3FJTA

Crystal structure of a human fc fragment engineered for extended serum half-life
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
209
structure length
209
Chain Sequence
GGPSVFLFPPKPKDTLYITREPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Structural characterization of a human Fc fragment engineered for extended serum half-life.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 209
sequence length 209
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fjtA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3fjtA01
1DE4B 2NY5C 3PL6B 4KJWD 5EIIA 1F4HA 5J9PB 5E8PA 4J8RB 4MD4B 4UIMA 3W9EB 4OCYH 4KV5E 1DBAH 1MEXL 3CSBA 2FRGP 1QRKA 1UGNA 5ALBL 3QDMB 4JO4L 3O4LA 2X1XR 3H42L 3ULUD 5C0CB 5H8DA 4D0DA 1X5YA 4Y7MA 2WQ8A 3V4UL 4HIHA 4JKPH 1MI5E 4KQ4L 5IHUH 2XRAL 3STBA 2IQ9H 3BP4B 2UZYB 1NC2D 2NXYC 4WU5B 3H9HA 1NFDB 1HSBA 1NFIB 1K8DB 4JZNA 3O4OB 3ULUH 4LBEB 5HHVH 1S7SB 1W0VB 5I74B 5EG6C 3I6LE 3C60B 3OGCB 4QGTA 4XP6L 2DQEL 1NEZA 4Y4KB 1WBXB 3GGWA 4UTBH 1UM6L 5HYJB 1T0NB 3KDMB 5EU7E 4JR9H 1BLNB 3C5ZD 3OAYH 2EE9A 4L4JA 2PR4H 5HHNB 3VRJB 4HW6A 5C0FB 1UZ8B 4ZUUA 5F8RC 1KJ3L 1BBDL 3D85A 3QUXD 4KKCD 1QRNE 3T4YA 2VLRB 2NX5B 2LTQB 3MUHL 1WWCA 1JGLL 3EOTH 3V6ZB 1A3QA 2EEBA 1TPXC 1IRAY 7FABH 3HE6D 2BVQA 3QIUB 2YPKB 2BSRA 4KKAC 3MGTB 4XNXH 4A6YB 5A2JH 5ITFB 3MV01 5DGRA 3O0RL 1CDGA 3BH9B 3OJDB 4DTGL 3DIFA 1LP9B 4XZUA 5DUBA 1R3HA 4GMTL 4WJ5A 5GJSL 1N4XL 3OB0K 1NCDH 5FKAA 1JF1A 4BA8A 2E7HA 1QBML 3UTSB 1HQRA 3TP4A 1ERNA 3QUYB 3QRFM 4TYUA 2CPCA 4LSPH 3JTSA 2LFGA 4WNQA 5A2KH 1T7VA 1OGTA 2H32A 1OM3H 5C0AE 1FFOB 2QSTA 5EO9A 4LOUC 3HG1B 2OZ4H 4NN6C 2DOCA 5JXAH 1VDGA 3FOMA 3IDNB 4GUPA 2ICWB 4O2CA 4ODVH 4GAGH 1OTUC 1TTFA 1J0KA 2NXZD 3CFCL 1MIEL 4QHLB 4XPHH 2HKHL 4L4TD 4R97C 4FFVC 4O58H 2K7PA 5AAWA 2XZAH 1I7ZB 1E4XH 5AYUH 2D7TH 1J05A 2UYLB 3GKWH 2P46B 4X9GA 2GTWA 4XWOC 4L1HA 3TA3D 5DJ2A 5KW9L 4WWKD 1X5FA 5CP3H 2FECI 4FFZL 5C6WH 5A3IC 3SGDH 1A9EB 3WLBB 1PW3A 3IYLW 2EDRA 4FHBD 3BP7B 3VXRA 3VFRA 3UAJD 3P0VH 4QRPD 3P9WB 4PJFF 4U3XA 3VWJA 5KANG 1HHGA 1BBJA 3WFDH 5IROC 5IEKB 4HIJB 2EDXA 1T6WA 1PYWA 4U4BA 3NFPB 4YHKL 5GS0C 2W0PA 3IJYB 5C0GB 1R0AH 4XNUH 5EU6E 2R1XB 2CMRH 5F7LB 1KJ2L 2M26A 4BH7A 2EE3A 3SDYH 1WV7T 4K2UH 1BZ9A 1GHFH 2GY5A 4NKOB 1TVHA 5FKPA 1GRWA 4S2SB 5EDXA 1EO5A 1IGYB 2PXYA 4PLKD 5GS0H 4LCWD 1NBZB 5DR5H 3DI2B 4PP1D 3ALPA 1FN4A 1H8NA 1OAKL 2XFXB 3S6CA 1LDPL 3QYCA 4F57H 3GRWL 4KRPD 4Y2OA 1KLFA 4U6VH 1AGEA 1UA6L 4PLOB 2ATKB 4LKCA 5FGBA 1T03L 2LAGB 5FO9B 3NA9H 4ZSOE 3SGEH 4AEHL 4DFIA 4PTTB 3IXTB 4JQVA 2EC9T 5AUMA 4FQXD 4K7FA 4H88L 4M6AA 4UAOB 1UG9A 5DRWA 1Q9KA 4Z78A 3ZL4L 3T0DA 4XCNB 2VKWA 4LIQH 2E9JA 3BPNC 4G3YH 3SDCA 1CXKA 1UH3A 2F19H 5I16A 4BQBA 3RWIB 4PD4J 1KB5L 1XF3A 3V6OE 3ARGD 1P7KA 5HYSA 4ISVB 4Z76B 3V4VH 3O9WA 1ZHLB 1LVEA 1M7IB 4KJPC 5B8CB 4TOYL 4YAQB 1VGEL 2Y6SD 3PWPA 4CUCA 4C58B 4RAHA 2I9LA 1MJUH 1I3GL 3BD3A 2GJJA 1TFHA 2ED8A 1W0WB 1W72B 1MHPL 5MERB 1NCAL 4O51B 4XBGB 4ORZC 5KSAA 5C0IA 1A6WH 4J4PD 4I0KA 1U91B 1T1XA 4APQB 4JQIL 1A3RH 4K9EC 5HGBA 2XKNB 2FLBT 1G7HB 4HJGB 3ZYJA 5I76A 3Q6FA 4JDZA 5I8EB 3T8XB 3B6SB 1HXYA 1U8IB 2M8XA 2J6EH 4ZFZA 1A7NL 4D8PA 3UDWA 3GB7A 2OJEB 1W2KT 4S0SD 2F54A 3QDGB 2H32H 1IGJB 1FNHA 4R9HA 1TNMA 2FJGA 4ZO7A 2ZOKA 3GSUB 5DRZA 5E94A 1FNSH 3TFKC 4KI1A 1JZ4A 4C56D 4M62H 2APWA 3LSOA 3ISWA 3GK8L 1FYTB 1ZHKA 1RFDL 3OKMA 2V5YA 3GMLA 3P73A 3V52L 2DLFL 5IBLC 1I9RH 1E6OH 4ZTOL 1VFAA 1QLFB 3FAXA 3H3KA 2R2BA 1WFOA 4JFZH 1P6FA 1RJYA 1SVCP 4HWNA 1MRFH 3T2NL 2HRPH 4FABL 1H0DB 3KYKH 3GI9H 3DXAE 3VWJC 2Z8SA 2FATH 2YPLA 4OT1L 2VUOA 3PGDB 3L5XL 4M00A 3HR6A 5CBEB 3QEGL 4HIIA 5EO1B 5ICYA 2J8UE 1YEFL 4KK5C 1QEWB 4JAMB 4Z77A 3WDJA 2NTFA 3CLEH 4PJ5A 4WTZA 5E00A 2FDBP 3F7YA 4R6UA 3GSNH 5K9OB 4YDVA 3C5SB 2A2QT 1WWBX 2CUIA 1HHJA 5C0CD 1AXSA 3HZYA 1M05A 4MQXC 1NANI 4PUBL 4HXAL 4ZFOB 3I3DA 4F9PA 4M02A 1T7XA 3S8WA 3BO8A 4P9HH 4MHHI 4TVSa 4QRTB 1YEKL 4FQCH 4KXZI 5FGBC 4P5MB 6CGTA 4R96A 2CSPA 4NQCE 2QQQA 2E7BA 2IFFL 3OKLB 4JQVC 3T1WA 4JM2B 5I1IL 2PYFA 5HYJD 2J5LC 5DD3L 5GGRA 3MO1A 4BUGA 3RVVD 4UT9H 1TENA 2NW3B 2VDML 5TDNA 5BV7C 3MREB 4N0UB 4UB0L 5IB5B 4QHNA 3SDCC 3HC3H 4JGJA 4NJAH 2VLRD 2OK0L 3IDGB 4O02L 2VLJA 3ZSTA 4MNHB 2C4FU 3QIUD 3ABZA 4Q7DA 3TIEA 3DSFL 2EC8A 5CILL 3O9WC 1ED3A 2BSSB 4RA0C 2ED7A 5BV7H 1T0MB 2BJMH 3HS0A 4LLDA 1YUHB 3VMNA 3QDHA 1KF9B 1YMHB 2Q7NA 3L3IB 3QG6B 5HVFB 4N1CA 3B3IA 1NGYB 5KSAC 4LLMB 4FZ8L 4NQXB 4HLZG 3TCLB 1CLYH 3ROLB 3S5LB 4LSDA 2PTTB 4KMTH 3UTSD 3QUYD 4Q9RH 2AABL 3PWUA 5ISZB 1JTOA 3RDTD 3L3DB 3PJSA 2C3VA 2BC4A 4I9WE 3IDYB 1DDHA 3GSOB 3HG1D 1MCFA 5I1GH 3VFGH 2WSKA 5GSRB 3REVA 2Q20A 4K7PL 1A21A 5D4QA 4Z7WB 3UDWC 3MRLB 2V5MA 2ZUUA 1G0DA 2CIIB 3WE6A 2CLVA 3W5NA 3MCKB 4XCYA 3PWJA 3DUUA 1FFPB 1TNNA 2WIIB 3DETC 4R7NB 5DD1L 3QA3B 4KHTH 4YDIH 1FLRL 2CD0A 4KMQA 4XX1G 2H2SC 5ESAB 4LSQH 3DGCR 4JG0H 4PJIF 4M6MH 5FF6B 3U36B 4XP9L 3I02A 2VH5H 4E41B 2CRZA 4OGAD 2FX7H 3HR5A 1QHPA 3CDGA 3PHSA 2WLZA 2EYRA 1IZKA 2QSCH 2XZCH 3A67H 3FQUB 5GIRA 2AK4A 3D3VE 4E5XA 3ARDB 3PV6B 1FBIH 3UBXB 4PJDB 3EOAA 2MKWA 1MELA 2JJVA 5FGCB 4HDIB 5C0RL 