3QJOA

Refined structure of the functional unit (klh1-h) of keyhole limpet hemocyanin
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
491
structure length
491
Chain Sequence
ILVRKNIHSLSHHEAEELRDALYKLQNDESHGGYEHIAGFHGYPNLCPEKGDEKYPCCVHGMSIFPHWHRLHTIQFERALKKHGSHLGIPYWDWTQTISSLPTFFADSGNNNPFFKYHIRSINQDTVRDVNEAIFQQTKFGEFSSIFYLALQALEEDNYCDFEVQYEILHNEVHALIGGAEKYSMSTLEYSAFDPYFMIHHASLDKIWIIWQELQKRRVKPAHAGSCAGDIMHVPLHPFNYESVNNDDFTRENSLPNAVVDSHRFNYKYDNLNLHGHNIEELEEVLRSLRLKSRVFAGFVLSGIRTTAVVKVYIKSGTDSDDEYAGSFVILGGAKEMPWAYERLYRFDITETVHNLNLTDDHVKFRFDLKKYDHTELDASVLPAPIIVRRPNNAVFDIIEIPIGKDVNLPPKVVVKRGTKIMFMSVDEAVTTPMLNLGSYTAMFKCKVPPFSFHAFELGKMYSVESGDYFMTASTTELCNDNNLRIHVHVD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The refined structure of functional unit h of keyhole limpet hemocyanin (KLH1-h) reveals disulfide bridges.
pubmed doi rcsb
molecule tags Oxygen binding
molecule keywords Hemocyanin 1
total genus 94
structure length 491
sequence length 491
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00264 Tyrosinase Common central domain of tyrosinase
A PF14830 Haemocyan_bet_s Haemocyanin beta-sandwich
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1280.10 Mainly Alpha Orthogonal Bundle di-copper center containing domain from catechol oxidase Di-copper center containing domain from catechol oxidase 3qjoA01
2.60.40.2570 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3qjoA03
2.60.310.10 Mainly Beta Sandwich Hemocyanin; Chain: A, domain 2 Haemocyanin C-terminal domain 3qjoA02
