U1GB 4CN4A 4QOKE 2EUWA 5DO2C 2KDYA 2VJ8A 4JFXA 4WWKB 1ZV9A 3PGFL 4LCWD 2YMTA 3P54A 4ODHL 5HJ3B 1PIGA 2MNUA 4AYBA 2WNGA 3C6EA 2O30A 3UX9B 4H8WC 4CN6A 2R0WH 1WO2A 5FA3B 4AGQA 4OJDH 2R2HA 4GAAA 4WTZG 2DQJL 3E3QC 1INEH 3HMWL 4MHHI 3BXNA 1IIIA 1PNDA 3RVUD 4I85A 4UNUA 1MVFA 3GJFB 2JK5A 3O41B 2DI9A 1E27B 3RURA 2FUTA 4HZ1A 3B56A 1JXJA 1A6ZB 1JVLA 5D5MB 4P2QE 4HEPA 4QMEA 4XTRC 3MRBB 1M7DA 3MN8A 4FHJA 3O3EA 1DVUA 4ODXA 4F27A 1FI8C 2E76C 7FABL 5CJXC 2C4FT 1BREA 3QH3A 2Q3XA 4HIXL 2XQYK 3BC9A 2OTUB 5AW9B 1P4LA 1YEHL 4XNDA 4XN7A 1AOHA 5EUOB 3II2A 3WJLA 3EZJB 4N90E 2AXGB 4K3DL 2YQ3A 2A9DA 4DK3A 1IRAY 1O7DE 1HKLH 2VO8A 3L5XH 3N55A 5SWQB 3C5SA 4MQSB 3RNKB 3BWZA 2CPCA 2C9XA 1PZBA 1IAMA 3BZ5A 3WDJA 2XKNA 2XTJB 4BUHA 5E08L 4MGXA 5IQOA 2WK2A 4NOBA 3TYFB 3HB3C 4F3FB 1BCIA 1U92A 5H4YA 4AX3A 5MEQA 1J1PL 1S7WA 1Q9WB 1XH3B 3Q44A 1AE6H 5E6ZA 1ZEAL 2OR7A 3B7YA 2H2PD 3EJTA 4PGCB 3ZDZF 5D2NA 5AOLA 2AEWA 2ITEA 3L7FB 4G8IA 1KN4H 4GQ9L 4J3OG 4NUJB 4D3CH 4XVJH 5KSBB 1OAQH 3QDME 4WFGD 4MRBA 4LP8A 4R26L 1J8HB 4U6VH 4P8QA 5LO7A 1SOQA 5G4MA 4MNQE 4NKOB 3AREC 4K71C 4LPWA 3GNML 1KTDB 3HE7A 1LP9E 4XP6H 4OB5L 5B8CB 3K5RA 3MLZL 4WO4D 3OZKA 3VXPA 3ZUCA 1XTLA 1GKOA 2OAAA 4QRTB 3T2PA 3PHOB 2CIIB 4AQAB 4OQTH 4LF3A 2OJEB 3O6LH 5IFAL 1HZLA 2ZWYA 5EO1A 3H9SE 3LNIA 3JT2A 4K94H 1MI5D 3MLXL 3U4BL 2DQGH 3D25B 1PLBA 1N70A 2E7BA 3RPIB 4HSQA 3KYOA 3VRJA 2XZAL 2GTWB 4J3OD 4O5LH 1G7MA 2V17L 5FA4A 4ZRGA 3CVHL 3QORC 4RDQG 3CSYB 2I27N 4QI3A 4OZIE 1U2CA 3CTTA 3INOA 2AQ1A 1TFHA 1D9KB 4G6AC 4G8GB 5IVOA 5M94B 1IZJA 5JHMA 4AYMC 4FKKA 1ZIBA 4APQA 1BXVA 1XGUA 4DW2L 4Q97A 4GBXB 1OQXA 3NJXA 3OJ2C 2GBUA 2BRRL 1HYRC 2GJ6E 2JELL 5CU5A 1T5WA 3IMVA 3CC5A 5E0QA 5B1BB 3PWVA 4FA8A 1G84A 5EFIA 1BIIB 5EZIL 5CD5C 2C3XA 4JQVC 3NOIA 4TUOA 4Y19A 3CX2A 2D0GA 3DXAD 2X10A 3MUHL 4FE9A 5JPNB 1EEYB 4PCSA 4YDLC 4AK1A 3ILQC 5A2LH 3BUPA 3ZE1B 1JWUA 3B8YA 4CVZA 3D7PA 4RGNC 4BKLA 4M02A 3FT3B 1Z5LA 2FCBA 2HLFC 4EQ3A 1BZQK 1G7LA 1RU9H 3PIQB 3EGDB 4DETA 4PJ5B 5I8EB 2CRIA 2VM3A 4ZO8A 1H5BC 3P1VA 4P0DA 2CWRA 2I60H 4N4YB 5T3ZD 5GGSA 4OD3L 5I1JL 2HFGH 2WXOA 1XR9B 2IMNA 4QGYA 3BAWA 5ILTL 3HUJE 3NESA 4BE5A 1KSRA 2I5YH 4XPHL 1X4XA 3OF6A 3L5WB 3JWDH 3WTUA 4M6OL 2Y1YA 3L6FB 1WZMA 3SKJL 3U1PA 3ULUC 1XR8A 1UENA 4LEOA 5KANG 3WG7B 4AJ0A 5IOPA 3OQ3B 1M2VB 2GITA 5E9DB 3DO7A 1SVZA 5IBLC 3P11H 1EJ6A 4TULL 4POYA 2PYEB 4LVNC 3MR9B 3FH7A 4RLDA 4X6DB 3MBEA 3TVMD 1FHGA 4QRPA 4ZS6D 3ARWA 1HE8A 4FFZL 1XTMA 3V4PH 3O2DA 4KV5E 2XICA 5LAXB 3M45A 5A2BA 5HYJA 5FO9B 4GINA 1G0DA 1RK1A 2ZUYA 4GO9A 4V1DA 3GSXA 4YHMH 1RMFH 1RZKL 3KXFA 1FH5H 5EU3A 4ZG1A 2CUIA 1RVFL 1YUKB 1CGXA 4YHPA 3GJEA 3WDIA 4X80H 1L9NA 3GGWB 4OCRH 2HJKB 5A16A 5CEXB 1KB5L 2CBMA 2CPUA 3QG6B 4OF7A 5E00B 3SBWA 5GSRA 3U30B 4J4PA 3G5VB 1PTZA 4NUJA 3EOTL 3RVVC 2CO4A 2GBTA 2J1XA 1E43A 1L3WA 1Q1JH 3CVDA 4E9XA 1RURL 5IB2A 4PG9A 4ZPVA 2WBJD 2DQUH 2ZWNA 3DX6B 3TO2B 5LQBL 4ZQTA 2GHWB 3VQLA 2AXHA 1W0VA 1OT1A 3U7AA 1IU1A 4HIPA 4HG4J 1A3QA 4IEFB 3T0EB 3MUUA 2D9CA 4RFNC 3WD5L 4LMQI 1ZHLA 2H1XA 2H6PB 2VN4A 1WT5C 5BW7A 1BXUA 1BD2E 1UADC 3RX8A 2VZ3A 1TO4A 3D25A 4JKPH 4RZCA 