3QJOA

Refined structure of the functional unit (klh1-h) of keyhole limpet hemocyanin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
491
structure length
491
Chain Sequence
ILVRKNIHSLSHHEAEELRDALYKLQNDESHGGYEHIAGFHGYPNLCPEKGDEKYPCCVHGMSIFPHWHRLHTIQFERALKKHGSHLGIPYWDWTQTISSLPTFFADSGNNNPFFKYHIRSINQDTVRDVNEAIFQQTKFGEFSSIFYLALQALEEDNYCDFEVQYEILHNEVHALIGGAEKYSMSTLEYSAFDPYFMIHHASLDKIWIIWQELQKRRVKPAHAGSCAGDIMHVPLHPFNYESVNNDDFTRENSLPNAVVDSHRFNYKYDNLNLHGHNIEELEEVLRSLRLKSRVFAGFVLSGIRTTAVVKVYIKSGTDSDDEYAGSFVILGGAKEMPWAYERLYRFDITETVHNLNLTDDHVKFRFDLKKYDHTELDASVLPAPIIVRRPNNAVFDIIEIPIGKDVNLPPKVVVKRGTKIMFMSVDEAVTTPMLNLGSYTAMFKCKVPPFSFHAFELGKMYSVESGDYFMTASTTELCNDNNLRIHVHVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The refined structure of functional unit h of keyhole limpet hemocyanin (KLH1-h) reveals disulfide bridges.
pubmed doi rcsb
molecule tags Oxygen binding
molecule keywords Hemocyanin 1
total genus 94
structure length 491
sequence length 491
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00264 Tyrosinase Common central domain of tyrosinase
A PF14830 Haemocyan_bet_s Haemocyanin beta-sandwich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 3qjoA01
2.60.40.2570 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qjoA03
2.60.310.10 Mainly Beta Sandwich Hemocyanin; Chain: A, domain 2 Haemocyanin C-terminal domain 3qjoA02
2ZWEA 1BT1A 1LL1A 3NQ1A 1WX5A 2ZMYA 1WXCA 3AWWA 3NQ5A 2Y9XA 3AWYA 4HD4A 3HHSA 1JS8A 3W6WA 2ZMXA 4J3QA 5I38A 3QJOA 5CE9A 4J3RA 1NOLA 1OXYA 3AWXA 4J6UA 4OUAA 4OUAB 4L37A 1WX4A 3AWTA 3WJMB 2AHKA 3AWVA 4HD7A 4J6VA 4J6TA 3AWZA 4Z10A 1BT3A 3GWJA 5I3BA 3NTMA 2ZWDA 1LLAA 1LNLA 1BT2A 2ZWGA 4P6TA 3WKYA 3AWSA 3HHSB 1WX2A 4J3PA 4P6RA 4Z0YA 5I3AA 2Y9WA 3W6QA 3NM8A 3NPYA 4P6SA 4Z0ZA 4D87A 2ZWFA 3NQ0A 4HD6A 1HC1A 1HCYA 4L37B 4YZWA 3WJMA 2AHLA 1BUGA 2P3XA 2ZMZA 3AWUA 3AX0A
chains in the Genus database with same CATH superfamily
3RL2A 1JZ6A 3M17B 3RIAF 1E8WA 1K8IA 1OSZA 1ZHKB 5C0AE 4K8RL 3EJUA 4N2EA 1BD2B 3CJJA 2IDTA 4O58L 3CZJA 1AHWB 1SY6A 4PG2A 3N42B 1IJ9A 4JFDB 1VEMA 1LP9E 3IMRA 2BSRB 2PXYD 2I07A 4LGRB 4Y2DD 2XWXA 3ZSTA 3E6FB 5HVFB 4A2MA 4H4NA 1DBBH 2B3RA 4R7VA 3NCXA 4PWEA 1RP9A 1IIKA 2K9UA 2Y9WA 1ESOA 1KTCA 1E67A 1S7UA 4GEJA 4JPIB 4JUTA 4M02A 4Z7UF 2EDBA 2BFGA 2WXQA 2BSRA 1AD0B 3L9YA 4JRLA 3SEPA 1D2OA 3MJ9L 2N0KA 1RMFH 2ZOUA 5BVPH 1EO5A 2XVKA 2P5ED 4X7CC 2Z8SA 4JS7A 2HT4D 1ZS8B 3P1VA 5CIPA 5D70L 5CCKH 1EANA 4NWUL 2WIIB 2P49B 1JZHA 5DEZA 4HXBH 2W0PA 1BAGA 1OE3A 4QHPA 5T3XE 2WLLB 4FXGB 4ODUB 3S36H 2EACA 4NKIH 1MAMH 5KBNC 1FH5L 2WZ5A 3CBRA 1NCOA 4G6KL 1AZRA 2J1WA 3KGTA 2BOLA 5LBSH 4W1TA 3APMA 3TNNB 4AG4H 2WWMD 4MMXB 4M6NL 5FW6A 3MBWB 4OZHF 3IXTA 3ECUA 2DLFL 1RULH 1BD2D 4WW1A 1XQ4A 4ZD3L 4XVJH 5F1OB 4BFEA 1JVKA 2Y1VA 5EORH 3ET9F 3NRFA 2H9GA 3DNKA 5ACLA 1JWMB 1KLUA 3BIKB 1NIBA 3L1OH 3DGGB 3UZQA 4I0CC 5EC1B 5F1SA 1ZTXH 3QG6A 4PJ8C 5FEBA 5IVXF 2LVCA 1U8LB 2WCPA 4HEPG 3GRWH 2QTVA 1INDL 1F6AB 1XDTT 5C7XH 1P5UC 3QFJB 4YHPA 5LWYL 3EZJB 1X5AA 3L5WA 4PWFA 5E2TL 1Q9KA 4P2QA 3GDBA 4YDLC 3KPPB 2CK0H 1ZHKA 3UEQA 3VNZA 5BVJB 1I1YA 1HH6B 2FBOJ 5DZ9A 5HGBA 3ILDA 5H94A 5HDQL 3D07A 4M6NH 3LNEA 3HMXH 1ZHBA 3VJ6A 1YECL 3FTGA 4L8BA 3ESNA 4GO9A 1K2DA 3NP3A 3RFZB 2UX7A 4RFEB 2J43A 4MKMA 1UC6A 1WF5A 2XN9E 1E6JH 1IGIL 1XXDC 4P46A 1WS7A 2ENJA 2JE8A 2W92A 4XVTH 1QRND 2W59A 3VFRA 5K9QI 1CBVL 5MEOB 2JI2A 4MQXC 4FA8A 2IDQA 2NSQA 3AAZB 4IU2B 5D1QC 3L3HA 1JK8B 1G5AA 1VIWA 4WFED 4UNIA 5GGVY 4DEPB 3WEBA 3EHBB 4AJWA 2H41A 3H42H 3QAZB 4B9PA 3OKLB 2JB6A 4KQ4L 4A6YL 3D39E 4AE1A 3MOQA 2NYYC 3ESPA 5B38B 2XNAB 3LVTA 4I4WA 1TETH 2WAQA 4UWQB 3IRCA 3RTQB 4JFZL 2WIIA 4K2UL 2WINB 5HHPB 2FSDA 2X4PB 1AZCA 1QQDA 4JFWA 2IFFH 1M56B 4F2ME 2MEJB 1KIPB 3VFMA 1QHPA 4ERSL 1G7JA 1BVZA 2BSCA 5GGTA 1KV3A 1KBGH 3QRGL 4YBQD 3JTTB 2F2HA 3ZDYE 2FD6L 4FX5A 2NT0A 3CMOL 5E2WH 2R69H 3JWOC 2WYZA 1P5VB 2BDNL 1KCVH 1JFHA 2Z91A 2LW3A 4HFWA 4PTTA 1AKPA 4I1RA 3TX4A 3EIFA 4PLJC 3LIZL 1NAMH 3L4TA 4DAGL 5KSVB 2XBZA 3F5WB 4HJTA 1DZ0A 3EF7A 1J5HA 1QG3A 1R3JA 1BV8A 2QHRH 4M7ZB 5DQ9A 5IVZB 1KBKA 5E23A 3DTDA 3DGDA 1EGJA 3KLLA 4HFWB 1JWMA 2XPZA 1BQHA 4HF5H 2DMCA 4JDTH 1FGVH 1IZKA 3GYRA 2I27N 1NCIA 1SYVB 2LT9A 3O3UN 2NNFA 4Q2ZA 4X8GA 3TJEH 3LSOB 2EO1A 3QO1A 2Y22A 1NICA 3ORJA 1B0GA 2VIRB 1GAFL 4N90E 5EUOF 5B3JF 1I75A 4Y9GA 4HUMB 3TWCH 1OAKH 3L95A 1MWAA 1NIDA 4UM9B 3APNA 2AV7A 4F1SA 4LSUH 5AW3B 3AUVA 4P23B 1LQSR 2NQCA 5TF1H 4K5MA 4TF4A 1JXFA 1JRHL 1JSYA 2IDSA 1MZZA 2PW1B 2F19L 3R7RA 2VN7A 2YAHA 3S5YA 1FO0B 1HE7A 2ZPKH 4PRPB 4HHGA 4ADIA 3WFEL 3KLSA 1YAIA 2AXHA 3D08A 4MDJB 2EIZA 1L0XA 4K3EH 3ARFA 3HS0A 4YSAA 3N85L 4IMKA 5D2LF 4FLOA 5L6YL 3UIYA 4G9DA 3FTSA 1FGVL 5JHDE 1AYOA 3GMMB 1HILB 2VLJE 5D1QA 4PJ6A 4W9KC 1LO0H 1M3JA 4H13C 4R26L 1AY1L 2ZJSH 1QPKA 3KHOA 1Y1UA 4KDWA 4OZFB 1NBQA 1PAZA 3HE6A 4M5ZH 4X5WA 5A2BA 4B7LA 3QRBA 3D8MA 3B43A 3VCLB 1INQB 3D18A 3RDTB 3H9SB 3UPAA 4MXWL 4J3BA 5I1HH 1Z9OA 3ZMRA 3UROR 5HHPA 3HN5A 2XXMB 1MHPH 2NY1D 2D7NA 1I9IH 1M9WA 2WSKA 4RGND 2C9PA 2VLRB 3GHBH 2AQSA 4MNGE 4OI8A 3N41B 2CIIB 1OLZA 2JKNA 4G1EA 5I30H 1G7PA 4UOJA 3KPQA 5K1JA 4HOMA 5GIRB 2EINB 3WTYA 3DBXB 5JW3H 5TE6H 1R3IL 