1EZLA

Crystal structure of the disulphide bond-deficient azurin mutant c3a/c26a: how important is the s-s bond for folding and stability?
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
128
structure length
128
Chain Sequence
AEASVDIQGNDQMQFNTNAITVDKSAKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALMKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords AZURIN
publication title Crystal structure of the disulfide bond-deficient azurin mutant C3A/C26A: how important is the S-S bond for folding and stability?
pubmed rcsb
source organism Pseudomonas aeruginosa
total genus 30
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 1ezlA00
1ET8A 3AZUA 3BVDB 5D4IA 1NIDA 1SFHA 4ZK8A 3CVBA 3ZDWA 1XB6A 2BWIA 3OQRA 2BP0B 3V9CA 3SBRA 4YSDA 2GC4C 3ABMB 1A4AA 1JVOA 3AG3B 4EF3A 2X87A 2XU9A 4DP0X 2GC7C 3IN2A 3ASOB 1PMYA 3UAAA 3CDZB 4E9SA 4UAHA 1JERA 4KOBA 4A2HA 3NJFA 3ABKB 1W6WA 4P5RA 5F7AA 4PAZA 3T9WA 3FSZA 4JKNA 1GS8A 1KDIA 3FU9A 3NJGA 4G7QB 2JFCA 1BYOA 3TU6A 3X1FA 2PP7A 1B3IA 1GY1A 4E9WA 3DTUB 1WS8A 3EHBB 5B1JC 4GY4A 1BQ5A 2OCCB 2UXFA 2Q9OA 3MBWB 3NJKA 3PLYA 4Q89A 2P80D 3EH3B 2XV0A 1WA0X 4E9YA 2VW7A 1E5YA 3CVDA 2W88A 4M4RB 5AZUA 2BP8A 1KYAA 4DP8X 3EH5B 1R1CA 1J5CA 1J9TA 3QQXA 1CC3A 1BYPA 2PPEA 3NT0A 4CSZA 6PCYA 4WKXA 2ZXWB 1E65A 3DKHA 1J9QA 2X88A 2EINB 3IN0A 1KBWA 2PLTA 4YL4A 2YAEA 2HRHA 7PCYA 2UXTA 1L9QA 1PCSA 5D4JA 2PP8A 2QDWA 5FC9A 2HX8A 4YSAA 4L0PB 1JZJA 3OMAB 2EILB 3PXLA 4WTQA 2PPAA 1NICA 4UF7C 4AKPA 2XX1A 2YARA 5TK2A 1RCYA 1SF5A 4HCIA 2VW4A 3HEIB 3FPXA 2B3IA 4UANA 4G7SB 4G71B 3AG4B 2CBPA 1ET7A 2YAFA 1AANA 5LDUA 2GB2A 3S3BB 2OV0A 1UATA 2Q5BA 2UXVA 4KNSA 5B1BB 2I7SA 6PAZA 1CURA 2XVBA 1JVLA 2TSAA 4YSQA 3FYIB 3X1NA 2I85A 1FA4A 3PPSA 3OD3A 4GP4B 3JTBA 4QKTA 3H4HA 3IEAA 3FPYA 2XWZA 1BQRA 2ZWNA 1ADWA 4P5SA 5IY5B 3AG2B 2DY2A 3CG8A 1AZCA 4BWTA 4YSEA 5I6OA 4GYBA 3T6ZA 2LLNA 3T6VA 1SF3A 3IE9A 1JOIA 1HAWA 2DWTA 1ILUA 1MDAA 1X9RA 2VMJA 5AKRA 3UABA 2PCFA 4YSRA 4KO9A 3S3DB 1VLXA 2AZUA 4HHGA 1JZEA 2BZ7A 5B1KA 2DYRB 1OCOB 3ZIYA 1FWXA 5A7EA 2AANA 2W8CA 2FWLB 1PF3A 4Q8BA 3PAZA 1AOZA 4DP5X 4TXVB 3L45A 1L9RA 2VW6A 1AS8A 1ASPA 4KOCA 4RH4A 3HB3B 1ZPUA 2XXGA 1M56B 1PY0A 1HAUA 1PNCA 2IWEA 3ABLB 2FQEA 3WI9A 3AW5A 2VSMB 2CALA 2VM3A 1QLEB 1HFUA 2BP8B 1PLBA 4YVUA 1SJMA 2YAMA 1L9SA 4YSTA 3FSWA 2IH9A 4BDVA 1NWPA 3QJQB 1KGYE 1XB8A 4JHUA 2WO3B 2UXGA 1YLBB 3X1BA 4NAJA 5I5IA 1V55B 1GR7A 1ZIBA 2B08A 2WSDA 5B7EA 3NSYA 1IBZA 1NPJA 1OCRB 3IBOA 4HIPA 2AFNA 4A68A 2QPEB 4HZ1A 3EH4B 1IBYA 4DP1X 4KNTA 2A3TA 2PPCA 3D12B 3FQ1A 1N70A 1AACA 1A65A 1JZIA 5ANHA 2E86A 1A4CA 3X2QB 3NJIA 4BK5C 1URIA 2IH8A 1NINA 1J5DA 4A2EA 2JKWA 4DPAX 4FA7B 4HCFA 5F7BA 3T6WA 1AAJA 2GHZA 1GW0A 1MZYA 4E9VA 3MX0B 2AZAA 3WNJA 3UADA 4X4KA 1TEFA 1KDJA 3NJLA 3KW8A 1GYCA 5B7MA 1PZCA 3DIVA 2PCYA 4E9TA 4F2EA 2FJSA 2YAPA 4DP4X 4N4YB 2H47C 2ZOOA 2IDUA 3ASNB 9PCYA 2CJ3A 5B1JA 2GSMB 2HZHA 1OCZB 1OOWA 3SBQA 5I6PA 3UACA 2IWFA 1NWOA 1RZQA 5D4HA 2BW4A 1AZRA 2IDFA 4NB7A 4F7KA 2R7EA 3KW7A 3FU7A 2YQBA 1GY2A 3ABGA 5B1AB 2BZCA 1X9UA 2JXMA 4BWWA 2TSBA 2UX7A 1TU2A 4GP8B 3U25A 1E5ZA 3S3CB 5I6NA 1JXDA 1NIAA 2YAQA 1DYZA 1OV8A 5B7FA 1FFTB 1XB3A 1NIBA 2WO2B 4YVNA 1SNRA 2BWDA 1PZAA 3FYEB 2PP9A 1KCBA 3BQVA 4AKQA 4BXSV 4A66A 3NJJA 1AS6A 1QNIA 2XUWA 4W9ZA 3FU8A 3T71A 5I6KA 3QJVB 1DZ0A 4BDVB 2VM4A 2NRDA 3QJUB 1CUOA 1GSKA 1KBVA 2EIMB 2DV6A 4NERA 3EF4A 4DP9X 3PCYA 3TBBA 3WKQA 2IDTA 2J55A 4DPCX 4AI7A 4F2FA 2YXVA 5B3SB 2J56A 1L9PA 2BW5A 1TKWA 2XV3A 1AS7A 1PNDA 2XV2A 2ZONA 1OF0A 1ID2A 5EHFA 4A67A 1NPNA 4KO5A 2FNWA 3T6XA 1WA2X 3TBCA 1AG0A 3OMIB 3OM3B 1A4BA 3OMNB 4JHVA 3C75A 3NYKA 3QPKA 1WS7A 4BXVA 1T5KA 1MZZA 3NJHA 1N68A 3RYMA 4BWUA 1I53A 3ERXA 2FT6A 4K9JA 1L9OA 4DP6X 1SHXA 1BQKA 1EHKB 5I6LA 4YSUA 1W6LA 1TEGA 1RZPA 2FQDA 1W8EA 2XYBA 1ASOA 2FQGA 1AIZA 2FT7A 2FTAA 2EIKB 3FSVA 1AG6A 2BO0A 2MRYA 1NTDA 1XMEB 2FT8A 5PAZA 4YSSA 1AZUA 1GS7A 3WG7B 1SDDB 3X1EA 1IC0A 2GBAA 3PAVA 1AR1B 1A3ZA 4W1TA 4GP5B 2H3XC 2IWKA 2MTAA 3FQYA 3H56A 2P80A 1PZBA 3WKPA 1ZIAA 1JXGA 1WA1X 1NIEA 1ETJA 3GDCA 2H5UA 2PPFA 3GYRA 1BEXA 2EIJB 1SFDA 2BHFA 1ET5A 3G5WA 5E9NA 5I5JA 1IUZA 1AZBA 1PAZA 2XLLA 4DPBX 1PLAA 1J9SA 2R7EB 2QT6A 3WNIA 3FT0A 2IDSA 1CYWA 3FU7B 2IDQA 5I26A 3CVCA 1OE3A 5TK4A 3S8GB 3UGEA 4DP2X 2BP0A 1L9TA 1NZRA 3H4FA 2DYSB 2OJ1A 1M9WA 4G72B 1MG3C 3QJSB 3JT2A 4E9XA 2J57A 2PPDA 1JXFA 4PCYA 1SDDA 1ZV2A 3CDZA 4HHWA 3TA4D 1KCWA 1IKOP 2J5WA 2GIMA 1F56A 2CAKA 4ENZA 4A2FA 5I28A 1NDTA 4YSPA 2UX6A 3FS9A 4KNUA 4G7RB 2DWSA 4HCGA 5PCYA 3X1GA 1SHWA 1KV7A 1V54B 2RACA 4M3HA 3NP3A 2IAAC 4DP7X 1E67A 3QJRB 1OE1A 3V9EA 2YXWA 4G70B 3UAEA 1AZNA 4AKOA 1BXVA 2N0MA 1QHQA 2I7OA 5AFAA 1WAEA 2QDVA 4A2GA 3NSDA 3ZX1A 2VN3A 3AY2A 1A8ZA 2GI0A 1JZGA 4YSCA 5I6MA 1OCCB 1M57B 1PLCA 2Y69B 3NJNA 2VSKB 1BXAA 1GS6X 4KO6A 4FAAB 1V10A 1ILSA 3SBPA 3WIAA 4E9QA 3NP4A 2HX7A 1ZDQA 8PAZA 4E9RA 3ZBMA 3NSFA 3SQRA 2CUAA 2YAHA 1E30A 4YSOA 3GXUB 2HXAA 2HLEB 2AVFA 1JZHA 3QJTB 1EZLA 2Y1AA 1OE2A 3PAUA 4GXFA 2HRGA 2CCWA 4KO7A 1ZDSA 4AZUA 2HX9A 4HALA 2XX0A 5I5MA 1BXUA 1NIFA 4N8UA 2QPDB 3N55A 3AG1B 3N2JA 1JZFA 3NSCA 1AQ8A 2FQFA 3S8FB 2YAOA 1MG2C 2XXFA 4CSPA 4QLWA 4AX3A 1RKRA 1ASQA 3TASA 1BAWA 1J9RA 3FSAA 1CYXA 4MFHA 3NJMA 4HAKA 7PAZA 3CZUB 3FQ2A 4A2DA