5DHVH 5KSAA 3FT9A 3LQZA 1FYTA 3BT0A 4JFZL 3WAKA 1IAIH 3JWOH 4FQHA 4JJ5B 4E9VA 1SM3L 1XGQA 4LSPL 2Y7SA 1USZA 4L1TA 3RFZC 1NMBL 5FFOA 2BSBA 3LKNA 4LHUD 4JO3H 1TPXB 2AVFA 4NN7C 4PRHA 3X2QB 3ZGHA 4GG6A 2WB1A 1ZCRA 1ZSDB 2YSSA 3UZQB 2ADJA 4Z3JA 4F2MA 5D1ZC 4ANXA 2BNQA 1G9EA 3VXSD 1U4FA 4HOWA 2VABA 3BAKA 4KOBA 2H32A 3F85A 4G5AA 1MCCA 1RUQL 1IQDA 3BKCH 3KM2A 3KWWA 2HFFA 2BIPA 3WS3A 4EMZA 4NM4L 2WP3O 2AXJA 1NANI 4TQ8A 4GW4B 4M7KH 4AC4A 3GSRB 4BZ1A 1KLFB 4NZRL 2AEOA 4G6MH 4APXB 4ZZKA 1XF1A 3PWPD 2ALAA 5A6MA 3SPGA 5TK4A 1UWEL 5JA9A 2VR4A 3LKRB 4YZWA 5AOKA 1JZJA 4W9LC 3RWIA 3EJZD 3WFEH 2A77H 2PWGA 1N8ZB 5ANMA 2FATH 1U8OA 3ZKND 5ALBL 3TH2T 5FGCE 1ITBB 3OG6B 4OQTL 1CGVA 2HFEB 2IDUA 5DVMA 1AGCB 3WO4C 4CVXB 1YC7A 1GKEA 5KTEH 4YIQA 3VD0A 3GXMA 4ELMB 4NJ9H 4L5FE 2WKOA 4JDVA 1CXFA 2FJUB 3ZZSA 4ORGB 5DMGC 2BP5M 3T6QC 2JXMB 5JHDB 4Z7OB 2XA3A 3G5YA 3ROLA 5HI3C 4ABUA 3ZT7A 3V0WL 2NXZD 3CMOH 4EEEA 1FC2D 1PLAA 5I6LA 4G6JH 3ATFA 3TA4D 4V2BA 1QYGH 4XNMA 4WDIB 2XWDA 1F6AB 1CDCA 2MRYA 1N10A 1W72B 4MMYB 3RPBA 2VC2H 1OXYA 2A4EA 1BJ1H 2YD1A 3GBNL 5DK3A 1BD2B 1SDDB 3E38A 5IQ9A 3US0A 3V95A 1SMOA 2E46A 2OMZB 5CINL 1EFQA 3VMNA 3ZZLA 2I7OA 3OR7A 1A2YA 2BS9A 4JHVA 3HE7C 1C16B 1HNGA 3AAZB 4PY8J 4ZUWB 2EYRA 4HXBH 1BV8A 4NN6C 3SKMA 2IANB 1RULL 4U2YA 4GUPA 5E6UB 2D7PA 4OTXL 5I73B 5CN1A 3FO2A 4OAWB 4UAHA 2WXNA 3ETSA 4HS6A 1LDPL 1M3IA 3VQMA 1VENA 3AREA 1H3VA 4WI9A 5A7EA 4PTUB 3KHQA 4HJJL 2W9LA 4LLMB 5CSBA 3FAWA 1F6LL 4YZFE 5ENWA 2HVKB 4EIGB 3SDDD 2X1XR 4HIHB 2ESVD 5AALA 4P2YA 3MLYH 2Q86B 3WJMA 5BOZG 5BRZD 4D2NA 5I1LB 2YC1B 2FECI 2BNRD 4IBUA 1UUSA 4JHUA 2F18A 2VQ1B 2WNKA 2KT6A 3F12A 3QAQA 3UAJA 3VNZA 4HJ0D 4TF4A 2HFGL 4GG8A 3EJRA 4KAQL 3FUMA 4JPVH 1XF2B 4N86A 1JZDC 2CUAA 4PRHD 1U3ZA 1NLBL 5HVGB 1PBYA 3MRFB 2B15A 1VLXA 3PWVB 4FS0A 5D1ZD 2VW7A 2FLRT 3NQIA 3V5HB 5DVPA 4X5PA 2ITCB 3H7BA 4Y16A 5F6HJ 4Z78B 3NSCA 4MJIA 2D7MA 4TNEA 5JPNA 3BUBA 1ORQB 2NY3D 4LSUL 2NR6A 4R2GD 4XOAA 1AG6A 3H4HA 4UQ2B 3X11A 2H26B 1NMCB 3FT0A 4MBRA 4ZXBD 1P1ZA 3IXAA 1F3DJ 4X6DE 5DMIL 2OL3A 4LVHC 2J4WL 1EZUA 1E3XA 3KJ6L 1JFQL 3NZ8A 4KX9A 4QLWA 2LW3A 4MD0B 2FX7H 2R8SH 2ROYA 2VLRD 1YQ2A 1KXQA 3JV4A 3LH2L 1Y18B 2EDLA 5HGBA 4AEIL 1QWNA 5HYQB 3LNGA 4NO2A 2J8UB 4ODBD 5GHWL 4KH9A 3KPSA 2X40A 5EC2B 2O26U 3FRPB 3RUGF 1J12A 5IG7A 4TQHA 1G9ML 1B9KA 3FB8A 2VABB 5HHNA 3QJQB 2BHUA 4QY8A 1SJHA 4GMSH 4WU5A 1UOLA 4PYHA 4X5QA 1AO7E 1IAOA 2EINB 3DJSA 4XCCL 1LNUB 3RIAF 5FB8B 5FDYA 3SGJA 5D7IA 2NYKA 4PB9H 3U7WH 5DFVD 5BVJB 2WVTA 4FQIL 4X6DA 5IOKA 4HHAB 5F9OL 5IZ7A 2XLLA 2FGZA 3OXRA 4OF6A 3W39A 2NDFA 1D5XA 4XNUL 3GNMH 4Z7UB 2DTMH 1Q94B 2HH0H 4P5KA 2EDDA 4BH7A 5IUSA 4BFNA 4JEGB 2OX5A 5ICZA 5E6IA 2QHRL 5F89B 5L88H 2GJ6B 4P5TB 5AW0B 1AQMA 5DRWA 3HE7D 4IKIA 4HPOL 3QIWD 1U8QB 3FW6A 1QFWL 4R0LB 4PJCA 5AWNH 1TTRA 1PX8A 2Q7NA 1IO4C 1AAJA 2EXWC 4OIBA 2VAAA 1EMTH 3SB3A 3R8BB 4D8PB 2A6DB 2Y25A 3RWFB 3SQBB 4LGSB 3A47A 3N0AA 4HLEA 3A6BL 1WITA 2MCAA 2FWOA 5DYOA 43C9B 5IJDC 4EI5D 4KJYB 1OF2B 4DN4H 1X7QA 2UYLA 4MDIA 1QI3A 1T1YA 1NGXA 5IB2B 1DVFD 1W72A 2LU5A 1RD6A 3U83A 1QPXA 2JE8A 5E6YA 5EO0A 1CZ8L 4GRLA 3EYQD 