4Z0BL 4GW5B 1V3KA 4OLUH 1IKNA 4WEMB 5DK2B 5I30H 3UPAA 4JG1H 4NO2B 5IQ7L 1X7QA 2K1MA 5E2WH 3O45B 3UPRA 2C26A 2WW8A 2A38A 2NZIA 4OV5B 3BIBX 1AO7B 4MXQD 3KPSE 4KUCD 4MSWB 4IHOA 2D9CA 1KPRB 2C4XA 2GQHA 2HKFL 2Y7QB 5GGVY 1I8IA 2YD7A 5KSBE 4X8JB 4HAGA 1A3LL 3G6JA 3MA9H 4X6DF 4F9PC 5CEYA 3G5XB 3HZVA 4JFFB 1F2QA 1IE5A 1CLZL 4XAWH 5D70H 3PDGA 3H3PH 1Q72H 2BVPA 2D7OA 4JO1L 4U31A 5H94B 4ZDHA 3GDBA 1S7WB 1N2RB 4UILH 4MNGE 4X5WB 1S9XB 25C8L 2HTKD 4FQ2H 4JPKL 4WU7A 3T09A 4ODXB 1D5BB 2D0GA 5F7DB 1X5IA 5CEXB 3CJJA 4PJCF 4YHNA 1LO4L 1N8ZA 1DFBH 1IEBB 1OD9A 4XP4L 4YK4B 4ELMF 5IBTH 5C6TL 4NWTH 1MFDL 4L3EB 4YXHL 2MCG1 2FGWL 4AY0A 5EBMA 2I5YH 5CZXD 3OKEB 2PW1A 2XWTB 4J23A 4NQTA 1FGNL 2J88H 1EFXB 1PD6A 3B4NA 2CXKA 4X9BA 3EYUH 5I1JL 2YRLA 5E08H 2ZCKH 1LGVA 2B5IC 2JJSA 1MCJA 2YK1L 3KR3H 3IKCA 4ZXBB 1R5WB 4BFBD 5IJVB 4HT1L 3ARTA 4XNQA 5F6IB 4IOSD 4K71B 3TBYB 4GW4A 4CVZA 4URTB 4BQ8A 1YNKL 3MXVH 3MJGX 4XMPH 4JFDA 4POUB 4PJAA 1FAIH 5EZLB 1F4YL 4KVNL 1QLEH 3MBXL 3SKOA 5AWNL 4WHTA 2ZP0T 4LVOB 4PJIE 3BAEL 2E27H 4HS8H 4PTUB 3RWGA 4APQD 2VLKA 35C8L 3K0WA 1INQA 2ZOLA 1S5HA 2ZCHH 4EBQH 4DUXA 5CKAA 4G80A 2Y5TA 5IHLB 1ND0A 5AG8A 5H35A 4QNPF 1A7RH 4KTEH 5D7IE 5BOZG 4GG8A 5DRNA 5ETUA 2C3XA 4AEIH 2Z31B 4P46B 1PKQB 3AGVA 2HT2D 3QDGD 5E4IA 5ADOH 3SKUD 4FTVA 3CLFH 3WNPA 3RX5A 1QYGH 3MR9B 4AT6A 4QHMA 4Z7UE 2HG5A 3RP1A 3T65B 5DK3A 5JDJA 3QNXB 3U82B 3X11B 1FL3B 1DSFL 1FYTD 4Y1AB 1QLRA 5J4MA 3MRMA 4KH2A 2ZZUT 1Z9OA 3ZT5A 1I3RA 2JELH 2FEDD 3ZZ1A 5IEHA 3RBGA 2CR3A 3WS3B 5ADPL 3GMRB 1G7PB 5ACZB 3GUTB 5C0ND 2R0KL 5D2NA 4PRNB 1TXKA 4XVJL 1XCTB 4F3FB 1EBPA 2RFXA 3WIFB 2HFEB 4PJCE 3QI9D 1IKNC 1WVZA 5FM5M 4ELME 4BK5A 1TJIL 5K33A 4NSKB 1U8LA 2JJTA 2P8PA 1DN0A 3KPOA 4GRLA 2EDHA 3Q3GB 4KC3B 5HGDB 4DEPC 2J3SA 3KYMA 2DWDB 3IDUA 2AXFA 4GBXB 2HT4C 1MHCB 2Q86B 3EZ8A 4HD9A 5EZJA 1QFWI 3SQBA 4QOKA 4W6WB 1MHEA 2EYSB 4B7LA 1YEEH 1JGUH 1DEEB 4Y8AA 3KPRB 3B9EA 3TT1L 4OM1L 1A6VH 4G8GE 1WTGT 3ULUF 3CVIL 1MCWW 4MD0A 1B0RB 1I85A 2Y06L 2JIXA 4JFXA 4TNWF 4XMKL 5HVGB 4JM2D 3NFNB 1YPZB 3ZSSA 1OOAA 4OGYH 1HQ4A 2FSEA 5I75C 3D6GA 4R90H 5LCVH 4HMEA 3L5WB 2C9AA 2AV7A 1N5AB 4ZD3H 2JJSC 4UDUB 2BNQE 5HHME 1GOFA 3FQRB 4QRQA 1C5CH 4QNPE 1FO0H 4O4YL 3MODL 5D1XD 5EZOH 1G9EA 2VLLB 3QEQE 5TFSH 4PRHE 4DGIL 1FJ1A 5JMRA 3GMQA 2WWMD 4N8VB 4S1QH 4KTDH 4PJGB 5CJ8A 5JUEH 3RVTD 4RAUB 4M7LH 4GRWB 5DQDL 1V8HA 1HXMA 3UYPA 1F3JA 4OF8A 2GFBB 3OAZK 1VHPA 2P24A 4PGCB 3T1FA 1CLOH 1S7TB 4NO0D 5SWZA 1I1RA 3ARRA 4YC2C 5ISZD 3BGMB 2GITB 4PRIB 2HN7B 1HILB 3KLHD 4FZEH 1MVUB 4OAWA 5F7UA 2OMBA 1T1WB 1YYML 1OL0A 4WI2A 1WICA 2ATPA 5C09A 43C9B 2IPKB 4HUNB 1RURH 3AAZA 2W1NA 1TCMA 2Q76A 5E8DL 3OKKA 3PWNA 4M6OL 2P47B 1RUQL 3FO2B 2ZPKH 3R1GL 1NGZA 4HWZB 3RY6A 5CEZE 4GAJL 1ROWA 1MJ7L 2R1WA 3O8XD 4LLQB 3VGGA 1CI5A 5IVXB 4NPYA 1UM4H 1V5JA 3BSZL 1VFMA 3NIFF 3H9SB 1T2JA 2BMKA 3U9UA 5I0DA 2VITB 1AE6L 4OFYD 1T20B 3RUGE 1FZMA 4UTAH 4S11A 5DMYA 4J1UA 4E41D 4GG6B 3BYYA 1SYVB 4K94L 5DWUL 5I0ZA 3OXRB 3IETB 1P69B 5D2NC 2VZTA 3ALWA 2OMNA 1GGTA 3BPOC 5DT1H 3QNYA 5DJ6B 1NCNA 3RZCD 3ARDD 4MVBD 1VERA 4XVUC 3BE1H 4MB4A 1AGCA 1FVDB 2B2XL 1CD1B 3QXWA 1V7MH 2WANA 4CADA 3RWJA 5E9DA 5GS3A 1T1ZB 4KPHH 1H3WM 4EN3B 3V6FA 3CU7A 1YEJH 3EDFA 3ARXA 4DWHA 3BD4A 2JJTC 3O6LH 4I2XE 5L0QC 4GRLC 3KPNA 5JW3L 3UJJH 3C09C 4M61B 4DW2H 4JJHA 1AO7D 4L8CA 5JZ7C 1Z6JT 1NGPL 4OD2B 4RMVA 5IW6A 4I5BB 5EOQL 4LCCA 1FFNB 3CX5J 1X5GA 1RZFL 5TF0A 2PF6A 3BJLA 1X5XA 4HAFA 2R4SH 2KQNA 4JFFD 3U6RA 5L6YH 1WAAA 4CNIA 3O2VH 5T3ZD 4XCFH 4KUZH 3OKDA 5FUZL 1I85C 3E6HB 5TQ0H 3VFTA 5HHOA 4Z9KB 5C2BL 1R3JB 4PV9A 4FQJL 4CVWA 1CVSC 3RU8H 1J5OH 3LV3B 4L3ED 1KB9K 2BZDA 1AIFB 3NFSL 5FCUH 3CVHL 5I18L 3BZEB 3T77A 1P5VA 3LKRA 4ZQKB 3WXVL 2XQBL 5T3ZH 1EFXD 3T3PF 1S8DB 4QXUH 1H5BB 4HLZH 1F4WH 3KPLA 3P4MA 4ZXBD 5HPMB 2P49B 3KPPB 5IMKB 3O3BB 5A2IH 1XAUA 4R97B 4HH9B 4XH2B 3JXAA 4N0CC 4PY7B 3HRZA 3MUGA 2YD4A 4JANB 2I07B 4QRUB 4YGVB 3S3SA 4QHKI 3QHZH 3MUZ1 2ICEA 2DQUH 1QBLH 3MRRA 3J8F7 3V8OA 3TT3L 3BW9B 2VWEC 2CLRA 1H3PH 2GJZA 2C1OA 2DQGL 3PNWA 3CC5A 1KJVB 2ZUWA 1CDUA 1QQDA 1ZT4B 3ESVF 5ICZB 5IG7A 2OR9L 1YNLL 5CSZB 4PJEB 1ZTXH 4L4TE 1KJ2A 2BDNH 3L5IA 4DK3A 4G7VH 3U0WH 5K59F 1AQKH 4ONFL 4HGWB 5CSBA 1PX3A 1UH2A 3UTTB 5EIIB 2R2CA 2EICA 1NCBH 2YBRB 1MEXH 3W9DB 4KJYB 1HH9B 2Z31D 4P46D 5SV4A 5BOPA 2R4RH 5ALBH 2VTFA 3GRWA 4NFDA 5GQBA 4JO4H 3RY6C 2FHFA 3MYZA 3H42H 3D9AH 1MCSA 4KGLA 5BS0B 4LLWB 4QRPE 1AGFA 4P3DA 1ZLWH 3V4UH 2X4OB 2IBZY 3QUMB 4UIKH 4KQ4H 3REWB 4Y1AD 3H9HB 1FLTX 1ETZA 2VE6A 3PF2A 4IRJA 3VXOA 4JZNB 3I6GA 2FX9L 4I3RL 1HZHL 4HX1A 4BK4A 1F11B 2AXGB 3QXDA 2XACC 4XVSL 5IVNA 4NO3B 1U93A 1A22B 5CUSL 4Y19B 3QPXL 3IFPA 1KTRL 4ZODA 4NQDA 1FNEB 4TSBL 1IGFL 4KK8D 3Q6GL 3QWRD 3V0VA 1KN4L 1D5ZA 2JJWA 1KB5A 4YEEA 1A6TA 3DGGA 5TPWL 3WCYA 4EVNA 1KJ3H 1P4LA 1BBDH 4LHUG 3DO3A 4LVEA 1UWGL 5FGRA 1FFRA 1JGLH 2VQ1A 3TH2T 4MB3A 3TNNB 4AZ8A 1PQZB 2Q8AL 4XHQA 3T3PE 5DD6A 1LWRA 2E9WA 2W0KA 3B8SA 4BFGA 3AXLA 1NAKL 4LCCC 2A9NH 2FNBA 4JY4B 3NCCB 3O0RH 2V2XB 1WLHA 4K8RD 3VXSA 4XZUB 1I4FA 4DTGH 1R3HB 3QP3A 3FO9A 4PD4K 4WJ5B 4LSTH 4PGEA 4Q6IA 3EO0A 1JF1B 