3VFWB 4OJFH 5MP6L 5GS2H 3OHXA 5KW9L 3ARZA 3LKNB 4QYOA 2KBGA 1H3PH 2VLLB 3LXAA 1CXKA 2Y7MA 4XVSH 4ZAKC 1IC5L 3BPNB 3WDJA 2SEBA 3EZ8A 4TSCH 4UOQA 5BZXA 4UCFA 3JYBA 1FP5A 1KPRA 4FXGC 2E27L 4HS6A 5C0CB 2UZPA 1U91A 3MLPA 4LCCA 1XX9C 3FQ1A 1CZ8L 1I1FA 2ISDA 3S35X 5EEZA 3A6BH 4PUBL 5LN4A 3IMBA 2IH9A 2IH3A 3IMUA 5A16B 4F7PB 2F58H 4IMLB 3QO1B 1G9EA 2B5IC 1ZD6A 3CQFA 4FFZH 4JKWA 1PVHA 1XSJA 4WHTB 3AZUA 1DJZA 1I85A 3BQUC 3ES6B 4LESA 1I7UA 1KTJA 3HC4H 4LARL 4AUJA 1GS7A 3NTCH 2VKWA 3RI5F 3D85B 3RDJA 4ONFL 1DQQB 3HE6C 4M7LL 4ODWB 5DS1A 2YPVL 1OAZL 3HMXA 4JQIH 2Q86A 4G6KH 1KMGA 2ZUWA 3RGBA 2ZKYA 2F7RA 3FHEA 1V3MA 5HYSA 1KTKE 1FA4A 2FJSA 2YRLA 4ZYKB 1EGJL 1H6TA 3B56A 3WHXA 1U30A 2D03H 1YDPB 4RCAA 2Q6WA 5L7XL 3I50H 3X3FH 3HAEH 1S7RA 4XB7A 3QUXD 4EOWL 1E4WL 1FE8L 1IC5H 3L5XH 4GQQA 1LL1A 2A74C 4UQBA 2HVKB 3VA2C 4XGZB 1WAAE 4P57B 3DOIA 5C7ZA 3QR0A 4GAAA 5IFJA 5IWLA 2CZNA 4MJ5A 4BCZA 2KLSA 5J89A 1N26A 1YEJL 3CIAA 3S3SA 4OZFA 3ZL2A 4IBZA 5D2NA 4AQAB 1CK0L 1MI5D 2CDGA 1L9OA 1J7VR 4RFOL 1NLDH 1AGCB 4E9VA 3FB5B 1Q72L 5AZUA 2ZKXA 3AY2A 3VNYA 1VPOL 4A2DA 1E65A 4NENB 4ZS6C 5LDSA 4XNBA 1YYCA 2G4GA 3FSVA 4CMHB 3WIFB 1KGYE 4J4PD 4N0CC 1OAUH 3KPNB 2PCPB 5D6CB 2PO6A 1ZVHA 3NTMA 1ZVSB 2B7DT 2YD8A 4FQXA 5C0BD 4AGPA 4CDHA 2R2CA 5D1QD 4P07A 1AHKA 4IBSA 3B9DA 3GS7A 3MNVB 1YAZA 1MFMA 1TZGH 5KS9E 3OLEA 1NJ9A 3T4AC 3BFOA 4R2GB 3ARFD 1MY5A 2EDKA 5MENA 1QSEE 3KWUA 1QA9B 3GPSA 1WWAX 4FYSA 4TUJB 4LCCB 2TSAA 4S1RL 4X6DE 1MNUH 1H9VA 1NPNA 3CZFA 1DQML 5CD3B 5JHDD 4PJEA 1T03L 1S6NA 2L4OA 1REIA 4HBCL 3T8MA 2CJ3A 4QT5A 5ELIA 1BP3B 1TCRA 2AQRA 4YEEA 3C08H 1SXSA 2N7BA 3ZE2E 3QIWC 2ID5A 1NFDA 1DN0B 1WFNA 2B1HL 2XXCB 1MFDH 2Y07H 4UQEA 1PZ3A 5B21A 2EC9T 2FD6H 4W9EC 4M7ZC 4M29A 3V5KB 5I0YA 1TCRB 1PPIA 5AB2A 3ARVA 1S7WB 3C75A 1J1XL 4WTQA 2Y23A 1EAJA 1BDYA 1UJ3B 4NNYB 5F21B 1MWAL 5AOIA 3IGFA 5F7EH 1E6JL 1IGIH 2CBTA 2C9QA 3GWJA 4NQED 3P4MA 4XNUL 4NQXA 5L4JA 1AMYA 1TFHA 4YZFE 2P5WD 4XC1L 5ENWA 4X7SL 4H1LH 4PB0L 1X5FA 3V10A 3RTLA 3ABGA 4Q4EA 4V1DD 3W37A 3ZK0A 5IBTL 5KOVC 4N5UA 3VWKD 4E9LA 1AMXA 3MQIA 3P30H 4QJ4B 3DYOA 4I1NB 1ODUA 5JW5A 2YK1L 3PAUA 5SX5H 2Q8BH 4FQXD 1KLGA 4N26A 5EOTB 2OAAA 3P11H 4JPQA 1I8MB 4FHKA 4Z77B 3JBG7 3A4DA 4PGCA 3LS5L 4PJGF 5E6SB 4DPRA 3EJRA 2A4ZA 4KKBD 1RJYA 5I6KA 3OXSA 1S7UB 4IEFB 1FVEB 3S8FB 2OQJB 4DK3A 2MOGA 3AACA 3VRLE 5T1LB 2VR7A 2VMJA 3RWCA 4R4NC 3KYOB 4UTBA 4ISVB 1J0JA 4NI3A 4R3SB 4WLCA 4AZUA 4ACTA 2VO8A 1MFAH 2X7LB 5FFOA 1G7MA 1GZQA 5DD5L 5E6RB 4HALA 4CN4A 1IT9H 2HT2D 4IS6A 1WWBX 3PPEA 3V4PL 3LXUX 3IJYA 4I7ZC 5JW4Q 4JBSA 4POZD 1A4JB 4Z6AT 1U8QA 1KB5H 1GKEA 5ISZD 4JRYE 3RWHB 3T8XB 3ZYJA 2R2HA 1F2QA 2RD0A 1UOLA 3S96B 4H8WL 4KZCA 2I24N 1LYQA 2WLIA 3GXDA 5E8PA 4XVTL 4OLUL 1FHNA 2ZCZA 4IU3A 4POYA 1XCTB 5HYJB 1NGWB 4L8SA 3DIVA 1XGYH 5I1CL 3LS5H 3D7PA 2WQRA 4PJ8B 5SWSB 3M17A 3E2HB 2CGZA 5A2KH 5E8OB 2A77H 1PMYA 2ATPA 5DK2B 1X5JA 5F9WB 4CBZA 1XBRA 1JK9A 1EHXA 3FHAA 3QPXH 3GHBL 3MRNA 4WSKA 4QOKE 4E9SA 1D9KA 1T66C 3JV6A 1GZPB 1ZE3H 1H5BC 5BO1L 2X4QA 3FU5A 4WW1B 1SOXA 1R5IA 1KCSL 3MKKA 4LCYB 5DURB 5CCJA 5KVEL 3K8KA 2EE6A 2VQ1B 4LHUD 4AEEA 4UMGA 1Z5YD 2JB5H 4XMPH 4H8HA 3V7AG 3WKMH 4DUWA 1H3PL 3L6FA 2QZQA 3KPRB 4DP5X 3DURA 5GRXG 2FT7A 2KPWA 4LCYA 3VFRB 4YXLL 3MGOB 4OLUH 3WS6A 1YNKL 4MBOA 2FL5B 3JV4B 1ZMYA 2OMYB 2ZUXA 3AWTA 1HXKA 2ZCKL 4RFNC 1EAQA 1UM6L 4PB9H 4DTGH 2TRHA 2YEQA 1IAOB 3VMPA 1GYCA 2ZWSA 2JIXD 3MRKA 3TO4D 4NZUH 4BFJA 4N3UA 5FGCB 3VVWA 1OEZW 3QJUB 5HGBB 5IEKA 5IQMA 5DEFB 1ZOXA 1FFRA 5E7BA 5DZLA 3UGUA 3GB7B 1IQDB 2DICA 2JLLA 3GMNA 3KWWA 3WL9A 5FWRA 3B1TA 3CXHJ 3H3BC 2DKMA 1HHJA 4NKOA 1QATA 4KXZH 3EJSA 1F45A 1QR4A 1T5WB 2EVJA 1F86A 3NPSB 3REWA 5D1ZB 2VL5B 1GYAA 2Z4TA 4YSOA 3Q5TA 3IJ7A 2RACA 5ICZB 4AC4A 6FABL 4PY7A 2EDLA 2X4RB 3FU8A 4PRDA 2P45B 3QIWB 1AHWC 2KZBA 5F0JB 2EIKB 3FO9A 2OMWA 3CHSA 1CT8A 1CD1B 3MV7D 2NR6D 1U8KA 4HCFA 4RMQA 1U9KA 4JG5A 5B38G 2ZPKL 3EYUL 4PV9B 1ITBB 4DP6X 3ARDD 3EHBC 2J1XA 3WE6A 2A6JB 5E51A 2DD8H 3ARQA 2A6IB 4Y16A 5E1HB 1QLEB 4F3FA 3MRBB 3NA4A 2CRIA 1A1NB 4PV9A 2P42B 2ZZUT 1AO7D 3KNBB 3L9RA 3SGDH 5EF1A 1PFOA 5IB4A 4BM7A 4HCRL 1MCSA 5IMMA 2F8IA 5CU9A 4HH9B 2BLFA 3BHBB 4URKA 4JHZA 2FYYB 2PXYB 4RMWA 3TIEB 5IWLC 4CA4A 4HLZH 3SYAA 1Q9KB 4PJGA 1OO2A 2VXTL 3NACL 1W91A 2ITCA 3KL0A 4LAJH 1IBGH 1WG3A 1YEJH 2FT8A 4NAJA 2AK4B 1HH6A 4LCUA 3RI5K 1UENA 4ZMVA 4PCSA 5IMLB 2DEWX 5J56B 2OJEB 5L8KB 4Z3JA 3FQNA 4U3HA 1GIGL 2V3DA 4M7JL 2C7FA 1KCRH 1UWFA 3PDOB 5HDBB 2QGBA 2QQNH 4AY0A 4XC3H 4OGYH 1FGNH 2E75C 3JWDC 1MHEB 3DSFL 1NAMA 4QWWD 3ZTDC 4JFQA 1GW0A 2A74B 2F8OA 5IFAL 2J1KA 1WS8A 3LN4A 5HBBA 4ZW3A 3ZDXE 1FO0H 2UWEA 3HB3B 3GBMH 1TJIL 4KI5C 5CIPH 1NBYA 2ZCLL 3F6JA 5HHMD 5F88B 1IGYA 2EIJB 3TBSA 5D7SL 1MREL 4LCVA 5BXFB 5E1AB 4FLHA 1UT9A 3AWUA 3TEZA 3FCTA 1TO5A 4HKBB 4ZW5A 3IKCA 5B7FA 2VZSA 3GSNA 3BVTA 3UDWC 1FNSH 3QUML 3LB6D 3T09A 1JE6A 2IAMA 2VUKA 4S1DC 3SDXB 1CLYL 4OGXH 4PBDA 2P44B 5E8NA 2X10A 5FIEA 1LEGA 4B97A 1Z1WA 3EJPA 5DQDL 2ZICA 1QW8A 3J07A 4X6CF 1KUMA 4S0TD 2AXWA 3I6LE 3TBWA 4WRLA 2YD4A 4ODVH 4LF3B 2IG2H 4HUVA 5A2LH 2JELL 3AMKA 3FBKA 2B39A 4QRBA 1XEUA 1OCOB 3UAJD 3S4SA 2A83B 3BP6B 5DQ9B 2Z34A 3O45B 4JRYA 4PPTA 2K7PA 5EN2A 1N5YH 3D3VD 4XRCB 1C12B 1YPZA 1SQMA 