2I9LB 4NWTH 1KPVA 4JFXB 4WWKA 1NGYA 5F0JB 3LRLA 3BCDA 3H9SB 4JVPA 3TCXA 1RULH 4EIZC 5FCUH 3T8XA 1EHXA 4MNGA 4ZOCA 1ZJAA 3OWEA 4AT6B 1TSHA 2IDQA 1FH5L 2DIEA 3BFWA 4X6BB 2QL1A 1UKQA 2NY0B 1MLCB 3BIBX 3ASOB 4ZUSA 4MNQB 1MJJA 3FUDA 4BRJA 1QOKA 1N59A 2DBJA 3TFKD 2CK0L 4JO4L 1M7DB 2EVJA 4XN8A 3Q6FA 3QDMB 5KSBE 3QIWB 5E2VH 1BQLL 1DEEB 5TF0A 4PY7A 4HULB 4QNPE 1M1XA 5F0LB 3TBYB 1YN7A 1OQOA 3QXTA 3N40P 3OR6B 1NJ9B 1TETL 3SYOA 3WXWH 1N5AA 3CHQA 3DGGB 4PR5A 2H6UA 1QEWB 5HYSA 2F53E 3EJJX 5F7FA 2IVFC 2JKJA 2R56H 2WXIA 1GGTA 4HKJB 1ZT4A 2IO5A 3RZCD 5IGXH 3T3PF 4JFOB 4P07A 4W6WB 1RUMH 1TTAA 3B9DA 3ESMA 1Z2KA 4UT9A 3W0WA 5I5IA 3GMNB 3VWKD 4EZJA 2VDLH 2V2WB 4OZHB 1ZT7B 3PAVA 3U4AA 3WNIA 2X6CA 1VKXA 1GPOL 5DJCA 3D08A 3RUGA 2YUZA 4BUQA 1DBAH 4H8HA 1F2QA 1FL6B 4BCYA 1CCZA 2VJXA 3EOAB 1N2RA 2XXFA 2PW2A 2EDFA 5CSZB 1RUAL 4A7QA 2F19L 2JB5H 1CYXA 3I75A 4N8UA 2PPAA 3AGWA 4PJAA 3X12B 1EFXB 4PV1C 3WNPA 5DFAA 5AOMA 2C9QA 4HCRL 5J6GB 3C75A 1T83C 4XVSL 4I77L 1P6FA 1S7TB 1SVCP 1TU2B 3ABLB 4KKQA 4YHOH 3GKWL 4KXZI 2G75B 1QTSA 2VLKB 1I1AA 1ADQL 4G80A 3T3PE 4ANUA 1UM4L 4ENED 4UTBH 5HI5D 2KMWA 1TZ8A 1G9NC 3T1WA 1AR2A 5FM8A 3N85L 1NICA 2R0ZL 3M86A 1KB5B 2DTSA 1JSYA 2PCPB 4HJIA 2XN1A 5JXEA 3BVWA 4RAUA 5I1CL 5I1IH 3SYQA 5ERWB 5DS8B 3C60C 5C0BA 4QOKB 3BAEH 2R4RL 1MY5A 3KLAA 5HDBB 2XRAH 1ZVSB 1CWVA 2IH9A 2R29L 3DYOA 1GZHA 1ETZB 2FATL 5F3FA 4OI8A 4K5PA 4XVTL 3OG4B 2AJZB 2Z8RA 3TM6A 5EU6E 1DVZA 2OL3L 3WNNA 1D7FA 1YEDB 3RWDA 1U8KA 4JM2A 1BZ7A 2R0LL 4GO8A 3GYRA 2G3NA 2Y7MA 5C0JA 2ZUWA 4BXVA 1GL4B 4AVHA 1BVOA 1N6VA 4P05A 1AD0A 2DI7A 3OKOB 2Z92B 2JB6A 4RX4A 4Y4FB 2AHIA 1JGDB 2APFA 3L4CA 3TV8A 4C56A 3QWOB 1KXVA 3MHZA 2OYKA 1AKJA 3V2AR 3HS8A 2XHNA 5AYQA 3FK3A 3TBTA 4M93B 3UC2A 3AMKA 2R27A 2FX8L 4L3EE 5JOPE 1T0OA 5C0AD 1VGKB 2OLDA 3FQXB 4JFHD 1PKQA 2GTZB 2JQZA 2RH0A 3QPQD 1UWGL 2XVLA 3WE6A 3QIUC 3EBIA 3WHXB 1MFAL 1PX3A 1J5HA 2WZ5A 5I74B 1LO4H 3V7AE 3O4LB 3VFSB 2JJVA 3ALWA 4PREB 2CLRA 4FL4B 3UGXA 4MJIB 1YMME 3V0FA 1P5VB 3OD3A 4BCXA 1EQWA 3VD9A 4LQFL 2XKSA 4U3SA 4X6BA 3KLHD 2XY1A 3F2LA 2WXKA 1FZOB 1YAZA 1PU0A 2EC9U 3OAYH 3PGFH 3G6JB 4GSXA 3S98A 1LP9A 2X7LA 3GMRB 3L9YA 2E74C 3I3BA 4K4KA 4MA1B 5BUGA 5GQBA 1H3WM 2V5MA 2WY3B 2Y7OA 3LSOB 4I88A 5F9OH 3C5ZA 2H3XC 2JI2A 2OTWB 5D2LA 1R3KB 3MXVH 5A43C 1AGDB 1EEZB 4M3KB 3D0LA 4OZFH 5JMOC 3Q2LA 1SGKA 1LGVA 2EDRA 4HXAH 3ZTNH 1U8JB 4ZMWA 3AC0A 5C97A 2J44A 5CEYA 2BVYA 4P3DB 5CHNB 1C7TA 4X7EC 1CDJA 2JKIS 1UA6L 3SPCA 2E9BA 3FONA 3W82A 3HS9A 1CTOA 4KBPA 5JUEH 2DLGA 3BN9C 2XKNB 3RWCA 1WA1X 1K8IB 3FQRA 1JPSL 3TC9A 3QJFA 5ESAA 4BQ9A 5BO0D 3ZQXA 4AL8L 4XP5H 1FIEA 3QULA 3VFUB 3I3DA 5EN2B 4BK5C 3UH8A 1AZCA 1KEGH 1W15A 1S7VA 3OKEB 5JQ6L 3S5LG 1UGKA 2BHZA 3FFCA 4R5VA 3QO0A 3I02A 1I8IB 5EU6A 3H55A 1IGFH 1XGPA 1GC1L 1AD9A 3DETD 3DBSA 5A2KH 1JRHH 4HHAA 1D5XB 3L4XA 1MHEB 4FTVA 1T7ZA 4XX1E 3OXRB 3QIUA 4JUTA 4KFZC 3WNLA 2VXTL 5E9NA 5E03A 5JIIA 4R7DB 1JV5B 5CU9A 3P0GB 5C0BE 3KYMB 4G8EB 5J13B 3VRIA 2VLKD 5DS1A 2K9FB 3UP6A 3RJQB 4LKCB 1P84J 2VDOB 5C08E 1QSED 3QC6X 3UZEC 1BVKB 4TVPL 3B9KD 3SE9H 2VAAB 2AS5M 1HWWA 2FR4A 1GYAA 4L3AA 