3AWXA 3WKYA 3WJMA 1BUGA 3NPYA 4J6TA 3NQ1A 4HD6A 2ZWEA 1WX2A 3HHSA 1HC1A 4HD7A 1BT2A 3AWUA 5I3BA 1HCYA 3AX0A 4Z10A 1WX5A 4L37B 3AWWA 1LL1A 2ZMZA 3AWZA 3NM8A 3QJOA 1WX4A 4J3RA 3HHSB 2ZWFA 4P6TA 4P6RA 1BT1A 4J6UA 4OUAA 4Z0ZA 1WXCA 1LNLA 1JS8A 1NOLA 3NTMA 3GWJA 5CE9A 3W6QA 4L37A 2P3XA 2AHKA 3NQ5A 4J6VA 4J3PA 4P6SA 3W6WA 4YZWA 4OUAB 3AWVA 3AWYA 3WJMB 3NQ0A 1LLAA 2AHLA 2ZWGA 4J3QA 4Z0YA 3AWSA 5I38A 4D87A 3AWTA 4HD4A 2ZMYA 5I3AA 2Y9WA 2ZWDA 2Y9XA 1BT3A 1OXYA 2ZMXA
chains in the Genus database with same CATH superfamily
1BWMA 3WKYA 4KVCH 4OCLC 4DN3L 2WGXA 4DP0X 2PWEA 1JNNH 1TU2A 3GMOA 2HTKD 2ZX5A 2BS8A 4XPBH 3ZL2A 2LU5A 5CD3B 3H6JA 2NR6A 4ODSL 4TQ8A 2G2RA 4FZEL 1WX5A 4IOFD 1U8MA 4K8RC 4F58H 2JTYA 3TCLB 2BMKA 3EYFB 4KV5E 1F13A 5I82A 2JQAA 3IYLW 3QXTA 5EBLA 1X7SA 1UG9A 4ZMPA 1O5DT 4Y4FA 2Q87A 1LQSR 5ACZA 2VR7A 1BZ7A 3IDJA 4M6NL 4GPVA 1VF5C 1L9RA 1Q1PA 2IGFH 4QRUB 2PW2A 5ACZB 1C12B 2NT1A 3MRRA 3H1ZA 4YXLH 4RSVA 3C60C 1INQB 3UIZA 2BP0A 2X9YA 3UGUA 3NIGB 5SWZB 4HS6B 5I0ZA 2P24A 2NY0D 2H45A 4XNMA 1ASOA 3MV7A 4JPKH 3NK4A 3E3QC 5F7DA 2CUHA 2IAND 3G5XB 2Y6SC 3T04D 1OAYH 1E27B 1DP0A 2G2RB 4KXCA 4CNIA 2C9RA 3GS0A 4YHNB 4X83A 4WTWA 2CCWA 2GK2A 2XZQL 4X4XB 5D7SH 1EAJA 3MRLB 2OYKA 5BV7C 1RURH 4HHAB 3QUHA 4JPWL 1ZCRA 4M1DL 4AXWA 1IAIM 5ANME 2YD6A 3M88A 1MAKA 3MLUL 4L1HA 5BV7H 1N5AA 2B9BA 2C4FU 2QHRH 2J44A 3I75A 1SYVA 2Y1VA 3GRGA 4GI8A 1HQ4B 4OLWH 3HZVB 2HXAA 4CL7A 2OZNA 3PAZA 2F5BL 5JHLL 5JIDA 3HE6A 3DJ9A 5CEXB 3OKLA 2HTKC 1DVFB 1G7JB 5BQ7A 3QNXA 3OGOE 4OLZL 5KSAC 3S7GA 3ZE1B 5AQ0A 1BOGA 1WBXB 5TE6H 4ZD3H 5FLUA 1HNYA 2QQLH 4KUCF 3O6KL 4GLRH 1EZSA 1G6RA 4MA1C 3DIFB 1P4UA 1SVBA 1JIBA 2DQUH 4U31A 5T1KB 2FX8L 3AY4A 4PJ9B 4K7PL 1BSIA 1XIWA 1G7LA 4KNQA 3ZQWA 3II3A 4MCZA 3ZHNA 3FU9A 4XNBA 4V11A 5TPWL 2PW1A 5EZLB 4WWKD 2CRYA 5BMFL 3VQ1C 1BF8A 3L4YA 3UAJD 3QI9D 3T3PF 4XN9A 4MQXC 4JPVL 