3FJTA

Crystal structure of a human fc fragment engineered for extended serum half-life
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
209
structure length
209
Chain Sequence
GGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Structural characterization of a human Fc fragment engineered for extended serum half-life.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 32
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fjtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fjtA01
4Y2DB 1U58A 1URLA 4M8QA 4JRXB 4DAGL 1MCIA 3N9GL 4MJ6A 1T2JA 3SDXA 4X98B 1JPFA 3PABB 5DRWA 4R7NB 1W0WA 3GSXA 1F4WH 3NCMA 4K23L 3EOAB 4IRJD 1Z9SA 2UZIH 1F6AA 4ZQKA 4HC1H 5LGHL 3T2NL 4MCZB 3A6CH 4NWTL 4R90L 1DQLH 2H45A 3DUSA 2UWEE 1IMHC 3JV0A 4M1CC 4DKEL 2HRPL 4LASL 5F1SA 3DV4B 3VFMA 2DQGH 4PP1D 3TNNB 3QUXB 1JGUH 4NT6B 3WHE1 2DQEL 3KPRB 1KIRB 4ETQA 1FG2A 3GNMH 3IJSB 1JBJA 1OLLA 2IH3A 3T2PA 3B9DA 4G6JH 1EUTA 2ITDA 3VFSB 1FL5B 5I19H 4KJQD 1H15A 3IU3B 1FAIL 3H2WA 1T04A 5ISZE 3H0TB 5TF1L 3PDDA 3VDCA 1DEEA 1GXEA 4ZO8A 1Y6NR 3S35X 1ZVSB 2KZ1B 2J6EL 2FH8A 5T1KD 4XP6L 4F9PA 4JY5L 5IT2L 4FZEH 2Y6SD 1QLFB 1X5HA 2BJMH 1G7LB 3TT1H 5GXBB 5D9SB 3VWJC 3FB7B 1DSFH 5TJWK 3Q3GA 4P4KD 4H0HB 4YDVA 1H3GA 1XGPA 4TN9A 9CGTA 1QVOB 4WNQA 4X7FC 5A16A 4UDUB 3HC4H 1ZLVK 4NRYA 3LHPH 5I1KL 2BNRD 1PAMA 3E6HB 1ITCA 5F70A 3T3PE 1W72L 2X40A 4WWKD 1HYRC 3EKCA 2AABL 4P3DB 1U8NA 3QUYD 4TUKL 3VFRA 3ULVF 5CGTA 5JW4Q 5IFAH 4MVBC 5D2LF 1RV6X 4OFIA 5I73B 2VSCA 4PYGA 1A6UH 2XT1B 3NACL 5IHZA 3GRWH 1AD0A 3TFKC 4AEHH 5IF0A 2LTQC 1RUKL 1ZSDA 1BVKA 1KV3A 1T7XA 1RIHH 5I71B 2F54D 4I2XB 4IRSD 2UV3A 1I3RB 4PRPB 3V4VL 4HXBL 1A9EB 4XCNB 5IMOB 5GSRA 3SGKC 4M1CD 4HFUH 3QQNA 4OV5B 2FWOA 4I3RL 4RGOL 5KS9A 1S78C 1DBBH 3QA3A 1BIHA 5I1GH 2R2BB 1HXYB 4P46A 1I3GH 5TFSL 2GAZA 2Z8RA 5IHLB 1X4XA 3H9SE 4K3DH 4U1LA 1FC1A 1B0RA 3WIHL 4NO3B 3P3YA 5DT1H 3K4ZA 2BCKA 1OF2A 1JGEB 1BOGA 1U3HB 3INUL 1UWXH 2VDQH 5GJTL 2VZVA 3QISA 5HVHC 4JRYB 4J23A 4MJ5A 5DRXA 1E6OH 4KPHH 1YMHB 4M3KB 2CMRH 2LAGB 2B1AH 4EOWL 2I07A 1AGDA 4F7TB 2HFGH 1OT2A 1YJDC 3PL6B 5D2NB 1HHIB 1KTDA 1E4KC 4GKZB 3IDGA 1EO8H 4JQIL 3H42H 1MFAH 2EECA 4MNHA 4NKIL 4U1NA 3DGGA 3B9VA 3SDDB 3ZE2E 1ORQB 4S1DD 2VITB 1HILB 3O2DA 4D8PB 5BRZB 3W11C 5EZLB 2ADJB 5B38G 3TWCL 5ABDE 3ZE0F 1ZHBB 4MA8H 1I9JL 5CMAB 3BZ4B 5FA3B 3MV9D 3RGVA 1Q8MA 5IVXB 1DBKL 2YEZA 3LIZH 4HF5L 1OTUD 2DWDB 2WNGA 5KZCD 4ZODA 2WLYA 2YPKA 4URTB 3QIWB 5EU3B 3SE3C 3QUZB 2Z93B 1QQDB 2IAMC 1KGCE 3DV6B 2DD8L 4ZXBA 4M9PA 5A2KH 3TESA 2WBJB 5C09E 3FQRB 1WBYB 4L29B 4AH2B 1A3LL 1P1ZB 5DJ0A 3SN6N 5C0GA 4AEIH 4DW2L 4PJIA 1E4WH 5J1SC 3TVMA 3U83A 3EYFB 3W82A 2F15A 1CXEA 1PZ5A 2VNCA 4OTXH 3V9FA 4ZOBA 3EDDA 2DM7A 2VDMH 3RIFF 2XXCB 3QDJA 1U95A 1UJTA 5FV1L 3QDHA 2VERN 4GRWF 5FO8A 4OZGF 4WDIB 2NMSA 5FUCC 4O58H 5J06A 2A6DA 1WF5A 3B6SB 3MZTA 4U6TA 1VCAA 1C16B 2AXFA 2MCPL 3X3FH 2ZJSL 2A6IA 5JIIA 1XH3A 3B43A 4PJDA 3PDGA 5J8OA 1A3QA 5C7XH 4GJTB 3LKQB 4ZSOB 2X4RB 4S2SB 1VKXA 4Z7VB 5TDPA 1F4WL 4HXAH 5IJVA 1ONQB 4FQQA 3VFVB 3UTTE 4NQDA 3FRPG 1KB9J 4U3HA 5F8RC 3RP1A 2UZIL 4TVSa 4HC1L 5C3LD 2AXHA 5I76A 3VXSD 3A6CL 1RZKH 4KH2A 3VXRE 1DQLL 2OSLA 2N1KA 3DPBA 1CD0A 5IIEB 4Q74A 5HHMB 4ZPTB 3BT2H 4NZDA 2DQGL 1MCWW 4XH2B 3NCYP 4JO2L 4YBHA 1LDPH 4QOKD 1JGUL 4L8BB 3W9DA 2C7UA 2E7LC 4CMMA 3T1FA 3GNML 1Q9WB 4G6JL 5T1DH 3GSNA 1WCBA 2C3VA 5I19L 3MJ8B 1QSED 1INEH 1IARB 3BDBA 4YHPA 2HJLB 4JRXE 1G0DA 4F80A 3HMXA 5F1NB 2OI9B 1MCJA 4JDTH 5FYKD 1DQJB 2ZG3A 3L3GB 1Z0NA 4FZEL 3ARDB 1KLFA 2BJML 4LVOB 4XAKD 1UEMA 5HHPB 3TT1L 4CRPA 3W39B 1UWXK 3WS3B 4LFHD 1DSFL 1ED3A 1U8QA 3BESR 2ESVD 1S7UB 4DJMA 1FO0H 1JN6B 5K9QI 5EIIA 5E5RB 3V0WH 5BQ7B 3IXAA 2BVQA 3HC4L 2I27N 3VH8A 3MJGX 3JWDC 4L4TD 3RWIA 2ADFH 3LHPL 2WSKA 1FHGA 1XGUA 3IJHA 4KJWD 3KPRE 2X1XR 2APTA 5C07B 5FK9A 2Z4QB 1P4LB 3D5OF 5IFAL 4HSQA 4RMQA 2V2TA 3HI5H 4RMSA 4F9LC 4EIGB 1WBXB 4L1HA 2L0DA 1A6UL 3RJQB 1GOHA 3GRWL 4PJCF 1LNUA 2A38A 3QQ4A 3B5TA 4AEHL 4I0PB 5GGUA 1AHWC 1RIHL 5IMMB 3FB6B 2NXYC 5TDOA 1DN0A 1CGVA 4X99B 5JHDD 3O3DB 2X4TB 3FFCA 4DKAA 4YDKH 3OXRB 3KXFA 1XGRA 3RZCD 2JTDA 2OYPA 4HFUL 4NKMB 3V5KB 1U93A 3U7AA 1VEOA 4EN3C 2J5LB 5L0QC 1E4XI 5F7KC 3VE0B 3NCCB 5IFHH 3QFJD 1VGKA 1I8LA 3OR7B 3OBAA 4JKMA 4YDLC 1DBBL 1JZ5A 5I1GL 1NSNH 1I3GL 1NC4A 2HLFD 4NFCA 1P53A 1CDIA 2GIYA 2NY6B 4K3DL 4X4YA 4IOIB 4KRNA 5INDB 1AI1H 3MXWH 4M7LT 2CKBA 1Z6JT 3O9WC 4MHHI 2VDQL 3T0EC 5L2KA 4I2XE 2R39A 2FO4B 3H8NA 3F12B 3EOTH 4PRPE 1E6OL 4BYHA 4ENEC 3ZTJG 1BPVA 2GI7A 2YD8A 4MS8C 3JVGC 5IB3B 2B1AL 2AJYH 5J89A 2PYFA 3KYNB 4K71C 4NN5B 1BMGA 2HFGL 5MHSD 3N0PB 1UZ8B 1IGTB 1RHHB 1RI8A 2P8LA 1X5KA 1EO8L 4MLIA 4R7DA 1QR1B 5GSVB 3H42L 3OHXB 1I8MB 3FO9A 3BPCB 1MFAL 3HPLA 4KDTC 1TVBA 5IEKA 3VXOB 4I0CC 1PDKA 1UQSB 4LLVB 3OKOA 2XWTA 3I84A 1NCNA 2HMIC 3FQWB 4KQ3H 1MAJA 4JFPA 4XZUB 4AIZA 1MFBH 5JMRA 5IVOA 4Q9QH 2IALB 4MA8L 1QHPA 2NXYD 5I66B 4OLVH 1CD1A 3KPOA 5SWSB 4JRYE 3MO1A 3FT2A 3LIZL 3RPKA 5INCB 3PV7A 4Q0XL 1W8OA 5FECB 4YIQA 4X5LA 4EN3D 2HN7A 2NZ9C 5EO1B 4U6VH 5D2NE 1KYOK 3T65B 1HHJA 1CL7I 3RWCB 3IDUA 1G9ML 3PWLA 1JK8A 4XP9H 