3QJOA

Refined structure of the functional unit (klh1-h) of keyhole limpet hemocyanin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
491
structure length
491
Chain Sequence
ILVRKNIHSLSHHEAEELRDALYKLQNDESHGGYEHIAGFHGYPNLCPEKGDEKYPCCVHGMSIFPHWHRLHTIQFERALKKHGSHLGIPYWDWTQTISSLPTFFADSGNNNPFFKYHIRSINQDTVRDVNEAIFQQTKFGEFSSIFYLALQALEEDNYCDFEVQYEILHNEVHALIGGAEKYSMSTLEYSAFDPYFMIHHASLDKIWIIWQELQKRRVKPAHAGSCAGDIMHVPLHPFNYESVNNDDFTRENSLPNAVVDSHRFNYKYDNLNLHGHNIEELEEVLRSLRLKSRVFAGFVLSGIRTTAVVKVYIKSGTDSDDEYAGSFVILGGAKEMPWAYERLYRFDITETVHNLNLTDDHVKFRFDLKKYDHTELDASVLPAPIIVRRPNNAVFDIIEIPIGKDVNLPPKVVVKRGTKIMFMSVDEAVTTPMLNLGSYTAMFKCKVPPFSFHAFELGKMYSVESGDYFMTASTTELCNDNNLRIHVHVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxygen binding
molecule keywords Hemocyanin 1
publication title The refined structure of functional unit h of keyhole limpet hemocyanin (KLH1-h) reveals disulfide bridges.
pubmed doi rcsb
total genus 94
structure length 491
sequence length 491
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00264 Tyrosinase Common central domain of tyrosinase
A PF14830 Haemocyan_bet_s Haemocyanin beta-sandwich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 3qjoA01
2.60.40.2570 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qjoA03
2.60.310.10 Mainly Beta Sandwich Hemocyanin; Chain: A, domain 2 Haemocyanin C-terminal domain 3qjoA02
3AWUA 4Z10A 3NTMA 1JS8A 1LNLA 5CE9A 3AX0A 4J3QA 3AWWA 3NQ5A 3AWVA 4D87A 2ZWFA 3WJMB 4Z0ZA 1WX4A 3AWYA 5I3AA 4J3PA 3NPYA 1BT2A 3W6QA 1NOLA 1OXYA 4P6RA 4P6SA 3HHSA 1HCYA 1WX5A 3QJOA 2ZMYA 4J6VA 4L37A 1BUGA 3AWTA 3NQ1A 4Z0YA 2AHKA 5I38A 3HHSB 4P6TA 1WXCA 3AWXA 2P3XA 4HD6A 1BT1A 1BT3A 1WX2A 4L37B 4J3RA 4OUAA 2Y9WA 2ZWDA 1HC1A 3AWSA 4HD4A 4J6UA 2AHLA 3W6WA 3WKYA 1LL1A 2ZWEA 1LLAA 4YZWA 4OUAB 3AWZA 3NM8A 5I3BA 2ZWGA 4HD7A 2Y9XA 4J6TA 2ZMZA 3WJMA 2ZMXA 3GWJA 3NQ0A
chains in the Genus database with same CATH superfamily
3EOAB 4ELDA 2P28B 3I75A 3MUGB 3FT4B 2L4OA 4JKWA 4MD4A 2IH9A 3DTXA 1QFWH 2QPUA 4WW2C 3WEOA 5I30L 5F88A 5HDWA 4IJ3C 1M57B 4N90D 1OGAD 3D4GA 1D9KB 1MFMA 3IAQA 4B7IA 4L8BA 1TZHA 4TLTA 1ZEAL 3RWGA 1MG2C 3LN5B 2BNQE 1MAKA 4YHZH 3AMKA 1KEMH 1AIFA 1CDJA 4NN5B 4EOWH 1O6TA 3BJLA 1FSKC 3RWCA 4HWEH 4JZNA 1RULL 4PHZA 4YZFF 1RV6X 4Y19A 3ALWA 1RUML 3MJGX 1FL5B 5A16B 5IP4A 3IS1X 2HVKA 3GMNA 3RDTC 2HH0H 2ADJA 2RQ8A 4K9JA 5MERA 1AQMA 4J3SA 7FABH 1J5OL 4KDVA 1UASA 1B3JA 1QUNA 2F58H 4HIIB 5FM8A 3MMEA 3QG7L 1PLBA 1JGLH 1PZ5A 3IFPB 4BKSC 3U9UB 1MFAH 3VVWA 3UDWC 1MHCA 1DQIA 1F6LL 3HZKB 2BOCA 4I1NB 4QRPA 1H9DA 3BIAX 4YSAA 7PCYA 2CGRH 3MGTA 3OLDA 4IBLT 2FR4A 3CE1A 3HI5L 3CQPA 3MRLA 1A4JB 3OC8A 3W9EA 1A7NH 1ZV9A 2Y24A 2ADFL 1WWCA 4KUCF 1EAOA 3ZO0A 1GCFA 1WIPA 1UWYA 2V7HA 3BISA 5DC4B 1S7RA 3NSXA 2DEXX 2O5XL 5D6CB 1UD3A 4DGYH 5TE7L 1KB9J 4L3AA 4M5YL 4WRLA 3BYTA 3B7UX 1OTTD 1S78C 3FULA 2RAMA 4B3EA 3GKWH 5E4OA 4BEIA 1DVUA 3QORD 3PU7A 1KPVA 5I6KA 1VACB 2ICEB 2X9ZA 4Y7MA 5GPRA 2VDKL 3FU8A 3PGDB 3QXUA 2OW6A 3TCTA 2XVBA 4Q9QH 4DTGL 4KBPA 3TT1H 3U0TA 4P4KA 4R96A 2CIKA 1A6ZB 4ONFH 4IIQC 2MHAB 3QDHA 1E28B 4WU5B 2G2PA 1ZT1A 3FQWB 4G3YL 4W9EC 3QNFA 5GS1A 2ICES 4D0DB 1GIGH 3IJ7A 5HDLA 4HETA 1NIEA 1XVSA 3I02B 4CSTA 2QKIB 1VZGA 2XXMB 2PTTB 3FFCD 3NFNB 1AR1D 2ZWKA 4JO2H 5D8JL 2QV4A 4V11A 4KI5E 5DHEA 5IB3B 2R0LL 2EYSB 4HUNB 1A4AA 1OQXA 3LIZH 3DK0A 1MCWW 5KVGE 3VWJD 2XWZA 5C6PB 4F58L 4BSVB 3K2UH 4N0CC 1E8XA 5I66B 4FQCH 2H1PH 1I1FA 2P43B 4MDIB 4C58B 2OSLA 1X7QB 2BWDA 4RESB 1O9VA 4FMVA 1JNLH 4HHAA 3ZE1F 1XSIA 3SDAD 2GHZA 4FNRA 5KSVB 3HZYB 4FQQB 5TFSH 3D2UA 4RFOL 5CZRA 1VFOA 2C5DC 5DYFA 4JUTA 4KZ0A 1KC5L 5D7IA 1YO4A 3KBPA 4OZGF 4C57C 4J23A 4BWTA 1MI5B 3AREC 3QJVB 4JZJB 4Q2ZB 4N8VA 2WMPB 2PWFA 3GSVA 4L2LA 2WPGA 1C5DA 1GZPB 2J6EA 4WFFE 3D08A 5FKAA 3PNWB 1GGYA 4WW1A 1CLOH 3GMRB 4BFJA 2P26A 3OX8A 4UDTB 1VGEL 4AH2A 2DQDL 3GS0A 4OF0A 4HFWA 5FYJH 3DSNB 4V1DB 3EO0A 1UGKA 1AKJD 1JF1B 4GBXA 2GY5A 5C09B 3TYFA 1CXLA 4QXUH 3F6JA 3TASA 1C5BH 1SN5A 3VD4A 3IVKB 4HT1H 1J9RA 3NACH 4RISH 4U4IA 4PTUB 5E8NA 5AW7B 2D3NA 1SJHB 1HL5A 2XQBH 4K3EH 4PRNA 5HD8C 2WGXA 4FKKA 4UM8A 4CUCA 4ZS6D 1I8MA 3SDCC 5IIEB 2YWZA 3GI9L 2DD8L 4NQDE 3IXAB 4P9MH 3DUHA 5JYLA 1IAKB 3BAYA 2WUBH 4LOEA 2D0FA 1X9RA 2HYMA 1E9PA 1SEBB 2O5NA 3RDJA 1K8DB 1RMFL 2VR9A 3SQBB 1HKLL 4XOCA 4LRIC 3RYMA 3HNSL 4ETQA 2JTYA 2OQJB 5CJQH 1W2KT 3VX1A 3GK8L 2XG4A 4XNUL 4PVLA 4ZUWB 2K6YA 5I1KL 1KEGL 3FB7B 2FEEI 3Q6GL 1FGVH 3IEAA 2PYFA 1F11A 5AVSB 4NRXB 1NEUA 2Y36L 1NIFA 1T66D 2QKSA 3MBWA 3OLGA 4B0MM 4PGEA 4NWUL 3OVUB 5L6YL 3P0VL 1GYWA 2UX7A 3GRWL 2XZAL 2DMCA 2ED6A 5SX5K 3JV6A 4ZTOL 3U2SB 1E8WA 4GW4B 3UH8A 4KNTA 4K3JL 4OTXL 5ILTH 4AYFA 4TQEL 4L8DB 3GSOB 1M9WA 1P5UA 1A1NB 3NQ5A 1DVTA 5EC2A 1T80A 3LJ3A 4WGVB 4JQVA 4ZAKA 4XP5L 5D7JC 3G04A 1TZAA 2NX5E 1QO3B 2R1WA 4WHYH 1IGTB 5GISL 1BQHB 3QFJA 5KSUB 2OTWB 2NR6D 3MNVA 4GUCA 4QO1B 2CLRA 5EH1A 2FQGA 4Q6YA 4C4BA 2N56A 5KVMC 3ELAT 1R17A 3MCKB 1JXFA 1HAUA 2R2BA 3MLYH 4CC4A 3DGGB 4KROB 2GBUA 4X50A 1UH4A 4YAQB 3AXHA 5LGYA 3QJRB 3ULSB 1D6VH 4EZMA 3CFBA 2Q6WA 1JGEB 3KPOA 2FEDD 2HJLB 4DVBB 3LN9A 5DRNA 4DN3H 1R34A 3KEDA 1MCBA 3NRFA 1H6TA 2WW8A 2YA2A 4PLJC 2EIMB 3LKNB 3O3EB 4L9LC 