3QJOA

Refined structure of the functional unit (klh1-h) of keyhole limpet hemocyanin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
491
structure length
491
Chain Sequence
b'ILVRKNIHSLSHHEAEELRDALYKLQNDESHGGYEHIAGFHGYPNLCPEKGDEKYPCCVHGMSIFPHWHRLHTIQFERALKKHGSHLGIPYWDWTQTISSLPTFFADSGNNNPFFKYHIRSINQDTVRDVNEAIFQQTKFGEFSSIFYLALQALEEDNYCDFEVQYEILHNEVHALIGGAEKYSMSTLEYSAFDPYFMIHHASLDKIWIIWQELQKRRVKPAHAGSCAGDIMHVPLHPFNYESVNNDDFTRENSLPNAVVDSHRFNYKYDNLNLHGHNIEELEEVLRSLRLKSRVFAGFVLSGIRTTAVVKVYIKSGTDSDDEYAGSFVILGGAKEMPWAYERLYRFDITETVHNLNLTDDHVKFRFDLKKYDHTELDASVLPAPIIVRRPNNAVFDIIEIPIGKDVNLPPKVVVKRGTKIMFMSVDEAVTTPMLNLGSYTAMFKCKVPPFSFHAFELGKMYSVESGDYFMTASTTELCNDNNLRIHVHVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hemocyanin 1
molecule tags Oxygen binding
publication title The refined structure of functional unit h of keyhole limpet hemocyanin (KLH1-h) reveals disulfide bridges.
pubmed doi rcsb
total genus 94
structure length 491
sequence length 491
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00264 Tyrosinase Common central domain of tyrosinase
A PF14830 Haemocyan_bet_s Haemocyanin beta-sandwich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 3qjoA01
2.60.40.2570 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qjoA03
2.60.310.10 Mainly Beta Sandwich Hemocyanin; Chain: A, domain 2 Haemocyanin C-terminal domain 3qjoA02
3WKYA 3HHSB 1NOLA 3W6WA 2Y9WA 3AWXA 1JS8A 3AWYA 2ZWGA 4Z0ZA 2P3XA 2ZMXA 4L37A 1OXYA 3NPYA 5CE9A 4P6TA 2ZMZA 1WXCA 3NQ0A 3AWZA 1WX5A 2ZMYA 4J3RA 1BUGA 3NQ1A 4P6SA 4J6UA 4J3QA 1LLAA 4J6TA 1HCYA 1LL1A 4YZWA 2AHLA 1WX4A 4D87A 4OUAA 3AWVA 2Y9XA 4J6VA 3AWWA 4Z0YA 4P6RA 5I38A 4L37B 3AWUA 3QJOA 4J3PA 5I3AA 1BT2A 1BT3A 1BT1A 3NTMA 1HC1A 3WJMB 3WJMA 4HD4A 4OUAB 2ZWFA 3W6QA 2ZWEA 3GWJA 3NQ5A 1LNLA 4HD6A 5I3BA 3AWSA 3AX0A 3HHSA 4HD7A 2ZWDA 4Z10A 2AHKA 1WX2A 3NM8A 3AWTA
chains in the Genus database with same CATH superfamily
3FO0L 4AENA 5BOZG 2Y9WA 3H9SB 3RHWK 5C0DA 3W37A 2CUAA 2WUCL 5EN3A 3FO2B 3GRBA 4FGMA 4IHBA 3PL6A 5AVTB 2WGNB 3C12A 1R3HA 1SN2A 5D2LF 2XQYA 4PJ9C 4P59L 4PMFA 3CFEB 1AXIB 5HGHA 3T6VA 4E9WA 1D9KA 2IAMB 2VC2H 4LB8A 1WIOA 1X4YA 3QCVL 2CDFB 4P5KB 3RVXC 3LRLA 2XWTA 1M7IB 4AV0A 3MV11 3FT0A 2OXHB 3MREB 4FXTA 3QC6X 2I69A 3GIVB 3GSQA 5IHWA 4JK0D 3MV9E 1QFWL 4XMLH 4B0MM 5BS0E 5L4JA 2NDGA 2CKBL 3HPLB 3WFBL 2AI0H 3A4EA 4FDWA 1RVFL 2WYIA 5D5MB 3TBTA 2GJZA 3TJHC 2JB6A 4BUGA 2YPLB 2YGQA 4O2FB 3I6KB 4MMXB 4BYHA 4XVTL 3WUZA 3JWOL 1KIQA 4IU2A 3DDGA 4XNYH 3FSOA 5EU6E 2AABH 3ARVA 3EH1A 4JZOB 2EACA 2PYEE 4NZRH 2MCMA 5LDUA 5F7YC 1A6PA 1E67A 3I02A 2Q8BH 1V27A 5C0AE 5GGVL 4GBXC 4KDVA 4DP4X 1IQDA 4LARH 4ZXBB 2UZYA 1DVSA 4FABH 1AKJA 2P1YA 2HVKA 2NQDA 4PWKA 2X6AA 5J9PB 1JWUB 3TS8A 3ZOAA 3KPSD 2R56H 2WCPA 5DZVA 2EQDA 2I7OA 4PJXB 4LRNH 3RIAK 2X09A 5M7QA 1Q1PA 3GI8L 2WSDA 2EILB 2NY7H 2CHDA 5K39B 5ILTH 3BWZA 3AQDA 5KJRL 4HHWA 3D85D 4BZYA 4PJFA 3T65A 4A68A 3DMMD 3QORB 4HUCA 2R29L 1UA7A 1EIBA 4QTFA 4JPKL 1WAAF 2XI9A 1OGAB 1NUGA 2A6IB 1OE1A 4NQQA 4PWFA 4XXCC 3CSTA 3LN4B 4I77H 2VDLB 5HHNA 5D71L 4AI7A 2GC4C 4KX8A 2VE6B 1A3RH 4AIZA 3FRUB 3QG6B 3STLA 1W16A 2AK4E 4JFDA 4DP9X 2FHBA 3NT0A 3TBVB 3LRSB 1BYNA 4UV4L 3IJSB 4KUZH 5HJ3B 1OP3H 3ZTJH 1I82A 2WXQA 4L8SC 4P5SA 4WTZA 4M56A 5I1KL 2YAHA 3KEHA 1PKQE 3G5YB 2AJYL 4N2BA 4V1DE 3UADA 1OEZW 1F58H 2RTTA 2JB5L 2ADFL 3G5VA 3IU3B 4HKJB 4JFDE 3G5WA 3MZTA 2FUTA 4AV5A 4PLKD 3O0LA 3G6JA 3X1FA 5BUPA 4M93C 3QO0A 4HC1A 1PKQA 2V8MA 3N43B 2PPDA 6TAAA 3FZUD 5HGBA 1BM3L 5B1CA 3BH9A 4FKEA 4P3CL 3JV6B 4QI3A 3QRLA 1BFOB 2X0UA 4IOSA 1RZFL 5C07A 3LNGA 4XVJH 2PKDA 1ZLUK 1WCQA 3HAEA 1AACA 2AZAA 3LEVL 2XJLA 5L0QC 1UWEL 4I1NB 4BV1A 2J1YA 3GGWB 2HT4C 4UT6A 5HBBA 1ZGLP 1KJ2H 5FX3A 4FFVD 4JBSA 3MUGA 3FCTA 4HDIB 3GC3A 4JAMA 4F5CA 3LZNA 3QIWD 4ZQKB 1RUKH 4KOCA 2ARJB 1UD3A 1JK8A 2H2PD 3BQUA 1CGYA 5C07E 1YEDA 5D6CB 5JHDB 4HX1A 5LGHH 3V7AG 2DLFH 1E8ZA 1J0JA 1I1CA 4DN3H 3WAJA 3KPPA 2HRPL 1L0XA 4I48A 2K9FB 2XA8L 2OA9A 2JXMA 4GS7B 1AO7D 5BPPA 5T3XL 3CVBA 3GGWA 4ZFGL 2R8SL 4Z78B 3CV5A 4PRPB 1BQHB 3RIKA 4KI5C 3ZL4H 5DSCA 2ZD0A 3MU3A 2XZCL 2HLFC 4PW4A 4W70A 3KPRE 4N2GA 3FS9A 4K3DL 3MUUA 4D9RD 2N56A 2JI2A 4UDTA 1FDLH 2JFCA 2EIZA 1LEKA 3S6CA 1JXKA 4ZUUB 5FM8A 3VWKC 2Z65C 2EXWD 4N90D 1UKTA 3QO1A 1FHGA 1T1WA 2R27A 4Y4HB 4I77L 5TF1H 1AZBA 2R1WA 4N9OB 3K72A 3OR7B 1QSFA 4QY8A 3DBSA 5DK2B 3K7UA 4H25B 2J3SA 4JRWA 3P30H 3KG5A 4MD0A 3G5XA 3RJOA 1XF2B 1T80A 2JE8A 3G6DH 5DMGD 1XF1A 2H8PB 3H6AA 1E28A 3FTGA 1UATA 1N0LB 2YPVA 1XH1A 3SGJA 1U8IA 3TT3L 4S10A 1LK2A 4UT9L 5HI5C 2WLHA 2L7EA 3CDYA 1WD9A 2B2XH 3AXLB 5E9NA 2QVTA 2ZXDA 1IZJA 3VFWB 3JVGA 4Y5XB 1SN5A 4LP4A 5EB9A 1BAWA 2ADFH 1UHVA 4Z3JA 5DFVC 3MLVL 4OF8A 3WE1A 2XVBA 1F6LL 3QQ9C 3RVTC 5DJXB 4IDJH 5AVZB 2CIIA 2Y5EA 4N4YB 4ODBD 2NR6D 3K2UH 3RKPA 3SSGA 3KLQA 1RU9L 2XQYG 4ZO8A 4CRPA 1E5ZA 2P5ED 4HG4J 3FFCB 1MSPA 4CDGC 5ERWA 3SO5A 4ZFOB 1NDMB 2EZ0D 1MI5E 2X3BA 2YPKA 1JJUA 3D51A 5DC9B 3FTVA 1A7QL 1NEZB 1RZFH 4RRPA 3PP3K 1VB9A 4WSJA 5FGCB 2JLLA 1J0YA 1U8LB 4A2EA 3VWJA 2AEQH 4P57A 4I1RA 1CE6A 3IGAB 3QFGA 2JV6A 5EFIB 1MHPH 2OR9H 2Z7YA 4ZW7A 1A7NL 4P9ML 4ELMA 1OPOA 5DRNB 1JWUA 5BXFB 1MI5A 4W6YB 4JGJA 