1WAAF 1EAPB 3ZT6A 3PE9A 1E4WL 1Q9KA 5D2LB 5F3BA 2J12B 2AJVH 4HX1B 4OTXL 1KN4H 5GZOC 3MZGB 3TH4T 5DD6A 5KN5A 3PHQA 2VDML 1D3CA 1IBGH 5BRZE 4QGYA 5MP6H 3LN5B 2YA0A 4A2MA 2F74A 3MV8A 4KK8D 3UPAA 1UZ6E 1ZXQA 2C1OA 4OKVA 1I7UA 4S1SH 4XCCH 1S5IH 4O58L 4P2CG 4R4NC 4ENED 4I3SH 5IVXE 3OKEA 5E6IB 2HVKB 5D5MF 1JZ4A 1KC5H 4BQ8A 2HT3C 3OJVC 4IIQB 3X3FL 5I16B 4I8DA 4Y4HD 1L9NA 3HRZA 5C7XL 3GMMB 1JYNA 4JM2F 4XBGB 5IBTH 4LQ1A 4UAOB 1EEYA 4M9OA 5ITFA 1FZKA 4GRLB 2IANA 2G5BB 4HXAL 4LLUA 3RUGB 3ULUC 1T0PB 3RVXC 1FCCA 1S7VB 3CPLA 3WNKA 4M03A 1CR9H 1F6FB 3ECBB 4M3JA 2FZ3B 4YBLC 2HLAB 3AS0A 3V0AC 3DIFA 4WI4A 2K3TA 5HDLA 3L3DA 1RZKL 3P4NB 5EUKA 4XVJH 4OF7A 4P2QA 4GAJH 3V0VB 4XMLH 5E4EC 5AZ2H 3BT2L 1WZLA 2YC1B 1OWRM 1I1AD 2XZZA 5BO1H 1WQVT 1LDPL 1KNOA 4F15C 4GLRH 1ITBB 4WW1B 4GS7B 4TVPD 3C2SA 3GDBA 4B5EA 4YWGH 2Q8AH 1W72B 5T1DL 4HUNB 1YYLH 1E0OB 3G5VA 4HWZA 3HI1B 5D1QB 1P7HL 2NZ9D 4EVNA 4NKQB 4ZSOE 4QRRD 3ZTNH 3FJTA 1BECA 4Z7VE 4JDTL 1T0NB 4MQ7B 2F19H 4Y5YC 2P8PB 3BIKA 3EZ8A 5F1OB 1X7QA 5JOPD 2Z0BA 4YHYB 3T09A 5BW7A 2XPGB 3O8XB 1YC8A 1SMAA 5J12C 5ADPH 4KI5D 1PG7X 1FO0L 2Z8SA 1OAYH 1JWMA 4U49A 3KPSA 2O93L 4K3EH 5HHME 1FFPB 2X9YA 3V0WL 5I8CA 5HGDA 1L9MA 1FDLH 4FS0A 2ADFL 3WFHA 1T1ZA 4AJ0A 3QEUB 1V3MA 3B9AA 3TH2T 2EEDA 2OQJA 8FABA 5E95B 4NN6B 3RY5A 2I60H 3TJHC 2W65B 4EUPG 4F7CB 4OKDA 1VSCA 4XRCA 4HUMB 4K8RD 3ZT7A 3VWJA 4XI5C 3RVXD 1SJHB 3VA6A 3ZKSD 1DBJH 3STBA 2WQ8A 1F3JA 2D4FA 1QFWI 3GKWH 4ZFOA 2Y7QB 5E00B 2GQHA 2W0FB 1LE5A 2V2WA 4YDKL 5GGVH 3SPVB 1IEAB 1A6ZB 5EBWB 2IFFH 5DS8B 5E7BA 1XF3A 1CICC 2W0LA 1UVQB 4HAGA 5IFHL 4AMKH 1AJ7H 5CAYB 4OZGB 3X3GH 4PS4H 4HKZB 1NSNL 3L5XH 5C07E 4PJFB 4HWNA 5DEFB 1U8OA 4U1GB 4L4VB 4MGXA 5LGJB 3BVNB 4TNWK 5DJYB 1AI1L 1ZS8B 4EUPB 3GUTB 4KROC 3C2AH 3MRHA 1KCRH 1S9XB 3MXWL 3SGKA 1ES0A 3BGMA 1D6EA 4ZNEA 3QXTA 5IWLA 3EOTL 1NH6A 4ETYA 2H32B 5BJTB 1OAQH 5KVEH 5C0CB 5M95B 5MI0C 5GRYA 3WHXA 2AJYL 1CZ8H 3ZDXE 1TNNA 2I9LB 5J11C 5EU4B 5GGSA 3MOAH 3VGDA 3QDGD 3VGAC 1H3PH 1LO5B 2H2PC 3ETBF 2OTWB 3GMRA 5GZNC 4PJXF 1FVDA 1A6TB 1XR9A 2DLFH 3QHTC 1MCOH 1NFIA 1R3KA 1CGTA 4FG6C 4KMLB 4LCCB 3IFNH 4KQ3L 2NY5H 3AU1A 1MFBL 1M05B 2PYEB 1QACA 2HKHH 4X5XB 4Q9QL 4HUKB 2IPTH 1A1NA 2APXA 2V5SA 2NY0D 3UJIH 4P3CH 3T0WA 1BVLA 1MLCA 1N59A 4OLVL 1FLTX 3MYJA 3F7PC 4J4PD 1J8HA 3HMWH 2EZ0C 1C5DB 3QYCA 5HGAB 1E4KA 4U1HB 4XX1G 3MTRA 1CE6B 4ZUUB 5C0EB 2VUOA 2BSTA 4PGZA 4U6VL 3MV11 3T3MF 2A0LC 1MF2L 5K93A 3UO1H 1G7QA 4H5SA 4YC2C 5FYKH 4XP9L 3PNWB 4HUUA 3WFBH 1U8HB 2CKNA 4AQOA 4NQCB 2VLRA 5EBLB 2A1WH 3P40A 2OZ4A 5C0FA 1KN4L 2Q7NA 1U92B 5EC1B 1IBGL 1R5VB 1K6QH 4PJCB 5MP6L 1NEZG 4LSDA 2DM2A 1UADC 4S1SL 3L3IB 1I8IB 4XCCL 3T4AB 1S5IL 3UBXA 4V2BA 4I3SL 5SWSE 2QLVB 3RQ3A 1F11B 1KC5L 2IAMA 2M1KA 5FM8A 5JQHC 3RWJB 3HCVA 4NC1E 1FZOA 5T1LB 1O7VA 3SBWC 5IP4A 1JMXA 3EHBC 3AB0C 5IBTL 1P7QD 3F8UB 1HHKA 4P2RB 7FABH 3K8KA 3O0RH 2EIEA 3KLAA 1R3JB 1G9NC 3TCXA 3SE8H 3B83A 2H2PD 3SOBH 5H94B 2EE9A 4JFDA 4YUEH 5DFVC 1CR9L 1CVSC 3O4OC 5HI4D 1A2YB 4V2CB 3BPNC 1O7SA 3TCLA 3ULVE 5D2LE 3DVGA 1EHNA 4XVJL 3TH3T 1EBPA 4UIKL 5ESQB 4GAJL 4XMLL 1I8KB 5AZ2L 4CN1A 1AKJD 1INDH 4C56A 1IC1A 5BO1L 3HE6C 1A3RH 5ACZA 5BVJA 4GUPA 3ULSB 4G8IA 3V6ZA 3RVUC 4MDJA 1LILA 3SKMA 1XFPA 4ORZC 4YWGL 3DX9B 2Q8AL 1L0XA 5AD0A 4PLNC 1MCWM 5EWIH 3RGVD 1YYLL 1L7IH 3MNVA 3VMOA 5T3ZD 4PTTB 4EI5C 4LCWD 3CK0H 4OD2B 2XKNA 3ZTNL 2DWEA 1OSPH 5I2IA 4OZHB 1TTGA 1BZ9B 3RUGE 3D3VD 5E2WH 3ARXA 2F19L 3MRKB 4G8GD 1Q1JH 1X5FA 3R1GH 2W59A 1KCVH 4LLMA 5GGTA 3RU8H 5ADPL 3TC9A 3BH8B 4CGTA 3WN5B 2E7LA 2VLKD 4K3EL 4HPYH 3DVFA 3BP6A 4JFEA 1FDLL 3JWDH 1PY9A 2OJZH 4Y1AB 2J4WH 1OPGH 3D85D 2VXUH 3WE6B 1B6UA 4I18C 3TZVD 2I60L 4PUBH 5E8OB 2QSCH 2HKFH 4JFFD 3RZWA 1R5WA 5ICYA 3CUPA 4HIJA 4LHUD 3GO1H 2R2HA 1DBJL 4KFZC 3C6LC 3HLAA 3GKWL 1J0JA 5F6HI 3MODH 3UEZA 4C59B 1KCLA 1YN7A 3WO3B 2ICCA 5GGVL 1MHPH 4S1QH 3E6FA 5FO7B 5JUEH 3REWB 4NBXB 3EAKA 4AMKL 1AJ7L 3TBSA 3ZE0E 3CXHK 5JA8B 5IMKB 5F1IB 3PUCA 3X3GL 1ZA6A 4HWUA 4PS4L 1NAMB 4BFIA 5D5MB 4F9LA 3DURB 1KTLA 3L5XL 2DKUA 3UPRA 4LSUH 4EI5D 1JIBA 3SDCB 3IDIB 3N1MC 1AHWA 3CZJA 1T20B 1SEBA 2H9GB 4U2ZA 3BGFB 5KSAA 3C2AL 1KCRL 1WT5C 3S88H 2X09A 2GK0B 1K4CB 2D7MA 4NQVA 1U3YA 3QXWA 2GCYB 3WNOA 1DVFD 3HUJA 1OAQL 5KVEL 2WIMA 1CZ8L 3KLDA 5DQDH 1JUFB 3GHEH 3D25A 2CQVA 3A0OA 5D7JD 4MMZC 3MUZ1 3R8BB 1FYHB 4Y16B 3DTXA 2CDEB 3QIBC 3MOAL 2YD6A 2VE6B 1JF1A 4GRWE 3VMPA 1H3PL 4OZGE 4ZG1A 2FR4A 2MTPA 3LKOA 5FYLD 4TTGA 2DTMH 4BFEA 3BKJH 1H0DA 2DLFL 4XCYA 3KPLA 1MCOL 4JZJA 4O4YL 1GSMA 3O9WA 3IFNL 5I9QC 3T0EA 2NY5L 4L4VE 4M61A 2HKHL 5IQ9A 4PRBB 2IPTL 1TDQA 3X12A 3UJIL 5CCKH 4W4OA 3AFLA 4P3CL 5C92A 4D2NA 4TVPH 5C0BA 3LQAC 3HMWL 3M17B 2RAMA 2XWBB 1EEQA 1RAMA 3O11A 5C0CE 3LQZA 5A40E 1N7MH 2FIKB 4QRQA 3GSUA 3OKYA 4Y5XB 5EU7C 1FFRA 2X4NA 1ZHKB 1VFMA 1JRHH 3S36X 1OAUH 4HULB 3UO1L 1RUQH 1CK0H 3DSNA 1NFKA 5FYKL 3RTQB 4W4NA 3SEPA 4D0DA 2DQIH 3RL2B 3WFBL 2BK8A 4LPVA 2BSSA 1OAXH 2E27H 2A1WL 4RFEB 3MMEA 4P5TB 3S35H 5FB8B 4DN4H 3MROB 4GKNB 4XNYH 1J12A 1K6QL 43CAA 5IEHA 5I1EH 3H7BB 4JVPA 3U0TB 3EOYG 2PYEE 4KC3B 5IR1B 2UUDH 2ICWI 5GS1B 3FKUS 