chains in the Genus database with same CATH superfamily
1HSBB 1R0AH 3BSHA 1P53A 4TQEL 4GAJL 3VXSD 4ATTA 2L3BA 4S2SA 1AQKH 1IC5L 1OF2B 2G2RA 4U4IA 4UIMB 2ZE0A 4Q9QH 4PGBA 2APVA 1I3UA 1UOLA 4HWZA 4XN2A 3FQWB 3LN4A 4ODSL 4X7TB 4GKLA 4JAMA 4YDKH 4DP0X 1I9EA 4WUUA 4W9DC 5HPOA 3ASOB 1WTLA 3WIFA 3UC2A 2C3VB 4E9SA 3K8MA 5H37A 4UAHA 2DM3A 4CJ0A 5E8EB 3TWCL 3GTTA 1NAMB 4R4FH 2AQ2A 3EYQD 2J1ZA 4OIAA 5E8PA 3DYMA 1OY3B 3I3DA 4F8TA 3ULUF 3PV6A 3UJIH 3DURB 1GS8A 5K59E 3NJGA 3GIVB 4UV4L 3X1FA 2WN2A 2PP7A 4P9MH 1OW0C 5CLZA 5ICZB 5CKGA 2YN5A 4ZFOB 1IAIM 4XR8C 1N26A 1XT5A 5ANME 1FE8L 3EHBB 1ZT7B 4N0CD 1T7ZA 3HE6C 2NX5B 5DYOB 3E8UL 4WNJA 4R26L 4NKDB 3DTDA 1N10A 2KBGA 5JW5A 3MBWB 3RA7L 1AI1H 1RZ8A 1S7SA 2P80D 3QDJA 2X4RB 3QWOA 5DZPA 5I8EB 2XN9E 1J86A 3D2TA 2Y7SA 4DP8X 1NEUA 5K33A 5K93A 1CE1L 4UTBH 5ACLA 3ZRFC 4ZMVA 2HJKB 4NCC1 4YK4B 4L4VB 4JFDD 3CNKA 3V0JA 3KEDA 3MOAL 3H3PL 4XWOD 5DI8B 3TZVC 1T20B 4FN0A 1IQDA 4FNTA 4YL4A 4Y4KB 3MXVH 4ALAH 3PWPD 5DEJA 4X80H 1CMOA 2EDHA 5CN1A 3STLA 2EXTA 4GH7B 5SWZA 1G7IA 4QMEA 1H6FA 1ECZA 2NYYC 3ARWA 3X3GH 3A6BL 4NQCB 4PCSA 3SKOA 1MFAL 3L3GB 2ENJA 4WI2A 1HHHB 4JJ5A 3F3HA 2XX1A 1D5MB 2UZPA 3HS0A 4WNQB 5JYMA 3RPKA 3GRWL 5FYLD 4Y1AD 4BCYA 1XR9A 3JV4A 4G71B 4KU1A 4NP4H 1OM3L 2RGSA 4JGNA 1TQBC 1NFDE 4NZJA 2I9TB 2R15A 2YAFA 4U2ZA 2EYTB 4X98A 1QOKA 5IG7A 2BSTA 1SEBB 2MOGA 4P2RB 4I4WA 2I7SA 5DS1A 3K1KC 4WGKA 1KCUH 4GT7A 1JVLA 4CU8A 3JTSA 3FU5A 1FLRL 3UXFA 1MUJA 3ECUA 1EA9C 2E46A 2UZYA 3CPLB 1D9KD 2FWSA 2VDRH 4N2NA 3NIFE 3TA3C 1M71B 3L1OH 4FMFA 4ODHH 3M07A 2Q76B 3MCYA 1E0OB 2GABA 2J12B 5AW3B 5IEKA 2GJ6A 5EBGA 1MCWM 1YYMH 1ZAGA 3K72B 3QWQB 2VLJA 4H26A 4JM2F 4UBDD 1R47A 3FTUA 2J4WH 3FN0H 4PRAB 2CRIA 3IE9A 4YXKH 1E6OH 2WUBL 1RAMA 3UABA 4YHPB 3LZPA 2TRHA 1KGCE 3QUXD 4MQSB 1JZEA 4JPKL 3IDIA 5LQBH 2R2EB 4AZ8B 3HG5A 2BVPA 2W8CA 5IB3A 2QSVA 3O2DA 1A02N 1X7QB 3MDJA 3VXTB 1DQJB 5J12B 1F41A 1V7MH 2FATL 3ZOAA 4YAQA 4I77H 1WFOA 3LKNB 4S1SH 5ISZB 3HC4H 1UJ3C 4QOKA 4J4PC 1HINL 2NPLX 3CHXA 3P2DA 5KYUB 4RDBA 4M61A 1TO5A 1EGJL 1MJ7H 2FAUA 1SJMA 2YAMA 3UZVB 3S35H 3V55A 1F3DH 4LSRL 4ERSH 3QIUB 2XQ0A 4BHUI 4XVUD 5KS9B 1HEJC 3FQNA 3WAKA 5C92A 1QWHA 4ZO8A 1F90H 1QAWA 4WHYH 3HAEG 1OO2A 4FF9A 4NOBA 1NCJA 4NKIL 4NQEA 4LIQL 2VJXA 3JUYA 1UWXH 1H8OA 3BKYL 1WJ3A 3BDYH 1SPDA 2AV1A 2VXTH 3L3DA 2JIXA 3F7LA 4HKZB 2GIXA 2XWEA 4BH8B 3MCKA 5JIKA 3HUJF 4S1QL 1L3WA 2VIRA 1DBML 1NGYA 4PGEA 3IJHA 5E8OA 4OFPA 2O6DA 3TFBA 4K7PX 4GUCA 1S7XB 4ETYA 2BIPA 5IW6B 1AACA 3IMVA 2A83A 4PRNA 5E5UB 3QUYA 4Z0BH 3L3KA 5BV7L 1FIEA 2FEDC 3HJ0A 2QQKH 1NINA 3KYMA 1KEMH 5GGSA 2WB1A 3UCRA 4GBXD 5F7DA 5HYSB 4MAZA 1FI8C 4FA7B 4JMNA 1RSYA 2VO8A 5C7XH 1UM6H 3Q7JA 5I8KL 2CLVA 4LASL 5DWUH 3UZQA 1ZPLA 4YHMH 5F9JA 2XQBH 4XWGL 4EBQH 2A9MH 4MD4B 4TVPH 4AYEC 3FCSA 4MMXA 2AEWA 4O58L 2X05A 2NMSA 1KLUB 4HWEL 1FJ1B 1M42A 4UM8B 3BRFA 3A0OA 5D2LF 4A6YL 3S6CA 1S46A 4NI3A 3TN0C 3IDNA 4UTAA 5DEZA 5F44A 5EDSA 1U8KA 2BVQA 1A7OH 1R5VB 3LIZL 5D55A 1DTUA 3D2UB 1ZD6A 5AW2B 4XOEA 4Y4HA 3VU1A 1ONQA 3DSFH 5D4HA 3V5HB 4LVHB 3QNFA 4UQIM 2QGEA 1WISA 1GZPA 4PJAE 4HKJA 4WHYG 1OSPH 1THCA 3MFFA 4FLHA 3WSQH 4HEMA 3UPRA 2ZXBA 3O41B 4DERA 1K5WA 1NFIB 4JPWH 1AYOA 2UX7A 1F6LL 1NEZA 4KC3B 2Z7ZA 3T3ME 5CHNB 4MJ5A 4OLZH 5INCA 3GMMA 5KBMA 2NR6D 5HDQH 3HBZA 1FCCA 1SUHA 1EXGA 4UNUA 1KCBA 3US9A 5C0ND 4W93A 2R69A 2WWOA 5IW3A 3FU6A 1PKQA 2OTPA 2ZQKA 2OTUB 2WVUA 2D7TH 4YLCA 1QFWL 2FSDA 4OLWH 1L0QA 1TDQA 1WIUA 2GK0B 3OKKA 5KJRH 5HTSA 5BVPH 5IEHB 4AL8H 5GZNC 2ROYA 4FI7A 4MWFB 4ZMWA 5EFIB 3MRIB 5DRZA 4KI5E 1J0JA 3MLZL 4PHZA 1ETZB 3C12A 1E4KC 1PEZA 3M1OA 1UA6L 5D7LD 2MQCA 3SE8H 1EBPA 3HIZA 3QQ3A 4NN7C 4XVSL 1KJ2L 3T6XA 5L88L 4OM0H 2YRBA 1CGVA 4P04A 5DRXA 5T5FA 2MCMA 1RLWA 4JQIA 3QCUL 2MNJB 3KVDD 3OF6D 5AOMA 2I5YH 2LAGB 1S7UB 4N0RA 4EI5A 3DX4A 4KKBC 5AB2A 2FR4B 3JT0A 5C07B 2ZKXA 1TJGL 1DBBH 2R56L 2C1PB 3VFPA 3MLUL 3MNMA 2VDLH 3S34H 1OANA 3KPSD 5BMFH 4PS4H 4EZLA 1KXVA 3BP4A 2YA1A 1NGPH 3VI4A 4YC2C 1DEDA 3F00A 3FUEA 4GRMA 5D1XA 5L4IA 3WUWB 3RPIA 2ENSA 3REVB 1S5IL 3ARVA 3QPQC 3QI9C 5CEXA 2BINA 2JK5B 1DQTA 5DLLA 4JPVL 1G9MH 2A4EA 2VXUH 3FRPG 3QPXL 4FQQB 2VXSL 2EXSA 4MA7L 4N3TA 2X70B 4PWGA 2G0LA 4PJDA 5J56B 1I3RA 1S4IA 2AKRA 5I1DB 3OKNA 3RGVD 4YNYA 5DK3A 3QR1A 3TO2B 1DBKH 2QL1A 1G6RH 1PTZA 2JKNA 4PY7B 4JGJA 1ZKAA 1QBLH 4NQXB 4MLIA 3WYRA 3WNOA 1AXSA 4GAYA 1NAKH 5LUMA 3ET9F 5E00A 3U0WL 3E9TA 1U9KA 1JFHA 1DVYA 1IUZA 3VWKD 1MFMA 4FC3E 3BVNB 1D6EB 2Z65C 2X53A 4ZMNA 3BYTA 3WXVL 4KHTH 3L8QA 2IDSA 3V6FA 3WLWC 3BN9C 2H6PB 4NJAL 5JUEH 1TJIL 1Z7JA 2DQUL 4CMMB 4EN3B 1BQSA 5E6ZA 1M9WA 3G5ZB 3AT0A 1KB5B 4YHZL 3LDBC 1T3FB 3AFLA 3EDEA 1S9KC 5FO9A 1UB6A 1Q0YL 3PABA 1UB5B 2C1OA 3LKPB 4NQTA 1XSIA 3TA4D 4Z7NF 3CDCA 4IMKC 5FKPB 5LDSA 2WBJD 2Q2LA 2WPGA 1KPRA 2X6BA 5IM7B 2E6JA 2R0KL 1F56A 2X4SB 3M6DA 1HE8A 3DX2A 4FXGA 2ADFL 3SQOL 3V4VL 1TO4A 3WNPA 1NBYA 4GAAA 3VAEA 3KPNA 4PP1C 1D5IL 5IV2B 3VSQA 1D3CA 4UOJA 4PY8J 4FQCH 3NMEA 2ARWA 5H37H 2IAAC 3T1FA 3ZTDC 2IMNA 