3KPRD 4GMTH 4M7ZB 1N4XH 2KZ1B 1RUML 4OD1H 2Y36L 5FAAA 3ULVD 4QXGL 2MTPA 3JTSB 4WNQB 1FV1A 2Z4QA 4PG2A 4YO0A 1OP3K 1DANU 1BQSA 3PG2A 4XWGL 2DWEA 1NFDF 4M93C 2HJLA 3FOMB 5EPMA 3MRJB 3BT2L 1OB1A 3EBAA 2APFA 4JO2H 4AL8H 5K59E 3C6LA 1TZIB 2PYEB 4DUVA 4OJFH 1Q94A 4KAQL 1GIGH 3AFLA 2V7HA 2VZ1A 5FYLD 1XH3B 1GGIL 5DMKA 3BIAX 4X4XB 1OP5K 5KJRL 2GTWB 5CHNA 1IJ9A 5DJ2B 2F8VA 2VDKL 5KW9H 4A2MA 5FYLH 4D94A 4FFZH 4OZIA 4C54A 1HDMA 3P4NB 3VXRB 5HVWA 2WP3T 2DB8A 3LKSA 3W39A 1LO2H 1BBJB 3H0TA 1OSZA 1ZT1A 2E7CA 3I75A 3EDJA 4NGHL 4C56E 4PRID 3RWFA 1RVFL 1LP9F 2VZ3A 5F9OL 5JPMA 5C08E 4YHKH 2Z8WC 4GW1B 1G7QA 4IS6A 5LVEA 5BMFL 1MIML 1RJZA 5GGRY 4BH7B 4TPRH 2NLJA 3QXAA 5D71L 1TVHB 2PXYB 2EDEA 2FJHA 4NOFA 1ORQA 1TZGL 3QPQC 4K23H 1JGEA 3U7AA 1FN4B 2AJUH 3IU4L 2X4PA 5CGYC 4GXVL 4PREA 1OAKH 4CMMB 1MNUL 1LDPH 4KK6C 3H9SD 4IRJC 3GRWH 4JDVB 1AGEB 5INCA 4JREC 4OTXH 3HB3D 1P84J 4AJ0A 4JHAH 4KK9D 5CD5C 2R56H 4Q9QL 1OF2A 3GJEB 3CSYA 3FOLA 5GGUB 4UNTA 4R0LA 3QDME 4OB5H 1J0IA 4NZRL 2R29L 5DRWB 4H88H 4PYGA 4G8FA 4AQOA 3RVXC 5C0CE 3OJMB 4Z78B 3O6FA 4P57A 5EC1B 1CT8A 4NRXA 5JIHA 2R1YB 1DJSA 2WWKT 4EN3D 4NUJB 4M7JL 5I16B 1XGTA 5I1EL 5LBSL 4HG4K 4JRYB 1NFDE 3VJ6A 4JJ5A 3G5VA 4RFNC 3EGSA 5GGQL 4CW1A 3I50H 3U9PL 2XNAB 3WD5L 1XT5A 1L7IL 2IALB 3QIWA 4KKBD 3K80A 1JWSB 5CLTA 5HYJE 4TOYH 1VGEH 4EXPX 5I1AA 2NY1C 3OB0H 4Q6IC 4ETQA 3LMJL 4CAGA 1I3GH 4XCEB 5KSAB 4O2FB 1XR8A 1MHPH 2Q8BL 1T1XB 2VLRE 2NX5E 1QNZH 4U1GB 4KUCF 4PG2C 1NFKA 2AJ3A 3DVIA 5ID1A 3FO0L 5BW7A 2BHYA 1ZAGA 3Q6FB 5I76B 4OZFG 2W91A 5J12C 4P23A 3MJ7A 5KG9B 2Z92B 3S98A 4ZFZB 4NRZA 4HJJL 4D8PB 3GB7B 1QSEE 2DQIH 1A7NH 3C6LC 1LP9E 3K8MA 1EZVX 2FJGB 5BO1H 3NCFB 4UOW1 4G6AD 2ZOKB 4MD5A 5F1IB 1EXUB 5E94B 1WBYB 4X6CF 4ZUVA 4WHCA 4RMWA 3UTSE 3F7VB 3LSOB 2IH3A 2X05A 2O5YH 1ZHKB 3OKMB 2XTJC 3GMLB 3P73B 1RFDH 5F96L 5TF1L 2AEQL 3HG1E 5HVHC 1XZ0A 5KSUA 2R2BB 2I9TA 4OLWL 1QTYT 3V7MA 5I1LB 2MHAA 3TBTB 4GMSL 3T2NH 1HWGB 4FABH 4E0RB 4ZUTB 4P0DA 1SMAA 4OT1H 4AG4H 4NDMB 4GOSA 3PWVA 5FUCE 4LSUL 3UTTD 1Q9WA 2XXCB 5ICYB 1I8KB 1C1EL 1R3KB 5ANMB 5DO2D 4JRXA 4Z77B 3TJEL 4OCMC 5L8KB 5E00B 2NYYC 4JFHD 3GNML 3LKOB 3BZFA 4MDIA 5FOBA 3MV7B 1HH6B 4JY6A 4LHUA 1MFCL 1DQDL 1GGYA 1HHJB 4ZNEA 5DEFA 1OCWH 1IGTB 5BS0D 1YN7A 5I66A 1FVEA 1JVKA 4OZGB 3MGAA 4IMLA 3W11C 5HGAB 2A0LD 4WO4A 4BSWA 3BO8B 2MKLC 4HXAH 4JVPA 4J3XA 4DQOL 4YBQC 2J4WL 1PEZA 4X0KA 3Q1SH 4R0LC 3DX9A 4WI7A 3RKDC 1FE8L 1K2DA 2IFFH 2X4SA 4WWID 4XNZC 4Y19D 4POYA 4N5EC 2UWEB 2H3NA 3JV5A 3O6FC 4EXKA 1AHWB 3WIHL 1LK3L 3FN9A 3CFBB 4NKQB 3NACL 1A6PA 4UB0H 2VLJB 3QAZB 3VG9C 2OK0H 2F58L 4O02H 3HRPA 1A02N 1IILE 4KWUA 3U4EA 3X17A 4EUPA 1ED3B 1S9VA 3DSFH 2RJMA 4MHHG 2ESVA 3HS0B 3QIWC 5FB8A 4LLYB 3GSXA 1KIQB 3IS0X 2AJVH 3UTOA 4ONHA 1UCBH 4UOJA 2FYYB 3IJHA 3QZWA 5IESL 1IEAA 1F8TL 5IFJB 4JPVL 5DD5H 1JHTB 3QIBB 4FZ8H 5D6CA 3FB7A 3N1MC 2IADB 5F89B 2OLDA 1KFAL 2AABH 3JVGA 4NCDA 3RFZC 1IQWL 3NTCL 5BW7C 1DDHB 4NZTH 5K9QI 3VD9A 4P23C 2CIKA 1Y0LA 1ONQA 3H7BB 3LKQA 4OF7A 1S7UA 4K7PH 3T0EE 4KJQC 4NZDA 1O0VA 3TGXA 4X9FA 3WE6B 4XCYB 2OBGA 2VDOH 5B4MD 1G7LA 1JGDB 2PYED 4EDXA 4JM2F 2OP4L 1Q0YL 3SDAA 3TFKD 4ZO6A 1OSPL 3IFLH 1I7UB 1FLRH 1BQHB 1GPOL 4RGOL 3MFFB 1TQCB 5SWSA 1KLGA 1VFUA 5K9JL 2VDPL 5DYOA 4XP9H 4I48B 3CDGB 3L1OH 1J18A 5E99L 3ZKXC 4E9LA 2QTEA 1GL4B 1JPSH 1VADB 3QDGE 4IIQA 4PY8I 5GZOC 2FL5B 4LFHD 4M5YL 3KHOA 3AU1A 3V7AE 3EOAB 4NWUL 3ARFC 5D2LA 4F7MB 4QGYA 5JOPE 4J6RL 2VMFA 3MRNA 5MHSD 3RVWD 5E8OB 1FYTE 2VZSA 5GZND 2APTA 4D2NA 3IAGC 5IQ7H 3FFCB 1JPTH 2BOBB 3C6SA 4P5KA 1DEDA 5DFVC 1MQKL 4L29A 4W68A 1MFEL 1X4ZA 2PXYD 5I1DB 5I17B 1GAFH 1YY9D 3O41B 1F3DJ 2YPVL 5CSGA 4HUWA 3G6JB 4YHPB 4WO4C 4YHOL 4XXDB 4X4YA 1A3LH 2JK5B 4ZOAA 3DVGA 3GSQA 2H8PA 4ZDHB 2NZ9D 1CLZH 3NABL 4LARL 3ZTJG 4WU7B 1F90L 2NY4B 2YUXA 1D5MA 4Y5XA 2QQNL 1N8ZB 2W9EL 4G43B 5D1QD 3NZ8A 4G6ML 4JFPA 2JB5H 2QR0A 4NQEA 3KPMB 1X6LA 1MFDH 4YXHH 2FGWH 4X98A 4GQ9L 1CDBA 5EOCJ 1Z9LA 3CFEA 3PGFL 1NUDA 1FGNH 4O2EA 5I1JH 1GH7A 1JMZA 5DFTA 3LRGA 2X4UA 3HI1A 3NIDF 3RWHB 3IKCB 4OSUH 3TEUA 3DRTA 3DV6B 4JRYD 2YK1H 3CPLB 3TIDB 1P2CA 1I8MA 3W0WB 4NNYA 4JFQA 5EIVA 1C5DA 2OSLB 3HA0A 5DJYA 1KEGH 1RULL 4MWFA 1T66C 1N5YL 1YYLH 1HKFA 1YNKH 5AAMA 3MLZH 4PJAB 3L95B 1WEJH 4NQSB 3T3MF 3FFDB 1OWWA 4WHTB 1NKRA 4KVNH 4XGZA 3MBXH 5KSAD 3IGAA 4XI5D 5AWNH 5F9WC 2CDFB 3RWGB 4HEME 3BAEH 2XZZA 3QFJA 2VLKB 3TESA 2BVUA 2ZOLB 3JVGC 3MZTA 5L2JB 1MREL 2V5TA 5MEPA 35C8H 3U0PB 4YXLL 5IW1B 5C07B 3WDHA 1DANT 1MCOL 4S1RL 2IF7A 3VFSB 5I1KL 1B0GA 1A4JA 1T2XA 3BQUA 5I2IA 4FTVB 2AGJL 1OGAA 5F1SA 3MA7A 4U1HA 1AXTH 3SDAC 2HG5B 5J11B 3OX8A 3LCYA 2UZIL 1E28A 1QLRB 5HHXH 1UXSA 3N1PC 5JXEA 1DSFH 1HNFA 4ZS6C 1WFUA 3NCYP 5ILTL 4Z7WE 4QWWD 1JNNH 1LEIA 1CGXA 4N8CL 5ADPH 4IIQC 1WBZB 3SN6N 1N0LA 4OF5A 1IAII 1XF2B 1J1OL 1IGIL 4XVJH 3Q5OA 4MNQB 1Z2KA 4IOIA 4UDTB 4D9QE 4PRBB 1RZ7L 5AD0B 3OR7A 5ENWA 4WW2F 1VKXA 1RK0A 2P8PB 5L0QB 3KJ4B 1NUGA 4XXCA 1U58B 4E41E 3WFHA 4MJIA 5IFHL 2W07A 4MAYD 1KV3A 3MV7D 3NIDE 4M48L 1MCRA 5EZJB 4HUUA 4QOKB 4CVXA 1U8QA 3RPIB 4NN5B 4B7IA 4BKLB 4PJDE 5DS8A 4NKDA 4UBDC 4UQ3B 2R2EA 5FGCE 3MRDA 