4O9HH 3WJJC 5T5NF 1GIGH 1DP0A 5DC9B 3O45A 2JB6A 4BH8A 5M7QA 5MEPB 3QIBD 5C8JB 4AENA 7FABL 3O0RL 3LDBC 4FNLH 1JZ8A 3SE8L 1DEDA 4K8RH 4LLQB 3IFOA 3SOBL 1FE8H 4CW1B 3F7QA 3I6LD 3QZWG 4YUEL 1YA5A 4F2MB 4WUUB 4NQCE 3TIDB 4ZUSA 4NKOA 4I5BB 2QQQA 2YXFA 2BX5A 5TH2A 3VJ6A 4L8SC 4J8RA 2CRZA 4CBPA 3TO4C 2MSPA 1T89A 4XNXH 5E1AB 1JVKA 1INDL 1ZA3B 4PJCE 5FDWA 5FYJU 1LE9A 1A3RL 4G9FA 5FKAA 2Z91B 4ZUVB 3FQNB 1T1YB 5CBAA 3FB5B 1NGQH 5EWIL 4JPKH 1L7IL 1Z2KA 4MD4A 4WIQA 4BZ2H 4YNYA 4PJGF 3OKMA 4JN2A 1D9KB 3CK0L 4UOW1 1CCZA 5BXFB 1OSPL 3AAZB 3UTSB 4XX1E 4P2RE 5E2WL 1VHPA 2X70B 3R1GL 5D96B 5HGBB 1AGEB 4D0CA 2VC2H 3STZA 3FB8A 5EPMA 1KCVL 3IJYA 4I77H 3RU8L 4Y4KD 4P2YA 5F1KC 2YD3A 4ELKB 4N90E 3C60B 4HPYL 4JDZA 1RZJC 4PRID 3JTTB 3QHFH 4QXTB 4GW1A 4NZJA 3JWDL 2OJZL 2IMNA 2J4WL 3TYFB 3MLPA 2YSSA 2Q87A 1OPGL 3KS0J 2VXUL 2PO6B 3E2HC 5L8JB 4F37K 2KH2B 1Y0LA 4PUBL 1J8KA 2QSCL 2HKFL 3EYOB 2ENSA 4YHIB 5DQ9B 2WWKO 4Y5YA 4MXQD 3E8UH 5F89B 3PWPD 3FHAA 2BY3A 4W6XB 5FO9B 3CD4A 4HH9B 4OZHE 3GO1L 1KB5B 2V7NB 2Y5EA 5CP3A 2VYRE 2VOTA 4M7ZC 3CLFL 1FBIH 3AREB 2ZOKB 3QQ9C 3RWGA 4ISVA 5FF6B 4L9LC 3RWDB 3TBWA 1S7XB 3MODL 1ZT1B 1BGXH 1JNHB 4P5KB 1A6WH 4ODTH 4P0DA 3MOBH 1MHPL 2ZNWA 4S1QL 3TO4D 1N8ZB 4KK6D 1P4BH 2HJFB 3ARBB 3UTPE 1JHTB 5JUEL 4NQXA 1N3NA 1NJ9B 2PW2A 4Y1AE 3K2MC 1O0VA 3LB6C 1JWSA 4AIOA 2NY4C 4M5YH 1WVZA 1S7QB 5D7LB 3MNWB 1C12A 3MRDB 2PXYD 1ZE3C 4LSUL 32C2A 4IRJB 3UYRH 2OR7A 3MCKB 3TBYB 1FV1B 3WKNA 5HJ3A 5KSBB 2DDQH 4PR5A 1MJUH 3CXDH 3MYZA 3HHRB 3P77B 3DBXB 3ROLB 3S88L 1WC7B 3KWWB 1MFCH 1WAAE 2DRUA 3U36A 3OWEA 3LKPA 2UUDK 3UTZA 2X4PA 4J2XA 1CICA 4OCNC 2VLJB 3QEQA 4ZDHB 1VFAA 1U8LB 2F8VA 4JKWA 3SKOB 3MUGB 3LEXB 5T1MB 5HGHB 5DQDL 4XGZA 1MCEA 2DBLH 1JHKH 3GHEL 4QHMA 2FJFA 4LDLB 4NO2B 3DVIA 3S8WA 1OVZA 2VZUA 3KPSD 3LEVH 5A2JH 4OZIB 3OXSA 3HG1A 5EO9A 1I7TB 4Z95H 4E5XA 5D5ME 5T1KB 3NFPA 2CSPA 4HWBH 4NM4H 1FVEA 5B38A 4MJIB 2DTML 1TQCB 1A6AA 1YQ2A 3BKJL 2HT2D 3MJ7B 5EC2B 4HJGA 4JY6B 2BVPB 3QH3B 4K07A 4UTAL 5ALCH 1KT2B 4D0BA 3MRCA 2GY5A 5CCKL 3O41B 4UUJA 1YNLH 4TVPL 3D69B 5L2JA 2WIIA 2VIRB 1S7SB 5DMGC 1CT8B 3BRGC 5TGBB 4WWKB 1FFQA 3UTQA 4ODWA 3LMJH 4H26A 5T3ZH 2YUZA 1N7ML 3STLB 4G9DA 3ZYJA 1NPUA 3V6FB 4BFBD 4WEMB 1JRHL 2O61B 1J5OH 1OAUL 2DM4A 1RUQL 1CK0L 2NY4D 2R8SH 1TTFA 3T77A 2DQIL 3DXAD 3NFSH 4DQOH 2HWZH 3UROR 1XIWC 4X4XA 3PWVB 3HTLX 1OAXL 3WLWC 2E27L 3EDEA 3IB4A 4FFZH 1FFNA 4IRSB 3C8DA 3G5ZB 1OQOA 3S35L 4DN4L 5E94A 1J1OH 4R4BA 3QFDB 4XNYL 1MWAB 3IVKB 1S8DA 4KK9C 3TNMA 5I1EL 4W81A 4WO4A 1CI5A 1MI5A 2DIBA 4KZDH 1HCFX 3O3BA 3QULA 1FNLA 1PQZB 4O9HL 4Z7WB 1JNJA 2NQCA 2P5EB 4UQ2B 4NOBA 1XR8B 3P4OB 4OFPA 3K4AA 3VGGA 5GGSY 1J10A 3DETC 2WK2A 4H8WH 4X4ZA 2Y4SA 4Q6IC 2AQ3A 4I0KA 3MGTB 5FUOH 5J1AA 2JKXA 1F3RB 4FNLL 2FGZA 1G9NH 1HQRA 4K8RL 5DHVA 1T0MB 4YAQA 1FE8L 4PV8B 1RU9H 2DICA 2PCPA 2E3VA 3GJFA 2F9BT 1KEMH 2ICEB 4Y5VB 4BSVA 5DVKA 3CVIH 4Z78B 3SDAA 5JIPA 3H9ZA 5DJ2B 2CLVA 4XNXL 2KDGA 3TA3B 4TRPH 3S4SG 4DGYH 2Z8WC 1XAUA 5CZKA 4LSRH 5FM5O 2VZOA 2R1WA 1HH6B 4RAVA 2IH1B 1NGQL 3QIUD 4JPKL 2FX9H 1DQQA 1F4YH 1TLKA 3BXNB 4X5WA 3QQ3A 4X6BA 1J8HD 5D1ZC 5F7DB 4BZ2L 5KAQF 4L3AA 3MRGB 3PQYB 4XT1C 2B5IB 5F97E 2CLZA 4BQ9A 2HTLD 5DI8A 4XWGH 3OKNA 5D93B 4HLZG 4KI5F 1AQDB 2VC2L 3G6AB 4IJ3C 1A0QH 3BIBX 4P9HH 4RWYH 3QXUA 4I77L 1NBYB 3QUMH 4UV7H 4LRIC 4Y2OA 3SE9H 2X4UA 4AQ1B 3HE6A 1S7TB 2VLRD 2R0WH 1CDUA 4KK9D 1UKQA 4NC0B 1BZQK 4M02A 3QHFL 3IDXH 4JG0H 1TVHA 5T5NG 5BMFH 1YPZA 2XNAA 4MA7H 4P99A 1MHEB 1RJZB 3CSBA 4U1KB 4QWWC 4MQSB 3C5ZD 1TQBB 5KBNC 1T6VN 2A2QT 1I7ZA 2Z8VC 3EDKA 5FYLH 3SDXF 4FQXB 3E8UL 2P43B 1I7RA 5JR1H 1QSFA 4OI9A 2HT4D 5JW3H 3CVHB 3UTSE 4TUOA 3NPZB 4NO5A 4P5MA 1FBIL 3BKYH 1VFOA 1NGPH 3KYAA 1M71A 2ZSVA 4Y4FD 3F7YB 4PBXA 4U1JA 1BGXL 3VFOA 1A6WL 2E9WA 4ODTL 3MCLH 5CLTA 3W0WB 2H2SD 4S10A 3MOBL 4Z7QF 3JV4A 5C0NC 2H26B 3OGOE 1BX2A 2OTUB 4H25B 1P4BL 3QP3A 3ARFB 3FOMB 5J7CC 1IAMA 5T33H 5E9DA 4P23C 2IQAB 2R1YA 4I18A 1T4KB 5J4MA 2BSRA 3V8CA 2OXHA 2B1HH 4N8CH 4QT5B 3JTSA 3G08B 4N8PA 3HZYB 5SWZB 4M5YL 1U8KB 1VACA 1UGNA 3BSZH 4LCUA 3UYRL 3V4PH 1T5XA 2XZAH 4Q7DA 2DDQL 3C6LA 3QAZC 4HZLA 1UJ3C 5CJXC 4FXGB 4OQTH 1MJUL 3CAFA 3CXDL 2YKLH 2AEQH 4NN7C 3T3ME 1NBQA 1YMMA 2G75A 1CFNB 4JPIB 1X5JA 1D5BA 2ORBH 1M7IB 5JIKA 2MMXA 1MFCL 2EDLA 4GW5B 3RX8A 5HVGB 1QEWA 4QOKB 3X17A 4X7SH 3WDIA 2JIXD 3RL1B 3QPXH 2LU7A 2P42B 3TIEA 2DBLL 3LN4A 3VFNB 1HOCB 1W0VA 2A6KA 3TO2A 4APQA 3LEVL 3VFTB 4G80B 3FQXA 4Z95L 4HWBL 4KRMB 4NM4L 4LIQH 5D7LE 4PJGB 2X7LA 2P8MB 1WT5A 1C5BH 3GMOA 3O3UN 1DBAH 5HYJA 4HUWA 4MAYA 4PGCA 5EO0A 5EG6C 2ESVB 3U6RB 5ALCL 2JJVA 2DQFA 4Y2DC 5B39B 5DR5H 1YNLL 1S7RB 4L4TB 3GSRA 3LQAH 4Z5RA 4P59H 3KHQA 1PYWA 5C09D 2MFNA 5C0ND 2CIKB 2VLJE 3SCMD 4HWEL 3LMJL 5T3ZL 1SVCP 1TMCB 5GHWH 5KS9F 2AKRB 3ROOA 4M48H 2KUTA 2GJ6D 4N0UA 1V3JA 3E3QE 5C0RH 1J5OL 2HAZA 1QBAA 1WBZA 4OZIE 2R8SL 5KVMC 1HH9B 3LV3B 1B3JA 3IETB 1ND0A 5C0IB 3UZVB 3IS1X 3NFSL 2HWZL 4DQOL 2C1PB 5DMJB 3B8YA 3FTGA 2W60A 4MJIE 4Q9RH 5DJXA 1I1FA 3P9LA 2KQNA 4FFZL 3KGRA 3QUXC 5IKCA 2PTTA 2EYRB 5DWUH 5EZJB 1YUHB 5JHDB 5IVZB 3TBTB 1MOEA 3HB3C 8CGTA 1J1OL 5TE4H 