2VR8A 4MD5A 3CC5A 2DEXX 1V3LA 1FN4B 1BXVA 1YY8B 4GG6B 4LOVA 4F7TA 4KMTH 5BOZG 1AHWB 5IQ7L 5L2KA 2H1LM 5DZNA 1TLKA 4RVBA 5DVLA 1A9EB 1IILE 4MZIA 3NJNA 1BBDL 5JMRA 4K5OA 5DUJA 3QEQD 3RFZB 1BD2D 3CZFB 4NQVA 3OWEA 1X5IA 3BISA 4KRNA 3GMLA 4LF3A 2HX7A 3SJVE 1FYTE 4O2CB 3W39B 2O6PA 1ZLWK 4JUTA 5CJQL 4F24A 1RJZB 4OCLC 2Z31A 4TUJA 4R7NA 2HLEB 3MV7B 2CDGA 2NTFB 3D48R 3RJOA 4XH2A 4LNVA 3ZK0A 4RWHA 3L5WA 2FL5B 1MCNA 4FTVD 5D6DA 1NGQL 2WWKO 4MB1A 1YA5A 1ZLDA 4JDVA 4OIIL 4FNRA 5I1LB 1KB9J 3ME0A 3CLFL 2DQGH 2YWYA 3VGAC 5AENA 4IRJA 3QG6A 1RKRA 2CIKB 1Z66A 1NCCL 4BZ2L 4G6AC 1V7NH 1FZOA 2BMKB 2B4CH 1JP5A 4PI2A 1BQHA 4EXKA 5FFLA 1YEGH 4JFEB 4QHKI 2UY7B 1GPOL 2B15A 2F1AA 3BQUC 4N25A 2Q7NA 5EUOE 5H37G 4F7EA 2OMBA 5BUAA 1GTNA 1YEJL 4P2CG 4OD2A 2EDRA 1ROWA 4A63A 1PEWA 1GHFL 1UXLA 2F5AL 2CGZA 4UU9A 3N0PB 3LCYA 1UD4A 3I6GA 4GI8A 4JG9A 2DJMA 2ZJSL 3JTTA 3W9EA 1GC1H 1MAKA 4LFHD 3QEUB 3W0WE 1J1XH 1I1FB 4OZIA 4NPYB 2MH4A 1DL7H 1NEPA 1W6WA 3DX1A 3WMQA 4H1LB 2N59A 2WTRB 2E9IA 2HTLC 4MA1C 4AGMA 2B77A 5DD0L 4JM2A 4ENEC 1MREH 3A6CL 3GEFA 4G8IA 4ADGA 4B95C 1XH1A 1HSBA 1MHEB 5F6HJ 4B7LA 2Q8BL 1I75A 4PV9B 3UYPA 3IYLW 3GUFA 1B4LA 1SM3L 4N6RB 3DX7B 5FKAA 3GSUA 1U42A 4XVTL 1T22A 4MA3B 2OCCB 2NY6C 2O5XL 3FFCA 2VDMH 3NIDB 1AQDB 2AAVA 3K2UL 3ZO0A 5B1CA 1E4JA 4TSBH 3C6LD 5D1QB 2AI0H 3GXPA 1DE4B 3MGTB 4QKXB 3RWFB 3EH5B 5LN8A 1CL7H 3ZT5A 5HGBA 1I4FB 1KIPA 2ICES 3O2DH 2WCGA 2C3VA 4XVJH 5AVVB 3ULSB 4MNQD 3H9HB 5MEOB 1DQMH 1RZGB 3FHQA 4WKXA 4X6BB 2XWCA 4K3EL 4U6YB 4Y9BA 3S4SB 2GAZA 4A7VA 4JQVC 3GXNA 5JPNC 3MLTB 5I23A 4B50A 2A5UA 5IOPB 4KK9D 4I3RH 2Z1PA 1BZ8A 1WAAF 3SPHA 5IT2L 5LNEA 1MCDA 3CIAA 2MNUA 4IRZA 4X99B 3MODH 5D2NB 5C0RL 5ICZA 1QZNA 4ORGA 4X5WA 4GKSA 5SWSE 4KZ0A 1VRSA 4YPJA 1T5WA 2KLSA 1SMDA 3I74A 3F5WB 1HSAB 3FUIA 4XX5A 3DX9B 1OQOA 4MXVE 2LQRA 2FJFB 1XZWA 4RWYL 5D7EA 3SSGA 1OARH 2NOYA 4X5LA 3SKNB 2PW2A 3HUJA 2FNBA 4N0UE 3H7LA 3VXOB 5KYWB 3FT9A 5DI8A 3SY0A 4P2QB 1G9NC 4KNSA 4DN4H 4YEFA 2DKUA 3EHBD 4BYHA 4XXWC 1MRFH 1J5IA 2NX5D 4OCYH 4B9ZA 2PWGA 4LK4A 1SVCP 1XZ0B 5FFGA 4AQAA 1GJWA 2QSCH 2VXVL 1V3KA 1P7KA 4OF5A 3JWOC 4P5SA 1JAEA 1GMIA 4L4VD 4YHYB 2BH0A 3VFOB 3SCMB 3VRJB 5FYKE 2WVTA 3A4EA 4PRPA 1PYWB 3VMOA 3TT3H 4LPUA 1Q1PA 3MREA 3QS2A 4Y4KD 1KT2A 4LZKA 3S5ZA 3EOAB 1JK8A 1MDAA 5D2LA 4PRHA 3LX9A 5GS0D 2UV3A 5JOPD 1LNUA 3R1GL 4KJPC 5BO0D 1HI6B 1FHGA 1SEBA 4MJ6A 4KV5F 3O6KH 4P2RA 1GXEA 1GCFA 1LK3H 1PG7W 5JW4R 3ARGB 4OLEA 2AANA 5EWIL 3V4PL 2VR5A 3AUVA 4OLYL 3RP1A 3PAZA 2ZUQC 1AS8A 2BVUA 3KYOA 4KOCA 1LO3H 3WNNA 3QDGE 3GJFB 1LO0H 2AXGB 5F1NA 2XNAB 1K8DB 5L0QB 1HHGB 3QZBA 3HHMA 2HVBA 2IO5A 2JKLA 1CFQB 3K72A 1ORQB 1A14H 2J43A 2ZZUT 1KMGA 2ENYA 3MRQB 3BZ4B 1B0IA 1S9VA 2WB7A 4MJ2A 3KEHA 4FLRA 2IBZX 2C7UA 4YXHH 2R2EA 2QHLA 3O3AB 4AZ8A 4AVKA 4N2HA 2R69H 1HYSD 1WBXA 4AEFA 1OAKL 3K5SA 3TL5A 4WW2C 4U1NA 2CR3A 5DRNB 4YXLL 4BKLB 4N24A 1FQ9C 4P5TA 5F7YC 1PFOA 1WQVT 4NC2B 5EOCJ 5ISZA 1MFDH 4TNWK 3P0GB 1INQB 3SO3C 4NN6B 1SZNA 5AVTB 4UV7L 1UKQA 5EO9B 2A3TA 2HH0L 4K71C 2IJ0C 3CUPA 4KVCH 4XHJC 1EERB 3UZVA 1SOQA 3RWJB 3PGCA 4WWOA 5IFHL 3GB7B 3VRLE 4BK5C 43CAA 5GHWL 2JKSA 4TMPA 1TF4A 4QWWD 2CD0A 3ZE1E 4DEPC 4N8CL 4KNQA 5EEUA 5EOCL 2DKMA 2AVGA 5CD5D 2AQSA 1E2ZA 3U36A 4OW6A 2XPGB 4MCYB 1TCRB 4JQIH 2R39A 2GTZB 5CD3B 3PWLA 4R0LB 3SDAB 3UPAA 4NKMB 4RZCB 5D7KE 5HHQB 5IW1B 1MW3A 2KPNA 4XI5C 4B9KC 1HH6B 4M7LH 4WJG3 4BH8A 4XNYH 4FKEA 1MVFA 2FCBA 4PSRA 4EMZA 1MXGA 2BM3A 3QIUD 1IL1A 3L4VA 3RJQB 2QKIC 2IANB 1P7QB 3HFMH 1TXKA 1GIGL 1HILB 1BIHA 4LCVA 1B4RA 3ILQD 3HFFA 1NEZG 1CLZH 2B9BA 3BOVA 3AGVA 3L17A 1AZRA 3G6JB 4I1NB 2ZYRA 1UD3A 4WKZA 2F5BL 3DYOA 1BGXH 2G9HA 3ABGA 1HYRC 1EFQA 2ICWA 5GISH 5IJVB 1FFNB 2D31B 4JFHE 3T8VA 3AB0C 1WC7B 3U25A 2GITA 1A0QL 4UDUB 4JS7A 1NKOA 3KPMB 2H26A 1NFDF 4AVHA 3B7TA 2JJTA 5HHVL 3HE7A 1FJ1A 3N43F 1C5CH 1X6NA 4NZ8A 1ZLUH 5LN4A 2KC0A 4AKQA 3NJJA 4TKWA 5DTFB 4S1RL 4ES8A 4HIHB 3RHWF 3ARQA 1MW2A 2WKOF 1R5VA 3AU1B 3I9PA 4G9FE 2GT9A 4BDVB 4FXKB 4GAGL 4KJQC 2B3RA 4C56A 3PCYA 3NN8B 3NIFF 4CVZA 2PTTB 4EIUA 4LP5A 1OP9A 5I30L 2VRAA 1IKNC 4P3CL 1IC7H 4Z3FA 3TBSB 4OB5L 1FGVH 1OGTB 4B0MM 3QISA 2HT4C 3OG6B 4PBXA 4HG4K 2UWEB 1QUPA 2F8XC 1Y6MR 3L1EA 1FSKB 4HUVA 3LRMA 1QSZA 3R7QA 2I9LA 3IDYC 4F7CB 4JW3A 3ZKMC 2OZ4L 1UH2A 4YBQD 3ECWA 3D2UD 2J71A 3AQDA 4PJ5A 1BBJB 5K9QI 1KBGH 3ULUH 2KERA 4Y2DC 3EYFA 3NJHA 3P0YL 1HC1A 2JVUA 2ZSWB 5IBLD 5FM8A 3AXLB 1JRHI 3LVEA 4NGHL 4A38A 2OXGA 2W60A 1LO5B 5DS2A 1VGKA 3ZW3A 1AD0B 3L3IA 3ZKQD 1CICA 5J06A 1JGEB 4YSUA 2WLJA 2CGRH 1W6LA 3U4EA 4TM9A 2XYBA 2F53E 5HDLA 4XN5A 2FTAA 4XPTL 2EIKB 2BO0A 4M1CD 2E6PA 1I9IL 2FT8A 5DK2A 2Y36H 3EJYC 4HDIA 5AOKA 2DF3A 1OP3K 3POCA 4K5LA 5HYJA 3SYAA 5I1GL 1DBJL 5CGTA 3TH2T 3UYOD 5DC0A 3X12B 2Y5TB 1ES0B 4GMTL 3HZMA 1I7RA 5MEQB 1DLHB 1ZIAA 1YECL 4R4BB 3ROLA 1NIEA 3U0TA 3FCBA 4OGAD 1L6PA 4XBEL 4ZZKA 1RIUH 1CDGA 2BSRB 1MRDH 2ZOKB 2OFQA 5IF0B 3T77A 2YIHA 1MQ8A 1YMMA 2O5YH 5HYQB 1YNKL 5L8KB 2XN1A 4ONHB 1HHKB 4IBVA 5LBSH 5KSAB 1P5UB 3FUFA 1WE5A 3IPEA 4DKTA 4OQTA 2WQAA 5TK4A 2R2HA 2A1WL 2WVVA 1M53A 1P5VA 2BXZA 3T3PE 3VD4A 4ZMAT 3JT2A 4IKKA 4OKDA 1QUNB 4DAGH 