4NZTL 5MENB 2MOGA 4NZFA 3GSXA 1GSKA 3N42B 1L9PA 3IDNB 4FLRA 3VFTB 2VQTA 2AV7B 4Y4HC 3I6LE 2BSTB 2O4EA 2ZOLA 3N9GL 1SM3L 2NXZB 4JDEB 1EEUA 2YA0A 4MMXB 3ULVH 3WY1A 3EDJA 2O30A 3QIBD 5EZOL 2XN9A 5D2NB 5B1CA 3RWJA 4YHYB 5JDSB 1BOGB 5GS2H 3V5KB 3MV9D 4C83A 2IBGA 4CKVX 4HBCH 1ETJA 2A4EA 2X4QB 2IH1A 2DQGH 1BVKA 3V7AG 2WOYA 1O5DT 2K3TA 2E9WA 5FYKD 3HE7D 1QWUA 1B0WA 4IU3B 4X0KA 4XC3L 4YSOA 1DSWA 2HT2D 1RUPH 5IMMB 4A7TA 3SQOL 3W6WA 3S37H 5G55A 1GZQB 5GGQL 3JT2A 2YD3A 4GKNB 4HEMA 3QI9A 2JLLA 3CQQA 5D71H 3C6LB 5HYEA 5J8OA 2J6WA 4CW1B 1F18A 4GRLC 3QR1A 5BJTB 4UAOC 1ZTXH 2CDGA 2LOEA 5I76A 1M42A 2WYIA 1CGSL 5FYLH 4TQHA 3GNMH 3CHRA 1MWAH 3H53A 3C08H 1OAXL 3ROOB 4W9GC 1KCUH 3TTYA 3IMSA 4AK2A 2YC1B 1OHQA 4PWJA 4DEWA 3WTSA 2OV0A 2B1OA 3QWNA 5KVEE 3UTTA 4KFZC 2MCG1 1BVOA 4XBMA 5DRWB 3KJ4C 3ZSTA 3ARGA 2EC9U 3ELQA 3ML9A 4Q4IA 5CBEA 5FEBA 2F1BA 1V55B 4QXTB 4CKQA 5FYJU 3U30B 4N9OB 1GYCA 4K3DL 4LLDA 1ET8A 4ZS7H 4OVUA 4A55A 1WCBB 2X5PA 2X0UA 4XNZC 1WZLA 3L6FA 3V5HB 3N44F 2X4OB 1CXIA 1T5XB 4KK5C 2GT9B 5HHOE 9CGTA 3WN5A 4NM4H 1OF2A 2EDEA 5DHVA 3E7JA 4AIZB 1I8KB 3DETC 1KG0A 2ICCA 4OJFL 4PWEA 1QSED 3NN8A 4K8RL 1IFHH 5F1NA 3IWUA 4G6JL 1W16A 4GG8B 4OQTL 3G6JA 4ISVA 1YA5A 4F7TA 2ITCA 1BMWA 3B43A 2F0CA 4ZX5A 1ZT7B 1RHFA 5JQHC 1KXTA 4Y16B 1FRGH 1NPNA 4JLRB 4HKZA 4J6RH 1YEIH 1AO7B 4Z7WA 3O4OC 3KLHC 2R39A 4KX8A 4P59L 3C09C 5EU3A 4M62H 1PLGH 4ELMF 4ZX3A 3BEVB 2E7LA 1SQMA 3FOMB 4M1CC 1IGFH 5F7EH 3B3IB 4X6EA 5F7AA 3RY6C 3SDDB 3VGDA 5E4AA 3DX3A 2DQJH 3EOTL 4ONHA 4XVTH 3EBGA 2A3TA 3QPQC 5CR1A 4ZW6A 3VI4F 2UVEA 3GBNL 5C0JB 2AITA 2CO7A 4A66A 1YY8B 5EBMA 3FTWA 1U58A 2IMMA 3NYKA 3RZCC 3EHBB 3PWVA 3K2KA 1TQWA 4HD9A 3UJTH 4QLWA 3I50H 1JIBA 3RGVB 2CBQA 1J9CT 4HWZA 3D05A 1CGWA 5EZIL 4ZMOA 3ETTA 3P0YH 2P8MB 2EDTA 5HP5A 1JXGA 2R27A 3GINA 5DQJA 3V6OA 3QO0B 1P1VA 2B7DT 3JV5A 4B9YA 4KHXH 3IGAA 4S2SB 5AKRA 2XC8A 2J55A 4PGJA 3SGDI 2JJWA 2PPDA 5I2IA 1ET7A 2LVCA 2PPCA 3T2NL 5AAMA 2Q76A 3C60D 3FU9A 3DVIA 3CIAA 4MQSB 4Z78A 3C2AH 4HGKC 3PDDA 1YYLH 4YSDA 3TBTA 2QJDA 1TJIL 3QIUB 2DY2A 2O72A 3ARFA 3H3PL 1W91A 1I31A 3HAEH 3I6KA 3IE9A 4TPRL 5T1DH 4AUUA 4G1EB 5J13C 4K8RC 1IV8A 3I2CL 1LO0L 4L4JA 5E6IB 2YEQA 4WO4B 1OAZH 1CU4H 4OIBA 2X4PA 3LX9A 3P9MA 3BP6B 1E4XL 1RZKL 2RCSH 3KPNA 4J4PC 2BSED 1DQLH 5LAXA 4K94H 2JIXB 3KBHE 3LHAA 4YDLC 2W9EH 3TBYA 5I5MA 1JZHA 3SODB 2UXTA 1EBPA 2B59A 1J0HA 1N6UA 3T6XA 3MRGB 4KUZH 4TL4A 1MI5D 4FYQA 3QJFB 2VR7A 3MLWL 4G1MB 3B5HA 1N7MH 1V10A 4U7MA 4OFDA 4S1SH 2LLLA 4FXKB 3P2TA 4U3SA 1INQA 4JM4L 2VDML 2VDQB 4L8CB 3OKOA 3RPKA 4FFVC 4MNQB 4G83A 2FWOB 3RL1A 3UGUA 3SPJA 1WZKA 1MJJA 2YAEA 2KKQA 2XI9A 4MB1A 3U4KA 4HIXH 3VGFA 4QT5B 2X70A 5DR5L 1TVDA 2BS8A 1BF5A 2H2PD 4ZMZA 5KJ4A 1U8JB 4ZNEA 1KIRA 3PP4L 4LL4A 4IMLB 3ZDXE 5E23A 1NZRA 3NH7L 4G8FB 3BZ4B 4D3CH 5CEXA 5HHNA 2DF3A 1R5WB 1TLKA 3ESMA 1I4FA 3R1GL 4UT7L 4ELME 3BRGC 4PJ9B 3X14A 4OT1H 2MPAL 3CUPB 1WZ1H 1X4YA 4M7LL 5BRPA 3L3OB 2VQ4A 4B7LA 2XG5B 4AUYA 2F18A 1FZOA 4IOIA 4AJVA 1JPFA 5JW5B 5GZNA 1LP9A 3O9WB 2WVSA 4G71B 2O61A 3US9A 1CE6A 1DBKL 4YNYB 3B2MA 2HLFD 1OLZA 1N8ZA 1KLGA 5ACLA 4Q0XL 1EZLA 1HC1A 2DH3A 2GABA 1RZ8B 3QZWG 1MFEL 1SLWA 3N06B 3MV11 4Q6IB 1HIMH 2N7BA 2YGQA 1ASPA 3SPGA 5A2LH 3J7HA 1B9KA 4LSSH 3KVDD 5F7UA 4R97B 5AW2B 4GKZA 1JYXA 1MAJA 1DJWA 2C9AA 5IVNA 2QZ5A 4EDXB 1S2EA 1SY6L 2QLYA 3DC0A 5D9SA 2WB1A 1FFQA 4X4YB 1KMGA 2BWIA 3KLAA 5BS0E 5IFAL 2Z6FA 1RZKC 3X1EA 2LAGB 2VITB 4DF9A 3JWNG 5J3HD 3BH9A 1IQDB 4QKTA 2IWFA 1JZ2A 1FV1B 3HHRB 1I7UB 3GXPA 4K7PX 3T3PF 3KPLB 4YDJB 1MJ8L 1AZVA 4BZ1L 5TQ0L 1KGYE 1YAZA 2A1WL 3W0WE 8FABA 3UAJC 2K78A 1SF5A 5EEYA 2GI7A 2MWCA 2QVKA 4PY7B 4GKLA 1L4IA 1NIBA 4YXKH 5KN5B 4PRPE 5EWIL 3L54A 5EORH 1AS6A 4UANA 2YD7A 4HKJB 4EXPX 1D5IH 2P9RA 5MEPA 1F0LA 1H5BC 1XGRA 3KDMB 4UV4H 3E8VA 4XCYA 5LUMA 1A4KA 2YN3A 5I26A 1OCZB 1KWKA 4KROD 1S9YA 5DJ0B 2YMXH 4TRPL 5EBLB 5ACMA 3GXIA 3HPJB 3CZSA 3TIDB 4AENA 5D7IF 1AXTL 1N18A 1IC7H 4JO3H 4ZDHA 2AQTA 5L4MA 3HNTL 2BPBA 4YK4B 2Z8SA 5E8PA 3SD5A 4U6XA 4WUKH 2QDVA 1A8ZA 3B7YA 5E9DA 5F7WC 2F1EA 1DBAL 3PXHA 2BM3A 3NTCH 5CWSB 4JPWL 2BINA 2Y06H 4LHUB 3ESUF 1GOGA 3QIWA 3FNKA 2Z4TA 3WFZA 2NXZD 3C8KB 1NMBH 4NQDB 1MNUL 3MRNA 1TETH 2WNKA 1B0GA 4QHPA 3B1UA 5L8KB 2XPGB 5J1SC 3AWXA 1PU0A 4ZZFA 1H8OA 1K3ZA 5FO2A 3R18A 5EU5B 4OZFB 5EA0H 1UZ8A 4OLZH 4PI0A 3VFNB 4NCC2 4LFHD 4ACTA 1E3XA 2R4RH 4XMKH 2VUYA 3EH1A 4YFLF 1HK6A 3UPAA 4R5VA 2DEYX 3CXDL 4HC1L 3VFPB 3VFSA 1AD9B 3V0GA 4OV5B 4GMTH 4DAGH 1BZ8A 1CTMA 3ZHLA 1R3JB 4RZCA 3P30H 3BAXA 4WFED 4LSQH 5ACZA 1XIWA 4DKAA 3C6LD 5AD0B 3X13B 5J6HB 1ZVSB 4UF7C 3NRPA 1MCHA 2FTAA 2WK2A 5HDOA 2Z93A 3B2DC 4FI6A 3ULUE 4LLWB 5DVKA 5HVHB 1XTLA 4Z1PA 3KXFE 4ODUA 3CHOA 3N40P 1M3IA 2Y7NA 4YLQT 2W65A 3RVUC 5EHFA 3RNQB 3WELA 5AZ2L 3FO0H 5DJDB 2VQ1A 3IDUA 3KL5A 5DYOA 3ORJA 4BH8A 5JXED 1BQ5A 5DD3H 2NX5B 2K3HA 3WJMA 4PJCE 1WAAF 5HI4D 5HJ3A 2QFRA 3VTAA 4OLXH 4HZ1A 2R2EB 2V2TA 4DGIL 4Y2DC 3EO1B 4ODSL 3EGDA 3WFBH 1F4XH 2WXRA 1A7OH 3Q43A 4YQXL 5LXGH 1CYGA 3F58L 5GGSB 3QB7C 2CUHA 3UTSA 4IIZA 3CBJB 2B20A 3A6CH 3IFOA 1NC2A 4Y1AB 1K9TA 2JV6A 3MXVL 4B5ZA 3SE3C 5E08L 2FD6L 4D0BB 3H6JA 3VA2C 1K5NB 1RIHL 2DJ4A 4JY6B 5CEZL 1UENA 4QYOB 2XSKA 5I1AB 1UA6L 4GAYB 4WJKB 1UGNA 3PV7A 