3RZCB 3F7VA 3OTTA 5CSBA 3VMNA 1Z0MA 3IXTB 4KZDL 1OHQA 4XPHH 2MJWA 1LEIA 1PVHA 3QFJB 3HAEH 3NVQA 3P73A 3GJEA 4YX2H 3OX8B 4PG9B 5IOPB 1PG7H 1RZIA 3MRQA 4H8WL 2ZUXA 5EOTA 4OIBA 1MQKH 3BO8A 5DGRA 3MLZH 5TDNA 4LKXB 3PGDB 4O02H 2DN7A 5FUOL 1KN2H 3C5JB 1G9NL 2FYYA 3IYLW 1M6OB 2GTZB 3GMQA 5CP7A 1RU9L 1JI1A 4NHCH 4WJ5B 1TZHB 1JZ2A 3ALWA 3BE1H 2FGWH 1D7FA 1KEML 3GGWA 2VZ1A 3RWEB 3CVIL 3WIFB 1OT1A 3MRPB 3QNXA 3SKNA 4TRPL 1NDGB 3HAEA 1FZJA 3WJJA 4QYOB 4HGMA 4IHOB 4LSRL 4IMKC 3L1OH 5I73C 2WINB 1IKNA 3A6OA 3VD9A 2CIIB 1G6RA 2P5EE 5A2FA 2QSQA 2FX9L 1F4YL 2BHUA 3KJ4B 5DHYA 3DUUA 3VG0H 5CEXA 5C0BD 5IBLD 3LSOA 5HYQA 1VB9A 5F9OH 3UX9B 5FHAH 4PJIF 4KDVA 5A1AA 2VL4A 5FYJE 4PJ9D 3K1DA 3D0VB 2GEEA 1U8JB 3DMMB 1A0QL 4P9HL 3CDYA 4RWYL 4KKAC 4QHLB 4HGWA 3QUML 4UV7L 3WNLA 3SE9L 3KPRD 5J6HB 5DUPH 2R0WL 3HR5A 4KMTH 4PGJA 2EE3A 1RZJH 5H37H 1ZGLM 3DJ9A 2BY2A 3IDXL 4JG0L 5EU6B 5GS0D 2QSVA 1OWWA 5BMFL 3WEXA 4MA7L 3FQUA 3GMLA 4EQ2A 5JW5B 4PJDF 1P84J 5ANMA 4P57B 2ZG1A 1UFUA 4OCWH 4PJ5B 1EH9A 2GTWB 2X4QA 1ZLWK 4IDJH 3RPIA 5JDSA 1U3HC 1ZT4B 3PQYE 4ZTOH 2QHRH 4QRTA 5JR1L 2EDHA 1K4DA 1SYSA 5JW3L 2DKMA 1X5YA 3ARGD 1JTPA 3OGCA 1PZUB 3BKYL 1UT9A 1NGPL 2VDKH 3GKZA 5F3HA 3PL6C 4ACPA 3VRJA 5D2NC 4Z8FH 1BD2A 4HK0B 1LO2H 4JG1H 3NIFE 3GSWA 3MCLL 1KJ3H 1ORSB 1FLRH 4ZOEA 2XA3A 1CG9A 1D5MB 4JFOB 1YYMH 3U46A 5K9OB 3WUZA 5CJOH 2L4OA 4UU9A 5T33L 1ZLSH 4QNPE 4Y4HB 5MEOB 4AT6B 2A73B 4QRSB 3RDTB 3RNKA 4JANA 3SDDC 5E8NA 4O00A 2B1HL 1INQA 4N8CL 1OARH 3WD5H 5KAQG 3ES6B 3Q5OA 3QNZA 1G9EA 1NGXB 4ODHH 5EH1A 1T3FB 3BSZL 1BFOA 4OGXH 4PLJC 4ORGB 3V4PL 2NY7H 2XZAL 1R5IB 4L9LA 4OQTL 1RUMH 4WFFD 2YKLL 2BNQD 2AEQL 3X14B 4WU5A 2C5DC 1OD9A 1JGDA 2YBRB 2ORBL 2BY0A 2Q3AA 3QUZC 2WANA 1UXWA 1I1AB 5IESL 4L8CB 3AUVA 2W92A 3LRSA 4GG8A 4X7SL 1HSBA 3QPXL 2A9NH 3W0WE 2OL3A 3BFOA 2WBJC 4LMQE 1D5ZA 5HYSA 2MQ3A 1SHMA 4JPVH 2PTVA 4U6XB 5E8EB 5KG9B 1F45A 4M5ZH 4X7TB 4B41A 4Z77B 2ZNXA 5SWZE 4CVWA 4LIQL 2VDOH 1U3HD 4FMFA 4MA1B 2Q86A 5IMLB 1C5BL 4YJZL 1DBAL 4JRYD 4UINH 4WFGD 4HIEA 4LAJH 2X1OA 1TCRA 5L88H 4HWEH 4HS6A 4G6MH 3NPSB 5DR5L 3BPOB 4R6UA 1A9BB 3FL7A 3LQAL 4P59L 4QOKE 3QRFM 4YPJA 1HK6A 3KYOB 4QHUA 4CNIB 5GIRA 5HHOA 4M93B 3PWNB 1OSZA 4NQUA 3VGHA 4UQ3A 5GHWL 3LS5H 2DTSA 2R2CA 2UWEA 4AM0A 2Q76B 4M48L 3UZEA 4O51A 4U1IB 1RJCA 1GPOH 4JHAH 5C0RL 2YOCA 1QHOA 4PD4J 1LQSR 4E41A 1U58B 3MLVH 5BRZD 5GS3A 2C9AA 5FYKE 4PLJD 4Q9RL 4TSBH 2AJ3A 4XAKE 5JNYB 4PJGE 4JB9H 5DWUL 4XBEH 1DJSA 5TE4L 1F6AB 4ZQKB 2GITA 5I6XB 4DZBA 2ESVE 1AXSB 3QIWD 3QUZD 4MQXC 1OGAE 4XPHL 2GJZB 4L3EA 1EJ6A 2E9BA 3QDMA 3MLRH 3DUSB 2ZP0T 3W5MA 4L4TE 3CX5J 2PW1A 4YX2L 2WBJD 1G7HB 1PG7L 4M7LH 3VFMB 4A6YA 4WHDA 5I30H 2OI9C 4ODXB 2W9DH 3PF2A 3CFBB 4QY8A 5FKPB 1MQKL 1EGJH 3ARDC 3MLZL 4UDTA 1FG2B 3FONA 4LVOC 4ZUWB 1CDJA 4O02L 1ZEAH 3KYKH 5FDYA 5FUZH 1KN2L 1XIWA 2DB8A 3NBNA 1S9VA 2ITDB 1ZT7B 1XGTA 1T04B 2ITCA 4MJ2A 4NHCL 5IJKC 1AR1D 1HEZA 2UVEA 3BE1L 2FGWL 3X11A 4UILH 4WHTA 1VADA 2AQ1A 1LHZA 2D7PA 2VR9A 4JE4B 5F9DC 1XGQA 5JHDE 3BP4A 3EDJA 4GKSA 4ZD3H 1LEKB 1WLHA 1RZGA 3CH8A 4WGWB 3L1OL 1KJVA 1WFUA 5CZXC 4YDVB 1EZVY 4E42B 3AVEA 1IAOB 1XGPB 2ARJB 1U2HA 4Q6IA 3QEHA 3QFJE 5C0AA 3UC0H 5D7IB 5A16B 4NBZB 3VG0L 5E8PA 4HJ0D 4I0PC 1I9IH 1MCCA 3UYOD 1C1EH 5F9OL 4LVNB 1S9WA 4XNMA 2NZIA 3D18A 5FHAL 1JZ7A 1U8NB 2IPKA 4U0QB 3LZFH 1QFWH 2O5XH 2L7UA 5HHMD 5DVNA 4HIHA 1VFUA 4JFYA 4S1RH 2NY0B 2J3SA 2J5LC 4LKCB 5IHZB 1JMZA 1JPSH 3H7LA 2YA1A 4OZFA 4OI7A 4G42A 5IF0B 2FJHB 1ZSDB 1BVKB 5DUPL 4Q2ZA 5E24E 4KMTL 3L6FB 4JQVA 3LKRA 1RZJL 4HKXA 3S6CA 4XP4H 4LLAA 1IGML 5DQJB 5T5FL 2XKSA 5GSRB 3F65A 5DRNA 2A83B 4WO4D 1P69B 1F2QA 4MA3A 4OCWL 4GT7A 4XPGH 2FWOB 4IDJL 5KS9B 1VFBA 3QA3B 1AO7A 4P46B 2QHRL 4ZTOL 4ZUTA 2GAZB 3KAAA 2P7TA 1OGTB 4NN5C 4IS6A 2VDKL 4I3GA 4U1LB 2FJGA 5IB5A 4Z8FL 1CFBA 1LO2L 4JG1L 1KJ3L 1FLRL 1QO3A 2BCKB 2AJSH 3ZKXB 4PY8I 5D6DA 1BOGB 4GRMA 1AGBB 1YYML 4D9LH 5E56A 5CJOL 5C07D 4FN0A 3ILPA 4MJ5B 5DRXB 1ZLSL 5J6GA 5LCVH 5I8EA 4XWOC 5EU6E 3WDHA 1P7QB 3I50H 2I07B 3WD5L 2IPUK 1IC5H 3BQUD 2CK0H 3T0DA 1KPRA 4ODHL 3TBVA 1DLHA 4WU7B 5DJDA 4PJ5E 1FL3A 5CZVH 2MCG1 4U7SA 1KTDB 3M07A 5CHNA 4OGXL 4POUB 1NMBH 2NY7L 4BQ6A 1F02I 1CFTB 2NY3C 4K55A 3WLBB 3G5XA 5C6WH 1RUML 3S36H 4MNHB 1AC6A 4U1NB 2VQ1A 4MCYA 3DGGB 4NC1C 1CXHA 5LJYH 4EZMA 3MBEA 4R3SB 4P23A 4KKLD 2A9NL 3KPPB 4HJJH 5KVFH 4OFYD 2E7BA 5DC4B 2ADIA 3GB7B 3GMPB 3RGVB 3WJLA 2HRLA 1IZKA 4MDIA 2YD4A 4JPVL 4ZS7H 2YEZB 3ULVC 4GFTB 2NY6D 5A43C 2YPKB 2DLHA 3C5SA 2E6PA 3HZMA 5J56B 3T4YA 2EKJA 4LVHB 3D3VB 1UJ3A 3RJDA 2VDOL 4G8GB 5FXCH 3OKDA 5JOEA 4FQCH 4UINL 5DJ0B 5C0GB 3MGOA 5E6IC 4JFXB 5L88L 5E08H 3W9EA 3TVMB 4IIQC 5AYUH 4O2FA 5D72H 2VLKB 1FSKB 2VO5A 5FGBC 1U0QA 3UTTA 2QQNH 3AMKA 2X89A 4UAOC 4ELMF 3SQOH 1V05A 4GRLC 4TVPE 1X4ZA 1U95B 2M26A 5FOJA 5FO8B 4FHBD 3T1WA 3LS5L 3TZVB 1Y6MR 4ONHA 2FHCA 4JFFB 4XWOD 5F7YC 1FIGH 1GPOL 2ICES 4H1LH 4JHAL 2YMXH 3U7YH 3SGJC 2AXFB 3SY0A 5E9DD 2A6IB 3TF7C 1FG9C 1MCRA 1XH3B 4PJDB 3MLVL 5BZDB 3S3PA 2WP3O 3KPTA 3EO1A 5AG8A 1SJVA 4ZFZA 4TSBL 4TUJA 3REVB 1IQWH 2LV4A 4JB9L 4XBEL 4GS7C 4OBSA 4NQDB 4Y2DA 4AG4H 5F72S 