12E8H 1JHLH 2YQ2A 3E38A 3FBQA 4OT1L 3WXWH 4FQQA 1PZ3A 4ANVA 4DGIL 5I1KL 1QACA 4Z76B 4GXUN 3GMNB 5IGXH 1DLFL 1H5BA 3TVMC 4MYWB 3L2LA 4LSVL 3TO2A 4EQ2A 3LH9A 3X13A 3UJTL 5KYYB 1LP9B 4F2MA 2ZKYA 4OF7A 4NQXA 4XTRC 4OF0A 3OPZH 2BIIA 3TBYB 3WNKA 5A2LH 1A7NH 3RNKA 3GS4A 3O6MH 1RZJL 4WJKB 3NP3A 5CU9A 5C09E 4YQXH 1O9ZA 1YEFH 2H6PA 4IQHA 5GZOD 2EIZB 4XPHH 2YZ1A 4EN3A 1G1OA 4CMMA 2N0MA 3BVUA 4PU2A 5JLZA 2R1YA 2OYPA 1J88A 2BY0A 3EYVB 4JFQB 4YJZL 4TTGA 2WVSA 1W8OA 1QNZH 2VXQA 3FBKA 4PRIE 2WGXA 3GKZA 3DA0A 4PJAF 2GPZA 5FA4A 3BMVA 1W0VB 3LKSB 5DJ6B 3BKCL 1RULH 1FNEA 3UO1L 3QJHB 2ZSVB 3UTQA 3ZBMA 3T3MF 1UZ8A 5GRJH 1ZTXL 5IR1B 2CJUL 5D7JB 1FORH 2XWJB 2HXAA 4FNLH 1GZQB 2X3AA 4JFOB 5TDOA 1HNYA 4OGXH 5ESAA 2J20A 4CU6A 2V7NB 2AJYL 4RMRA 3MA7B 4QRTB 1W2KT 1E50A 3MRDB 3FQ4A 4ZFZB 3EYQC 1QSFD 2ZYIA 1WAAA 5BQ7B 1TEYA 1YYLH 3SGJC 1VPOL 4JCWA 4P49A 5EEWA 2V17L 4PWEA 1TENA 4U1JA 2C7FA 4ZDHB 1ACXA 2BVEA 4L3EE 3GLEA 4IRSA 4R6UA 1U8NB 4HJJH 4IRZH 7TAAA 4KI5F 3RFZA 5IJKC 3KYNB 3DSNA 3MV9E 3E1ZA 4OIFA 5HHXL 3G04B 4G82A 3WD5L 4OCSH 1KCSL 3AT9A 4WSJA 4PB9L 5EU4A 1OXYA 5GS1C 3W39A 2WBKA 5D7IB 1GJIA 4HS8H 5KSBB 4PWHA 2BIHA 2DIAA 4N90D 2A9NL 4XNZC 1H9DA 1TZAA 3BPCB 2BP0B 1O7VA 5GRVL 4PVLA 2X12A 4XWOC 1KBBA 1D7DA 4AEIL 1OGPA 1IE4A 4NO2B 5AOJA 5IK3A 3LZFH 1J1PH 3TNNB 1JPFA 3SGEH 3D4ZA 1XGPB 1PMYA 3BT0A 3CZJA 1NGZA 4XXDB 3SE3C 2X4UB 3MV8D 1HIML 1M1XB 3Q43A 3OL2A 4TTDD 3E6FB 5J1AB 5EH1A 3D0LB 4LP4A 4R7LA 5AW5B 2A9DA 1U92B 5D1ZB 3MV7D 3HZVB 4F93B 3BGMA 2BMKA 2BOLA 2BY3A 1EJFA 1ACYL 2PW1B 1LWJA 3QXVA 1BF2A 4HHAB 4OTXL 1TUPA 2YC1A 4K15A 4KQ0A 4I13B 1SXAA 4BKSC 2ILLA 4X6FB 3MC0A 1OB1B 1HXYB 4XP9L 1E4HA 4CUCA 1P2CA 2A74C 2AV7B 2CR6A 5GGRY 3S98A 1T04A 1XR8A 3KR3H 1UWYA 2CE6A 3QQXA 2VQ1B 1CU4H 4F37F 5CCJA 1JPGB 4W6XB 4JG1L 3S9DB 4U1LB 4Z3JA 1D9KC 3IM1A 3OZKA 3WS3A 4NPYA 3CHQA 4JFED 2NZ9D 4L4TE 2YAEA 1Y0LB 1C16B 1S8DA 5GGTL 3AQXA 4XO9A 5AW4B 3HCVB 4HH9B 1T1ZB 5E1HB 1FDLH 2H3NB 3D85D 3HRPA 4JB9L 4AC2A 4UBDC 4UUJB 3MAWA 3OMAB 4MA3A 3PXLA 3P9MB 2GUOB 3S36H 3N44F 4B9PA 4GUOA 3FUJA 2AITA 1RURH 2PYEB 1ITCA 1AQDA 4G42A 5EBMA 5BRPA 2Z91A 1XWVA 4FZ8H 3UP1A 5D1QA 1ZHKB 4NN5B 3RILA 3MGTA 4PLKD 2NTSP 2OP4H 3KH3A 3RWFA 3FUNA 2Q2EB 3ILEA 4L1BA 4M62L 2X0UA 4N2OA 4Y9GA 3RL1B 4LAQL 2VQ4A 2FH8A 3F6LA 2XBDA 3K8KA 2VMCA 2CZNA 1RK7A 4MDIB 4Y16B 5BO1L 4ILDA 4YHNA 4YDIH 3P4OA 1UM5L 2CXKA 2J1YA 2MEJB 2I85A 4JFZH 4JVPA 4OY9A 2N7SA 4YHLH 2W92A 5EDXA 5K9JL 4LIQE 2R1WB 3OD3A 4G8FB 1ZSDB 2D3NA 1TQTA 1MCQA 5T3ZE 5L4FA 4YFDB 4XN9A 5DEGA 2VB5A 3QAQA 3QHFL 3MGOB 4JKPL 4RAUA 5IB4B 4TUOB 4FQHA 4PP2A 4PG2A 4XVUC 3OKOB 1P1ZB 2DY2A 4GEIA 1OM9A 1EQWA 1UENA 2WXGA 3RPBA 1CGSL 4BWTA 4X6CF 4QTIL 1FC2D 1TITA 4OD3L 3BRGC 1P84J 2IFFL 4APXA 2DWTA 2EYSA 5E8NA 2UY6A 1BVNP 3H7BA 4P3DB 4KO9A 5I1EH 3OLDA 2P5EE 3IFOB 5F7MC 2FEJA 2OMUB 3QDME 2V2TA 1WIOA 5CWSB 2DYRB 2PCXA 2IOOA 4IKJA 2ODIA 4UM9B 3HI6H 2DQ6A 1M4KA 5KVEH 3CV5A 4GFXA 4GQZA 4Q8BA 3VXRB 4K8RH 1VADA 5HYEA 4QT5B 4DP5X 2O5ZL 4TXVB 1FL5B 4RX4D 5FO2A 1AYRA 1XZ0A 3NTCL 2ITDB 2X1WL 2D4FA 2VJ8A 3L2MA 1LMKA 2X09A 1KN4L 4GBXC 4JO1H 5T1KB 2ZP0T 3BXNB 2DLHA 3L4XA 1R24B 3B5TA 1NFDA 4YGAB 1CGYA 4K94H 4TVPD 5AVXB 3HBGA 2CLZA 2IG2H 2VDKB 4XCFH 3U0PA 3EOAA 2FO4A 3ZRCC 1XB8A 1T0OA 5EUOF 4CSTA 1ZJBA 1MF2H 1OSZA 3SDXF 4XPAL 5I73B 3U1SL 2EABA 2V5MA 1PLGH 5I5IA 2WKOA 4M5YH 4JEGB 1IQWH 4DIXA 1I85A 3LN9A 5FUZH 2F1BA 5KAQF 2IV8A 3D0VA 3C2AH 1MFUA 2XYCA 5GQBA 2VLRB 2YJQA 3RKDD 3C5ZB 4G59C 5DMKB 3QUZA 4A68A 4TSAL 2DWYA 3EO9L 5DCCA 3DI2B 2CO6B 4DTGL 1A7RL 3P2TA 1KTCA 2WY3B 2YO3A 1DJYA 5A16B 4K9EH 2V9TA 5GSRB 1W8NA 4H8HA 3ORJA 5TTRA 3L3JB 2X4PA 1LWHA 2JKJA 4I18A 5HPMA 3H55A 5BRZE 1CFNA 4FE9A 1CFQA 2X4NB 3VD9A 3A5VA 4UZSA 4NNPL 4XNUL 3SDCD 1BDYA 4KAQH 3ARGD 4Z7OB 2ZOLB 2P49B 3SYOA 3DUHA 4ZQTA 4DPAX 2D7MA 4XC3H 1XHHA 4KUCD 4R7VA 1J48A 2L4OA 2AZAA 4HPOH 5CSZA 2B1OA 4TNFA 5BS0B 5FOJA 3LB6D 4V33A 3IPBA 1QQDB 1FIGH 2VE6A 3NJLA 3GJEA 4QRQA 2WWKT 3PREA 1G7JA 5F7KC 3EO0B 4NO0B 2C9AA 3TCXA 1JUFB 2QFPA 3TV3L 2YD2A 2PWDA 5LGJA 2VH5L 1TTAA 2ESVE 4FQJL 4Q97A 3HBQA 5GGQL 5EO9A 3WFBL 1U8JA 2ZXAA 2OYLA 5I9QB 2D7QA 3RWJA 2B2XH 1Q0XL 1UOVA 2CPUA 4IOFD 2Y5QA 1X3DA 2OSXA 3ULAB 2NUPB 3QFDA 2DEWX 3QCTH 4UDTA 3KLQA 2K7PA 4GQPH 5DC2A 2FX7H 4ODWA 5E9DB 1DVSA 1HQ4B 2ICEA 1GY2A 4GW4B 4G7VH 4PJEB 4TSCH 4CL7A 1FLTX 1TCRA 3DC0A 4PRDA 2W0FB 5CEYA 1YSOA 3LHAA 2HLFD 1E8XA 3OZLA 1NOAA 4R0LA 4RIRB 4XCNA 5EU5A 1JXDA 2LLGA 1DYZA 1NCAH 3FNKA 3MRFB 2D9CA 1PZAA 2VNCA 4WAFA 2NW3A 2FJGB 1R3JA 2HKHL 4KKLD 5CIPA 1VZIA 4OQTH 4MZ3A 1EJ6A 2OX5B 1DZ0A 4XP5L 5EBWB 4S1DD 1WFJA 3EDDA 4FDWA 1Q94B 2PO6B 2CNZA 1MI5E 3G6JA 5ACZB 1NSNH 3APCA 3VXUD 3KJ6H 4CADB 5JW4N 3S3JA 2EDLA 1Q72H 2ZONA 3CDYA 3HPLB 3Q01A 1OTUD 3LTVA 3MJ6A 2FO8A 1E4XI 1NCNA 1NMCB 2JTYA 3T65B 2B0SL 2LGNA 3S0PA 1YEHH 4RGNE 2NY3B 5F1OB 4KZEL 4WEEA 4YPGB 3V52H 2IAND 5TF1H 4TNGA 1P7QD 1E3ZA 1AG0A 2IQ9H 4UZGA 4JRYD 4OLUH 2OI9C 3VWKC 4EDWH 4C47A 1AP2B 1N3NA 4OGQC 1WS7A 4OVUA 4QRPE 1UVQB 3O4LB 2BY1A 4FQLH 4X8CA 4LLQA 5B3NA 4IGBA 1MCHA 3MLSH 1FZKB 3FO9B 4OZFB 3IF1B 3MNVB 1BQKA 3MXWH 1VFAB 4PJAA 5EORL 3NN8A 3SB3A 