1G7HA 4WFGE 4YDJA 3VI3A 2E7BA 1OTTD 3MBXL 3LPGA 4Z7WE 3F65A 3HG2A 5CSZA 5HI4D 2X89D 3G04A 4K8RH 4LKCA 3AQXA 4PD4K 4ZZFA 3CIQA 4NBZB 1T7ZA 4QTHA 1CQKA 1O9VA 2YAOA 3MJ7B 3UTPD 2E9WA 4R6UA 4NQCD 5CP7A 3N0AA 3GJFH 3QIBB 4GBXA 1F3JA 3VYNA 5ABZA 1I8KB 1NWOA 3LN9A 5E7FA 1NZRA 1YY9D 1RL1A 2ZYHA 4XO3A 1G1YA 4GO6B 3JZ7A 1KJMA 1J9CT 4KK9C 2FBJH 2NOYA 3CFBB 4N2IA 2D0GA 3SJVE 3PWPE 4K3HA 4HEPA 4AXWB 4FTVE 4RVBA 5D1XD 1MFBH 2XVGA 5D71L 1DBAL 4YDVB 5E5UB 4CADA 4XX5A 4H2AA 3A6OA 3VXSB 4APXB 5AG9A 4OZIA 3AVEA 3W56A 5E8DH 1FNGA 4M56A 2ZXWB 3EF4A 4W9JC 4M8UA 1N19A 5HYQB 4FLQA 4G1MB 2BNRA 3NJGA 4UZUA 5EO9A 1A3ZA 1YEIL 4J3OC 1XGRB 4MMYB 2ERJC 4S1RH 4XCEA 4YIQA 4NWUH 2MQGA 2AJSL 1DO6A 4I2XB 4JVWA 4OT1H 4PJCF 3CVCA 2VW7A 2X2YA 3OZKA 4TTDC 2WKLA 2BY3A 4LLQA 2CHWA 4NO3B 4LLYB 3QUMB 4WIQA 3EXJA 2V33A 2IO5A 3QEUA 1GGYA 3OB0K 3T0DA 4D0BB 3IKKA 3GMOA 1MCOL 3Q1SL 1AVAA 1M71B 2CIKA 3GJFK 4FHBD 2YUXA 4XX1E 1U8HA 3AG1B 5FOBA 1BQSA 3JV0A 1XR9A 4HIEA 4PP2A 1IGJB 1NGXA 4G1EB 3LTVA 2W9EH 5FLVA 2VDMB 1NCNA 5CZVL 3ULVH 3OR7A 1O6TA 4J27A 4M3HA 1J8KA 5L2KA 5FO7A 1BJ1H 2Y06H 3BDYH 4WEEA 4AYGA 4EAEA 2ENYA 5F1IA 5SWZA 5FECA 4ZPTA 1RXLA 2F54A 4HJGA 2BCKB 3LPWA 4XH2A 3OR7B 1FV1B 3SYPA 5TQ0H 3WS3B 2Y9RT 4OCWH 4LMQE 5FR3A 3Q6FB 4PI0A 3SPVA 1SDYA 1ZJAA 3DWTA 2GJ6D 2X42A 4JGJA 4PRHB 4LKXA 1TQVA 2G2NA 4BFIA 5EG6C 5C97A 4UAOB 1C7SA 1X6NA 4PN6A 4F7EA 1I3GH 3UG3A 1LO5B 5IJVA 2DYPD 4M5TA 3MCLH 3AWEA 3KJ6H 4PJAB 2FECI 1A4CA 2YBGA 1DBML 3ZE0B 4CNIB 4OD1L 1DVTA 2Q2EB 1HKLH 2V9RA 2YUWA 2Y2TA 4PJXB 4G8FA 5DC2A 3UX9B 5IJVB 2V17L 4PHXA 5LGJA 3EUDA 3EYUH 1LNLA 3S5LA 2ZCKH 4KRPD 3LS4L 4YFLI 1ILUA 2B15A 2BH0A 3BUYA 4MS8C 1F02I 2Y0SA 3QDAA 4NZUL 5IHBA 4WW2B 1KTLA 1LE5B 1LMIA 4O51A 5CINL 4RZCA 2FH6A 1PG7L 2Z31A 5E99L 3VMOA 4GQ9H 1BM3L 2WN3A 1A1OB 1E28A 2CDFA 4LGPB 1UGNA 1A7RH 2BERA 3FU6A 4MJ5B 2R29A 4LT7A 2EE2A 2DMHA 1I9JH 3ZE1E 2NUPB 3SDYH 5IROD 2WUBH 1U2YA 2VAJA 2H6OA 5GRUH 1ZANH 5HGGS 3U2SB 2IANE 2WVSA 5D7LA 4LPCA 5FV2A 4BV1A 2CKBA 3GRWL 4PCKA 5AALA 3HE7A 5JHAA 4OAWA 4LVNC 1NJ9B 3V4VB 3ZPDA 5HSFA 4F33A 2WN2A 3KPRE 2CNYA 2VZ3A 1BIIA 3GDCA 4L4VA 1UWGH 3PQYB 1GZQB 2X6AA 3L7EA 2UXGA 5BRPA 5AKTA 1N12A 1QYGL 3MOAL 2XV6B 5D6CA 3G5VA 2VLKD 5C0AB 2F74B 2R9HD 2VO5A 4JDTL 4YGAB 5BW7C 1XV8A 2Z8WC 1JZDC 4KROC 4GIAA 3TNNA 3NIDB 1U8IB 1G6RH 2NY5C 3MKGA 5E24E 1HDMA 1RJLA 4MX7B 1JPSH 4UDTA 1JWUB 2WLZA 2CPUA 4CSSA 1VGEL 4DERA 5L2JA 4X4MA 2GT9A 1QWHA 1YO4A 1JIBA 1S7SA 4JKPL 1Z66A 3PUUA 2HTLD 3IGAA 4R4BA 5EZOH 4PJIE 2V7HB 2Q3AA 5KBDA 1T0OA 4AEFA 1I9RH 1MXGA 4AEIH 1A6ZB 3ZT6A 3SBWA 4AGNA 2R2HB 4QPEA 4WI7A 2AJXL 1UYWL 1L0PA 1S8DB 3KG5A 2LU4A 2PUQT 4YX2L 1IE4A 1CICB 1NGWA 4N2GA 2UY7A 5LKNA 3Q9PA 1OQOA 1MRCL 1ZIBA 2APVA 4U6YB 1XGTB 5AVSB 1S9WA 2XZCH 3BC9A 1PLGH 1RUAH 1S8DA 1D5MA 1OHZA 1PLBA 3D39A 4OLVL 4JFED 5DO2D 2D0FA 4O4YL 3UJJH 4L1DA 5I1AA 3GMRA 4H8UA 3I6GB 3OL2A 3TVMC 1DVXA 3DV4B 1DVFA 1MH5B 3MJ6A 4Y4HB 4ZX6A 1PZ5A 3SDDB 5GGVH 1OTTC 3ZDZB 3AITA 2VQ1A 1OTSC 2OP4H 4I0PB 1M7UA 4MNGB 3STLA 2VMCA 5KYXA 3N6YA 4YHML 4MLIA 4DH2A 1LO4H 4QRPE 2C3GA 5DRNB 3V5DA 2QPFA 4J6RH 5JXED 1MG3C 3SPGA 1HQ4A 2OYKA 1S7TB 4LLUB 1CI3M 2YEVB 1DE4B 4X80H 2PYFB 4U1JB 3TBTB 3RAJH 5BCAA 5HI3D 3WNMA 3PWNA 5AAMA 2IBGA 4OCRH 2B3IA 3VO0A 5EOCJ 4HWBA 3N04A 4LLUA 3X12B 5I1LB 4NT6B 1UD4A 3O0LA 3SY6A 3Q6GH 3VXNB 4GP8B 5E9NA 5HGHB 1J5OL 2AW2A 1WFMA 2IDCA 3K3QA 3GT6A 3CX5K 3PCYA 3CU7A 3FSZA 4U49A 1KF9B 2KI6A 1IU1A 3FUDA 4N8VB 1BVKA 5FCUH 2BX5A 3QQDA 3STZB 2I9LA 1NCBL 3IVKB 1IC7L 1G7LB 3C6LB 2EE3A 2XFGB 4GRWE 1GCFA 4JFEB 3MRNB 1E9QA 2JWYA 3U7YH 2YKKA 2EECA 2N0MA 3B5HA 3HUJA 3NBNA 3HR5B 2YGVA 4CRPA 2FWUA 4Z7AA 5IVZA 3ZDXB 1KCRL 3M46A 4GINA 3QAQA 1YZZA 3TH2T 1GGTA 4O02H 1J1OH 2MHAA 2PPFA 3G9VA 5JOPE 1P6FA 5TDOA 1G43A 1BG1A 1CXFA 4A6YB 4PIRF 5K9JL 2GITA 1AO7B 3JT2A 5C0GB 1MCPL 4JMXA 1XD0A 2ZWEA 1MW0A 3UPRB 2R51A 4ENEC 2KZ1B 2OSLA 4WO4D 4OGAD 4X50A 3KHQA 2FATH 4HPOH 3WNNA 4G6FD 4GMTH 2RQ8A 1YC8A 3L16A 3PL6C 4R7LA 1MEXH 1H3XA 1NSNL 4NSKA 3HN3A 4JG0L 2Q7AA 3GD1C 4H25B 5HDOA 3SGJC 5DJ2B 1IAOA 1CFSA 3HKZA 1NL0L 3OLDA 2O4EA 3KPRD 5E00A 4JQVC 3LXBA 4CUCA 2AJUL 2X9YA 1UXSB 3WL9B 3PWLA 4L3EB 4W9DC 3U1SL 1EO8L 1BJMA 2H6UA 1WIOA 2B59A 2CO1A 1IAII 1P4BL 5DJ8B 1QKZH 5I15H 1JPGA 3CSBA 2FK9A 1CE6B 1GCYA 4YSDA 1BD2E 1EUTA 2NY6D 2NQ3A 4WI3A 5AB1A 1SNRA 2X70A 1A7PL 3PAZA 5AYTA 4ZFOB 1WE5A 2LLGA 2XUWA 3VM5A 3KJ6L 3OKYA 3GJEA 4UOW1 2E7MA 1I85C 3BQUA 5I2IB 1CE6A 3FO0L 4FL4C 2WQVA 1X5KA 1S7TA 4TULL 4X99A 4IK7A 4PY7B 2E6JA 3GZKA 4QXWA 1BBDL 4LU5L 5DUJA 4OIIH 1VZIA 3VD9A 3CXHK 2UY6B 4IKKA 3QCTL 3U0TB 1E4XH 1WK0A 1LK3L 2F5BH 4EI5A 5C0BE 1SXCA 5KG9A 4FXGA 1JGLH 1LMKA 4JY5L 5D7LE 4PTTB 4X6DB 3VD4A 4ADGA 4U1MA 2L7QA 5JYLA 3HZMA 5B3NA 4BSVA 5DUPL 3BEVA 3FCBA 2CIIA 4K7PH 1WCBB 4MASA 4JM2A 1A65A 4R2GC 4TL4A 4U0RC 4UTBH 3W2DL 1RQ5A 3G6JA 1NOAA 5INCB 3L3IB 5I1EL 3QUYC 2GJ6B 2ZD0A 1FC1A 1XH2A 4M8VA 1NFIB 1JYXA 3MLZL 1F3DJ 4N5EC 4HBCH 4X9YA 3F58H 2WKOF 1G4RA 2OL3A 5AUMB 4LDLB 3KH4A 4JQVA 4WGWB 3BHBA 3ARGC 1I82A 1C5CL 4GW1B 1FPTL 3UTZB 3X14B 3MFFB 1LEGB 3QEGH 3OSKA 1TENA 1DBBL 1FN4B 4NQTA 2H8PA 5AW0B 4JJHA 2Z0UA 2YMOA 3W3BA 1RK1A 1R5WB 3RQ3A 1KELL 4JHVA 5GZND 3OB0H 1J1PL 1MWAH 1M1SA 4NJAL 