3QJOA

Refined structure of the functional unit (klh1-h) of keyhole limpet hemocyanin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
491
structure length
491
Chain Sequence
ILVRKNIHSLSHHEAEELRDALYKLQNDESHGGYEHIAGFHGYPNLCPEKGDEKYPCCVHGMSIFPHWHRLHTIQFERALKKHGSHLGIPYWDWTQTISSLPTFFADSGNNNPFFKYHIRSINQDTVRDVNEAIFQQTKFGEFSSIFYLALQALEEDNYCDFEVQYEILHNEVHALIGGAEKYSMSTLEYSAFDPYFMIHHASLDKIWIIWQELQKRRVKPAHAGSCAGDIMHVPLHPFNYESVNNDDFTRENSLPNAVVDSHRFNYKYDNLNLHGHNIEELEEVLRSLRLKSRVFAGFVLSGIRTTAVVKVYIKSGTDSDDEYAGSFVILGGAKEMPWAYERLYRFDITETVHNLNLTDDHVKFRFDLKKYDHTELDASVLPAPIIVRRPNNAVFDIIEIPIGKDVNLPPKVVVKRGTKIMFMSVDEAVTTPMLNLGSYTAMFKCKVPPFSFHAFELGKMYSVESGDYFMTASTTELCNDNNLRIHVHVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hemocyanin 1
publication title The refined structure of functional unit h of keyhole limpet hemocyanin (KLH1-h) reveals disulfide bridges.
pubmed doi rcsb
molecule tags Oxygen binding
total genus 94
structure length 491
sequence length 491
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00264 Tyrosinase Common central domain of tyrosinase
A PF14830 Haemocyan_bet_s Haemocyanin beta-sandwich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 3qjoA01
2.60.40.2570 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qjoA03
2.60.310.10 Mainly Beta Sandwich Hemocyanin; Chain: A, domain 2 Haemocyanin C-terminal domain 3qjoA02
3NQ5A 4HD6A 1WXCA 4D87A 2ZWEA 3NM8A 4J6UA 1HCYA 1WX5A 3NQ0A 5I3BA 4OUAB 1BT3A 2Y9WA 3WKYA 5I38A 3WJMA 3AWZA 3AX0A 4P6TA 1BT1A 2ZMZA 3HHSB 2ZWGA 3NQ1A 4L37B 2ZWFA 4YZWA 3AWUA 3AWSA 4P6RA 3NTMA 1WX2A 3AWTA 4J3RA 4Z0ZA 2P3XA 4Z10A 2ZMYA 4J3PA 3GWJA 4J3QA 1OXYA 2AHKA 3NPYA 1LL1A 2ZMXA 4HD7A 3AWVA 2ZWDA 1WX4A 5I3AA 4OUAA 4Z0YA 4J6TA 2Y9XA 1LNLA 4J6VA 3W6QA 1HC1A 1BUGA 3HHSA 4L37A 3AWWA 3QJOA 3W6WA 1JS8A 1BT2A 2AHLA 1LLAA 3WJMB 3AWXA 1NOLA 5CE9A 4HD4A 3AWYA 4P6SA
chains in the Genus database with same CATH superfamily
5ANMA 1LE5B 5GRVL 2V2TB 4H8WC 3GHBH 5DMIL 4FXKC 3KPSA 1HFUA 4YUEH 3V0WH 2YPLD 5FLVA 4DGVL 4ONOA 1A7NL 1BECA 3FO2A 3B2DC 3O3BA 1VFBB 1ZEAH 4XPBH 5EA0L 3GRWA 3MXWL 2Y2TA 4IIQC 3TN0A 1W8OA 3D18A 2I26N 4OQTA 1R0AL 4JFTA 1TYJA 2IC2A 2NY1B 3IEAA 5G4NA 4IRSC 1KJ2A 4XAKE 3V5HB 3TT1H 4PJIA 1LTXA 4ENZA 2L3BA 1AFVH 3DOIA 2L04A 3IKCB 4K94H 1LO2H 4A55A 4XNDA 5IF0A 3L5WB 3W81A 3TESA 1VERA 3GRGA 2YQBA 5J6HB 1A3RH 4ELMF 1N19A 1IGIH 3R0NA 4TQEH 5AVSB 1N26A 2JMRA 3P9LB 4AYFB 2G2NA 4ONHA 3ZHFA 3IETA 1P69B 4PY7A 3GKWH 4MD0A 1ADQH 4YBLC 4HJJL 1EZVX 4E9LA 3RDTB 1F0LA 2AQNA 2XACC 3DX9B 4MASA 4R0LA 5E6SB 3QO1A 2OK0L 1ED3A 3A6CL 1SYSA 4GO8A 3KM2A 4KI5F 4HIJB 2QDWA 3AQYA 3CFUA 4ZODA 2X2JA 5D7LA 2H2PC 3IJHB 4GG6B 4ABQA 2P47B 3F64A 4KHTH 1PD1A 4NKOB 5DF0A 1XCQA 4XMKH 1SJXA 5ABAA 2IH8A 5CSGA 1S9VB 2XFGB 1HEZA 2LAAA 4FZEH 4H4NA 2J6EH 4S0TD 2X09A 4HFWB 3S35L 4BM7A 1WICA 1WZ1H 3BP5A 3NT0A 3NUKA 1DQMH 1GYCA 1F41A 1NKGA 4RRPG 4HXAH 3UAFA 3UC0H 3KM1A 2ZMXA 3F5WA 1G7QB 2VLKA 1BF8A 5LB1A 4FD0A 1HSAB 1NIEA 3PP3K 4WW2F 5I19L 4ZTPL 4Z0YA 4L23A 5EU7E 5JIPA 3S34H 3BVTA 1PLAA 3OKNB 5HXMA 5J11C 2R0WH 5BQDA 3HMXL 2MQ0A 4EF3A 3Q2WA 1CL7H 4ZNCD 4X98A 1BBDL 1CGVA 5IEHB 5DT1L 4M9OA 3RL1A 2WMPA 3SOBL 5DK0A 5IKCB 1JZDC 3EYUL 5HI3C 4BSVA 5JOPD 2YD4A 2EH7L 3EHBB 4MAYD 1EK3A 3MLXH 5AW2B 5DUML 1BYPA 1OAUL 3HPLB 1K6QH 4KXDA 3BVNB 1EAPA 4NM8H 4Y1AA 1J8SA 1RJLB 3HA0A 3RTQD 5A16A 1I31A 3MX0B 1FYTE 3WBDA 1KFAH 4HDIB 2FJHA 1MRCH 2BH0A 3P30H 1PAZA 4EBQH 3LXUX 1NGYB 2AJ3A 3ETBJ 3GTNA 3BP7B 3CZJA 5B1BB 2G60L 3DTXB 4U1NB 4YBHA 5C0IB 2E9JA 3CFJA 3MNVB 5I1IL 3QO0A 4V1DD 3VFVB 4DKEL 2WBJA 3WFCH 4A6YH 4NXSA 5KSAB 4XBGA 3DGGA 4ANWA 1F4YL 2DM2A 5F7BA 1ZDSA 3VXPA 1JCVA 4MKTA 2PWEA 4PRNA 3MNDA 1BM7A 3QJFB 1MCEA 4PS8A 7TAAA 1CE6B 1G7LA 3QEHA 1VB9A 3QQDA 4OGXH 2DQ6A 3B6SA 3H4HA 3M88A 1BZ9A 4BHUI 3HMWL 4N8CL 1TMQA 2O5ZL 3GMPB 5LGYA 1CG9B 3IK2A 4PLJC 4LSVL 2XZAH 5HGAB 1UENA 3QPXH 4G7RB 4U6HA 2OMXA 2XNAB 3PL6B 5HPMB 5E8DH 1ETZB 3I9GL 4B3EA 4R84A 1E9PB 4U1MA 4IMKC 1OB1A 1OM3L 1PLGL 3SY6A 4ZXBB 1Q72H 3ASOB 4JKWA 3SODB 3TO4B 4J39A 2IAND 3EOTH 4FCAA 3Q44A 5D1QC 4W4OC 4O5LL 1AKJD 5AUMB 5C0AA 3SE9H 3ZDXE 5HHXH 3QRGH 1LILA 3WY1A 1YEHL 3C6LC 4X6DE 4WKZB 5E99L 5LJYH 3B7SA 3LKPB 3P9MA 5DS8B 2R2BB 4YXLH 1BD2A 4N9GA 4NQEA 2FJFB 5EV7A 3TWYA 2ZOKA 1T0MB 1K8DA 3ILDA 4H40A 3S9DB 2LAGB 1OCOB 2F5AH 3WEAA 3VRJB 4APXA 3Q48A 4Y9GA 3TGXA 3VFSA 1WWAX 3VH8G 3QPQD 1U21A 4FFZL 1BW8A 4Y0GA 3OTTA 5F7NC 2W9LA 4WFGE 3QFDB 5F6IB 4ZO8A 4YX2L 1CB4A 3DX7B 1H8OA 5LO7A 1MFCH 3GZOA 4JN2A 4KQ4L 2G5BB 3OKLA 4J3WA 5I1CH 1OY3B 2ICEC 5DJ8B 5LAPA 3RL2B 4Z7OF 1AGCB 4DP5X 5DQJB 1M7DA 5DLLA 4IRJB 4XP6L 5C0GB 4JGJA 4WI0B 4HX1A 3SN6N 1NKRA 4WGVB 4ZW8A 4G70B 5MI0B 5GIRA 4FERA 3SCMD 1P7QA 1DEEA 2AXJA 3IXAA 5PAZA 3T4YB 3IDUA 5D5MF 4AQ8C 3E3QC 3SE8L 3SPVA 4XP4L 3X1BA 1KIRA 2G30A 4RA3A 4N85A 3NJXA 4BSWB 3GJEB 1I4FA 5EO0B 2FZ3B 3BO8B 2YAHA 1N18A 2R39A 2R8SL 3SKJH 2H32H 3CQQA 5F9DC 3MJ9H 3RQ3A 4ZS6C 1MCKA 3G9AB 4RVBA 4QRPD 5BV7H 3C6SA 4LQ1A 4YN3A 1CVSC 3ZRSA 4YSQA 3EJTA 3PPEA 3PNWA 2P48B 3D39E 4AQAB 2PPCA 2WVVB 5FB8A 4QF1B 3TYFA 4NCC1 4GP4B 5BVJA 4JCWA 4NFDA 1FH5L 3C09C 1Q1PA 2VXTL 1RK0A 2V9QA 5BZXA 2DDQL 1F86A 1KYUA 1SHMA 