3QHTC 4XE0A 5AG9A 1BZDA 3UTTA 2J2ZB 3HHSB 2VXQH 1BAFL 1HKLH 2FQDA 1JHKL 2FQGA 2K3TA 3KL3A 4P2OA 4XC1L 4FQ1L 4YZFE 4AC4A 2WBJC 3GXDA 2ZOTA 2MRYA 1EXHA 4NBYB 5T3XE 4N2AA 5PAZA 2O61A 5LLIC 4PQXA 4ZX5A 4KY2A 4Z77B 4BCXA 1WFIA 3VGEA 4RAVB 5J3HD 1A3ZA 1JXJA 2VDOB 2WXNA 2IWKA 1IGIL 4NQQA 2ADIA 4D8OA 5BRQA 3WU1A 3CQFA 3WKPA 3M86A 4JCMA 1WA1X 5IHUH 2AXFB 2AJ3A 2EKJA 4LPVA 1R19A 2AJUH 1SFDA 2ZSWA 4YS4A 2Q6WA 1FNAA 1FGNH 1HL5A 2WXPA 1N0LA 4FNQA 4FHKA 2QBWA 1HCFX 4L0YA 4Y4FB 5DK0A 3S8GB 3EGDA 1JSYA 4MMYB 1KCRL 3FT3A 3VFVB 5T8IA 3NDYE 3ZT6A 1N5AA 1YEEH 2MJWA 4P9HC 2DQIL 4M03A 4ZTEA 4HVBA 3GSQB 1XV8A 3FMGH 3VRLF 2F74B 3DGGB 3BSZA 4Y5XA 1SJHA 3ZE1F 3BCDA 1QW8A 4S11A 2AEPL 5FYLL 3IDGA 3X12A 1FC1A 4DUVA 4Q9RH 2OW7A 2IDCA 4FYQA 1Z9OA 3ARYA 4L8DB 4I0KA 3NFPA 4MB4A 1CDJA 4OD1L 2E7LA 4KNUA 3K81A 4LVNC 1EZVY 4GKNB 1FV1B 1DJHA 1IC4L 3AT8A 5HYQA 4NM8L 4ONHA 5C0CA 1YY9C 1E6JH 4KKAD 3S5LA 1P7HL 4Q6IC 4K2UH 4HYTB 3TONA 5B39A 3NGBB 4L29B 1H6TA 2XKNA 3D9AL 5F3HB 5CEZE 1CK0L 4UZUA 4KXCA 1WBYB 1QUNA 4D9QE 1WUNT 2VN3A 4JFXA 4E42B 1HESA 5EPMA 4F80A 3DO7A 4FP8H 4G8GA 2VSKB 1GA2A 5DRWA 5KYNA 1DSYA 2XFXA 5EO0A 3MNZA 3UG3A 3OKDA 1EEUA 5C0IA 1JHTB 1K72A 2O93L 5KSAD 3HG2A 2IQAB 3NSFA 2WXRA 2XIDA 3OV6A 4JNXA 3WJMB 5E6UB 3RGBA 2AHIA 1I82A 3H3BC 1G7LA 3GXTA 3NG5A 2PYFB 2QR0B 3VSUA 1KC5H 3DRQA 2WNGA 3WEOA 5D1ZI 3CCHB 2L0DA 3EFDH 2XXMB 4RISL 4GSRA 3UO8B 1MIEH 1LO2H 3IETA 2JLLA 4HGWB 3UMTA 2V0AA 2F7QA 3EG9B 4X7SH 3WIIL 3S8FB 4CSPA 2QHRL 3MLVH 3HJEA 4O51B 1EEYA 4JN1H 1TJXA 4URKA 5FYJD 2KDYA 3RDJA 4D9RE 4MFHA 5DJAA 3C6EA 4BJLA 1Z9MA 1CIUA 5CLYA 4HKBA 3QJHA 4G6JH 4XPFH 3AZUA 4FFYL 2EH7H 4M43L 2F19H 1TZHB 6CGTA 3GNMH 2IPTH 4S0HA 2HVKB 2XWDA 3C6LC 4W9KC 3TNMA 4ZK8A 2ZPKH 3ZDWA 4Z6AT 5BOPA 3CMOL 3EJZD 2VITB 1CFVH 4Z5RA 2RCSL 4PRBB 3QNYA 3H9YA 5I6XB 1E9OB 3UTPD 4JG0L 1TT6A 5AZ2H 5ITFA 4YX2H 4CC1A 4XBGB 3EJQA 3WJJC 3D87B 3MLRL 4A2HA 4BGDA 3AQYA 5F8QC 4F9LA 1UEYA 1U8NA 1XGRA 3BDXA 1XCXA 4FMVA 3SJVA 3KYNA 4ZO7A 2X6MA 1FYTA 1FPTL 3G04A 4P5RA 5D7JD 5ENWA 1H3TA 1KYUA 4NYLB 4X6CA 4G7YL 1DVQA 4PREB 3GMOB 1KDIA 2WK2A 2JQMA 3DETD 3OAUH 2CMRH 3HVDA 5E8DL 3C08H 3NIGB 3KPPB 4PW9A 4XMVA 1MQKL 3L9BA 3VXMB 3CZNA 4EO5A 3VG0L 2WQRA 3INOA 1T1XB 2V9QA 3U4BL 2DQCH 2J5LB 3L9EA 1KTKE 2ZWYA 1SLWA 1JNLH 3IFLH 5E4AA 3HI5H 3CBJB 2Z35B 3EH3B 4XP1H 1WA0X 5CKAA 4PJHE 1G7HB 1E5YA 1FO0B 5FECA 1MCIA 1YQ2A 1AKJA 3EHBC 5H2BB 1DQIA 4Y2LA 1QFWM 1KCLA 1AFVH 1M1XA 3P30L 1SHMA 4G1EB 5LO7A 4H8VA 1MNUL 1RU9H 4GUQA 5J1AA 5J89A 3D0LA 1Z5LB 3OKLA 4OFDA 3MRGB 3QYNA 3NZ8B 1X9QA 3N41F 1X5FA 1U92A 2FE0A 5D7SL 3T3PF 1HDMA 5E1AB 3P73B 5CCKL 1FNSL 1K4CB 3JWDC 2KDGA 1JWMA 4JPQA 3GBML 4HHAA 4L9LC 1ZGLM 3SDXA 5L4JA 3CFDA 1YZZA 2NY4B 5HHPB 3ZPDA 4NUJB 4Y4KC 3AS1A 1E3FA 4IOSA 5C0BB 5C2BH 3DXAB 4N1EA 3WN5A 2IC2A 4ZSOB 5GS0C 2Q8AL 1U2YA 1S6NA 2OL3L 1V27A 2BRRH 3CFKB 3HPJB 3Q6FA 4RSVA 5DFAA 1YCSA 3VFGH 4UTAL 3DARA 5F9AC 3W0WA 1DDHA 3OAYH 3VB9A 4Z3TA 4YFLF 2CK2A 5D1ZD 1KCVL 3KLKA 3HNVH 4QRRE 4X9BA 1IBGH 3X14B 4U1LA 1UATA 2J1KA 5FUCC 3IVKB 4WHCA 1SGKA 1BIIA 4WQOA 2XZAL 5B1BB 2F58H 2XBZA 1UWFA 4GG8B 4HIXH 4JO5A 3RIFF 4H88H 3BJ91 5L8JB 3INUH 2HFGL 4RRPM 4D0CA 5C2UB 3LZLA 1IVTA 4YWGL 3L9YA 3GSNA 1OP5H 1CFBA 1ZHNA 4UUJA 2XWZA 1F4XH 1MPAH 5BQDA 1HS6A 4AM0A 4U6HA 2DTML 2GUOA 4D9LH 2BLFA 1CFTB 2CBQA 4KTGA 1UJTA 2PYEA 2MIZA 1G1KA 5FDWA 2DLGA 2VDQL 3L3HA 3S5YA 4HV8B 2EO1A 5J57B 1U4EA 2WINB 3PWVA 3T6ZA 1RK1A 1K9TA 2OSLB 1HAWA 2HG5B 2Z4TA 1HYSC 5CBEB 2G60L 1G0YR 1F4YH 4PB0H 5FYJU 4R90H 4WUKL 1P1VA 3K71B 3QAZB 1HEZA 4OJYA 1DQLL 1WO2A 1XF3B 2BZ7A 3CXHJ 4HUCA 4BSJA 3Q06A 3QUMA 1BMWA 2ZCKL 5AW7B 4XO3A 3J07A 1UWEH 3L45A 4CVUA 4LSTH 1IGJA 1KSRA 3O0RH 1B0GB 2XY2A 3K6DA 4I48A 2OJZL 3M7OA 3N85H 3MGOA 1PY0A 5T5FL 4QWWC 3MRCB 4MJIA 1Y18A 4DH2A 1P1ZA 4OLVL 4R2GB 4JFFE 4DW2H 1IFHH 1KACB 5J12C 1ZLUK 2J8UE 5DD3L 5HDBB 1L9SA 3NA4A 3KPRB 3UAJD 4Y16D 1N8ZB 2YA2A 1T0NA 1RZKL 1ZHLB 4MRBA 5GGSY 5DQJB 4AWJC 1P4UA 4M6NH 2HT3D 2WHVA 5AD0A 1UT2A 2P5PA 3IGFA 1KG0A 1F4HA 1A6ZB 3V10A 2B1HH 1QVOB 1XCTB 4P4KC 1D5XB 3F62A 3VFMB 1V55B 5A6MA 2IWGA 2PWEA 1SMOA 2HN7A 1T1WB 5CIPH 5D1XD 2WSDA 1J0YA 4KZCA 3DHJA 1B6UA 4QXWA 2W59A 5KZCD 4PMFA 2EDYA 2B1AL 3EDKA 4LRNH 3QQ4B 3H54A 5ERWA 3P02A 2F8IA 3ILQC 1OSEA 4M93B 2J21A 5I16B 4UT9L 1W72B 2NCEA 2PPCA 4GRLA 1RUAH 4ELDA 4G43B 1QRNB 2EEFA 1VDGA 2NW2A 1WWWX 2O1AA 2HJFA 5L88H 1HOEA 5EIIB 2XY1A 4NZUH 1TZGL 4BQ8A 1ACCA 1WCBA 4JE4B 2CDEB 4HCFA 4I2XA 4ETQB 5IESH 3LS4H 3ZU8A 3NCJL 5FIEA 1JWUA 3RBGA 3UADA 3QFJA 4CN1A 4OFYA 4TPRH 1PDKA 2FYVA 2H41A 4ELKB 4WEBH 2EZ0D 1T66D 3IS0X 4HUNB 4I88A 5T1KD 4D8PA 3H2WA 1LTXA 3C5ZA 4PS8A 5D6CB 5L4MA 2PCYA 3L5XH 2VC2H 4HIEB 4JDTH 1ZVSB 5DHYB 4PGZA 3QXWA 2H47C 4JFVA 4OJAA 4DVRH 5A16A 4LBEA 1QW9A 5GSRA 4BSVB 3MACH 1W0WA 3AADB 1XF1A 4FQXB 2CO1A 3L2NA 3HC3H 4WFFE 5IBTL 3JYCA 5E2VH 4QHNA 5IB1B 4CSSA 1QWUA 2VRKA 1NCWL 4KTDL 3IGUA 1L0XA 4A7UA 3O11A 2DD8H 1TOXA 3I9GH 4L8SB 3F12A 3I2CL 4UWQB 3ZDXE 3WY4A 2CCLA 3ULUD 2XZCH 2Z1KA 4DQAA 4WWNA 1VGEL 5B1AB 4YBQC 5G2NA 1EEQA 5DEFB 2JXMA 4JANB 4U3XA 1E5ZA 4TVSa 4UQEA 1RERA 2F7RA 2Y07H 3L4UA 4ODUA 