1SDDB 4Y16D 4P05A 4Z3GA 4U1LA 4I5BB 4Y5VC 1X5HA 2FBRA 5BOPA 1U33A 3U4EA 5B3NA 3IPEA 2YO3A 4RX4D 3VXUE 1MRCH 3FSVA 4R7DB 5CEYA 4L1TA 1EANA 3OZLA 1RURH 4JQIA 2VXTL 4AMKH 3H2QA 1IVTA 1VZHA 4QF1B 4NHUA 5IHUH 1QTYT 3PL6A 4Y1SA 4HH8A 1IC4L 5CMAA 2HZHA 3U9PL 4WKZB 2J25A 5IG7A 2WNWA 4UU9A 1WBXA 1UUNA 2J21A 1DFXA 4UTAL 1E6OL 2Y2WA 3ECVA 4G8EA 4PJBA 4XXCA 3JSSA 3WFCH 2IBZY 3FO9A 2V5MA 5DMKA 3RGVD 3SKOA 5F3BA 3FMGL 2BNUB 3E3QC 3RWDA 3KZ8A 5KVFE 5E1IA 2Z8WC 4TUJB 1QA9B 2ZOWA 4LEXH 1UJ3A 2IOOA 1KCKA 4X8JB 2XQ0A 3DWTA 4KJPC 3MCLH 4JK0D 2IMNA 2AK1H 1E5CA 1C5CL 2WBJC 2QVMA 3HC4L 5HYIA 2NZ9C 4Z8FH 1E4JA 5TF1L 1INEL 3TCXA 1A3ZA 3S36X 4ZPTB 4EN3C 4KDTC 2R0KH 3V4PA 1CF1A 4BK5A 3CFUA 3N40F 3OKLA 4X7DC 3L5XH 5JZ7D 1KCVL 1GC1L 4MS8C 1A02N 2VIRB 4GSDL 5C0EB 3ZQWA 4KQ4H 3WXWL 3IMUA 2ZUYA 3F04A 4O02B 1YDPA 5I6OA 1XGPB 4K7FB 2GJZB 3MJ9H 2GFBA 3QIUD 2MEJB 3E38A 1FZMA 1LO5B 2R29L 1KLUA 1R3HB 4WZ9A 2BNRA 2E6PA 4DGVL 3IDYC 3QQDA 4M6OH 1KZQA 1IBZA 5HHOB 1BBJA 4TUOB 4LL9A 4B53A 4DK5A 1G7QA 1QBML 3RFZC 3NCWA 3FZUD 3BLPX 4GQ9H 4H1LH 3ES6A 5F9JB 1H15A 1EUTA 2MNJB 3RTLA 35C8H 3BO8B 3LKOA 4P2QD 3HNVH 3BAEL 5AKVA 1T1YA 5AQ0A 4AOFA 4F91B 4J3QA 1NMAL 1U21A 5IW1A 3VFMA 3GBML 2I27N 3HCVA 1PMYA 3QUMA 1IC1A 5J12B 2W81C 3FRUB 4P5MA 5K9OB 1J0JA 1N0XL 2VLRA 1PEWA 2EDRA 2GJ6A 2LU5A 3ILQD 5DS8A 4JFZH 4FZEH 4U6YB 2PCPA 1WICA 4ANUA 1WRFA 2WO4A 1DHKA 4UQBA 2R69H 4N0FB 3V0HA 3D4ZA 1CYWA 4X8XA 2NYYD 3SCMA 1OM3H 4HZLB 1F3DJ 2WJ7A 3HMXH 4MNQD 4E9VA 1GVIA 4NSKB 1DDHB 4QNPF 3UGEA 4Q9CA 7PAZA 5I15L 4XB7A 4KHTL 5ADOH 1FIGH 3H6AA 3MR9A 5F96L 5EPMA 2AMUA 3WKNA 2NY5L 1SHXA 4MNGE 4K2UH 2IOIA 5HPMA 3N0AA 1QFUH 1PVHA 2GITB 3RDTA 3LD8C 5K9QG 4NBZB 2AC0A 1QVOB 5I82A 2XIDA 4A6YA 1KT2A 2L0DA 4PJ9D 1QBBA 4ZMLA 1JFQL 5L9DL 4ES8A 1WS8A 1KY6A 1A6UH 2YR3A 1CLZH 3P9LB 4JFTA 3TX4A 3UDWA 3O9WD 1FP5A 1EFQA 2MTPA 1GC1C 4I48A 1EMTH 1HINH 1M2VA 3KYMB 4JMXA 4FDWA 5FW6A 5SWQB 5C0DB 4CAGA 5IBTL 1MRFL 5GSVB 5ERWA 3RB5A 1LWHA 2FWUA 2VLLA 1S7SB 3G5YA 4HUWA 5DFVC 5FAAA 2WTPA 1ZGLB 4BKTC 4KK8D 4OFVA 3POHA 5F1IB 1KBBA 4J6UA 2VSDA 1IGJA 2F7PA 2NW2B 4NO5B 3UZEC 3O3AA 1BD2E 3DTDA 4NAJA 3QWQB 5E1GA 4OCSL 3NABL 4JFEA 4WEBL 5BO0D 1D5XA 4QHKI 1CL7I 4NC0B 2NYKA 3CFMA 4ODTH 2ZWSA 4FLOA 1A1OB 3CBKB 4OKDA 1U3HD 2AJSL 5ISZE 4Z0BL 5JLZB 5IB2B 3B4NA 1WIUA 4HCRH 3WG7B 3WXVL 5ICZA 3NRQA 2FNBA 3C2SA 3MLRH 4PR5A 3NIDE 2ZWZA 4FTDA 1Z9OA 3E6FA 4URTB 1U2HA 3VTMA 3AU1A 1MFCH 1DEEB 5DJAB 4F8PA 1IBYA 1MCNA 1DYZA 1FNAA 4ZO9A 1UADC 3KPTA 2E3VA 1RJLB 4IIQA 2WLIA 1I7TB 4XO8A 1N4XL 3AB0C 3N44B 2QR0B 3S3BB 3S88H 2UY6B 1CUOA 2WAQA 1DLFH 1QTPA 5FUOL 1DFBH 2OMZA 4N0RA 3A4AA 3C5XA 4WFFD 4GEJA 3K6OA 1T1WA 4P23B 1ECZA 5AOZA 5DRXA 2NY5C 5I0WA 1O6SB 5EF1A 3WE1A 3MLXH 1M05B 3FTYA 3MA9L 3BGMA 2GY7B 2YK1L 1ETA1 4QTIH 3AS1A 4BZ2L 2O5YH 3KCWA 4JUSA 5IB1B 4MBRA 3UBXB 1PD6A 1PG7L 3BWUF 4YC2C 5IKCB 2IFGA 3KMDA 4NZRL 4LARH 3SE4C 3LEYL 4H88L 2CBPA 2HTKC 3D9AL 4OM1H 3W37A 1KB5H 3RBGA 3ZDXB 5LBSH 1U8CA 1GS8A 4HPOH 1LO4H 3KLDA 5AG9A 1R24B 1C1EH 4AG4H 1Q9KA 4DZ8B 4ELMB 2WCPA 3X17A 4O5LH 3IF1A 3QEGL 4CBZA 2V8LA 3MRCA 4LHUD 5DD0L 4F8NA 2YPLA 4KUCD 3EJCA 3DRQB 4NQDD 4FXGB 1KN4H 1HDMB 1DVFD 3IDJB 5CP7A 2MRYA 5IJDC 1OTTC 1NGPH 3AREA 4APQB 1WTGT 3P3RA 4TNVK 1YMMA 5JIHA 2ENQA 5MEOB 3QORC 1JTTA 3QISA 1HWWA 3TT3L 2RD0A 4FFZL 4YSUA 1EDQA 4GB9A 1EPFA 3A4FA 1F4WH 5CZVH 3I9GH 3D69A 5E70A 4L4TA 1J88A 4LIQH 3ZU8A 4QDGA 1IILE 2FJGA 4NAQA 4LPTA 4MXWL 3DX4A 3EIFA 1SXZA 2A9BA 2XV2A 1LP9F 2ZXQA 1GSMA 5EU7C 3QJUB 3DVNA 3PFUA 2P7TA 3CJJA 1M7IB 1T0NB 4BGLA 2VC2B 3ILEA 3QS3A 2RA1A 4TXVB 1UKQA 3NFPB 1AR2A 3RAJL 3BLKA 4PCYA 4TVPH 1MUJB 1AR1C 3AU0A 3U4BH 2XHNA 1KTLB 3MRDA 1IAOA 3SDCA 5C0FB 2ZWEA 1L7TH 4LVOC 4OUUA 3BKCL 2IGFL 4NQCE 4OAWA 5E1QA 2Q87A 4A63A 1WH0A 3VWJC 3BUPA 3FQRA 3VYPA 4QOKE 3APDA 3W0WB 1FVCA 1NKGA 3FUEA 1NUNB 3WY2A 2PUQT 3EBAA 1J5HA 4A7GA 4BH7A 4Z7QE 1ZIBA 4HJEA 5ANMA 3VFUA 3SDAC 4IKJA 2AJVH 1A9BB 1RLBA 4PVBA 1HL8A 3D2TA 5LGJA 2ZMZA 4KO6A 1LD9A 2BZCA 2CM6A 1U95B 3QXAB 1ETZB 2AF2A 5E2VL 4OSUL 4PJEA 1FL3B 5GS0D 4LASH 5B7FA 1FC2D 2VABA 4AGMA 1MIEH 3B2VL 4MS6A 4GXUN 2NTFB 4R0LC 1NLBL 4GAGH 4Y1AD 3V4UL 1SXAA 4Y5XB 1IKNC 4P2RA 1FO0B 3S96B 1CG9B 5T5FH 2UV3A 2Z4QA 3QDJA 1FNHA 4X6CE 1I8IB 1G6RH 2GUOB 4GW1B 3C5SB 4GLRH 4QXGH 5F9OH 4G43B 1P4BL 1CBVL 5CCKH 2RMNA 1MFDL 3A6OA 4K9EH 1IC0A 1T5WB 5EG6C 4GMSH 4B9FA 4OD2B 5EIVA 1BFOB 3BKJL 1UWEH 3LQMA 2CLVA 4AW4A 1UYWL 5D7JA 2L7JA 1V3MA 4RAUB 4XR8C 4A67A 3TN0A 2G3XA 4HAKA 4PCKA 4PIRF 2XZZA 4JANA 4Z3EA 1EAPB 1UJTA 1BFVL 4K07A 4ZS6C 3AXLB 5C08E 2EYRA 3KG5A 4YXHL 3B34A 4XPTH 2Y7MA 3DO7A 1U8QB 4LRNL 4FI7A 2RBLA 4YHNB 1H8LA 3G5VB 3JTSB 4R4BB 3WL9A 1HKFA 4EN2A 4XP6L 5BVPH 4JX0A 4ODWA 4MJIA 4P5TB 5JA9A 1ID2A 3BMVA 3BN9D 4OJYA 4FQLH 2P3XA 1JERA 4LMQE 4TNFA 2I5YL 4I18B 3MJWA 2O6FA 4S0SD 1UH2A 2ZQKA 4TOYL 5IF0B 3TYGL 1WJ3A 2ZCLH 3B5TA 3PUUA 2NPLX 4Y4HA 3IGLA 3KDPB 3VSTA 1J11A 5I75C 3BZEB 2EIKB 5DI8A 4UQAA 5AOIA 3FKUS 3KXFB 1T66C 4N2GA 3VG0L 5A40E 2DQCH 5I0XA 4B3VA 1ZRUA 4HD4A 4U1IA 3OKYA 2ZKXA 5DT1L 4NENB 1BQUA 4KDWA 5FYKL 5JPMC 3TFKD 2CCWA 3EGSA 4EVNA 1RJCA 5FYJE 2A6JB 5FGBA 4NBXB 5EEZA 3FB5B 3ULVF 1BZQK 3QRFM 2APWA 4OUOA 2AFNA 4M7JL 3T2PA 3MJ8A 1NCGA 4KJYB 1GGUA 