4WI2A 3RDJA 1IE5A 4AJWA 4P23C 2EEBA 4Y4FD 1HSAA 3TLRA 3CTTA 4OLXL 4YSCA 1KENH 3APDA 4EOWH 1I9IL 3SDDC 1U4FA 2JJSA 4N2EA 1NIEA 5DO2D 3VXOA 5BO1H 3CFJB 1QO3A 4GI9A 1NMAL 3RZCC 4F7CB 4JMXA 2A38A 4MJ2A 3HVDA 4YQXH 4AK1A 4HS3B 2DQDL 1J18A 3IAQA 3NSXA 3R18A 4G42A 5IHBA 5FV1L 4BEIA 1SYVA 1SF5A 1SHMA 2H26B 3U7YL 2QBWA 3N04A 3O3BA 3GINA 4AL8H 1JYWA 2ITEA 3BAEL 4KUCD 5DYOA 3IXTB 4C4UA 2B08A 4R2GB 3W9DA 4FFYL 3AG4B 1NFIB 2J57A 1FNAA 1KG0A 1S9WA 2K0RA 4RDQF 1VDGA 2XYCA 1P6FA 2VWEC 1XGYL 3B5HA 4NQXB 5DVMA 3UZEC 3NK4A 4NP4H 4X5PA 3WNOA 1QWNA 3VXMD 4F37K 5I8CA 3L7FB 1GAFH 3TO4C 4K23H 5I76A 4BHUA 4OCLC 3SPCA 4QRRB 3WFZA 4L29A 3II3A 4NUMA 3S37X 5GRJL 4U6HB 5HXMA 2H0EA 4Y1TA 3VCLB 3V5KA 4OI8A 5KSBB 4PSRA 4I87A 4ILDA 2L04A 1ITCA 3S0PA 1GC1C 3DROA 1I75A 1FGVL 3FPXA 1NQBA 2VZOA 3ARDB 4WJG3 3T8VA 3QYMA 2TSAA 4Y19A 4FG6D 4M4RA 2YBRB 4LE8A 2IBZY 2WLLA 3ESMA 5DTFB 2GY7B 3VI3A 4R8WH 1PZSA 2NY2B 3QCTL 3OD3A 4XRCA 1GH7A 3H0TB 2EICA 4XMKH 4JPWH 1HAUA 3FBQA 2P3XA 5FDWB 5TJWK 4AYSA 4BFJA 2V7HA 4O02A 4X7SL 3Q0HA 1RZ7L 5D5ME 3WNNA 4UZUA 2C4FU 2CHZA 2WSKA 1KBGL 2YMXL 4LPUA 3B7RL 1LEIB 3UAAA 5FCUL 2CBTA 3FUJA 2WXPA 2WGXA 5H4YA 3M17B 4IIQC 3DXAA 4PRHE 4ODWA 5F0PB 4PD4J 3BYYA 2V2WB 4IU3A 4XN2A 2EEFA 3VGDA 4M62L 3WEXB 1WH0A 3LKPB 1QTSA 3BD3A 5EU3A 3BEVA 4IQHA 1JTOA 3HNTH 2OFQA 2HKHL 4S1SH 5EO1A 3QI9D 2YD3A 3OSKA 1JZFA 1UH3A 4ZQTA 4HIEA 3RI5F 4WAFA 4BZ2A 1Q9LA 1WBYA 3JWDH 4EN3A 2B1AL 4HUXA 1NCGA 3ZL1A 4JDTH 4OM0L 2AAAA 4KX7A 5F96L 4PJBE 3MXVH 1A65A 3CVHB 2D0GA 2QPDB 4H8VA 5HHVL 1G7MB 3ZMRA 5ISZE 2A74C 5D1QD 4WUUE 3F5WA 1A6AB 3UROR 2EAEA 4M02A 3IMTA 5F1SA 1RURH 1K4DA 3NZHH 1A66A 4V11A 4G8EA 4JZJA 1KACB 2CO6B 2HXAA 4YC2C 2BOBB 1VPOL 3H55A 2Q20A 4WNSA 5C08D 5EEVA 5HHXL 5EC1A 4JCMA 1TTRA 1KT2A 1JBJA 3EHBB 2AMGA 5I74C 3LS4L 3TBCA 3MJ9L 1JN6A 3U4BH 4BWTA 1KTLA 2A99A 3S5ZA 3L9YA 2Z91A 3MRJA 5FHAH 5ICUA 3O6KH 3MCYA 3HLAB 1UM4L 1BXUA 4LOUD 1IQDB 2BC4A 5F89B 3SDXF 1G6RA 1RLWA 4LAQH 3TCLB 3KXFA 4QXUH 3LB6D 3MRKA 4FQLH 5K9QG 4JQVA 2BS71 2PW1B 1JCVA 5EH1A 1MNNA 1A21A 1S7SA 1UQSA 2WXRA 4GW5A 1MF2H 1RY7B 1IGTB 1NIFA 4R7DA 3QIBC 1OLZA 3QUZC 3D25B 2ALAA 1XSJA 2YRLA 3FK3A 3X1EA 5C6TL 3JTBA 3RUGE 1CFVH 5HJDA 5AG9A 4LPCA 4EKJA 1KXQA 1A8JH 5FHBH 4E36A 1SN0A 3T1WA 3QUXD 3JTTB 1T7VA 1AG6A 3RTQB 2OXHA 4H8PA 2WLJA 4AM0B 3JVGC 5C7ZA 4GS7C 5CZKA 4IBTA 4X4YB 1ET5A 2A1WH 1N5AB 4W4OC 1NEZG 5EOQH 1YO4A 3D25A 4U7SA 4HJ0D 4X4KA 4JM2D 2EO7A 4FFZL 4EIBA 1R5WA 3F3HA 5LB1A 1L0QA 3LNDA 1K85A 1T1XA 3K6SA 3L5XL 2YC1B 4WRLA 4OJDH 5AW8B 4LQFH 2ED9A 1N0LA 3KW7A 3NA9H 5C08A 3ZDZF 4QRUB 1S3RA 3RWGB 1UZ8A 5HI5D 3SOBH 5B4MD 3D9AH 2BJMH 4EDXA 3PNWB 3AB0C 3D52A 4FHBD 4TULH 4G8FB 3C8KB 1GIGH 1TQBC 2E0PA 5IT2L 1OP9A 1Q4NX 1X9RA 5JXEC 3M17A 4K8RD 5A2BA 3UGXA 1GGCL 2NQ3A 4Z95L 3PPSA 4XPFL 5K9KA 3ABZA 1B4TA 1DBAL 1NCIA 1T1WB 2BRRL 2WZPA 4HIQA 5EUKB 5DWPA 2VERA 3OAZK 4NO2B 5CU9A 2R2BA 3O4LA 5EZPA 4J8RB 1QSFD 4G8GE 1NPNA 2WY3B 2XNAB 3LKNA 2F5BH 5CEZH 4Z3FA 5AD0B 1KGJA 3DK2A 1OD9A 3QJVB 1H8OA 2PO6A 4ZD3L 3ZRCC 5DFWH 5DZLA 2BINA 1KIUA 4F57L 1NDMA 2XXGA 1IAIL 1H3TA 4RRPG 3RWCB 5MHSD 2QKIA 5FA3B 2G75B 3S4SG 2OX5B 4Z7VB 5FC9A 4I88A 4U1GC 1NLBH 4AL8C 3UFIA 4XP1H 2CKNA 1PG7W 4DP1X 3CG8A 1CGSL 5BJTA 2MQCA 2B3IA 8CGTA 4E68A 4TQ8A 3TBWB 5C9JA 1PQZA 5CJOH 3STZB 4J8QA 4OI9A 3GO1L 4WWKA 4BWUA 4RA3A 1QOKA 1ED3B 3QULA 3CDCA 3GTNA 1FNGA 5FFGA 3FB5B 3KL0A 4P46D 2KZ1B 3ULUH 4OCWH 2JIXA 4ABVA 1DQQA 1MH5B 1YNKH 3V55A 4ACTA 3U48A 4I3RL 1YPZB 3CFIC 1KJMB 1HQRB 1GGBH 2AERT 3VE0A 2OYMA 1IL1B 2MKWA 4QT5B 5GGTL 2L0DA 1R47A 3S9DB 5FHBL 1GPOH 1HINH 4RMSA 3ZGIA 1L4IA 3NQIA 4QRAA 5DFTA 5DLML 5L6YL 1OM9A 5IFAH 5ESVA 3KVDD 1WZ1H 6FABL 4ODTL 1UB5A 5DDHB 4NERA 1A22B 3X2QB 5F7LB 2IOIA 4YSAA 1YUHA 3Q43A 4HQQH 1B4LA 2Q8AL 5I1IH 2X1XR 3UMTA 1XGUA 3UO1H 4MCMA 3PUCA 3SY0A 3TCLA 1YHPA 5DC0A 3FQ2A 4PWJA 3P69A 1FFPB 5LCVH 5EBWB 3G5YA 5EF2A 3WDJA 1JPST 4S1DC 3SDDA 2NNFA 2VXUL 1MXDA 4E9YA 3S96A 2ZWEA 1VCAA 2E7CA 3SOBL 4F7EB 2BSSA 4P23A 3GSRB 4AVJA 4HU2A 2UY7B 1IKFL 3IJHA 4L5FH 1DHKA 4HX1B 2R4RH 2ZG2A 2DI8A 2DBJA 1FH2A 2VQ1A 1YMMD 4LF3B 1AS7A 4WFGE 1XXFC 3GKWH 3F7LA 1TYJA 4CVXA 1H0DA 2BZCA 4KC3B 3NIFB 1UADC 2O5ZH 5J12C 1E5YA 4P06A 5IBLD 4ZZKA 1A6AA 5I8OL 2A9BA 3T0EC 4MZ3A 3QZBA 1DVZA 4OUUA 4KI5F 2C5DC 2HKFL 4LCWD 4PQXA 2ZOKB 1LNLA 2K7QA 4UZSA 3BAIA 1LO4L 1JFQH 1KJVB 2QSCL 3VJ6A 1AE6L 2VW4A 3PGCA 1ZXQA 4ANUA 1WLHA 5E99L 2OJEB 1PAZA 4YBLC 1RIVH 1A6TB 3KGTA 2K6WA 1KYUA 4M7KL 4P6SA 3D12B 3L3KA 4F58H 2XX0A 1X5YA 3OB0H 3EJUA 3HBGA 4LHJB 3QG7L 3R8QA 1F4XH 4UT9H 1NLBL 1SMOA 3BPOB 1T83C 2DLTA 3EGDA 1OLLA 4UQAA 2F1AA 5IMLB 2EABA 4LVHC 3T0EE 2AV7B 1DJIA 2MEJB 3CU1A 4MS8C 2BIOA 1A3LL 1M56B 2RH0A 32C2A 1TEFA 3K6OA 2V2WA 1NANH 1G84A 3QIBB 2A73A 3F85A 2NX5D 3HHSA 3G08B 3OKOB 3OLEA 4I4WB 4M9PA 3N3EA 4BKLB 5K9JL 1G9NL 4EI5D 4K7FA 1VFOA 5CUSL 1RZJC 3U1SL 4DHLA 5IB4A 1MPAH 2R9HC 3Q2WA 3DTUB 2Y7QB 1A9EA 1TJHL 2DY2A 3MTRA 3P0GB 4ODVL 3BUYA 4OUOA 3DV4B 1CDYA 1AYRA 1DVXA 1KB3A 3MREA 3W0WD 3Q8CA 4JKWA 4BH7A 3QDME 4HWUA 1LE9A 4AQOA 1JVOA 2WHVA 5K1VA 4PJGF 4X7EC 1K6QL 9CGTA 1KCBA 4X6FA 4Y19D 3FRPG 5CJ8A 4GI6A 3L1OH 4YIQA 5GQBA 4GT7A 1WVZA 3A67L 1XAUA 5T5NF 5E1IA 3ZUNC 4DGIL 3ZDWA 5EF3A 1TO5A 