1O9WA 1QR4A 4PRIA 4IBZA 2L7UA 4NJ9L 3AG1B 3TVMA 1VGEL 3MACL 4XO5A 2CUMA 2ESVB 3VQ2C 1GW0A 5DC0A 4HMDA 4BK8A 3IFLH 2V5SA 3C12A 4TUJA 4YFLF 3K71A 1UWGH 3RWGA 2X70B 3A24A 4GI9A 4EXPX 2ARJQ 5E8OA 2Q0ZX 4UIMB 4LL4A 4KXZH 3BCDA 4UIKH 2G0LA 3A4DA 5T3XE 3J27A 1SVBA 1BZEA 2EC9U 1GXEA 1CF8L 2H3NB 4PEEA 5AVVB 2EH8H 4UBDD 5C0DA 3VGDA 4NLAA 4U0QB 1AGEB 4JMNA 1KZQA 2A6IB 1F90H 1MW1A 2R0LH 2I9LB 2PO6C 3CDFA 5AAMC 5I66B 5LNGA 2OMTA 2NT1A 3IDMB 1ZE3H 2W65B 2FR4B 1VACB 2VRQA 3PWPA 4OZHA 5BVPH 3CSYB 3QH3B 4QXTB 4ZFFA 4ZMNA 1A5FL 4YAQB 2QKIB 1XHHA 1U8QB 3QEUA 1DQQA 2AJSH 2F6AA 3FU7B 1OPOA 2GK0B 3MNZB 5IT2L 5SWZD 3O0RL 2WCPA 2RFXB 2ADIB 3VB8A 1TQBB 3UTTA 2NY1C 5TDNA 2E9GA 4LQFH 4MNQB 5DRNA 3U79A 1UTDA 2LU5A 1GOGA 2IMNA 3M46A 3VXUA 4LHJB 3EG9A 2FYYA 1A3LL 1G84A 2SEBB 1EIBA 1YEJH 2WQXA 4QKTA 3AM8A 1FSKB 1MWAH 1BJ1J 4XI5D 5CIPA 4GQ9L 2Z0BA 5DWPA 1Q9LA 4H2AA 2PCPA 1NAMB 1GC1C 5DMKA 2VDOL 3KBHE 3ARVA 4HQQH 1G7PB 3VFWA 4WI3A 5AKVA 2CAKA 3H1ZA 3NAAH 3M7OA 1WIPA 4GBXB 4JN1H 3FJTA 3NYKA 3RDTC 3H3BC 4H7VA 6PCYA 4MD5B 2P5EB 5JPMB 4PJEE 1YDPB 1YN6B 3G5VA 5C3LD 2XQ0A 4YS4A 2NW2A 2A4EA 2O6DA 3TO2B 4I13B 4NN7B 2ZWEA 2HUHA 4IDJH 3EDFA 5BS0A 4ZMPA 2FX8L 4W70A 4MZRA 4JPKL 5KVDH 3L1FA 4BKSC 1CD9B 4JVUA 1TVHB 4WI9A 3BN9D 4C58B 4QHLA 3V0EA 4ANXA 2VR9A 4XVUD 1U58B 4PCYA 3EOBA 1RIVH 1EEZA 3EXJA 1EHLH 1JNLL 4KKAC 3JV4A 3CMOL 4FLRA 1SN5A 5ISZD 4Z7UF 5F8RC 4HUXB 2GSMB 5HI4D 4PJ5A 2AXGA 3VFPA 4E5XA 1IFHL 2E59A 1MEXL 1E4KC 1Q9KB 5FDWB 3AWUA 5ADPH 5DJZB 2OMUA 3ZE2F 3OKDB 3ELAT 1JZIA 2K9FB 1UZ6F 3BWUF 3EHBC 1QQDB 3KXFD 4HJUA 3KPRE 3IWVA 4PWEA 5D1QE 3UAJD 5I8OH 4OAWA 5FYKL 2AJVH 1EZUA 3CZFB 3K80A 1HKFA 4WU7B 4DP6X 3F7LA 1WBYB 1R47A 1YJDL 1JZ5A 4OFQA 3CNKA 3WFEL 3VFUB 1NDGB 3U25A 2MWCA 1YYLH 5AOZA 5GSVB 4OUAA 1UACH 2W8CA 2FO1A 3ORJA 2E7LC 3MOBH 1HKLL 2VO8A 3BUYB 5F89A 2Q76A 4RESB 4A67A 3GMQB 2ENQA 1UXSA 1U0QA 2Y9RT 4XXWA 3WY2A 3TT3H 1OTSD 5D9SB 5MEQA 4AMKL 2AABL 2P8LA 1BIIA 3KWXA 5KSAC 3PUCA 4JDVA 3I50H 1VDGA 3C5SB 1C5DA 3VQLA 1R19A 1UATA 4BINA 3QRBA 4JS7A 1ZVSB 2AV1B 2E75C 1AC6A 1HHIA 4FQLL 3ASNB 3TEYA 4NO5B 5DHVA 5HVWA 1H8NA 4JZOA 3FB7B 4LHUG 4K8RL 3HVDA 1CZ8L 4U31A 3SDXA 3MYZA 1NDMA 3RTLA 3ENEA 1AD0B 1M05A 2WZAA 3OZ9L 1XBDA 5I8CA 4PJCA 5F7LB 1DVXA 1BCIA 4X4ME 3WIAA 1HL8A 3LH8A 4GB9A 4N8UA 4Q56A 2AQRA 2VW4A 2C1OA 3DV6B 4IMLA 2N1KA 1JE6A 2PMZA 4MZ3A 1MHEA 3PL6C 2QBWA 2VISB 4X9YA 5EOQH 2R2EB 3MLVH 4X80L 1O9ZA 3QJHA 4QRBA 1BVKB 1LO4L 2H47C 3NSYA 1E27A 4OZFB 3CQPA 5CSZA 4PJDA 5I1LB 3QZLA 2X12A 2VN5A 4ZXBC 2DM4A 3ZDZF 3HUJB 3TO4C 2BVPA 5L2JA 4DSYA 3FSAA 5K9KB 5KW9L 5DJYA 2VM4A 2FWLB 2GJZA 2GBUA 2BRRH 2QSTA 3LZFH 3GSRA 2XDHA 4PTUB 2VDQB 3MOQA 3JWDH 4RWYH 2X6BA 2ZYHA 4B41A 3TV3H 2B3IA 4JLRA 4FEIA 2DOCA 4DUWA 1UXWB 1OAZH 1QNZH 4OZIB 3ARQA 2EDWA 5CWSB 3HTLX 1YEDB 2WLIA 3LKSA 1CICB 5E1GA 3SKOA 5JXAH 3TEWA 3VG9B 3QUZB 4A7UA 2VITA 2WKOF 5IJVA 4ZO7A 3K1DA 2WQUA 1JV2B 2UVFA 4IW4C 5F6IC 4JPIB 5DFAA 1ZLDA 3QHFL 4HWEL 1H3TA 2XHNA 1B4LA 3ARDC 2O6PA 2ZX6A 3CBKB 5EZIH 4Z23A 3K3QA 3QCUL 4J3QA 4ODWA 5ETUA 2GSGA 3US1A 3MRKB 4H25A 1ETJA 1SM3H 5ACZA 4H8UA 4ZW5A 1IAOA 2FATH 4R7VA 5MI0C 1IQWH 1S3KH 1D5ZA 4D0DA 5HDLA 3WFHA 3NPZB 2EXSA 2Z93A 3FTXA 3IPEA 3O41B 1Q94B 5EUOF 5HSFA 4G9FD 2XYCA 1UQSA 4FNSA 2NSQA 2IG2L 4JPVL 3F7QA 4TVUA 5E0FA 1FI8C 4PG2C 1AANA 4DGIL 5AVUB 4K3JH 3GXDA 1VAHA 2Z1PA 1PNDA 1QBMH 3C75A 5T33L 1TQCB 4KK8C 5DHMC 5DJXA 4XO8A 5EIIG 5EUKB 3EO9L 4PBXA 2APTA 3RX9A 1JGDB 5JOEA 1FNHA 5HYSA 1TO4A 5E94A 2I07A 3MV7D 1S8DB 1KCRH 4BSJA 5A2CA 4CGUB 3PWNB 2AZUA 1B6UA 3EJSA 3QJRB 2DKSA 4QTIH 3NEOA 4H13C 2VLRB 4JFEB 2EIBA 3RBSA 4DERA 3I6KB 1IARB 4HOWA 3CSFA 2HFGL 1P7BA 4B0MM 3IDYB 1K2DA 3RKPA 5LCVL 3QORD 3H9SB 4CC0A 2HPTA 1PY0A 1UT9A 2E9WA 1CT8B 2KS0A 1ZHBA 1HZLA 2FJUB 3B4NA 3OX8A 5IB4B 2AANA 1IKNC 1JXKA 2YAPA 2QADB 3KS0H 3LNHA 4U3HA 1G7IA 1TVDA 2YEVB 2F61A 1L9PA 3UG3A 2BNUA 4NP4H 2LV4A 3ZSSA 4MWFB 1S2EA 5AVTB 4CNIB 5CD3B 1R5IA 3P3TA 2EIJB 5I6NA 4N2NA 2BERA 4MCMA 4L4JA 1RI8A 3B3IA 1ZXQA 3ZKMD 3VXTA 5DVNA 4J3XA 1P4IH 4KUCF 1CK0L 5DWUL 2FSEA 3D0LB 3VI3B 2N59A 3LXAA 2AGJH 1L5GA 5TFSH 3B7YA 4O58H 5EIVA 4I2XA 3FMGH 1QZNA 4H1LH 4OCWL 1E3XA 4D8OA 1VA9A 5F0LB 4ODXA 2H0PA 5C0FA 2I7SA 3RAJL 1KT2B 4NHUB 4YSRA 2ICES 2QKIC 3EOYG 4M1CD 3GMLB 4XCNB 2XWEA 4BDVB 4ELKA 3H53A 1W8EA 4RBPH 3NTCL 5JR1L 3ZL2A 4O2CB 4B5EA 2IO5A 4OD1L 4PAZA 4ZPVA 3DRTA 5KJ7E 3DMMA 2ZXQA 1TQBC 3DUUA 1MAKA 2I7OA 4MX7B 1YC7A 5JW4Q 1FFNA 4E2OA 3AQXA 3L3JA 2D7TH 5J1AA 2CKBH 3NPYA 1ZA6B 4ELMA 1MVYA 5CP7B 5SWSA 5JIMA 4XVOA 1FSKC 3DBXB 3KGSA 32C2A 3HRZC 4P0DA 3CDGB 3RVWD 3W9DA 2DWDA 5DD1L 4B9GA 4M93B 1N0LB 3PWVB 4IJTA 4XBPB 1JPSL 3MPCA 2LOEA 3KW7A 4AENB 2YPVL 1ZS8B 1CTOA 4GBXC 5D7IF 5F9JB 1U30A 5JPMC 1ORSA 4YHIB 2CBTA 5AQ0A 1M2VA 3UJIH 4OJEH 1RP8A 1LHZA 4IU3A 2AJZA 3ZT5A 1E90A 3O3DB 4NN7C 3DHUA 3IF1A 3IU4H 2J1XA 1Q9OB 4K9EC 5F0MB 3CFIC 5BQ7A 5D1XB 3O2WL 4N2GA 4F33A 4M5YH 1USZA 1XF3A 2VDNB 2Y25A 5D6DC 2YUVA 1E2ZA 5EO9B 1HHGB 4FHKA 4F2MA 3T0DA 2YWYA 3IAPA 4RDBA 4X9HA 4WW2A 1TVBB 3GUTA 4OKVB 1P7HL 2W88A 5IVXF 2WNXA 4NJAH 2OYPA 3LHPL 1WRFA 3ZE0B 3B7RL 4X5RA 1QLFA 1KGWA 4Z7VB 1FGVL 3H0TB 1E9OA 2YFOA 3FZUC 4TNWK 5EFIB 4F58L 1WTLA 2DQCH 3CC5A 1Y18A 3QFJB 2AK4D 1EXUB 