3TT1H 2V2WB 3CVHA 3NOIA 4Y5XC 1UT9A 4WGVB 3B2UD 2CH8A 3T3ME 4DUWA 1IAOB 2JIXB 3CX5K 2N7BA 2WINA 3D0VA 3H6JA 1ZMYA 2DI7A 1XCQA 1EO8L 2FSEB 3VI3F 2EH8H 1EEZA 3V95A 3I85A 4ERSH 2AV7B 5F7EL 4G8IA 2HWZL 4OGXH 2XN9A 4WW1A 2GK2A 5DC4B 1CL7L 2VQUA 4JFFE 4LEOB 4YDLC 5F7FA 2NY3C 1J0HA 4O4YH 5CJXA 3MODH 1RIUH 4ODTL 5FM4A 2XWBB 1QFUL 1IM3A 4OZFH 4DGIH 3GMQB 1LHZA 1RMFH 5IOPA 1YC8A 4L3EE 1TJGL 5FECB 2F8OA 3EAKA 2YMXH 5DQDH 1FP5A 3KHQA 2VJXA 3QIBD 3SGJA 3ZE1F 1MRDL 5D5MA 4BZ2H 5CJQL 5KN5B 1U92B 3WHE1 3IDJA 4NUGL 1CFQA 3G04B 4N90D 3KYNA 4PIRF 2FZ3A 4JN2B 3F62A 5HDLA 1YYMH 2ATPB 2G75B 1ZT7A 4Q2ZA 3VD7A 5C09B 3PABB 3ULVF 2IANA 5EU5B 2JB6A 3BQUC 1P7QA 1M7DA 1S9WA 5E8DH 2MCPH 3G9AB 3DRQA 2ID5A 4JM4H 4MJ5A 3CH1A 1AR1D 5C0DA 1YQVL 3R1GH 1YPZF 2W65B 4XRCA 4K94C 2DYPA 1CBVL 3AREA 4LSRL 1KPVB 4YJZL 1IGMH 3GBML 2SEBB 1DVFA 2F5BH 4KDWA 1Q9LB 3PP4L 5JXEC 2DMKA 3EYSL 1UB5A 1CGVA 4J12A 3U9UB 1ADQL 3L7EA 2N7AA 3E2HB 1TDQA 1AE6H 3LPGA 1QO3A 1FC1A 1GXEA 3GMOB 5K93A 1BZ7B 4PJHA 2B8OT 3CFIC 2GHWB 3KLAA 1PKQE 3LEVL 2P45B 1QSFA 1CFTA 4P2QB 1U3HB 1XGPB 2FWOA 5BJTB 1D6EA 5GSVA 4PJGF 3S9DB 1AGCB 4GRWF 2B2XH 4UUJA 4Y1AE 5CZVH 3VI3E 2X10A 1S7VA 1YC7A 3KPNB 4XXCC 4H20L 2DBLH 1PVHA 3FFCD 3MNVA 5JQ6H 3PHOA 3K4AA 2AKRA 4L8CB 3RY4A 2MPAL 4UOW0 4FXKA 2YS4A 1HHIA 4LCCB 4HFUH 5BVPH 4R7DB 4YBLB 2BP3A 3HUJA 1J12A 5DVOA 2ED9A 5KSVA 1MY7A 3VXPB 4YX2H 3U6RB 3H7LA 4OLZH 1K4CA 5MEOA 4GH7B 1NANH 1PJ9A 2NY4D 3HI6L 1MH5A 1Q8MA 5FUZH 5IVXF 4Z0XA 1SYSB 1HCVA 1JPFA 4KXZH 1KG0A 5T3XD 4M1DL 3LKRB 3NFSH 4L8DA 3CVHH 1HKLL 3LZFL 5MEQA 4JHZA 3VE0B 4L8BB 2XQBH 2X1WL 4NM8H 4L1DA 5EH1A 3TWCH 5BRZE 3P4MB 1BGXL 3B5HA 5T3XH 3ULVE 4PJ7A 3W0WD 5CJXC 3MUGB 3I9GL 1JK8A 5C0BB 5EU6B 1T1YA 5EBWB 3D39E 2GK0B 2VRAA 3MRRB 1YPZE 1A64A 3OAZH 1EO7A 2AP2A 4WUKL 4QYOB 1KBGL 2C1OB 2QJDA 1N6QH 1T22A 5HGHB 2OI9B 3PNWB 3SGJC 3FQTA 1OAUL 4G42B 4LASL 2DQGH 5JNYA 5CFHA 1CGYA 4X6FA 5DJ8B 4LDEB 4NJ9H 4LHQB 4DGYL 1MI5A 4OFIA 2H2PC 3OKYA 3TNMA 3RNKB 1KJ2B 4ENED 5T5NF 1GGUA 5C07D 5F3BB 5D9SA 3FB5A 1DBAL 2DMCA 5CEZL 3C2SA 4G9DA 3U7WL 3ILPB 3VXUA 4U1NA 1G7MB 2FX8L 3N1QC 4PJGE 2VDQL 5I8OH 4GRWE 1T7YA 2BVYA 3U1SL 3GO1H 4GFTB 4X7TB 5LAXB 1F02I 4WFFD 4JKPL 5I71C 5IHUL 3AREC 4P3DB 1CIUA 2DICA 3IDMA 1UEYA 5E0QA 1DVFC 1AKJB 3ULUL 1EGJH 1ETZB 3ZKND 4IRJB 5HHVL 3DSNA 4HUXA 3PP3H 4HX1B 4F15C 2FX9H 3QXDB 4I3RH 1HZHH 1U93B 1EIBA 4XVSH 4JR9L 1KJMA 2IAMB 3RPKA 2PR4L 4NQDB 4K3EL 3QPXH 4K7PY 5T33L 3DX7B 4TSBH 1SEBA 1IGFH 3VGDA 3Q6GH 4I0CC 1P84K 1KN4H 5FYJD 4MNQD 3EYOA 3LHPL 3EOTL 4R4BB 5TPWH 3F8UB 1JPGB 2W9DH 4NT6A 4AIZB 4HJ0D 4QT5A 3OV6A 5E5UB 1UWGH 4XNXL 5GGSY 5I1CL 3NGBC 2GUOA 3KVQA 3DUSA 4EJ1C 3WFZA 4GG6E 4PJEF 5I73B 3MZGB 4U1LB 3QO0A 4IDJL 3AXLB 3U4BH 3BDBA 4RQQA 4XHJD 2A1WL 2BNUB 1NAKH 3HKFA 4QOKD 1NCTA 2VERN 1NCDL 2UVEA 4U3CA 5IHZA 1CR9H 5DZNA 1M71A 3AY4A 3EO0B 4Q6IB 4LNRA 2VZUA 3SOBH 4LSPL 4V1DB 4X9IA 2ITDA 5C9JB 1BMGA 1KCUH 2BHZA 2ORBL 1RUMH 2Y36H 4YZFE 5LQBH 4QXGH 2Z4QB 3JV4B 4MJ6B 1QPPA 2H6PA 2OZ4L 3MRCA 5JXAL 5KTEH 2EXWC 4U0RC 1JWMA 2IFGA 4PLJC 4XWGH 4RFEA 1LDSA 4ODVL 4GAGL 3Q5YA 1AD9A 3FRPG 1OB1B 1YY8A 2R69L 3BT2H 2YD9A 4XPHL 7CGTA 1LK2B 1PY4A 4FMFA 1BWMA 3LKNA 3OTTA 4O58L 2VAAA 1WZLA 2XZAL 5ID0B 3ZYZA 1FVCB 2V7HB 3WEXA 2D7TL 1MQ8A 1ZV5A 3GKWL 3GMNA 2A73A 3BXNA 5CIPB 4EZMA 5C0EB 4QCIB 1Z5LB 5B39G 2G9HB 1Z3GL 5JLZB 2XTJB 4TTDC 4S1SL 3DHJA 2UUDH 2VDKH 1B0WA 3RNQA 2FHCA 3G6AB 1A2YA 3P0VL 5DA4A 4HKZA 2R9HC 3D25A 2N4IA 3LDBB 3MLRH 4F7CA 1SQ2N 3H0TB 3TZVA 1OSZB 4JKLA 1P5UA 2VXVH 2EZ0D 5IFAH 3RKPA 3RZWA 4NYLA 4NGHH 4UZGA 2BSTB 3BEWA 5F9OH 5BZWB 1G7QB 1HHHA 1L6ZA 4K2UL 1U8NA 4N8PA 5C09D 4D0BA 3WO4B 5IIEA 1MIMH 5I15H 3QXAB 3RGHA 4ZPVA 3C5JB 3OAUL 5DMGC 3S36L 5DR5L 3SJVA 3TBVA 1E27A 2HH0H 2FJHB 2XY2A 3IVKA 1ORQB 5E95B 1JGEB 5F6HJ 4F57L 4N1HB 2YRPA 4U6VL 2X4PB 1TZGH 5LWYL 4PJEE 3IU4H 2A6DA 2VXUH 1NDMA 3MMEB 5IK3A 2X9XA 5INCB 2HVJB 2R0LL 3UTTE 4N0FA 3V6OA 3MRHA 1KCVH 2XTLA 2YR3A 1OF2B 3VDBA 3WIHA 3CSYB 5EO0A 5FYKU 4E42B 4I0PB 3O4LE 5CMAA 4P2QD 1U3HD 4NZRH 1PZUB 2R29H 1N6UA 1CT8B 5BS0E 4Z5RA 1MWAL 3QO1A 4IEFB 3RA7H 1IAIL 3BH8A 5C71A 3VD4A 5IVZB 1JTPA 1AH1A 4HPOL 4L9DA 3VJ6B 1RU9L 4M7JH 5LBSH 5C0AD 3EGSB 5T1LA 3P9LA 1F00I 3V4VL 3U9PH 1DL7H 3OSKA 4K3JL 1FL5B 3RL2A 4PJFA 3QQ3A 3WD5H 1L7IH 4OGZA 3P4OA 4PJ9A 2VDNH 3FT3B 2VUYA 4U1IA 2XWJA 3QULA 2EDJA 2AVGA 2YD6A 1U8JA 1TZHA 3AY4C 5IBUB 5JW4N 4NBXB 1OW0A 3GSWA 1U95A 3MRFB 1UZ6E 1XR8B 2KH2B 3HAEA 1H9VA 1QFWH 2HTLC 4MQ7A 4XP1L 4B5EA 2Q8BH 1UKQA 3SCMA 32C2B 2AJ3B 1IKFH 4Y16B 1LO0H 3P30H 3BESR 1DQQB 1CZ8L 5ID1B 3MX0A 1G9NH 1JF5A 2J6EL 4JZJA 4RWHA 1ZLVK 4RMSA 3CXDH 5D7KE 5GGSB 2A83A 1C08B 4FQHA 4MA1C 2AQ2A 3FRUB 1NMAH 1DR9A 1X4XA 1S7XA 2C3GA 2HLFC 3DXAA 2HMID 4C55A 3X14B 2FJFB 1GJIA 4Y2DB 3DYOA 2KKQA 5IMLA 1U3ZA 3HZMB 5E56A 1G1CA 1I9RL 5C0BD 1E6OL 1K5NB 5DURB 5EU6D 3EIFA 3QCTL 3CMGA 4X7DC 5JA9A 5F96H 1RHHB 5TF1H 2AEQH 3TYFB 2I9TB 1MRFL 2CDEB 2HRPL 3I6KB 1ZLUK 5HSFA 1HIML 1JBJA 2MHAB 4JVWA 3TZVC 4GMSH 2PO6D 3RTQA 3PQYB 4RAVA 2Y23A 5C8JA 3UBXI 3BN3B 3KG5A 4P5TB 3P0YL 3PWVB 3VXQB 3DECA 5KS9A 1R3LA 5FO7B 1EJOH 