1NLDH 3IYLW 2VLMD 3QDAA 5J06A 4GUQA 1N3NA 1W72B 2Y06H 4FYTA 1TVBB 4KI1A 5T1DL 2HH0L 4X6DB 2QTEA 3V5KB 1ZWIB 1V10A 2C1PB 2OZ4H 4GSQA 1NGXB 5DQJB 4ZX3A 5HVFB 4J4PA 3SKJH 3UDWC 5HGDB 2J6EL 1WG3A 3UTTD 4QRPB 1ZLVH 3DGDA 4GKZA 5F97E 4OLZL 4BRVA 3B43A 3ML8A 3VQ2C 4YIQB 2VKWA 4ZRGA 1QQDB 1QSFE 2FDBP 4QHUA 4EI5B 4UBDC 5I1LB 1NFDA 1PS3A 5D1XC 3FU3A 2VLRB 4L0YA 4FS0A 3UYRH 2CJUL 3QIUD 4XWOD 3BUYB 3O9WA 1R19A 1U91A 2CUIA 2VDMH 2X89A 3QXAB 1OALA 1UB5B 1EERB 3A0OA 1KC5H 1UT9A 2HX9A 4Z7WB 1U4EA 4MLIA 4DK5A 4XCFH 5HHOB 1J8HD 1FZOA 1R75A 2GI7A 2IANE 2VTFA 4CBPA 1IGTA 2HRHA 5E8EA 2J1KA 2VXSH 4MQXD 2RBLA 4KTEL 2GJZB 2RALA 5SWZA 3VD0A 4HKXA 5DRXA 2XZAL 4B5EA 3J07A 4U7KA 3EW3B 3UYPA 1R5IB 1VJSA 2BZ7A 4RGMC 4YHNB 1KOAA 2BP0A 2V9UA 4JFYA 43C9B 1IAII 1D5XA 1P5UB 2DIAA 4N90E 3SQOH 4AG4L 3IJ9A 3I6LE 1HDMA 3RUGF 3TV3L 3HN3A 1GS7A 4OFQA 4UV7H 5D7IA 4K5MA 2UXGA 1I53A 1M1SA 4M7JL 3DIFA 4HUMB 5J89A 5E9DA 4QXTA 3U36A 5D7JB 2XA8H 4CNIB 4TSAH 5AVUB 4K07A 2QVMA 3P2TA 4MMZB 2Y2TA 1TZ8A 1W8EA 1NCCL 2XTJC 3AACA 1OSPH 3HZVB 5C0NC 4OBSA 1SPDA 3QCTH 3JXAA 3L5WB 2EKJA 4HWZA 5D4QA 4JFHE 5EC1B 5AW6B 1O7DC 3IWUA 4ONHB 3CSFA 1ZHKB 1NANI 5MENE 3GIZL 5DFAA 3K8KA 5KBLA 2QGCA 2FWLB 3OBAA 4XPHL 3UJTH 1EHLH 1JS8A 1F3JA 1VFMA 2YMXH 3DURB 5FA4B 5FGBC 4MXVF 2VISA 4FKHA 4WY7H 4DCQB 5IOPA 2NY0B 2GJ6A 2QV2A 1EO7A 2NR6A 4JPVH 3Q5OA 5D2LA 3GT6A 3HS9A 1LDSA 1KCKA 1DL7H 3TU6A 4OLYH 4Z76B 2XKSA 2ENPA 2WINB 2E3VA 5E9DD 4D9QD 1P1ZB 1USZA 4HMDA 3G6AB 3A4AA 2I27N 2Y9RT 3PV6B 5T1DH 3TVMD 5DHYA 3QE5A 3GK8L 2IOOA 3VM7A 1JGIA 1E40A 3B8SA 3HHSB 3G08A 4FF9A 4AYDC 5BQ7B 2ERJB 3AM8A 1FE8L 4WTWA 4A2DA 2YXWA 5C97A 4KTYA 3IBEA 4PV8A 4E41B 4ELME 1A1MB 1SJMA 2N7AA 4NBZB 1TF4A 2GSIB 4M6ML 3P4NA 3AWGA 1KYOJ 1BT3A 1WBXA 3U9WA 2HTLD 1JZHA 4JE4B 3ALPA 4PGZA 3MMEB 4TSBH 4X6BA 1JZ5A 1AOZA 3VFOA 3LDBC 4GG8B 3EYSL 2EUZA 3SKNB 4X4YA 2A3TA 4B95C 5I1JL 4S11A 3ZXAC 2EEXA 1PIGA 3D69A 1QSEE 3CSYB 3TA3A 4MNQE 1KC5L 1PW3A 1HI6B 3RY6A 5HHXH 1M7UA 1BJ1J 1PAMA 3K6NA 2JI1A 3B9AA 3LPWA 5TFSH 5HD8C 4BJLA 4N25A 4XXWC 2PCYA 5HYIA 3TURA 3KD4A 3C6LA 3GHBH 5I6LA 1GW0A 4TVPD 4DW2H 4CVXB 2WBXA 4XCNB 3HR5B 5DZNA 4PR5A 2ZUWA 4ZMTA 3EKCA 4NBXB 3QP3A 4UM9D 5KSBA 1JNHA 4HD6A 2WBJB 4I0PA 3MCG1 4XC1L 1KENL 1JZEA 1BGXH 5E2UH 1GYWA 2UWEE 4HAGA 2AS5M 3PP4L 3KWTA 4NM8H 5IZ7A 4IOFD 3VXNA 3BP4B 1BPVA 4Z6AT 4XN1A 3H9SD 1S7UB 4KVCH 2PW2A 4B96A 3FQTA 3MRFB 1D5IH 3RU8H 4IOFC 5BS0B 4PP2B 4YNYA 1H8NA 1ZXKA 2NY6C 2RFXB 3D69B 3U7YH 4EN2A 5K69A 3MV7A 5DRZA 2IEPA 3HE7D 4KRLB 1PZUB 3LKRA 3ZPDA 2B8OT 2B77A 4W9CC 1DO6A 4LSUL 3S34L 5G55A 4Y19E 4FQQB 4MDRA 3MRDB 5D1QE 2X70A 2XPYA 2F7QA 2JJUA 1YMMB 3RL1A 2JB6B 1ADQH 4BKLA 1GCFA 1XGYH 3QIWC 4JY5L 1ZLEA 2IH3A 3ESUF 5A2AA 3C08H 4OJYA 5CIPA 5E2WL 5I38A 3HG0A 5HVHB 5D9SB 5JIQA 2KI6A 1BT2A 3VH8G 4TUJA 3DTXB 5IV2B 4ZNEE 4NUGL 1QQDA 1JV5B 3ARBD 2FD6L 4O9HL 3K8MA 1X7QA 4XXWA 1XSKA 3C09C 2X2HA 4TNVK 5EDSA 5C0RH 2VDNB 4TULL 1YY8B 4PRHA 1MFEL 4XHJD 1L9TA 3BKCL 2NTFA 2YFNA 2DIBA 3HZMB 4DZBA 5CJXC 3W39B 5EU3B 4F2MB 4Z7VA 2GIXA 3GHEH 3EOAA 1KYDA 5CFAA 4JPWL 2WO2B 2WNWA 5IVXE 1L7TH 3FAXA 3VGBA 1IC1A 4ODWB 1B2WL 1KGYE 1BMWA 5E1GA 2GAZA 4N0CD 2PXYD 1XEDA 2CO4A 3BPNB 4ONGL 1EQWA 3GEFA 5JIMA 2YJLA 2ICWI 5E8DL 1V5JA 3H53A 2UVFA 4HV8A 4LLDB 5SV3A 4BK5A 4X80H 1MUJB 3GSNL 4UINL 3TVMC 4GG6A 5LBVA 3WHE0 4GUPA 3HG3A 1IFHL 4GY4A 1YN6A 2D03L 3L3JA 3EIFA 4U1SB 3VRIA 1BD2E 4F27A 3MROA 4B27A 2BIQA 1NAKL 4U3CA 4OLUH 2EIKB 4JY6A 4HUVB 1V3KA 3MBWB 1A9VA 2FTAA 3JT0A 4RMUA 3LH8A 2D2OA 3IE9A 5IMOA 3VFSA 2KT6A 3EJCA 1SUJA 1MCJA 5F3HB 5JA9A 3DROB 2FWSA 1DUYB 1XIWC 1MVYA 4Q6IC 4XC3L 4Z7QF 4Z3GA 2EDNA 1FYTD 1DJSA 1AANA 3V7MA 1NM9A 3AT9A 4MSWA 2W80C 4HK3N 4NKMB 4FJZA 3V6OA 5EBMA 5IHLB 2J5WA 1CFTA 2VH5L 4XN9A 1XF4B 3QC5X 4PJGE 2HLFD 3O6LH 3BMVA 3EOBB 2F7RA 5SV4A 2WIIB 4BH8B 1MAKA 3ZIYA 5DLMH 4R9HA 1QUNB 5ETUB 1J1OH 5HHME 2DWXA 3QPXL 2CDFA 3ENEA 4OGQC 1F6AA 3N1GC 5EG6C 1LO0H 1J1PH 3P3SA 4GKNB 3E1F1 3MOBL 4ONFH 4XVSH 1BZQK 1H0DB 4LCCC 5GGUA 1Z9SA 4PJ5A 2E6PA 5EBMB 4HLEA 3C5JA 3FC8A 2FYVA 4CKVX 4HH8A 4M4PA 2DYPA 2IH8A 2OMXB 3FO9B 4YHPB 4IRJD 5JDSA 5E8NB 3DJ9A 5C0AB 1BIIA 2ARJA 2IQAB 2HT4D 2NY5C 3D0VA 3FQRB 2D4DA 4MQ7B 5AQ0A 3MQIA 1J1XH 2D9CA 2QTVA 3B83A 5LGJA 3C6EA 5IMOB 3CBKB 2Z92B 3F8UB 3IDUA 4BSWB 2KPNA 4LP5A 2VN7A 4IM8A 4UOZA 4ELDA 4YDVA 2MJWA 2DBLH 1FLRH 3G6AA 4F8PA 2EIEA 5IREA 1T0NB 4RGNC 2ZP0T 1J8KA 3DVFA 3MV8D 4S1DD 4WGWB 5HI3C 5TQ2H 2VZUA 1MQ8A 1TITA 2OV0A 2Y1YA 3NZ8A 4HIIB 1PD6A 5IM7A 3QYNA 1ILSA 3FW6A 5C86A 3LZPA 3VO0A 3LQAH 3MRPA 2HKFH 2WW8A 3FQ1A 3UZQB 2WXNA 4HBQA 2BWDA 3NRQA 5J11C 1DVFB 2IJ0C 2ZCHH 3BJ91 4Y4FB 5JXAH 4OZFB 3W0WA 3MCKB 4K9JA 3WTSA 3LHPL 1TJIH 1H5BC 4AGMA 3OX8A 1AS6A 2IXQA 4G8FA 5EOQL 4Y8AA 5BOPA 4B9ZA 3VFRA 1TZGH 5GRZA 5EU6B 5JDSB 3EO9L 3NCFB 3QNXA 1FYTB 1G43A 2DQCL 5SWQA 3WHXB 5E70A 2AQ3A 3SE9L 4M29A 1ROCA 1NGQH 5CCJA 2XIDA 3ARTA 3C5JB 4I9WD 5EEZA 3ROLB 3RYMA 4ANXA 1N70A 2EE0A 3OPUA 3NEOA 1JPTH 3X3FH 5CEXB 4HFWB 3BUBA 3TH3T 3VVVA 3ZR6A 4DPCX 4IJ3B 2WP3T 2BVTA 3RIFF 5FLVA 2EYTB 4M5SA 3HTLX 3O2DA 1N8OE 3VH8A 2HJFA 2BVQA 5KSVA 3CHOA 2IAMC 4O2EB 1AGEA 3QWOA 3QPKA 4Q4EA 1BV8A 2ODIA 3T4AB 1U0QA 4OLVH 4U1JB 5E94A 1BX2B 3CXFA 5CMAB 1XQ4A 5D4HA 