5SV4A 4HA1A 2E3VA 3DI3B 4HEPG 1NA8A 2W9DH 4K3DL 4OCNC 1AO7A 4LSUL 3RJDA 1WCQA 4PW4A 4F7MA 4HLEA 5F93C 4P5KA 3H9SB 3ATDA 5AVRB 3EYUH 4XHQA 4HC1A 3QO1A 4BINA 2XUWA 5KW9H 2R0LL 1HZLA 2BNRA 1KNOB 1EWHA 5BS0D 1KBVA 3B9VA 5EZLB 4M1CC 3UTSA 2VABA 3S7GA 5DQDH 4LSPL 3V6ZB 4AI7A 3BSZH 1C8PA 2YXVA 3SDDB 5DQ9B 4KQ3L 4B96A 1F02I 3FCTB 4NO0D 5KVDH 1N5YL 1KJMB 4QJ3B 1IGCH 3Q6GL 4X9GA 2NXZD 5LAPA 3UIYA 1ORSA 5C6TL 3TC9A 1VSCA 4LB8A 4C83B 2EUXA 4NXKA 3TBCA 3AITA 4OGAC 1PZ5A 2GW5A 1V8HA 5JNYA 1AC6A 2DBLH 2Y6SD 3ZZLA 1HXMA 3EGSB 3R19A 5LCVL 5F3BB 4IRJD 3FH5A 2QMKA 2C3WA 3DVNA 1GAFL 1UM4L 3RYMA 3C60A 2P24A 5E9DD 2Z92A 5CSGA 3SE4A 1YEKH 4LOUD 2X89D 4EQ3A 4TOYL 1IT9L 2FH6A 4DKEH 1AXTH 3KCPB 2C5DC 3AAZB 4DQOL 1ZHBA 3H1ZA 4OAWA 5D4QA 1SYSA 4TUKH 3LS5L 3UC0H 2H32A 4V2BA 4ZMOA 2CKBB 1A6WL 3LEVL 4WO0A 2HKAA 1F58H 5HVGB 1KGIA 4OZ4B 2NY0D 2MQ0A 4QXTA 5F9WC 3SGKC 3T65A 1TTCA 4YSSA 2FSEB 2P8PB 5HHOE 1NLBL 3DOSA 4X5XB 1ZTMA 3LVTA 3REWB 2K45A 3IDXL 4FLQA 4A37A 1J8KA 5A40E 1PZBA 1TJHH 5EU3B 4G9FA 1I1AA 1ETJA 2PO6D 3MMEA 3M46A 1MLBB 2EH8H 3WKML 3US1A 4U1IB 1G1YA 1R3KB 3G5WA 3L5IA 4JM2D 4LEEA 5GZOC 5DJCB 4BA0A 4PI0A 4JQXC 3M88A 3WFCH 1NJ9B 4UQBA 5ABZA 5SWQB 5GGVH 3CVCA 2AGJH 2NY3D 4F27A 1FZMB 2BERA 4GLRI 1L9TA 5I0WA 3FFCD 4PHXA 1UD8A 3TZVB 3K4AA 1BREA 1QHPA 1A6UL 3L7FB 1UCBL 2AQRA 5A6IA 4QXGH 3DX3A 4LDLB 4ZFFA 5G4MA 3O4LD 5TE4L 4Z77A 2XN9B 4FG4A 3S5LG 1NAML 5EN2B 2WW8A 1D5ZA 1RL1A 1WWBX 5FO7A 4QRSB 5B39G 2A9AA 2QELA 5IMKB 3T0DA 3IDMB 2X1PA 2UX6A 3FS9A 4POUB 2MHAA 3VFTA 2D3LA 3QJXA 3NABH 4MD0B 4WF7A 2XWTB 2QQNL 1ZA6B 2W95A 4F9PA 1XF2B 4Z8FH 3BAIA 2F53A 4ZFOL 5HGHB 5AOLA 3ALXA 3GO1H 4MHHG 1OPGH 1E67A 1TQBB 1TPXB 4FGMA 4LEOA 1YPZF 4LLYA 4IYKA 4ZRGA 5AKSA 4AKOA 4WWKB 1RJLA 3V0HA 4C4UA 4WWPA 3E6HA 4GIAA 1H3WM 4YO0A 3BUYA 3GSQA 4X4XA 2F74A 3IGLA 4XPBH 3LPWA 4PWKA 1PX8A 4X6EB 1D2PA 1U6AL 3P9WB 5CUSH 3QUKA 3BO8B 1AHWC 2E0PA 4CA4A 4X9YA 2H6UA 2Z8VC 4FCAA 3SY6A 5DVKA 4ZPVA 2HSIA 2A9BA 2KQMA 2WXOA 3CZKA 3N43B 3VYPA 2CK0L 4RBPH 1B2YA 4EUPB 5IVZB 1KENL 2O30A 4U0RC 2QZ5A 2BDNH 3UAFA 3SKJL 3TJPA 4ADIA 3FULA 1OAUH 1RUQH 5SX4I 2QVKA 3PAYA 4TTDC 4XNBA 3I50H 5I5MA 4XP4H 5HGAA 3BH8B 4L29A 4KY1L 4LKCA 5F3HA 4LHUB 1FBIL 3NCEB 3NSCA 4QPEA 4WGVB 2L7QA 5MEPB 4AOFA 2GBVA 5JR1H 3AABA 4CRPA 5JIHA 5DJZB 1JPTH 5HJGA 4J3BA 4PRHD 1IAII 3DYPA 1ASQA 3SPVA 2GYSA 1G5AA 1SY6A 4I0PA 3NRPA 1T4WA 4WFGE 1MLCA 1WEJL 3UDWA 1TQUA 4DJMA 1UJ3B 2DLEA 5DFWH 3K7UA 5IFJB 1AD9A 3UH8A 4W4OC 2OBGA 3WJMA 3CAFA 5ALCL 2MOVA 3CVBA 5DMYA 1HT6A 4EOWH 1BFVH 2XG4A 5JHDB 3PNWA 3K8LA 3M1CA 3RVUD 3ZYIA 2Y7QA 1RUKH 1A4AA 4HZAA 4YE4H 3LNIA 2XU9A 1YDPB 1U3YA 2NZ9C 4QRAA 1VFMA 3EFFB 1QSEA 3H0TA 4M8RA 4P8QA 4HGWA 4K23H 3GSNH 1BZ7B 2X4OB 2QJDA 3NSXA 4K7PH 4O51A 3T8XA 4LPWA 4UQCA 3FSZA 1SLXA 2BC4B 4LPYA 4YZFF 5AVYB 4OBRA 5JIDA 4PJXE 4XMPH 1BYOA 4FI6A 2FX8L 3VO0A 1OTSC 1QATA 4N2BA 3ZYOA 4UILH 4UT7L 4CDGC 5B1JC 4PLKC 3EOTL 3CJJA 5IMMB 1KXQA 4ZO6A 2IAMA 1BQ5A 5TQ2L 1UEMA 4KX9A 3JV5A 2VN6A 4MNHA 3PLYA 4PRBA 2BCKB 3FO0L 3O3BB 5DHVB 4FFZL 2JJSA 4J3OF 2FIKB 4E41E 1IGML 4M4RB 1IE5A 4L3EA 1MCBA 1H15B 3CQQA 1LE9A 1NC4A 3NT0A 1VCBC 3QUMH 1XD0A 3QULA 5JQ6H 3WY2A 4ZODA 1PL3A 1EO8L 2AMUA 1M7UA 4ZAKC 3VFRB 4IMLB 1BWWA 2D3VA 1TFPA 4NYLA 5KAQG 1SYVB 1R46A 3TN0B 5AYTA 3W9DB 2HFFB 1YEDB 3K0YA 2R4RL 2PCPA 1M7DA 5C08E 1QFOA 2WC7A 4L0PB 4AKPA 1XSJA 4R3SB 3GRWA 4KWUA 1S3KL 1A4KB 1M05B 1BEYL 2Z35A 2A73A 1NBZA 2J6EL 2DL9A 1S9XA 1XIWA 2FGWH 2WBWB 3TCLA 4N2LA 1ANUA 1HL8A 4XMZA 1ERNA 3N3EA 3CFEB 3RWCA 2MFNA 2R2CA 2D9QB 3S3BB 3W1ZA 2Z9TA 5EOQL 2UXVA 3G6DL 3MO1A 2XCMC 1BCIA 2YSTA 4WV1A 3MPCA 3MRGA 4JPIA 5D9SA 3VXMD 1NCBH 5FYKH 6PAZA 2Q7YB 2R0WL 3T4AC 1JFQH 4Z7WE 2MPVA 3L7EB 4PR5B 2QGBA 2W9EL 5E2UH 5EO1B 1FYHB 4XCEB 1E8YA 3NZUA 4LL1A 5DJ8B 3LH2H 5ESQB 4DN3H 1M6OA 4ZUSB 5T33L 3QHZH 5LGHH 5L2JA 1PY9A 1A6AA 3FPYA 5HHPA 3HE7D 1B4JH 1TVHB 5JTWA 1BQRA 2A6JB 4HBQA 4WWID 5C0BA 2F18A 3VQMA 3AG2B 3KXFB 1CIDA 4YHOL 2NUTB 4N1CA 3HPJA 2GJZB 2OXHA 4YSEA 5FXCH 2GCYB 2N3JA 1DJXA 1L0PA 4UQ2A 3KWWB 1JOIA 3KGTA 4FQIL 2DQDH 4C56D 3P4MA 4NN7B 1U8LB 1CTOA 4NUGH 4L4TA 1Q9WA 5DD5L 3BUIA 2J25A 3CDFA 3CSYA 3IVKA 3F64A 5FOBA 1KYDA 2ZUYA 1FWXA 4RGOL 1P69B 2NY4D 4TLTA 5ID0A 1J8RA 4F7PA 1GGIH 1H8LA 3V7MA 4PUBH 3A4FA 3NSJA 2DBJA 6FABH 3PJLA 2VMEA 3DXAD 1VACA 4LCCB 3HG1E 1ASPA 3L6FA 3IE4A 4GQ9H 4E9LA 3SDCC 3Q48A 2PUQT 2GEQA 2DWEB 1M56B 3ARGC 3MBXH 3TOPA 1NBVH 4HKXB 2FQEA 4Y7MA 2R4SL 2VSMB 4PJ5D 1EGJA 2EEDA 4YC2B 4QNPE 5DGQA 3WTTA 1WD8A 1PLBA 3ZTNH 1A1MA 4TULL 4OCRL 3WOVA 3LB6C 4HV8A 5LXVA 1LO4H 1JMXA 1O75A 3QI9B 3T2NH 4X4YB 4LKXA 5FGBC 2AJVL 1PJ9A 5L0QC 3IXAB 5I74B 1CICD 4R9HA 2N7BA 2FLMA 4X8JA 4AL8C 3CSBA 3K71A 4LSSH 5KVFL 1BSIA 4HC1H 5AYUL 3TBWB 4CC4A 5FHAH 1N7ML 4QHUB 2ARJQ 3ROOB 2PR4H 4HISA 3B2VH 1TLMA 3LMJL 4A2LA 1HEHC 4KVNH 3PUCA 1B0GA 1WZ1H 1QBAA 4I3GA 4KHXL 4FERA 4IOFC 2BFVL 3ZYZA 5HYJD 1T1YB 3TGXA 1FL6A 1U58B 2QQLL 1R5IA 1XBDA 1Z5YD 1Q4NX 4NJ9H 5I0VA 4XNMA 3KPRA 2DQEL 4ZUUB 3TF7C 1T2QL 2P5EA 1ZHLA 2JKRM 3UIZA 1FH5H 3U2IA 3DGCR 4NN6C 2QMJA 2GHZA 4PJ9A 1I8AA 1TZIA 4PWJA 4HXBH 1RFDH 3KM2A 1SXSA 1A6ZA 3UBFA 