4NQCA 2GJ6B 1C1EH 4OZHA 3GSNL 5HDBF 4R4ND 3O11A 2NQCA 4RFOL 1IC7L 3TJEH 2EE2A 5D1ZA 5A40E 3BP6A 1U9KA 3GNMH 3KYOA 3VXRE 3QEHB 2XV6B 2YXMA 1MFCH 5T1DL 5DHVA 3VFPA 1T6VN 2PTUA 1JF6A 1FVEB 3VWKB 4P9HL 5CGYD 4FQCL 1EPFA 5DI8A 1AKJD 2VXSL 4IRJD 5MHSE 5EU3A 5C0JA 3WL9B 3V6OC 3ES6A 1EMTH 3UTZB 2J4WH 2F5AL 3SPVB 3DX9B 3EYQC 1K2DB 2X4SB 5IMMB 2IAMD 5F93C 3P77B 4RA3A 4UT9L 1L9NA 4UT6H 4I3SL 3WHE0 1YMMA 3HC3L 2VL5A 3FN3A 3F5WB 5EN2A 1CD8A 4QF1B 4JLRB 4JFEB 1LK3H 5JO5A 1W0YT 1BX2B 3DX8A 4ZAKA 3NACH 2BERA 4JHBA 2EIZA 4CVUA 5J6HA 1PZ5A 1M6OB 2F58H 1LEGA 1DBKH 2YD5A 3OHXB 4XPGL 3FRPA 4EUPB 4HGMA 5TH2A 5BVJB 1KYOJ 5FB8B 1TMCB 4WFED 2DLHA 4FQLL 1MAMH 4BSJA 4PJ9C 5B3JF 4OUUA 4ONHB 4NCC1 3UYOD 1JZ6A 1OW0C 3QZWB 2FBOJ 5B39A 1D9KA 1IEAB 3PGCA 4ZO8A 4KMTL 5E03A 5IESH 5D72L 1F8TH 2B4CL 5F1NA 4V1DD 5D6CB 2NR6D 3SCMC 3HFML 4P2YA 4JRYE 3TBSB 1V7NL 3R0NA 1V3JA 5HDQL 4P4RA 2EEAA 3VFGL 1EAPA 3RGVA 2YUWA 4JZJC 1IQWH 3NTCH 2G2RA 4OZGF 2CIKB 4U33A 1NBYA 4TUOB 1XF5B 2DQTL 4RGNC 5DSCA 1IBGH 1PFCA 3GJFK 2DQJL 2G5RA 3PWPE 1BFTA 3NZHL 1CDIA 5MENB 2E3VA 1T21A 1KTLB 2YUVA 3LRHA 4KZDL 1NC4A 4EDXB 5T1MA 2UWEF 4JFOB 2OP4H 5HDBE 4H1LB 1Q0YH 5J1AA 3TPUB 2CK2A 1EX0A 5J3HD 4M6ML 2IPTH 2Q6WB 4EIZC 3ZHLA 4U6HB 3K8KA 3D48R 3RWDA 4RGOH 1KGCD 3MV9B 4YHLH 5FM5O 3SO3B 2PCPA 2QSCL 5A2LH 3A67L 3SKJL 4OI7A 2VDPH 2L7JA 3X3FH 2YA1A 1A1NA 1OQXA 4HK0A 3IB4A 2F74B 1OD7A 3ZKMD 3U2SB 5E99H 1RJCA 1BPVA 3RTQC 5E2VL 3FB8B 1T04B 1FC2D 4CMHC 1FDLH 5D2LB 2W92A 3O3AA 4GKZA 1NMCC 1CDJA 1H3XA 2X42A 1X5AA 3HMXH 5E2JA 4J6RH 4U2ZA 3GHBL 4MNGA 4MS8C 3V6BR 1C16A 1HYSC 4Z95L 4OBRA 2Q1EA 5D1ZC 4U1JA 4IJ3B 3SDDB 4XVTH 3C6SB 1YNTA 4L29B 5AG9A 1MOEA 3I2CL 1S9YA 1MFEH 1CIDA 1E6JH 5CGTA 1O5DT 4PB9L 3MA9L 1PX4A 2WP3O 1J1PH 1GOHA 3OXSB 3ZMRA 4B50A 5D70L 3H3PL 5FYKE 3RWCB 3DVGB 2X7LA 4UILL 3U0TA 4FQ2L 2Z93B 3S35L 3MYJA 1GZQA 5F88B 5AZEL 5B3JE 3QEQB 3RBSA 3UPCA 3NABH 5DHVH 1P4BL 5ANME 1DFBL 1D5MB 4Y5XB 1CFNA 5IVOA 4MJ4A 5EC2A 1F90H 4QXTB 1MLCA 5BCAA 5DHYA 3NZ8B 4JFPB 4RGMB 4HQQH 5IQ9A 2W9EH 1ZS8A 4I0PD 4G6MH 1DBML 4X98B 1ACYH 2CUHA 3CFEB 1HSAA 3BOVA 4L8SA 2YOCA 2X4UB 4ZAKC 4OZGE 4DOHB 2EKSA 1VEPA 4IOFC 3VW3L 1CICD 4LLVA 3BGFC 4W6YB 1IAKA 4YDLB 2NY3B 1FPTL 4JFQB 4Q74A 1MFBL 3TM6A 2YEZA 1C5DB 4Z7VB 4RIRB 2LQRA 4XMPL 4MWFB 1DQJA 4Y4FB 3S96A 1FAIL 4L5FL 3TJHC 1N5YH 1QLEL 4LPCA 5L2KB 1YECH 2YD8A 3AMKA 3VDAA 3ZKSD 1D9KC 4M9OA 1IGCH 4DN3L 3OWEA 2E27L 3IGAB 5ESQA 1LE5A 4KROB 2R0ZL 3LQAL 2XZQH 4PJ8A 3QFJB 5L8JB 2ZCHL 4EBQL 1JMXA 2VLJE 3LB6D 3LN5B 1OP9A 3VA2C 2WWKO 4Y16D 5FO8B 3RGVC 3EYFA 1MREH 3BVNA 1W72L 4YXLH 4MA8L 2RAMA 1A7RL 1N7MH 4KTEL 3CD4A 3VI4E 2DF3A 3MLWH 1HWHB 1KPUB 5E4EB 3D69A 4ZPTA 4AEIL 3O3DB 1QA9B 4HBCL 3HTLX 5ADOL 1MCOH 1NL0L 2WBWB 1B0GB 4X6DA 4M43H 4RRPG 4PLNC 3BQUB 5I1KH 5F9JA 4R4FL 1OGAB 3D2UB 4WI5A 3QXVA 1ADQA 2MQ3A 3MACH 1D6VL 3ARUA 2IQAA 4PGDA 4Y2DD 3OX8B 5E1AA 2HLAB 3JWOC 3L9RB 4PJCA 5F6HI 1FCGA 2CLZA 4ELMA 2YD3A 3TPKA 5DURD 1Y18B 1CS6A 4N90E 3KS0H 5HPOA 1ORSA 1RZGB 1HEZA 3TH3T 2BXZA 3KPSD 3RAJH 4OFVA 4RX4D 5D7JA 2VYRE 4N8CH 1CE1L 1T4KB 1JP5A 1YZZA 2P5WA 5GZOD 5HHPA 4DVRL 1N64H 3PQYD 1J1OH 4BELD 1IGIH 2FH8A 2OL3B 2C1PB 3CIQA 1A6ZB 4P5TD 3MRQB 4G8GA 1XIWA 3IU3A 1VKXB 4MA3A 1RK0B 1B88A 1DUYA 1UENA 2GJ6D 1KACB 4PRAB 3MRKB 1YEDA 2Z35A 2BVOA 4MLSA 3EJZC 5TGBA 5IFHH 3VU2A 4NQVB 4JHWH 2AK4E 4M48H 1YEEL 5H2BB 1JGUL 3WYRA 3EJYC 1U8QB 4X7SH 3MJ8B 3E6FA 3A0OA 2Z91A 2P8LA 3BPLC 4P2RA 1XGUB 3MGOA 1A6VL 3VWKD 2BNQA 2HA1A 4OD3H 3M17A 3O6KL 1ZGLA 5JPNA 1QVOB 4PRDA 5DJAA 5J1SC 5IUSA 3L3JA 2VABB 1KXTB 1WFTA 3DVNB 3D87B 1AFVH 3FFCE 4XNYH 5EWIH 2Z0BA 3LEXB 4H5SA 5FHAL 4ZFOL 3QDJB 1JZ2A 4MJ2A 5DVMA 4HS6A 3T0VA 3C9NB 1EEZB 1IT9H 2OQJA 1FL6B 2GSGB 4G8IB 5DEGA 4L8SC 3CU1A 3VH8G 3EOBA 1U8KB 2DQDH 5F7EH 3DBXA 4JFED 3G6JE 1FO0L 1FGVL 1HOCA 4MCZA 5EZOL 1G7JA 3RI5F 4FNLH 3TO4B 4Y5VA 2CXGA 2XYCA 3HPLA 4S1QL 4KTDL 1IM3B 4M7LL 3MBEA 4ODTH 1G7IA 1NQBA 4X4ZA 5KVFH 1QFUH 1EHAA 4WV1A 4OQTH 3AS1A 4ZS7H 3SKMB 4QXWA 4MLIA 1CLOL 1TJGH 5BQ7A 2J1KA 2BRQA 4NN7B 4MYWB 3JUZA 4MQSB 1GZPA 4H8WH 4NP4H 2Q7YB 4FQQA 4PJ8C 3DX6A 1OVZA 4FZEL 4FRWA 3FZUC 3B9KB 4WY7H 3W0WE 1CFQB 4NUGH 3KYNB 4HWUA 3BIKB 1FZJA 3FONA 3U46A 2FZ3B 4GRMA 4WFGD 3QT2A 1RURL 4JGMA 5F21B 2GI7A 5IW3A 2VIRB 4PJAE 1FSKB 1XGQA 5JIKA 2YWYA 5MEND 5HGGS 4MJ5B 1BECA 3MFGB 4U1KA 3ULSA 4XRCB 4AENA 1YQVH 3ET9F 2DYPB 4WCYL 1RZIA 3JV0A 3O81A 3HNVH 2VLKE 2CGRH 2QADC 4LSRH 1UB5B 5C07E 1NC2A 3GBMH 1BVKA 5HHQA 3EYSH 1UB6A 4TQEL 8CGTA 1B90A 1N59B 1QFOA 2AJXH 4JZOA 3MV9D 4QRSA 2R23A 4FA8A 4JPWL 2H1PH 4DFHA 2HT3D 5D7JC 4PGBB 3KLAB 4H1LH 3HE7D 3CZFB 4FTVE 1QSFB 5B22A 1CFTB 4KV5F 5HYQA 3LEVH 4WFFE 3C5ZA 2X1QA 2H26A 4NQUA 4WEBH 4U49A 5HBBA 2RCSL 1CE6B 2XA3A 1YEJL 2NY2D 1T5XB 3P9MA 3QUXA 5CJ5A 1XIWC 5HI5C 5GRJL 3MUY1 3SE9L 5DJ0B 1LO5B 3DV4B 5D96B 3HE6A 5F1KC 4POZC 2QKIA 3PHOB 2AKRB 1VB9A 3SDDD 1JI2A 3F58H 3VGFA 4FXKB 2JLLA 1MJ8L 3VA6A 2LAAA 2HJKA 5J06A 1CXEA 2R4SL 2HRLA 1KTKE 3BZDA 2OZ4A 1WISA 4UBDD 5FYJE 4MNQE 4C59B 4RISH 3O2DL 1NH6A 4TUKL 3QH3B 3QEQD 3MNZA 4XTRC 1ZA6B 5INDA 3RU8L 1J5OL 2DAVA 3HI6H 4GKNB 