1PJWA 3CFCL 1JK9B 3FYEB 2D3NA 2XZCH 3ECUA 4DZBB 1G7HA 2ZUXA 3IGAA 1NM4A 3GNML 4X50A 2R59A 3B2XA 6FABL 5HGDB 2UUDH 3VGAB 4WSJA 5CCHE 2Y9WA 3ESNA 2J21A 5EBWB 4J3UA 1ANUA 1T6BX 2GTWA 5IROA 4E9XA 1LO5B 3KYKL 4C56D 1TF4A 2BVOB 3FQNB 4WHYG 1AR1B 3WTWA 1BFVH 1GR7A 3SE6A 1FVEA 4HV8A 3LNDA 4I18A 3F2LA 4OFPA 5LUMA 1ZLEA 4DIXA 1OAQL 1VENA 3QYCA 4H8WH 3GSWB 4M6OH 3WNOA 1JUFA 1PBYA 3BEVB 3ARFD 4OLUH 3TIDB 4UOQA 2IWKA 1QTPA 2CDEB 1SJEB 1A9BB 4KNUA 2CJUL 2WXFA 1A6WH 1F1DA 1KBGL 4MB4A 1MUJB 5TPWH 2OJZL 4JQXC 3SQRA 1A6ZB 2YOAA 1D5XA 1G7JA 1LL1A 4OLVH 2ZWZA 2QPEB 1QLEL 1AZZC 2NX5E 2QQNL 3UMTA 2GHWB 1S7WA 5CMAA 2EXTA 3UL4A 3LQAL 4LCCB 4N2BA 3BSZH 2QR0B 1YUHB 1Z9SA 2AF2A 1J8HA 4KKLC 4LESA 5EOTA 3WKPA 1P6WA 3ULUL 4XN2A 1B2WH 3L3OA 4AEIL 1I7UB 4EZKA 3F58H 4L18A 5DXWA 1W72L 3GXMA 4LAQH 3PNRB 4RSYA 1G7MB 1RY7B 5FHAL 4PSRA 5DA4A 2OMNA 2ZKHH 3D3VD 4OIBA 2R2CA 5GRZA 5KN5B 2RJMA 3HAEA 3ULVF 3W39B 4M7KH 5JHAA 4GAFB 4CUCA 1KTLB 2B9AA 4ZTOL 4GKSA 5AW5B 5D7KD 4ZFZB 4LDOB 3RE0A 4ZUUB 3FQ4A 5ID1B 5T3XH 3ES6A 4Y9BA 1NINA 4PUBH 5JLZB 2ZOWA 2JKJA 1QSFB 2IAAC 5B38B 2ESVE 4QY8B 1HN1A 2KPNA 1LO0H 2YD7A 4R4BA 4ODHH 4W9LC 3ULSA 1QFWL 3C5JA 3CBRA 3KEHA 1GHFH 2VJXA 2D0HA 3LNFA 3NJMA 3QIUB 43CAA 5E08H 1FC1A 1HEHC 1CICC 2BS9A 3KLQA 4WK2B 4YC2B 3VG9C 3QUZC 2BIHA 4JY5L 2WSKA 2NXYD 3GMNA 4MJ5B 1GA2A 3TZVD 1U8PA 2Q7YA 2RALA 1U8CB 3GO1L 4LF3A 2VERN 2EABA 1RV6X 1PZ5B 2A6DB 5D4IA 4DCQB 2MQCA 4NQSA 3B1TA 2A5UA 3W11D 5MEOA 3KLDA 1AXSA 4ZX4A 1MFAL 1TZGH 3Q9PA 2OMWA 4HKXA 4I77L 4K3DH 4BK5A 4Z0XB 2FRGP 3ESVF 4HJ1A 5JA8B 1N3NA 4ZYKB 4FYTA 4DQOL 4JHVA 5D5MA 5GSRA 1FPTL 4X6EB 5GZOC 1BSIA 3QJVB 3R06B 4BYHA 3F01A 3I75A 4N8VG 4ORGB 4IOIB 5TQ2H 5I17A 2IAMD 4P46B 1WP6A 4O02A 5GGSA 2V5YA 4NZFA 1MIEL 3SKMA 1CYWA 1EO7A 5L4MA 1TQCC 4HVBA 4MXQC 4IKIA 5GPRA 4Z77A 1E0OB 2GPZA 5HHQA 4M00A 2W9DL 3WE6A 3V52H 4MNQE 3SBWA 5EU4A 1T1YB 2JK5A 3EJPA 4N2FA 2XPGB 1ZANL 4JFOB 4ZNEA 4X0KA 2W60B 4H1LG 4HFUL 4B7LA 1T66D 2H4EA 4NQXA 3E0GA 1BOYA 3BW9B 4BE6A 4KUZH 4KK5D 3LZRA 5IMLA 4O9HL 3QNXA 3CVCA 3IDYC 4QRRD 3HW7A 3T8VA 3AREB 4UQ9A 3WFDL 4IBVA 2AQ2A 1J5IA 4PP2A 1XBRA 2HKHH 3MJ7A 3PDDA 4XP9H 5T3ZL 2KZBA 1AZBA 4DO4A 1QHOA 3GS0A 2P5EE 2MKWA 4JFHD 1RZKL 3H2QA 3PHQB 1ID2A 2CZNA 2G4GA 2KZ1B 1CFNA 3KHQA 3O11A 1HILB 2OXHB 1YEFH 1KCSH 2QADC 4PREB 2C3GA 5DZOA 5DJDB 2NUTB 1FO0L 5J8OA 1N10A 1PJ9A 2CWRA 1S5IL 4UV7L 4ODSL 1MNUH 1P5VB 1UWEL 3Q5TA 2WN3A 4DFIA 4N0FA 5CINL 3V5KB 4FZ8L 4GEJA 3REWB 4I0CC 2YAQA 2CMRH 3RNKA 4P23B 1DL7H 2YPKA 5TK2A 3DX8B 2WZ0A 3UAEA 5IGXL 2HT4D 2FIKA 1A22B 5IESH 1ZGLB 5H35B 3WUZA 4LZKA 4Q2ZB 4U6VH 4G71B 4LNRB 4R5TA 2CGZA 2D2CC 3FO9A 4WO4B 2HJKB 1AQDA 4I87A 2TRYA 3GDBA 1LQSR 4NBYB 2V7HB 1IVLA 1SYVB 2ED6A 5DRWA 5HGBA 4YXHL 1EDYA 4S1SH 4M6NH 5I1HH 5AL0A 1HHHB 3EW3B 5FHBL 2MCG1 1QYGL 2LVEA 1YECL 3BKCH 2VB5A 4GT7A 4IRZH 2XCMC 5IJDC 4PFEA 1NGPL 4OCRL 4LEEA 4PB9L 2H7WA 2E46A 3Q1SH 5HHVH 1M6OB 1Z9NA 3AY2A 3X11A 2W38A 4YDIL 3BQUD 2F54B 3T04D 3J07A 2ZXGA 1T1XB 2IGFH 5TD4A 4NHCH 2P5WB 1AOZA 3IFOB 4XWGH 3AXLA 3DYOA 3P02A 4IBUA 3IVKB 1DO5A 4GXVH 4HIHA 2GCYB 4M93C 1R33A 3D25B 4ZMXA 3GJFH 4LLYB 1NFIA 3TURA 1O7SA 4GKZB 5SV3A 4Q6IA 4D9LL 4FKHA 1ASOA 4N0CD 4AXWB 4ENED 3EUUA 2R0KH 2KLSA 3NTMA 4KJYA 4NIYE 1T5KA 1WFTA 2CHZA 4ZS7L 5FUOH 1ZLUH 4WJ5A 4L5FL 1MFBL 4KRPB 5D1XC 3WNPA 3FQTA 4L3EB 1S7TB 1NCAH 1S46A 1RUAH 5T3ZD 2A99A 1J5OH 1KGYE 4G11A 1W0YT 2O4EA 3SD2A 5K1VA 3AABA 5DD6A 3BT0A 6PAZA 5JXED 3AWVA 5FM5M 4Q9RH 5AW8B 5E70A 1JWSA 1YEIH 3NCWA 1FNLA 2Z65C 3ECBB 1TZIB 3L3IB 4D7PA 1NUGA 4OZHE 4Z7UA 5F7YC 1V7NL 3VYNA 2VMJA 3M8OL 4OFYA 3MV8A 3B3BA 5DHYB 25C8L 2AQQA 4WU5A 5DK2A 4KZEL 4IS6B 1GJWA 1OAYH 4WF7A 2ZWNA 3X12B 3SY0A 4KKNA 2E5EA 1UURA 5HJ3B 3HUJE 1ZY9A 2HKFL 1EA9C 4HK0A 3JVFC 1T7YA 2EE3A 3H55A 4Q6YA 4DH2A 2P28B 2D3VA 3GBMH 3VGAC 1OV8A 1NSNL 1AXIB 3BYYA 4WWKB 2BFGA 5E6RB 5JQHC 4RA0C 4X8XA 1G0XA 2JTYA 5DFTA 5MEPB 4HEMA 2H1PL 3SIKA 1PD0A 1IEAB 4P3CL 3EFFA 5I1DA 3HI5L 4AV0A 4IQHA 2HX7A 1K4CA 3QI9A 3D33A 3FONA 1ZT4A 5IW6B 3VRIA 4OZIE 2XIBA 4QTHA 4GLRI 4XCYB 5E9AA 2XX0A 3AY4C 4JO3H 3MA9H 3JT2A 2A38A 5DYOB 2F2HA 3UBXA 4YFEA 4M43H 1N64L 3SYAA 3SYOA 1FAIL 2Q6WA 4KJWD 5HY9B 1LE9A 3TH4T 4L4VA 4YWGH 1XB3A 3L9RB 5IJCC 4NWTL 3BLPX 2CHXA 4UQEA 2XKNA 1A02N 1KYOJ 1IAII 2OTUB 4EAEA 4G8EA 1NCIA 1S9YA 3EFOB 4MQSB 5BOZG 3CVIL 5E1QA 2FX7L 1RULH 4LCCC 3ZGHA 1PG7L 3P3UA 5I6PA 3GC3A 1GC1H 1RP9A 3F7VA 2W5PA 4YDKL 4WUUE 4UDTB 1T2QH 3BP4A 4Y4HD 3UZEA 4KO6A 3QIBA 5J3HC 3A4FA 2R1YA 4H26B 3TM6A 1NLBH 5B39A 1XAUA 1LWHA 5JOFB 3ULVL 1AJ7H 2CD0A 2R0ZL 3VYOA 2MNUA 3ETTA 4XCCL 3NN8A 3WDHA 2J73A 2F1BA 4J6IA 4P2RA 2VDPL 4PG9A 5I24A 4LGSB 1UXLA 4UYQA 3G5ZA 3MLSH 2EECA 4OF7A 5GGUB 3VXRB 1EHNA 2CO6A 4FJZA 3HC3H 4OTXH 4YHYB 3GIZH 4FNPA 3LOWA 1HXMA 4YBQD 2XUWA 1HH9B 3H9SE 3MKGA 3T8MA 3KYMB 4RNRA 5EZOL 3RKDC 3STZA 4QDGA 3IDGB 4GXUM 5A2BA 4J3OD 4PTTB 3D85A 5KYUB 1DVYA 2XA8L 3QIUC 4UM8A 1LJMA 4CN1A 1JCKA 4YC2C 2WKOA 1T0NA 3Q05A 1AYOA 3CLEL 3W1ZA 3KYOB 1BM3H 5CJ8A 3WIIH 1YNLH 2O5YH 1ACYL 2YD2A 4L37A 3WL9A 3G6AB 1I3GL 4P5MA 4L29B 4U6YA 1CLOL 5C6TH 3BKYL 3O6MH 3DX0A 3TNMA 1NPJA 3N1GC 4IGBB 4ONGL 2F1AA 4XXCC 1CS6A 2H41A 2VLJD 2Y69B 5IG7A 3VI3E 3UERA 1PFCA 3JZ7A 2I69A 3TCTA 