1ZS2A 4R4FH 1C08A 1CDIA 2ZYRA 3JV5A 2H3XC 3ARBB 1DBKL 5BV7H 1J9TA 3DO7B 1BZ9A 1DFBH 3ABLB 1R3HA 2J5LB 2P5WE 2J8OA 3IF1B 3QXWA 3IDJB 1KXTA 1SVZA 2AK1H 3HHRB 4BH7A 3FFDB 4BXVA 1SGKA 3THML 3PDDA 4YDVA 2ZKHL 1NOLA 5JYMA 1MJUL 3GSVB 3T3MF 1RFDH 1K2DB 1W9XA 3C60B 3P69A 2BMKB 3US9A 4ZMWA 5JQHC 2B0SH 4U6VL 1NCHA 4KBPA 5B1AB 4FABH 3CN4A 4G8GD 3E8UL 4Y5VB 3RDTA 4DPCX 2P8MB 3UO1H 3OV6A 3R06B 4M03A 3IXAA 4Q9RL 3CLWA 4ZOAA 4JPVH 4AQAA 4NO0B 3Q44A 2HUHA 3MV8B 4UAOC 1S2EA 4A7TA 1QFHA 5TFSL 4AQ8A 4HUWB 2A0LD 2NRDA 3RVUD 4I3GA 3O2VH 2VUYA 4L8SC 4JZJB 4LPWA 4OJCA 3N1PC 3FW6A 5DJAB 3QEUB 6PCYA 3SOBL 1QASA 5I0XA 4U1NB 5JIDA 3MREA 3RVVD 5KTEH 1N2RA 2JKXA 3MV9A 4WNQB 3O6FC 4ZQKA 5BO0D 1N5AA 1FFOA 1HINH 2BVEA 2M26A 5A3IC 1OM3H 1RZQA 2YQBA 1CYWA 3GBLA 4JRYD 4JO4L 4ALAC 1X7TA 2VR3A 4DUXA 2CJUH 4QXTB 4AJYV 1XF3B 2WXGA 2YMXL 5IJKA 2G4EA 5E2TH 1ZT4A 3ZKXC 2YC1A 2CO2A 3V0VA 1OTSD 1F3DH 2WIMA 2ZX8A 1DP0A 3NJKA 5GGUB 4ICXA 4ELMA 3GBEA 4ZNEA 3DXAE 5IQNA 1M7IB 3AWVA 1ZSHA 5J8OA 3BP4B 4C4KT 3OKDA 5T1MA 1AR1C 2DWEA 3GZQA 4B7IA 1NMCB 2AV1B 3A4FA 1G9NL 1TQUA 3S8WA 1I8LA 3QUZB 2F53E 1V7ML 3E1F1 1YQVL 1GZHC 2KDGA 4NJ9L 3FUEA 3DVNB 3NIFF 5FV1L 3S48A 4Z3HA 2EXSA 3ZDYF 2DWTA 2WOBA 1JI2A 4L4TD 1AGEB 5D7IE 1UADC 4AK1A 3N9GL 3RNQB 3CVBA 4AYFB 3CFJB 4HJGB 3QS3A 3KLAA 3BWUF 1ROWA 4TRPL 1IGMH 1G6RA 2E86A 3DX3A 3FS9A 4IRSB 5KYUB 2F5AH 2YS4A 5G5DB 3ZRFC 4K9JA 5AOLA 5ANMB 1CF8L 3S98A 1EJOL 3RNQA 2EP6A 5DD5H 1JZEA 3VGAC 1ZKAA 5DJCB 3T77B 1NKOA 2YJLA 1LM8V 4MDJA 5FYKU 4L29A 2H2PC 5F0PB 1DUYA 2CCLA 3GUFA 3DX4A 3QXAB 3U4EA 4WI4A 1Y0LB 3QIBC 1AC0A 3GMMA 2WYIA 2IIJA 2XG4A 4G6ML 4O2FA 3K2KA 1ASPA 4BA0A 3K72B 4PRPD 1DVFD 4RMSA 3VXTA 1HNYA 4OGAC 4XO5A 2WXIA 3JWOH 3IBEA 2J3SA 4XBPA 5MI0C 1BM7A 3FBQA 4FG6C 1LO2L 5IKCA 4Y2OA 5DF0A 1VZHA 1MQKH 1XBDA 2OCCB 4FNLL 4EN3B 4B5ZA 5E2VH 1JHKL 1P1VA 3UFIA 3K71A 4I2XA 4P2OB 3A0OA 5HHNB 4BD4A 1IM3A 1T2XA 2YWYA 3CFTA 5F7MC 4APQC 4RX4A 2CUMA 2R1WA 4J3XA 1RJYB 4AW7A 1KJVA 4GIOA 4UOZA 1IMHC 4PWIA 1A7NH 2DQIL 2H4EA 3QI9D 3QJXA 1UUNA 1JFQH 1CGXA 4J3OH 3P4OA 5C0AA 3TC9A 1IFHH 2HTKC 1NEUA 3W6QA 2YUVA 1KXVC 4EI6B 4F7EB 3ECQA 3L5IA 4PJDB 1JZ4A 5E9DA 1A21A 5CFAA 5IF0B 1ND0B 5L2KB 3IMVA 2AABL 3AU0A 4HCRH 5IOPB 1J8SA 4X6EA 4UT7H 4N0FB 4G9FE 1NMAL 5AOZA 5F7AA 4ZPTB 1PG7W 5EOCL 2FATL 4HPOL 1OW0C 3NA9L 3HB3C 3MLWL 4H8PA 4LK4A 3SKNA 3II2A 3L08A 3FB7A 3CSYB 4D0DB 2EYSB 1U3HC 2EABA 4NRZB 5IOPA 2PYEA 2HFGH 2NXYB 4KXCA 2KPNA 2PXYC 3DSNB 5DWUL 3ULSA 5F8RC 4WWKA 2XFXB 4YS4A 1MIEL 4WF7A 3MI6A 3SKNB 1EH9A 1TFPA 3CX2A 1G6RB 4IRSA 5SX4I 3V4UL 1VRSA 3ESOA 4LGSB 4G8EB 4LL1A 2KL6A 3GPEA 5HYSB 2ZOLB 2PR9A 4AMXA 1BLNB 5GS3A 2D9QB 3WAJA 1HNGA 1OPGH 5KVEE 4NI6A 5CEZE 1XGQA 4KK6C 3KPRA 3LRSA 2AERT 3CTTA 4XN1A 2FVNA 4FFYL 2HSIA 5C09D 4Y16C 3KL3A 5DRXB 2IBZY 3W82A 2YPKB 5IFHH 3OG4B 43CAB 4WW2A 3TZVD 3KD4A 3P3TA 1KLGB 3JWDL 4LCWE 4LOFA 4ODHH 3VX1A 1PSKL 4Z8FL 4HXBL 2R4SH 4Z3GA 5IB5A 5D96C 1BX2B 3RUGB 3KGRA 2V8LA 5I5JA 2BWQA 2Z0BA 3SQBA 4I87A 5IKCB 5F6HI 2I5YH 5DMKB 3D34A 4R5TA 1V3JA 1A5FH 1JGLL 1ZS8A 2AMGA 3HLKA 4ZMZA 7PCYA 3EJJX 2CUHA 3QZMA 1AZBA 1NUDA 5C2BH 1FG2A 4YHKH 1XSIA 2GTQA 4FQCH 1Y1DA 1UWXH 4JVUA 1X5YA 3UBXI 4QOKB 1JGUL 3OPZL 2AHLA 4JG0H 1QI3A 3BX7C 2EDTA 2Y1AA 4MRBA 5FUZL 2LHAA 1QFUH 3B7YA 1T4WA 3GKWH 2YQGA 2B9AA 4U7SA 4GKNA 2EDNA 2BWIA 3KEDA 4EDWL 4JFFE 4MFHA 5C9JB 1E9QB 4OLXH 2VDLH 5DR5L 2O6PA 5I17A 3TURA 5MENB 2D03L 1RZFL 3I84A 3S3DB 3MBXH 2EEBA 1QD0A 2Z93A 3EYSL 4YN3A 1RIHH 3UZQB 4XC3L 3T2QA 3V4VH 3VFOB 2WWKT 5E70A 4PGDB 1YNLL 2ZXDA 4HJIA 4MHHI 2OKMA 4RGMB 4NKQB 4DVRL 1QMUA 3Q2CA 1X5LA 4K8RD 4JJ5B 4N3TA 3L9RB 1XMEB 5HDQH 5CSGA 3VWJA 1BZ7B 5LAXA 4I89A 2V5SA 3MBWA 3TIDA 3TBYB 5BOPA 3CVIL 3FONB 4FTVD 4ZRGA 4YWGL 2CJUL 5D1XE 1E5BA 5EZJA 5ESQA 1MUJA 3VD7A 1N9PA 4MQ7B 3ZKMD 1JK9B 4YPGA 5FK9A 4D8OA 3NPZB 3KXFD 4OZ4B 2KC0A 5FGRA 1THAA 3PWLB 4M1DL 3QPKA 3STLB 3HI6L 3QQNA 2XICA 2J56A 4WEBH 4JDEB 4GQPH 1UJTA 3HTLX 1D3CA 3FYIB 3WDHA 3W6WA 3EO0B 1XAUA 4JO1H 3MROB 4HOXA 5MEOA 1R75A 2QQLH 4GUPB 2H47C 5EPMA 1G1OA 3MJ9H 2F8VA 3KPPA 3MYJB 1S78C 3QUZD 2BZDA 4MTMA 1HHJB 1T1YB 4NKOB 3EO0A 4NKMA 3FTUA 2E8YA 2GK0B 4XX1G 3RGVC 4ZG1A 3U7WL 1TZIA 4E5XB 5EO1B 1A1MA 1UXWA 4HD9A 4PJ9C 4RRPA 2R69L 1P4IH 2PWGA 4X6FB 5CCKL 4HWBH 4QOKD 1P1ZB 5IBLD 1G0YR 4KDTC 5B39A 1AQDB 3EFOB 5IEKB 5IBUG 2Q3ZA 2HPTA 5J11C 5EZIH 5TE7L 5LGKA 4E0RB 3SKOB 1TEYA 4PW4A 5B1JC 5J06A 3DRQB 2I60L 3NRQA 3DVIA 2O5YL 4MJHA 1LEKB 1YSOA 5FYKH 3GS0A 1J0IA 3DETD 1E6OH 5F6IC 1WFOA 3CDZA 2DPKA 4FQQB 2EKSB 1QFOA 4KKQA 3O0RL 5D2NC 4OFKA 2IOIA 3GI8H 4Q89A 1N0LA 1AXTL 4HT1L 1SY6L 3D50A 3N43B 3MCYA 3TBWB 5KVGL 3DJSA 2VGLM 1RD6A 3MRIB 4POUB 1U95B 2D3LA 5H35A 3T0BA 3HIZA 3WHE1 2H8PB 4ZW6A 5DJ2A 4IRJA 4ZX4A 4Q9RH 4XAWH 1QEXA 4DP0X 2VLJD 1B0GB 2VIRA 3WFCH 4KTGA 1L9QA 3L3GA 4F2MA 5I8KH 4IDLA 2IAMD 5ITBL 3N91A 4I77H 4D0CA 3D0AA 2X44D 4XPFH 4BSWB 2WO3B 3EAKA 3U0WH 3H4HA 4PV8A 4YBQC 3MRGB 4IRZL 1BFVL 5M94B 5HYJD 3UTZA 4EXKA 2UYLB 1WISA 3QIBA 5E94A 2AZAA 5CCGE 1QUPA 1JGEB 1KN2L 2D7TH 4KMLB 4C83B 1L7TH 1H0DB 1BF8A 2R23B 3JWNG 3M88A 3ZRCC 4GT7A 1U4FA 4G6MH 5JQ6H 4OCMC 1HI6A 3RJDA 4LSTL 3QDGD 3T0AA 2ZF8A 3HAEA 3E7JA 4P6SA 5HYSG 3HG5A 3X1FA 1HILA 1T83A 2BIOA 1L3NA 