1T20A 3MFGB 2NW3B 4TUUA 3QDGD 4ZFFA 3SPIA 3T3PB 4LEOB 3QAZB 4OI9A 1PY0A 2HRHA 3ME0B 1AGCA 3CXFA 3SIKA 4MAYD 4HK0A 4DOHE 4H8UA 1CDBA 3K72B 1AHWB 3MRQB 2NR6C 1E5ZA 2ZOOA 1AAJA 4PJIA 1TENA 2F5BH 1FFPB 4GRLA 3KPSA 3O45A 3WHE1 5FKPB 1B0RB 1YPZA 3O8XA 4OCRH 5FUZL 2WWMD 4LCCC 4XP1H 3IRCA 2E7HA 3ZQXA 4U2ZA 2FEDC 4OLYH 4JRYB 3VXUB 4IRSB 3ZT5A 3KPQB 4XPBH 4XMZA 5TDNB 3W57A 4AJYV 4OLWH 2Y2TA 1CFSA 1YJDH 1JMXA 1JL8A 3BIKA 5FA3B 4CDGC 5FECA 3RRQA 3BKYH 3VI3A 3MUHL 5CU5A 5INDA 3CFQA 4L9DA 4PGCA 1KPUA 1OE3A 3RX7A 1FZKB 1UA7A 3LSOA 1DQDL 3QIBC 2FQDA 4M1GL 3KJ6H 1A3RH 3HLAA 4BUGA 1XGUB 1CD1B 3C9NA 4NNYB 4H8HA 3W1ZA 2HJKB 3NAAH 2J2ZA 3LNFA 3IETB 4XWOD 1X9UA 4F20A 5BRZE 5LQBL 3EFFA 4N6QA 3I74A 1VKXB 5D7LA 3MRIB 2EEXA 1D7BA 3O2DH 3VXRA 3HE7C 4PV8B 4HIHA 2HT2C 2EECA 2F7QA 4PJAA 3MBXH 3C6EA 4JN1L 1UOKA 2GK0A 3RWFA 5AOLA 4EUPA 4PJBF 4HH9A 1KYUA 1XF5A 2EILB 4QHLB 3N50A 3VVVA 5JXAL 4J3RA 2UZYA 3EYFA 3GI8H 4PRAB 3RY6A 2X4TB 3GJFB 2VQUA 1FFOB 4MMYA 5SWZE 4GAJH 1DJGA 3CN2A 4RH4A 3UPCA 3BUYA 3REVA 4QKXB 1HI6B 3D51A 4EQ3A 3G5XB 4FKEA 3VXSD 3RZCA 4AGPA 1AZCA 3GDCA 1KZYA 1B2WL 4PMEA 3CFCH 1ZANH 4TV3A 1ZLUK 1U8KA 5EIIA 1KIUB 2R83A 4AQEB 3CZEA 4IOSA 3EFDH 4ODBD 2AXFA 5HGAA 1J86A 4OCXL 2GEQA 5L8JB 4NN5C 3IJSA 3ZPDA 2JJSC 4OF8A 1RJYB 1SDYA 1X5LA 3BP4B 2JCWA 3B6SA 3FXIC 3MJ7B 5E2WL 3GFUA 2F54A 1A5FL 2IEPA 5F89B 1DUYB 1IMHC 2R4SL 4FOMA 2E0PA 4M8RA 1OP3H 2QDWA 1TJMA 4JPVH 1A3QA 5B8CA 2HG5B 1OT4A 4GRMA 1CFVL 2DAVA 3ARBB 3ZR5A 4D9QD 3L3IA 1A0QL 1J8SA 4WK2B 3U6RB 3OAWA 4P23D 3D06A 3PGFL 4M5ZH 3V0DA 3P4NA 2ITDA 1BHGA 3LKPA 2WLLA 1M71B 3MRRA 2FRGP 1FZJA 4NO2A 4G6KH 1SJVA 1U8PB 3K91A 1LEIA 5CKGA 1HILB 3QH3A 3DHUA 4P9HL 1Q9LA 4LXFA 4OQTA 2QGEA 4LGPB 1ZTXE 4MNGB 2CDEB 4LKCA 5FYLE 1W0YT 5J06A 3FTZA 3QUGA 1DQJA 3PG2A 1FNGA 1B6UA 2JSFA 4XCCL 2ZCHH 4GH7B 1TEYA 4J4PA 3GB7B 5EBWA 3KNBA 4EEEA 4JJ5B 4LKXB 4U7SA 4P6SA 5EZJB 4FQHA 1A14H 2OR9H 3LH2L 3BVXA 2P45B 1HCYA 4KOCA 5D6DC 4E41E 2AEQH 1E7UA 4RMVA 5CJXC 1T22B 4APQD 2WQ8A 3MGOA 1DJIA 2DMBA 4IEFB 4Q74A 3S4SB 5CKAA 5KVDH 2Q7YB 1URLA 2GIMA 5K39A 1ZWIA 1TZGL 1DQKA 5EN3A 3FCSA 2YXFA 3FO1B 3V9EA 1WIOA 1JZ3A 3V52L 3AC0A 2X4RB 1VSCA 3KM2A 3KL0A 5F2FA 1IKOP 1CQKA 3QHZH 2FLBT 1OAJA 2P5EE 4JN2A 1AYOA 4KRNA 1KTJA 5GGVH 3QXDA 1XH0A 5L2KD 4TUKL 2HRGA 1VESA 1V3KA 2F7OA 3D1MC 3L13A 3RIFK 5BV7B 5FM4A 4BSJA 2BERA 2R0WH 2E74C 4Z7OF 5AB9A 4X9BA 4M7ZB 3VU2A 2JJUA 2OJEA 2ZSWA 4HFUL 2C4XA 4LSVL 3KWWB 1GOFA 3U7YH 2YRPA 3NIDB 2BHFA 5TPWL 1DJYA 1L7IH 3MRBA 1R33A 3OKDB 2YKLL 2WKOA 1BAFH 4KMLB 3TO4A 1Q1JL 2AQNA 4U1SA 1DANT 4JO5A 1H9VA 1HCZA 1VCBC 4DVRL 5KYWA 3VX0A 3WCYA 3BH8A 4KMTH 2Y6SD 4YFEA 3P11H 3F65A 1FFNB 2OCFD 2WP3T 1N59B 2WSDA 4FRWA 4P9HC 5K1VA 5FA4B 4UOW1 3FH7A 3QQ4B 2C9RA 2UZIL 2XRAH 1YEEH 1OP3K 4QRRE 1IBGH 1WV7T 3QYMA 1RLWA 4WLCA 3W9DB 3SBQA 2Q2EB 3FHAA 4EZJA 5I6MA 1A7PL 5B7EA 2QGBA 3DO4A 5IMOA 4GG6A 4Y19D 2A4ZA 3ECBA 1X3DA 3QWOB 5TE4H 2V5YA 3FPXA 3L3GB 5E03A 4ENZA 1CICB 3GXUB 4HMCA 4BINA 1T1ZB 4F3FB 1P4LB 5FOBA 4YLCA 4P46B 3UAJA 1IGCL 4GIPD 1A9EA 1S9VB 3P3YA 4YH6A 1FNLA 1A6VH 1IT9H 4DP2X 5IHZA 1SYVB 2IV8A 4JDVA 2H2PC 3STZA 3EO9L 4DQAA 1P7KA 2Y23A 3H9HA 2JKWA 5IHWA 1RPQA 4UQ2A 4QJ4B 4AZUA 4HJJH 2BK8A 1BYPA 1JHKL 5FGRA 3WENA 1NAML 4FXLA 4QRPD 4MCYA 1F1DA 4MX7A 1H5BA 4AVIA 5BXFA 4NCDA 3ZBMA 4N5ED 3ILDA 2FSDA 2GJPA 2A6IA 1BYOA 1OZUA 5GGRY 4BGDA 2WQUA 1GGBH 1WITA 4JRXA 4KQ3L 1YNLL 1P2CA 3BVWA 3DARA 4LLYB 4OLEA 2JFCA 2HN7B 3GPEA 3SGEH 2HLFC 3F7KA 4XXDB 3D4CA 4A37A 3PJSB 4P5TD 3BVNA 3AY4C 2AJYL 1JI1A 2YPKA 4EI0A 1ASOA 4PPTA 3OHMB 3ARPA 1FAKT 1JI2A 2R1YB 5DRZA 3DBXB 5KJ7E 5K1NA 4HISA 4BDVA 2OX5A 3VB9A 4LVHB 5HHMD 3QJQB 4FZ8H 4M5TA 4PRHA 1G94A 2B0SL 2PW2A 5DK2B 2E75C 2EXWD 3KXFD 4B9PA 5ETUB 2FT7A 2R2HA 5GZOA 4HWBL 5AB1A 1A6TB 2WUCH 4KOBA 4RGMC 4QOKB 1NKRA 4G7VL 5J3HC 3MNWB 4LCUB 3QG6A 4NRZB 3DPBB 5D2LA 3AWSA 3K4DA 4Z7QB 1MF2H 3JVFC 3WKMH 1KJ3L 4GNKB 1SY6A 4HXAL 5F0PB 1X6LA 3SJVE 1JWUA 5C97A 3ABKB 2HFEA 2Y5TA 1F6FB 4G8AC 2V6HA 4WHTA 2AK4A 3RQ3A 2W59A 4JFFA 1XGZA 1RP9A 2DBLH 1HEHC 2GSMB 1EA9C 1FJ1A 2F53A 3NEXA 4XNQA 4L3EA 3OGCB 1I1YA 4XVSL 1VFBB 3WNKA 1M3JA 4L23A 4XH2B 5DZJA 1E4XI 2XWEA 1CDHA 1UD4A 2ZXEB 4JS7A 4XBGB 3T0EA 3VGEA 5C07A 4XPAH 1CFNB 3NCEB 4KY1L 1CK0L 1CF8L 1D5BA 3CCHB 1RQ5A 4X6CB 3N91A 1Q9WB 4XMXA 4EO5A 2R2CA 5HYQA 4UDUB 1M53A 4Y4FB 1GKOA 5DD6B 4KROC 4GSUA 3U2IA 3O6ML 1AI1H 3S34H 2VCOA 2KL6A 1GMEA 3E8UH 3H9SA 2NQDA 4PJEF 5JIKA 1JZ7A 1UOVA 2YBRB 3IJYA 4JRYD 2BSRB 2DQ6A 4IRSD 3KPRE 4QD2E 2J73A 1BGXL 1JV5B 4H2CA 1GW0A 2C8NA 3SDYH 3KL3A 4ATWA 1K85A 5GJTH 4DH2A 1W0VB 4AM0A 4E42A 2F1AA 4XMTA 4JFYB 3UO8B 2UY7A 3DV4A 1BREA 1CE1L 2CKNA 4HW6A 4U1HA 2VMCA 3CVHH 4CBPA 2NXZC 4UINL 3K8KA 5KBLA 1NLDL 4QHMB 3RX8A 3QPXH 4BZYA 4ZFZA 5I6LA 3HMWH 5D2NC 4YHYC 3HE6B 4U05A 3OAUL 4WEMB 3GYRA 3SKNA 4GBXD 3DKHA 3SE3A 1PZCA 3U36A 1MLCB 2BSSA 4EZLA 2AP2A 1KJMB 3WTYA 12E8L 1XB6A 5HVFB 4JHUA 2W5PA 3EGXB 4XCFH 4S1RL 1QBLL 2R1XB 3KPMA 4Y5VA 4MKTA 5I8OL 1KFAH 5AVZB 3G6DL 3JWOC 1NPUA 2DTSA 4RQQA 5I38A 3ZN6A 2VW4A 4HIEA 2CK0L 3HI6L 3C6LC 1F45A 3Q0HA 2QVFB 1F6AB 1OIOA 1X5XA 5ADPH 1XZWA 4I4WB 2PF6A 4M3JA 4DKDC 5J11B 1GGIH 3GSRB 3TIEB 1OCWH 4WU7A 3ZQ9A 4QHKJ 4ZQKB 4TM9A 3M17A 1I9RL 