3T3ME 3GMQB 3FFCB 3T0EE 4M7LH 1RU9L 1A6TA 3LYRA 1FORL 2ZSWB 1KFAL 3LZFL 1ES0B 2B4CL 4FFVC 5GRWA 4NNYB 3QJXA 1VKXA 2DS4A 1J1OL 1Q1JL 3AITA 4Y9BA 4LSQL 1ZS8B 3V5DA 3CSYA 4ABWA 4L8SC 3DX4A 3AWUA 3IU4L 3CZJA 1Q0XL 2YUZA 1URLA 4FCHA 3WY1A 1KGJA 2BVQB 3QFJB 5DO2D 4R97C 3IGKA 3AS3A 4PV9A 5A2BA 4ETQB 3HG0A 3VVVA 4OCRL 3OV6A 3ZE2B 2NTFB 3PF2A 3MJ9L 4YHZH 4H1LA 4XPFH 3Q8AA 5T3XE 3SN6N 5D7IA 4K0OA 4XVSL 2F8IA 1SN5A 3STBA 3LNGA 4L4TD 3W11D 4LL9A 4JL2A 3PFQA 3MBEA 9CGTA 1L0QA 4R5VA 4ZMWA 2XZCH 1TF4A 3QJZA 4LQ1A 4DO5A 5IMMB 3VD5A 1I1AA 2LT9A 3RYMA 1AJ7L 2IQAB 2W92A 1OCWL 4PRHB 1NFIB 3SO5A 3KPPA 3CVBA 1REIA 2XRAL 3BZFA 4P06A 3U4EA 4DN4H 1D5IL 2WSKA 4P99A 4X5RA 4WUUD 3ZZ1A 4KJQD 3BC9A 2HJLA 1U3YA 2VLKB 3D85B 4N0CC 5TD4A 1B4TA 5KWYC 3ELAT 3W39B 1MCIA 3MBED 4DPAX 1DDTA 1WWAX 1H6TA 5LKNA 3P4NA 4Q6YA 2RMNA 2RH0A 1AGCA 4A67A 2P7TB 1IQWL 2C3XA 3VFTA 3WGUB 2ZX8A 5DQDH 3V0AC 2Z3FA 4KBPA 3Q6GH 4PJHB 3NN8B 3HFML 3Q2VA 3QJQB 4YS4A 1A7RL 2IMMA 4OFPA 3VXSA 3WTYA 2ZT9C 5CR1A 1CLYH 3VI3E 3F7PC 5CD5C 3W6QA 5JORA 1E40A 1WJ3A 1F4XH 5TJWK 1ZT1B 3UZQB 1H3VA 4NO3A 3W56A 5KSBB 5DO2C 4IKKA 4ODXA 5A2FA 1K5WA 4LLYA 1GH7A 4ECNA 3DYPA 2YQ2A 4MZ2A 4APQC 4JY6B 2QFRA 4EIBA 1QMUA 2XWDA 3RI5K 2ICEC 2YD9A 2IOMA 3BP6B 2ARJB 2VB5A 3D51A 5MEOA 4RNRB 4Z77B 2EEAA 1GGBH 3DXAA 2ZKYA 4I2XB 4MS8D 4UDTA 5FCUL 3SKNA 3O6MH 4Z78B 5IB5A 3S37L 1DLHB 3LZRA 1D5BA 5CLZA 3FFDA 5FKAA 5IGXH 4J3SA 2MH4A 3BYYA 1T04B 2FEJA 3MOAH 4FI8A 3KG5A 3X3GL 4YHPA 5IUSA 5J06A 1E2VA 3UAJC 3KBPA 4U3SB 2EZ0D 4YUEL 3EJUA 2NT0A 5JIPA 5D72L 1JYVA 2OFQA 5AYQA 2E7DA 1RULL 5LB1A 1L5GA 4UZUA 3CHSA 5T1JA 3HRZA 4JFYB 5KW9L 2WQXA 2XXCB 2ZWLT 4FQCH 2WJ7A 4HIQA 5E7BA 3TO4A 4PJ7E 3VFMA 1UT1A 1YY9D 1NLBL 1USQA 4HOZA 3C6EA 