2RBLA 3D18A 5FCUL 1UKSA 1JPFB 1NCCH 5T3ZL 1EVUA 4XC3H 2EKJA 4LMQE 4M1DH 4QOKE 3OR6A 4MZ2A 1JV5A 3LZFH 1X5JA 2HP4A 4AIOA 2DMBA 5ELIA 3SEPA 1A6AA 4DKEH 1DZBA 3EFFB 2E7MA 5CP3A 3VXTA 4L4TA 4Y5VC 2NY6C 5DK0A 1VACA 5C08B 4RRPA 2QQLH 4G6FB 3QHZL 5FUOH 1XGRA 1QBLL 1T1YB 3MBEC 4Y4FD 3T4AB 1S78C 2FLRT 3N85L 4WV1C 4LGRB 1H3PL 2NY0C 4WWKA 5L2KD 2V17L 3ARYA 2F53B 3LN4A 3OF6D 1SM3H 3QFDA 4KROD 4H26A 4LASH 4XAKD 4QRPA 2BDNL 5J57B 5JTWA 2X4NB 3U0WL 3UTPE 5D7SL 3L3GA 1TITA 4PR5A 1NAMH 1AQKL 4PGZA 3VFOA 2V6HA 1NCBL 5D9SB 4KJWC 5D93C 1K85A 1I7RB 1I1FA 3MXWH 1UXWA 3KNBA 1S3KH 4G9DB 5CEZH 4HWEH 4ORGB 1NUNB 3OKNA 4HZAA 5DTFA 5DUPL 2R4RL 4U1NB 3VXUB 3CZJA 2DQHH 4KHXH 5JIPA 3U7WH 1T7WA 3I84A 2FX8H 5ERWB 2VDQH 2X4QB 3D9AL 3U1SH 4YIQB 3ULUC 1OGAD 2AJZA 3D2UD 3IFOA 1A9BA 4LCWA 4UIKL 3M1BB 1MJJA 4ZOEA 2ZUVA 3X12A 3ILQD 5CCKH 1KULA 2EH7H 1JUFB 4HXBL 4JKMA 3BEVA 1NDGB 1BF2A 2DI8A 4NRYB 4HUXB 1NLDH 3A6BL 3SKNA 3QUZA 4PBWD 4HKXA 2F15A 4M4RA 5HI4D 1RK1A 5C09E 1T5WB 2DLEA 1MWAA 1WC7A 3V5DA 3CCHB 4FQXA 4KDTA 4ZUSB 3C5ZC 1H8OA 3EUUA 4K3EH 1W8OA 1SEBB 5CD3B 2AEIT 5T33H 3EYOB 3QUXC 4KKCC 1D7FA 1J86A 5ICXA 3LHPH 1C12A 3O3EA 5DJXA 2E8YA 4LLUA 5AYQA 3AM8A 5CJBA 4GT7A 1AD0A 2ZCLH 3HE6C 4QKXB 1I1YA 4FG6D 3B83A 5I1CH 3ARGA 2R8SH 1ZA3A 2A9NL 2C7UA 3V5KB 1GVIA 4IDJH 1QSEB 1SJHA 3WNOA 2A1WH 4LSTL 4P2QE 4AH2B 1L0XA 3D5OF 2VL4A 2ARJQ 1U8MA 4OD1L 1WCBA 5FCSH 1VESA 1VGKA 3PIQA 2J6EA 3VXNB 4G6KL 4J4PA 3ZLQC 4GAFB 4HV8A 4K8RL 5IB1A 5IMOA 1OHQA 5FK9B 4P2OB 4HIEA 2ORBH 1F6AB 2CKBB 2H6PB 4S1DD 3MRCB 2OXHA 3U30C 4F7EB 3QDJD 4P49A 4YPGB 1Q9OB 3ULVL 1ZK9A 2AQ1A 4AL8L 4JO2L 1B6DA 3NPSB 1AD9B 4X80H 3BRFA 4EIGB 1YY8B 1SY6L 4O9HL 4OJFL 3WN5A 4MA1B 2NXZC 2R69H 1GIGL 2KUTA 3LKNB 2B1HH 5CP7B 1A8JH 3L3KA 3ZE2F 1WAAE 1AQDB 3TO4D 2B1AL 5JDSA 4JQXA 3RL1A 4WI9A 5E5MA 3MRIB 1MLBA 1Z3GH 4WWKC 5FYLL 2XKUA 3KYAA 4LVNB 4ALAH 4S1SH 2VISA 5E6ID 5JW4R 3AUVA 3RNQB 3KPQA 1SEQH 1A2YB 2O5XH 4FP8L 4NKMB 1LO2L 1BD2B 3D25B 2DD8H 3UAJC 2GSIA 4WFHD 3R8QA 4TSAL 3QDAA 1TJHL 1IMHC 3RJQB 3GSNA 4OM0L 3B9KD 1R5VA 3VRIA 5T1KB 4NYLB 4OIIL 1DE4A 2A74B 2VB5A 2BCKA 4D9LH 3NBNA 5C0BE 5LG1A 2HJFB 2GAZB 2PETA 5J9PA 4J8RA 4MD4A 1HHHB 3F6LA 4GAYA 3V7AG 2MQCA 4TPRL 5HI3D 3HLAA 5TE7L 4KKLD 4Z18A 3BP5B 5EOTB 5IIEB 3TVMB 4X6BA 1L7TL 2GIYA 3JV6B 1GGBL 1KCSH 4K23L 3OAUH 4UV4H 3DNKA 3S36H 4PLKC 2AJUL 5C0CA 3EYVB 4PP1C 1TQBC 8FABB 1OLLA 4NZJA 2BXYA 1Z9MA 4KRPC 3BP4A 3E1F1 1NDMB 1U8OB 2LE9A 2P7TA 4HS3B 1B2WH 4OTXL 4WU5A 5DMIL 5LWYH 3LD8C 3UC0L 4JHAL 1NFDA 1U8PB 1GOGA 4NCC2 5J7CC 2R56L 2R0LH 4N0FB 5DJCB 1KSRA 1NFIA 1K8DA 3QUZC 4OCWL 4ZO9A 4LBEA 2DDQL 1K4DB 1FNAA 4OB5L 1W0VA 2VKXA 1JNHA 5EO0B 4F7PB 3ECBA 1IQDA 4FQXC 4LVHC 3OGCA 4MXWL 3S7GA 4KDTC 2J8UF 1WBXA 5HYJA 5B21A 5JHDB 3VRJA 1TTGA 4ZFGL 3QJHB 3QO1B 1UZ8A 3DYPA 5IB3B 2QQKH 1MWAH 3AM8C 1IAIH 4NO5B 5C7XL 4GLRI 3UO1H 3E3QE 3I50L 3VD5A 1IARB 4HHAB 3NAAL 4HPOH 4V2CB 5T1LB 5I1HL 3ARGC 3QIUA 1RU9H 3P9LB 2YPKA 1KXVC 1C7SA 1G6RB 3MGTA 2GT9B 4OFKA 3DARA 5DQJB 4B0MM 3T0EB 1CTOA 4PJFB 2IGFH 4K3JH 4NQDE 3ZE2E 2Y6SC 3OJDA 4U1IB 2XWJB 3QULB 3MNWB 1LP9A 1TZHB 4KQ3L 3HCVA 1QNZL 1JRHI 3HAEB 4J4PC 1SMOA 3GJFB 3UTSA 1KYOK 3QUYA 4P3WA 4XP1H 3X13A 1EHNA 3WUWA 1BIIB 5TDOA 4GS7B 3RDTA 3B2VH 5DJDB 4JZJB 1CZ8H 3HG1A 1BJ1H 4WFEE 2DQIL 2I27N 4BSVB 4L3CA 4RGNB 3IDNA 5BO1L 2ICWA 3VXSE 3WN5C 3IRPX 2MNUA 2X4TA 4LPVA 3SBWA 4KZEL 3GZKA 4V1DE 2O5YL 2ADGA 2HFGH 2B20A 2ADIA 5E8EB 5C08D 5F3HA 4G6FD 4JQXC 3S5LG 4OCNC 3QCTH 4NNXB 4OLEA 3LVEA 5HYEA 5JHLL 2F53D 2C3WA 1A9EA 1WCQA 2X9YA 3WLBA 1BREA 1WUNT 4EI6A 3BP7A 1PY9A 2R9HD 4L9LA 2O93L 3NPZB 1HIMH 5DFWH 3E0GA 3TBWA 4Z7OF 4AG4L 5IEKA 2YC1A 3N1GC 3QQ4A 4AM0B 5DLML 3C08H 3BKML 3NFPA 3PL6D 3R4DA 1MCCA 5KS9B 3P0YH 1CGSH 3IJYA 4ONGL 2XTJE 5C0GA 4OCSL 3H2WA 4OZHB 2R1XA 3VXUD 1KGCE 4AIXA 3QDMD 3QXUA 2H45A 3PXJA 5JMOC 4P9HC 2JCCB 3BZ4B 3BP6B 4RFOH 1IC7H 1OCWL 1BP3B 3KYOB 4NKOA 3IDXL 4S2SA 3VFUA 1IGYA 2ICES 4OLXL 3STLA 1NBZA 5T1DH 3GMMA 1P1ZB 2D31A 5JA8B 2ZJSH 4ZTPL 3G08B 3HPJB 5DI8B 4CBPA 3F65A 5LXGL 2VXSH 3L3HA 4Y4HB 1RV6X 3DMMB 3Q1SL 3UBXG 1MCHA 5FO9A 4R8WH 3C60D 3T0WA 3QUML 2F5AH 4Y4KD 4PTTA 2MFNA 5IHBA 2GCYA 2OTWA 4NC1C 4X6CA 5DJZB 2G60L 4LP4A 3RVVC 4I3SH 2VL5B 3FQNA 1KIRA 4XCNA 5EN2B 1UVQA 2NX5D 2LTQC 4PS4L 4PP2A 4LRIA 3QIUC 1LILA 3BWAA 1LEGB 5DF0A 5KSBF 3PUCA 4YHIA 5TH2B 4XPGH 3VGAC 4Z76A 5E70A 2B4CC 2AJVL 1IFHL 1ZHLA 1K3IA 2DQFB 1M7IA 1UCBL 5B8CA 1QSED 4QHUB 4FQLH 5DZOA 4OUUB 4YAQA 2X89D 5DD5L 4U6TA 3THML 1F58L 4FFWC 4A6YH 1W0WA 1W72A 1CQYA 4O51A 4XBGA 4XPBH 1U91A 5D72H 2B4CH 3QUYC 4APQA 1ZOXA 1PLGL 3WLWD 4P2OD 3ZKQD 3L5HA 4NZTL 1ES0B 3HFMH 3RDTC 4P4RB 1V7NH 5HDQH 1EAPB 2BRRH 1ZLVH 4IMKA 4LK4A 2YD1A 3GSRB 5I8EA 2L4OA 3B6SA 4Z7OE 1U8IA 5EU4B 2VDOL 2DQTH 4GQPH 1A1OB 1QR4A 2OJEA 4Z6AT 1I1AB 3QDGA 4FXGB 4PB0L 2DQJH 1OTTD 1IGJA 3NZHH 1NC4B 3SBWC 4BQCA 3DROA 2WIMA 4RZCB 4KZDH 3IFLL 2APXA 1R6VA 5IV2B 1IVLA 5J1AB 4WTXA 2C3HA 4IDLA 5FUCC 4QLRA 4RBPK 5J6GB 3L6FA 5TDPB 2W60A 4P3CL 4OGAC 2Y72A 4G9FB 3L1OL 1ZLUH 2D7MA 1QLFA 1JPSL 2X1OA 3SKJH 1JWUA 3QG7L 1TVBA 4L9LC 1BD2D 4PJBB 3BDYL 5D7IF 