3VFNB 4CW1B 4AQEB 2I27N 5EB9A 1IC4H 5EF0A 2BP5M 5LGKA 3O8XB 2CUHA 1ROCA 1ZT7B 1IBZA 4GY4A 1FV1B 1S9XB 5EUOA 3L3HA 1VFOA 1PLCA 3B2VH 1ESOA 2HVJB 5ANHA 3X3GL 2Z4QA 3EKCA 5T5NG 3CHPA 4BFIA 4LPCA 4RMBA 4YSAA 4KAQL 2XC8A 4UWQB 5FKAB 1SXCA 4X4XA 4KJPC 4LVEA 4P46C 1OAXL 1P2CB 4TSAH 1KEML 2IDSA 3U6XA 4OCSL 5GS1B 1EJOH 3FH7A 3UTZB 5I1AB 2Q9OA 1DUZB 1M6UA 1DUYA 3PREA 4BZ1A 4F57L 5EU6B 2OMVB 1UUSA 4Q4IA 3VJ6B 2K6ZA 1BOGA 1QFHA 4WFGD 3KW8A 1OTTD 3CSBA 2W9EL 5T5FA 4ERSH 1RK1B 3FFDA 3N6YA 3T2OA 3ECVA 2B8OT 2F53B 1ICTA 4PI2A 4RZCA 5IVZB 4R7NB 4K3EH 2X1XR 4B6ZA 4FXLA 3C5ZD 1BT3A 4TYUA 3K46A 3FHAA 4YSDA 3L7FB 1C5BL 3BZFA 1KB5L 1QFOA 2Y5TA 4KVCH 3QWQB 4ETYA 1LEKA 2Q2EB 5C8JB 1J0YA 4ES8A 4XX1G 4RDQF 1QWHA 4JO1L 4IHOA 4TNWF 3AREC 3ZYOA 4GQPH 4NN6B 2BMKB 2X4RA 5HYFA 3FRUB 2YBGA 4MCNA 3BAJA 5D72L 3ZKXB 5F1OB 2Q1EA 1DHKA 5FR3A 4YZFF 3MOAL 3ML8A 3LNGA 3ZDYB 2W95A 3FU8A 1U33A 3BX7C 5LGHL 1KTCA 1OSEA 1FZOB 4KY1L 2GT9B 4IRSD 5D1XE 2A0LC 2P43B 4F37F 5CLWA 4G5ZL 1IE5A 4ZX6A 1WCBB 4QHMA 4UF7C 4XPAH 2PYED 3I3DA 3TA3B 1KY7A 5I2IA 3RUGF 1PYWA 4P23C 3FT1A 4XOBA 4JDTL 4CMHB 3JTSA 4GW1A 1BFTA 4L48A 5EU3B 3ARYA 3HNVL 2K0RA 4HZLB 3ROLB 4ACPA 3N44F 4Z7WB 2N0KA 1N59A 5KBLA 1FVDB 3DVGB 1QSEB 3ZE0E 3GK8H 4FTVA 2Q2LA 5GGVH 5J5EA 4HGWB 4Z7VE 3BQVA 4PP1D 4FABL 3BJ91 2I9TA 5DU7A 3F7KA 4ILDA 3U6RB 1JGUL 4UT9L 3QFJE 3TCLA 3US9A 4BEIA 1I3RA 2ODIA 3B8YA 2H2PD 3GI9H 1VZGA 1IM9B 1BFOA 2HAZA 5IB5A 1ORQA 5D7HA 5L2KB 1VZHA 2VABB 3SDDA 3U0PB 4GAGL 2XQYA 4NRYA 2B1AL 1KF9B 3NA9L 4I1NB 1FCCA 1J9QA 1Z3RA 3IFPB 1XD0A 3FTWA 1SHSA 3CZUB 3O2VL 3MXVL 2HJFA 1BQUA 4XB3A 2JVUA 5C0BB 3O0LA 3EYVA 4FQCH 4CBPA 1CLVA 5HYJB 1JWUA 4MJJA 4DKDC 5HHPA 1HVXA 2DQUH 4EMZA 5DLML 1RUKL 3UPRB 4APQB 4XCFH 2A74A 3DXAD 4TKWA 1HINH 5E2VL 2QPSA 3VQMA 2J7LA 4KQ3L 3FUMA 5D7IA 5BRPA 2WBWB 1KCUH 1VADB 5E2JA 1KBKA 4J7RA 5I1JH 5KBDA 1Z5HA 4JFQA 5AVQB 4XVSH 4L8BA 5L4JA 1Q0YH 2FBOJ 1XL4A 3RWJA 4KRPC 4WY7L 3BUPA 5C7XL 4NT6B 2QQLL 4W9GC 2YLKA 2XY2A 5GGRB 4NKIH 4NKQB 1JZHA 4A7GF 2EE0A 3VFTA 2FQFA 2AJUL 2EADA 2YXVA 4F3FB 4N2CA 1RH8A 1FNEB 1YZZA 3BHBB 3X2QB 4Z7NB 1TQSA 4HIEA 4PW9A 1YNKL 1NGZA 4WFED 3X1GA 2WLMA 3CFDA 4ODVL 1IIIA 5L7XL 1M3IA 4JDZA 5IVXA 5DJ2A 1T83A 5B7FA 4CC1A 1WITA 1XGTB 3G3LA 2ZWGA 3B5HA 3ARRA 1I7TA 1P84J 2YD9A 1IGML 4EI6B 4JE0A 5CILL 4MDRA 3NIDF 4KK9D 1IBHA 1HDMB 3BZ4B 2AJXH 2OM5A 4UT7H 3ZL4L 1EVUA 3THMH 3H3PL 3QXVA 3S97C 3Q06A 4ZW7A 3C08H 1BXXA 3WS3B 5M7QA 1EXGA 3Q2LA 4MQXD 5K9JL 2APBA 1BQLL 1SVCP 2GJ6D 1VSCA 4NQDA 1G9MC 2AP2A 3R4DA 4WWKC 4DN3H 1ASPA 2PXYD 2FX9L 3Q2NA 1WTGT 4PLJD 3ATDA 8FABB 1F2QA 4JFWA 1QSFE 1BQKA 1A7QL 2B0SH 3EYOA 4MJIA 4N3UA 4NYLA 1MG3C 2WLNA 3HLAB 4BKLA 4OM1H 2H9GA 2CO4A 3GHPA 4KHXL 2R69L 4MRBA 5GZNA 1K3IA 1NC4A 5GRWA 4EUPB 2GSIA 1UUNA 2PYFA 4AE1A 1WA2X 4UNTA 2AITA 3QA3A 2OZ4H 2HTKC 1YPZB 1IM3D 1MJ7L 3FHQA 3FUDA 1BVZA 3C6LD 2JQMA 4B9CA 3FO0L 4I0PD 2GBTA 5LVEA 4X5LA 4YNYB 4XCEB 3UX9B 1W0WB 3KWUA 2X4PB 4O51A 3WDJA 4N86A 2XV3A 2XIDA 3MJ8B 4KKBC 4M6AA 4HF5L 2IH1B 1HZHH 5CN3A 1LK3L 2BZDA 2ID5A 3QDGD 2ITDB 3LIZL 1NEZB 2FAUA 5B3NA 1NAMH 5DTFA 2AJYL 5IF0B 4LSUH 4YHZL 2G3NA 4LSTL 5ESAB 4QHNA 3RVUD 4MXVF 3TONA 4ZMWA 1GH7A 4U1LA 3ZT7A 4IKKA 1ZLSL 1QLRB 1L9NA 1CDJA 2CBOA 4PY7B 4CVXA 1JRHI 1YHPA 1KACB 2WWMC 2BCKB 5T1KB 3ALWA 4E9YA 1KCLA 4BCZA 1GVIA 2ZCHL 1WO2A 5D7LB 4YHYC 3MRQB 5B22A 5BO0D 3BUIA 2IQ9H 3A23A 4LLUB 1D5BB 2B77A 1OSPH 2VMDA 4U1KA 4LP4A 3SDAA 3X13B 1NGWA 1ECYA 1KLFA 3HZVB 4GMTL 1I75A 1MLBB 1MCRA 2JI3A 2PPFA 4X7CC 4JY4B 4YLBA 3KHOA 3GIVB 3IMRA 3UDWC 4LCUB 5HPOA 2VRAA 3U4BH 4FI6A 4U1JB 4FYSA 4ATWA 2A4CA 3P3SA 4FFTA 3RA7L 3ILQC 4IGBC 5I0ZA 2JV6A 1KN2L 3RL1B 1YEWA 4RMTA 3MRNB 4JR9H 4L3CA 3BWAB 4HD7A 4WCYL 4DHLA 4HXBL 3O8XC 1NCBH 2A9NH 1EPFA 1ZPLA 4I9WE 1PTZA 1PDKB 2AQPA 3MODH 1N12A 3FTUA 4NO0A 3REVA 1J8HE 4OLYL 3N91A 2WWNA 1N68A 1T1ZA 3B8SA 2WTPA 4FG4A 2Y06H 3K0YA 4Y1AB 4GLRH 2CGYA 4I9XA 2DQFB 3D50A 5DI8A 5GS1C 3G5WA 3LS5L 2YLHA 4PJ8B 4JRYA 5E51A 2ZPKH 1XIWA 1R3JA 2BOBA 3UYRL 3LQZA 4YEEA 2DMHA 1KZYA 1I9IL 3L95B 1LP9B 4WFFE 3FB8B 5DUBA 3SQBA 4UQCA 4JRXB 3RWCA 2F54E 5IUCA 1BPLB 1IAIH 3KVDD 2MPAH 3VFOB 2CGRH 2OQJA 2P5WE 3DSNA 3IU3B 2RCSL 3BKJL 3EDKA 3VGFA 5GS2H 2XWBA 4KPHL 1E28A 2PO6D 1KB5A 1CDHA 4YXKL 4PBDA 3ZR5A 1Q1JH 3A67H 1GKOA 2XN1A 4WWID 3V6FB 5FYLE 2NR6C 4NN6C 5JO5B 4DVBA 2JKRM 4PRNB 2DQEH 2FO8A 5HYIA 3G9VA 5I15H 3E6FA 3NH7H 5AW6B 3TBSB 2XY1A 4PSPA 1S7QA 2X05A 1HXKA 1X9LA 1A64A 1GGBL 2BPBA 1N4XL 4JB9L 4TV3A 4XHJD 2WGNB 3OR6A 5IB3A 5J6GA 4HSAC 1ZCRA 3IMTA 1J0IA 4HZAA 2UXVA 2XOTA 4L3EE 4OZFH 1RZJH 2ZICA 3LB6C 4PY8I 1ETA1 3L3KB 1LNUA 5LG1A 3TA3C 4R26L 3BZEA 1SY6L 4CMHC 5ALBH 2VDKL 2ZP0T 3OJVC 4UMGA 1CDIA 2A9DA 2WLHA 4PVMA 1P7KB 3M1BB 3W57A 1XSOA 5SX4I 4KK6C 2VDQH 2I24N 1MRDL 3DHMA 3JVGC 1I1AA 1T3FB 1E8XA 3X1FA 3VU1A 4WI8A 3PP4L 4NQCA 3IJSB 1J48A 3P9MB 1WUNT 3CVHB 5GGVY 1BD2B 4N9GB 5FF6B 2Y7LA 2ZOKB 3DO7B 1JV5A 3WDIA 4H20H 1K8DB 2V17H 3OHXA 4XMLL 1DJIA 3TOPA 1OOAA 4A68A 5EC1B 3GPSA 3AWFA 1J1XL 3CUPA 1CC3A 4P5RA 3TFBA 4F8OA 5E9DA 1NBVH 4E42A 2DAVA 4JRFA 2A9CA 3N0PB 2VLME 4PJFA 1XGZA 3N43F 4FG6C 2VXQL 1YRKA 1U2YA 3O3EB 4AC2A 3BWSA 4N0YH 2VAAA 4KKAD 3A4EA 5TGBB 5ICYB 3T0BA 4APQC 1YN7A 4KKRA 4CADB 1E67A 