4JRXA 4GLRI 3UAJC 4KI5E 4R7NA 5D1QC 5GS0H 3MLRL 2OSLB 3VH8G 3EOAA 1BOYA 1TXKA 2AV1A 2DS4A 4HMEA 2BXYA 4M7LL 5I30L 4AK1A 2W9DL 3TN0A 3TT3H 5F6IB 2C7UB 1EGJL 4CMMB 1ZEAL 3ULVD 3KYKL 4YHYC 5FUZL 4NRZA 4GH7B 3O8XC 1WCBB 2C3VB 2ZUQB 1FC2D 3PIQA 2NR6C 3QUXA 1G84A 4YHPB 5IHUH 5ICZA 3MNZB 1GZQA 4UILL 2X05A 4KHTH 1NCAH 1FZMA 2YPLD 3QUMB 2J7LA 1FYTA 3TGXA 2X5PA 4ZD3L 2CPCA 4HUVB 4NCC2 5D7JB 2OR8A 2LU3A 1QLFA 1G7LA 4M00A 5FGRA 3UC0L 4YHML 4RAUB 3R8QA 3IXAB 4ODUB 4Z7QE 3RWIB 2I9TB 2J1KA 1UA6H 1I9IL 1H3VA 1XGUB 3IJHB 3P0YH 1C1EL 5AG9A 1EFXA 5D6CA 1BWWA 4U0RB 1TCMA 3VXUD 5MERA 3CGTA 3LZFL 1QFOA 5FK9B 4UDUA 4G6AC 1QFWL 2O5XL 1AY1H 2FL5B 3F6LA 4S1RL 1MHCA 5BS0D 4KK5C 1JPSL 3AS3A 3F62A 1LNUB 3QQ4B 2FHFA 4FQJH 1BHGA 4IMKA 2CUMA 5TDOB 3UAJD 1IGJB 4MSWB 2ZUUA 4QHNA 4XP4L 3VXPA 3KXFB 3OF6D 2C4FU 5J13B 1JP5A 3QPQC 4U1GC 5EZIH 1HKFA 4XPGL 1UM4L 5D7IE 3WV0A 2X42A 3C8KA 3VXTA 1VGKB 4J3OC 5E0QA 4IRZH 4PLKC 3VWKD 3DWTA 5F6HJ 3FRUA 2RB8A 5C08A 1XZ0A 4KUZH 1VEPA 4K94H 4Y8AA 5IQ7H 4LMQI 1FL6A 3QI9C 4X4YB 5HHXH 5DA0B 1WIOA 4ZOAA 2CRMA 4P49A 4CUCA 1HDMA 2GUOB 2AJSL 2X1QA 5TF0A 1JTOA 2NY2D 4D9LL 3WNNA 5FA4B 2DAVA 5L2KB 4QF1B 25C8H 5LCVL 5CSGA 2FEDC 4TSCH 3CNKA 3I50L 3FAXA 4LCCC 4NUJB 1IC5L 2CK0L 4HK3N 4EDXA 1EXUB 4XVUC 3DHMA 5CZVL 4KKBD 4XHQA 1NMBL 4TNVK 3A6BH 5KS9E 3SHSA 1HIMH 3FO9B 3S36L 1IGFH 1TVBB 3PL6A 4H0GA 5D2NA 4G6AD 5AYQA 4N1CA 3OAYH 2X9WA 3OKOB 2XWTB 4GKZA 3T0BA 1QUNA 3ZYIA 4Q58C 5F7WC 4JFPB 1SM3H 4AIZB 5EIQA 3FQTA 3MA7B 3K8MA 4K3HA 5KVFL 3CCHB 3O6FD 4QRPA 3SDDA 1R3HA 2CLRB 1ORQA 1CD1B 3KPOB 2VITA 1HILA 2MKWA 4OGYH 3FT2B 1YN6A 1SY6A 4OD3H 4XTRC 5EZLA 4GG6B 5HYFA 4L4VD 1D5IH 3BZ4A 5CMAA 3EJYC 2EDRA 4OLZH 1HHJB 2DWDA 3UDWA 1H5BB 5EU3A 3U30B 4FQCL 2FX8H 1KJ2H 1JK8B 3O2WH 3PWLB 4PRNA 4G6KH 4OUUB 1A7RH 4OD1H 4Y4KB 2Z93A 5E08L 3DV6A 5AYUL 1Q9KB 5D72L 1IM3A 3BYTA 1IAKA 2J2ZA 1WBYA 2QQNL 5KANG 5JW4M 3BZEA 1P1ZA 4S0TD 5DD6B 5KN5B 3SQOL 2F74B 3MV8B 3B9KA 3BUYB 2C1OB 4OKVB 1I7UB 4AYFA 5T3ZE 3VXNA 4OJFH 4TYUA 1FIGL 3U7YL 2YMXL 2JELH 3L7EA 4YBQD 2AS5M 4WDIA 5BV7B 3D3VE 2R0ZH 5DTFA 4C4KT 4PPTA 1EEYB 4HDIA 4G8GE 3NIDF 1FZKB 2V5MA 2ATPB 1IQWL 1C16A 3L3OB 4OI8A 2ICWA 2JCCA 4AG4L 2ICWJ 4OM1H 2QBWA 5E5UB 3LKQA 3GZKA 4EDWH 4Y8DC 4S2SA 2NW3A 2O5YH 5IW1A 3HUJF 3DIFB 4Z7VA 1JZ3A 2VLKE 5GS0L 3Q2CA 5EUKB 5JXEC 4BM7A 2E7MA 3BKCH 3JV6A 4P2QB 4H0IA 5IW6B 1SVZA 5DC0A 1JWUB 1DCLA 2VXSH 3SQBA 3MCG1 4HGKC 3TT3L 2FBJH 3B3IB 5HPOA 1QBLH 5EOCH 2APBA 4HD9A 2PXYB 2DJ4A 4QKXB 5IIEA 4XTRD 4JFFE 3U1SH 4X6CB 3G5VB 4HWZB 4XH2A 3RNQB 1CQKA 3SO3B 5L8LB 1LWRA 4PJDE 4L8BA 3WN5C 3AGVA 4EVNB 1T6WA 5IHUL 2EXWD 2NX5D 2D0HA 3QEGH 2P24A 4XHJC 1T83C 4M1DL 1H8NA 4KHTL 1NCAL 3MJ8A 5GS2D 3BIKB 2Y25A 3DRQA 4NQDE 1X7QB 3QWQB 5T1LD 3HI6H 5E7FA 4PB9H 1BQHA 1R0AH 1DL7H 1DQJA 1B90A 1JWMB 1IKFH 3ARDA 4LOUC 3KPSB 5HHPA 5EOCJ 4P2RD 5I8CB 1MJ8H 5GRJH 1AGFA 2VMFA 3QO1B 4TNVF 1UA6L 5B4MD 3VD7A 3P0YL 5I0DA 3P0VH 3RY6A 4TPRH 3CDCA 4PGEA 5IJKA 3SKJH 2OQJB 1OP5H 5I1IH 1AY1L 2P48B 3OAYK 3BD3A 4XRCB 2Z4QA 4FQJL 2GT9B 4QEGA 2EIBA 3M45A 4CJ0A 5DD5H 4ZFOB 1V8HA 3G6JF 1WBXA 4S0SD 4XPFH 5GJSH 1N64H 1LE5B 1F90H 2V2WB 3HZKB 4JFQB 1Q94A 3SDCC 5DJ8B 3LPFA 4I0PA 5IMMA 1T21B 4ELMB 5EZIL 1XF3B 3BGFC 3QDMD 4WW2A 3NIGF 4YO0A 1X9QA 2X4TA 3U4EB 3DXAB 3OXRA 4IRZL 5DXWA 5FYLE 4YQXH 4NKMA 3V5KA 3OZ9H 1RK0A 2FEEI 4KUZL 3UTPD 4K94L 5IQ7L 5HHXL 2EE6A 3OR7A 1U8OB 4RA3A 5C86A 4XHJD 5CGYD 1KXTB 3LH2H 5IB2B 4R96A 4F3FA 4Y16C 5LWYH 5EUOA 1CDGA 2FHBA 4J6RH 1ES0B 3BGMB 1CYGA 1D6EB 3ORJA 5INDA 25C8L 4X83A 1EHAA 2BVEA 1CE1H 3WXVH 3KXFE 4TSCL 4F7MB 4LOUD 3ULUF 5JA9A 1V3KA 1EBAA 3A6BL 2BHZA 1HIML 2AQ2A 3GMRB 1IGFL 1B88A 3BMVA 1UZ8A 1IGTA 3EOBB 4PTUB 1D5XA 2P44B 4Y5XC 1R3KB 2DMBA 3ZTJH 5GSVA 1SM3L 1I8MA 3BPCA 3UBXG 3VXOA 1UQSA 3HC3H 2AK4D 4PJ8A 3QIUB 5E03A 3RTQC 1BVLB 1N59B 3MYJB 3QNYB 5L2KE 1DTUA 1LK2B 4OGYL 1J8HB 4LCYA 1W8NA 1QSVA 4OD3L 4XZUA 3ULVH 2DLTA 4JM2D 3V8OA 4YFLI 4P5TC 1D5IL 5D1XD 1KF9B 5EZOH 5CWSA 4OLZL 5SWSA 2FLRT 2W91A 4YHKH 2CJUH 4XPAH 4NJ9H 5I75B 4LIQE 2F5AH 2FX8L 1KJ2L 3O2WL 3SJVD 4NQED 5GS1C 5FECA 4G6KL 4HUUB 1A7RL 4OD1L 5EO1A 2VLRB 2BERA 1TPXB 3T65A 4RFOH 3MSPA 1OY3B 3RWCA 1NUNB 1WJ3A 5C0FB 2B8OT 5GQBA 1HWHB 2C3XA 3NFNB 1UCTA 4PJBF 4Y16D 1EAPA 1HKLH 4Z7NF 2B20A 2BOCA 3C5ZB 3OKLA 1FAKT 1AQKH 4R26H 4HX1A 4U6HA 5CKGA 3LN5A 4JGJA 4QRUB 4GG6E 1IT9H 2JELL 1FZOB 4GO6B 1OP5K 1J05B 5GPRA 3CH1B 1HNFA 3QO0B 2QEJA 3OR6B 2R0ZL 5SV3A 2C3GA 4WHCA 2HVKA 2NLJA 3V79C 4Y4FB 4IIQA 1NFDB 3VI4F 5FGBA 4JFDB 4OM1L 5D8JH 4EDWL 3GMMA 5ACLA 4XBGA 2O5YL 1CFQB 3PDOB 4I48A 3RUGA 1NC2A 2G5BA 2NYYD 3DVGB 5C9JB 1H8SA 1D9KC 3BKCL 2J6EA 3V95A 1AGCB 3L3HA 4X8XA 3BW9A 3ECBA 4PY7B 2VXSL 3MFGB 3MV8E 4G8EB 4GBXA 2FBJL 3RTQD 3SGJA 4L8DA 5EOCL 3V6ZB 4MDJB 5D96C 3TLRA 1JJUA 3WO4B 3MLSH 1QRND 2Q3ZA 5AD0B 3RY4A 3U1SL 4PRHA 1SBSH 4P5TD 1J0YA 4EI6A 3L3KB 4Q9CA 5C3TA 3C60C 3QEGL 2XKNB 2DWEB 5I2IB 2CK2A 3WXWH 1W72A 4OM0H 5J0BA 4JVUA 3HI1A 5D1QA 2JIXB 2PO6C 5KJRH 5FV2A 3HI6L 1EAJA 1UKTA 4PB9L 1R0AL 1DL7L 5EU5A 1IKFL 2Z9TA 4P4RB 2EXYC 4P2QE 3J8F7 1OTSC 1CLYH 1UWGH 4JFEB 4OZ4B 1MJ8L 