2BIPA 3OD3A 1IE5A 1JPTL 2JKSA 1PX8A 2XZQL 3PGCA 3MZGB 4WI6A 1CFQA 4PW9A 5JXEC 1PF3A 3L3JA 2ZICA 4J8RB 4TLKA 4ANKA 5HI4C 1AGEB 4DOHB 4JFXA 3WKYA 2Q0ZX 4L3CB 4PJFF 4ESKA 4PJ7E 5EO1B 3L4YA 2CO2A 4ZFOB 5DEFB 1KGXA 3U2JA 1KTKE 4P2YA 3BXNB 4ZSOA 4O2EB 1CLYH 1HXMA 1XCTA 3HUJE 2CCLA 4WWOA 3ZRSA 4L29B 4B6ZA 43CAB 3ATFA 4CNIB 4KTYA 4FJ6A 3FCTB 2E27H 3BZFA 4EN3A 4KDTA 3GC3A 3MLVL 5ALBL 2H26A 2DQHH 5F70A 3VE0B 2Y1AA 3ARBD 1CN4A 3DOIA 4AEHH 4NNPH 2LU3A 3Q44A 4AI7A 4OI7A 4UZGA 4JRFA 4N25A 3FBQA 4Z7IA 4Y16C 2HKHH 1GMIA 2VAAB 4JGMA 1BG1A 1IGML 3CWGA 1J8RA 5DZOA 4Q9RL 4TLUA 4ZO8A 1JWMA 3Q6FB 3RFZA 2EIZA 2OYMA 2ATKB 4JG9A 3D3VA 15C8L 3MCG1 4HUKB 4YHOH 5K59F 4PWFA 2QPDB 4JDZB 4YXLH 1MLBB 3HI1A 5IR1A 5D4QA 3SDDC 4X5QA 4UB0L 3QNZA 4GKSA 1NOLA 1ZA6A 1ILSA 1U8IA 1W8EA 4YGAB 5HDBF 3CFEB 2XWBB 1IEBB 3VI3F 1EIBA 2IWGA 5BZDB 1F02I 2R23A 4EI6B 2X9YA 2EH7H 1LQSR 1INDH 1IM3B 3RUGE 1TTAA 2X05A 3IDMB 3RGVC 1W6WA 5IJVA 2KUTA 2DMHA 4ERSL 1J1OL 1IGIL 4HWUA 2XN9D 2E4FA 1MQ8A 1C12A 2BSBA 2VKWA 4IBSA 3WUWB 1NIDA 1K4CB 1CXHA 4DK3A 2JK5A 4L1BA 2QFPA 2YGOA 5SWZB 1KXVC 3QQNA 3VG9C 3SY0B 3BSGA 1WXCA 2LV4A 3C87A 2X1XR 4WV1B 5HJBA 2H41A 2F8OA 3L7EA 5LLIC 3K80A 5JZ7C 1RZIA 1QG3A 3QWRA 3OM3B 3AUWB 1J8HE 1M1XB 3IJEA 5DC2A 2BC4A 2KZ1B 4M8QB 4JFDE 2BCKA 2XBZA 3QIUC 4U0RC 1G7HB 5DFTA 4I1PA 4M4RB 1CI5A 4XZUB 4UNVA 5DEGB 3EF4A 4M29A 1THAA 2J8UF 2WVTA 2CR3A 3MQIA 1JK8B 5F44A 1F3JB 4WO4C 2XY2A 4TNVF 3RPBA 1E3ZA 4KKZA 2NRDA 5C3LD 5FK9A 3ZL4H 3FZUC 4NO3A 5FFOA 4AQZA 4DP1X 1ZS8A 4MA3B 4FQJL 4GUOA 3FTXA 5I1LB 3L3HA 2FB4H 4NXKA 3FUMA 2KS0A 3UROR 3HLKA 3UTTD 1BIIA 5F0LB 3RA7H 2YMTA 3ARGD 2AABL 3OMZA 3UZEA 5CD5C 1C7TA 4JO4H 1U2YA 1WBZA 3GT6A 4P57A 1SLUA 1NFAA 1PDKB 2JJTA 1OHZA 1I9JH 5C0BE 3V0VA 3HVDA 4CVZA 1OO2A 1S7QA 2XETA 5H35A 4J6TA 3ILQC 1VFMA 1VEOA 1WQVT 4ZUSB 3FO2A 3PJNA 5E8OB 2F5AL 5IVOA 1UXSB 4KVNH 1W72H 1OGAA 4FXKC 3CSYB 2CM5A 2NYYC 1WEJH 3SKMB 1MWAB 1AGBB 2WNXA 2KQNA 4G7SB 1B88A 3NK3A 5F8RC 3L5JA 1NM4A 1MCPL 4HAGA 3K4ZA 3AAZA 1RJZB 5E2UH 4TQIA 4NI3A 3SOBL 2ZJSL 4M6NH 4IHOA 1NEZG 2PXYB 5E5MB 4E41B 3BPNC 3HEIB 3ZE0F 1X5FA 2DWEA 3UZQB 4U6HA 2CA4A 4PJ9C 1KYOK 3D25A 3F8UB 3CDGB 4E9YA 4ZG1A 3L3OC 3PWUA 5DA0B 3VA6A 5I30H 1L9NA 2B5IB 1AZBA 5IQMA 1JN6B 1V7NL 3L5WA 2QGCA 3O9WC 4IHBA 3WMSA 1ZEAH 1MXDA 2BIMA 2P5EB 3IU4L 1JZFA 5I1CL 3V2AR 5L88H 1TYJA 2APVA 2ZUQB 1HE8A 4PM1A 1RULH 2WIIB 4APXB 4Q6IC 2EKSB 3AWFA 2RH0A 4FULA 4Z7VF 3MACH 2YARA 5E4EB 1CYXA 4KK8C 4YDKL 3HG5A 5JR1H 2C1PB 2P47B 4R97C 4F9PC 5B21A 2RJMA 3T8VA 3NCXA 1J5OH 3LHPL 5EOQH 4MB5A 3L2NA 4XVJL 4XCNA 1PBYA 2C26A 3QG7H 3WOVA 1HHHB 2CKBH 4JGNA 1C08A 4QHUB 4HZAA 1LEKB 2HCZX 4JFQA 4QRQA 2OXGA 1UQSA 4HKXA 4KY2A 3AFLA 1U3HC 2GSGB 1R3KB 5GGUB 4A1RA 5KOVC 3ZKQD 1MCFA 4JRLA 2WOBA 2V0AA 4IOFD 3OAZK 4OIAA 1UEMA 5LNEA 2VERA 3HI5H 4DVBA 3O6LL 1PPIA 2XQYK 5JNYB 1QSFA 4FG2A 2YJQA 1R5VA 3NJJA 4MXVE 3B9VA 4XPGL 4YL9A 3L16A 5KG9B 4QRRB 1V7ML 1X9LA 3F7LA 2CJ3A 2FJHB 2OI9B 1TJGL 3RPIB 4XMUA 2DH2A 3CG8A 2MH4A 2O5XH 1MHHA 1OSPL 1I82A 2DWXA 2R8SL 5H4ZA 5ENWA 5DJ2B 1DBBL 4WKXA 5FO9B 4M5YH 2X38A 4FD0A 5LXVA 1B3IA 1OAQL 4Y4FD 1TTBA 1AMYA 1U93A 3G3LA 3N41B 1D7FA 1J1XL 4NZUL 3PUCA 4M9PA 5IM7B 5K5YA 4WI5A 4AJWA 2B4CL 2LAAA 4R90H 3UO1L 3J27A 2JB6A 1LMIA 5AVQB 3TA3B 4ZODA 3QUZB 2YD4A 2XNAB 2VDKH 1RZGB 2WNGA 5GS0L 1R19A 1UACL 5E9AA 1RZJH 4FTVE 3L1GA 2H6PB 4DTGH 1NCDH 1T3FA 3A22A 3CX5K 3EH2A 4JGJA 1D7DA 3WKPA 3CFDA 1MSPA 4FABL 3U7AA 2VUKA 3HAEB 4A2EA 2DYRB 1XSJA 3DUUB 3ZXAC 1ADQA 3KPPB 1QHQA 2ZXGA 3BC9A 3P4LA 3QDMA 3GJEB 3IJHA 2Z31B 3NJMA 4CC0A 2EE2A 4HX1A 3Q8AA 1DVFC 4ZTPL 2DQTL 5D8JH 3F7VB 6CGTA 3LN4B 2KPNA 2X6CA 3ILPA 1U2CA 5C0CA 2R0LH 1IKNA 3IXTB 3CFIC 1XF1A 3OXSB 3TH4T 4X99B 4NDMA 3ZE0E 2ZOKB 2WANA 4F58H 3N1MC 3DX6A 1JF5A 4N2FA 4Y4KA 5ITFA 4G70B 3DUSA 1BVLA 2CZNA 3H0TA 2EDKA 3AVEA 3ARDB 1Z66A 2PO6B 5CIPH 4DP6X 1JV2A 2IH3B 4LCYA 2Z0BA 1PAMA 4GSQA 1W8NA 2A73B 1AKJA 3GS7A 4PTTB 1G7JA 4FFWD 1WFOA 3O4LE 4FFZA 2Z34A 4RFOH 3WNMA 5DS2A 4KWUA 4EUPG 2PYEB 4HA1A 2A77L 2V33A 3LRSA 3TJHD 3S5YA 5ID0B 2JI3A 2K4AA 3VQ2C 4LCWA 3DURB 4PU2A 3SBWC 2YEZA 4PJ6A 5HVHC 4YN3A 5MHSE 2VH5L 2J88L 1TZOA 1B0IA 4YOKA 4OZHF 1F90L 2C1OB 4IM8A 5D5ME 3MOBL 4KTEL 4U1NB 1VGEH 1X5GA 4I88A 4LHJB 2DQDH 2C34A 2DWTA 1JGVH 3DNKA 3IJ9A 5TK2A 3O81A 1D5RA 2ZOUA 3MRMA 5EIIG 2BY1A 2IDTA 3UYPA 3IAGC 4FCAA 3PV6A 1YG9A 3O2VL 5AZEL 3IGKA 2MNWA 2AAAA 5D2LF 4PJ5E 2B4CC 1YUKB 5KVEL 3FCGA 4UTBA 2RACA 3IM1A 3GMQB 1AZNA 5EU6E 2JB5L 2AHLA 3GXNA 3FPYA 4O02L 3DDGA 3GSQB 5D7KE 5E94A 5GS0C 4W70A 3AWZA 1I8UA 3IGFA 4J3OF 3MO1B 5BMFL 1U91A 1YEDA 2ZF9A 5JOFA 2H9GA 2AEWA 4QTHB 3FF7A 1F41A 2DD8H 4LIQE 3LRKA 3SEPA 4W9HC 3TWYA 3WIHA 2E7MA 3WHE0 4ZW7A 5TH2A 1ZS2A 4HD7A 3KPRB 3QNXB 2WIMA 1BEYH 1RMFH 1HKLH 1EHLL 3HNSH 4I13B 4HPHA 4Y2OB 5JIDA 4KXBA 1TQBB 5JHDA 1XMWA 4KX7A 4TVPE 4DCQB 4XNUH 2GTWB 5IMLA 4PRIA 5I1KH 1KEGH 2VR6A 3MXWL 4YL4A 2ENSA 3Q6GH 2OYPA 5IUCA 4AQ1B 2EDWA 2O6CA 4NLAA 1DE4A 3L3KA 4YBHA 4NX0A 2Y36H 4PJXF 1E9QB 3VD3A 4BELD 5LCVA 5ANHA 1AS7A 3ARQA 4NWUH 4OGXL 5L6YH 3P0VH 4I85A 4YHKH 3GRWH 4PEEA 2XZAH 2ED7A 5TDPA 4I87A 5E9DD 4PP1D 5F7MC 4ZTOH 5SWSD 1NFDA 4K3JH 1NGYB 32C2A 4OTXH 4DSYA 4TQEH 3B9KB 4HJ0C 5DMYA 2BZDA 1IM3D 4CSPA 