4M5ZL 2W0LA 5E2VH 1K3ZA 2JF1A 4OUOA 5T1KD 2AV1A 3PGDA 1U6AL 3QI9A 3WKML 5EO1A 3CFKA 4KDVA 3ARVA 1JPTL 4Z7UF 4ODHH 3GHBH 1QEWA 4JAMA 4YHMH 4ZUWA 2LABA 4WUUA 2V7NB 3HZKA 3DO7A 2A6IA 3TVMD 4MXQC 4Z95H 5K9OA 1YNTB 4QEGA 5E1HB 3C5SA 1AP2B 1GAFL 1S9YB 2OX5A 2QBWA 3I2CH 5JW4Q 3AS3A 1CQKA 1KIPB 4LMQI 4PB9H 5IGXH 2CJUH 2H41A 3PQYE 4QRRB 2XT1B 4YPJA 3QJFB 4ZFOA 3LS5H 1YEHH 4Y88A 4P5MA 3S35H 4Q9CA 4GKSB 2HTKC 2K9UA 5AZEH 3RIAK 2XKSA 3BJ91 1KTDB 2GJ6E 1F3DH 2JB5L 1G9ML 1P4BH 3OKLA 1MHHA 1BHGA 2E6QA 4OFDA 5IQ9B 2BOCB 1R3IH 1BFOA 1YN6B 2IMNA 4JM2A 1CGUA 1FO0A 2MSPA 4UAOC 2FD6H 43CAA 5HYFA 5JHDD 3FHAA 2ZKHL 2ERJB 5CZXC 3TV3H 1DBMH 1SJEB 2BSED 1CXHA 5HD8D 5EUOB 1X5HA 4OSUL 4CL7A 3LY6A 4YDJB 4N0UA 5IB5A 1BFSA 2EKSB 1UH4A 3IDGA 4LRIC 4F33B 1ZVSA 1JN6A 1IAKB 4MNHA 3FQXB 3VW3H 1KEGL 5J13B 5EOCH 3MLYH 1T3FB 5D1XA 1FPTH 1YYLL 5D2LF 1MFBH 4Q9BA 4V2BA 3MLZL 3T0ED 3S96B 5ITBL 1YDPB 1WEJL 5B8CC 4PJXB 1F97A 3LQAC 2KBGA 1GGCL 3QHFH 4L5FH 2EE6A 1CF8L 1YMHA 1WFNA 4F7TB 4HULB 4K7PX 3L3IA 4KI5D 2P42B 2P8MA 2WUCL 1CFSB 1NGYA 4CRPA 1MF2L 4MAUL 4DN3H 4LLMA 5ESQB 3W2DH 2XPGB 1LE5B 4JFEE 3TCLA 4NO0A 3SE4A 4APQC 4PJ8B 2PTTA 2VN7A 2R0ZH 3LQAH 2FIKB 3IAPA 3JWDL 3B9AA 5ISZA 4DGVL 2A77H 3FMGH 3EYFB 3L3DA 4YLQT 4F8TA 5FA3A 4J3OC 4IMKC 4LPYA 1U8HB 4NOBA 1W72H 2P1YA 4MA8H 3PHQB 3VFMB 3VFVB 1KT2B 1WZMA 1MCWM 1O7SA 3GJFH 4RGND 4X99B 2P4AB 5DD0H 3MRLA 4HBCH 2HT2C 1NL0H 4M1GL 2CIIA 1AXTL 3MCKA 4HF5L 4HUVB 2DJSA 1I9IH 4R4FH 1XGYH 2BFVH 4X7FC 4WGWB 2WIIA 3VXMB 4PGDB 4N8VG 4R7NA 5JOPD 5E1AB 4A2LA 3O8XA 1D6VH 4BFIB 2R2HB 5HHXL 3QA3A 2CLZB 2QADB 1JHKH 5ESAA 2NY7H 4U2YA 2FEDC 1ORSB 4OFYA 5FF6A 3U36A 4ODWB 1JNNL 4WFGE 4L4VA 3BN9D 5BZDB 1CU4H 3UYRH 5SWQA 4Z7VF 1ZSDB 5C0NC 3S4SB 1BQUA 2FECL 5MENE 4XBEH 1CE1H 1TCRA 3RZCA 3ARDA 2HVKB 3PV6A 4H0GA 5FGSA 4DVRH 3QI9C 5BXFB 1HHKB 5CJOL 1W8NA 3MLXL 4MCYB 5J8OA 5DK2A 3IU3B 3VFWA 3O45A 4KKNA 4TUJB 4MS8D 4YUEL 3MV9E 2Z35B 2BVOB 4OV5A 2AXHA 1BOYA 1AO7A 5TGBB 5KOVC 3RUGF 3KXFA 3ARBA 4MSWA 1PG7W 4LAQL 4RMRA 1KPRA 2Z91B 5B38B 4P2RB 3L3OA 1NGWB 2FO4B 3EO1A 5BRZB 4HK3N 5D2LE 5F72S 3KGRA 4X8JA 1I1CA 1NSNH 3F6IA 3G5XA 4K3DH 4JFFA 5DXWA 3O6KH 4F2MA 4Y4HD 3G6DH 5D8JH 1S7WA 1N2RA 3DMMD 2ITCB 4U6XA 4AEFA 2XA8L 4X5WA 4DKFH 1S9XA 3D39B 4ODXA 1D5BA 5F7DA 4F37F 3QCVL 2YUZA 1DBBL 3GFUA 4D0CB 4JM2C 1IEBA 5FHAH 3K2UL 2EH8L 1J87A 4L3EA 4ERSL 3MLUL 1Q1JH 4U6YB 4OGXL 2OQJB 3OKEA 1EFXA 1CD0A 1R24B 1FGVH 4ZXBA 1ZANH 1R5WA 2VO5A 4LEXL 3F7RA 5IJVA 5T5NG 5D1XC 1RIUL 4Y5VB 3TBYA 1FNGB 1RMFL 1IC1A 1UQSB 3DURA 3GM0A 1F42A 2WBJB 2WWMC 2XICA 1M7XA 1DUZB 2YMXL 4WV1B 3RVTC 4PRPB 1TETL 5EZLA 4YHYB 3RVUC 3WFBL 4BZ2L 3C8KA 3SE4C 1S7QB 4U1SB 4WW2A 4ZMAT 4DOHE 5IWLA 1B4RA 1U2HA 3BPCB 1PG7L 1NKOA 3KLHC 3V4PH 1JRHL 5IF0B 4H25B 3IDYC 1C8PA 5JR1H 2G5BB 2EDOA 3MPCA 2P5EB 4Z7VE 1FZJB 2YWZA 3KLDA 4GRMB 3CFDB 2W0FB 5DGQA 5L2KE 2MCPL 1XGQB 4JM4L 2Z31A 2AK1H 4P46A 5GHWH 1I1AD 2VXQH 5C6PB 1XR9A 2GTZB 5KVDL 3SDXA 4U1KB 1BAFH 3MR9A 3O8XC 3WNLA 4XAKE 1IGML 1RZIB 2F5BL 3ZHDA 3QFJE 3T65A 4LL9A 4D9QD 2WUBL 4WCYH 3S37L 3MLPA 3QNXA 2NXYB 3X11A 5CWSB 1TLKA 4NHUB 4TVPD 2A6JB 5JOFB 4JZOB 1QD0A 5E8NB 4TQEH 4G9FD 2R23B 2AJSH 4R2GC 4M1CD 3FT2B 2EDFA 4ODSL 4JPWH 5ESVB 4ODUA 5ACZA 3GUTA 3AROA 5HYQB 3RZCC 3ARDC 1OGAE 3C5ZB 1N3NB 2H26B 3QWRA 4MVBC 2VDLH 3S3PA 4F3FA 1J8HB 5CZVL 2RCSH 2GYSA 5MI0C 3PDOB 2DBLL 4P4KA 1TPXB 5GRJH 2NW2A 5JQ6L 1NGXB 4XBPB 3SE9H 1LEKB 4HKBB 4NSKA 3V2AR 1KOAA 3RI5K 1WSST 3Q3GA 3BI9X 4ZFFB 5HGDA 3WIIH 4RSVA 4HFUL 5BVPL 1E0OB 5JIIA 3CFJA 3ARBC 1MHCA 4MXVE 4OLVH 1D5XB 1MJ8H 4YX2L 2HJKB 1IAMA 2EYSA 2ZG1A 1OTSD 4OLZL 3K1DA 4QRRD 2UY7A 3KPRA 4UNUA 3QUKB 5LGKA 3QQ9C 1F4XH 3O2DH 2EDQA 2O5ZL 4TUKH 3MNZB 4Q6YA 1EEUA 5INDB 1U41A 3VFNB 1SY6A 3D18B 4YK4C 4Q97A 4M8QB 3MV8A 4JO3L 4NN6B 3VCLA 3U30B 3NFNA 1YPZA 4MMXC 1CCZA 4NM8L 1KLUA 2W38A 1EDQA 5EA0L 3OR6B 3TWCL 2O61A 1BM3H 3L5WA 5FM8A 1AC6A 2XY1A 1A6UL 1N5AA 3INUH 3V0WL 2NXZB 4FOMA 1AGDB 4UDUA 4ZXBC 5T3XL 3VXTB 3ZT6A 2OS7A 5F1OB 3FQRA 3TCXA 1UWEH 1JCKA 3IXAA 5I8CA 4K71C 1G84A 4IRZH 1XGRB 2VLLA 5HJ3B 2FR4B 1K8IA 1X5LA 4N9GB 1I9EA 3RX7A 3N85H 3QDJE 4N8VA 3DOSA 3S88L 4PJGA 1N6QL 4RAUA 2NPLX 3CUPB 2V17H 2GFBA 4PGCA 4NJ9L 4LVOC 5GS2D 2XN9E 3OJ2C 3QFDB 1S7TA 4WW2C 2EIDA 4H26B 5AZ2L 5IWLC 5F7WC 2OCFD 1Z0NA 1F6LL 3LH2L 1A7QL 4MZ3A 3BGMA 2GITA 2ZSWA 4PRIA 5D7SH 2HN7A 2X41A 3OBAA 5E8PB 4D9RD 4UIMB 2Q87A 1T1WA 5GS2H 5I8OL 5TQ2L 1T80A 3GO1L 2Z31C 2IPKA 4P46C 1R5IA 5DUPH 43C9A 1RSFA 2AEWA 3O4LB 1YJDH 3BD5A 3BFOA 5F8QC 3V5HA 5FV1L 2L0DA 3FO2A 4I4WA 5EIQA 4D0DB 4HWZA 4HIHB 3VXMD 3GBLA 1A7PH 1A9BB 4WFHE 3GEWB 4LCWB 1MJJB 3X12B 1TQBB 5GS1A 4LLQA 3VMPA 5IVXA 1T89A 2XG5A 5E2TH 1EGJL 1DLHA 5I6XB 1HSBB 4HXBH 3H9SA 3F12A 1T20A 4LFHG 3GMPA 1J88A 3U4AA 3A6BH 5K9KA 3QUZB 4HKXB 1SYVA 3CK0L 3MTRA 1WC7B 3B5TA 1NEZB 3GGWB 4UV7L 1NCWH 1A7OH 2AEPH 4KK8C 1UCTA 3HHRB 1HINH 3U83A 4ZUUB 4W4OA 2W9DL 3D85B 3BPNB 4FMKA 3T4YB 3LIZH 1CD1A 3R0MA 2ZUSA 3O3EB 4P4KC 5DJXB 1T1ZA 3WUZA 4EN3A 3JZ7A 2BVQB 1I1YB 2BSRB 1F3RB 4M61A 5FYJL 1ZHNA 2NTSP 3U4BL 2D03H 2H9GA 4GBXD 4OD2A 1NBQA 3NCJH 4I5BA 1A4KA 3DIFB 