3HAEH 4PH8A 1WFIA 1BVNP 4S11A 3LV3A 4NKQB 3TM6A 1J48A 2OJ1A 4W9FC 2VN5A 4P6RA 4CN6A 5EO0B 2APFA 3MV8A 4K9EH 4NHCH 2FBJH 5IK3A 3G5VA 1MW3A 3I6KB 3SE9L 2VMEA 4B9GA 5DS8A 3W0WE 4QLWA 4KZEL 4PRDA 1F11A 1LO0L 5EORL 2DQ6A 4HUUB 4BZ1H 3ESVF 2BNQB 1J1PH 2V5SA 4JFED 3TT1H 3CFKB 4FTVA 2VWEC 3KPQB 2NY2D 4JDZB 4GAGH 3FB7B 3WFHA 4P2RB 3MN8A 4RFNB 1KIPA 1OSPL 2E9GA 1QAWA 2JI3A 4PD4J 3PL6C 4FDWA 4YHIB 5DJ8A 3RWEB 4ZDHA 4F3FB 1M6UA 1S8DB 2OSLA 3GI9L 4FI7A 3NZHL 4LLVB 4FLRA 2JJTA 4N0UA 3AGVA 4BUHA 4JFDB 5PCYA 1ZY9A 4Y16D 5FB8B 4MHHI 4MVBC 4DP8X 2FYYA 5IQNA 4DGVL 3J27A 4O4YH 3WSQL 1KT2B 4QRPE 3C6SB 1RK7A 3HNVL 1ZLDA 3K8MA 1DBJH 2Y5TA 1OL0A 1T0MB 2GY7B 4MMZA 2VLMD 3BVDB 1C5CH 2ERJC 3D87B 3CCHB 2WV3A 4LXFA 3U1SH 1CE6A 1H15B 3RFZC 3JYBA 3D39B 1EO8H 4KU1A 4RFOL 4OV6F 3SE4A 4XWGH 1SEBA 4GMSH 3QORB 3GKWL 5LBSA 1V27A 4OGQC 4YSDA 3UTZB 2J8OA 2C3VB 1L7IL 4NKOB 3DHMA 4PV8A 4F7EA 4KZDH 4G8EB 1OQXA 3PWNB 4PJEB 2A9AA 5JHMA 2KPNA 1ETA1 2ZP0T 1K2DA 1CFSA 2D03H 4KVPA 3L5IA 4YQXH 5FDYA 1SHMA 3QXDA 2R9HC 4MJ6B 1CZ8L 4KUCD 4PJ6A 4HIEA 4NS0A 5E8EB 3X13B 1AIFB 4F80A 1KB5H 1HJBC 4BEIA 1AXTH 1X7QA 2LFGA 2ETWA 4AKOA 3V0EA 2EXWD 2Q10A 1VA9A 2J20A 3KJ6H 1WX2A 3MRKB 4LLDA 1QYGL 3UIYA 1FFTB 3T8MA 3PFUA 1D5ZA 2P48B 4GW5A 2ITCB 2D3JA 4ELMB 4OJCA 3SKOB 2XV3A 1EAQA 3VRLE 3MRNA 4Z7VE 3G9VA 4U1GC 1LM8V 2BRRL 4W1TA 5FKPB 1A3RL 4GI9A 3WIFB 4KY2A 4B5EA 2RFXB 1WVZA 4TKWA 3HN8A 1OCOB 2G5UA 3HI5L 1VZGA 3CC5A 2LAAA 4G6FB 4LSVL 2FNBA 3N2JA 4AT6B 4NN6C 5I66A 4JQVC 4L5FE 4U1SA 1N7ML 2VRQA 1RLBA 1CICD 3PWPE 2R1WA 4J27A 4G6FD 2M2DA 5IROA 2EUXA 1A4KB 1UJ3C 3BDXA 3UX9B 4MHHG 4NHCL 4DWHA 4QY8A 4FX5A 3QEQE 1ZVYA 4RISH 1QNIA 5GRUH 1B2YA 3EJSA 4APXB 1FNLA 1UH2A 2JE8A 4PY8I 3NABH 5GXBB 