3R8BB 1YJDL 3NABL 5A6IA 3IMRA 4ODHH 4JPIA 1KB5A 5I2IA 1SMAA 2FSEA 1KLGA 2GW5A 4AT6B 1KTJA 3IDXL 3UTSD 1PMYA 1KN2H 5EPMB 5BS0A 4L8DA 2EDJA 2VZTA 4OFDA 2HVKB 1AQHA 1N64H 2EH8L 2FQFA 1OAUL 4GP4B 1HCVA 4UT6L 2Q7YB 1GS8A 4IBWA 3REWA 1SBBA 4JO5A 2J7LA 3US9A 4LLVA 3I02B 1OQXA 1CFNA 3AWFA 5F9JB 4Y5YC 2CGYA 2Y3NA 1ZJBA 3GMRA 1WX4A 2IQAA 3ES6B 3GO1H 3QIWB 4P23D 2C3VA 5FKPA 5AZ2L 5D2NA 4X0KB 3VAEA 1Q0XH 2WTPA 2VGLM 3QGVA 1CFMA 1MCFA 2BNQE 3DX7A 4F20A 1MY5A 1JDCA 4HGWB 5HJBA 3UTZA 1UWFA 4XBGA 3AT0A 1FH5L 3L9RB 4UDUA 1QFWH 3H9ZA 3P4OA 3I9IA 3TWCH 5T3ZE 1JGEB 2AI0L 3NCMA 3CDZB 5FYJE 5DMYA 1LO3H 2APVA 3N5AA 1U30A 3KLHD 4PYGA 3S36X 4LSRL 3SDCC 4AM0A 3S36L 1EBPA 3FTUA 4GW1A 1YEJL 1CF8H 3F7KA 3M86A 5J12B 1WGOA 3QZWB 1F45A 5BVPH 3HNVH 4NWUH 3CLEL 5DHDA 5D7LA 1ED3A 3A22A 4NRYB 4OZGA 3GMNA 4DK3A 2NX5B 1FJ1A 2UY6A 1BVKB 4B9JA 3IU4L 4YX2L 4I0PD 1AXSA 3TT1L 1TZGL 5C0EA 4TKWA 5GGVH 1HOCA 4OQTA 4G80A 3J2PA 5CEZD 3AABA 3VD9A 5SWQB 4KVNH 3MOQA 1UM6H 4JQXA 4JKPL 4APXB 3OC8A 3QEQE 3CZFA 3RG1C 3VGGA 2NLJB 1FG2A 1HHGA 2EXTA 2AK4A 3UERA 3VI3F 4OZHF 5B39B 2EUXA 1J9TA 4QHNA 5CBAB 2H3KA 3W0WB 4DOHE 4WO0A 1C5BH 2EJ1A 2OI9B 2W65A 4MB4A 4ZK8A 3ARBB 5FOBA 5TGBA 2R2HA 1BQSA 3GKWL 3KGRA 5TDOA 5IESH 3A6BL 2X2IA 3JYBA 3UJTL 3T0EA 1MNUH 5EFIA 2XXFA 1OW0A 5EZIH 2HMIC 4PRAB 3B37A 3HW7A 4AZ8B 2CBQA 5HHQA 1QWUA 1YJDH 1DQJB 3LN4A 3G9VA 2HA1A 2VMFA 4KKCD 3H9YA 1BQHA 2EP6A 5I26A 3V4PL 3HB3B 4PJHE 1S7VB 3IFNH 1JF6A 3JZYA 3BYTA 4OQTH 4ZW6A 4G7SB 4XO8A 4L8SA 3AWUA 1WZAA 5L2KE 5F6IB 1EX0A 2EC9U 3Q05A 3I9GH 3CNKA 2CZNA 1OAUH 1CC3A 3NJKA 1UB6A 4HWEL 3OKLA 4ZUVA 1IT9H 2J8HA 3BQUB 5LO7A 1OCOB 2VIRA 5D5MF 1QBML 2F0CA 4CNIA 3VXMA 4LNVA 4PBVC 3UC0H 1C5CH 5FIEA 4EJ1C 2BRQA 4JHWL 4DO5A 4IMKA 4YUEL 1TMCB 1FFPA 3MRNB 1NBYA 4ZS7L 2P26A 3PWPA 4M7LT 4RX4A 4LLYA 1ORQA 4YDMA 3W9DB 5JPMB 1BM3H 4JUTA 1ASQA 4WHYH 4KRNA 4PVBA 1PG7X 4POZD 1HC1A 3NCBB 2IH3B 2DQJH 4HJIA 3BIKA 2XN9A 1MCEA 1NCUA 3DETC 2YXFA 2Y0SA 2BWIA 1TVHB 2IH9A 3HS0B 1BQRA 3KWWB 4GXVL 3UZVA 4DKEH 4BQ9A 5C09B 3EDEA 3SIKA 5A6LA 1K6QH 5IHZA 3BQUD 5DEZA 5EO0A 2RR3A 7PCYA 3NEEA 4Q56A 3H1ZA 3EUUA 3V4VL 4UQEA 1DTUA 4FI6A 3QXTA 3KAAA 4OKDA 1K5WA 2QLVB 4I2XB 4YX2H 3UACA 4QHUB 4I9WE 3EFDL 4N0UA 3HS8A 3OKNA 2XWRA 3Q9PA 3O8XA 4W81A 5EORH 4A2HA 2LV4A 5DJYB 5DHEA 3FONB 3FU7B 4KXBA 1AMXA 1EJOH 1H5BB 1WFJA 3LRHA 1MLCB 1KNOA 3VCLA 4AQAB 4KVCL 2KL6A 1YSOA 2AZUA 4ZQKA 4GPVA 3R4DA 3WTUA 4NLHA 4PRBB 4JKKA 2Q9OA 5E1HB 3D7PA 2OTWB 1O7SA 2C3WA 2BMKA 2VQTA 4PJIE 4H8WL 4PP1D 3D8MA 4NQEE 4RFNC 3RZCB 4Y2NA 2ZE0A 4RFEA 3K80A 3PFUA 5CINL 1N7ML 5D6DC 1NUNB 4Z9KB 5IKCA 3T77B 3EZ8A 3VYNA 3IBOA 4YSSA 4DKTA 2PABA 3OAUH 4N5UA 4F9LC 1IAMA 2E27L 1A6VL 4XX5A 2PR4H 4KY1L 2XV0A 1HHHB 3N55A 2MCPL 4HOXA 1JP5A 1T89C 4UQ9A 5TH2B 4B5ZA 2VN5A 1BD2D 1KTKE 2E74C 3P9MA 4F7CA 1JPSH 2H1PL 4D0CA 1SXAA 1RK1B 3PG2A 2UXVA 2F53D 4WO4D 4LU5L 3LN9A 4LGRB 1F8TL 1JAEA 4NM4H 2BNRA 4BM7A 4I3GA 1YEIH 1M57B 1YEHL 3B3BA 3PV6A 4QKXB 2GJPA 4YHMH 1JYXA 3FQTB 4Y4HA 1U95B 1RZIA 4ZPTA 3GIZH 3MNMA 4BE6A 1U42A 4O00A 3P11L 4LPYA 4XP9H 1C1EH 1M6OB 5T3ZH 2FAUA 2BHFA 4UTCA 4ZAKC 3AUVA 5TDPB 3UAJA 4POYA 5E6UB 2UUDK 3L3IB 2I7SA 3HI1A 4NO3B 4AJ0A 3ZT5A 3VXSA 3QUKA 1T66C 1HHIA 1S7WB 3V6BR 1U8LA 4LMQE 4ISVB 3EBAA 3UP6A 2YO3A 1MHPL 2OR9L 4N28A 5INCB 4OLYL 2P5WD 4X98A 4Q6IB 5IQMA 2WXFA 4UDUB 3M46A 3D0AA 2VQ1B 4LVOC 5KBPA 4BQ6A 3GBML 5HTSA 1D7BA 3BESR 1UOVA 2QPUA 3MJ9A 1FC2D 2UX6A 2FGZA 1MJUH 4F24A 3IDJB 4WSKA 5H2BB 5SX5H 3DUHA 1CFNB 5F9JA 1X5GA 3C6LB 5CHNB 1RD6A 4TUKH 3NJFA 3CX5K 2JH2A 5EBWA 3TBYB 3WLBB 4I89A 3EO0A 4UTBL 1FBIL 4CUCA 5GSRB 1RZKL 1XR9A 2GEEA 4KUCF 4U2YA 4K94L 4DPRA 1I8LC 4DPAX 5LXGH 1NDTA 1PBYA 4PVMA 4HALA 5J6SA 3OF6A 3WIHH 3DMMB 4LFHD 2PWFA 4LNRB 5BMFH 3RWJA 3VQ1C 4J3OD 3C2SA 2X41A 5I0VA 3B7YA 2XRAL 4ZUTA 1QHQA 1SLVA 3MXWH 5CSZB 4BWWA 1CDJA 3PAUA 4JHZA 3ZE1E 1PTZA 1BXXA 2X4OB 4NBYB 3V9FA 3ARFD 1YPZA 4OF0A 2KQMA 3ZLQC 1ZDSA 4WFFD 2AV7A 5F7WC 5E8OB 5IBUG 3IF1A 3S3SA 2XQYK 3MRNA 1WS7A 4R96A 3O8XB 1A7PL 4G8AC 3ZDZE 4M6OL 2CRMA 4DKDC 4UZGA 5DS8B 3ZRSA 3FSWA 4NKQB 4YAQA 2YQBA 4OD3L 2MRYA 2C9SA 2WVVA 2ZCLH 5LBSA 4Z77A 3EO1B 4PRBA 5GGSB 4NM4L 3FO2A 3ZYZA 4N2LA 5I6KA 4WI9A 2VE6A 4AIZB 5CEZE 3F84A 2WO3B 1RMFL 3Q2VA 1C08A 5I1CL 5I16A 5FGSA 2OYKA 3MI6A 1U8OA 2HP4A 5DD1L 2X4PA 1ADQA 3N44F 3CHRA 3FB6A 5EBLA 2O5XL 2FL5A 2W91A 3O41A 5HDBF 2J73A 4MHHI 1KPRB 3T0DA 2H3NB 1T1ZB 3W3BA 2XBTA 4OB5L 3C8DA 2J4WL 2CU9A 1P2CB 2QHRH 3QI9B 2YGOA 1N0XL 4AH2A 3NCJL 4NO2A 2WLNA 2Y7QA 3NACH 4FL4C 5IF0A 2WQRA 3D3VB 3KH4A 1X7TA 3KMDA 1RUML 4AIXA 4CC4C 4J2XA 2CE6A 3UIYA 1GZHC 2YGNA 3EO9H 2X9WA 5IW1A 4HZLA 2FATH 2P5EA 5FAAA 4JFZL 4DP0X 3FT2B 2V5TA 4H0IA 3HJEA 4GMTH 4PV8B 1ZANL 5L4MA 1UXWA 3C9NA 4AGOA 1MIMH 2VDLH 2C7UB 4ZO9A 1NDGB 4QWWC 5DD3H 2WLMA 4FAAB 2PO6D 5I17B 1QKZL 4X8JA 1EAPA 3VFVA 3HZKA 1QSZA 5T1MA 1S7XB 4KRPD 1KFAH 1CFSB 4YSQA 3K71B 3M1OA 4KPHL 1ID2A 3TA4D 3VRJA 4XCYB 1EJFA 1WITA 3BP5A 3W81A 3AFLA 5GSRA 3BJLA 1SEQL 4PJ5E 5LBGA 3VWKA 4YPGA 3DX4A 4AK2A 5AL0A 3R1GL 5F9DC 1IJNA 3ARDD 1IMHC 2F5AL 2J2ZB 1QRKA 2PWGA 5ELIA 4AGNA 3P3YA 1V3JA 3D05A 3NFPB 3PWPB 2ADJA 2X4RB 1SXCA 1IFHH 1S7TB 1URZA 1KN2L 4QTIL 3NZUA 2Z31A 1U6AL 1CT8A 4G1EB 2GFBA 1PSKH 