3RURA 3O6FD 3JV6A 1KXVC 3H7BB 2WYTA 1CFMA 3QULB 1D9KD 5DD5L 1RJZA 2RQEA 4F92B 4YSTA 1HC1A 2YPLB 3EGSB 3CDZB 3RG1C 1Z5LA 3N40F 3EJZC 1BZ7B 4B9YA 1EMTH 5IQ7L 1AFVL 2MFNA 4K94L 1RU9H 3DROA 4RZKA 4KDVA 1MF2H 4YR6B 3VRLE 2X9ZA 1R6VA 4QNPF 4QHUA 2XN9D 5C3TA 1IGIL 2EE2A 1YAZA 2IANA 4TQEL 1GCYA 1SMAA 3QUYA 4HD4A 5TH2B 3VFGH 3U36B 3V4VL 5MENA 1NBYB 2QQKL 4F1ZA 3AQDA 3O2DH 2F8IA 2FUQA 4HPHA 2E8YA 1REIA 2YSSB 3EH4B 4M5ZL 4QWWC 2CO2A 3C6SB 3Q6FA 2VSMB 3EDJA 3MRHA 3F05A 1V27A 4ZPTA 4BZ2H 2JIXA 4P99A 2XVBA 3HN8A 5FB8B 5AOJA 1ML0A 3DHPA 3WD5L 4XMKL 2ZX9A 4KTGA 2JKIS 3A21A 1RK0B 2FCBA 3UCRA 4KXCA 5JNYB 4ZT1A 4CSPA 3U4EB 4D9QE 1W2KT 4PRPD 3ABKB 2V2WA 3QT2A 4R4FL 3UC0L 4F7TA 2H6PA 4RGOL 1WC7B 2I85A 4KBPA 4L4TD 2K4AA 4QOKD 4Y9CA 1I8AA 3VXRE 5T1LB 2Z92A 3UJJL 5IFHL 3NJKA 2R0WL 4AMWA 4ZFOB 3T08A 4U7MA 4L2YA 1CL7L 4GRWB 2EVFA 2B4CC 4Y16A 4G8GE 1KGIA 3Q0HA 4HIIA 8CGTA 5K39B 1U4EA 5CGTA 4Y2OB 4WO0A 3L3DB 4LIQE 4HETA 1JXGA 2PWFA 1FG2B 3BUTA 3EFDH 2CBMA 3MLXL 2VL5A 1LK2A 3LRSB 2OMZB 3KR3L 3TPUA 2IMMA 4AGMA 4OJDH 1QBAA 4NM8L 3K4AA 1XH1A 2BSDA 1H3GA 4MVBC 4FGMA 3CZSA 4MAYB 1WAEA 1ZTXE 3PWPB 5FCUH 2Z31D 4HSQA 1MRCL 3NJIA 3RRQA 1T4WA 4QRPA 3VD1A 1VRSA 2XZQH 4LLVB 3MV9D 5F1IA 3EO1B 4P5TD 1ZWIB 5IHHA 3FN9A 5AVXB 3RTQB 2R29L 1NGXB 3VE0B 1PCSA 3U1SH 3NCBB 2XTLA 3QEQB 4QRQB 3UTTB 1DDTA 1V05A 2C1PA 4PJHB 1FYHB 5DRNB 1FBIH 3T8XA 3ZIYA 3I9IA 2OMYA 1HWWA 3UCQA 1DLFH 3HBQA 1IBYA 4XZUA 5BCAA 1TTRA 3V4UH 1QUPA 3D51A 3TCXA 1GGIH 4UQIM 4Y19D 5CIPB 1A25A 5EU6E 1CBVL 1J5CA 4AH2A 3NMEA 1MW0A 2BHZA 3KYNA 4OGYH 1O6VA 1UD4A 4OGXL 5E5MA 1BEXA 3ARDD 5IFJB 5C0JB 4G6JH 4Y1TA 5DRXA 3NK3A 4L8CB 2V9UA 1QMUA 2WKLA 1A6VH 1FRGH 4G42A 3LDBB 2NNAA 2VDNH 4LSQH 3K6NA 5ICUA 5KBMA 2XZAL 3S36L 3QPXL 5BPPA 3NIGF 5JIIA 4EXKA 2J44A 1ZHNB 4URTB 5CBAA 2WCSA 5TK4A 1TJHH 3LKNB 1KLGA 4FRWA 3G08A 5I5JA 4PJGF 4XMZA 1SMOA 3DBSA 2BS71 5E8DL 3EADA 2JXMA 3T0EB 2J3SA 3VG0H 3BPNB 3VVWA 5E8NA 3KLHC 4LEXH 1MOEA 3ZDYE 2A6KA 4N1CA 1TCRA 1PZDA 4AL8L 3QRGL 1UFUA 4M7LT 5A3IC 1KPUA 4QYOB 4J6UA 3MLWH 3UG4A 2WJ5A 1KV7A 4UU9A 4B0MB 3AWGA 4NUJA 5GJSL 2CCVA 4A7TA 5CP3A 1CLZH 2E0PA 1AKJB 1HQRA 2AXGB 3HE6D 3LS4H 3MCG1 4OD3L 1JWMA 1KELL 4KXBA 4M7JL 3G5YB 3HC0B 5FOJA 2XWDA 1D5RA 1P4BL 3C8KA 1OCWH 2Y23A 4I5BB 4Z7WE 3V7AG 1UD3A 5AYQA 4P4RB 3ILPB 5BUPA 1QSEE 2V2XB 5KZCB 4ZX5A 1YMMD 2ARJA 4F8TA 1VEPA 3GEFA 3RIFK 1KIQB 5JA9A 3NCXA 4HUVB 3MRLA 4CJ0A 2DL9A 2BIMA 3KLAA 4PJ8C 4YJZL 2BHYA 3M07A 5CM1A 5IFAH 3FCTA 5C70A 2ZKXA 3HS8A 5H2BB 3STLB 2Y36L 4QRTA 4RFOH 3BMWA 5F89B 4WI7A 3FL7A 2Q76B 2VC2L 3PV6B 2IADA 4Q4EA 5CCKL 3FRPB 1E8WA 3TP4A 3N1PC 4N9OB 4PGBB 4ALAL 1NMAL 5HYJE 1HJCA 1NC2A 5JPNB 5B3SB 2WLLB 4YHPA 2ICWJ 1QABA 4DP9X 4EI0A 5IJBC 4FCHA 4LRIC 1WK0A 2P46B 4OCNC 4MLIA 2D03H 3SCMB 5I76A 1TYRA 4QO1A 4DP0X 1SHWA 1U91B 4OFKA 3S4SB 3SKJL 2CR0A 3QQ3A 2YN5A 5AVYB 3QHZL 2YQ3A 1TR7A 1DDHB 4JZOB 2GY7B 3LN9A 5A2JH 3BZ5A 2A9BA 3RJDA 4DW2H 3MNWB 1FP5A 5K5YA 5FCSH 4LCYB 3OGCB 2VLLA 1SQMA 1JRHH 1A14L 2N1TE 1T1WA 4C4UA 1ZSDA 3AUWB 3L5XH 4HJTA 4M4RB 7PAZA 1C12A 1MCWW 5ACLA 4Y1SA 1BYOA 3A6BL 1INQB 2HZHA 5HHNA 5CE9A 3GSVB 3RUGA 4Z7NE 5TE6L 2NZ1A 1MVUB 1WEJH 2BXYA 5KVEL 2F19H 4JY6B 5IOPA 1E2VA 3VUAA 1A4CA 1AIZA 1OWWA 3LZOA 3Q01A 4E5XG 5JHBA 1YEEH 1SQ2N 2P5ED 5L6YH 3OPZH 4LOEA 3ZUNC 1OQXA 1VHPA 4C47A 4NWUL 2WK2A 5IMMB 1XMWA 5A6LA 2NUPB 1IC0A 3M6DA 4MHHI 1TKWA 2EQDA 1BX2A 3HR5A 2F5BH 3EDEA 3L1OH 1EGJA 2YRZA 1DQDH 1E4XL 4PRAB 3TJPA 3V6OE 1QWUA 4EVNB 3FSZA 1KLUB 1W15A 1SDAB 2WHVA 3PE9A 3HG5A 4FJYA 1I1FA 5DYFA 5LKNA 3TBTA 4Z95H 2J2ZA 3WFBH 2EIKB 5LAXA 3O6LH 3P9WB 3SKOB 3PWUB 3AS3A 3SJVD 2IV9A 2KBGA 5BVPL 3OXSB 2ZUWA 1EX0A 1X6NA 4TUOA 5LGJA 4F2FA 1DBKH 3L54A 1F4WH 1DFBL 1IGFH 1B0GB 4ODWB 1HHJB 5GRUH 5DUJA 1O6TA 3JQOB 3VXOA 4JK0D 3QNYA 4JVWA 4LQFL 1XR9B 3UTSD 3T1WA 1IGYA 1UA7A 1YPZE 3ESUF 2YD5A 4FYRA 4MTMA 2FBJH 4RGMB 5SWZB 4OV5A 1EQWA 3L1EA 4OJAA 5MERA 1MJJA 4A7GA 2P24B 1SLWA 3ZYJA 1DBBL 1MWAL 4NOFA 1I9RL 3TF4A 1R3LB 2G5RA 3K2IA 2C34A 2EAEA 4UTBH 1PZ2A 4KXAA 3GLEA 5IHBA 4YO0A 4HBQA 3QJZA 4KGLA 3EO0A 3CK0H 3ZZSA 1ADQA 2VR3A 2VOTA 5DGQA 3B9KB 4AQ1B 5FKPA 3NJGA 3OKOB 3H9HB 1G0DA 3T6XA 1MI5D 1IL1B 1CD1A 2VWEC 3RLSA 3FQUA 2ZSVA 3D8MA 3GSUA 3BXNB 1XF4B 3FOMB 3BVUA 4DPCX 1JHLL 5I6XB 1OAJA 3QUXA 2D7PA 4BQ9A 2DTMH 3OXRB 4G7VL 2R1WA 4JM2D 2X4SB 4XXDB 5JHLH 5A2LH 4DGUA 4TUUA 4GW4B 2VXUH 1U8OB 4PGDA 5AKTA 5F9OH 3W0WA 4CBZA 3Q8FA 4XPFH 2J6EA 3O6KL 3QWRD 4M29A 3F12A 3GMOA 3MLPA 4G6AD 3UACA 5KSVA 1RIVL 1ZHBB 1NOLA 4OD2B 1UEMA 5D7JA 2F74A 3ZDXF 4NS0A 3B43A 1YYML 3PGCA 4X6DF 4P6SA 3BMVA 3KPOA 5ICXB 5SX4H 3GUFA 1U8JA 1JYVA 1H3UA 2JCCB 1MCFA 5KSUA 1CTMA 4KKLD 1I8LA 4JHAH 3GDCA 4QCIA 1A4JA 5ADPL 2VZUA 2B5IB 2VXSH 3PYCA 4WEUD 4UAHA 5ISZB 3PWLB 1BBJB 2FEEL 5I8EA 2EEAA 2FDBP 1F5WA 1A6TA 4JHZA 4W9CC 2XX1A 4AZ8A 1TQVA 4YGVA 3IXTA 4Y7MA 3NJVA 2A83A 4KZDH 3OPUA 3KXFB 4MAYC 1P9MC 5G5DB 4ODUB 5ADOL 5AG9A 4HAKA 3MV7A 4LKXA 4FLHA 3RTQC 3BI9X 1UM6H 3WJMA 1F4XH 1AGDB 2NSMA 3MCKB 5TE4H 3AX0A 4HC1L 3KS0J 4R3SB 1XXFC 5CD5D 1Y0LA 4YDZA 1ROWA 2C7UB 3CCHB 4L05A 3HNTL 4WUKH 4K23H 2GKIA 5FYLH 2Y24A 4A6YA 4FQ1H 5EULV 2FHCA 2ADJB 1U3NA 3DO4A 2AMUA 4YDMA 5SWSB 3CFBB 2LABA 5IMOA 1LP9E 2ZYIA 5HYSG 3FBQA 