2G3ZA 4XWOC 5FYJH 4R0LA 4FX5A 1G7QB 3BLBA 4OTXH 4WWPA 1GOGA 1V05A 3NZUA 3TNNA 2ZWZA 2WO4A 4YLCA 2WUCL 5C09E 4AQAA 3QO1B 4EUPA 1KEMH 4ZOBA 1WK0A 1RIHL 4DEPC 4N2EA 4XMXA 1IVTA 2R0WL 4H8QA 4ZAKB 1MLBA 3SOBL 4F8QA 2ADYA 3H1ZA 2DPKA 3PWUB 3J8F7 2R4RH 4JZJA 2JF1A 2JJSA 3BQUA 4GSDL 5I8KL 3UTTB 5MP6L 4LSVL 2X89D 4TKWA 2IH3A 2WXGA 4OKDA 4FFVD 1NKOA 1QFWI 4CU8A 1NC2D 2BP3A 2BPBA 2DKUA 2JH2A 2VB5A 3ETBF 2DIAA 4P2CG 4PRAB 1WTLA 5F7KC 1NFKA 3MV7E 3MLXH 1MFMA 5TPWL 2EACA 2P26A 4IU2B 5D7JD 1KYDA 3CVIL 4F33A 1AGEB 1JDAA 4PJCE 1CE6B 2EH8H 1GPOH 2YGVA 1MCPH 2D4DA 5JO5B 4W4OC 3RHWF 2UZXB 3VRJB 1Z3GL 5GS1A 5SWZA 2CR6A 5I71C 1TQSA 4WWKC 2B08A 5BOPA 3C6LA 4HUMB 4TM9A 2BSRB 1TQCC 3LV3A 35C8L 1LD9A 4ZFFA 4YDVA 1I3UA 3BZEB 3O9WA 4LSTL 4NC1E 4HUNB 3QJVB 4A68A 1EDHA 4OBRA 3KCPB 3CK0L 5D7IE 3CZJA 4OZGE 3AB0C 2JTDA 4HKJA 5BS0A 3H2PA 3HZVB 3AQXA 3GI9L 4UIMB 2X4TB 5T1DL 4JFQB 3WY1A 2WCSA 4GXVL 4R96B 2F5AL 2V2WA 4OZHA 5D55A 4XI5C 3MRQA 3BP7B 1G7HA 4ZW3A 5D5MF 3ZHFA 4YQXH 4QYOB 4AOFA 1MFBH 5C0EB 4JL1A 3QNZA 1F8TH 1I8MB 5GGVL 3ML9A 5J4MA 1AP2B 3EBGA 4N8PA 3DA0A 4RFEB 1YDPB 1WG3A 5EZLA 1FNEB 5IMLA 5LXVA 2JV6A 5CIPB 1RIVH 1T1XB 4MB4A 5E9DA 4QHUB 1EEZA 3BPOC 2OCCB 1U8PB 4CA4A 3HBGA 4EZLA 3ARFD 4A7TA 1N12A 3S48A 1NOLA 4F15C 1D5MA 3ENEA 4XRCB 1U8IB 3ECBB 3V4VH 3VFPA 2IQAB 3QEQE 3SODB 3NCXA 2K6YA 5MENE 3DSFH 2XZAH 4O5LL 4XP5L 1XVSA 3UAEA 1HOCA 1PJWA 4W9GC 5KJ4A 4XWOD 2BNUB 3QUXB 4BH8B 1I1AC 3MGOB 5ITBL 1NBVL 4CGTA 3ULVD 1YJDL 3BHBB 3A4FA 4M1DL 4N0CC 3EFFB 2FBJH 1GHFH 1S78C 4UQ9A 2AFNA 1KOAA 2F8OA 1AGBA 1UD8A 3R4DA 4CSTA 2O61B 1YEEH 1NCTA 5ID1A 3MRDA 1AJ7H 1E65A 4NQXB 2UWEF 3MXWH 1T04A 3W3BA 2FEDC 4FQ2H 1JV5A 4HCRH 2J12B 5C0CA 3S2AA 4GY4A 3WSQL 4NBYB 1E6OH 4KK9D 1BVLA 3Q3GB 4AQ8C 2Q86A 2P5EE 4JPWH 3WJMB 2OJEA 3RDJA 4BGLA 1UTDA 5FFGA 2A73B 1ZLWH 3HN5A 1GH7A 4P3CL 4NQUA 5I8CA 4P5MA 1T2QH 1SXBA 4EE2A 4KPHL 2X6BA 1I31A 1B0RA 1MWAA 2IH1A 1EDQA 4BSVB 1ACCA 4JR9H 5L4IA 4NQEE 2NPLX 3VWJA 1I1RA 2NXYC 4NQDE 3IMBA 4LLAA 5FGRA 2CE6A 2GTZA 2HN7A 5CAYB 1ZV5A 4JFUA 1OD9A 3IJ9A 2GAZA 4O51B 2W5PA 4WHTA 4FABL 3MRNB 4R83A 5L4MA 3ZRCC 4C83A 5TPWH 4QHNA 2NX5E 1E9PA 4I8DA 1I7UB 2VSMB 3SO3B 2NZ9D 3FB7A 1J8RA 1YLBB 4X5RA 1J8HD 2EH8L 3LZQA 5HGAB 3WAJA 3DOHA 3HG4A 3K71B 5ISZD 3QA3A 3IGAB 3ILPA 2A4CA 1CG9B 4IBLT 5DGQA 2P3YA 3ABZA 3EYFA 4Q6YA 3FRPA 2J55A 2F5BH 4JANB 3TNMA 4X9BA 2P8MA 2R1WB 1Z1WA 4GW5A 4M6AA 4JO3L 3MRKB 4FNRA 5C7ZA 1O6SA 4KWUA 2L8AA 3NT0A 3Q06A 4ZFFB 3NJHA 4FEIA 3A22A 2DW5A 3LY6A 4O4YL 2TSAA 2A4ZA 1H3UA 1CD9B 1ZSDA 1FL3B 2ZQKA 2I9TB 4DK6A 2FUQA 2X3CA 5GGSB 3RWIB 4IQHA 4YVNA 4GXVH 3IKKA 5D1QD 2MOQA 2Z3FA 2ATPA 5IVXB 4U1NB 1T21A 5LWYL 2NNCA 1Z9PA 5ID0B 2CO1A 3KPQA 3ZPDA 1UT2A 1AGFB 4F2ME 3WMPA 4YHNB 3T77B 1UJ3B 3ZKMD 3HPLA 4GSDH 3SJVA 1KXHA 5CBEB 5K39B 4PB0L 1PF3A 1I8MA 3MJ6A 4KKAD 1XGPB 2B4CC 2OQJA 3FUIA 1AY1L 2JQMA 4U05A 5IJBC 3V6OA 1G7JA 2ZCKL 4J4PC 4H1LG 4XP6L 1P4BH 4LARL 1M71A 4Y5YC 4GIOA 3UBXA 1YNKL 3FNKA 2WCGA 3GSOA 1TJIL 2ADGB 1HIMH 3ECBA 3MZGB 4ANVA 5IMKB 4GT7A 1AIFA 2W91A 2OL3H 2ZNWA 1N26A 3QDJA 5D6CB 3O45B 2OMBA 4FRWA 3TOPA 5TE6L 1EO8H 