2VIRB 3BZFB 4ZMPA 4GXFA 3ISYA 2WOYA 4Q9BA 5F9WC 2CCVA 25C8H 3HZVA 3RRQA 4AW7A 1XGRB 4HGMA 3KXFB 3BH4A 3ML9A 3EH5B 3MUGB 4RISH 1AQDB 5GJSH 1BREA 4A7VA 4MZIA 5JOPD 2DM3A 2BW4A 1OAKH 2HAZA 4KJWC 3DARA 2N7SA 1RUAH 2R2HB 3U46A 2QGBA 2Z91B 1Q38A 2X44D 1KGUA 1MCOH 2DDQH 4WWKC 1FAIL 1I1FB 4ENEC 2H32A 4HPYH 3O9WC 3ZDXB 4P59H 2WBKA 4BRJA 1PU0A 5EZOH 5GRVK 3WKYA 1G1CA 2PTTB 2YUZA 3D3VE 1MLBA 2AGJL 1VADB 4MJ6A 2CALA 1PDKB 2GAZB 3IJEA 1OKEA 2E8ZA 3T2NH 3K1KC 2XV6B 2XLLA 4NSKA 1E6OL 1S4IA 3V10A 5ITBL 3UOAB 3MBEC 3IKKA 3LIZL 1T5WA 4KKCC 4NIYE 3SDCD 5DI8B 1FRGL 3GB7B 1F0LA 3VMNA 2PTUA 4LQFL 2CDEB 3QZWA 2YC1A 5JW3L 1WZKA 1B4JH 2H9GB 2ISDA 3TJPA 3MLRH 3RDTA 1HXMB 4BFNA 5CEXA 4W9GC 3INOA 4WI0B 2NX5A 4ZX6A 3IGKA 5BJTB 2IANB 3L4WA 1QLRB 3OLIA 3F7YA 3RB5A 4O4YL 1AC6A 1FLRL 3D09A 5EU6A 4G2AA 4RMWA 1ICTA 1S8DA 5HY9A 4WJKB 3AAZA 5IQNA 3OX8B 2OSXA 1XL4A 1JGEA 1CLCA 2NX5E 4NPKA 1HZHH 4YBLB 2VR6A 2F5AH 1A4KA 5CLZA 2XTSA 5CEYB 4F15C 1X5MA 4G7YH 1UTDA 2NW2B 1CK0L 3DX3A 2PPFA 5E4OA 1KB9K 3MA7A 5ID0B 1QFUH 3CN1A 3EDDA 4M48H 5F0JB 1X4XA 3W38A 3QDJD 1HXKA 3CFCL 4X9YA 5KBDA 3T0EB 4CMHC 3DETD 4G7VH 3HG4A 2XC8A 5KVFH 2DEYX 1SDYA 4JRXE 4Q6YA 3H2QA 4FTVB 4Z7UA 1PSKL 2ZX6A 3K1DA 2TSBA 2D3NA 2YJQA 1YUHB 3MRFA 3U7WL 3L4CA 5GS2H 4J6RL 2YA1A 5DTFA 3VI3B 3BFQG 4HK3J 5KBMA 3NJIA 1HXYB 4CU8A 3KE0A 5C0JB 3BPLC 3U1PA 4HP5A 4UU9B 3MACH 4CL7A 1A9BB 1G5AA 1RJZA 1OSZA 5L7XL 5D7SL 5JW5B 2NXZB 1T89A 4RISL 5GJSL 2ZSVA 5IB3B 1QBBA 1IVLA 2FQGA 1G1YA 4K55A 4L4VA 4WTZG 1XH2A 4KUZL 3GHPA 5DZAA 4ZS6C 3QK0A 1GZQA 2PPCA 2Z1PA 4AEIH 3F83A 2G5UA 1B0GB 1J9QA 4ATWA 4PTTB 2JIXB 1JPFA 2WVTA 1SM3L 4YSDA 2DWDA 3OMAB 2NQCA 3MRHA 4PREA 3SDAA 5ITFA 4OCYL 4CJ0A 5L2KB 1OARH 4XE0A 1K4DB 4DNLA 2IBBA 1HEHC 4XOEA 3X11A 2OSYA 1WC7A 2HRGA 4GXVH 4KWUA 5DD0H 1U8KA 1MREH 4WEEA 5F8QC 3WV0A 3FSVA 1ZHBB 3RPIA 3QXVA 3IGLA 2OPCA 2ATPA 2Y7NA 4X5WB 2H7WA 1A4AA 1JI1A 3BH9B 4GO8A 2E47A 2NW3A 5EEWA 1BA9A 4IGBB 2UWEF 2V37A 2V4LA 2VOTA 4MB5A 4N2CA 2UX7A 3FRPB 3LIZH 4RESB 4GRLB 3DX7B 3QXDB 4PRPE 3HZKB 5JMRA 3BWUF 2B1HL 3CCHB 3CQQA 4HAFA 5AD0A 1QEXA 3ISRA 4WSGA 3ZVVA 5E4EC 5JOFB 4TS6A 3HE6C 2DJ4A 4OIIL 4OZGE 5CKGA 5GS1C 5C0JA 3NJNA 1R3LA 1I1FA 1PZ2A 3F6JA 3QDMA 2BC4B 1PY4A 4PRDA 1I1RA 1QPXA 1E2VA 4QPEA 5J3HD 4LCUB 5TDOB 3ZHDA 4F33A 1VACB 3EG9B 2CK0H 3E6FB 2V2XA 4GRWE 5F6HI 1NCAH 4OGAD 4UM8B 1PF3A 2AW2A 4FI7A 2WQXA 4MMZC 1AHMA 3WEMA 3R06A 4XXCA 3V4PA 4P5TA 2D7QA 5SWSD 1BAGA 3MLYL 2HB0A 1OVZA 5DEFA 1GJUA 1HZHL 5ES4B 4UQDA 5JUEH 5IB1B 4OGAC 1YEJH 3VWJB 2WUCH 3BGMB 1Z3GH 2H0PA 4U6VL 3SY6A 5BV7C 1PD1A 5T5FA 1F3JB 3GXNA 4U1MA 3EGXA 4DP5X 3A47A 3AS0A 1KJMA 4EZLA 1Z5HA 3MJGX 2DQGL 2H0JA 4JG1L 5BVJA 2YAMA 5EOCJ 1N9PA 4X5WA 1H3GA 4Y4KB 1INQB 4WU7A 2AQNA 1Q9WA 2UVEA 3A3YB 3K5SA 4OVVA 2W8CA 1TJMA 2H1XA 5IFHL 3F7VA 4FG4A 4PG2A 3V0AC 4KKNA 5LQBH 4R0LB 3KJ6L 3LD8B 4NRXA 4N20A 2J5LB 1XF4A 3G6DL 4KMLB 4XVTH 3WL9A 4LIQE 1MJJA 3BWSA 3CX5J 3KLLA 5D9SA 1KG0B 3MGOB 3WMQA 2EDLA 1PPIA 3FQNA 3U1SH 3PABB 1D7CA 3N43F 2V7NB 3MJ7A 1TPXB 1U3JA 1WJ3A 2IXQB 4R7NB 2XPZA 2QPFA 2WSPA 1WAAE 1OARL 1NDGA 3JWNE 4FMVA 2ZNXA 2P4AB 3GEWB 2BPBA 3LNFA 2Q6WB 2FLBT 2NNAA 2ID5A 4L1SA 5AOKA 5I5IA 4GB9A 3AREC 1C7SA 3HN8A 5AB1A 4KQ3L 2ZP8A 3H42H 2IFFL 3F2LA 3QUXA 3VXUE 3IFOB 1JNJA 4CN1A 4RWYH 4NO0A 3UPAA 2G4GA 4TM9A 3TO2B 3PWNA 3TIDA 2VC2B 4PJGB 3B1UA 4FQCH 1YY9C 3LZQA 5DVNA 4ZBJA 1KGXA 3BEWB 1UYWL 1WCBB 4P2OC 4P2CG 3U0PA 5JNYA 4HV8B 4LLDA 2FEEL 5I6MA 3MGAA 1NKRA 4QRPA 5E94B 4EVNA 3QFDA 1AZNA 2WN2A 1QLEL 2IG2L 4I0PB 2QFPA 3SJVE 5C70A 5HYJA 5EWIH 1FBIH 3PABA 1GKOA 4Q7DA 3ZHNA 3QUMH 4NIKB 1AGCB 2PUQT 5A2KH 5JZ7C 4CW1B 3DI3B 1JYNA 3LQZA 4KO7A 3W57A 4HWNA 3WTXA 1ZV2A 2ZAGA 4X6CF 3MA9H 2KERA 5HD8D 4PJXF 1S7TA 3VXPA 4XO9A 4PJEB 2V9QA 4P5TD 1T5XB 3T2QA 2BHYA 3H2PA 4YJZL 4P46B 2JKJA 4P9HH 1NMAH 1GZPB 4R0LC 3H3PL 1IGFH 3KL3A 1A6WL 1IC0A 4J6VA 1JUFA 2CQVA 4TUJB 4OVUA 1N8ZA 4PS4H 4BSVA 1QTYT 4D2NA 4NENA 3QJRB 4P2QB 4OUAB 1COBA 1LO5B 2J20A 1F6FB 4HH9A 4U6TA 4N2KA 2ZKHL 4AEEA 5T1MB 4OZFA 4A1RA 1I8IA 4MCYA 3AGWA 2WTRA 4NUPA 3GLDA 4JFOB 2HFTA 4OFIA 1EEZA 2ZCZA 5FECB 1CLZL 4OD2A 2WIMA 3GXIA 4MXWH 1RV6X 2ENYA 2BCMA 1KCRL 4MNQA 4WI6A 5IF0B 3ZJAA 2E7LC 1F3DJ 1UGNA 1GAFL 1KGWA 3UIZA 1EO8L 3T71A 1O75A 4PJEE 2W60A 4IRJC 1NIBA 1XGPA 3IMSA 1CXKA 3LJ3A 3PXJA 4UAOC 3OGOE 4IOSD 3SZKC 4WV1A 5DD1H 1J05A 3ULVD 2HWZH 1IGCH 3WS3B 1S78D 1RUPL 5FO8B 2JTDA 2I60H 1ACYH 4H7VA 1IAOB 5L9DL 5KW9H 4X5XA 4OUUB 1BAFH 3RNQB 4AEHL 3L2NA 2XN1A 1FORH 3MRLA 1KV3A 3OB0K 5DGRA 2GFBB 1T2JA 4G1MB 1YMHA 4X7SH 2QMKA 1OGSA 5HJGA 5DQ9A 4ZFGH 5C6PB 1OM3H 5DS1A 3NQKA 3KW8A 2XA3A 1CLVA 2ESVB 3CFBA 2YSSB 4M1DH 5DJ0B 3ZN6A 2ZX9A 3BCFA 2ZXGA 2K1MA 3BE1H 2W59A 2J1WA 4HUXB 3SBPA 5EEXA 3FQWB 4M43L 3WFEH 4X9BA 1AO7B 3OHXA 4KH9A 3ARDC 4MKMA 2Q5BA 4L9LA 1NCWH 4ZTPH 3CN2A 4Z7UF 1EAQA 1OW0C 3FBKA 5AOIA 1LO2L 1XH3A 5B1JA 2AQSA 2FBJH 3KPSE 4AXWA 4YXKL 4WGKA 3HG1D 3TVMA 5J6HA 5JOEA 4XO5A 4GG6F 3HKZA 5T3ZL 1Q72H 1MHCA 1RZKC 3U2JA 1CQKA 1XR8B 4QOKA 4BHUI 1YMMA 4FHKA 4YO0B 3WJLA 2Q76A 2IAMD 4JFUA 1MRFH 2J8UF 4Y1AB 3V0VA 4OU3A 2EEDA 1WFNA 2GI0A 3O11B 2TRHA 2W0FA 2GJ6D 2XTLA 4JZNA 4N8CL 4KITB 2H45A 3HC3L 1RQ5A 3HB3D 4M61B 5C0CE 3V6FB 2P43B 4PGDB 4PCYA 