1OARL 1VA9A 3EKCA 1QSFE 1CR9L 4K8RC 5I19H 3C87A 5DUBB 5I8KL 1OWRM 5BRZD 3SOBL 4QTHA 5FKAB 1WWAX 1WCBB 1L0YA 1KCUL 3PIQB 4K3HA 1HQRB 3RIFF 4YEFA 2BX5A 5LQBL 3ULVC 5F7HA 1BEYL 4G6KH 1INDH 4HV8B 1MSPA 4HIEB 1OGTB 2H32B 4K8RH 3KAAA 5KTEL 3D39D 5EO9B 2DIBA 1FCCA 3U79A 4LPWA 1R3JA 3BHBA 1H15A 2I25N 4UNVA 3LV3A 1AIFA 3W81A 4S0TD 4GUPB 4O2CB 3ULVH 3IT8D 3LPFA 4ZQKA 5GGTL 4QY8A 4HEPG 3WN5B 5F7MC 4EKXA 1S8DA 4YFEA 3EHBC 1SY6H 4O9HH 1A14H 5KVEL 1H5BA 3MOBL 4K55A 3L3KB 3O3BA 3RHWK 1CK0H 5DDHA 4JGUA 1J05B 4HH9A 2B1AH 4PY7A 3RL1B 3FQWA 1RD6A 2I07A 4QRUA 1TIUA 2WBJD 4WTWA 4JB9H 4I3GA 4PRPD 4J7RA 3BW9A 3KPQB 3MLRL 1N0XL 3VFRB 4EQ2A 1FORH 4FP8H 2GSIB 3VWJB 2VXVL 1KJVA 1HHGB 1UM5L 5IFAL 1DQLL 4JFYA 1PYWB 3GSNB 4TSAH 4OCXH 1OAQL 1TJHH 4GRWH 2YRZA 4OM0H 2BCKB 3J7HA 4LQFL 4OIIH 2P5ED 3SE8L 4HGWA 3UTTA 3GIVA 4GAYB 3HLAB 5I15L 2YBRA 5TE7H 4DCQA 3W9DA 4KJYA 4X6BB 1BZ9B 1HH9A 5DA0B 2HH0L 5FKPB 2F53E 2NY5H 1L7TH 4TRPH 1GGBH 1NLBL 4EQ3A 5GS1C 5BS0A 4LLWA 4TSCL 1T89C 2VXUL 2X4OA 3QUMA 2NXYD 2P7TB 3REWA 2EDTA 4LKCB 1KCVL 2KZWA 5DMIH 3MC0A 3HB3C 3UC0H 4YFDB 4DZBA 3WNNA 4KK9C 4OCWH 4DJMA 1F11A 2AXGA 1RZKL 2DDQH 1BJ8A 3VXUE 5F9DC 1JNHB 4NO3A 5AUMB 3ECBB 1IQDB 1MFAH 1KEMH 4K7FB 1MRCH 4Y19A 1Q9KB 4XB7A 1INEH 3VG0L 5IKCA 4MXWH 1FNEA 2J5LB 3RA7L 4W4OC 5FDWA 1SBSH 4WTZG 1J8HD 5BV7B 4ZFGH 3SDCB 2E5EA 4N68A 1Z0MA 4EN3C 3R8BB 4NBZB 3O2WL 1YEIH 5C7XH 1XF3B 1IZJA 1P7KB 3NAAH 4KKAD 5HYSB 1DL7L 3DTXA 4KGJA 3TNNA 1PQZA 5I1HH 3O9WB 1B4JL 2X5PA 3VGAB 2VDNL 4KKBC 4FQIH 4JY4A 4W4NA 3PWPB 2V2XA 2I9LB 3LKPA 5EUKA 3HCVB 1KB9J 4KQ3H 1QFWL 4Q0XL 5C0IB 5I6XC 5F71A 1QKZL 3ARSA 1IKFL 1LO0L 3P30L 4MX7A 5HGBB 3X13B 3MJ9L 4U0QB 3H3BC 4CGTA 3WUWB 1G9NL 5TDOB 3RDTB 1H3UA 4UU9A 5A43C 3CXDL 4JDZB 2IH1A 4LOUD 2ZUTA 1HXYB 3VGBA 3NCMA 5LGJA 4XMLH 4L3CB 3NA4A 1AJ7H 1NMAL 2F54B 3MRJA 4UT7H 1UKTA 3DUHA 1OTUD 5J0BA 2D0HA 1QG3A 1H5BC 1TZIA 4G6AC 5DRZB 4NHCH 2X4TB 4X5XA 2PYEA 1RUPL 2NMSA 1A1MA 2ADGB 4FFVD 4KZEH 1XH3A 2ADIB 3EOYG 5F3HB 4D3CH 1HI6A 3BDXA 4X4XA 3N50A 2RIKA 4XWOD 1VFAB 4TULL 3IFNH 5FDYA 3T0XA 1RJYB 1JFQH 3NMEA 5A3ID 2IG2H 1P4IL 2CO7B 5JHLH 4EI6B 3P4NA 2FHBA 4L9LB 3VRLF 2YPLB 3TBWB 1KENH 1BIHA 2YC1B 3QQ4B 3ARFA 1EJOL 4HIIB 4KI5F 5DLMH 5DC0A 3CX2A 3BKMH 5GS0D 3VDCA 4JKWA 5DO2C 4GW1A 1A5FL 1NGQH 2NTFB 3NH7L 2OJZH 4PJ5B 3BRDA 4ONGH 1J1XL 1U3YA 4OCSH 1K6QH 3F7YB 3UTQA 4YDVB 4NIKB 3QRGL 4G7YH 4NM4H 5SX4H 4AEEA 3O4LD 1OAXH 3CDYA 1BQHG 1BD2E 3K3QA 2CK0H 3VFUB 1AXSB 3HZYB 1M05B 3STLB 3IDXH 3GMMB 2D31B 4OLXH 1LNUA 5GISH 4CMMA 3P2TA 2A0LC 4ZTPH 2IJ0C 1EMTL 4JDVA 2DKSA 3L3HB 4R96B 1MPAH 5LXGH 3QUZD 4JVUA 4J3TA 1J11A 4WIQA 3GJEA 4UT6L 2PYFB 3QUMH 5GGUA 3WFCL 3BKJH 5D1QA 1E4WH 2GCYB 2OTWB 4X6CB 2IBBA 4N0RA 2VR5A 3SJVE 5GGRB 2DKMA 3MO1B 1KXQE 5TDNB 2G60H 5EC1A 3FQNB 1KIRB 3D85D 5ACLA 1UVQB 2ICCA 4QHNB 2R1YA 2B5IB 1MUJA 4NUJA 1DBKL 4PP2B 2DI9A 4JRYA 3BWAB 3TIEB 1M1SA 4PS4H 4M8VA 4BZ1L 4YHIB 4FFYL 1MAML 2WQRA 4LLDB 5D7KD 2XNAA 3FJTA 3DYMA 4KJPD 2BY0A 5KS9F 2IALA 4LPUA 1IFHH 4RNRA 1JWSA 3H9ZA 3M8OL 5JHDE 3B3IB 4OZHF 1JYXA 5IJKA 4M6NH 3JTTA 4M7ZC 4YQXL 3WJJA 4XCEA 3THMH 2JCCF 1F58H 4O2FA 1GC1L 4ESKA 3PWUB 2WK2A 1G1YA 3NCYS 4OF0A 1PLGH 3PJSB 2C3VB 4HGKC 2BC4B 3K74B 1CLCA 5F44A 3REVB 2PW2A 4MDJA 5FIEA 3VRLE 1GSMA 1I9JL 1IBGL 4PJFE 5KG9A 2Z92A 2D7QA 3LPWA 2CLVB 3M45A 4K9EH 3PWJB 1LE9A 4FQ1H 5B4MC 3DUUB 4KI5E 3UMTA 1WT5A 5DQ9A 4DAGH 4XPAH 4PB0H 3DROB 5F1IA 3WMSA 1EXUA 1WBYA 1FIGH 3D0LA 1S5IL 3IF1A 2IPTL 5AEAA 1F5WA 3F7VA 3L6FB 4YHLL 1REIA 3I02B 1JGVL 2W60B 4X5LA 5IBLD 3X3FL 3HR5B 1G6VK 5DMJB 4P3CH 2V5SA 2EYRB 5IM7A 4H0IA 2P48B 4RGNE 5SV3A 1JWUB 1ZLSL 3WFEH 4EOWL 5GIRB 3VXRD 1TVBB 2AK4B 3C2AL 3OJVC 4HC1L 5I1LA 1Y6NR 3QG7H 3TBTA 4E5XB 3VWJD 1FDLL 4PBXA 1KCKA 4E0RA 3BDYH 4M5ZH 4ZUTA 3HMXL 3MLSL 3S34H 2AV1B 3QI9B 4JY5L 4NDMA 3RX8A 2Y9RT 3RVWC 3E8UH 1U6AH 5D7LA 1X7QB 4GXUN 1E4KA 3CFKB 3UJIH 1I8KA 5GZNC 3UPRB 3WKMH 1R3KA 4KK5D 5ANMA 4CJ1A 4ZUWB 2ZWLT 4XVTL 4WUUB 3HZKB 3DO7B 2A6IB 4DEPB 4HFWA 4MAYA 3LKOA 1ZHBA 1E6JL 3K81A 3MV7A 4P99A 1HH6A 4IHOB 4I13B 2PXYC 3KWWA 1J1PL 1YY9C 1I8IB 3WNMA 4Z7WF 1IGTA 3P11H 4MQXD 4MA7L 1G9MC 5CEYB 4ACPA 3HZVB 4OZGA 3TYGL 2OXGA 2BVPB 5HGAA 2NZ9C 3FT4A 5KS9E 4U7SA 4I1NB 4OZHE 3HC0A 4HQQL 4YHNB 1XF4A 1MHHB 5D1QC 1G9MH 4HG4J 2JCCE 1ACYL 1BFOB 4OFPA 1FO0B 4JDTL 2UWEA 5EBMB 43CAB 5I75B 1DLFL 1IL1A 2PW1B 4J3VA 2ZKHH 1AHWA 2YKLH 3G5YA 3SDCD 4OZFA 3CFBA 3KLSA 1ZVSB 1JN6B 4PJBF 4XNQB 4PJDF 5D1XB 4GW4B 1DQTA 4CVZB 3AB0C 3O9WD 1XEDA 2APBA 1YECL 4JFDB 5A2FA 5ITBH 4LLYA 1KIQA 3DI3B 3PWPD 1IGCL 2BVTA 3JWDC 1GGCH 4M3KB 5IJKC 3SKOB 1CF8H 3DVFA 2P8MB 1YMME 2FYYA 3GIZL 3WJJC 4XI5C 5IFJA 2XZQL 4FFWD 2WUCH 4G8EA 1JHTA 4NO0B 3GBNL 3QIBA 1JZ3A 1MF2H 2QL1A 4MAUH 1AI1H 9CGTA 4U1GC 4DN4L 1INQB 2DJUA 1K9TA 4YC2B 2IADA 1S5HB 5F89A 5L7XH 3JWDH 4G80B 2Y5TB 1N7ML 5IB2A 3P3YA 4DGVH 5FA3B 2NNAA 3MLWL 1DN2A 1ND0B 3P40A 5H35B 1RHFA 4OLYL 1KIUA 5JW5A 5EBGA 3H7BA 3K2MC 1HN1A 1SJXA 3CGTA 4GG8B 4M43L 5DRNB 5ETUB 5JW4M 2F54D 2Y07H 2F8XC 1WT5C 1QSZA 3MACL 4M1GH 4AT6B 4HF5H 1JGDA 4QHMB 3DETD 5H37G 1CXIA 2AW2A 4UINH 3O8XB 4G5ZL