1YECH 1AXTH 3AADB 1Y7VA 4J1UA 1G7QA 1YJDH 1I7TA 3C09B 4WUKH 3TNNB 3V7AG 1HOCB 3V9EA 1KCSH 2P7TA 1QYGL 4HAFA 2C3HA 4ZBJA 1CJYA 4D9LL 3MJ9L 2O6EA 4G59C 4QF1A 4BBWA 2VXQH 1RHHB 4JVWA 2Y7LA 5IVXE 1P7KB 2ARWA 3ZKXC 3GZPA 5E4EC 3LKSA 4FQJL 1E8YA 1IEAB 5SX5H 4A37A 2ED9A 3IFPA 4AM0Q 1GJUA 5CM1A 3ZE0F 1JD9A 4GP5B 3WSQH 4NBZB 4WJKB 4YZFF 4AMKH 4DKTA 5T3XL 3GHEH 5T1LA 3TBSB 2OTUA 3O2DL 4XE5B 5BZWB 5A2FA 2W95A 3O8XB 4XPTL 3ZL2A 4P3CH 1N6QH 1E8XA 3OKDA 1PLGL 2K0RA 3PDDA 2CMRL 4DOHE 1ZTXH 3SPVA 2R4SL 2XPGA 4ESKA 1BFSA 1BFOA 1JP5A 1R3HB 2NT1A 3DHJA 4EN3A 4X99A 1YEWA 1JZFA 5GRVL 3BDYL 5F9JB 1IKNA 2ZUUA 3WI9A 3V0HA 1XGTB 1BFTA 4U33A 2Q6WB 3SDCB 3F7YB 1S4IA 3EDEA 3BWAB 2YPVL 2QT6A 3LNHA 5JNYA 3OKMA 4JY5L 3BT2L 3LV3B 4PLOB 5I1EH 2PCFA 3X3FL 4FERA 2DWDA 7PAZA 1AHWA 3BW9B 1CXEA 1KDIA 3K2UL 4I4WA 4AE0A 3NZHL 4DPRA 4OLVH 4ODVH 4IRZL 1ZGLM 2WZPA 2VJ0A 5GS0L 3KPSD 4LSUH 2R23B 5JUEL 4AQZA 3VG0H 3APNA 3W5MA 1OTSC 2CHNA 3L08A 4I0PD 4MQ7B 4NQDB 3D09A 3WS3B 5SV3A 1XV8A 3SO5A 2QDVA 3FQNA 1VZHA 2EABA 3LRSB 4KTDL 1GR7A 1VFMA 3BVUA 4F91B 5CLXA 2C9VA 3FQWA 3GBNH 3I6GA 4XC3L 4KK5D 1DLHB 4MD0A 2X42A 5F72S 4LXFA 3UDWC 1JRHL 5GZNC 4IMKA 1DFXA 4XNBA 4MA8L 5ALCL 3C9NB 4NUQA 5TDNA 3L2NA 3O3AB 5BNXD 4OFYA 4TSCH 1HCZA 1HH6B 4NB7A 4U0RC 1HQRA 1BF5A 3FCGA 4RAUB 1WE5A 1B4RA 3GXFA 1ZV2A 2NY5C 3D48R 1GGUA 3CPLA 3FL7A 2NQ3A 3BZFA 3B7TA 3A6OA 5L7XL 4QRPE 4ADJA 3MBXH 4CC0A 4ZSOB 3HHSA 1CF1A 3PHOA 5G2NA 1YAIA 1EXGA 3QRGL 2J20A 3UADA 3MJ7A 3RWDB 4RGOH 4HLJA 4B7IA 5DF0A 2X2HA 1HH9B 3ELAT 3M88A 5CN3A 5KJRL 2ERJB 4FFZA 3VSQA 3CFBB 3GPEA 4FA7B 5MENB 3QEQB 1FHNA 4MDJB 4R5XA 4GUQA 2WWMC 3DX7B 4OI9A 3P3RA 1P4IH 4NZ8A 5LGHH 4K23L 2DWTA 1IGYB 4U1KA 4KVNH 3KS0H 4YHKH 3RGBA 4IDLA 3IVKB 3FN3A 4D9QD 1Z9LA 5JHLL 2RTTA 3WS6A 4AKQA 4JQXA 2HKFH 2YN3A 5TFSL 4DEPB 4IKJA 4GSQA 3ZDZE 3O11B 1YMHB 5D7IF 4GKOA 2H8PA 3G9AB 1EAPB 4HG4K 4BZ2H 4R0LC 5DMIH 5DDHA 4N26A 5ABDE 1XGRB 1VGEH 4L3EA 2YMXH 4JFZH 2K4WA 4YUEH 1ZPLA 3OAYK 4Z77B 3OAUH 4OGAC 2YKKA 1Z3RA 4AUYA 4QRAA 5IBUG 4I1NB 4U6HA 2O6CA 4O4YH 4W9FC 1NDMA 2GAZB 4O51A 1UUNA 4DZ8A 2IPTL 4PJIA 1XR8B 4LEOB 5L0QB 2J6EL 4HQQL 5I75C 1N7MH 5GGUA 4PJCF 1MPAL 1AI1L 1TQVA 1XB8A 4NAMA 4NFCA 4WENB 2IADB 1X3DA 4I2XB 4J3OC 5CP3H 5E8DH 3NFSH 4N0YH 5T1MB 3SD5A 3KWTA 3RAJL 5AFAA 4WUUD 1CBVH 3RGVD 4WNQA 3VTTA 3F3HA 1P5UB 3MU3A 4D8OA 4NQCE 4KUZL 5FHBL 5DK0A 3V52H 1EJOL 5FYKL 1F8TL 2ESVB 1M9SA 3R4RA 1EHLH 2DQCL 1ZVNA 2XIBA 2CRYA 3ETBJ 3FFCD 4UB0L 2DTML 2HH0L 1RZIB 3DXAE 1BX2B 4U31A 2V4LA 2CBPA 3IFOB 5AAMC 3MV9E 4XAWH 4IJ3B 4ODVL 5E24E 3AWEA 1MCOH 4M48H 4F7TA 2IEPA 1TTCA 1QVOB 2JKRM 1RUML 5EWIL 3T08A 3V4PA 4A2HA 1RZQA 3ME0B 1F13A 4OLZL 3UTTE 5J6GA 2QKIC 2R2CA 1EEUA 1E8WA 4MWFB 3TIEB 4CSZA 3BUTA 1K6QH 4MAYA 3P73A 4Y4HC 5F7MC 4DGYH 3D5OF 3QFDA 4K8RC 2IOIA 5HPMA 1E2VA 4KVCH 2F19H 1ZGLB 4XGZB 3OX8B 5C09B 3F7VB 3QUKB 4XXDA 1U3NA 1D5ZA 3MLRH 2EDWA 3UTZB 1BWWA 5J0BA 4ZOEA 5A16B 4NO3A 1FYTD 4QHPA 2WXLA 4KDWA 1M71B 2PMZA 3LQAL 5C08B 3BDXA 3MLWH 2VQTA 3UAFA 2PCPA 5B7FA 5JHDD 2X3AA 1MLBB 4CKVX 3V0VB 3W9EB 5ERWA 5C0BB 1RSFA 2CBOA 1G6RL 3I50L 4MLIA 5E1AA 