5BRZD 4PJCE 4HUNB 1OTUD 1A7OH 1E6JL 2DMGA 3DIVA 5HDOA 5B7MA 4H0LC 4KNUA 2XPGB 2Y1ZA 2KZKA 3DVNA 2EDHA 5KSUA 1TXKA 4YLBA 1OTUC 5DQ9B 1E5BA 2AVGA 3SPVB 1NEZA 4HLJA 4R6UA 3K6DA 3NOIA 5I8KL 1O5DT 3MRRA 2DM4A 2A0LD 4KJYA 5F6HJ 1EWHA 1TYRA 3QG6A 1CICC 1CE6B 1MHHA 4OKVA 5FHAL 1EO8H 4IJTA 2K4AA 1S8DB 5HY9B 4U3XA 1ZLSH 1F97A 1T0PB 3H9SA 3HR5A 2FZ3B 3VACA 2F7IA 4PY8J 2ICWJ 3QZMA 3FYEB 1U3NA 2MSPA 4JJ5B 4ZMQA 1IGCL 1RJLB 3GSNA 4WV1B 4LESA 3QZOA 3CC5B 2EDOA 4ZW3A 4KO5A 1HHIB 1IGYB 2GTQA 4K8RH 3L4UA 4RMRA 4QJ4B 1X5JA 4IRZL 2DEXX 4OGZA 3BEWA 3IXTA 1X7SA 5TE4L 4AYGA 2LU3A 2HRLA 4UAOB 1M6OA 4Q4IA 2XZQL 4B0MB 5MEND 3L4VA 2AQTA 5LJYH 5AVVB 2J8UA 3CPUA 5HHMB 1RUQH 3JYCA 1FP5A 3TGXA 2WKOF 1KBBA 4Y5VC 1HK6A 5J1SC 1IBYA 5E08H 2BDNH 5DS2A 2NUPB 1T20B 5C2BL 1AFVH 1MY7A 2QJDA 1HVXA 3C8KA 4N87A 2Y25A 1BWMA 3FNKA 1M2OA 4IBQA 1R3JB 3JTSA 3Q6GL 3WEAA 2OQJB 3BAEH 1CD8A 2Z31D 2FEEI 1P4BL 2LGNA 4AITA 4HZAA 2DL2A 3W5NA 4CA4A 2XY2A 3B6SA 3T77A 2RGSA 5IB5B 2OJ1A 4N0FB 1SHWA 5BO0D 1FZOB 2LT9A 4KKBC 4YH6A 3U46B 1MI5B 3FYIB 2XTJD 1MJ7L 3ECVA 3PUUA 1ZIAA 2R83A 3S98A 5KSBF 2O93L 3MBEB 3A4DA 4OF7A 1CL7L 3V52H 2L7QA 3DGCR 1CFBA 1EV2E 2QQLL 2ZOTA 4G7YL 3II1A 5F2FA 5C0GA 4G9FD 3SDXB 4DCQA 5DT1H 5K9OA 2GCYA 2IAAC 4KKRA 4Z8FL 3AJ7A 3HBPA 4ZDHB 1INQA 2EDEA 1CTOA 1KJ3L 4LSPH 1IKOP 3S8WA 1IEHA 2KDYA 1JVLA 4N2FA 4UIKL 1MFDL 3UCRA 2AANA 4Z7VF 5HHMD 4C57C 2GIMA 2Z34A 4N6QA 1ORSB 3LOWA 1A6ZB 1MVUB 4N9GB 2DMBA 3GZPA 1WAEA 4LDCA 5D2NB 1H5BA 1Z5LB 2BIIA 2HG5B 4MA8L 4KGLA 1KUMA 3IDGB 3QHZL 3RUGB 2DKSA 3IFOA 4HUWA 3ZZ1A 2A6KA 2ETWA 1DVYA 4JE0A 2VR3A 3OZ9H 4GSUA 3N85L 3I9AA 3KYKH 2WWKT 3MV8E 4XPTL 3JWNC 4MNGA 3QRGH 5C71A 1T66D 1FFOB 4A6YB 5CU5A 4TQIA 2FJFB 2E7HA 5EV7A 1YYCA 4Y16A 1X5LA 5IFJB 1I7TA 4PJ7E 3Q5YA 3OVUB 5ESVB 2YK1H 2LFEA 4G9FB 4LEEA 2Y1VA 2HFEA 3VQMA 3KVQA 2VAAB 1JDDA 1P7QA 5F1IA 3W2DL 2E6JA 2WBJC 1HQRA 1MKFA 1G4MA 1ZTXL 3B9KC 3MR9B 3LCYA 3FQWA 2VW7A 4MJIB 1N8ZB 2HFGL 3WFBH 1JWMB 1P6AB 3E6HB 3OKLB 5GGTH 4HCIA 2BVEA 1Q9WB 5C0BA 4YSPA 2X40A 2B1HH 3RPIB 3TM6A 1E8XA 2OMYA 3MZGB 3MV8B 1KYOK 4PJ9B 3F7VB 4FX5A 1IIIA 2YEZA 1J1XL 4P46C 4NN5C 3D08A 3FSAA 5LGKA 1G7IA 4HS8L 3MLUL 2XYBA 3QIUA 3VYOA 2O5YL 5DD5L 5DQJA 3RZWA 1NM4A 1DCLA 1YQVH 2LW3A 2VAJA 3ARSA 4CC1A 4F92B 3BKJH 2EYRB 4HHGA 1SLXA 4DPBX 2EDBA 1BPLB 5HHNB 4L3ED 4PJDA 4JRXA 3MLZL 4YK4C 3ASWA 2O6PA 3EJJX 2DF3A 3GMRB 2YFOA 1J10A 2CRYA 2AXHA 5DT1L 2ILLA 2ZCHL 3BDBA 5D1ZC 1T7ZA 2F7PA 2D4FA 5GS0L 5I66B 1VHPA 3IMWA 3QSKB 1JWMA 5KSAB 4BDVA 1M3JA 3QORC 2JJSC 2ENJA 2Q3ZA 4N5ED 3KHOA 3QFJD 5JYLA 4WFHE 1YQ2A 3I2CH 5E6SB 5IUSA 3DOSA 3SKOB 4AMKL 3RVWD 1IM3B 5KSAC 5JW3H 1J0KA 1JHTB 1MHEA 2X0VA 2IBGA 4YXHL 4MBOA 3RGHA 2VLJD 1LLAA 2WC7A 1G9ML 5L88H 5D7LB 3WGUB 3CPLB 1IBZA 3E3QE 4GAYB 3T3PB 4ABQA 3KYKL 2QQKL 4TMPA 5ADPL 1YAZA 1CYWA 1NMBL 4ANVA 2FR4B 1TYEB 5AUMB 1T6WA 4X8CA 5AVWB 5BNXD 3ZKND 2MQ3A 2F8OA 4ORZC 3LMJL 4AGLA 3ROLA 1R46A 2YK1L 4P07A 4W6XB 2ENSA 2VUOA 4H5SA 4ODHL 3BT2H 3NIFF 5DURB 3QFJA 2F15A 1DSYA 3QEQA 2EIMB 4JFFE 3ZSSA 3CFBB 1K5NA 2W9DL 1MVUA 3PWVA 4OCSL 4Z0YA 2BNUA 2DICA 1XHHA 1KXQE 4G7VL 4WUKL 2FRGP 5EU7C 4RWYL 4S1QH 2VLLB 1ZTXH 5IT2H 2AXGB 1JZGA 1IFRA 5DRWB 4CVZA 1XH0A 4FQCL 3PGDB 2HUHA 3V8OA 1MLBB 4G8IA 4HS6A 1G0DA 4LLWB 1PZDA 1YNTB 5C0DB 4XZUB 1DQJA 5F1NB 4K2UL 3VXRE 1P4IL 3MNWB 4HFUH 3PQYD 2J6EA 3O4LB 4JQXC 3BW9B 3O45A 1HH9B 2YMTA 4W9KC 1OP4A 3WXWH 3V0EA 2E7LA 1CD0A 2D3JA 3MLUH 4HCRL 1OB1B 4ZTOL 3MBWA 4A2MA 2XKUA 2Y06L 4KRPB 1RUKL 3BDXA 1XGPB 3CXHJ 3BKJL 3IPEA 1NGZB 1GOHA 3GBNL 2EC9T 1FN4B 4JLRB 5ICZB 2DM7A 4X4XA 2EIBA 4HD4A 2ZUVA 4PJDB 4Z0XB 3CHPA 2VO5A 2JKLA 2AEIT 2KPWA 4Y9FA 5BOJA 3VG0H 2MTAA 3P0VH 1XMEB 2VDQH 2JKRM 4FNSA 3QIUB 3BD4A 3Q2NA 4NUJB 4WI5A 5TH2A 1K9TA 2NUTB 4FYQA 4Z7NB 4J3BA 2R51A 3LH2L 4I0PC 4QDGA 3U82B 4XNMB 1GVIA 3UTSA 3B3IA 4RVBA 5I19H 1UZ8B 4JRYD 1G7HA 3ZE0F 1G7MA 2ZJSH 1NH6A 3PWVB 3AC0A 4DZ8B 1TKWB 2VLKE 2X88A 2NY3B 3W39A 4OCWL 2VNCA 4N22A 3S5LB 1B6UA 2XQBH 1I8UA 3X3GH 5BRPA 2HLAA 3S35L 5DJ6B 3LYRA 3PDOB 3V4UL 5JHLL 3GSOA 5MENB 1EAJA 3K0YA 2W9EH 4FOMA 1WHPA 4XTRC 5L8KB 1PYWA 4IRSC 3SGDI 5IG7A 2BSED 4BE5A 3D0LA 3T3PE 2KZBA 4RBPH 4NO0D 5KOVC 3LPOA 4NUJA 2R0ZH 2ODHA 1YYLL 1I8MA 4JJ5A 3P73B 5L6YH 5DJZA 4RFNB 2NSMA 3GBEA 5E6RB 2ITDB 4GP5B 4U7MA 4JMNA 1KYAA 4HQQL 4OFVA 3PWJA 3UG3A 4KKBD 2J1XA 3FHEA 1CS6A 3DXAB 4OZ4A 3TP4A 1MCHA 1A14H 3FUFA 4GAGL 2NXZC 3MJ6A 1KN4L 2HX8A 1KCLA 4P2RE 1H6UA 1NCCH 3SDDB 2CXGA 4JY4B 4XB8A 4YLCA 4IKNA 1PLGH 3IFNL 3KPLB 2R2BB 7TAAA 3AREA 4QRPE 4GKLA 4I2XA 4KTDL 1HHKA 3TIDB 3PHOA 5BV7L 3GBLA 5FDWA 4HEME 1KEGL 2MPAH 3SB3A 2FX8L 4Y9BA 2ZTBA 1SEBA 1BZ7A 1IARB 2VABA 1A6ZA 2NY4D 1IT9L 1DDTA 5FYLL 5CN3A 4UTAH 4GO6B 1F1AA 3WFEL 2FSDA 1E5CA 4JKNA 3BXNA 2V3EA 3WIAA 3BPCB 4W9FC 4Y5VA 2EIDA 3DWTA 3KS0H 4P0DA 3VE0B 1A1NA 4Y1AD 1BEXA 1MEXL 4L29B 4RGOH 4YXKH 5I1KH 1I1AA 3MAWA 4IEFA 1ACXA 5GRUL 4MMXC 3ZZLA 4NNYB 1ZVSB 3F7RA 4QD2E 3UTTE 3P73A 1TFPA 4M8QB 5D2NE 1NEPA 5AKRA 4L9LB 5G2NA 1CDGA 3EGSB 4RAVB 3ARED 4NCDA 2ZT9C 5BO1L 1JPFB 4RMQA 4ENED 1ZLUH 4JDZA 2H9GA 4G6ML 4PIBA 3BH8A 2ZZUT 4X6CB 1OK8A 1EAPB 3VFVB 5EUOE 4TVUA 2VZ3A 2VCOA 4ELMF 5L2JB 2G30A 3QDMD 1W72L 4G6JH 1CLOH 5E95B 4GLRH 3FT1A 5JW5A 5L8LB 3KZ8A 