1TETH 2LLNA 3NEXA 4JRXE 5E03A 3K8MA 4JAMA 3DURB 2AEPH 2VDOB 5ESQA 5C0CD 4IU2A 5HDRA 4K7PH 4N90E 3FTZA 3MGTA 3WIFA 3TF7C 2HXAA 3BGMA 3UC2A 4FHJA 1JPFB 1FL3A 1IAKA 2YMXH 1AI1L 1MQ8A 4J2QA 5CZVH 4IU3B 3MBWA 5IB2A 5E00A 4X5XB 1OARH 4PRHA 4OBRA 4EQ2A 1CXKA 3CPLA 3LEXB 1XF3B 2JWYA 4KO9A 3T0EC 5FO7B 5IW1B 12E8H 4F7EA 2NZIA 3BPNC 4L1HA 4NM4L 3RNQB 3MRBB 5FUZH 4NBZB 3KWWB 4MXQD 5JW5B 5IBUB 3KWVA 2AS5M 3Q13A 1QBLH 4QLWA 3PCYA 1TJIH 3RILA 4AK2A 1UJ3A 3LZFL 4QRUB 1QLFB 3FQXB 2NYYC 4H88H 4M61A 1E9OB 2A73B 4W9HC 5C07B 1NA8A 4I48A 2VLRD 3MO1B 4JFED 3LH2L 3DDFA 3FAXA 4RWYL 2YJLA 4UOZA 1JK8B 5MP6L 3U0WH 3TV3L 1TZHA 2E7MA 3D2UB 4WEBH 3UO1L 1E4HA 4JUTA 1RHHA 3DGCR 3OAUL 3SGKC 1OAZL 3MR9B 15C8L 3LEVH 2I5YH 5BW7A 3KLLA 2L7JA 3BIAX 1E3FA 5JXAL 2XWZA 2FLRT 3EH1A 3HRPA 4OLWH 3S5LB 5C09D 3HNSH 5CBEB 5FV2A 1CE1L 3QPQC 2F0CA 4YSUA 1HNFA 3AXIA 3LY6A 4M7LH 4AIZA 3ZPDA 5EZIL 3D7PA 1A1NA 4HWZA 1M57B 1GMEA 4FQXB 2EIZB 3ULAB 5TF0A 5KBNC 2XQBH 4L1BA 2FATL 3AMKA 4OJFH 5I1EL 4K73A 5DZAA 5AG8A 3CHOA 5EU5B 1SXSA 3TIEB 3ZIMA 2XRAH 1KDIA 4XO9A 3S98A 2G3ZA 4B96A 4F7CB 1HSBB 2Z7UA 4UTAL 4NZUH 5DFVC 5B38G 1JZ8A 3IBOA 3SCMC 4K3JL 3MLUH 1QBML 3O4OB 5C08B 3UJTL 4QAWA 4ZW3A 1UCBL 1AIFB 3FU5A 5DD0H 4G9FB 1UOLA 4J3SA 3GZPA 3PXHA 2BP0A 2E3VA 4NPYA 2CHWA 5DK3A 1GGYA 2YPLE 5EORH 1PGRB 2H32A 1IZKA 4WK4B 2K8MA 3MJ9A 4GUPA 4F9PA 1S7WB 4I4WA 3BDBA 4JKLA 3LNIA 4PJEF 3QXDB 5DEJA 4EI5A 4ZSOA 4L8SA 3UYPA 1U3HB 1UT2A 1N6UA 1SLVA 5EOTB 1UM5L 1LEIA 4UQ2A 2EO9A 4PV8B 3OBAA 3TXAA 1KUMA 1RVFL 4EN3A 1ND0B 4H44C 1BVLA 4G1EA 4HWBH 2KPWA 4HOXA 1JZ6A 1FZMA 1INDH 1IC5H 3C60A 3KWTA 3L2LA 43C9A 2CM5A 2QGDA 1VLXA 2VWEE 3FW6A 4XNXH 3MLRH 3JXAA 3QORB 5FYJL 3GI8H 1AG0A 2XJLA 5F3FA 3DGDA 1RIHH 4EIUA 1O5DT 2XBTA 2AEQL 4LIQH 3FTGA 4MBRA 5T5NF 2OX5B 4XPGH 2IEPA 2AW2A 5GGTL 2Q10A 2I25N 1CXIA 5AAWA 3QJOA 2KMWA 2XTSA 3ARFA 4XRCA 1P5UA 3P69A 5I71B 2EDOA 2AGJL 2QHRH 2J5LB 5EIIA 1I8UA 3HCVA 4HS3B 1U8KB 2FB4H 3KEDA 2EYRB 3S5YA 1ZTXH 2N4IA 2ZE0A 2JB6A 3GKZA 4XP1H 3ME0A 4GRWE 3VSQA 1RZFL 4AV4A 1X5HA 2Q7YB 4KDTC 3B83A 5FK9A 1FC2D 2J12B 5D1ZA 1H8SA 3N41F 1QUNA 3WN6A 5T1DH 4YQXH 5HBBA 5J7CC 2FD6H 3PY9A 4G72B 4K71B 3GMMA 4B50A 2HMIC 4G6MH 4F80A 5JOPE 4X6BB 1D5MA 4RGMC 4KGJA 2HLFD 3UABA 2NW3B 3NQ0A 3LV3B 2VM3A 3EJJX 3RX8A 2RHEA 1RUQH 2XKSA 5ERWB 1MWAA 4U3CA 3L7EA 4B95C 3K0WA 1YQVH 4RH4A 3GSXA 2VKXA 3QEQE 4ZUTA 1WIUA 3MBEA 4RWHA 4PJHE 4XI5C 1U6AL 3B9KC 2ADFL 4AQ1C 2DYPA 3GHEL 3NFNB 3UJIL 2VN6A 1E5BA 1A0QL 5F1NB 1M7XA 1UB5B 1AXTH 2G5UA 4V1DE 5JHDA 1AQKH 2FGWL 1Y6NR 4RMWA 3K4ZA 1TU2B 2CLRB 5I6XC 4JFPB 2OR7A 4M5YL 4Z0BH 2VGLM 1HAUA 2GVYA 3ARGB 4RETB 2BW4A 4DOHB 5BRZA 2W07A 3QIWA 4QXUH 1GZPB 1ZVHA 3OMNB 5IQ9A 1K4DB 5LN8A 4RQQB 1X7QB 2ZAGA 3I6LD 4JFDB 1U8IB 3E2HB 3HHRB 2NQDA 2P49B 1AP2B 3QXAA 2OTPA 1A2YA 4N0UB 1QVOB 1T4KB 3ARTA 3KNBB 4XVUC 1J7VR 1S6NA 3SPHA 2DQCL 4G43A 3T0EE 4DZ8A 1RSFA 3WUWA 1QFUH 3VMPA 2B5IC 4FLOA 4PR5A 5IVOA 3FFCA 1OE3A 5JQ6H 3VFMA 4P2QA 5J3HD 4JFXA 5FFOA 5A2IH 2X3CA 1B4TA 1QATA 5D2NA 5AYUL 5HI4C 2D73A 1TJMA 3CVBA 2X4OA 4LLQA 3P0VL 2FWOA 4FYQA 2AK4B 1YMHB 5E6ID 5GRVK 1ZT1A 2G75B 3KLKA 3FO9B 4OCMC 1YUKB 4GSDH 4HHAA 3UAJC 3C5XA 1KBVA 2JJTA 3QG7H 5HGBB 1RFDL 1PCXA 4UOW1 3BDYL 3QDMA 4LCIL 5JYLA 3V5DB 2D9CA 1QRND 3MRIA 2IBZY 4I1RA 1COBA 1Q9WB 4GG8A 5EOCJ 5IEKB 5I0XA 3VD0A 2Y07H 2DQDL 1F8TL 1H5BA 4C56B 4R4NC 2JCWA 2WN2A 3S6CA 4WTZA 5AW4B 1QSFD 3VX1A 1MCSA 3RKDD 4P2AA 4MMZA 5TDPA 4QRRA 4FXGB 3S5ZA 5K9QI 2OP4H 1CLCA 4GQRA 3HG1B 4MDIB 4JFSA 2ZXDA 3GB7B 3WIHH 1U3JA 1BAFH 1OTSC 1QACA 4AGPA 4X99B 1IKFL 3BIKA 1ILSA 4Y5VB 1CURA 4X5WA 4MQTB 1NFIB 5I5IA 3UPAA 3K6SB 5FGBC 3MCLL 2V7NB 2Q7AA 4CMMB 3FCUB 1NCHA 2B2XH 5KYWA 3SSGA 4FQIL 4LVNB 3IJ9A 4Q0XH 3PIQB 2WQAA 4K7PY 4TNEA 4OR1A 4DP8X 1FJ1A 1T89A 3VI4B 1FNAA 2IPTL 3FQTB 4PJGA 3W9EB 2PW2B 1WVZA 3BYTA 4LOVA 2HFTA 4W9KC 2VDLL 2BNRB 5JMRA 3KVPA 2BNQD 4LAQL 5DMGD 5DD6B 2P5PA 4Z5RA 4CU7A 1JPTL 1SJHA 3ZGIA 3KJ6L 5F7EL 5DJAA 2E27L 1ET5A 2DH2A 3PQYB 5HI5C 3MNMA 3WLBB 1F02I 1R3HB 1X4XA 3LAFA 2UZPA 3ROOB 2BM3A 1CDUA 4HW6A 1KG0B 3DI2B 3N85L 4LEOB 4YHKL 5EC2A 4J5VA 2YRLA 4WI2A 3Q6GH 1A21A 3WN5A 3NZ8B 2XICA 2J1WA 4HS6A 5T1MA 3IDJB 2EDMA 2R27A 4F5CA 3DO3A 2X2YA 3BN3B 1IAMA 2JKXA 3WEXB 1J5DA 3ARED 3HC4L 3EGDA 3K6OA 4Y5XB 1NM9A 4AG4L 3L9YA 1W9XA 1TNNA 2B4CH 4R2GB 4OSUL 2MOQA 1J0HA 2GY5A 1ZA3B 3GXFA 1N7MH 1B6DA 4PM1A 4HUUA 4MB5A 2AXWA 4JZJA 2L0DA 3BVVA 3VXSD 4Q8BA 2P7TA 3O9WA 2F58L 3MRDA 4FNRA 1YJDC 4X6CB 4R7DB 1OF2A 3S96A 4IOSD 1ZHKB 3HLKA 4LFHG 5I1DB 1HK6A 4FQXC 4EUPH 2NXYB 3GSOA 5A6MA 1HXYB 5DR5L 4CC4A 1EZSA 2VDML 3QI9B 3FONB 2MPVA 3ERXA 4M1GH 2DMBA 1UEYA 3TZVB 3VRIB 4P3WA 5ALCH 1QD0A 3WKNA 3TBYA 2P80D 4XPTH 3FCSB 1GS7A 3CZGA 4FLSA 4K2UL 3MCYA 3HFML 1UGKA 3O4OC 2WO3B 4GKNA 1MKFA 4ZMAT 4X7SL 1NCDH 1AR2A 1MJUL 2BFVH 3RPBA 4G8EB 2IAMB 2B3RA 1MN4A 3D34A 2QFPA 2ZQKA 2DD8H 1JNNL 1QLEB 1JGIA 4GKLA 4K8RC 5SWZE 3SPIA 3DIVA 1Z3GL 3NGBB 2IALB 1UGNA 4ZRGA 3VWJD 1A7OH 4PRDA 5CAYB 2XG4B 1U3HC 1UKTA 2PPDA 5FO2A 3LEYH 4NRXB 4HKBA 5CJQH 1UZ8B 4BHUA 4N6RB 2BJML 4I88A 1JZ4A 4OLZH 4QRAA 3OL2A 4XWOD 1F97A 5EO1B 3E7JA 3FSWA 5E2UH 4GXUN 5LWYL 4XP9L 3JYBA 1PLBA 3MUJA 1N6QH 4X8CA 1R1CA 5EOCL 4N3TA 1RZGB 1W72B 4G82A 3MUY1 