4LDCA 4OCXL 4JDEA 5HHOE 2WYTA 3AY4A 5HHQB 4WTXA 1AYOA 3S3PA 5ICXB 5A6LA 4ONHA 3CPLB 4U6YA 3KLQA 4ZDHA 4ICWA 4JE0A 4B9YA 5AW3B 1F3JB 4EOWL 3MLUH 3I2CH 5FKAB 4CW1B 3H4FA 2WBJA 4XMZA 1BQLH 5J3HD 1WIOA 3LRHA 4F33B 1A8JH 1OAXL 2G5BB 1OSZA 5E8EB 3B8SA 4ZUTB 4UV4H 1A25A 1E3ZA 2AAVA 5D8JH 3WFHA 3VB9A 4ABQA 2DM2A 4K23H 3MSPA 4RA0C 3GLAA 5IP4A 2XJKA 3GSQB 4OLVL 4JUSA 2ZWKA 1RPUA 4DQOH 4M7ZC 3MRMA 1YNKH 1KENH 3T8XB 3VFVA 1QPPA 3OHXC 5TGBA 1OCCB 4Q9BA 4JFDD 4Z95L 2R9HD 4ISVB 4KROD 1BYPA 3KWUA 5I17B 3FU8A 2R29A 1NC4D 1SRDA 4LSQH 3IN2A 3AB0B 1WWWX 3GMOB 4YXKH 3RA7L 5DRZA 1KCSL 5J11C 2OI9B 1J05B 3P4LA 5IT2H 3V10A 4UQ3B 1KBGL 3MJ9H 4XCYA 2EE6A 3ARQA 4DT2A 5E08H 2VSCA 1BD2D 2IDCA 1KC5H 5EOTA 3FHAA 3F7YA 5D2NE 5DHYB 3TT3H 2Q2LA 4MZRA 3VXMA 3FCUB 5SWSD 4NENA 3BW9A 3C5ZB 5JW4Q 5D70H 4MJ5B 4FJZA 1HFUA 1UCTA 2EKSA 1IE5A 2CO7A 5T3XH 3RL2B 2Q8BL 1K8DB 2WLMA 3BSZH 5E8DL 2V7HA 3KWXA 3T0ED 4HUVA 4XPTH 3AS2A 1ZK5A 3KVQA 2VMCA 1ID2A 1WA0X 2ZP0T 3QH3B 2DQTL 3S37X 3HKZA 2Z7ZA 5C6TL 4GT0A 4XP9H 3WNOA 3CNKA 3BAIA 1TVHB 4NFBA 1DJGA 1RZ8A 2CK0H 4PJFB 2TRHA 5EO9A 3C5ZD 1TVBB 1TEYA 3L4YA 3VAEA 1NAML 2W07A 3K4AA 4P46B 3RRQA 3LN5B 2A6KA 1YO4A 3MLVH 1E0OB 1I9IL 4L4TA 1JG9A 1OTTD 4G9FD 4N24A 4P48A 4N0UB 3ZDXF 4M03A 4P2OB 4IBTA 1LTXA 4R7LA 3WXWL 4M3HA 4WEEA 4PV8A 3R0NA 2WXPA 3U4BH 2JVUA 1GZPB 3SGDH 1EPFA 4K3EL 3LH8A 2KYIA 1SHSA 3HOGA 4UT6A 1WDAA 4FCAA 3CVHB 1OALA 3H0TB 2Q76A 6CGTA 5IW3A 3AROA 3L3OC 1FG2B 1U30A 3E6FB 1HEJC 2L4OA 1GA2A 2Y3NA 4N1EA 3HLAA 1EH9A 4IMKC 3WEMA 2VITB 2JCWA 2IANA 1YZZA 2DBLL 3MLRL 3DBXA 4PJ9D 3W1ZA 4AWJC 5I73C 4MS8C 3W2DL 4N2HA 1ZGLA 4YK4B 3RYMA 4I18C 3T3PB 3EO1A 3WXVL 2PR4L 1EGJA 2EVHA 4UBDC 4D0CA 3NG5A 5D6DC 1REIA 4ZO9A 5GS2D 5DEZA 5AW1B 1CU4L 2AQ2A 2VXSL 3RY4A 4Q6KA 2FE0A 4N8CH 3S36L 1BOGB 1Q4NX 1KTLA 3CDZA 5DWPA 1A7BA 4J8QA 3BVNB 5ECGA 1QSVA 1A9BA 5FS5A 3WEXB 5IVXF 4DGVH 4W9HC 1AQHA 2OK0L 4PLJD 4KK6C 4E5XG 1NM4A 4GAYB 1OM9A 1QLRB 2D31A 2N0MA 4PJ5D 1VCAA 1YMHA 4C83B 3JWOC 4TNVF 2YEZB 4DIXA 1I7UA 1E5BA 3S4SA 2HJLB 4OZHE 2CHWA 5F6IC 1OK8A 3HG1D 4FXKA 4WU7A 2C8NA 4W1TA 5AW7B 3QZPA 4ZK8A 3NAAL 2B77A 1IC4L 5JQHC 2Q7AA 4RGNE 1LEKA 3MJ8B 2YPVH 4O2EA 1XBRA 2F53B 2F54B 1F90H 3OAZK 1PPIA 1TTFA 3ATAA 3B3BA 4DN3L 5JPMC 5DHXB 1A3LL 1CTMA 2BSRA 3JWDL 4KKLD 5B4MD 3WGUB 4CJ1A 3RGHA 1BF8A 4AV4A 3S3BB 1NGWB 2CG9X 4OCNC 3EYOA 3HRZB 4HD5A 1GJIA 3Q5YA 5J6HA 3LZFH 1NBZA 1I85A 3DIFB 1U8NA 2WVUA 4I3SH 4YPGA 4L4JA 2A9CA 3L1GA 4UAOC 4FYQA 2NTFB 2EKJA 5D93B 4ZTOH 5IT2L 1ADQA 4BZ2L 4OD2B 3WN6A 3KYAA 4PV9B 4YUEL 5FV1L 2MTAA 3BP7A 4HJ0C 3RWHA 1GGCH 3P4OA 1B6UA 4DO5A 5IW6B 1NSNL 5DJDB 2DLFL 5FGSA 3LKNB 1QABA 3W9DA 2H0PA 3W38A 3QRBA 5AOJA 3MODH 3QWRD 5DZLA 3LMJH 4G5ZH 2BIOA 1YSOA 5D1QA 3SGEI 3BSZA 4P2OC 1TQUA 3NFPB 4H20L 1QFUL 1V8HA 2JELH 3CH1B 2GT9A 4OCRL 4UU9B 1B88A 3CGTA 2QPDB 1A47A 3QZWB 3HKFA 2TRYA 5EZIH 2PPEA 4XP9L 4UIKL 4K5MA 4JW3A 5IHUL 1Q9KA 3PWJA 3EOTH 3CLFL 3GBEA 2YOCA 4IHOB 5ANHA 1EK3A 3VU2A 1DL7L 3X14B 2XPZA 1OAQL 2D2CC 1JV2A 1V3JA 3G5YB 4O2CB 1TVBA 5EZLB 3ZQWA 2LR4A 5D7SH 5EZJB 2DQCH 3FO9A 1AQDA 4Q6IA 4MB5A 4PHXA 5C71A 1AKPA 