1HTYA 3BN9C 2K6ZA 4M61A 2WN3A 2JQAA 3D0LB 5KS9A 1AQ8A 2EDYA 2X1OA 4AY0A 1AKPA 2FT6A 3NCJL 4XP5H 2Q8AL 5DJCB 1KJ2L 1ZVHA 5GISH 2HWZL 5AVXB 2L7EA 3IJ8A 5SWZD 4XO4A 2EUWA 5HGGS 3FT3A 5DQDL 4Z0YA 1EVTC 3QIBA 3VXNB 4IMKA 3TFKC 1T21B 3MV9A 3GEWB 1L0XA 4PJDA 5D4HA 2XZCL 5IB4A 4FLSA 3K71B 4BFNA 2W9LA 4HKBA 1VEPA 3SDXA 2SEBB 1XIWD 4PJ7B 4LVNB 4GW5B 1WE5A 3ULVD 1H6UA 4D8PA 3HZVA 4X5XB 5F7YC 4N26A 4O00A 3HE7A 5GIRB 4NZTH 2WLMA 3D39E 4H8WC 4P5KB 3UIYA 4X6FB 5I1IL 5I1HL 1DVSA 1MQKL 1Z9MA 2BXYA 3BSHA 3HPLA 4MAYC 1WYJA 3N9GH 3MOQA 5CSZB 2R15A 3U1PA 1SM3H 3FHQA 4MXQD 2D3JA 1Z5LA 2B9BA 4U1KB 4ZFGL 4X6DF 2ZTBA 5CZKA 3UTPD 5EZOH 1D6EA 3KH3A 1WLHA 3QFJE 2A6KA 2ZUSA 3OG6B 4YHLH 5J12C 1S7TB 3EOAA 3F3HA 2WWMC 3K6FA 4BQCA 5JIQA 3MUGA 3FT4A 4PFEA 4OVVA 2D8KA 3GZQA 2X10A 1DJHA 3IYLW 3RIFF 1HQRB 1G1OA 2QPSA 3EJYD 2XKUA 3SB3A 5TDOB 4R84A 1JZ5A 2WINB 1D9KA 4QRTB 2A9CA 4XC3H 1HE7A 2QELA 3II3A 4WENB 5FF6B 5C0ND 3UTSD 1LE5B 3LN5A 4N2AA 5JO5B 3SQOH 3VXQB 5JA8B 5GRVL 2X2YA 5GRWA 1NINA 3VXOB 5GGQH 4OLUL 4MZ3A 2JJSA 2W80C 4YDVB 3GBDA 2I25N 1JS8A 1U8MB 2XFGB 4JR9L 4B27A 2NXYB 3IFNL 4FYTA 4NC1E 1FL5A 5A16A 3MGAA 4L5FL 4E41D 2MQ0A 1CGSH 2IANB 1X5MA 3IBEA 4OGYL 1EV2E 5I28A 2G60L 5CHNB 5EO0B 1PZ2A 3FRPG 1OAXH 4Z6AT 4LLQB 4HJTA 3TNNB 1S7XB 1G9NL 4HIIA 3RUGB 3UTQB 1FH5H 1RD6A 1G9ML 3HA0A 4WTZA 1OP5H 4XWOC 1URZA 3IFPA 3U9UA 5IJCC 4X8GA 1Q90A 3AABA 1MELA 3WSQL 4OCLC 1ZHLB 3HZKA 3PL6D 4NI6A 4JREC 4Z7NE 4K3DH 1NCTA 3K5SA 4GQQA 5CU9A 3SY6A 1DSYA 1HNYA 1RZ7L 1NICA 3GGWB 2WC7A 1A4JA 3P0GB 3S35X 3ZHKA 5D7EA 4AUJA 1TQTA 4OJFH 4WFHE 4Q6KA 1J8HB 2QV2A 4DETA 4HEME 3CFKB 4K8RH 5D6CA 1Y6NR 5BCAA 5IEHB 1FHGA 4OQTH 1KIPB 5JW4N 2FT8A 5D6DA 3L9BA 3X1BA 1YRKA 1ZIAA 1CQYA 4FL4C 3RLSA 2HKFH 4LPXA 5CJXA 2WVUA 4MMZB 2J1ZA 3FT0A 5I8CB 4YDIL 2FX8H 3CVDA 5IQ7L 1T04B 2IFFH 2LR4A 5ICYB 1VACA 1MNNA 2D31B 4EI5B 3VD1A 2W0LA 4HIJB 2ICEA 2YPVL 1UZ6F 3JWNC 3HFML 1U3JA 3PGDA 3ZDZE 1XGQB 1N3NB 2PNDA 1T0OA 2CXKA 4J3OG 2YBGA 4PJFB 1ZHBB 2EIJB 4NQTA 1A6ZA 4QRRD 2MHAA 1E28A 2GYSA 1FLRL 1MCDA 4WU5A 3FQWA 5C0BB 3QRGH 4JKKA 1IX2A 2EDNA 3EOTH 5IW3A 4D0DA 3ZTDC 2C4FT 3I02A 2QKIA 3CDZB 3GBNH 2NY6B 4UCFA 1MG3C 3NFNA 4OUAB 4P23C 4IJTA 4KKBD 5DVPA 3MOAL 4LAJH 4ZMXA 4X6DE 5IB3A 2EYSA 1N8OE 3AS2A 2Z7ZA 3G6JE 3QJZA 1NJ9B 3RVWC 3ESNA 1TU2B 5EZIH 4BSVA 3WEMA 2CHDA 3MRPB 3TA3D 2O1AA 1FNSL 1G9NC 5I66A 2W9DL 1VADB 2YZ8A 1I1AB 4MDIA 1G9MC 1X7QA 2AV1B 3BPOB 4KK6D 3VGBA 2RFXB 4RIRB 1XO8A 1SOKA 4P3CL 4S1QL 4F2EA 2VM3A 3NFSL 2VERN 2GJ6D 3NCYP 3HZYA 2H0EA 4FQQA 4WNJA 4Z7WE 3ETSA 2E8ZA 2ESVE 3T2NH 4U3XA 4JZOB 4AMXA 3SCMD 3KW8A 4FXGC 2ZOTA 4UUJB 2AS5M 1NC4B 3P3SA 3UEZA 5EF2A 1QR1B 4Z7UF 2NY1B 1QPPA 1MI5A 1FBIH 3AG1B 5HDBB 4APQC 4H1LB 4JZJA 4Q2ZA 2WMPA 1GZPA 3H3PH 3PNWA 4TPRH 3GMRA 4LNVA 1LO0H 1DBJH 3US1A 1PLAA 4UDTA 3TBSB 4ZJ9A 4V33A 3O0RL 2GW5A 3ARDD 2PO6D 3DSNA 4V1DA 2G5RA 1JF1A 4HJIA 1JYWA 3I84A 1E4XH 1RZKH 1CZ8L 2WLJA 5C09A 1NSNL 3TLRA 2PYED 2VISB 1GYVA 3EJQA 1N5YL 5I1EL 3IVKA 3RTQB 2E5EA 3IFLL 4JDTL 4PTUA 1SJHA 4ZD3L 1NFIB 5KTEL 2IDFA 3KH4A 1A7RL 4DT2A 3MROB 1Z1WA 5IIEA 4HMEA 3GXDA 1OAUL 3MLWH 3IXAA 3RX5A 3U6XS 3BUTA 4QRUB 4BIKA 1IAKA 5A6LA 3ECUA 4XXWC 4S0TD 3NCCB 4JM4H 3CFJA 1SEBA 2FHFA 4UV7H 1K8DA 1NCJA 5G4OA 3SQBA 1F58H 1UTDA 1RVFL 3AY4A 2OQJA 4L37B 2J8UB 3O3DB 4JFED 1YSOA 1EO8H 5DR5H 4OJCA 2NTSP 1ZA3B 2Y6SC 4OIIL 1IRAY 4RWHA 4NQSB 4WWPA 2CHXA 4LLAA 4Y8AA 4ZUWA 4PS3A 3FB7A 2F15A 5C0AE 3NH7H 2YXMA 5DFAA 5T3XD 5KVDE 2FX9L 4NRXA 3R1GH 1JP5A 4UT7H 4ABUA 5LGKA 2M83A 5GHWH 2X42A 4LSPL 4M7LH 2PWHA 3TVMB 4Y5XC 1DL7L 2NY4B 3K1DA 2WB7A 2YSTA 5CLYA 2FEEL 2IDCA 3EKCA 3M7OA 3BPLB 3U2SA 3KGTA 5DUML 4FTVB 4GW4A 1ZDSA 2F8VA 3FCUB 4Z9KB 2NY2D 2WBKA 4L8DA 5F97E 3GSOA 2DKMA 3NJKA 3UBGA 1A1NA 1J0IA 5HPOA 5CN3A 5AUMB 5T5NF 4KKCD 2XN1A 5DVNA 3TM6A 1QO3A 3JT0A 1IGTA 1NM9A 1BQHA 5KSUA 1HVXA 3MRFB 2OTWA 4UQEA 3FQUB 4QO1A 1N64L 1SMOA 4XO9A 1QABA 5M94B 3K7UA 5ALCH 4ZNEE 1FN4B 3JZYA 2E9JA 4N5EC 5AZUA 3ZE0B 5IFAH 3MCKA 4A04A 4U3CA 5TF0A 2A9ML 1V05A 2BVUA 1UCBL 3DGGA 1CGYA 3TEXA 2ERJC 4YAQA 1RHHB 1Y6KR 3ULSA 1SLVA 4RVBA 4E0RB 3NPYA 1JGEA 2XBDA 3GSWB 4E9RA 3B9KD 4BZ1H 1MJ8H 4P5TC 2HJLA 1KFGA 2XVKA 3O4LB 1MJUL 3QJTB 4KGLA 5DMGD 5TQ0H 4DPCX 2X6VA 4I18C 1PZAA 1YYCA 2EH8L 2Z7WA 4NO0B 3O3EA 3LKNA 2Y07L 5MENA 1PZ3A 2IOMA 3UYRH 3P4MA 3IDNA 5CP3H 3VFTA 4Z7VB 3DJ9A 2AV7A 3EG9B 3WNOA 2BSTA 3KWVA 1ZXKA 2BW5A 4WI9A 3BGAA 4JDEA 2XA8L 2QBWA 3V0IA 2APFA 4AIEA 1A22B 5KANI 2EXWC 5L4FA 4L4TD 1TO5A 2DLTA 4J8QA 1L3NA 1KB5B 1RZPA 4WGWB 5D2NA 5D5MB 5JDSA 4RWYL 1M6UA 2H3NA 2BY2A 2LQRA 3V5KA 1J87A 4TRPH 4QXWA 1R75A 4HF5H 2X4QA 5C7XL 1R3LB 3KGRA 4MJ2A 1KY7A 4F24A 2G2NA 4H0HB 3TF7C 1BXXA 3W2DH 4PJ5B 4HWBA 1MFBL 3HNTH 4O51B 3RGHA 3RIKA 2Z91B 4RGNE 1HJBC 4IU3A 2XVGA 1CGTA 2WM0A 3ESOA 3QAZC 1KLFB 5EU6B 2OBGA 5IMMA 2VR8A 2CRMA 3SDCD 3VRLE 3W38A 4HS6B 3S97C 1GZQA 3ZVVA 1DBAH 3UOAB 3LVTA 4HALA 4GKNA 4JPWH 3HBGA 1AHWC 3P02A 5BO1H 4FXTA 3C6LA 3ZKXB 2WZPD 4CW1A 5KJRL 2JCCE 1MNUH 5BJTA 3ZL2A 5HSFA 3PPSA 5ESAB 3MRKB 4N24A 1N5AB 2G9HB 3V7MA 2JKXA 3MBEB 1UH3A 4JCLA 3ROOA 5IFJB 2J4WL 4NYLB 4QRSB 2HTLD 2YC1A 2XV6B 1T7XA 4JHAL 4ZOCA 1Y6MR 2NCEA 5DRWA 4AGQA 3OX8B 5JXEA 1OE1A 4IRSC 1S7VB 4QXTA 4XO5A 1VEMA 