2X4NB 3U0TA 3N06B 1JN6B 4MMXA 3UGEA 2X1QA 3QORC 1YEFL 3CE1A 1WQVT 5CR1A 3P1VA 1JJUA 4FFYL 4TF4A 4Z0ZA 3HPJB 4N8VA 5BXFB 1SDDA 3QB7C 1Y07A 4NGHH 3BD4A 5KYYB 4FE9A 1P4LB 4KMQA 2QVFB 1QSVA 1UC6A 2H3KA 2XN0A 4NZRL 5I71C 4CA4A 2FVNA 4QPEA 5TF1L 4DEUA 2J5LC 3V0VA 4DKFL 5CLXA 4CAGA 4P59L 3ZX1A 1FZJA 4GI6A 4AOFA 3V9CA 3ZKMC 5I30H 2CK2A 1T0NB 5GQBA 3VMNA 3X3FL 1W8NA 4GIOA 1FYTA 1SEBA 2JCCE 1NCNA 4H1LA 5F2FA 1UD2A 1UM4L 5F3BA 2Y9XA 4M6NL 4DGYH 5F7HA 3ISWA 1SOSA 5ISZE 3BFWA 1KIPB 3BKCL 2CR6A 3HI6H 1K8IA 1J1OL 2ROXA 4GYBA 4X4YB 3SPJA 3UBXG 2ATPB 1K5NB 4K71C 1U95B 4D8PB 4M1CC 4NBXB 2IDCA 4Y4HA 2IWGA 3KXFE 1I8KA 1QPKA 3B5GA 1KDJA 3NPSB 4UQAA 4P4KB 2VXVH 2Q8BL 1DVFD 2CKBA 5GRYA 4L9LA 1G43A 2Q3ZA 2NY5H 4JQIL 4YK4B 4YHNA 3ZQ9A 3BQUB 1K3ZA 5C0NC 4LARH 4QJ4B 4HG4J 3KBFA 4XBEH 1LQBC 1S7VB 4XVJH 4MHHG 1XGUB 4G3YH 3E1ZA 4PJBB 3UZQB 4E41D 2R23A 1A4KA 3BAIA 4UILL 1SOQA 3T2NH 2J88L 2CO7B 5CEXA 5FUOL 4PCSA 5B39G 3P77A 3IN2A 3MRMA 1LD9B 3AB0C 1XF5B 3DJZA 1FZKB 1RUAL 2Y3AA 4UDUB 4XN9A 4A1RA 3ARGC 3INUL 4FQPA 4PN6A 2PCFB 2CHDA 2ITFA 5KVFE 3PJSA 1EBPA 1OGAD 4PGZA 3SDCD 1JDDA 3WEMA 1OSYA 1OANA 3KDMA 3E2HC 1D3CA 4X6DA 1KYFA 1DFXA 1J0JA 3FAWA 3H42L 3RVVD 2GBAA 4PS7A 1JBJA 5I1KH 3PS6A 5B1JA 2OW7A 1FO0B 1B90A 3E9UA 3O3AA 4PJXE 4OM0H 2IFFL 2ZUYA 4IOFD 4QHMB 3I02A 3T77B 1OHQA 1MCQA 3P73A 3UIYA 2OFQA 5ID0A 4IBLT 1X7TA 5F3HA 1MQKL 1Z1WA 3RYMA 4AVIA 1HYRC 1YEGL 3FB5A 3CVHH 2Z64C 3EBHA 4PJ9A 4YLCA 1BLNB 2L4OA 3OF6A 3VB9A 1VEMA 3ZHKA 1P6FA 1PMYA 4IIZA 1YNTB 3A0OA 4ABVA 5C07E 2ORBH 5AB0A 2F7PA 2OR8A 4YIQA 1KPVB 1UFGA 1PX8A 1MLCA 3UGUA 4TSBL 2NY7H 2LTQB 3H3KA 3NJHA 3QZWB 5IP4A 5DVLA 4NC0B 4Z3IA 1T22B 2GK2A 4XNQA 3MA9L 5FO8A 1C5CH 1Z7JA 5ITFB 4FXKA 4M43L 2OR9L 3IDNB 3D9AH 3T6QC 5HYQB 3Q5OA 5T8IA 3GFUA 4S1QH 2MNJB 3NFSH 3RWHB 1C08A 5AKRA 3IJYA 1NH6A 2UWEB 3NJNA 4OLXL 3DK2A 4NO2A 4Y5VC 2RMNA 3KPPA 3HI1B 2NTFA 1MXGA 1EEYB 1U92A 2GFBA 5HDWA 1AGBA 2ZSWA 5AENA 5DO2D 4KU1A 5MHSD 3KPLA 3P0YH 5IR1B 3D39A 2BSEA 4LVNC 2WUBL 4F8LA 2ISDA 4RMSA 2NY6D 1O6SA 3AAZB 4LSPH 5GGRY 3BSZA 3F65A 1IEBA 4BH8A 4UQ3B 4R8WL 1THCA 4R96A 2NNXA 4PJ7B 5C08E 4F24A 2B20A 4G9FE 2ATKA 3SE3C 2YK1H 1KCVL 3VFTB 4F7MA 2MQGA 3W2DH 1XCXA 1A6UH 3GSQA 3ZTEA 2UZYB 1VIWA 3NFPA 3UAAA 2BIIA 1WT5C 1CCZA 1AJ7L 1X5KA 4TUKH 4UB0L 3DOSA 1RMFH 4AMXA 1L9RA 4J4PD 4N2MA 4UANA 2P52A 2F53D 4HJGA 3ARPA 5A7BA 3DVNB 1XF2B 4ZMZA 4D0CA 4JFFD 2H2SD 5HD8C 4JKPL 4LCWB 4C8XA 2PP8A 2EKSB 3UP6A 2PKDA 4OT1L 4L1DA 3QS2A 4P57A 4GAJH 4AEFA 2EVIA 1B4JL 1NEZG 2NR6D 3ABMB 2HPOA 4Y5XC 4FI8A 1CD0A 1A1MA 1F3JA 3CD4A 3MGOA 3UTQA 4GRWH 1MHHA 1HIML 4R2GC 2NYKA 1OAKL 1NMBH 3AWSA 3LKRB 1YNLL 4YDNA 1XGQB 2XWJA 3FSOA 4RAUB 3VSTA 1ZHLA 3UMNA 5C6TL 4E0RB 3P4LA 4U4IA 4B9JA 1S7SB 2ZXEB 2VO5A 4A2EA 4ZMTA 5HVFB 2DQTL 3EJQA 3LRGA 1F13A 2NXYC 2P44B 3DPBA 3EYOB 3LB6D 4J27A 4MJIB 4NYLB 3VXMD 3QI9C 4FQ2L 4MA8L 3TZVC 1GZHC 3L8QA 3KGRA 4D2NA 3F04A 4XAWL 2VLJB 3L3GB 2Y1ZA 4NNXB 2YBRA 2OL3L 5FM5O 1ZLVK 3RJQB 3W11C 4MA7L 5IGXH 4KTDL 4PHXA 1NWPA 2GSIB 2ZCKL 1BZDA 1QO3A 2DEWX 3GXTA 4DGVH 4Z3HA 1A7NH 2HT2D 1NAKL 2TSBA 4Y2NA 5EA0H 1XDTT 3MXWH 4WI5A 5FM4A 3SBRA 1ZLWH 4JG1H 1R0AH 3I2CL 4NRZB 3HZYB 3O81A 2IAMC 5IWLC 1ODAA 5L2KD 1BYNA 4O51B 4UUJB 3K2KA 3WKML 4PJEA 2JKNA 2X53A 3W6WA 3NGBC 3MMEB 4WZ9A 3VXQA 2OSLA 1HNYA 3LQAC 4LL9A 5DTFB 4EDXB 1J1PL 5LQBL 2N0MA 5C0BD 2HX9A 1NPUA 5J0BA 5CHNB 3ULUC 3C5ZB 3W5NA 3KPNB 1QA9A 4HJJH 4P5KA 1T66C 1OZTG 4APQD 3IDIB 2OK0H 2VH5L 1GMIA 3K6DA 3OG6B 1KENL 5F70A 4HUWB 1SBBA 4M8QA 5GRXG 1S9WA 2WXPA 2NNCA 2X4TA 5IBTL 4OZHF 4YDVB 3GRWL 2VDPB 5B4MD 1E4WH 3TEXA 1BXVA 4MMYB 3EJZD 3MRPB 2EEXA 3IPFA 3D48R 1YY8A 4OCXH 3C8HA 4DOHE 3BIBX 3S35H 3V95A 4OF8A 5F96L 4IMKA 4KNSA 5HVHB 3CIAA 4IRSB 4MCYB 3IAGC 1PW3A 1HQ4A 3KPRA 4L1LA 5D1QA 3HUJF 1IM3A 4JFDE 2HVKA 4HIPA 5I19H 4ZTPH 1T20B 5CUSH 4Y2DD 3S37H 3C6LA 4NO3A 3EOAA 4HYTB 2DEXX 3HMXH 4J1UA 1RK7A 4N0UE 4B53A 3FOLB 2I60H 2HT4C 1MDTA 5DT1H 3QRLA 4QAMB 1KNOB 3FU9A 2VE6B 5IQNA 3WSQL 3FK3A 3LKQB 2EH7H 5DC9B 5TDOA 3EDDA 1E30A 1MCPH 1TEYA 4JPWL 1CF1A 1BQRA 3FF8A 3HG2A 5DUMH 1NOAA 3S37X 1V3KA 2WQRA 1OAUH 4ISVB 4WEMB 4TVPL 1M1XA 3WXWL 4CVZA 2AK4E 4IRZA 4OZIF 4Q9QH 3P3RA 2YJQA 2PR4H 3ZE1B 2FJGA 2XFXA 3HKZA 1PD6A 3I85A 1E8ZA 3TWCL 1AMYA 3G04A 2IGTA 2ZNXA 3NPSC 3HG0A 4M5TA 1J8RA 4YPGB 5F9WB 1F56A 1T0OA 4P4KC 1BF5A 3TFKD 4YK4C 4TSCL 3GBLA 1XR8B 2ICEA 1LWRA 2G60H 5EZJA 3BQUC 2GTZB 3RB5A 1FIGL 3M1OA 4G80B 5BZWA 4C56E 3TLRA 2Q87A 5I1IH 1KIUA 4DKEH 2DQHL 1A9EB 3GJFA 2NQ3A 4MDJA 3SQBB 4YEFA 3KPQB 2X0WA 1DO6A 3DXAB 4AQ8A 1R5VA 3M1CA 3FULA 3BEWA 5I1JL 1F4YH 3HG1E 4X4MA 5DVOA 1T03H 2CLVB 4ZOEA 4PGCA 4RGNB 4UOJA 1KB5B 4WK0B 4PGEA 1CFTA 2CA4A 3D0AA 3PRZA 4M7ZB 1JF1A 2C9AA 2P9RA 2HG5B 3KPSD 3HMWH 1UASA 2IH3A 4N8CH 1LDPL 1BAWA 3Q8CA 5CU5A 2O5ZH 5IHZB 4BQCA 1KOAA 2LE9A 4DP2X 4PLOB 3CFEA 1N8ZA 4LSVH 4XNMB 5DD3L 4ZUWA 1RJYB 5KANI 1RZKC 2VSKB 2VRKA 3VI4E 3SOTA 4KTYA 5INDA 2E4FA 3V4PB 5EF3A 3BZDA 2EDHA 3K91A 4HD5A 2BNRE 1DE4A 2R4RL 3GBNH 3MLZL 5B1KA 2Q7NA 4HHWA 3I9GH 4AM0A 4LSRH 1BVNP 4TOYH 1BQHB 3B9VA 5GISH 1OM3H 1PLGH 4UT7L 3U2JA 2J55A 1UZGA 4HGKC 2X1WL 3CXFA 4O5LH 3QUKB 3PQYE 3CU7A 2ED9A 1YEHH 2CO3A 5J1TC 2WIIA 3CX2A 5E99H 2ZYRA 1MHCA 4AI7A 