3GIZH 1XCTA 2DKSA 2YPLB 4PJHF 4NENB 1B90A 3VFMA 1MCOH 1RIHL 2Y22A 3ETSA 4MAUH 4F1ZA 5LG1A 3KPQB 5A6LA 4HUWB 4U3CA 3FUDA 4ZD3L 4PWFA 2P7TA 1JS4A 3KNBB 5B7MA 4L23A 1G9MC 4A6YA 2EEBA 4S1DC 5BJTA 4Z95H 3MTRA 1S7VB 1PIFA 2H32H 3LIZA 2P1YA 4IS6B 4FXLA 1CLYH 3GMRB 2CM5A 5EIIA 3N44B 2WYIA 5B38G 1RZQA 4L1SA 4NB7A 5ABDE 4CBPA 3FT2B 5TE7H 3ZDZB 4ETQA 3M1BB 3DUUA 5KVMC 2E27L 4Y19D 4FS0A 4HOXA 5C8JA 2EVGA 1OZTG 3K6NA 4BWWA 1P4BH 1KB5L 3ESMA 4OZGB 1J8HE 3D4CA 1OV8A 3J7HA 3UMNA 4KXZI 4YVNA 3CFCL 5MERB 1T21B 2ARJB 4WUUE 1JRHL 1FFPB 1INDH 3B4NA 5CP7B 2ZUXA 5I18L 1GKEA 3H8NA 1MY7A 1AGFB 4HS6A 1F5WA 4BSVA 1K4DB 1MJUH 2O5NA 3IJEB 2XVKA 1N4XL 3VA2C 5IQ9B 4U1MA 3MLXL 4G3YL 2HMID 3I02A 5KG9B 2H2SC 2BP5M 4IU3B 4DPCX 4LCUB 2A9CA 4L8BA 5EBLB 1L7IL 1OGAB 3O3DB 4BSWA 5C0GB 3QYMA 5FWQA 5DVPA 1G6VK 1AS7A 1PNDA 1CCZA 3NVQA 3RWGB 1DVZA 1SXBA 2NZ1A 3ABZA 4ONFH 1FVDA 3KPOB 3DJTA 1KJ2A 2HKFL 3QDJE 5I0ZA 4ZUWA 1FRGH 4B0MB 2ESVA 1U4FA 1YPZA 5KANG 4F92B 4FQXD 4J3SA 2AW2A 4L2LA 3GI8H 1MCWW 4KUZL 4XVOA 2WQUA 1CFSB 1QBML 3NA9L 4O5LL 4HOZA 2E7DA 3TXAA 1I53A 1K2DA 1KNOA 4H0GA 3VGBA 2OMVA 3D3VB 4PY8I 1ADQL 3L5JA 3JSSA 1YQVL 2EKSB 2RALA 3B7YA 2O6FA 1AE6H 5SWZE 4YE0A 2EDMA 2VWEE 2BWQA 3QT2A 1I1CA 1TETL 3SDDA 5DQ9A 5GJTH 1XGYH 4XCYB 1AG6A 4NP4L 2J8UF 3H9ZA 5FPIA 1AZUA 3H9SD 5DUPH 4QHPA 3WG7B 4C83A 3UG5A 3X1EA 3JZ7A 3RZCD 3V4LA 2RTTA 2K9UA 4C55A 3OXRA 4JKKA 5M7QA 5T1JA 5C9JA 1UXSB 3B7RL 5E9AA 1VFBB 1ND0A 4BFNA 4KKAC 2AJXH 3A4DA 3GDCA 1JWSB 1QR1B 2NY6B 3FTWA 3MOBH 5CR8A 5DMGD 1P6WA 3V0DA 5KBPA 5EEXA 3L9RB 3L4CA 4OV5B 1JI2A 4HJGA 4U6VH 3OLGA 4YL9A 2B4CC 5TDPA 2V4LA 5DMJB 3DOHA 1AQHA 2DYPB 1F8TL 2XTJC 1EFXA 3W38A 2VDPH 2P46B 3V0EA 3GD1C 2V5RA 4H8QA 1ZV9A 2PPDA 3ALWA 3HNSH 3RQ3A 3HI1B 5JQHC 1CG9A 5JO5B 3DUSA 2GJ6E 1J5OL 2VLJE 3CDZA 4X5XA 2QSTA 4RFNC 1OW0A 4QRPA 2OMWB 4GAJH 3AM8C 4TQEH 5F96L 1GC1C 4Z7VB 3QWRA 2J5WA 3C6SA 2P26A 4QHMB 3V4VA 3BWSA 3OXSA 3V5DB 1FAIL 1U8HB 1HL4A 1IC5H 5EU3A 4JHAL 2WXJA 3HE6A 1F3DJ 1V7ML 4X7EC 2JQZA 4ODSH 4XGZB 3ZSSA 3IGKA 5PCYA 2LR4A 2ZD0A 5DJCA 4QY8A 4ZZFA 4P3WA 3SKUD 3TWCH 3JV6B 4JZNA 4PH8A 1MJ7L 3DTXA 4QRUA 3WDHA 4AE0A 2G0KA 4DCQB 4QOKE 1QASA 5SWSB 2QDVA 4UV4H 3ZX1A 3KBEA 2XJKA 3QORA 4HW6A 4J28A 5FCUL 1GS6X 2DM7A 5DDHB 1FE8H 3MV01 3ZDXF 1HHJA 2Z7YA 3BVVA 1KFAL 3IMRA 4ONGL 2OLDA 3E8UH 4R26H 1PZ2A 2JB6B 4NKQB 1AIFB 4QRFA 3EJZC 4N0UB 8PAZA 5EU6B 5F6HI 2A4ZA 4TLKA 5TGBA 4ATWA 3VQLA 4YSOA 2A4CA 4NQEE 1CE1H 3LQMA 3LSOA 3TZVD 1BLNA 2CO2A 3QJTB 4Q2ZA 5EF0A 2GBTA 3H3PH 3MOAH 3WEXB 3N04A 5IMLB 5I17A 1KLFB 2HX9A 2V2WA 5KTEL 1N59A 3LQAL 2Q87A 3HVNA 1DSFL 3D09A 5H4ZA 1NIFA 2XN9D 4PJ7B 2QPDB 4F3FA 4P4RA 5I1JL 1BVNT 3FTSA 4J6RL 3RHWK 2ZCLL 3HG3A 3DETC 3PGDA 4I0CC 2X4QB 3A6BH 4XPGH 4JGUA 2WLLB 1MFAH 3D39B 3FTGB 1T0MA 1ETA1 4LLWB 4BZ2A 1SJVA 2XQBL 1KIUB 1VB9A 2EC9U 2FZ3A 2F7IA 2FEEI 2VLKE 2W07A 3LNDA 4P59L 3T0EE 3TA3A 3GRWH 4Z23A 5AWNL 1A5FL 3OHMB 5C9KA 3TO4A 3ZDYB 4MA8L 3HC0B 1L5GB 4HMCA 4WWKD 3RWEA 1OM3H 2BZDA 3OSKA 4PW3A 5EU7C 1YG9A 2XC8A 2Q3AA 4P07A 3QUYC 3L95B 1OP5K 3KYAA 2HLAA 5D70L 2GC4C 3OKEB 3QIBA 1UQSA 3ULVL 5TQ0L 3BE1L 2P5WA 3QDGB 5FF6A 1E9QA 3PJNA 1FLRH 3PWUA 4X6DB 2GJRA 4PLNC 2IPUG 1AZVA 4N2EA 3MRPB 4GKZB 4PJ8B 4ZMQA 3N40P 4M56A 1XSOA 4P06A 2P8LA 3FQUB 3CU1A 3FU9A 5HJ3B 2AK4B 1UJ3A 3VCLA 5I1IL 3BW9B 1QI3A 4HEME 4K71B 2R2BA 1M7IA 2JCCA 4Q7DA 3A23A 1MHPH 4JRXB 4Z7UA 3C09C 3WNLA 1IU1A 2WUBH 2OJEB 1XGTA 5JHDA 2B8OT 4GXVL 3CH8A 1S7QA 3PDOA 3G6AB 4LCWB 4DEPB 1WRFA 4JPKH 1F18A 4W4NA 1UXWB 2V5TA 1VIWA 3CVDA 1SHSA 3M45A 4V1DB 1IFRA 3PRZA 2JH2A 3NRFA 4K3HA 3OAWA 2FATH 1HCYA 3MRMA 4H25B 1J9QA 3EOYG 5FO8A 3VD3A 1MIML 4ZYKB 5JMOC 1HINH 3RWDA 2E7BA 1BP3B 1CR9L 2LU4A 4QHLB 2ADGB 1EGJH 3IFNL 2QKIB 4G6KL 4AMXA 3GRBA 4LSRH 1I8IA 2K1MA 4GT0A 3RZWA 2YD0A 3LNHA 5BXFA 1RZIA 4XB3A 2UZXB 1KUMA 4FD0A 1LILA 3DDGA 4HCIA 2GK2A 4HT1L 3SD2A 3UBHA 5T1LB 1DN0A 3EKCA 4NKIH 4M4RA 4W9IC 3HLKA 5BMFL 4LIQH 1CFMA 4HJUA 2WAHA 1OWRM 3AB0B 4PV8B 1IO4C 5C0EA 2JE8A 2E4TA 4S1QH 1IB5A 1DBMH 3PIQB 3VFRA 4NN5C 3PL6A 1FVCA 3BLKA 3OGCB 1GOFA 5E94A 3VI4E 1NDGA 2IOMA 1ZE3H 2IGFL 3KPLB 2QLVB 4L4JA 3K91A 5BV7H 1COBA 3ZT7A 3ZVVA 2DI9A 2HFFA 3EFOA 2AEOA 3UAJC 2JI1A 2E4FA 2XA3A 3ILPA 4PJDE 4Y7OC 5JW4Q 4R3SA 5ICXB 4Y5YB 2WMPB 1VCAA 3U2JA 1JNHB 1DQDL 1U8IA 2BJML 3KLSA 4LASH 1BX2B 1KGUA 5I8KH 4CNIA 2DTSA 4XWGH 4Z3GA 4GYBA 2DOCA 4PG9A 5GRYA 1P9MA 5D1XC 1S9YB 2VMJA 3N42F 4O58H 5FGCB 2WYTA 3TN0D 1YEIL 4HWEH 2TAAA 2AZUA 3IDYB 4A6YH 1YAZA 4EIZC 1HH9A 4YDVB 3OR6B 3V4PA 4MSWB 5A7EA 4AEEA 4XCEA 4XMKL 5DJ8A 3B3BA 3LIZH 3ZHDA 3CZGA 3NAAL 1I3VA 1CJYA 1UC6A 8FABB 1DVUA 3HMWL 3DLQR 2YD9A 5F89B 3GSXB 1EJOL 1Z1WA 1U93B 2A6JA 5JXED 3WI9A 3AW5A 3GUTA 1LD9B 1DEEB 4HWBL 3RY6A 3FO1B 3NCBB 2ADYA 3ML9A 5FFOA 5AVSB 5DS8A 3FAWA 2H1PL 1MFBL 2GJZA 4AK2A 3GSRB 4RSYA 4MXWL 4K5PA 4QRRA 2X1QA 4EEEA 1KGYE 4IU2A 1ITBB 2EZ0C 1T66C 4LESA 2F68X 5IP4A 1HQRB 4MX7A 5I1AA 1U8LA 1NH6A 5C6PB 3X1BA 5C0JA 4PGJA 4K07A 3CFBA 1BV8A 3IJ7A 5T1MA 3STZA 4P2OD 1ZIBA 2OMZB 1U8QA 1G7QA 3NSYA 2COVD 3EJPA 4KKCD 5L6YL 1MVUB 4UTCA 3FQTB 1QFWH 3LQZA 4HIPA 3TV8A 5IREA 4FXGC 4PJIE 