4KX9A 1AMXA 2DPKA 4WI0A 1MFAL 3JVGA 5TF1H 3CXHK 3GSNA 2EDDA 3LNDA 3O3EB 3S36X 1ORQA 3N42F 5IF0A 1A0QL 4I3SL 4LAQL 5EU5A 1FZOA 1XZ0B 3DRQB 3P73B 4FP8L 5FFOA 4JDVA 4YR6A 5KSUA 2VZ1A 4NUMA 3WG7B 3C09C 2EEBA 1NOAA 3ZX1A 5FCUH 3UJJL 3IS0X 3CZFA 4FHJA 1OSPH 4GBXA 1KYAA 4X4ME 3DKHA 3V95A 1NBVH 4XO9A 2TRYA 3DO4A 1DJSA 4ZFOA 3ZTDC 3DMMA 1F4YL 1YUKB 2NRDA 2UZPA 3G6DL 4MNQE 1E3XA 4G8GD 5TDNA 4AUUA 1SVCP 2H0JA 4LLWA 4QJ3B 4U1NB 3CZKA 1WCBA 3QI9B 5KYUB 4AVJA 1TTGA 5M94B 1OM9A 2F8VA 5C09E 1U91A 2ERJB 3S9DB 3IPFA 2ESVD 5DHDA 3TO4D 4FQCL 3DYOA 2BO0A 3SE3A 1PAZA 2F58H 2OMBA 3GI8H 4MDIB 2OR8A 1CI3M 1XL6A 4FXKB 1JPGA 3QIUA 4WJ5B 3V55A 1NSNH 3RDTB 2VIRA 3MRJB 5DUBB 3QDGD 2CGYA 4W9JC 1CLVA 1R5VB 2EDEA 4P6SA 4K9EL 1MFDL 1VESA 3CMGA 4GT0A 1QRNA 4TLKA 5FW6A 3K80A 4WLCA 2XOTA 4L4TE 3DPBB 5AEAA 2FD6H 1Q0YL 1NGQL 2MRYA 4HWZB 4OV5A 2OMXB 5DVKA 1L9QA 2R0KL 3K46A 2DW5A 3VFPB 4YGVA 4MJ4A 4Z7VF 4JFOB 4QHMB 4JUSA 1T1XA 4HDIB 1X5LA 5IW1B 3CVDA 2Z91A 3IMVA 3K8KA 1TQCB 1QWNA 2A2QT 1RERA 1NCCH 3NT0A 2P1YA 2Y23A 3L7EB 2GIMA 2VDLH 1U91B 3SOBH 2MOVA 1ID5I 1UXSA 3GWJA 3LZQA 1TZIB 3VXME 3S3BB 1P2CB 4AJVA 1OE3A 1YN7A 1NC4A 1OE2A 4PVBA 2X1OA 2YUVA 4NJAL 5HPMB 2ZF9A 1CVSC 1PZAA 4MJID 3ZOAA 4Y2DB 4IBWA 1CG9B 5LXGL 4YHZL 2DMKA 4WO4A 4W9CC 1IVTA 1BFOA 3HI1A 3RL1A 1BZDA 3KH4A 3QDHA 5D1ZB 5JOPE 2R15A 4NQEB 3RU8H 2HN7A 1ZAGA 1J05B 2DDQH 2QDWA 5EU5B 2EAEA 4W4NA 5J11C 1OWRM 2Q20A 4PJ9D 4IRZH 4R4NC 2VDLL 1O6VA 3WXWH 5JOFB 3LB6C 4HEME 3O8XB 2QQQA 4L9LB 4MJ6A 1OPGH 3DO7A 3HOGA 4ODUA 4HKXA 3IPEA 1FE8H 1B4JL 3FCSA 4GKSB 3PWNA 2WQAA 4TNVF 2JTDA 4YBLB 4HH9A 4EDWL 2VE6B 2G3ZA 2HRLA 3SDAD 4G9FD 3W37A 4AQ1C 1UKTA 3TBVA 3D4GA 5K5YA 4FQLL 5CZRA 3AABA 2HJFB 1K5NB 4IOFC 4RZKA 3DSFL 4JZNB 