4XMWA 5A2IH 5IEHA 1ZAGA 4P9HC 3MR9A 1K3IA 3JVFC 4GQRA 4K3EL 3FN0L 1OQOA 1FUNA 2E9IA 1HU8A 2EVHA 1ZK5A 1F18A 1OE2A 4UQ3B 2ADIA 1NINA 4DOHB 2X1PA 1NOAA 1XGTA 3TJEL 3RWJB 3CFKA 3HB3C 4L0PB 4MJJA 2DH2A 4J8RA 1EFXB 1QVOA 2OXGA 4Q9RH 4LDOB 4LLMB 3TO4B 1P5UC 1ULVA 4LSTH 1THAA 5AW1B 4F8TA 2F54E 4LCWB 4XHQA 5B38B 2FEDC 4C4KO 3M7OA 1KZYA 5I1HL 4G9DB 2FX7L 1UVQA 3QDMB 4B9IA 2ZYRA 1DSFL 2JJTA 4JFDB 1YN6B 4UT7H 2YBGA 3VD4A 2YA2A 4IHOB 3KCPA 4ETQA 5EU5A 3PJSB 2Y2WA 4GAGH 4R84A 3CFDA 1FO0B 3MODL 1OCRB 3W1ZA 4OLWL 3ZR5A 3B7SA 1RPKA 3QQ3A 4JFOA 1QFWI 3S7GA 3U9UA 2I9TA 3WJMA 3QJUB 4LASL 5I30H 2Z8SA 2XZCH 3E0GA 3UDWA 1UT2A 2H5UA 1RUQL 5I6NA 4PJ9A 2FBRA 5LHDA 3N1MC 2R8SH 4K3JL 2W88A 4TUOA 2BNUB 2E9JA 3IRCA 4LCIL 1GKEA 3C5SB 1MJ8H 2K8MA 5ISZB 3L6FA 3PY9A 3EJRA 3IWVA 1A25A 5IHHA 1WC7B 1R4XA 1D5MB 3O6FD 4N8UA 3H2WA 1QW8A 3IJEB 5J1AB 1C5DB 5D1QA 1XF3A 2GTWB 3DTXA 4PY7A 3GUFA 3SE8H 3D2UA 3DPBB 3B8YA 1NCBL 2LE9A 2ICEA 1R5IA 3DMMA 1KIRA 4QKTA 3IAGC 4J23A 1YPZE 4XPBL 1PY9A 3UAJC 4R4BA 4MAYD 1IBGL 4U1NA 2UWEA 1F02I 1DBJH 1QRNE 3K6FA 1MFEH 1CZ8L 4PLJD 1RK1A 2MOQA 2R1WB 1NBZB 4JO2L 2F1BA 1LEGB 2DQHL 3KPRA 4WDIB 3ALXA 3Q13A 3FU5A 5T5FH 2VITB 4XCEA 3REWB 1UXLA 2NY1D 3ILPA 3P2BA 1U8QA 3KPSA 4MA7H 2VZ1A 2KBGA 2EXSA 2X4SB 3BP4A 3RWIA 3SGJC 2D31B 2DRUA 3ASNB 3CFJA 4P3DA 2NYYC 1VEPA 4JFED 2AVFA 4F2FA 3EF7A 3N0PB 5ISZA 3TTSA 5H8DA 4FL4B 5KYNA 2F53E 1QNIA 2Z0UA 4JFXA 4MYPA 1ADWA 4GG6B 2DLHA 5IKCB 5AOMA 1T1ZA 3H54A 1GCYA 5EULV 3S37L 4HXBH 1HE8A 3HE7A 2V0AA 3IDIB 1EHLL 2GVYA 2Q86B 3U30B 2R39A 4MA1B 1HN1A 2DPKA 3KDPB 1ACCA 2PPAA 3OKKB 1HZLA 1E50A 1CBJA 1QI3A 4FNRA 2DKUA 4CSSA 4DTGL 4HC1L 5FEBA 1H19A 5AEAA 3TA3B 4OLXH 2LAGB 5DO2C 3SKMB 2GHWB 4M5YL 2RA1A 3MBEA 4UT7L 5H35B 1VFAA 5A7EA 2ZKWA 4H88H 5D1XD 3T2LA 2EINB 3VFOB 5CR8A 4YBQD 4QXTB 2ZUUA 35C8L 4PIRF 2L3BA 4WW2A 1M6UA 4GFXA 4LL1A 1LK2B 4FE9A 4OM1L 4MRBA 4PG2C 1LP9F 3H9HB 5C8JA 4Y4KA 4CAGA 5IEKB 4E41A 3ORJA 4G7RB 4WENB 1A47A 2WVSA 2VH5H 3TNNB 4WVRA 5D4IA 3WFCL 2X4OA 5F7EL 2UYLA 4XNMA 2L7JA 4V33A 3EJYC 5D2LE 4J5VA 1IX2A 3U4EA 3GJEB 3DNKA 1FHNA 2VAAA 2Y7OA 2E5EA 4PWGA 3O6MH 1FVCB 2DM2A 5JHLA 4YO0A 4QO1A 4KAQL 4B9GA 1L0YA 5AOJA 4D0CB 5MEQB 1I7RB 1KLFB 3H9HA 3DVIA 1CJYA 2O5YH 4XNBA 4N8PA 1A3ZA 4UIMB 4WJ5B 5I82A 4NC1C 5HYSA 3LEVH 2YAFA 5C0BD 4AXWB 3QUXC 1P1ZA 3HE6D 4X7CC 4DN4L 3MYJA 4LPTA 5GSVA 3FN3A 4HWBH 4JM0A 3W9EB 1MAML 1UD5A 1NZRA 5MERA 2ZWDA 4P4RB 4BFRA 5JOFA 1KYFA 3D4GA 1ROWA 2W0KA 4WHTB 2EYRA 1KXVC 3NCYS 2B5IB 4PJHB 1N0XH 3EO1A 5GGSA 1UUSA 4FXGB 1WDAA 2DZEA 1ZT1A 4XMKL 3AXIA 2LVCA 4Q74A 4LCVA 1INEL 1QPPA 4L37B 5T3XH 2QZ5A 1RIUH 5AW2B 1VGEH 2Y1AA 1S6NA 2LU4A 1HL9A 2AJ3B 2BOCB 3BSZH 4HCRA 1D5ZA 3UP1A 4UNIA 5C6WH 1D5RA 1WFUA 2GCYB 3NSJA 3WDHA 1Z3RA 3VFWA 4L4TD 3VTMA 2I9LB 3PJLA 5FO8A 4FTVD 1BFOA 4TVSa 3ULAB 3P9LA 3JT2A 1G7JB 2VR9A 3MRHB 4PREB 5ITFB 3SDAB 3ZTEA 5C7XH 3TXAA 3UJIL 5C09A 5B3JF 4PHZA 3HAEB 5J4MA 3L3OC 2AP2A 3PV7A 3QWNA 1SEQH 4WGVB 2I25N 1KTRL 4EKXA 4MDIA 2NY2C 4L4VB 1UKQA 5DVKA 4MAYA 2R59A 1TQUA 4M62H 4KMTL 4YSOA 5IBTL 2CCLA 5B8CA 1J12A 5E2TL 3THMH 1A9BA 3V0FA 2V5MA 3BT2L 1F13A 3CN3A 1IC7H 1O6VA 4HPOL 3GXDA 4G80B 1D7DA 3WSQL 2EVJA 4F9PC 5IW1B 5D5MA 4N6RA 1U8NA 2FJHA 4U3SA 3FF7A 2EDFA 1PYWB 5IG7B 1JZ6A 2CIKB 2QR0B 2J8UB 1KPUA 4W9JC 3TTYA 5FYKU 3ZHFA 4DT2A 1XX9C 4R2GD 1MW3A 5AAWA 5DEGA 1Y07A 5JHBA 1EMTH 2NXYD 3M88A 4KRPC 4OLVL 1YEKH 4LCYB 4R5TA 4XPAH 5F96H 5AKVA 3S5LA 1OD7A 1FNGB 4ONOA 4WFHD 5E7BA 4XNDA 2APFA 2ZOKA 4I0KA 4TUOB 1ERNA 5CILL 2CJ3A 3HHMA 4OGYL 3LS4H 3UO8B 2BP8B 1A8ZA 3ABKB 2Z9TA 1MG2C 4V1DD 1INDH 1CXLA 1P9MA 3FB6B 3ARFA 4RZKA 2NUTA 4B9CA 5E8PA 4QRRD 1UEMA 3IMVA 1BXVA 2XN2A 2XBZA 5E8DH 4BZ1A 2DEWX 2R4SH 5J11B 5GGRB 1BUGA 3GNMH 1LMKA 3SYAA 3LSOB 3LNEA 1MCOL 1IE4A 3TONA 3ATEA 3APFA 3IETA 1A7NH 2QQQA 3GQFA 4NS0A 4P9MH 3Q48A 3HN5A 4LXFA 4QLRA 4H1LA 5DJXA 2VSCA 3BOVA 1CB4A 5D1ZD 1BFSA 5JW4Q 1C12B 2L4OA 5IW6A 3O6KL 4AUUA 3E6FA 3L48A 3TV8A 4GAJH 3ZKMC 1MRDL 4YDIL 2WQUA 5IV2A 4UQIM 3RVUC 3OWEA 4GAFB 3JV6A 2N1KA 4YWGH 4BFKA 5D7LD 4PGEA 2OI9C 1D6EB 3J27A 1MFCL 4NSKB 2H1LM 3E1ZA 4XAKD 5F1OB 4BKTC 2NUPA 4ZXBA 4GINA 4ADGA 1VZGA 5IHZB 5CSZA 1ZHLA 3ARGB 1TSHA 1D9KD 3O6LL 3GMNB 4HUKB 3RWGA 4E9VA 1E4WH 2X4NB 3C87A 3BAWA 4F15B 4XX1E 1XAKA 3BAYA 5ABZA 3LIZA 1GJWA 3QFJE 3MTXA 3TF4A 1H15A 3NP4A 5DMJB 4RDBA 5B4MC 4HF5L 4NRXB 4YGAB 4OZIB 4R26L 2UUDH 4N1HB 5D1ZB 3P3TA 3WS6A 1KULA 1PZ3A 1UH2A 2W07B 3NIDF 1BBDH 2FK9A 1FIEA 3A5VA 3L5XH 4NO5A 4LPVA 2FEJA 1PKOA 3IDJA 1L9RA 3RQ3A 1G6RL 2V9TA 1FVEA 5HGGS 5GS0H 3C5SA 1AZZC 5BS0D 1NBQA 4DP8X 1KF9B 3IVKA 2VC2L 5FFLA 3L5HA 3GI9H 4UB0H 1QBLL 3CZEA 3TPKA 1MNUL 2FX8H 1EMTL 3ARQA 1B6DA 1U8PA 2EADA 2WUBH 2F5BL 3KYOA 3LKSA 4XMLL 2AJSL 3ASOB 3BGMA 3BDYH 1CDBA 3PWNB 4F8NA 4KFMA 4AQ8A 3FUHA 4Y4HC 1P69B 3HVNA 3W9EA 1S3KL 3CJJA 4KXZI 4XOBA 3ZRFC 1Z5YD 2NRDA 2R1XA 3RWFA 2E7MA 2VJXA 3OG4B 2R4SL 5K9KB 2NW2A 2VMJA 2YUVA 4MFHA 1IBFA 4QWWD 3WNJA 4PRDB 3QJSB 2CNZA 1AD0A 4LVNC 4OCYH 3WKML 1OGTB 2H47C 2ORBL 4HMCA 4KKQA 3PAVA 4PV1C 1EA9C 3S3BB 1QBMH 1H8LA 4FYSA 3C5ZB 4Z23A 4JPIB 3ULVH 4WQOA 1C7TA 4G6MH 4ZO6A 5HYQB 4FN0A 4S0HA 3GS4A 2EDMA 3MRQA 2WBWB 1BX2A 1XB8A 3N9GL 5CMAA 4Z3HA 2RQEA 1B4RA 2UZPA 3QQ9D 