4DEWA 4EXPX 5I73C 3LEXA 5L2KE 2QPEB 4FCHA 2CHDA 3IFPA 4N5UA 5IBUG 1DP0A 3WHXB 4DOHB 4V2CB 3IKCA 4J1UB 3GS7A 3T4YB 2X7LA 1IGTB 3MLZH 1KN2L 3FQ1A 4PJXF 1G7PB 3A6OA 3CX5K 2YQ3A 1IAOB 1HCZA 1TQCC 5ANHA 3ULUC 1INEL 3MJ8B 3BYYA 5F70A 3EW3B 5KYXB 3GMQA 4DUWA 2G5UA 1IEBB 3DBXA 1KJ2H 4XVSH 4XMUA 3LZQA 2V7HB 4ZO9A 2DMKA 1EUTA 5DXWA 5HJBA 4KI5D 1BZ9B 1FG2B 3IXAA 3QW9A 1GYWA 2H0JA 3MRJA 4A04A 3QCUH 4IIZA 2EAEA 2WZ5A 2EO7A 2YSSB 4PJGF 5KVGL 4X4KA 4R4ND 3TBWA 4O2FA 2C4FT 4QHUA 2DQGL 5TH2B 2FRGP 1CXIA 1TJGH 4KDVA 2DJSA 2R56H 4Z0XA 2NY7L 3QG7L 3ROOA 5HDRA 3UBXB 3MLUH 5EIIG 1U8CB 2NY5L 4L5FL 5HVHC 1J0HA 4LLAA 2ZX7A 3LY6A 5C86A 3PHSA 2ZOOA 2Z31C 3QI9D 1NM9A 2B4CL 2EO9A 3GK8L 3QPQD 2J8UA 4HAGA 4L37A 4R7XA 5E1QA 2WZPD 4JDZA 5I24A 3TPUB 3PQYA 1M1SA 3HLAB 5DURB 4QUOA 1S5IH 2RFXB 3EJTA 3UACA 4JPVH 4LP8A 3B7UX 4MA7H 2PNDA 4LHQB 3QPXH 4LOEA 2VXSH 3MKGA 3O3EB 4OJEH 3CXDL 2AERT 2NXZC 3GLDA 1E4XL 3QXDB 4ZUUA 5F72S 1FZJB 1AR2A 2LU7A 3BZFA 1SOXA 3D69A 4KTYA 4F7KA 2R7EA 4AY0A 5I82A 4RFEA 2Y6SC 4R5TA 2V5SA 2EE6A 4IMKA 2VL5A 1JD7A 5C09B 1LQSR 4IRJC 1GC1L 5IHHA 3S3CB 3GEWB 3S3PA 3QNXA 2H9GB 1JVKA 3CZEA 2J44A 1YNLL 2ZKHH 3QXAA 1FFTB 2XWRA 1NOFA 1SNRA 1NUNB 5AOIA 1YJDH 4LOUC 4ABUA 3D07A 2IF7A 2LU5A 5KSVA 5MENE 1TJIH 4U7MA 4PRIB 4OZIE 2DQUH 2HFEA 3SYQA 4Z7WF 5F9OL 4PGCB 2BSEA 4YUEL 4G1MA 4YHZH 4NWTL 1CI3M 2Y24A 5IHZA 4LPCA 2WXMA 3WKQA 1Q0YH 2BSDA 2CR0A 2IDTA 1OL0A 2NY0C 5FYJL 5BZWA 3OHXA 3BEVB 2BNUB 3ETTA 3MJ7B 4ZW5A 2C9PA 2R0KH 3BIAX 4RMSA 3UPCA 5IOKA 3SQOH 4QYOB 2P8MA 2ADFH 2XKUA 3GSWB 3V4VH 5FWRA 2XQYA 4F15C 1CN4A 1CDIA 4O00A 3VXNA 2Y06L 3BWZA 3LKRB 4M7ZC 5C0AA 1D5IH 1WA2X 4OZGA 4FG0A 1ODAA 4JM2C 2OZ4A 5DO2D 1A3LL 3RNQB 1FFPA 1F4WL 1K8IA 4ODVL 4XNZB 3VFWB 3VX1A 2IMMA 4HUUB 4L1LA 2NY3C 3MV9B 1WSST 5IQ9A 5IQ7H 1E8WA 5F8RC 1NFKA 1X5KA 2ENPA 5F7WC 5C71A 2C9QA 3MSPA 5SV3A 2YKKA 5I6LA 3LEYL 4FQ2L 4LPXA 1AMYA 1PD6A 3RIKA 1S9WA 4RBPK 3DIFB 3O3DA 3GSVB 2FD6L 2LOEA 5F7LB 3ZSTA 1BVOA 4R97C 2VR7A 1J0ZA 1N64L 2X9YA 3EGXB 4QNPF 1X9LA 3RUGA 4Z7QE 4GUPA 3F83A 1NTDA 1EAPB 1NCGA 4Y5VC 3ZQ9A 5CJQH 1AGBB 4IOIB 3G5VB 3QO0A 3O6LL 4UQ3A 3EZJB 3OKYA 5CINL 4DN4L 1IBBA 3GI9L 3HUJE 4GKOA 1KTJA 1MRFL 4Y2OB 2Y23A 3SJVD 1KY7A 5DJ0B 3BQUA 2OMTB 1CFSA 1FYTD 1Q8MA 2DQFB 3B9DA 4ODXB 2F7OA 3TJEL 1NGQH 1XCQB 1XTLA 3X17A 4OIIH 1HTYA 3NCYS 2QSCL 4DPBX 5C0DB 3CFTA 2A74B 2EKSA 5A43C 4WU5B 2QT6A 3CLFH 2C34A 3EOBB 3HB3D 1NZRA 4NQCE 2NSMA 1NCCH 1D9KB 3QJSB 1ZT4A 4G72B 5K1NA 2SEBA 5G55A 4N8VA 4PRPE 4DFHA 3FONA 15C8L 2B14A 1GKOA 4EI6B 3PHAA 1RK0A 1GPOH 4EKXA 4U1HA 4R84A 1DJIA 1X4YA 5FA3A 1YEJH 1SEQH 3MLYL 1ZLWH 5I28A 1QR1A 1P0SE 2BHYA 1GHFH 2F5AH 3R06B 4AUJA 1ZXQA 5IVXB 4HLJA 2HPOA 5E4EC 4P2RE 3OB0H 3FU3A 1NANI 2GSIA 5F3FA 1BJ8A 5LVEA 2ZJSH 1QEWA 1D7BA 4FJYA 3VFUA 1IEHA 2VN4A 3CVHH 1BFOB 4LLDA 5AB1A 2Y7LA 4PGDB 1R6VA 2CLRB 2YXWA 2APSA 1DUYB 1IAKA 4BQCA 5DD0H 5HHOA 1NGXB 1IM9A 4UI2A 1JV2B 4JQVA 3A6CH 5JPNA 1Z3GL 5G5DB 5LGYA 1RLBA 4E0RA 3BFWA 2Q8BH 2NY6D 5AW8B 3W0WD 4FAAB 2FLBT 1SM3H 2BSSA 3DROA 3WIAA 1RZFL 5D5MF 4XVTH 4AMKL 3P3TA 3OKMA 1YNTF 2O5XH 4XBPA 5GJSL 1DQQA 4M7JL 3K2UH 5E5MB 5CNHA 2EC8A 4Z9KB 1KGJA 2DYPD 3RVUC 4AJVA 3QZPA 2EEAA 3B6SB 1E9PA 2I07B 4ISVA 3ISRA 2DLFL 3DPDA 3B7SA 1I8MB 2FJHB 2CUMA 2D7PA 2GSGA 4K3EH 3O6FA 2XPZA 4X2UA 4OZHB 1IV8A 5ISZE 4RESB 3RU8L 4DCQA 4HCRL 4GI9A 4N9GB 3U48A 1XTMA 5IT2H 4X4ZA 1RUML 2Q1EA 4FL4C 5C0RH 4YBLC 4L8CA 2YAOA 4D3CL 1DBAL 1I9RL 4JZJB 4H4NA 5K9OA 3AY4C 4NNXB 5KS9E 5CN2A 3KDMA 3CZUB 2ERJC 1AIFA 1QEXA 2HVJA 4GBXB 4DGYL 5D4IA 3EXLA 5J9PB 5HVWA 4XNYL 1CS6A 1IZJA 3FB6A 3DK2A 3K6SB 1RMFL 4CU7A 1XB6A 5SWSD 3OQRA 2XWBB 2FK9A 4AQ1B 5EUKB 2JMRA 4P5MA 3D08A 4KPHL 2F54A 5F97E 1JVOA 1ZS8B 2MQGA 3OQ3B 4PJ7A 2OQJA 3JWNE 1PVHA 3QCVL 5E0FA 4GW1B 3TJHD 3CFJB 2CPCA 3S35X 3TBTA 4LVEA 3VXQB 5AB9A 5EU6D 1QTYT 3WEBA 2Z4QB 3CN4A 2C9XA 2X4QA 1P7BA 2VXVH 2WLLA 5IB5A 4PAZA 4Z1PA 2YBRB 2EYRB 2R8SL 4NDMB 1GSMA 4CVXA 3DX8B 4KJPD 1Q9OB 3FHEA 1J0KA 3EYSL 5I75C 2Q86B 4HU2A 1A6TA 4TL4A 5L9DL 1XGUA 1CVSC 3I84A 3GBLA 5J6HA 4LDOB 3R1GH 1ZT1B 3FK3A 4ZUVA 5DF0A 4BQ9A 4C57C 5FYKD 4K55A 4EIBA 4U49A 4K7FB 4GRLD 2W88A 1CD0A 5EWIH 3V4PH 3ZGIA 1R3HB 1R1CA 2D03L 2LHAA 3QJOA 4OLYH 4X6DA 4AJYV 3CN0A 4JVUA 3L4YA 3X11A 2VDKL 2GEEA 4WW2A 5BRZB 3MRPA 1WV7T 4AUUA 1KBWA 3TURA 3VDAA 2AS5M 3QQDB 4FEIA 4B27A 1J8SA 3HE7C 4WDIB 5GGTA 1KPUA 3FO2B 5HJ3A 1BM3L 4MNGB 4OFYD 5GIRB 1R5WB 2ZG2A 3E3QC 3VI3B 3RTQA 1TG8A 4OSUL 3B9KA 1A1OB 1XGQB 4XMTA 4FMKA 4K7PY 4HFWA 1BMZA 3IMSA 3EUUA 2VDNB 1XD1A 2E59A 3G08B 3QDGD 1KPVB 3HZKB 1K5NB 5CU5A 4GO6B 5D7LB 1AR1D 2WV3A 4WO4A 4FHBD 1SF5A 1AHMA 1ZGLB 2ATPA 4WFHE 5D93C 2XZZA 1PAMA 3HEIB 3U30C 4E68A 4PJ8D 4WCYL 1E28B 2RQ8A 1OAKH 2CBPA 2G75B 4YXLH 3QDAA 5LDUA 5F2FA 4KZDL 3US0A 3HKZA 4AQEA 3IRCA 4NQDA 4ZX6A 1NCHA 3TM6A 4ZFGL 4UV7H 1CURA 4AYFB 4QIRA 5KVFE 4AXWB 3KLAA 4OCMC 2NQCA 4BKTC 1FA4A 2M1KA 4LCWD 5IROA 4KRPB 1GH7A 3WE1A 5IFHH 3G7TA 1XH2A 5GHWH 1L6ZA 5E1IA 4D0BA 4N8CH 5EOCH 4LVOB 3IJ9A 4PJGA 3EZ8A 1RIUL 4W9EC 3P3RA 1CICC 1RHHB 3CHOA 1SF3A 3BWUF 5AVQB 1MELA 3DX6A 4IHBA 3RDTB 1MOEA 5C07E 1MH5B 5AKRA 3VGGA 1GTFA