4FZ8H 2YBRA 4M5ZL 4ZOEA 2VLRE 5D70H 3DO7B 3DX1A 4PFEA 4QRBA 2AXWA 3UEQA 2WQUA 2YSTA 5I0YA 1S7UB 2J1KA 4I0CC 2ICWJ 1HAWA 1CDBA 3VI4F 3BIBX 3D2TA 2C9XA 4XHJD 5HDBF 3TT3L 1F6LL 1DE4B 1I3VA 2WO3B 1PD6A 5L88L 1XBDA 3KL3A 2V0AA 2VERN 1TCRB 1E42A 1W8OA 4KH9A 3WTUA 3C2AL 3SSGA 3DGDA 1UKSA 2XVLA 3GF8A 1T89C 1B6UA 3GSWB 3K6IA 1HWHB 4WHTA 4DH2A 3EHBC 43CAA 5FYLD 3K2KA 4TUOB 1IEAA 3TYGH 2OLDA 2ZXCA 5DZJA 2WKGA 3M86A 5KVDH 1A7RH 1E65A 3QIWA 2JXMB 4QRTB 4A6YL 1YEDB 3SDCD 1JK8B 1TZIA 1NJ9A 1S3KH 3NCYS 2WY3B 2WWKO 3OG4B 3TV3L 1NANI 2QL1A 4FJZA 4Z5RB 3OLGA 1EERB 3C5ZA 5I2IB 5EBMB 3VAEA 3OZKA 3PWLB 5JUEL 3FSWA 1BIIB 3NSJA 4NP9A 5A2IH 1HHKB 2XT1B 5D71L 1GR7A 3BWUF 2PO6A 5JQHC 4LSPH 4RRPM 3U36B 3C5JA 2FNWA 4DVBB 4PMFA 3JWNE 4XP9L 3N04A 4I8DA 3E2HC 2FUTA 4ZNCD 4TVSa 3UPAA 1CIDA 4D9RD 3CVHH 3L95A 4PJBA 3CDYA 2B4CC 3F7YB 4JRXB 2G60H 3GJEB 3IM1A 4NJ9L 3WIFA 4PLJC 3PGDA 1YEHL 3HMXL 4M6OL 2X4UA 1GXEA 3CFDA 4IMKC 4AGOA 1HZHH 2VDRH 1XF3B 2V7NB 5C2UB 5FGCE 1YNLH 4EKXA 1C5DB 12E8L 1IBBA 3O9WA 1KT2A 2DQIL 2GTWB 5D1QC 3RILA 5IJKC 1DJHA 1GMEA 2HX8A 2BCKB 4Y9EA 4UT6A 2PYFA 2MQGA 3N0PB 1HXMB 3D3VA 1ZXQA 2P5ED 5D1ZC 4M7KH 3VTTA 1KGUA 3VFWA 1K8IB 3QUZA 4NENA 1UJ3B 3U6RB 4JDVB 3O2DL 2JCCA 5FM8A 1X7QB 4YN3A 4GS7C 1JOIA 3W81A 1SEQH 3DX9B 2VC2L 3CU7A 3FH7A 3T5WA 3TH2T 2AXGB 4HWBH 2FATL 3LZPA 4ORGB 1C08B 5E8OB 5EOQL 3MOBL 2X44D 3QARA 4YNYA 4LVOC 4OFYA 1BAFH 3VRIB 1KGCD 3SDYH 2ZAGA 2WAQA 1PTZA 1AACA 3CK0H 4C56D 4AQEB 3GBDA 4XH2B 2BPBA 4I89A 4M3KB 4FXKC 4FL4C 4L0ZA 4NKOA 2Z1PA 4HPYH 3AWXA 1GYUA 3S2CA 3SEPA 4DZBA 2QKIC 4NP4H 4AVKA 4FYQA 3GHPA 1MW0A 2NZIA 3G5YA 4AEEA 2WBXA 4OLYL 3N1PC 3Q8CA 1BJ1J 4MLSA 1PZCA 1LNUB 1MHEB 2J1ZA 4JM2D 3C8HA 4AQAA 3JVFC 2W9DL 3B9KB 1UUNA 