1U8LA 3D6GA 1J05A 4DN3L 3MROA 1UWXK 3C87A 3D3VE 1K9TA 4OUUB 4FP8L 5EBLB 4CGTA 1U8MB 4HKZA 4UINL 1C1EL 5D7LD 5J9PA 4I1PA 4W9EC 2X40A 2GJ6B 4A38A 1T5WB 3AWZA 1UD5A 2B0SL 2ZXCA 3L4UA 5HJDA 1Q0XH 2R1XB 3RY6C 3VI3F 5I16A 4AGQA 4XTRD 4HOMA 2PXYB 4FFZH 4HUCA 5IW3A 3TBWB 2LTQC 4P3DA 2W0LA 2A9ML 5AAMA 2EYTB 1TTBA 4IEFA 3FHEA 1LE5A 1QOKA 4LKCB 2V2TA 2OZ4L 4X6CE 2VLKD 3V0DA 1PZ3A 1R3IL 4X7DC 4IK7A 3FPXA 2FO4B 4O2FB 4KQ4H 1VFBA 2ZNWA 4A04A 1AKPA 5EHFA 5J12C 2WWKT 3VFRB 1R3KB 1XTLA 5F88A 1CFSB 3NRPA 4X7TB 1JXDA 4JFYB 2GEEA 6CGTA 1TO5A 4XP6H 1U2HA 3U7AA 1SN2A 5BJTB 4F93B 1RURL 2HN7A 2PABA 1W16A 3V5HA 4YHLH 3IKCA 4I0PB 3APNA 3L5WA 1HI6B 2DYRB 4PCKA 1XH2A 3SE8H 5J6HA 4XP4H 3ZTNL 1NAML 2AEIT 2W0PA 1T5XA 4ZX3A 1BMGA 3DVFA 3P9LA 2DI9A 5CJXC 4AYFA 2XPYA 3OC5A 1IGCL 4HS8L 4QHUB 4Y1AD 3K74B 3QDGB 3LKOB 5B8CB 5HP5A 4U1SB 3RDTA 1BUGA 3DX9A 4PJ8D 4AX3A 3RHWF 1I1YB 1JZFA 3EZJB 4A66A 4HIJA 3I3EA 3I84A 1WFJA 3IJHA 2PN5A 3HZ3A 3VSVA 4PMFA 1T83C 2PP7A 4NKOA 4TULL 3OD3A 2WBJD 1S9VA 2VZSA 3ULUE 1FH5H 1R34A 2ITCB 4WHDA 4ZUVB 3EF4A 2VXTH 4M5SA 3MBXL 4HFWA 3QQ4B 5F97E 4NJ9H 3NCYS 5K93A 1CI3M 1G7QA 2O72A 3DC0A 4KO5A 1HSAA 4Z3EA 4YBQC 3Q43A 4LCVA 4D0BB 4NNPL 4JO5A 1TCMA 1VZIA 4LE8A 3ZE0F 5JORB 4JFHE 2BVUA 4Z7VF 5IEHA 1NIDA 1F1GA 5DA0B 3V6ZB 4J3OC 1SEQH 1E4KA 3SPGA 5IKCA 2HFEB 4Y9FA 3BH8B 1JS4A 4CSSA 2NCMA 1MRFL 3PWJB 4K07A 1CF8H 5SX5H 1D5IL 3V0IA 1ES0B 3GTTA 3DECA 2CIIB 4C54A 3HPLA 2OCCB 5L0QB 3BVNA 3D09A 1KJVB 1RJLA 3OKMB 4MYPA 3MX0A 4HDIA 2WQWA 5E7BA 5K59E 2YSTA 3MI6A 2Y06L 2UYLB 1A5FH 2ZG2A 4C55A 2FT8A 3MUGB 1BZOA 5C0AD 2E7LA 2JI2A 3BP7A 3DTXA 2ZPKL 4U1NA 2NOYA 3DX2A 3MNVA 2NLJB 4WDIB 2ZX5A 1MY5A 1BD2D 4NQED 3VFVA 2FQDA 2W0FA 1GPOL 1NMCB 2YMTA 1FE8L 3I3BA 1I3VA 3V9FA 4B9PA 5KSAA 4TTDD 2MPAL 1A3LH 4BFBD 3TYGL 3T3MB 2OMYB 1C8QA 3ZO9A 5FWQA 3U9UB 1RUML 3II2A 4GQ9H 1HHKB 4OH2A 3QJFA 4X4ZA 3FUIA 1NCUA 2VDOH 1CE6A 2FT7A 3A67L 2ZWYA 5KVFH 2YXMA 2EDDA 5FLUA 1G5AA 2WXIA 2DQEL 4M3JA 3L16A 1SLXA 3G6JB 3NG5A 2CA3A 2WC7A 4MCZB 4MAZA 3GMPA 4PJBE 1CG9A 2HT3D 3ULVC 4X8GA 1KB3A 5HGAA 2D4FA 2IQAB 2FWSA 1WA1X 4EIZC 2YC1B 4N2OA 5DJCB 4IBTA 1TITA 3VU2A 2V3FA 3RI5F 3VXNB 2XNAA 3PL6A 2VQ1B 1RZJL 4JPKH 5FC9A 5HPMA 3ZUCA 1R24A 5E4AA 1ETZA 2R83A 2MQ3A 2JQAA 1E9PA 3OMIB 4M4PA 4ZXBA 5HVHC 1Q90A 3MLTB 2WTRB 1JFQH 3TO4A 3BDXA 1BJ8A 3CN4A 3CXHJ 1F4AA 4KMTL 4P2YA 5AUMA 3ASWA 4XNYL 5T3ZE 2F1EA 5ALBL 5JHMA 3N42F 2JJSC 3NCYP 4WAFA 4YSSA 1JNLH 4WKZA 3OQ3B 3PFQA 4ZMQA 3CMOH 3LKPA 3FT3B 3OZKA 4D9RD 5DS8A 3ZTJG 2R2BA 3D52A 2Z6FA 2FJFA 2WXHA 1T0MA 5CXPA 3LZPA 3S4SG 1IFHH 3WFZA 1X5AA 1MEXH 1GYAA 1QFWI 3KLSA 3OKKB 3VRJA 2V17L 5D7SL 3EYSL 4PP1C 2KQNA 3EYFB 5KOVC 3V9EA 2QT6A 3CDCA 3DARA 4NUQA 4DT2A 5E5RB 1EAJA 4QT5B 1MZZA 1WLHA 5J13B 2AHIA 1HCYA 1YJDH 1JFHA 4ONFH 4PRID 3TVMD 3WFEH 3U2SB 3QFDA 3DX7A 5F9WC 3TNNB 5FX3A 2BVQA 5T1LD 5E8PB 2G5BA 3RL2A 1HKLH 5DJ8A 4HBCL 1AGCA 4RAVB 5DQJA 3RIAF 5JIDA 4IRJA 2YD1A 5C0GA 1TJGH 1IIKA 4WI0A 2NX5A 1U3ZA 2XG5B 4HLZG 3PHSA 2HJLB 3T4YA 4AMKH 3IGFA 2AABH 3CHXA 1GOHA 1HH6B 2D3LA 2EYSB 5KTEL 3FS9A 3OJDB 4OKDA 5ILTH 3G6DL 1KBWA 1FH2A 3O6FB 3CH8A 1M7UA 3QBTB 4BSWA 1RU9L 2DEYX 3GZKA 3GJEA 4QR7A 4PG2A 3RPIB 5EO0A 2FZ3A 2P8MA 1D9KB 4FQLH 3BO8A 4RGNC 3DV4B 4IDLA 3ECQA 1OP5H 2UWEE 4A2DA 5DZPA 4M7ZC 5CEZL 1UB6B 3PWPD 2WOBA 1CZ8H 2EDJA 1PQZB 1WF5A 3JWNC 4U1HB 4Q74A 3BP6B 2JELL 3OZ9H 5DC4B 2XN9B 4AQAA 3NK4A 2E9BA 2OCJA 4QF1A 3VH8B 2FJSA 2HFFB 3H9ZA 1N5YL 3DJ9A 2YA1A 3QEQD 3UTTD 4BZ2L 4PJ7E 1ZSDB 1L0PA 3VXUD 3P2DA 2EIEA 3MRCB 4L5FE 4X80H 1LO4H 3ARBA 4H0IA 4N5UA 3HBGA 5HHNB 1NCWL 4JO2H 2ESVA 4GO9A 4UI2A 2C9UA 2XVGA 5F44A 1MAMH 2G9HB 1IKNA 3KBEA 5KW9H 5C92A 1BT2A 2D31B 1B9ZA 2YUWA 4KK9C 3QDJB 2VDKB 4FNQA 2EDEA 2WV3A 5KSBB 4UIMA 2EVGA 2BSSB 4LCWE 4PRPB 4NOBA 2XQYK 4GSRA 4L4TB 4MQXC 1OLLA 4QOKB 4YFDB 3LRLA 4AW7A 4AW4A 2H3NA 4G8IB 1H15B 4POUB 2XTJB 3HR5B 2PXYC 1IBGL 2A6IA 3INOA 4D7BA 2K6YA 2I9LA 4OY9A 4N0RA 3T0ED 5I66A 3CV5A 1CXEA 3IDMA 3LX9A 1IT9L 3FT2B 4GW5B 2W65A 3H54A 3ILEA 3NCJL 2FR4A 1YYCA 3EIFA 5IV2B 3CSYA 4QXTA 1RLWA 4GQZA 4YAQA 4OF5A 1OPGL 2QKIA 4HPOL 4AJVA 2CHNA 3NM8A 3FU7A 4HWEH 2GK0A 1KGUA 3MNZA 2Y7QB 2OZ4A 6TAAA 3DNKA 3QCUH 2XZQL 4TUOB 5GJTL 1CFVH 2YAMA 2ADIA 4P8QA 4GAYB 2BY2A 1SDYA 2NYYD 4MNQA 4PJ5D 4FC3E 4MAUL 5BO1H 2VLJE 4XH2B 2Z31B 3U1SL 4O2EB 3IGUA 4I0PC 4RDQG 1IZJA 1IGTB 1U42A 4BD4A 3MV9B 3N9GL 1FBIL 3VCLB 4P5TB 5HDBE 2IG2H 2SEBA 3MYJB 4Q14A 2DQGL 1MFEL 5KZCD 5MERB 1ONQB 2VW7A 4DGIH 2EE6A 1NAMA 2APXA 3V4UL 3QR1A 5CEZD 4CILA 1G7PA 1GGIL 1PSKL 4ICWA 1U2CA 2YO3A 5B8CC 4GBXA 1XH3B 2HVBA 4MD5A 3EO9H 2P5EA 3C9NB 5EPMB 5JPMA 2B59A 2QZ5A 4Q58C 4RAHA 3RVUC 3AXHA 1OVZA 1A6AA 4RISL 1YDPA 1YN6A 7CGTA 4G6JL 2OXGB 3V4VB 4Y19B 2CDGB 1A6VL 1M9SA 2YA2A 1A4AA 3CXDL 3MDJA 2KI6A 2FEDD 1FFPB 2VUYA 2WBXA 2X3BA 3ARDB 1OP3K 4ETQB 1T21B 2HFGH 4RX4D 1P4UA 2EO7A 5D6DA 5LCVH 5ICZB 1TVHA 3FUHA 5DFVD 3HG3A 4WWNA 1U58A 2WUCL 3WO4C 1KTDA 1OGPA 1ZIBA 2OCFD 5K1JA 1T04B 4N1HB 3IMVA 3WNMA 3AGVA 2ERJB 2Z91B 3S8FB 2X38A 4HUXA 5D7JB 3HB3C 2Y6SD 1JDCA 4K0OA 3ZU8A 4XGZB 3T65B 4B3VA 4OJYA 3NCMA 4C83B 1Q9KA 3SBQA 5FDWA 1U8JB 5DJZA 1CO1A 1CDCA 5DWUH 2HKAA 3LS4L 3TL5A 5IQLA 4BBWA 1QQDA 4Z3TA 2NTSP 3CZFA 4WU7A 4XPHL 5L0QC