2OR8A 2P8MA 3DDGA 3N43F 2IQAA 5E4EB 4OD3H 1NCAH 1MFCL 4KRNA 4RGNC 4N9OB 4Z7IA 2ALWA 3EFFB 3POCA 3QDME 2BNRB 1NCWL 5BPPA 1AGDB 3NZUA 2X4OB 4O2CA 2H2SC 4AQEB 5TQ2H 2YO3A 1BMGA 3JTTA 1WUZA 1GPOL 3UABA 1ZGLP 1OARH 4FQ1L 1LWJA 1AS7A 5IEHA 1CLCA 3U36A 3TO2A 1H6EA 1MCKA 3KPSA 1BJ8A 4F5CA 2O93L 2LAGB 4O2CB 2D2CC 2VLKE 5D4IA 2NX5E 3TBVB 5DFVC 4LQ1A 3RY4A 1DEDA 4P2AA 4ADJA 4YSRA 2GJZA 5GGRY 1G7PB 5L2KD 1RZJC 2OR7A 5F8QC 4IMKC 4B9YA 4FAAB 3FQXB 1ANUA 4LSTH 2X4UB 2EDEA 5KZCD 4HZLB 3FN0H 3KXFE 1XCWA 1P6WA 1PSKH 5TPWH 4CKQA 5I9QC 3CC5B 3MUUA 1N2RB 2YEZB 2GJ6A 1KIRB 1C12A 2H26B 1CD0A 2BS71 4MA3A 5ICXB 1CU4L 2LVEA 2PWFA 2VDQL 3JXAA 4F92B 5FECB 5KSBE 3G04B 3N3EA 4CBPA 1PEZA 4XN8A 3PXLA 2UZYB 3Q1EA 2BOBB 4AGLA 4P4KB 4TQHA 5ICXA 3C6LD 2NY1C 2D3NA 4F91B 1HHKB 1MHPL 3PV6B 2FSEB 4FEMA 4AVJA 1BWMA 5B4MC 4I13B 5AW2B 4WI2A 1CDUA 5C8JA 4LSPL 1KY7A 3C60A 4L3ED 2G9KA 2B1AH 1CDHA 1FNLA 1FI8C 4JRWA 4YDZA 4M4RA 2J8HA 1WRFA 3NACH 5D1XA 3U0PB 4ZMNA 2WXPA 2XDHA 2APTA 4Y9FA 3V5HA 2YKLH 2YRZA 1KYFA 2B1OA 2GI0A 3FULA 5GRVL 4OLEA 5HHOA 4H1LA 5GS0C 1T3FB 3P0YL 2A73B 3UJIH 4PJ9A 1LXMA 2G30A 1MJJA 3EOTL 3TNMA 4ZAKA 2CR3A 4G43B 4XP9H 3RU8H 1S9XA 4L4VE 4O2EB 3K6DA 4ZOCA 4NKDA 3VD0A 2WVVB 1AZUA 5HHOB 3CUPA 1N5AB 3MGAA 2RCSL 1F4WL 5BOJA 4LEEA 5J0BA 4JPWL 1C5DB 3GBML 3UZEC 1R3KB 1KJ2L 3GSUB 4B9JA 1NGYB 1RUQL 1NFDE 4P3WA 3VFWA 2KQMA 2XHNA 4ZUWA 4BWUA 2VZTA 4MZRA 2PPEA 3N2JA 5J12C 3P4NA 2VW4A 3FOLA 1HKFA 4PLOB 1JHLL 3MREB 3FRPG 1D9KD 1ADQH 1KDJA 1DQJA 2VQUA 2KQNA 4ODXA 3UTSD 1W8NA 4DN4H 1MY7A 1S7XA 3VXMA 3ZMNA 2W65A 1IJNA 3VU2A 4GRMB 4OY9A 2OMVB 4HKXA 5M7QA 1IAKB 1BOGA 4NN5B 3HG3A 4IRJC 4BFOA 2JMRA 5C0JB 4UT6A 3V0WL 3VW3L 3VXOA 3QARA 1M53A 3DX6A 1DQJB 2OR9L 3IDUA 3EYOA 4OF7A 2EIEA 3IWUA 3QDGE 1JCVA 3INUH 1J8RA 4WO4A 2CDEB 4YO0B 2DBLH 2CWRA 4PJEB 4PREA 1OWRM 1BG9A 3F7LA 4UT6L 2WBJA 1M9SA 5E0QA 1WAAA 4WU5B 2AAVA 4YAQA 4GFTB 3VACA 2AV1A 2X0VA 3N44F 4FN0A 1GRWA 2XXFA 4MGXA 3FF8A 2A9DA 2XPGB 1SUJA 2YPVH 4ZXBB 2HRPL 4XODA 1UXLA 3LNFA 4Z7QB 4RDQF 3QJFB 5DI8A 1OAUL 1YG9A 5DVOA 4LKXB 4NDMB 3SKMB 3QJOA 2CSPA 4BZ1H 1I8KA 4LLWA 3VXMD 3ERXA 3UJTL 1NPJA 2XETA 1GGUA 2EVHA 1IBBA 2BHYA 1E40A 2GY5A 3VD3A 4FTDA 1E8YA 1B4LA 2HRHA 2FECL 4FQXC 4HSAC 5DHVH 2GVYA 2HB0A 3GKWL 4RAUB 3RGVA 2DEYX 4QTIH 3KJ4C 5H4ZA 3MU3A 4LIQH 4N8UA 4QLRA 2ZG1A 3O6KH 3I6GA 3SPIA 2AEPH 2BO0A 4BEIA 4UT6H 5AVRB 1RIVL 4NNPH 5K9KA 2DQCL 3RURA 4N2FA 5DQDH 3SDDA 3VTMA 2V5TA 2YARA 3VUAA 5D7LB 1BBJB 3LHPH 3QIWD 3R8BB 1L7IH 2FTAA 3RFRA 3D0LB 4MXVF 3WEMA 1NKGA 2OJZH 3MV7B 5J9PB 3V4VA 4JQIA 2PPAA 3WNPA 1EPFA 1QEWB 3VFVA 4X4KA 1XCXA 5FKAA 4Y0GA 4WO0A 4G9FA 4PRID 4ERSH 5ADPH 3QDJA 2VR8A 4XZUB 4JFDE 3ML9A 4LRNH 4QOKA 5DJDB 2BP8B 1U8NA 2D7TL 4GSXA 1NDGA 2DDQL 2DI7A 3W38A 1IBYA 3LQAH 3N06B 1KCBA 2NCMA 3LZFH 3IDMB 1HJCA 2H3KA 1WAPA 3CNKA 1RSYA 4HCIA 1MJ7H 1SN0A 4N2MA 1A66A 1DR9A 4KXZI 4TSAL 3WD5H 1K3ZA 3CN1A 5I1CH 2X0UA 4NUGL 1Y07A 3GHEH 1FZOA 4YPJA 2N56A 3FT4A 2DAVA 3ATAA 3D12B 3M86A 3AS3A 3GXFA 2AXGA 3OAWA 3IYLW 4Y2LA 4L8DB 3TONA 4M9PA 3NFPA 5F3BA 3DK2A 1QNZL 4NXKA 5DC4B 2ZG3A 4CC1A 5ERWB 2F9BT 5DK2A 3BLKA 1KENL 1UJ3A 1BZ7A 5LAXB 3ZDWA 3H3PL 3KMDA 1WICA 1K4DB 5AW9B 2CH8A 3IRZA 2HAZA 4YQXL 3GRGA 1TCMA 1JNNL 3FB7B 3UPRA 4A7UA 1OP5H 4QXGL 1HHGA 4TTGA 3BW9B 5CUSH 4DSYA 1QR1A 1IV8A 1AHWA 1R17A 2NY2C 2DBJA 4D9RD 4DKTA 4FI8A 4HYTB 1OB0A 2D7QA 4Y5YB 1FZKB 4YDKH 4YVNA 5ICYA 3PJSB 4FULA 2C3VA 4XNUH 4X5QA 1BXXA 4PJAE 4ZUTB 3E6FA 4XPGH 4NGHH 3QIUA 1NEZB 3US1A 3CG8A 4O9HH 3D25B 4FHJA 1ORQB 4PB0H 3ZO9A 1N8OE 4KNSA 3MRDA 5DZVA 1BGXL 2ZOKA 4PGBA 2HYMA 2MTAA 1WIUA 2Q9OA 4S0SD 4XCNA 5DD3H 4ETYA 3ARUA 2OX5A 5TGBB 2VERA 4YPGB 3OXSB 3CGTA 4CGUB 5KVGH 4GRWB 2ZXAA 2P52A 1N7MH 3PHQB 4LFHD 4ZSOB 1UACH 3QEGL 3DVFA 2APSA 4LPYA 4N25A 1EV2E 2DJMA 3L5JA 3TEXA 3U4KA 3QA3A 5I5MA 2FHBA 1J87A 1Q0EA 3GSWB 1Z9SA 4RLDA 1A6UL 1AO7E 1F11A 1JV2A 1LDPH 4Z77A 4HH8A 4JN1L 1ETB1 4NZFA 3FN0L 1P4UA 4MB4A 4AEHH 3ZE0F 2YD1A 4ZFQA 3BWZA 2VZVA 5C0DA 4DKDC 1EJ8A 3FO9B 5HYJA 4FQQA 3D52A 4Y4HC 3QIUD 1JMXA 1TZAA 1X9LA 1F6LL 4EVNA 4L05A 3S3BB 3LQAC 2X2JA 3TO4C 5TDNA 4Y2NA 1ZY9A 3F5WA 1A4JA 5LCVL 2DTSA 3B7RL 1Y7VA 4YXKH 1N6VA 2CD0A 1OL0A 1W0WB 3EBGA 4RGOL 3CE1A 4N24A 3RNKB 3RZCD 1BYOA 4FLSA 5D7IA 1CGWA 1F6AA 1GGBH 2VMEA 1HTYA 4QHNA 1KWGA 2F15A 1K4DA 4P5MA 1B0RA 2A9NL 4NQEB 1IKFL 2GBAA 4DVBB 4IIQA 3PP4H 2BRRL 1I3UA 3IETA 3FB6B 1RZKH 2VUOA 3D5OF 1FJ1A 1D5XA 3OKMA 3V6ZB 5HHXH 2VN6A 1U4EA 1AG6A 1EGJH 1U95A 5D93B 5DVKA 3TIEA 4B3VA 3TBYA 5K1NA 2DWDA 3SQOH 3NCYS 1A4BA 5F7DA 2ZG2A 3LRKA 5CKAA 5DZJA 3BGAA 4QHLB 1VCBC 1MZYA 2AQ3A 4MXVE 4MQ7A 1IC0A 2XY1A 3EJYC 3N5AA 4HX1B 5KUMA 4BH7B 3V0DA 1MHCB 5IW1B 1T83C 3BD5A 4LOVA 2O1AA 4LCIH 2ADGB 4I9XA 4XP6L 5ESAA 3L4ZA 1HX0A 1KYDA 3TCTA 4KKPA 2JTYA 1D7DA 4DP7X 1B4TA 1HCFX 4Z7UB 4DKFH 1JDCA 2BP0B 4Y89A 4YFDB 3ELQA 2YD6A 5C3TA 1VFUA 2X4OA 4G3YH 1K8DB 1PDKB 1ZHBB 3VJ6B 1KY6A 1NCUA 1V10A 1Q1JL 1T1ZA 4G8IA 4I2XE 4Q8BA 3LN4B 2YZ1A 3IFLH 4IGBD 3DGCR 1VPOH 3WY2A 2G5BA 4G82A 4P46B 1F4XH 3CSPA 3LZPA 3ZUNC 3FQWA 4OM1H 4YE0A 3QIWA 5AEAA 4I0PD 3DARA 1LP9A 3OAYH 3D3VE 4PJGE 4Z76A 4P2RE 2EJ1A 5DGQA 5FFLA 3VD5A 4QRPB 2ZSWB 4U3SA 1OOWA 2IGFH 4M6ML 4R96B 1FCGA 3L3IA 3ZU8A 3T3ME 