1X4YA 5GRJL 1AXIB 4LSTH 2XPGA 3O8XA 5GGQH 4U31A 3AREC 4KI1A 3P0VL 4JHBA 4TPRL 2QV2A 1LP9F 1NBZA 3SKJL 2NXZD 1ADQH 1WUNT 5HHVH 4EJ1C 3I6GA 4X6CE 5I1IL 3ARBC 2UY6A 4Z76B 3CUPB 4PIRF 2AV7A 4HIJB 2CXKA 2R2HB 4GRWH 4FMKA 3HLAB 3I6KA 1DANU 4UBDD 5DD5L 4XPFL 1EA9C 5GJSL 1N64L 2PN5A 1F90L 4ZAKD 1YN7B 5DYOA 1OAKH 3WIHA 4IRJC 4ESKA 2YUXA 2GJ6B 3GSOA 1IC4H 2HFFA 2MQ0A 3E6FB 3KPSE 1PKQB 4KRLB 4NM8H 5CIPA 3NN8A 2W0FA 4EUPH 3HPJA 3TBSB 3N50A 2EO1A 3SPVA 1ZA6B 1IEAA 5DURB 4YQXL 4BFIB 3OZ9L 5DS8A 2P5WD 3UPRB 1EHXA 3ARTA 4Q9BA 1KACB 1V3LA 5KSAB 3E3QC 3LH2L 4PJFA 5DEFA 5LWYL 3M1BB 4OV6F 4J6RL 4Z7OF 4CADA 5I1AA 4NQVB 5LGJA 3HUJB 1PKOA 1TQCC 3BVNA 1CE1L 5DJYA 1ZS8A 3WXVL 1S9XA 4WI3A 1GJIA 2JJSC 2Q6WA 4ELME 4RQQB 2L7JA 3ARED 2H32A 5C0CA 1FNGA 1JF1B 3DXAE 3DX8A 2FR4B 3QI9A 3ZYOA 3LKOB 2I9LA 4WI8A 3D39A 2ZCLH 4UV4H 3D2UA 4N0RA 4WWKC 1H0DB 3ARBD 3V6OA 4JZJB 3QUYC 5HYIA 3RVWD 2AK1H 3L5HA 5IQ9B 3X12B 3FOLB 3HC3L 4YR6A 1N0XH 2WMPA 2ZOLA 5D7LD 5FHBH 4ZNEE 5C0BB 4KUCF 4JGMA 4I13B 3ULVL 4OF0A 2PYEA 2YD1A 4IRSC 4H1LB 3LQZB 2E8ZA 2GFBA 5EZOL 4JZNB 2BFVH 1Q9OA 2X4NB 2O5ZH 1N0LA 4NJAH 4PJ9B 1REIA 4YHKL 2CJUL 4RNRB 4XPAL 4NJ9L 5HGAA 2F5AL 2NTFB 4U1HA 4LEOB 4D0DB 5GS2H 3WHE0 2VLJD 2EDTA 2BSSB 1NUDA 3HR6A 4RFOL 4NO0D 3MMEB 1IM9A 2EEBA 1X6LA 1OQXA 5IBUG 5IB1A 1LD9B 2V9TA 1HKLL 4N0YH 5DGQA 4NQCA 5CJBA 4HC1A 1AQKL 4R26L 3G6JB 3MLTA 2FDBP 4MJID 4RMVA 3NZ8A 5ERWA 1J8HE 1R5VA 2ZWLT 3JUZA 4CVZB 1PD6A 2JK5A 3O45B 1IT9L 4WI6A 4Y5VC 4BH8B 3ARGB 3MRJA 3TA3C 2Z92B 4L9DA 6FABH 1F11A 3NOIA 1S7WA 1K3ZA 2D9QB 3RIFK 3NCBB 4LQFH 3HE7D 4NQSA 3FO2B 5D8JL 3QWRD 1FNHA 3RWFA 2VLRE 5KSUB 1F6LL 3MRNA 3VJ6B 1HNGA 4J8RB 2B5IC 1A7BA 5H94A 5JIHA 3QWOA 1N6QH 2YRLA 5D93C 5H35A 3E1F1 1A2YA 1YY8A 4S1DC 1BZ7A 4G9FB 2BVOB 5FKAB 3P4MA 4P3WA 4BZYA 3O4LD 3MLSL 2ZUYA 1FRGH 1I8KA 2RQ8A 1KLGA 1CF8H 5DMKA 1Q9LB 1SBSL 3IT8D 4K7PY 1RZFH 4Z9KB 2Z35A 5ENWA 3MRIB 4YNYB 2BNQB 1GC1H 3EJJX 4FQ2H 5TQ0H 4JN2B 1HXMA 3TPUA 1MCKA 1OTUC 3QB7C 3WXWL 4OM0L 4AIXA 1NFDE 1JI2A 5KJRL 2P5ED 4FP8H 5JXEA 1TQBC 4JFDE 1BBJB 1KULA 4OD2A 2QADB 1T66D 3IJYB 4OZHA 3TV3H 3PHSA 3F6IA 1BZ9A 4K2UH 2Q7YA 3GRWA 4RDQF 3JBG7 4F15B 4FQXC 3MRKA 4EBQH 2JB5H 2EDEA 1CLYL 2AJZB 1UWGL 4XVSH 5FYJD 5C0DB 5DJZA 3K81A 2VABB 4LSTL 3DYOA 5GGQL 4DVRH 1C7TA 1ADQL 1Y0LB 5HHVL 5F7NC 1T83A 4Y1AA 3TA3D 1IL1A 4DTGL 4Z0BH 4IOFC 1P5UA 3BPLB 5DRZA 5E8OA 3EYUH 4TQEH 4ISVB 1NAMH 3RAJH 3WKMH 4LBEA 3QDAA 5C0JB 3ISWA 5LXGH 1OAKL 4RX4A 2D31A 4KHXH 2G60H 3PQYD 3T0XA 4YDJB 1IC4L 2H6PB 3P2TA 4PJBB 1KUMA 4PYHA 1X5IA 4NM8L 1N3NB 1S9KC 1NL0H 2NY5C 4JFEE 3HC0A 3HS0B 5JW4N 2PW2B 3CMGA 1SBBA 4HMDA 1AIFA 2HP4A 1RFDH 3WL9A 4YXHL 1C12B 3REWA 2OJEB 4WTXA 5EORH 5HJ3B 4PR5B 5HI3D 1HE7A 4LAQH 4XNQA 1KLUA 2I26N 4JDVB 5FGSA 3RFZC 3IDIA 3U36B 15C8H 2H9GA 3BWUC 3UTZB 2X4PB 2BZDA 1FGNH 2HVJB 4FQXD 2A9MH 4G6FB 3MJ9H 4XPTH 4LPYA 4U1SB 2GK0A 2R1XB 2GJ6E 3BAEH 4QHMB 2FJFB 1PKQE 2GCYA 4QHKI 2EDWA 1RVFH 1A7OH 2JF1A 2VKXA 4ZO6A 4PD4K 3MOQA 1ROWA 2AP2A 3OXSB 3HG1B 1JUFA 5EO9B 3MR9A 4E5XB 3W0WD 1KJ2B 3NFPB 1FVEB 5B38B 2ZCLL 5JLZB 4UV4L 4KJWC 1A6AB 1D6VH 3EW3B 3U9UA 4CU7A 3UZQA 1YDPA 3H9HB 2CDEA 3ARFD 2VE6A 3HNVH 4Y19A 3FAWA 4HJGB 4NNXA 4HS3A 4IOFD 2AK1L 2C4FT 3O3AA 1BAFH 1DQDH 2ADGA 5SWZD 5JZ7D 2R29H 4R97B 3QG6A 3CX5K 1L7TH 2WIIB 3HUJE 1QZ1A 5HYEA 3UTQB 3BMWA 4ODWB 2XACC 2BFVL 4FFVD 2O5ZL 3RZCC 4K7FA 4NJAL 3U48A 4ZNCD 1A5FH 4M62H 4RA0C 1UH2A 4Y5XA 2FBOJ 1LP9B 5GGRB 1BP3B 2W38A 4HIXH 1NLDH 3HN3A 4X4XB 1OP3H 2Z31A 5F9JA 3I02A 4ONFH 4RRPA 1JV5A 2HLFC 5E94B 4N0YL 1S8DB 1TZGH 3TNMB 1HSAB 5EIVA 2XICA 4YGVB 4WO4B 1MI5B 4RFEA 3WYRA 4F58H 3QULB 4WTWA 4CN6A 1AXTH 4QTHB 2EDNA 1KENH 3MROA 4CMHB 5C0BE 2QQLH 1KJMB 3EFDH 4S11A 2GKIA 3H7BA 4BSWA 4YXKH 4L4JA 5DFWH 1WWAX 4J3UA 1LEGB 5DZLA 3CZFA 3VXMD 1OGAD 5JPMB 6FABL 1CGUA 1VPOH 2YPVH 3B2VH 1T1XA 4J7RA 2ZPKH 4LQFL 3I9GH 1P9MA 3ZT5A 4XBPA 3GSQA 3GJFB 2GK2A 4D9QE 1OCWH 4WCYH 1KYOJ 3BWAB 3KJ4C 2VXVH 4BSVB 5KANI 3SDAB 5AAWA 2CLVB 1H3TA 1I1RA 1N6QL 1VDGA 3RIAK 4F2MA 4WUUA 3BN9D 3BQUB 3U82B 2GSGA 3DECA 3QSKB 3G6JE 4RAVB 4KXZH 1FRGL 3DMMC 3VRIB 1CF8L 2A6JA 1FO0A 4HV8A 3WSQH 2X41A 1DQQB 3MV7D 4P2OD 1RZFL 4MNGA 4ZUVA 1GC1L 4FQ2L 3FQNA 4GW4A 1T1YA 2CLZB 1YY9D 3AM8C 4OGZA 4PJHA 2B4CC 2IWGA 3NIGE 3FB5A 1S5HA 2B0SH 3L7FB 5DFTA 5B8CA 4FP8L 1D9KA 4F7PB 4JY4B 1XF5A 3AAZA 3UTSA 3TV3L 1G7PA 4K2UL 1NUGA 3QJHA 3CMOH 4O5LH 1MFEH 4EBQL 2JB5L 1AGEA 2W1NA 3Q1SH 2BMKA 1CS6A 1YEDA 2BNUA 4XVSL 5HTSA 3PHOB 1KB5H 3CSPA 1UWEH 4PFEA 2EDJA 4DVRL 4G9FE 5DT1L 2XQYG 2F58H 4ELKA 4KK8C 3PWUA 4UMGA 4BSJA 2F53A 2XTJB 3C60A 3EYSH 4RWHA 3JTTA 2V2XA 4KU1A 4QXTA 4KPHL 1RK1B 4WFFE 2CMRL 3ULUE 3TYFA 2BNQE 5MEND 3ZHKA 5B3JF 1I7RB 3LN9A 4Y4HC 4Z0BL 2H3NB 2EH7H 4V1DA 3RDTC 3EYUL 4NO5B 4TQEL 1NAML 3RAJL 2WQRA 1C08A 1L6ZA 1M71B 3WKML 1FP5A 4U1JB 3VFOB 2DJUA 5F89A 5LXGL 1J0HA 1U3ZA 4NNYA 4KHXL 4HH9A 2G60L 1I85A 4LLYA 1BX2B 2ZOKA 4CAGA 1K8DB 1S7XA 5E9DB 3G6DH 1NL0L 4P5KA 4NQTA 1BF2A 4GOSA 3B5HA 1N8ZA 1I1AC 3DMMD 5DF0A 4DEPB 1VACB 1RFDL 4U1MA 5D7KE 3BP5A 2XFXB 4CU6A 5EORL 4LCUB 4WFGE 1NJ9A 1II4E 1T5XB 3C6LB 1OP3K 5EU6D 