4PRBB 1CWVA 4HC1H 3DJTA 1WCBA 2HRPL 1J5DA 2NLJB 3NBNA 3V5HA 2X4OA 1EJOL 2Y7LA 1T5XA 3QDJD 1P1ZA 1GS7A 1R5IB 2GT9A 4R83A 2WZ6A 4TLSA 2NXYD 1E8YA 3BVVA 2EVIA 1A21A 3ARYA 3V6ZB 4AIZA 2VL5B 2Y6TE 1I8KA 4C8XA 2IAND 4UT9L 3TGXA 1T89C 1I3RB 1G9EA 4GG8A 2ADGB 1RI8A 2OKMA 3IBOA 5D7JD 3NZSA 1CO1A 1HCFX 2G4EA 1ZT7A 4YBQD 2D7QA 4Y16A 3TN0D 3FRPB 2HAZA 4JLRA 4WNSA 2BY0A 4EE2A 1TQCB 4K3HA 1B4LA 1AO7A 4DGIH 4HSQA 3M1BB 3FQ1A 4ABWA 2HG0A 5CJBA 1G6RB 2F74B 3FSWA 3BEVA 4HUVB 1UM6L 4Y5YB 4YQXH 3FOMA 3F58H 3M1CA 2CJTA 3SKJL 1A47A 2QQLL 3SDDA 3JZ7A 2DM2A 2R7EB 4UNIA 5KS9F 2P24B 1EO5A 1MFNA 3KBEA 3MXVH 4FQ2L 4P0DA 4HUUB 2IF7A 4R5TA 2K9UA 4Y8DC 5E08H 5C0JA 1VGKB 2XTJE 1YY8A 2WHVA 1RIHH 4AYID 2WXGA 1UA6H 2BVOB 3L4CA 5IQ9B 2F6AA 3LH9A 2VDNH 4FG4A 4OZHB 3D39B 2WXFA 1IU1A 4ZQTA 5MP6L 3RGVA 5FXCH 2YOCA 1ITCA 5HYSG 1IZJA 3NIGF 4EI5D 3UPRB 5BV7L 1YLBB 4AYGA 2P8MA 2ARJB 2IADB 2YZ1A 2VXTH 1AQKL 3QO0A 1ID5I 1SOQA 1ZV5A 2PN5A 4S2SA 1IAIH 3ZTNL 1IC4H 3HS0B 4M43L 1F4HA 1U30A 3PHSA 2MOQA 4LP5A 5IB5B 4JG1L 3U9PH 1KJVB 1UXWB 2WQWA 4I77L 2BSDA 4M02A 2H5UA 4O58L 4Q58C 1BCIA 3ARBC 4AMWA 2R2BB 2UVFA 5IT2L 2YRLA 2Q8BH 4UTAH 5BQDA 3HG1B 2OS7A 4LNRB 3OLIA 2YD2A 3D12B 3L4UA 4DFIA 4EF3A 3CFBB 1LLAA 1IFRA 3K0YA 2V9RA 3QIUA 5T5NG 5FO8B 3DXAE 3PWPE 3FMGH 4G1EA 3R19A 3VJ6B 3TONA 2V5SA 2N7AA 1QI3A 3IDXL 5LDUA 1E2WA 4JY4B 4WVRA 3O8XD 1N12A 5E6IA 3RZWA 4WO4A 2PWDA 4XAWH 1XTMA 2ARJQ 1IM9B 1OT1A 1K72A 4X8CA 4PMFA 3IE4A 1H3XA 5HVGB 3RP1A 3BP6A 1BM3H 1E4KC 5TF1H 3APNA 1INEH 4FX5A 3L1OL 4HLJA 4XE0A 1PTZA 2JIXA 4YSRA 2LABA 4D9LL 1GC1H 3SD2A 4PJXB 1ZT4B 2JLPA 1NC4D 4M5SA 3WXWH 3MRGA 2EXSA 2NY1D 1BPLB 1G7IB 2FDBP 4NCC1 3QJFA 3ZJAA 1QFWL 2MNUA 2X1QA 5SX4H 2R29H 4G1MA 3MV7E 2Y1ZA 2CNZA 1T4KB 4DGVH 4FXKA 3MYJB 4L8CA 1CVSC 4ALAL 3L2MA 4MNQA 1YEHL 2FWOA 2YQ3A 2CO6B 1QBMH 1BX2B 3NSYA 4PW3A 2Z65C 3SOTA 1FL6B 3T2OA 3MLTB 4QT5A 3ZTJH 4J2XA 2Y1VA 2EKJA 3BAEH 1U8JA 3LRLA 5LKNA 2NY0B 1NMAH 4IMLA 4F15C 5BV7C 3GBMH 5D7LD 3RTQD 3BZ4A 3VXRD 4F9LC 3T3ME 2ATPB 1R5WA 4PJ9A 4ZW8A 3WTVA 1N0XH 4JFHE 3CUPA 4NLHA 2F58L 3L3OA 4D94A 2XG5A 3EH5B 1WD8A 4NS0A 4AM0Q 1VPOL 2W1NA 4KZDL 5JW5A 5AYUL 3T5WA 4L2YA 2VLKB 3O9WA 4GRWH 4KKAD 4BXVA 3ZDZB 3ZRFC 2DB8A 3VU1A 4JFWA 4KXAA 5CINL 2LT9A 4YNYA 3J2PA 3UBHA 4XNYL 5I15H 5AW5B 1RZ8A 5C0RH 4KHTH 2OTPA 4WI8A 5F96H 5LN4A 4X42A 4DESA 4Q6IA 4Y88A 4AKQA 2WLHA 3WFEL 4I0PB 1A7NL 3T4AB 3VGAB 4UZUA 3LEXB 3NIGE 3ARGC 3C5JB 2OMVB 1U6AH 4F9PA 1TIUA 4EDXA 3EJJX 3NN8B 4MQXD 4X6DB 5F3FA 3DVGB 4X4YA 5SV4A 1JFQH 2ZX8A 5L9DH 4OZIF 3G6JB 1NBZA 2EQDA 3TVMD 4HHWA 1ICTA 1UM5L 2NY4D 1QLRB 2VITA 3VD7A 1IQDA 4YBLC 4Y2LA 1FV1A 3QGVA 3G9VA 4W6WB 5C0GB 5CCGE 5CLZA 3DJSA 1JXJA 2W88A 4DO5A 2VLRE 3HKZA 1I7UA 2C3GA 3WTXA 3V0JA 2FJFB 3KPLA 4YDJA 1MRFH 5IBTH 3ZMEA 2OTUB 3K46A 4FJYA 2VLMD 3LPPA 2I9LB 3S5ZA 4OFYD 5I5IA 2ESVB 4PY7A 4Q9QL 1HHGA 4NXSA 4DP9X 2VZSA 5KN5A 1F4YL 3TT1L 5T1MB 2Q86B 4ONFL 1XF2B 4ALAC 4KV5F 3ZSSA 1I8AA 1ORSB 1V54B 4MQ7B 2CMRH 4HKJA 5LNGA 3WD5L 1GIGL 1FCCA 3NABH 3OPZL 3KDMA 4WEBH 2WV3A 4S11A 1BMZA 3JXAA 5DJ0A 2AJSH 1SJXA 5EU4B 5EBLA 4BA8A 4Z0BH 3BEWB 2LVEA 4H26B 3VTTA 3RHWF 2KC0A 3HPJA 3D52A 1Z3GL 2OMXB 3TIDA 3WXVH 3K2UL 1HH6B 3Q8CA 3QYCA 3DMMB 3O11B 3O4LD 2H1PL 4GO9A 1I8LA 2FZ3A 2DRUA 2WTOA 2VXQA 3S48A 1JNLL 3VDAA 2GKIA 5KSBE 1OWWA 4LB8A 2F19L 4LVHC 5CWSA 4LHUA 5E2TL 3B1TA 5FUOH 3BW9B 2NUPB 3V8OA 5I18H 1NIAA 3C8KA 3CTTA 5I73B 4NQDA 4MYPA 3FFOA 1DVQA 3QQ3B 2GCYB 2BLFA 4TF4A 4XX1G 2XPGA 4MAUL 4FQPA 4KXZI 3RWIB 2ZYHA 3MA9H 4NHCL 1H8NA 1K3IA 2YK1H 5EU5A 4OZFA 4BZ2H 1SYSB 2CH8A 3VFNA 3TPKA 1E0OB 1CLOL 1MH5B 1O75A 4WDIB 1PG7H 4IOFC 1MREL 1CMOA 4PJ5D 4NZRH 5AAMC 2C3VB 4XOBA 1DVXA 1J5CA 3BJ91 2VDPL 1FPTH 5C0AB 1L0QA 4P6TA 3VFPA 1AD9A 3ZT7A 4OV5A 2DYSB 3P9MB 3HW7A 3UZVB 2ZWLT 1R3JA 2DWSA 2LTQB 3NJXA 1E6JL 4LPYA 5CZXD 5DD0H 5AD0A 3X13A 2JTDA 4Q52A 2ZKHL 3HVNA 4HT1L 2P52A 3CC5B 1ZVSA 3QJHB 4HJUA 3MV01 4RISL 4R3SB 2VRQA 2XQBL 3LNGA 3SBWA 2A6DB 4PGZA 4Y4FC 3TO4D 3FU5A 3K81A 4LLWA 1UWGH 1YN7B 1P6FA 3MBED 3JYCA 4AQ8A 3TT3H 1WGOA 2BP3A 2QPFA 3IDGB 4FFZH 2K1MA 3LPOA 1ZLDA 4CMHB 1QFWM 4QCIB 3RNQA 4AEIL 5L0QB 3FU6A 5DJDA 4OZIE 4MXWH 5LAPA 2NX5A 1KGUA 5DCCA 3BWUC 3FQTB 4M9OA 5J0BA 1Z9PA 3O3UN 5IROD 2R2EA 1QNZL 2LFGA 1WG3A 4JGUA 3EO1A 3B7RL 4RGOL 5ESVB 2XQYG 5F9WB 4L18A 5F7DB 1YEKL 5EN2B 1FGVL 3RAJH 3FW6A 4I9WE 3B3BA 3GMMB 2EUVA 5FIEA 1QEXA 5GGSA 5KUKA 4Y1AA 1SEQH 5AVRB 5E5LA 2QVTA 2YPLE 1YC8A 1FYTB 2DM4A 3BKCH 2IGFH 4Z7UB 1KXHA 4D0BA 1P4UA 2G5UA 1EBAA 4OZ4B 4JY6A 4WTZG 2WZAA 4QYOA 1ZAGA 4GAYA 4HLEA 1SDDA 1BWMA 1UD6A 1YMME 1COBA 3GS4A 1NL0H 4I5BA 4JVWA 2CR6A 1FVEB 4FNLL 5J6GB 5HYFA 4FFWC 5BW7A 3QNYB 5I0VA 3BGFB 4R7DA 1T2XA 2ENYA 3GLEA 5E2VH 3U7WH 1N6VA 4OSUH 3TJHC 3JV0A 1J8KA 3THMH 2AI0L 2CDFB 2DL2A 2XTLA 1BZOA 4WKZA 3A67L 1XDTT 5CUSH 3N42F 1RIVL 3DGDA 5K9JH 5KBDA 1OD7A 1DJSA 5IVXF 1BZ7B 3BVUA 2X88A 1OOWA 1CBVH 4RGNB 1EZVX 2X2JA 5DDHB 3QEHB 1MFDH 1LK3H 3SE8H 5JW4Q 2BNUA 2P5WE 5GZOD 4NC2B 3VYNA 4TUJA 1QA9A 2JCCB 2Y2YA 2ZYSA 4X8JA 3VXTB 5CCJA 3ARTA 3N6YA 1BFTA 1QTSA 3FB6B 5FO7B 4K23H 1R0AH 4MCNA 2I07B 3SGKC 4OFQA 2E46A 4ZPTA 1BFVH 3S3JA 1XX9C 4O4YL 3ULVL 1FE8L 3BT0A 4J3OD 3U46B 4YXHH 2VIRA 2ENJA 4JFFD 3GHBL 4H8QA 