4HFWA 5AVSB 3T09A 3ABMB 5I15L 2IVFC 5KTEH 2UY6B 1KXTA 4BQ8A 2FT7A 4OTXH 1T5KA 2HJFB 3GI8H 1ZT7A 4K71B 1JUFB 4Q14A 4UUJB 5GS1B 2OSWA 5AW5B 1IKNC 3BX7C 1J8SA 1T5WB 4QHLA 3CK0L 4KJWD 1P4IH 1HAWA 3Q6FA 3UTTB 2A6IA 2EVGA 3TZVD 3U4KA 5DHMC 4JPKH 1OAJA 4RGNB 1ZT1B 5CS7A 4KKLD 5L2KA 4YMPA 3CX2A 1NICA 3QYCA 5HDLA 4NB7A 3KWVA 3UGUA 4HEPG 3HE6A 4PJBB 4XZ4A 5T1LA 5BZDA 4DUVA 3MOAL 1IAOA 3GBNH 3DX9B 3FU9A 3MJ9H 3C5ZA 4FQ2H 3VDAA 4HKBB 4HEMA 3WFDL 2ZKYA 2EO1A 3COOA 1Z2KA 3MCKA 3U83A 3KJ4C 5T33L 3SPVA 4DEUA 2LOEA 1EJOL 1WP6A 1Z3GL 1OSPL 1EGJA 2VM9A 4LLVB 4UOW0 4WJ5A 3X1NA 1H9DA 2R29A 4JFXB 3MRBA 4KK5C 1Q94B 2XTJE 3B9DA 4GKOA 4Z7WE 4EN3C 1IKNA 2OCCB 4NZTL 5ILTL 5D70H 4Z7OB 2CA4A 1RP9A 2XPGA 3WAKA 2H2PC 3K4DA 3MNZA 5T3XE 2DD8H 3R0MA 5J6GB 1KY7A 3IXAB 4F1ZA 1Q0XL 3SGDH 3C60B 4XBPB 4Y4KD 2DQTL 2MNUA 1AZVA 5EO0B 3A24A 4NZUL 1ASPA 1K2DB 3S35H 2I5YH 1FIGL 3ARDA 3KPRB 3MLPA 3AU1B 2IPKB 5D7IF 4DGYH 2I85A 2N59A 3EYFB 1MWAB 2AXGA 5KVDE 4G6AC 1Q9KA 4X4ZA 1E4XI 5C0AA 3OAUL 2EH7L 4CSPA 2L8AA 1QAWA 2MPVA 1FVEB 1S3KH 4IBUA 1AI1L 4IBVA 4KK9D 2X4UA 2ED7A 1ORQB 2DV6A 5CLTA 5BRQA 2A9AA 4Y88A 1AZCA 2CJSA 4YHKH 4ZPVB 3VGAC 3T8MA 1F4HA 3I85A 1Z9SB 1T5XA 4PJ5B 5FGBA 1DP0A 5H35A 2VW6A 1E9OB 5CZXC 5IQ7L 4TOYL 3IDYB 5DMIH 2ZWZA 5ECGA 1T2QH 4YL4A 2IOMA 4ZAKA 2OULB 4W4OA 1F4XL 3PDOA 3VW3L 5HGDA 1RCYA 1J8RA 2BY2A 1JF1B 3LQMA 3WD5L 5C3LD 2HTKD 2WKGA 4E9SA 1YDPB 2GK0A 3AWVA 4OT1L 3IJ7A 2BJML 3UBGA 3BPCA 4B60A 1FG9C 1UXMA 3OKDA 4KI5E 4IMLA 2EYSA 5JOPE 1OOWA 5F3HA 1VA9A 4XP9L 1JGLH 1QABA 4JGMA 5I1JH 1H8SA 1OGAE 1AXTL 3QUYC 4KTGA 4AYBA 1T1YA 1UOLA 1DQML 3VGAB 1OTTD 3FN9A 4G8GA 3VU1A 4EI5C 3FMGH 1E90A 3IDNB 4JDVB 4EDWL 4R4ND 3GDBA 5HSFA 4O58H 4PJIB 1JRHI 5DZOA 2RFXA 3ERXA 4FQ1H 4JFSA 1GMEA 1XMWA 1S7UA 2R7EA 4JRYA 4WTQA 1ASOA 1SYSA 1I7ZA 5A2LH 2NNCA 4R4BB 4WNQA 5DR5H 2X3CA 3TOPA 3QWOB 2XFXA 3IDNA 3I9GL 3OAWA 3RX8A 5EEYA 4N86A 3CLFH 4UQ3A 2RCSL 1RHHB 4XR8C 3RFZB 2HN7B 3WKQA 2JMRA 3DUUA 3MRRB 4TF4A 4B50A 4UYQA 1W72H 1BOGB 4G6JL 3ZDZB 4BD4A 3UC2A 2E86A 5F7EH 4K3DH 4BSVB 3R0NA 4LVOB 2QPSA 3O4OC 3T6ZA 3VXTA 3CMOL 3ULUL 3SDDD 2R15A 1O9ZA 4GSRA 4P4KD 3X17A 4XCFL 1TZOA 3DHJA 4M1CD 3OXRA 4X6EA 3QJTB 1S9XB 3U7AA 4ZYKA 1IEBB 1V54B 3AU0A 1KCRH 1HCFX 2Q87A 4HJEA 2WO4A 4PGDA 4ABWA 1JCKA 1XTLA 5HVHC 3HNSL 1DBKL 2WXMA 1AI1H 3JWDC 5D6DA 4HBCL 1BZDA 5HYQA 1MCDA 5JIKA 2YD1A 2NTSP 4YEEA 5IHUL 3B2UD 2VDQB 2Y9XA 3LPFA 4KH2A 4OF3A 5E4AA 3TV3H 3UAFA 4LVEA 3KLHC 1M7DA 4EN3D 1VERA 1RUPH 5F0LB 4X9HA 4JRYB 2TAAA 1QSFB 1T0NA 3BKCH 4FQQA 4F33B 1AZUA 4HD7A 3H7LA 1E3FA 5CWSA 1DSWA 5I1DB 5I30L 2SODB 4HIJA 3AWXA 4PUBL 4AV4A 2PLTA 2ADGB 2GITA 1ZLVK 4R90L 3OPZL 1GGTA 1Z0NA 3E38A 1RXLA 1A5FH 4ZOCA 3TBSB 5HPOA 1XL6A 4IK7A 4Z76A 3NCEB 2G60L 3L1FA 4GQ9L 3CHQA 4POUB 5IVXA 3ZTDC 2MHAA 1TTBA 5IWLA 3BE1L 4QRRA 3T3ME 1IQWH 3QWRA 3VSUA 5KJRH 4W68A 1TVHA 3RFRA 5D1QC 4EDWH 2FL5B 1GHFL 3IVKB 3KPPB 4LSSL 1Y1UA 1XF5A 4ESKA 1JXGA 4RMBA 3MNVB 1DVQA 1Q9OA 3TA3C 4BCYA 3UJIH 4FQIH 1NAKH 4PP1C 5D7IE 1TFHA 3KBEA 4CJ1A 4WI7A 1UENA 4Y4FC 1GC1H 3EXJA 3EOAB 1WD8A 1S7RA 2W07A 4JO4H 5F3BA 4U1KA 4ZOBA 2Z7UA 2BSRA 2CG9X 2CIIB 1L9MA 3HZ3A 2QMJA 5LXVA 1A6VH 3TNMB 3WJLC 5DQDH 4AJVA 4KMTH 1QASA 5DR5L 4KY1H 5E2VL 1DDHB 3NAAH 1QWHA 3VVWA 3N40F 4E9XA 4HSAC 5EO9B 1CFSA 4J3WA 2YRBA 3VGEA 4PBDA 4OCXH 1SFHA 1FL3A 3ET9F 5ANMA 1ZS8A 1QEWB 4TSBL 1TKWA 2OX5A 4NQEA 2NY4C 1A7OL 2FUQA 1KIPB 1NC4A 2DQUL 1F8TH 1TTUA 4N8VG 3IMBA 4R7XA 5A40E 5A6MA 1HSAB 1S2EA 2B20A 3D18A 4FFYH 2W1NA 1ETA1 2X70B 4HH9B 2AFNA 5CUSH 1F4WH 5DHVH 1U8CB 4HXBL 2A9NL 2BERA 3QO1B 1SXSA 3ELQA 1CD9B 2P42B 1CICD 1CF1A 1WUZA 5CLYA 2GPZA 1PG7H 1WWAX 4LIQL 1YCSA 3EFFB 3GNML 5DJ2B 4OF5A 5E5UB 4RFEB 3RBGA 1ONQA 4DTGH 2PW2B 2GY5A 3WMSA 2KH2B 2LTQB 4F7PA 4X7FC 3EO0B 4TL5A 3I75B 1BQ5A 4OV5A 1TJXA 1SUHA 2AK1H 5FYKH 1E7UA 3F7PC 3RKDC 4ZFOA 4MTMA 1PFOA 1A4BA 5LNGA 4KHXL 4AEFA 3D39D 4LHQB 4ZMOA 4E9LA 1R3IL 4GRWH 1BOYA 4S1RL 5GGRA 4XBEH 5EIIA 2FJUB 3BMWA 2DBLL 2OMXA 3L08A 4LHUD 3HLKA 1G0XA 4OAWB 1W8OA 3OWRA 3OAZH 4KK6C 3PGDA 3UBXG 3DHUA 2KC0A 2W38A 4G9FE 2A9ML 2LQRA 1MFCH 1BHGA 5C0IB 1I9RH 2FX9L 2G60H 2ARJQ 2QFRA 2ZWGA 2KLTA 1FFTB 1VIWA 3HJ0A 1QFOA 3M1BB 3LQAL 4GRLD 1KCSH 1EGJL 4X6FB 1RZKH 3PGFL 1D5XB 1P5UA 3N50A 5CZRA 5C0FA 2VERN 1HCYA 1G7HB 3BVWA 3VXSB 3NZHL 3OKEB 3LVTA 1ADQL 5F9AC 3UYPB 3U36B 1FDLL 4O2CA 1A9EB 3HIZA 1KZQA 3AQXA 1AR1D 4LSUH 2IDFA 2VLME 3MRIA 4F8QA 3ESOA 3C75A 5ESAA 1XVSA 3G5ZB 3WY2A 4GI8A 1FLTX 4DN4H 3MRCB 2UWEB 3US1A 1ZOXA 1KWKA 4JGNA 3SCMA 5F93C 3ES6A 3WIFB 1LP9B 3VWJC 3NAAL 3T4YA 3LY6A 4XMZA 5IMLA 4LSDA 1MJJB 1BEYL 5LN8A 2EEAA 1N19A 4GXUM 3PWLB 1XCXA 5I3AA 2X2JA 3RWEA 4DESA 3QXAA 1QYGL 1T6BX 5H94B 2FECI 2XBDA 3QZPA 4JX0A 1QBLH 3LKOA 4FXKA 4AKQA 3FU0A 2ZG1A 4LOFA 4OD3H 1BFVL 2GUOB 4JS7A 4M1GH 3VTAA 4PB0L 3RGVB 3SGKA 2YSSA 1SQMA 4N9GA 3P54A 5B21A 5A7BA 1T22B 5AW4B 3T0ED 2FIKB 2KQNA 2X5PA 3N1FC 1XEUA 3O41B 4HJ1A 3VXRB 1WK0A 3GMPA 1RJLA 3CHXA 1S7VA 1DBMH 2AXJA 5CAYB 1TJGL 3A4FA 1YEDB 2CLZB 5D6CA 5JHDA 1JGUL 4FA7B 1OE3A 4IGBC 3S88H 2J2ZA 4X7DC 2YOAA 1X5ZA 4R7VA 3SKNA 1XWVA 4W4NA 3VG9C 4LKCB 1EZUA 5DFVD 1WA0X 3BPOC 2ZX8A 4Z7VE 1I3RA 1KCVH 4P99A 3RDTB 3VGFA 2EDYA 4K7FB 3ARGD 1WBXB 5ACMA 3TIEB 1HDMB