2R29H 4HWBA 3QW9A 4OF8A 3KG5A 2CBTA 4AQEA 1KXTA 3KEHA 4HIEB 4M9OA 3VFOA 3IJ8A 3WIHA 3AXLA 2R39A 4FFYH 4Z7UE 5ID1B 3PREA 4ALAH 3HBZA 5B38G 4G8FA 4HH9B 5KOVC 3OV6A 4GG6E 3AG4B 3KHOA 4J6IA 2IMMA 3QUZC 4WI6A 1ITCA 1FH2A 3EUUA 3M07A 5KYUB 3EJPA 2F58L 2BNRA 4UNIA 4LOEA 5J11B 1WH0A 4P9HC 1DBKH 3GMPA 2GHZA 1AO7B 3HAEG 3T2NH 3DSNB 1E27A 4X9IA 3F62A 1S7UA 3VA2C 4PR5B 1N4XL 2H4EA 4LP5A 4U1IA 4BV1A 3HUJA 5F1SA 3LTVA 5DJAA 3VXTA 2AQ3A 1WISA 3TH4T 3L3GA 2H1LM 3WIAA 1E6OL 2CGZA 1LWHA 5DRNB 2VMDA 1R3JB 5D1XD 4A6YH 2IDFA 5I76A 5JXAL 1IC5L 2XTSA 3QIWA 5JW3L 1BEXA 5B38B 3T0EA 4W4OA 4UUJB 3LIZH 3BXNB 2WLLB 5IB4A 5E6ID 4PJDB 3VFVB 1KLGB 4ZUUA 3TZVC 4CC1A 1J8SA 1XF5A 1DEDA 4NZRH 1DBBL 1N8OE 2OM5A 3KXFE 1S7XA 5F1KC 4YVUA 1OM3H 2VRQA 2NY7H 5FO7B 3EGSB 1EFXA 1RIHH 5KBPA 1CLOH 1MDTA 1NAMH 1T0MA 2E7CA 3P69A 5HYJE 1DVFC 1I75A 4U1JA 5K1NA 4UT6L 2IJ0C 3MXVL 3CX5K 4NQDA 1PX4A 4XXWC 3ZDYF 4Z3GA 1KIUB 2IF7A 4HXAL 3ZTNL 5F6IB 1OCZB 1YY9C 4GEJA 3DKHA 5GRJH 4B7LA 4HS3A 3VH8B 3UPRB 1XL6A 3F5WB 3HZKA 4PGCA 3PGCA 4X98B 3DJ9A 5CLTA 2KZ1B 3T3MF 3BP5A 1ESOA 3IRPX 2MMXA 3M1OA 2QPEB 1PDKA 4WFHE 3NEEA 4PRID 1HKFA 5D7JA 3UTPD 4WNSA 3V7MA 3ZL4L 1F4YH 3VUAA 1ERNA 2E4FA 1O7DC 3VYOA 3TA3B 1UA3A 2QGEA 1JK8B 5IQ7L 4MMZB 3PAYA 2X89A 4DGYL 1NFDA 2FB4L 2ZKMX 3IGUA 3KVDD 1NFAA 4L37B 3LKOA 1OAJA 2AJXH 2IWEA 2X4RB 3BQUD 4PJFA 4U3HA 4EBQL 2AJZA 5EEVA 1JZGA 2VDLB 4RAHA 4M5TA 4M29A 4Z7VF 4H5SB 2K6WA 4NHCH 3STLB 1UKTA 3S3DB 3WNKA 1MW1A 1VFBA 5CGYD 2WSPA 1V27A 1KIQA 3V5KB 2V8LA 3LHPH 3NSXA 4EI6A 1F5WA 1KB5A 5I24A 1BZ9A 3ARPA 4ZX4A 2Z9TA 5FWRA 1WCBA 5I1DB 4OZGF 2BNQD 2YQGA 3CSYA 3SE4A 4QWWC 1DBJL 1G0YR 3EOYG 3EJCA 4TVPH 1DDTA 1QSEA 4IDJL 4QXTB 1NC4B 3CLFH 5FYJL 4ZQKB 4WU5B 4KK5C 3QC5X 1QRND 2GPZA 2BLFA 4R4FL 4X8CA 4PVLA 2WUCH 1BQHA 5C6TH 4LLUA 3MLUL 5C0NC 4Z0XB 1WYJA 4Z7OE 3FCTB 1S3RA 3QIBD 3HPLB 5DFTA 4LCCA 4DUWA 1M57B 2WQAA 1H8OA 2OSWA 1I7TB 3PHAA 1N67A 3FQYA 3L4TA 4B27A 2NNRA 2DWSA 3WFEL 4ELME 2EYTA 1GW6A 1I9IH 4NKMB 4P4RB 1NOAA 2W88A 3V9FA 1F1GA 5D7LD 1RHHA 2YPLE 3U0PB 2WUBH 3DI3B 5FGCB 2IALB 5AW2B 4S11A 3ZE0E 1PYWB 2Y7QB 3TJPA 4WUKL 1XAKA 4P3WA 5DC0A 5GIRA 4B60A 2CDEB 3IDNB 1OGSA 3O8XD 4JKPL 3PHSA 5K33A 3WHXA 5ABZA 2FSEA 1QFOA 1Z9MA 2YJLA 2WLNA 2GK0A 2Y69B 2E7MA 4Z7OF 3PUCA 3WTYA 4G6JL 4Y88A 1R75A 5C7XL 4GIPD 1ED3B 1Z0NA 3Q8FA 4KU1A 3W2DH 3PWLB 2NXYB 2A6JA 3MREA 2WXQA 2WXHA 3HE6C 5HJ3A 1B90A 4HCRA 3LEXB 3ZBMA 4O58L 4NN5C 4M7ZB 3UACA 4FQ2L 2C3VB 3B9KA 1M2VA 3MFFA 1YUHB 5CZVH 5DJXA 5C0AE 4V1DD 2ODIA 3QIBA 5T1DH 1SLVA 2DIBA 1XSOA 4FGMA 2BOBA 4BSJA 1MHCB 1UM5L 1CGTA 4DVBB 3QDGA 3W81A 5KZCB 1PD1A 1ZHBA 2GQHA 2IXQB 3GMQB 1ZT7A 4IKLA 4Z7WA 2Y07L 3HZYA 4NOFA 1G9MC 1U93B 2JCCF 5GS0C 3CH8A 5E5MB 4MAYB 4FTDA 2DYPD 2Y6TE 4N2GA 1F11A 1I9RL 2GBAA 1MAMH 2CR0A 4OGQC 2GUOA 4BM7A 3JTTA 4Y4KA 4ELKA 2K9UA 6FABH 5BZZA 3LPGA 3M1CA 5EC2A 1NOFA 4P49A 3FFDB 4JRYB 4WQOA 4Y5YA 1BW8A 4WIQA 3TYFA 2V3FA 2X4NA 5FEBA 5BV7C 5C08A 4LEEA 4WI2A 3S34H 4PJAE 3X1BA 4KTDH 3OLGA 5CKAA 3D05A 4GW1B 5AOZA 5DD3L 3BZFB 4X0NA 3K2IA 4P4KB 2AXGA 4X4MA 4ODUB 4Y4FC 2AMGA 3KJ6H 2R8SL 2XFGB 4ONGH 3O6MH 5AVWB 