5CBAB 4XN7A 1C7TA 4MCYB 4M61B 5FAAA 3ATEA 4LPTA 1M7XA 3ZZ1A 2MNUA 4DT2A 2J12B 1PCXA 1PNCA 2P5WB 3QCVL 1XR8B 2V8MA 2UZXA 2JV6A 4TLUA 4G9FD 4OFDA 1RSFA 4PRIA 3G08A 1A3LL 3A4AA 4FTVA 4TXVB 3IVKA 3LZLA 3H9HB 1F00I 5TDNB 3V4LA 2E7HA 2DD8L 3WUWG 1UA6L 1UA7A 4B0MM 6CGTA 3G6AA 1NFKA 2CM6A 2GJZB 3WEOA 3RUGF 2QSVA 5J4MA 1Q9WB 3TJEL 1P5VA 4HXAL 4O00A 5B3SB 1W16A 4J12A 5E5RB 4HS6B 1TJHL 3HRZA 1Q0YH 2EQDA 4PRHE 2NPLX 2GJRA 3RWJA 4JZOA 3R0NA 1YEEL 4XOBA 4I9WD 5G4OA 4HIJA 4J6VA 1PY0A 1RUPL 5I6LA 1VADB 4BQCA 4NO2A 2YIHA 4BFNA 4JPWH 4XMXA 5GISH 1L9MA 5AVYB 5L9DH 3BPLB 4Q6IB 4YDNA 1QFWM 5EEUA 3BZEB 1I1AB 2AK4D 4N2CA 4X9IA 3SDCA 2WCGA 4PJXE 2GUYA 5D7LD 1NDTA 4X9HA 5F7DB 1MKFA 3KDPB 4P4RB 4BH8A 3VWKB 2JCCA 5IQOA 3NCJL 3MNDA 4U1GB 2C8NA 3KGUA 5DK0A 4F7TB 4N2DA 2HCZX 2NNXA 2A74A 5GJSL 5I16B 5D2LA 1CURA 2ICES 1P6AB 2R15A 5EB9A 1LWRA 3R8QA 2FHFA 4MZIA 3BXNB 3MA7B 4XGZA 3OD3A 4DO6A 5IESH 4ZT1A 2OYMA 3QXAA 3U4EB 3VSUA 1YN7A 2X2HA 4DFIA 4P46D 3SO3B 2IWEA 1UEYA 2LOEA 2OS7A 4YK4C 4OLZL 1J5IA 4YR6B 1FL5A 3RJOA 5DU7A 2RBLA 1WLHA 3BXNA 4W9IC 5FOJA 5ETUA 4MJIB 3QO0B 4KVCL 2WXHA 4MDRA 1BBDH 2A9CA 3LKOB 2NT1A 4LU5H 4YE4L 4D9QD 1XZWA 4S2SA 1NMBH 2P28B 3FU7A 4JJOA 1JS4A 2GKIA 2WXFA 2UY6A 3TYFA 1ONQA 5BNXD 3ULUD 1JXGA 3A5VA 1X4ZA 3GXTA 3K4ZA 3LZFL 5E8NB 3VI4B 3CVHL 4Z7WB 4GJTB 1DBJL 2WB7A 2PKDA 1SJHB 1G1CA 2FJUB 1DVYA 4D94A 2DYPA 1HS6A 4GSUA 1K4CB 1KGCD 1MCJA 2H26A 1GJIA 5DJ0A 2YGOA 1ZA6B 1H8SA 2EDFA 3W2DH 2VR9A 5CEZL 5F89B 5D1ZD 2NZ9D 1ZVSA 3HFMH 4NQDE 4HG4J 1EHNA 5KSAC 1UM5L 1BMZA 3EW3B 1B88A 2WVTA 3IDYC 2VCOA 2JELH 2FLMA 1G1KA 8CGTA 3V6OE 1U8MB 5K9OA 1NL0H 4HV8B 2LR4A 5ANHA 3V52L 3SY0A 2XQYA 1EEZB 3LKQB 4ODHL 3T6ZA 1JTPA 1FVDA 4QCIA 4MJ2A 1EEQA 4GBXB 1F3JB 3TVMB 3SKJH 1SBSL 5DRZB 2ORBH 2CK2A 2K4WA 2M2DA 3OZLA 1BUGA 3WIHH 3H6JA 3BAIA 2BOBA 3D05A 3MMEA 2JKSA 1I3RA 3LN5A 3DOSA 3FQUA 4FZ8L 1SF3A 4U1GC 1DN0A 1MCOH 2FSEA 4J3UA 2GTWA 3IJHA 4PJHA 1TQTA 1XGPB 4QXVA 4WU7B 1T04B 5T1KD 1KLFB 4AQ1A 4H0IA 5AL8A 4UOW0 3NABL 1E50A 1TT6A 3VX0A 1XZ0A 5DMGD 3FQUB 4BZ2H 4KUCD 3W9DB 3H9SE 1J8HE 3PS6A 4D3CH 4RMBA 4WU7A 4AQ1B 3IAQA 2C9UA 3IU3B 4W9CC 1AACA 2K70A 5GGRA 4NDMA 4J3OG 3BO8A 2G5UA 3SKMA 5C0NC 1QBMH 1QLEH 4C4KO 5KYYA 2MCPH 1FNGB 5SWQB 4FDWA 3ARPA 4UINH 3OAUH 2P1YA 2GYSA 3WIHA 2E9JA 1KBBA 5JUEL 3ZE1F 1JN6B 1YNLH 3O8XA 2H6PB 3V4PA 2CUAA 4NM4H 3WTXA 3B2UC 4MMYA 3TTSA 4PRHD 2NW2A 3Q8AA 5IMOA 4QTFA 5EUKA 5EEYA 2CK0L 2MOVA 3OX8B 2R9HC 5DJDA 7FABH 1GHFH 2WP3O 2J5LC 4WJG3 5CZKA 4Z7NB 3AG4B 3MV9B 5HHVL 1MVUA 3E8VA 3I85A 1HINL 2X89A 1VERA 3ZE0E 2OMZA 1IKNA 4XB3A 1CFVL 5J6SA 5D1QE 1FC2D 4A1RA 3NZ8A 4N8CH 5C0CD 2W9EL 2BSEA 1HZHH 2X6MA 4U2YA 4B41A 3D2UA 4N0UA 4U1LB 2XT1B 1DBKH 1DEEA 4F37F 5BV7L 4AYBA 1HL4A 3V0VB 5KBMA 4GKZA 3VXMB 4A2LA 3VXRB 1EDHA 3ZX1A 1N0XL 4F20A 4A7GF 3SQRA 2W0FB 4LBEB 4UZGA 2V6HA 2HLAB 4ORZC 1KBVA 1YEGL 3DHUA 5C0JA 2NSMA 5TQ0L 1A7OH 4FADA 1RZGB 4UQ3A 2EIMB 3IMSA 1TUPA 4LCWB 3VH8G 5B39G 3BQVA 2IEPA 3EDEA 2Y07L 5T1DL 5IF0A 1KT2B 2DL2A 1MCBA 4EZKA 1RZGA 4UQ3B 3IDXL 1N3NA 3LN5B 3HNTH 2VLME 1GKOA 3DHJA 1ZLUH 1HL8A 1CICA 1A47A 3F7KA 1KTLB 2HX9A 4Z7NF 2IH1A 4C56B 3IGLA 5EU5B 5KVFH 1CXLA 1HNFA 2FIKA 2DOCA 4HQQH 3CZLA 3SE9H 1KN4L 4QGYA 2Z3FA 2UUDK 5B8CC 4GKLA 1YYLL 4PJXA 5FYKL 1BZDA 4FZEH 3MV9D 1YEGH 4V1DE 1QSVA 4IKJA 5EU5A 3CH8A 2K4AA 4NQSA 4PFEA 5HI5C 1MIMH 5DJYA 5CJXA 3DURB 4YHNA 3ZT5A 1BAFL 3IJ9A 1FGNL 1BQRA 2K6WA 2B14A 1IEAA 2G75B 3PNRB 5CU5A 5DMIL 1WGOA 3MNWA 1OK8A 2DF3A 2QSCL 4UTAL 3CDYA 2DW5A 1B0IA 4ZTOH 1IUZA 5E08H 4P23D 4G5ZL 4JHWH 5IQ9A 3V4PB 3W81A 1OSPH 3WIIH 4AGQA 3QH3B 4UM9D 4HK3N 1XCQA 3TA4D 1DE4A 2AF2A 4ZOBA 1TZIB 4C47A 4E5XA 2H32A 5IJBC 4PJIB 4KZEH 1ZEAH 3BAEH 1DVFB 1MH5A 2WV3A 3PP4L 3LEVL 3H3KA 3NQKA 4BIKA 4TOYL 2XN0A 1AQDA 2ZWNA 3QDHA 4PJBE 5EA0L 3UL4A 3X2QB 1P84J 3GI9H 3PL6B 5D1ZI 4KHXH 4I0PA 5CNHA 4IRZH 4WK0B 1URZA 3U25A 4ZPVB 2FEEL 1G7QA 4BA8A 1U21A 4N0UB 4HKZB 1PZ2A 5A2JH 1IAIH 2F61A 3QEQE 1OAYH 1HH9B 3KW8A 3GM0A 2K6ZA 3QQDB 4U1IA 5EOQL 3WTTA 1Y6KR 2GTZA 2NDFA 1A3QA 3G5XA 3HR5A 3MLYH 1KV7A 2I32A 1O7DC 1DVUA 3LKSA 4LCWD 4AKQA 2C1OB 5GS2D 3IB4A 3LMJH 4TUJA 4XO8A 3X12A 1P2CA 4P3DA 5I6NA 4GH7B 1VHPA 1HSBB 3SBQA 2EDQA 3RVWD 3RRQA 3VH8B 1IARB 3SCMC 2FWOB 2XX1A 4UDTB 3W11D 2OMTA 3PHAA 4AKPA 3T4YA 4NRYB 3GHPA 2IANA 2ZX9A 3GI9L 4BQ9A 4KHXL 3FN3A 1DTUA 3AQZA 1Z3GH 1QTSA 2XWBA 5KVEH 3WKPA 2C9RA 4NSKB 1QOKA 1DUZB 1XWVA 5EBMA 2BNQA 3E2HC 4A04A 2R27A 4XHJD 2NZ9C 1DSFH 1AE6H 3IMTA 4K3JH 5IV2B 2DJUA 1A9EB 4Y2DA 5KW9H 3ECVA 2Y7OA 1JPTH 1YUKB 5IT2H 12E8H 1AC6A 2JXMA 4AZ8B 4TQEH 2MPVA 4QLWA 1H0DA 3HC3H 2CKBH 1NINA 1UG9A 5JPNC 1JS8A 1T6VN 4GI9A 3NSDA 3V6ZA 3LEXA 4L3FA 4KU1A 5A40E 2VLKA 5ACZB 5ILTH 4H25A 4X9BA 4YHMH 1Q90A 3QJQB 1TPXB 4CSTA 3I6KB 3M1BB 5FO8A 3WIHL 1OB1A 2P24B 3OM3B 4CVXA 3RPBA 3RA7L 3NTCL 1S7QB 1JERA 4KO7A 1FIEA 1Z6JT 4GS7C 1NH6A 4JDZA 4JFSA 2WUCL 4KI5F 3PL6D 1BVLA 2W60A 4FJZA 5AVQB 3WXVL 3MRMB 5K33A 5MEQB 1EEYB 1AIFB 1FG2B 2YAPA 2BP0A 2XX0A 2X6CA 4N8VA 3U36B 4N5ED 4WQOA 4HJSA 1R5VB 2OQJA 1G7JB 3QDGB 1DJGA 1T2JA 2BXYA 2PYFA 1BA9A 4XNMA 3HUJB 3CSTA 2LE9A 3VXQA 1RU9H 4UNUA 1O9WA 2Z31C 4DGIH 3FTYA 1CB4A 3W0WA 2YQ2A 2D31A 3RIAK 5JZ7C 4Q4IA 5I30L 5J3HD 1NGZA 3Q5YA 4KKLD 