4LRNH 4RAVB 5C0EA 3HS9A 4I3GA 3STBA 1S5IL 4O02A 3HG1D 1XGPA 4K7FA 2GJZA 4L3ED 4XP6H 2DQGL 4P2RE 4TSBH 1JHTB 1M2OA 1HSAB 1LO5A 2DWDB 3T0ED 1R3HA 3D87B 3GEFA 5T3ZD 5JTWA 2J5LB 4ZDHB 2I5YH 4G5AA 4DEUA 1P53A 4RFNB 5HHOA 4TUOA 4TOYH 3TYGH 3G08B 3O3BB 1IM9D 4DZBB 3S37L 4BWWA 3TV3L 3ZHNA 2JVUA 3H9SD 1JZEA 5F9JA 4BWUA 4NQVB 3BO8A 4XI5D 3VG0H 1KGJA 1YQVH 2OLDA 2UWEF 3LNHA 5DT1H 4QJ5B 5FYKH 5FC9A 4YHPB 3GNML 3FRUA 4R2GB 5IV2B 1ED3B 4NPYB 3CU7A 4PBDA 5DJYB 1N6QL 4RZKA 3TPUA 4PP1C 5DK3A 4AQAB 5AYTA 4U6YA 4H0GA 4M7JH 4P8QA 3AROA 2BIQA 3DIFB 4N0FA 1R4XA 3GRGA 2A9NL 3OKKB 5CE9A 4HZLA 3QC5X 3U0WH 5AOKA 5CBAB 3HB3B 4QEGA 4ZS7L 4NSKA 1DDHA 3NJNA 1OLLA 1HWHB 2AXGB 3LRMA 4MBOA 3NGBC 5EOCL 1EDYA 2Q2LA 1F13A 5DHYB 4WV1C 4HGWB 4EJ1C 2GITA 3LQZB 2V2WB 4HLZG 2HPTA 5FUZH 1U8LB 2OMWB 4UOJA 1QVOA 3ZGHA 2Z1PA 1PFOA 3A4EA 1KXQA 4IDLA 1OSZB 2ZCKL 4NBYB 2VDLL 3GF8A 3P9LA 3CVHB 5F7LB 4FG0A 1XIWC 2D0GA 2VLKD 1EX0A 4LSRH 5LNDA 3ULVC 2OXHB 4BK8A 4GUQA 4B60A 3UG4A 2AQPA 1SUJA 3KYMA 2IWKA 1ETB1 2BVQB 3NCBB 5SWQA 5C0DA 3NZ8B 5IVXE 4G5ZH 5GSVA 3RVTD 4YS4A 2VSMB 2WP3O 2OMBA 5FCUH 1S7SA 2W0PA 1PLGL 4MXQC 4QGYA 1KB3A 3NSCA 4I0PD 3BHBB 3GM0A 5C70A 1ZGLA 1QZNA 5I9QB 1HL4A 2X87A 3HRZB 5F1IA 4J39A 1DQDH 3D09A 2YJLA 2GJRA 4NN6B 4NO5A 2NW2A 5CD3B 4M1GH 5TJWK 4PJIE 2DQJL 3CSGA 3V4PL 4CC1A 1AD0B 3DXAB 3PWPB 1K2DB 2HFTA 3MI6A 4NKOB 1YPZE 2EDLA 2ZP9A 1OV8A 2APSA 3FAXA 4X80L 5GSRB 3TBVB 4LEEA 4KFMA 5TGBB 1A1OA 3EJYC 4U49A 5LQBH 2QHRL 2JJVA 4JPKL 3CXHK 2CSPA 5IB2A 5JLZA 5C0NC 3II1A 4H2AA 5DO2C 3E6HB 4RDQF 4U1GB 1V3JA 4JN1H 3P0YL 4TSCH 1SMAA 1I1CA 1G7LB 1CL7L 3FT1A 1DEEA 5DJAA 3QO1B 2YAOA 2W60B 1DN0B 1RJLA 5JXAH 1I7TA 4JKNA 2QR0A 3L45A 3TF4A 1NDMB 2UY6A 4BUQA 2KBGA 4U7KA 1BQHG 3BD3A 4ANVA 3K2IA 3ENEA 3PHQB 1RSFA 3MV7B 4P23A 2JI1A 3QUML 4NQEE 3Q13A 1Z9LA 1S9XB 1O6SA 4IBTA 1ZLVK 4DP4X 2I9TB 1M05A 3GWJA 4N22A 1GH7A 5JQ6L 3PL6C 2WXKA 1ZLWH 3Q3GB 2G4GA 4IGBB 5IB1A 3UBXA 1KUMA 5HYJE 5IKCA 4OCXH 5K33A 3GMOB 2MCAA 2ZUQC 4ZI8A 3I6GA 3NK4A 5IFHL 5E4EC 5FR3A 3OJMB 4NZ8A 4XBPB 5E2WH 3T3MB 1R24A 1A5FH 3D18B 4PJAE 4KNQA 4DZ8A 3QCTH 4ELMA 2E6JA 2PR4H 2R4SH 2Z92B 2XWCA 4BQBA 3KGSA 3WDHA 3WS3B 4N2HA 3DRQA 2ADIB 4U4BA 1CFVH 2GHWB 4FXGA 4WSJA 5DGRA 1TXKA 1A0QH 1HDMA 3IDJA 1QQDB 2XACC 1Q1PA 3QZPA 3F5WB 4A6YL 1MHPH 2OM5A 3KE0A 1KBKA 4KUZL 4APQA 1BQSA 3VI4A 4HU8A 5MEOA 4MJ5A 1N10A 3I6SA 4P9HH 4S1SL 1YCSA 5D1ZB 4JL2A 4X7SH 3T65B 2H2SD 4HU2A 3H7BB 4BK5C 4FA8A 4ABVA 1IC5L 1JZJA 3QZOA 4HS8L 5D93B 1T7ZA 1FDLL 1FG2B 3QC6X 2YMOA 2FYYB 1CT8B 2NYZA 3NIGB 2DPKA 5C0AD 1BUGA 3FUDA 3PF2A 4XCCH 3EBIA 4A38A 2OI9C 4Z3JA 4UOZA 2IJ0C 1M7IA 1T0NA 4GFXA 4Y7OC 5KEZA 3WNLA 3LYRA 2HJFB 4L8SB 2X12A 3NFPA 3LH2H 3M8OL 4PUBH 1EFXB 3N55A 1MUJA 5FYKU 4D3CL 1QP1A 4JFVA 5D1XB 5KYUB 4KKBC 2AJ3B 5H37H 1PY4A 5C0FA 4WW2B 2BP0B 2YFNA 1ND0B 4OD3L 6PCYA 4IJ3B 1GY1A 2YUWA 1TZGH 4BD4A 3CVCA 3W0WA 3P40A 4KI5F 4XC1H 4AGNA 5TE6L 3TA3C 4MWFB 3FQXB 3V52H 5CCHE 5T3XL 3EJTA 3RE0A 4NQXB 4U6VH 4RNRB 4KK6C 2IQAA 4GJTB 3S36L 3PQYB 1JNHB 4FFYA 2HLAB 3T04D 1G7PB 1I53A 1A9BA 1FSKB 2EDDA 4N1HB 4PGDB 2AQ1A 4WY7H 4Y9FA 4G8IB 4TUKH 1YEGH 3RWEB 1U95A 3EYUL 1ETZA 3IAPA 3QXAA 2EVHA 1A6AB 4JJHA 4ZYKB 1FL3A 3SCMC 4Z3TA 4LHQB 4MD5A 4UM9B 2ADYA 1I1RA 5FB8B 5EBGA 4HFUH 2BHUA 1S6NA 2NTFA 3FT2B 1ZPLA 4Y5XA 2WLNA 4WHDA 3UBXI 1FO0A 1NCAL 1FYTD 2MQCA 1CG9A 3I9IA 3S96A 4F92B 4K94C 2W92A 1I8IA 2GUOA 4GW1A 3C5SA 3E1F1 1ZLWK 4G43A 4X9GA 2M2DA 3CFTA 4LOVA 5AW6B 3CZGA 4RMTA 2EP6A 1ACYH 1T5WA 3RVXD 5KSBB 3ARDC 2PO6C 1QWHA 5I0YA 3GO1L 2BS9A 4OD2A 4DVRH 4CGUB 2VLLB 4AKOA 1BFOA 1WPCA 4NJ9H 1Z6JT 3EJZD 1W72B 4OD1H 1PQZB 4RAUA 1QZ1A 2UZIH 3CAFA 3GLAA 1G6VK 2XWTB 2XCMC 3OHXB 2AHIA 4J3PA 2OZNA 3I9PA 1EAPA 1JSYA 2NZIA 4WQOA 4JO8A 3AXLA 1DQQB 2HTKD 1A7PH 4H25B 4PREB 1U8QA 1GAFL 3DBSA 4RMSA 2EC8A 5J6SA 1QOKA 2E9GA 2QQNL 5I1JL 2OMUB 2YMXL 3G5VA 1MJ7L 2H32B 4RGND 4YHNA 4R8WL 3JTSA 4R4BA 4YX2L 5L2JB 1DCEA 3Q9PA 4WTXA 4E9XA 4HVBA 3Q8FA 4P5TA 1LO3H 2WLKA 2Z0UA 4K5PA 1IC7L 1MCWM 1P7QB 4JO3L 1HHIB 1IGCH 1J10A 4OKVB 1BXAA 4FERA 4I18A 2Y7SA 1TDQA 1TZ8A 4MHHI 2X1WL 5IF0A 3EO9H 3RU8L 1X6NA 1Q72H 2AHKA 3BZEA 1NAMH 1W8OA 4N8PA 1UWXK 5DMIL 2DKUA 3KXFA 3QW9A 5F7BA 3WEAA 4I3SH 3HJEA 4NKMB 4NENA 1BT1A 5E00B 4NEHB 2I24N 3LKRB 3X3GH 1QSFD 3EYQD 4FYRA 4OZIB 1WBYB 1YNLH 1ZV2A 3BSZA 4RDQG 2A6JA 3H3KA 5DWUL 1KDJA 2CNYA 2BJMH 2FUTA 3FB5A 4L05A 1JCKA 2YD5A 3GBEA 1KBPA 4OLZL 2G2RB 3DJZA 2NY2C 4W6XB 4DO6A 4KJYA 2AJYH 4WFGD 4OF3A 2PCFB 3TXAA 1M7UA 4GFTB 2NW3A 3HN3A 2CKBB 1TQBC 2HKAA 2AQQA 4KKCC 4LEOA 4BK4A 3ME0A 2BIOA 1S8DB 3NA9L 4M8UA 1ROCA 4XBEL 3K72A 1AHWA 3MRQA 2B0SH 3ZYIA 3HC0B 3MRCB 4LSQL 5TK4A 5GXBB 3MA7B 2YPLB 4QLRA 1FFPA 4L1HA 4J3WA 4YLBA 5FKPA 1B0RA 2YXVA 1CGVA 4G7VH 4PG9B 4EMZA 1QSVA 2ZE0A 5H2BB 2H1XA 4U1MB 5AENA 1KJ3H 4RLDA 3CZFB 1N19A 1BXVA 2CCVA 4HXAH 3BMWA 3ETBJ 3B9KC 3QR0A 4OGZA 3QDMD 4N0YL 3K6NA 5DMGC 4JRYA 4ZW3A 4IRSA 3T2LA 2X40A 4W9CC 5DD3L 3KPQA 1K8IB 5TDNA 1WFUA 2ZD0A 4D2NA 1NFKA 2Y3NA 4G7YL 3V5DB 5C0CD 5I0ZA 4XVSH 5FA3A 3MV8B 3HC2A 4ORZC 5INCB 1TMCB 1HZHL 1F4XL 5F1OB 4JL1A 4Y4KD 5JOPE 3QUYB 4RRPG 2VDKB 1FZKA 1G5AA 1CK0H 4KY1H 1CF8H 3SSGA 1Q9OB 1TCMA 4PRHE 1T89A 1XQ4A 1XD0A 3O6MH 5MI0B 3WEBA 4F5CE 2H7WA