1S7QA 4LAQL 2OK0H 4Y0GA 1YNTB 1MVUA 4ZPVA 1D5BB 4IRJA 15C8L 4PJ5D 4RDQG 5KSBA 5DZNA 2OXGA 5L7XH 4AEIL 1X6NA 4GMTH 4AEEA 1YQVH 3P77A 1FGNL 4XPTL 2A9ML 3MJ9L 3MREB 4NSKA 3CFCH 1WC7A 3LN4B 4PJBE 3BAEL 1X5ZA 3KLSA 4HG4K 4AY0A 1MUJB 4KI5C 4Z7NE 1RVFL 1W0VB 1A7OL 3GK8H 5ICXA 3SGEH 2EDXA 3TO2B 4APQB 4ZDHA 5L6YH 1U8LA 2IADB 3NPSC 3SKOA 3MUGA 3BPOC 4HAFA 3FQXB 4WFHD 2YPLB 4HUXB 4J12A 5HSFA 3PJSB 1D6VL 4NDMA 1ZWIB 4M93C 5BOZG 1FFOA 4OZIA 3HNVL 4OLUH 3CDGA 1K2DB 5HYJB 4MAYB 1RJLB 1GZPA 3RRQA 1B0GB 1SJXA 4J3WA 3RDTD 5T1KA 3RIAF 1QBMH 4WV1A 4X6DA 1BAFL 1DQDL 3VI4E 2R29L 1ZGLB 4K8RC 3MJ7A 4RCAA 2JJSA 2AEWA 3FN9A 1PY4A 1L7TL 3G04A 4P4KA 4Z5RB 3ARPA 3AY4A 5F9AC 3VXUB 2X4OA 4DN3H 4HCRH 1MWAH 3ROOB 1A5FL 3D69A 4M62L 2BNRA 5EN2A 1WBZB 3GM8A 4R8WH 1CT8A 1XCTB 4WWKA 5HPMB 3STLA 5BS0B 4W6YB 5J9PA 3HG1E 3QUYA 3V6FA 4HIXL 1NLDL 2Y9RT 3GI9H 3FTGB 2W60B 2O61A 1BQLH 1I1FB 3P9LB 3R06B 4ONFL 3HAEG 2PTTB 2YN3A 1FGVH 1MCDA 1INEL 2I25N 1K5NA 4PGBA 3MQIA 3OV6A 2OP4H 1QYGH 1TZGL 3F7VB 3BUTA 2F54A 1FQ9C 3N1GC 5FYJH 1F4XH 1JPTH 2LU4A 4N9OB 4F58L 1LEIB 1O5DT 4NYLA 3G5ZA 1AXTL 2VDNH 1KENL 2D7OA 2VL5B 2QQLL 4HCRA 2K7QA 1VA9A 3P73B 3EFDL 1NGYA 3TJEH 4YXKL 3WUWA 3WFZA 4UI2A 1J88A 1IILE 3VWKB 2VH5H 1TJGH 4Z7WA 5HI5D 4UQ2A 1VPOL 1IAIM 4RGMB 5K9QG 5AEAA 2YPVL 3B2VL 2HFEB 2ZPKL 1I1YA 4PRAA 3I9GL 5CP7B 1DFBH 1LP9E 2FATH 2NY2B 2D0GA 2R9HC 3SDYH 1OCWL 3MGTA 1P7KB 4WCYL 3GGWB 2VXVL 3DX6A 3KPNB 3NGBB 1SYVB 3HI5L 2XN9D 3QNXB 1BVZA 4JFHE 4LVNC 4MZ3A 4BQBA 5K59E 3VD4A 1MI5E 4Y5VA 3KNBB 3HA0A 2YN5A 5DJ2A 5FGCB 1G6RB 2NY0C 1JNLH 3WSQL 5CD3B 1VERA 3DUUB 4J4PC 5K9JH 4DFIA 1QPXA 3LSOB 2XQBH 5LAXA 1EK3A 5HYQB 2Q8BH 3V5HA 5F7HA 3L9RA 1IE5A 1Y6KR 3P9MB 2EIZB 3BJLA 1WFTA 3BXNA 3MRFA 2B0SL 1Q72H 5F7DA 3MRGA 4GRWB 5ECJE 1T22B 3O6FB 3IF1A 2IG2H 1SQ2N 2FCBA 3CMOL 4O5LL 1MFEL 3Q1SL 3OMZA 3MC0A 3G6AA 3CVHH 5FEBA 1KB5L 1UWEL 3MV9A 2C4XA 4Z7OE 4YZFF 3GMLB 2F58L 4LDEB 3Q6FB 5SV4A 1S7TA 4HLZH 5F7LB 4MHHG 3EYSL 1BFVH 4RZCB 2X4QB 3V5DB 3ZKXC 5CFHA 3RPIB 5JDSB 3WFCH 1RJZA 1A6PA 1N5AA 2EH7L 2XZQH 1A14H 3ARQA 4CKVX 3P9WB 1BLNA 3BHBB 4X9BA 4NOFA 5F3HB 5HYSG 2KKQA 2R9HD 1A02N 3D9AH 2PUQT 3ZDZF 1R24A 3KLHC 5DUBB 4B7LA 1N6VA 1XF4A 1WK0A 5LKNA 2ATKB 3U46B 5HI4C 5M94B 3QXDB 2WWMD 4UU9B 3V4UH 4JM4H 1CDCA 1EO5A 4B50A 3RNKB 1E6JH 4JANB 1INQB 2H26A 2EC9U 4H25A 3TM6A 5HDOA 2DQDH 1J18A 2XTJE 2RIKA 3VI3F 1BFOB 4DZ8B 5ID1B 4OB5H 3RGVC 3G08A 3HZYA 2J8UA 1U8KA 4C83A 4JKKA 2OK0L 2DQUH 4WU5B 4I9WD 4KZEH 1UXWB 3N85H 2V7HB 4IMLA 3LRSB 4WRLA 4LVHC 5L7XL 4FXGA 4GG8B 4GMTL 3VXSA 4UT7H 4Y89A 1YQVL 4HIIA 4LRNH 1Z9OA 2OL3B 5HYSB 1CFNA 4P46D 1MH5B 3U0PA 1M7IA 1P2CA 4GMSH 2AJVL 5E9DE 4QOKA 4XMPH 3GK8L 3TVMC 1U8PA 2NX5B 2AXGA 1FSKC 2LE9A 5L6YL 2QTEA 1A1MB 5ESVA 3V2AR 3VD3A 3SE3A 3VFNA 1EX0A 1QSEA 1DANT 1HOCA 3ESVF 2AAVA 1NCDH 2Q86B 3CXHJ 5T3XD 5F7UA 1JFQH 2N4IA 4OLUL 4H8WC 3TZVC 2JE8A 2FX7H 3MRMB 4PREA 1S9YB 1TCRB 4LSSH 1QBML 4NP4H 4HS6B 1VESA 3I3EA 2P8MA 4ZFFA 1UXSB 4QXGH 5HY9A 5C2UB 3KLHD 2ESVA 1MHHB 5SWQA 3ZZ1A 4DN3L 5B39A 4HCRL 4AM0B 1RMFH 2QKIB 1MPAH 1MWAL 4L4TA 3GSVB 1DUZA 4JFZH 4R8WL 5DK0A 4E41B 3S5LA 4BELD 4NFDA 4ALAH 4YGAB 1NEZB 4UIMB 2YPLE 3GI9L 5IK3A 1BQLL 1V5JA 3JV5A 2ZCKH 4OAWB 2XA8H 5F6IC 5DD0H 3D0LB 1FGVL 1HH9A 2HTKD 5HYJE 3IETA 3AS2A 2OP4L 5C0IA 1QYGL 2SEBB 2C1PA 5CSZB 1BWMA 3OKKA 1U8MB 2E9IA 5E5MA 2ZUQC 2CD0A 5FYJL 5I1DA 1F4XL 1JPTL 4L3EB 3QDMB 2YR3A 5JHDA 2VDNL 4PJ7A 5IVZA 4ZXBD 4PGDA 4WEBH 3RZCA 1UC6A 4A6YB 3TJEL 3WNPA 3MLXH 4P9HC 4RIRB 1F3DH 4QY8B 3VXUE 3IAGC 2VH5L 3IXTA 1DVFC 1TJGL 4UDTB 3BJ91 3FONB 1ZLUK 4H20H 2XV6B 1OAYL 3TVMD 3QFJA 3CC5B 4DKEH 3B2UD 3OX8A 1S9VB 4XNZB 1DE4A 4XXDB 5DD3H 1XGTB 2IGFH 5D7JC 2ITCB 4OZFG 1A4JB 4HFWB 5BS0E 2DQEH 1DFBL 1HEZB 4UB0H 1HI6A 5CEYB 1K8IA 4OCMC 3QDJD 3SDYL 1UEYA 1QFHA 5DEGB 3C5JA 3X11B 4WHTB 1MRCH 1NANH 2R69H 1IVLA 3VFGH 2GTZA 3F5WB 1WISA 3BP4B 4GQPH 4U0RC 3VRLF 4WJ5A 4BKLB 1TZHA 3DVNB 1RZGB 4DWHA 5IM7B 5I1LA 1KJVB 2ERJB 4MNQA 1LGVA 2O26U 3PV6A 5IT2H 4X8JB 4JKLA 4YE4H 4NHUA 5C0AB 1JNLL 3MRPA 3HZVB 3DX7A 3CFJB 2YUWA 4QYOA 3QCVH 1XF1A 5K9JL 4NQDD 2ED7A 1GGIH 2XQBL 2Q8BL 3I3DA 1S9WB 4XNMB 2B4CH 2IFFL 1YEFH 5AUMA 4X7CC 4JN1H 4KMQA 1I4FA 4X80H 3EYVA 1Q72L 3MRLB 4E0RA 5J13C 4HIHB 3EYQC 4NKDA 5DJ6A 2AK4B 2VWEE 2IG2L 1J86A 4OZFB 4X4ME 4XMKH 4G42B 1NBVH 1ZHLA 5LVEA 3BYYA 4Q2ZB 4Z0XA 4OF5A 3LKRB 5I17B 2A77H 4R2GD 4JM2B 3CVHL 5D1XB 1TITA 2R0KH 5DRNB 3MRBA 2APFA 4MA3B 1E4JA 5FGCE 1BFVL 3SJVB 4NQEB 4N5ED 4EN3A 5EBMB 4N5UA 1VFBB 2JCCF 3WFCL 1WWWX 4J1UA 1AO7B 5HD8D 4ZUTB 1EPFA 4M43H 4P57A 1ULVA 3UYPA 2XZQL 3DROA 5ID0A 2GTWA 1A14L 2QQKH 1GVIA 2XKUA 4LF3A 1NMCB 1MRFH 3W5NA 3D9AL 1QO3B 4NZTH 2VKWA 4GRMB 1A64A 2AGJH 1X5GA 1U6AH 2XTLA 3V4UL 1DUYA 2IJ0C 3ILPB 5J6GB 1HZHH 5I8EB 1E6JL 1D5MA 1F5WA 4O2EB 2DQDL 1JL8A 3JVGA 1KIUA 2XZCH 4MXVF 1KPRB 3ARWA 3TBVB 1DLHB 1NCTA 5DJDB 5IV2B 4J3XA 3VG9B 1MAKA 1FL3B 2WAHA 4Y4HA 4AT6A 4HKBA 3I3BA 5CHNB 4PJEA 1K3IA 1NGZA 4OB5L 4WEUD 3G5XB 1MCHA 3ES6A 2VB5A 3FFCD 3ZMRA 1NGXA 3KXFD 1T3FA 4KDTA 4KZEL 1YEEH 3EYQD 4ORGA 3N85L 3BEVA 3Q48A 3DRTA 4YPGA 4G8FA 4QCIB 