4FOMA 5IGXL 4PJCE 5DD6B 5JHLA 2AJYH 1K85A 3QDGA 35C8L 3TEYA 1E5YA 1EBAA 2LABA 3DX1A 2NY6C 5ESVB 3H9YA 4KV5F 2AEWA 1QP1A 4LVOB 4HFUH 3VRJA 3L48A 4N4YB 1LGVA 2WLIB 5E8PB 1RUMH 4KROB 2FZ3B 5EF2A 3S8GB 3V9EA 4JMNA 3QULA 3O81A 4JM2B 4K55A 5AAWA 5JPNA 4G8GE 1DJHA 2A6DA 5D7IB 2B4CH 4GXVH 4JANB 5C92A 5LXGH 3BPCA 4AENB 5I3AA 5LG1A 2DQHH 2VC2H 5LNGA 3A23A 1F42A 4WGVB 3JSSA 4A66A 2H45A 4P5KB 1IEBA 2FEDC 5I76A 3CHPA 2YPLD 3MJ7A 3QNFA 4P8QA 2AK4A 4F2MB 1RZKC 5ANME 5G4NA 4J3QA 4A2EA 4EQ3A 5DK0B 3AY4A 3NIDE 2V2WA 1K8DA 2P43B 1RPUA 1ED3B 3LZNA 5IIEA 3NJXA 3MFGB 2PTVA 5DUBB 1CDGA 1JGDB 4A2GA 3N41F 3SDAC 3GJFA 1EA9C 2G5BB 3T3PF 4WWID 2BY0A 1BOYA 3HHSB 1DJYA 1DZBA 3BZEA 5CGYC 4HUXA 1QABA 2WM0A 1OV8A 4R7DB 1UB5B 2BS9A 4OF5A 1LP9B 4L37B 1LILA 5DD1H 4OGQC 4QO1B 3RTQA 1CLOL 1ZT1A 1NA8A 4LFHG 3AGWA 3C87A 4PRIE 1E5CA 2ZAHA 3KEHA 3VDCA 4U6HA 2I9TA 2BVUA 1KIPA 4M8QA 2AEIT 2BPBA 1FYTB 3OKEB 1T1ZB 2FJHB 3K5RA 4JCMA 2YJQA 4I3RL 4NBYB 2RTTA 3LD8C 1Q94B 3CK0L 3FZUC 4OQTL 4RSVA 3RY6C 3AWGA 2C4FU 3EFFA 5D7JB 5FGBC 3MLTB 5IHZA 4TNVF 3GMPB 4X98A 5KEZA 1YY8B 3SE9L 4N2AA 2K3HA 5HGAA 1GGCH 2WWMC 3F04A 1J8HB 3KM2A 5ALBL 2XQYG 1A4KA 4K7FB 4UTBL 1Q9WA 4XHQA 3FUIA 2NY7L 2L7JA 2EDYA 2OFQA 3FU7B 1NFDF 1S7XB 4MCYA 3H55A 2IJ0C 3FN9A 2P26A 1MFEL 4RSYA 3TLRA 4JZJA 2ZT9C 2VH5L 3GZPA 3HZKA 1UGKA 1BFSA 4WDIA 3KLHC 2QKIC 5T5FA 3MR9B 2Z91B 1UH3A 4WTWA 3NCYP 1SZNA 1NFIA 4FKKA 1G7HB 4C4UA 3EGSA 3UTTB 5EIIA 5C7XL 5FA3B 4OBSA 3P9MA 3HI5L 4EE2A 4P4RA 3NESA 2YD9A 2YEZA 1WXCA 1DJIA 4Z7NE 1Q38A 5CEXA 1JYNA 1VB9A 5AAMC 1KXQA 3BH4A 3V0GA 3WN5C 4AENA 3DOSB 1V27A 1SMDA 3WO4B 4NQCE 3Q9QA 3OC5A 5H8DA 3FSOA 2MTPA 3B9KA 3LZQA 3QHFH 2GHZA 4DKEL 5KTEL 4CMMB 3QQ3B 2RFXB 3OXRB 2A4CA 5JPMC 5HVGB 4NUMA 4ONHA 3UYPB 2Y7QB 4DK6A 1M6UA 3ARFB 3K6SB 1BZEA 1G0DA 3KPLA 3TJHC 2HT2C 4ATTA 1A02N 5FUCE 3Q2WA 2BVPA 1A6PA 2ZWLT 1I1FB 2VTFA 1MELA 3PGFL 4WI9A 1D6VH 2EE9A 4OCYL 4Y1AA 4MNHA 2J8UB 3L8QA 4RBPK 5E8DL 3LNDA 2QADD 4XOAA 1RJCA 3ROLB 4P5TB 3AREA 3BSHA 1MRFH 2W88A 1CC3A 4U6VH 4FABL 3HE7D 1MCDA 1A6AB 2OP4L 4Y1AB 1FO0A 4L37A 1KJMB 3E38A 4YDIL 1XF2A 1NLBL 5ID0B 5FB8A 3UGXA 4F8PA 5INDA 4NQDA 2J2ZB 1W0VA 3O8XB 1MCEA 5LWYH 4PQXA 3PREA 3K1DA 2D7MA 1MF2L 5FM4A 4BFKA 2QVTA 2OZ4A 3QSKB 4OFPA 4UM8A 1TVBB 4K5OA 3DI2B 1MRDH 2IGTA 1LO0L 4ODXB 3VCLA 2IOOA 4D9LH 4L3EE 1EXHA 1TTGA 2AGJH 4KGLA 4MAYD 4U6TA 1GL4B 5FLUA 5DDHA 4LDEB 3K0YA 3PFUA 4U1LA 5D4HA 5JLZB 4Z7QE 4KFMA 3QUXB 5FKPA 3ZKNC 5I28A 1MLCA 5CXPA 1FFPB 1CD8A 3BH8B 2VXQA 4XWGL 4BFBD 4DGUA 3IGKA 1U3HD 4XOEA 5ABDE 3BI9X 1WX5A 5E6ZA 3FT4B 4YJZL 4B60A 4RDQG 2CLZA 2IALB 3FMGH 4QHUB 4KHTL 4AYFA 4EEEA 4FG6D 1XF4A 2EYTB 2XXGA 2VLLA 3FUKA 4JM2F 4JO5A 4NS0A 4TSBH 5DD0H 3WXVH 5BZDA 1HEZB 5BUPA 4L9LC 4WY7H 5ERWA 3QJFA 5DI8B 3PQYE 3W9EA 4WWKD 4RMTA 4Y4FA 4XMKL 2IBBA 5A2CA 4IHBA 2OSXA 3UZEA 5AWNH 3WV0A 3QEQB 1PNDA 3SYCA 1RUKL 4M4PA 5FGCE 3UGEA 5C86A 4QHMB 5LAPA 5CP3H 4FFZL 4E2OA 3IFOA 4PSPA 2BSBA 5CJQL 1KT2A 3H6AA 1QKZL 2X40A 1IKOP 4ZUTA 3DMMB 4XMPL 3RIFK 4JZNB 1HHHB 1YECH 4TMPA 2VRQA 4WVRA 2PYEB 4HSQA 1CS6A 4I85A 4XTRC 4Q97A 1M1XB 1YNTB 1F4AA 1SM3H 2HP4A 3W9DA 1U3ZA 3MOBH 4QRUB 3I9IA 2KYIA 1KXVA 3O4OC 2MFNA 1KZYA 4LDOB 2J4WH 3UAAA 4LSVL 3NSJA 3ISYA 1X44A 3NCMA 3PP3H 2ARWA 4GAFB 5DUMH 1OY3B 1LO2H 3EO1B 3FJTA 2FX7H 2IAND 4YUEL 4OIIL 4KKRA 1V05A 1T21B 3CH1A 4KKAC 2DWSA 2FEDD 2Q7YB 3EO9H 5F7FA 2NY5L 1MOEA 4WJKB 2P3YA 4Z1PA 1JI1A 2IV9A 2ICEA 1RZKL 1UXMA 2XSKA 2MWCA 1QFPA 3NK4A 1XF5B 5CJQH 3DIFA 3K81A 4GAGH 1KEMH 1TYJA 4HD4A 2JQAA 2X3BA 2JKTM 4KK6D 1E2WA 4NM8H 1SM3L 4KAQL 3VG9B 1OP3H 4D8PB 2JIXA 3RPKA 5JHLL 2GTZB 3APDA 3TXAA 2YA2A 4JFPB 1HN1A 3ZZQA 4MX7A 1UM4L 2C7UB 3TCXA 4QMEA 3H0TB 3B6SA 4N6RA 4WJ5A 1ZXKA 2C1OA 2YRBA 3Q01A 3L7EB 1EIBA 4KPHH 4ZO8A 4EQ2A 3BQUD 3RVXD 2D9CA 2CDEA 4YO0A 4ZPVA 4R97C 5HHMB 3BLPX 3RB5A 2ICWJ 5D9SA 5BZDB 3FZUD 3F05A 4C56A 2VSDA 1FV1A 5BJTB 1R3LA 2YPLB 4JO3L 3V5KA 1B4JH 1J5OH 3NIGF 4PYHA 3S37H 4P5SA 4NKIL 2HFGL 1HXYA 1HHGB 3C5SA 1BXUA 2DTML 1QR1B 3VXUA 4HPYL 3VD1A 2Z6FA 3RU8L 2ZCHL 4A6YA 2FIRT 1TJXA 3BISA 3CPUA 4IIQB 4XZ4A 1R3LB 4IQHA 3QG6B 3L1FA 1K8IB 2JJUA 2PTTB 1HESA 2OSLB 1FYHB 2XV3A 1XSKA 1YPZE 1SYSA 1U3YA 2Z92A 4M7LT 3PF2A 4ELMF 3NRPA 3MNWB 4AVIA 2Q2LA 1UZGA 3LRLA 1NC2A 4QRTA 5A2FA 2Y3AA 4QRSA 4E9QA 5GSVA 2XVBA 5IW3A 5F1KC 1VFBB 4Q58C 3KH3A 3NOIA 4HCRA 5IFHL 32C2A 3MROA 3C5JB 4JFFB 1QLFB 2VDRH 1ZGLA 1SMAA 3D09A 5T1KB 5ESQB 3T04D 1JZ5A 4YHYB 2VAAB 3AABA 3FSAA 3OZ9L 5ADOL 4Z7UA 4ZS6D 1QFWL 4LNVA 3WEAA 4E9WA 4OZ4A 1KC5L 1SLUA 1TJHH 4OZIE 2N3JA 4PAZA 5BVPL 4GG8A 2R83A 3GIZL 4YBHA 1UKTA 5MI0B 2DIBA 3BQUB 5CAYB 3F84A 4PJFA 3H4FA 4W93A 4DGYL 5GS1C 3KR3L 4WUUA 3GXUB 3E9UA 1I7TB 3VWJC 5FC9A 3SE4C 1R5VA 4MNGA 4JAMB 4BUQA 5ECGA 3REWB 2QSQA 2QADC 4UNTA 5CR8A 5FF6B 4Z7QF 1TJGH 2C26A 4N9GA 1W15A 4A7SA 3BIAX 4YHIA 4JKNA 2EC8A 3H9ZA 4KY1H 4XWOD 2Y3NA 3O3DB 2CHZA 3VI3F 2UXTA 3RDTC 1ZIAA 3Q5OA 1DLHA 3JWNH 4X6FA 4A39A 2BOCA 4BKSC 4PRIB 3O3EB 1VFMA 2H9GB 2ZF9A 4GKNB 5JOPD 4KMTL 2BZ7A 1X4YA 1CVSC 3K7UA 4W81A 1KG0B 4NQEA 2VL5A 3QFJD 5BJTA 2X1QA 1AXSA 5ADOH 3TU6A 1FAIL 4EVNB 2CO7B 3F7QA 3T6QC 4Y5XA 5F1NA 3GC3A 5AVVB 4FFWC 3V7AE 4JFVA 1E5UI 1J05A 3QDMD 5LB1A 2EDHA 2DIJA 2R1XB 3V8CA 