3EOBA 3MMEB 3MYJB 2CAKA 3S88H 4FHBD 2B20A 1K2DA 2GJZB 4TSCL 3A67L 4S1QH 1KFGA 3IN0A 3ZK0A 1N6QL 2ADFH 1AR1D 4JZJB 3PHQB 1ZVSA 4HH9A 4KJQD 1IUZA 1BECA 1QFUH 4K55A 4U1HB 3QBTB 1IGJA 1PG7H 3QI9A 3WE1A 4Q89A 2BVTA 1I1FA 3LPOA 1UT1A 3BDYH 1NWPA 1NANH 3CN0A 4KPHH 2YA1A 2PYEE 2J1ZA 1U8MA 1IGTB 2FWOB 5DYOB 5HTSA 3VI4A 4Y2LA 1CDYA 3V4LA 1ZLEA 2RALA 4N2FA 3DSNA 1IJNA 5F8QC 4AJYV 3FTVA 4HOMA 3NAAH 3L3GB 4IBVA 4YXHH 1GOFA 1OE3A 2KKQA 3DIDA 1PQZB 1YA5A 3KYKH 3HUJB 4FLRA 3T6XA 4XR8C 2F7PA 5CLWA 3T04D 4DO4A 4YHKL 1P6WA 1HI6A 5I6XB 3INUH 5MI0C 1IGCL 2X6UA 2VMEA 4L3CA 2PO6D 1T66C 1IM3A 1VHPA 4L48A 3CFTA 1FF5A 1IIKA 2VR9A 4ZFOA 2V7NA 2JLLA 2EDKA 3MKKA 3HMXL 4OZ4B 3SDAB 4DZ8B 3FZUD 2MJWA 1PY9A 1MVUA 1Z66A 3O9WB 4Z18A 2H6OA 3Q2VA 2PP7A 2HWZL 5BVPL 1S7SB 4YDJB 1FNEA 4EUPH 2P43B 4UOZA 1YHPA 3BO8A 3M7FB 2VZ1A 2Q1EA 3BSGA 3GSNB 4WFED 4F1SA 4ZTOL 4DH2A 1X6LA 4LPVA 2C9UA 1TNNA 2JKLA 2VN3A 4Z3HA 1N4XH 2QGBA 2EE9A 3H8NA 3HVDA 4G1MA 2IWFA 5CFHA 5GGSY 4K94C 1WAAE 1DP0A 1E30A 1CLYL 4NLHA 3UZEA 4Z7WF 3MUZ1 5EZPA 4FNTA 5E2TH 1ZEAH 1IC5H 3VFSA 3CC5B 3LN5A 3NFSL 3PS6A 4M61B 4N0YL 4XNYH 4AQ8A 3MRJA 2X2IA 4PJ8B 5FO8A 2ENYA 4ACPA 1XR9A 5T1MA 2E6QA 4RETB 5I6KA 1D5MB 5KANI 4K2UL 2OMWA 1EJOH 5FYKH 4JM2C 3BGFC 3CXDH 3PXJA 2YKLH 2Y07H 4FG0A 3WIIL 1X9UA 4BXSV 4FQIH 1ZE3H 3RP1A 4LOVA 2EYRB 1U3HB 5FDWA 3POHA 2Y5EA 2JKWA 5DQ9A 2ZX8A 3UTOA 2J5LC 2OW6A 4TLSA 4Z76B 4PLKD 5F7NC 3X3FH 3ULVH 4WRLA 2N59A 1WVZA 5FOBB 1KJ2L 1L5GB 1EIBA 1J8KA 3DX1A 4L18A 3FN0L 4WDIA 3EAKA 2M26A 5GSVB 5L88L 3KPRB 3T0WA 1QSEB 2LFGA 4OZFA 4QXTA 2PCXA 2X12A 1MFDL 4C58B 1QFWH 1NCDH 1NQBA 4XNXH 3FFDA 4JRYA 5GGTH 4DFHA 4Q9QH 1QP1A 2Z1KA 5EULV 3W9EA 1KXQE 4MJHA 2ICEC 1CDUA 5AKVA 4FP8H 5C0FA 2F58H 3ILQD 4ECNA 4W9IC 2VUYA 4KO7A 1N3NA 1WWCA 1JK9A 4QKTA 2NYZA 1T7VA 2Y2WA 4B6ZA 3BVXA 1PSKH 4QXGH 1UWGH 2R69A 4XB7A 1VADB 2LLNA 4I0CC 5IFJB 3DTXA 1BAWA 5GSRB 4NQEA 1M7IA 4O58H 5CEZL 2YD3A 4PWGA 2ZYRA 1OAZL 1ZLUK 5L9DL 1MFAH 1MWAB 2IH1B 5GRYA 3U30C 4FQJH 2QSQA 2Z0UA 4Z5RB 4JM2F 4KQ3H 4M8VA 2OJ1A 3NBNA 4OIFA 2P8PB 1SXAA 1ORQA 3GXUB 3MAWA 4YNYB 2V2XA 3RDTB 3RNQA 3K6NA 2BZCA 3EADA 4PHZA 3KW7A 4PJ9C 4AG4H 2VR6A 4KY1L 1W0VB 1ADQH 1T66D 1AHMA 4NNXA 4WWID 2IAMC 5KSVB 4CBPA 3R06B 3PDOB 4IDJH 4K7PL 4PRAA 3L3DB 5CCHE 2ZOUA 1EUTA 5I9QB 3U2JA 3O0RH 3OKOA 4N0CD 4XVOA 5EUOE 5JIDA 3UC0L 1ZHLB 5D7KD 5DDHB 1E9QB 5K1VA 1OM3L 1XGRA 4AK2A 1EHLL 4KTGA 4CMMA 1GRWA 3SY6A 1Y6NR 1PZSA 2B0SH 3D3VA 5GXBB 4YO0B 2Z93B 2FEDD 1R4XA 1E6JH 1XX9C 5JMRA 3NJKA 3B5TA 2F0CA 4P2QB 1KV3A 1E8ZA 5D5ME 5T3XE 1P1ZB 1EBPA 2YPKA 3MNZB 3MX0A 4NQED 5HHVL 5BZDB 5GZOA 4LNRB 1FVDB 4QXVA 2CO2A 3BVTA 2WUBL 3MTXA 1DANU 2CR3A 5JHLH 1EAJA 1KY6A 3CSBA 4RMSA 5JQ6H 2ZTBA 1TDQA 1VAHA 5DD3H 5EEXA 3VXMD 4IBYA 4GRWH 2PF6A 1L3NA 3BP4B 5ISZE 1INDL 2BVUA 4X83A 2JJUA 5DC2A 2XWJA 3SDDA 1T6BX 2WQRA 4LQ1A 5C0EA 4WI4A 8FABA 1L6XA 5BXFB 1JPGA 2P5WA 4GAGH 4QYAA 4CVWA 4F7CB 3IMTA 5D6CA 3WLWC 4L9LA 3FBKA 4S0SD 1J9CT 3KGSA 3E3QE 1Z7JA 1Z6JT 2A6DA 2NRDA 3BSZL 3JZ7A 3KGRA 2J6EH 3LHPL 4L4TD 4YFDB 5I66A 3DVGB 1QSZA 2FHCA 1RZPA 5SV4A 3P0VH 2IAMA 1H3TA 2OXGA 3FQRB