3MBEB 4UT7L 4ZO9A 4RMUA 4JHWH 4LRNL 4KRPD 1OD7A 1GGUA 1CQYA 3X14A 1QRNB 3KG5A 3S37X 1H5BC 2HG5A 2YBRA 4GMSL 5H2BA 4L8CA 1NC4D 4MDIB 4Y4KC 4XMPL 1MCLA 3IU4H 1MSPA 4LLWA 1RJYB 3C5SB 2VLLA 3T4YB 3UJJH 4MLSA 5DDHB 5DO2D 3B9EA 2X1WL 1NCDL 2GSIA 3OKDB 1JFQL 5L2KD 3GBLA 4QRRA 1T1WB 4LGSB 1VENA 3VCLB 4Z77A 2FX7L 4TTDD 3MGOB 4FFWC 5C9KA 4LSSL 3W9EB 4NP4L 3QCUH 4MXQC 4O2FB 1N2RA 4QXGL 5BV7C 1QBBA 1BJMA 1T2QH 4WW2F 1F13A 1TIUA 1PJ9A 3MUJA 2NXZB 2EH8H 4E9LA 3ZDXF 1RMFL 4ONHB 1MPAL 1WGOA 1A9BA 4OGAC 1MAMH 4KK6C 4JFZL 1UM5H 4TULH 3SY0B 2BY1A 2NX5E 3KPMB 3QXVA 4ALAL 3I75B 3PG2A 1IEBA 4YHNB 1UYWH 4U1IA 2BHYA 5J1TC 5HVWA 2XA8L 5DD0L 4QLRA 1EEUA 5EUOF 2V9QA 4ZAKB 2PXYC 4G43B 3MPCA 4N9GB 4UOW0 3SO3C 1CVRA 2Y07H 5DK3A 4Z18A 5JNYA 2VAAB 4RFNC 4X9HA 2AV1B 1Q1JL 4WEBL 3ALPA 2W9EH 5E2TH 4PJXB 3WCYA 3MLXL 3RI5F 3RVVC 1AXSA 1V7MH 3TN0B 5HHOE 2GJZA 2P5WB 3QZWB 4X7EC 3KJ6H 4H20L 1KPUB 5BW7C 4XCEB 4NRZB 1G7HA 4ODXA 3PIQB 5DD3L 2IGFL 4JO2H 3CFBA 4E41E 2UYLA 5FKPA 2LFGA 5ICZB 4ZUWA 1SJEB 3MV8D 4UB0L 3T2QA 1GZQB 2VQUA 1MRCL 1BIIA 2R69L 1FZMB 1Y18B 3JWOH 4B7IA 3VFGL 1FYTB 1ZT7A 2P47B 4FFWD 5B3JE 1KIPA 2HT2C 4XP5H 4OLEA 5I8KH 1UB5B 1BBDH 4L3EE 3QDME 4X9FA 4LNRB 1DR9A 4YE4L 2IAND 5HDBF 3T8XA 3QCVL 1LEKA 2VISB 1GGIL 4E42A 1F97A 1EFXB 3MV01 5D6CB 4OGAD 1IAOA 2ARJA 2B4CL 4KJPC 1OTTD 5CJ8A 1YEFL 5MERB 3QDGA 3HFMH 5D7IA 4JN1L 3FO1A 4X80L 4P2QD 4JREB 3FCTA 4IOSD 1KTKE 1MHCB 3C6SA 2CH8A 3N1FC 4XMKL 1NBVL 4G5ZH 4FXKA 4PJAA 3WIIH 2CDFA 1KPVA 2EDYA 1ZK9A 2A77L 4XP1H 4QHNB 3VXPB 4Z7UA 4LKCA 2DYPA 2R0KL 4J4PA 2FJHA 3ESUF 2YWYA 3ARUA 3ARYA 3L6FA 1PG7W 4H88H 3RVVD 2FEEL 5C0AE 4HHAA 5IG7B 3K7UA 3C8KB 3VXTB 5DQJA 5T3XH 2A83A 1FN4A 1OLZA 4M43L 4NO0B 1T2XA 4UOJA 5IWLC 2P46B 3FRUB 2EKSA 5C08B 5C6PB 1XZ0B 2QQKL 1U91A 1T7ZA 3RUGF 1FL6B 4D9RD 1TZIB 2CGRH 1X5XA 1MRFL 2H8PB 4JZOA 1MY7A 1OAZH 2AK4E 3L3JA 4NZTL 1HDMB 3FZUC 1OGTA 2AGJL 1U6AL 1EJOH 1HZHL 1MY5A 3ALXA 5E8DH 4MQTB 4KQ4H 3FFDB 5BZWA 1TVDA 1AGBA 3RWHA 2XZCL 3O2DH 4EDXB 4XNUH 3VWJD 1MJJB 1T5WB 3HE7B 4UNTA 2YK1H 3SJVE 4NQEE 1EUUA 3QIUC 5F21B 1P7QA 1F4AA 4LEXH 1M1SA 4KJPD 1AO7E 1RQ5A 1UENA 3BZFB 4WU7A 4GAFB 1MIEH 1KTRL 4AL8H 5F96H 4HWBA 2HTLC 1QA9B 1YEEL 2FSEB 1CFTA 3WLBA 3ZDYF 1R3LA 3FQTB 4JHWL 3S34H 2OM5A 3O4LB 4MVBD 1LK3H 5I75C 4QRPB 3BEWA 1CFVH 3DUHA 1R3HB 4YLQT 1AKJA 4B0MM 2HJKA 1DDHB 5GGVY 1YN6B 3IU4L 3G5YA 4R3SA 3TFKD 1QNZH 1TPXC 3KPPA 3MRRA 1FH5H 4POYA 3UJJL 3GB7A 3GMPA 4FQHB 5IW3A 1C5CH 1FJ1A 3C5ZC 1FVCA 4IM8A 4LCWA 3I85A 1GIGL 3BGAA 4Q0XH 4PRNB 4WY7H 3D3VA 5ETUB 3QCUL 4G8GA 1IM3B 1S78D 1IAKB 2HT4C 1CLOH 1G9MH 3BZEB 1CIDA 2E7HA 1QTYT 1T2QL 1IC7H 4JFXA 3LKSB 5KSVB 3B9KB 1TNMA 4Y4FC 3FZUD 5F7MC 1QRNE 2IMMA 2VLKA 5DMIH 1JF5A 2DL2A 1CBVH 2EH8L 4N0FA 2H2SC 3VXNB 3CFKB 4X6EB 1MAML 2BOBA 5F8QC 4DK6A 1UM5L 4TULL 4XVTH 1KIQB 3D85A 1A4KB 1XCQA 1RD6A 3L7EB 4KKNA 5LQBH 2DF3A 1CD8A 3U4AA 1EZVX 2GYSA 3TZVA 3SBWA 5DTFB 4JFFA 4ZS6C 3AXLA 4HDIB 5E2VH 1UYWL 2UY7A 3KDMA 4PJFF 4Y88A 1UKSA 2ICWB 2JCCB 5BZDA 2P1YA 3WO4C 3SE4C 3WBDA 4LHUA 1BQHG 3JZ7A 2NW3B 5IW1B 1YEGH 3GSNH 3UPCA 4HKJB 5GRVK 5TPWH 2Y07L 3REVA 1UG9A 5HHQB 3JV6B 4ODVH 2W9EL 5E2TL 3H3KA 3HMXH 1CDYA 4RGNB 1V7ML 3KJ6L 2DMCA 2E6QA 3W11D 4WHYG 1T7YA 4K3GA 5IROC 5CINH 3IGAB 4GAYB 4YZFE 2XG5A 1I75A 4BA8A 1F42A 3G9VA 3S4SB 4EI5A 3BN3B 2P24B 3O3EA 3DO7B 2R23A 3JWOL 3LS4H 3PP4H 3DRQB 1WZMA 2IAMD 4DCQB 3MNZA 3IFPB 4XP5L 3ZKMC 5I8KL 1BBDL 1BQHB 2MOVA 3QUMA 1DVFA 4X6FA 4JO1H 1XEDA 3ZDZE 3C9NB 4PJXE 2FRGP 1AGFB 5IB4B 3MUY1 4JFDD 3PWJB 4HUVA 2P5WE 3GI8H 5ALBH 3LPGA 5D7JA 3SCMC 4PGEB 3P11H 5KOVC 3HFML 2K1MA 4RAUA 2J88H 4ODUA 4QXUH 1MFDH 2I9TA 3EBAA 4QTIH 2QR0A 4ZS6D 4C56D 4XB7A 1CIUA 3RKDC 4DVBA 1IQDB 2B7DT 3VI3E 1P6AB 5DJAB 4G5ZL 4J3TA 3WIIL 1MRDH 1FYTE 1Z5LA 3BP7A 2FL5A 4OCXH 3DO3A 5GRVL 4XP1L 2NNAB 2NTSP 2CDGB 1Q94B 1QOKA 2DQJH 4GAGH 1JYWA 3LD8B 4AZ8A 4H88L 5KSAC 1IGJA 3KYMA 4MSWA 4WW2B 1JZ6A 2X4SB 4YO0B 4NPYA 2CKBH 4Z6AT 3ZYZA 5T3XL 1PGRB 3MLWH 1JHKL 1RK0B 3B4NA 4NBYB 5I1CH 3LKNB 3U0WH 5HVFB 2IBBA 3BRFA 2CGRL 3QRGH 5DJCA 5E70A 4X0KA 4WGVB 4JFED 3VGFA 1ZLWH 1OAZL 4NIKB 4R96B 4F3FB 4OQTA 1FPTH 5EUOB 3RX5A 3OQ3B 2YUVA 5F44A 3VD5A 2BP3A 1SMOA 1EJOL 5E8DL 1KB9K 3ZKMD 1VEMA 4KQ4L 2GUOA 2VAJA 3VXMB 1AC0A 1OGAB 4JZJC 2Y5TA 5FA4A 4ZTPH 3O2DL 4JAMA 4XNUL 4QF1A 1VGEH 4MNQD 2MHAA 2YK1L 2IQ9H 4LP5A 1CGSH 3ABZA 4N1HB 4W4OC 1IAIH 4HPOH 4LEXL 3QIBA 1E28A 4NUJA 2VLMD 5IBLC 5J57B 3VFWB 1BJ1H 4D94A 1EXUA 1MIEL 4AL8L 1D5XB 5F96L 5C08E 4OZHF 5DK2A 1YECH 3L95A 1EV2E 1NEUA 3RKDD 4MWFA 4MD5A 5C6TH 3CFEB 4PJ9C 3S34L 4QHKJ 4WVRA 1LK3L 5DURD 4PJ8B 1CFVL 2D7QA 3NCEB 1YC7A 1NUFA 1R6VA 4F7EA 4DGVH 3MV7B 4P2OB 1CXFA 3LEYH 1GGBH 4LCYB 4RMTA 3VFUA 3MA7A 1IFHH 1QNZL 4JO4H 1M7DB 1FH5L 4NZRH 3CCHA 5KSAD 4KJYA 2CLRA 5GS0C 3EDFA 2NY3B 5CWSB 1QFPA 1C5CL 3MFFB 4GG6A 3BH9B 1BJ1J 1A7NH 5CUSH 1HQ4B 4WY7L 3IDJA 4PRDA 1RY7B 2BVUA 1GCFA 2M8XA 3GM0A 1CLOL 1JPST 1MF2H 3ARGC 1H5BA 1UB6A 5BV7H 1ZV5A 4OUUA 4F33B 1IC7L 4K9EH 3ARVA 3MX0A 4Y4KA 2EC9T 1WFOA 2BOCB 3DYMA 3O4LE 2B39A 3OKLB 2D9CA 1CBVL 1G7MA 5DMIL 4QRPE 4PRIA 3TPKA 1EDQA 3EFFA 4U6H