1DL7H 3QNYB 5F44A 4HH9A 2MOQA 3O8XC 5T8IA 1L7IL 3OKNB 2CG9X 3RWDA 3VG9C 2ZQKA 5F96L 1WBXA 4ALAH 4Z7VA 2DH3A 1ECZA 3P2BA 4X4XB 5B1JA 4X6DF 1BT3A 3QNZB 1LK2B 2P7TB 1JYVA 2OXGB 1DLFL 3TA3A 1T0PB 4QDGA 3AWSA 5EO0B 4HJ0D 3HC2A 1F4YH 1T22A 2H7WA 1WYJA 2EEAA 3F83A 3IM1A 4JX0A 5T1KA 2P80A 1BVLB 1GSKA 4Y4HA 4WKZA 1MJ8H 3AM8A 5JIIA 3KWTA 1OGSA 2OX5B 2A9ML 2MJWA 5TGBA 5EO0A 3ZTJG 4U6HB 3LEYL 1IKNC 3ENEA 1NAMB 4V2CB 5I8CA 2IOMA 3HMWH 3K6FA 1E8XA 4FNTA 3P3RA 3O4LB 1TTUA 5ISZE 3Q3GA 4DJMA 2ORBL 3GLAA 3KLDA 3NJFA 2BVTA 4TLTA 5ICZA 1HKLL 1Q9LB 4HIIA 3T2OA 3HS0C 5DYOA 3KWWB 3TEUA 3MLVH 4OCXL 1WAEA 4LMQI 4TVPD 1A1MB 1UXWB 3MA9H 3QZLA 2CO3A 3VFTB 3BEVB 5IW6B 3PNWA 4NRXA 2O5YH 5PCYA 4YHIB 3K6NA 2J6WA 2GQHA 4HOWA 3O2WH 4E9RA 4PJ5D 5LN8A 2XKNB 2WQWA 2PP8A 1OF2A 1FNEB 3QZWG 4LHUA 3WNLA 3KYNA 5GJTL 4L48A 1PD6A 3RX5A 2FJGA 1RJZB 2ZUQC 3QULB 4EI5B 2DH2A 1RMFL 4BYHA 4QRPA 2XTJC 4E42A 2X4PA 1QQDB 4RZKA 4D3CL 5GRJH 2FWSA 1I9JL 3G5ZA 3S3PA 4X6DA 1ACXA 4LCCC 3S2AA 3ESUF 5E1IA 4RAVA 3ZDXF 1FBIL 4D0CB 2R0ZH 2WLHA 4WFHE 5D70H 5E1AA 5C09A 3VSTA 3LKPA 3X3GL 5HGDB 1KCUL 1N0LB 2GCYA 1XT5A 2XG5B 1IM9B 3A3YB 5E8EB 4FP8H 4UT9A 3Q8BA 2ZAGA 5KVDE 2AC0A 2W8CA 4NJAH 4U31A 4WTZA 3NEEA 2ZONA 3GBNH 4M1GH 2VDOB 3FT3A 4LNRB 3IU4H 4APQB 4BK5A 1SN2A 1JBJA 3QNYA 4IRSD 3SOTA 1YYLH 1MCRA 4QF1A 1MRDL 3QG7H 5IMKB 2VB5A 2B2XH 4RMVA 4Z7VB 1WIPA 1FN4A 1UB5A 2MPAL 4Y4KB 4DP2X 4AX3A 3U9UA 1I1YB 3MA7A 5AYUH 2TSBA 1A6UH 1PKQA 3C5ZA 2FQFA 3D4GA 4S1SH 3MRHB 1I7RB 4H2CA 1BQLH 3SPJA 3ARWA 3N85H 1S7RB 1XH0A 2HN7A 1RZ8B 3HHMA 1D6EB 3LQZB 2FJFB 3APCA 3WFDL 3HZ3A 5DA4A 2V2XA 2QGEA 4YHLL 1BPLB 1U8OB 3NMEA 2Y2YA 3LKOA 3GKZA 3NZHL 4G8AC 3CFMA 5I1KL 1NMCC 5I8CB 3FH7A 5IFJB 1ET8A 3ZKQD 3LX9A 1T20B 2WLNA 5FYJU 4FC3E 4L3CA 3BCDA 3MV7E 2ITDA 5IY5B 5AYQA 3Q3GB 1OT2A 9CGTA 4K7FA 3SOBH 3NIFB 4AQOA 5C0RH 4Z7UE 4ZTEA 4G9DB 5KBPA 3QG7L 4M1CC 5B38A 4OZGF 4NC2B 4DZBA 1GA2A 4AIXA 3D0VA 4LSUL 1GVIA 3UC0L 4GRLC 3HE6B 4JQXA 1B2WL 3UG5A 4F1ZA 3CD4A 5HYQA 4O4YH 4ELKB 3BE1L 2WVVA 2YAFA 3N55A 4HP5A 2HWZL 2MSPA 4MA8L 2Y25A 2JCWA 5CSBA 4QYOB 2Q10A 2DQEL 1CK0H 3EDJA 3WJLC 5LDUA 3G08B 2R39A 4FTVB 4YVUA 1A7QL 2IAMB 4RFOH 3IJ8A 5IHUH 4AGMA 4OD2B 1FFOB 1KFAH 1JV5B 3EYSH 1FRGL 1F0LA 4N2KA 4U05A 4J6UA 1MWOA 1UFUA 2Q0ZX 2EIDA 4UB0H 4QUOA 5DDHB 2FUTA 4HWNA 1HK6A 1KPUA 1UKSA 2DLTA 3KPOA 4K3DL 5HGDA 5JDSA 4GO8A 3UYPA 4KFZC 3TV3L 1H3UA 4EDXB 5JXEC 4WKXA 1OK0A 3GSNH 4YAQB 3U9PH 3L7FB 4Y88A 3O6FB 1P7KB 5KN5B 4HKXB 1HZLA 1AE6L 1IAKA 4K3JL 3SDDD 2YN5A 5DHEA 5J1TC 3N44B 3I3EA 3HG1E 1T04A 5I26A 1KLFA 3QORA 4QT5B 4XRCA 3ECWA 4KVNL 2BVYA 3WSQH 1T0MA 3CX5J 4XMTA 3BDXA 3ZDZE 4DUVA 1WA2X 5HPMB 5J6GA 4E41A 5CSZB 5I8OL 3PV7A 4KTYA 4BRVA 1F4XL 2XV0A 4GAJH 3ZYZA 2BZCA 1M4KA 2ZUUA 1CG9B 1PZBA 4GBXD 4IBWA 2C4XA 1PX8A 2XI9A 1ZVNA 3CBKB 1PKQB 3C5ZB 2P8LB 4JFDD 3QPQC 3H2WA 1W72B 3HAEG 4MS6A 2Q8AH 3OG6B 5HHME 1SEQL 4MNHB 1JXKA 1QZ1A 1DQKA 4XVSL 2ZXCA 1BLIA 3LRSB 3MUY1 4WV1B 5DJXB 4YHNB 3VXRE 2H5UA 8FABB 4WTXA 4CADB 3BAYA 2RGSA 3CFQA 3Q2VA 4F8TA 1CR9L 4H7VA 1MJJB 1XH1A 3K71B 3K8LA 5HHQA 4F7MA 3LPPA 4ENED 4JGUA 3HNVH 3OR6B 4KMQA 2VE6B 3L2NA 4GRWH 1BZ8A 1U6AL 5DJ6A 3T0EC 3ARBC 2VW6A 5MERB 1YEFL 2O5ZL 3G3LA 4NPJA 3VTAA 5A2IH 4PGEA 4MA7H 1RZIB 4U0RB 4MJJA 3WFEH 3LNIA 1NDGB 1JFQL 4B9CA 3LPFA 4JREC 2B8OT 5MEPA 1L9SA 4XBPB 3PQYA 4ZQKB 4XN9A 5C07A 4G80B 4HMDA 4FA6A 1WWCA 2ZXQA 4WO4B 5HDWA 5FXCH 4MJ6B 2KZKA 1IL1B 5DSCA 1XF4B 1IBZA 1ZLEA 5I74C 4M5ZL 3UAJC 1MJ8L 1U3HB 4F2EA 2AQQA 3BT0A 3CWGA 2ESVE 1NAKH 1XXFC 1JP5A 5EZPA 5FO9B 3GRWA 4EXPX 4QRRB 2IPUG 4GRMA 4PP1D 2XWTA 4KXDA 3IWVA 3F62A 3ALXA 3CN3A 1J88A 3BN9D 3P4OB 4RWHA 4YLCA 1DQMH 1K72A 1ZA3A 1UB6B 1T03H 1YEHL 3L3JA 3AS2A 4QCIB 4E9XA 3P3SA 1EHKB 3MGTB 3S36L 3VXUB 3TT3H 4LQFL 4HEMA 3IGAB 3DVNA 3BVXA 4R4BB 4WENB 1RHHB 1CL7I 3D33A 2GG1A 3U83A 4XNDA 2C7UA 1DQLL 2OMTB 4MMZA 4WGKA 5EZLA 4Q74A 2O6CA 1VGKA 3PYCA 1CLYH 4PY8J 4AYID 1I9EA 1FL3B 2OXHA 3KYMB 3L5HA 1K3IA 4UIKH 4Y4FB 3U46B 1U8IA 3LHAA 2ED8A 1GXEA 4M43H 3NFPB 2PWHA 5C70A 5FUOH 1D5IH 3BJLA 2M1KA 3MTRA 1WJ3A 4IGBB 3S88L 3F8UB 5DJYB 2LAAA 4M48L 1E7UA 2YOAA 4CNIA 2OMBA 4LLWB 5GS0H 4HS8L 43CAA 5DTFA 4ANKA 1TMCB 3MAWA 1CFBA 2FIKB 2M83A 3HI1A 2HT4C 5GGRB 3WMSA 1IGCL 2FEEI 1NKRA 1S5IH 4K94H 3NPYA 5B7EA 2XG4B 2XWZA 4F15B 3ROOB 4H1LG 4HPHA 3PHQA 3SN6N 2BP8A 5D2NB 4FJ6A 3J8F7 4OKDA 2KUTA 3PABA 3CFNA 3CFKB 4G70B 3D25A 4JREB 5F7BA 3QQ4B 4PJCA 3ZE2B 1FZJB 3QZWB 2KLRA 4Y4HD 3VGAB 1CL7L 3O2WL 1BM3H 5C08A 3MV7A 5J9PA 1HWGB 1WV7T 4EOWH 4YDLB 2MQCA 1M2VB 2ZKWA 4K23L 5KSAB 1HYSD 1EZSA 2WBKA 1FSKB 1LK3H 2F5BL 3IPBA 3OC8A 2HLEB 4Y9EA 4A2HA 3NVQA 4B9IA 4QI3A 3SE6A 3TT1H 4JPIA 5JTWA 3TS8A 1K5NB 3TFKD 1CFMA 3RZCC 3ARSA 1DLHB 4PMFA 3NJJA 1QHQA 4NO5B 3ARDB 3ULVC 3MBED 1OAQH 5E4AA 3MV9E 4Y4FD 5I71C 2QQQA 2NYYD 3C5SB 3AXLB 1C5BL 1MXDA 1RLWA 1TNMA 1YEKH 1UT1A 3GSWA 4G72B 4NQCB 3ZOAA 1YMHA 2BRRH 2NDGA 4JPVL 2ZUYA 1OOAA 3QNXB 4WZ9A 4OZHB 1J5CA 3ARRA 4BDVB 1P53A 1KXQE 3FT2B 2Z7WA 4NQCA 4OM0L 4QJ3B 4ELME 4NC1E 4OCLC 2QLYA 3EOAB 3MYZA 4JO2H 2A77L 3NSFA 1ZPUA 3EJYD 1U42A 4HGKC 3BRFA 1JNNH 4U4IA 5T3ZH 1VGKB 1R5IB 1VFBA 4FQLH 3L17A 3TT1L 1HHIB 2IXQB 3GMQB 5KAQG 1XCTA 3A6CL 3UPCA 3CHOA 3IFPB 5AVUB 5J13B 5JUEH