4LB8A 4OF3A 4NQDA 3W9DB 2QQNH 2AHKA 4WV1A 4ZXBB 1ND0A 2DKUA 5EIIB 4AVIA 4D3CH 2WAHA 5HYFA 3WLBA 4N0CD 2F15A 1CU4L 5HJBA 5I1IH 2JJSC 3H3KA 1OSZA 1OTTC 2CIKA 2X4NA 4HCRH 4WW2F 3ZR5A 5I1CL 3IB4A 4XMPH 2B3IA 4CVZB 3MNDA 5I19H 4U4IA 3AXLB 1G87A 2Y3AA 3IJYB 4LOFA 2DH2A 2XPYA 3FPYA 2V2TB 1TMCB 2R27A 4N2CA 4U6YB 1KBGL 5EZOL 1FZOB 2E59A 4X9HA 4WW2B 3UROR 3KXFB 4J6VA 4XVUD 3VWKB 5HYSA 2W9DH 2PMZA 4A7UA 4HC1H 4PV9B 1AZRA 5HI5D 4E5XA 3KPQA 5HYJA 1E30A 3K1KC 5E8NB 3ASNB 5EOTB 1YPZF 3VFOA 2GTZA 2MHAA 2WP3O 2J8UA 4PJEA 4WWKC 3TV3H 4ES8A 4IBVA 1XD0A 3SBRA 3FQYA 5DHVH 3G6JB 2BRRH 5MI0C 2Z7WA 4FFWD 5JXEA 1IGJA 3TNMB 2NXYB 1CN4A 3S3DB 3OR6B 2EEDA 4OLUH 4Y2DC 2P8MA 3OWRA 4Y2OB 4BGDA 1SBSH 1UB5A 5IM7B 1AE6H 1UFGA 3DMMC 5EUOA 5HHNA 1P7QB 4WO4D 2FJHB 3VFMB 4J2QA 1UACH 3MNVB 1BJ1H 4IKLA 4WWNA 4YHLH 1SLUA 3CUPB 5CP3H 3VD1A 1Z66A 5F6HI 3H9HB 2DKMA 3EF7A 5IVXF 5IP4A 5T1DL 2WXLA 1AZVA 1QBMH 2E4TA 3L3OA 3WN6A 3NCCB 2ZXBA 1EVUA 4NCC1 5E8DH 3ULVF 1MCLA 4N0UB 2QSTA 2Y2YA 2ADFH 3DX6A 4WI5A 2PWGA 3GZQA 1Y18B 3L9RA 5E1AA 3VXNB 4JN2B 5I0WA 1KXQE 1PIGA 4KO5A 1KZQA 4WUKH 2R69A 4XO5A 3S4SA 4YAQA 4Z7QE 1ZA3A 4J3BA 3SBQA 2A9NL 1BUGA 2NY4D 3AWFA 4K3DL 1ED3B 4PS3A 4QYAA 5AW9B 1AS8A 5JIHA 4U3XA 4HBCL 4QD2E 4WFFE 1YQVL 1W2KT 3FSVA 2XWCA 5B38G 3P2TA 4Y5XC 5DR5L 4RFEA 3F7VA 1FNFA 4HHAA 1UA7A 5IJKA 4PN6A 3ISRA 3SCMC 1GGCL 1JHTB 1ZA6A 2WHVA 2P47B 2VMCA 5JOEA 2ZP9A 3VFTB 1X4ZA 3RZCB 3CFEA 5EO9B 5I1DA 1L9SA 3ZRFC 4Z3JA 2X4RB 3LV3B 3B9KC 2H0EA 3VVWA 1X3DA 7FABL 5HGAB 1CTNA 3FUMA 4WEEA 3T09A 5JOPD 3NJLA 4IBUA 5B4MC 1MREL 4KTYA 1NL0H 3D39D 4ZYKB 4NP4L 2PW2B 2E7LA 3O2VL 4PJ8A 4KITB 3E9TA 4I48A 4PJAF 4WW1A 5J1SC 2WIMA 4NWUL 5DS2A 2BS71 2ESVE 2OJZL 2XNAB 3HZYA 1N64L 1R3IH 4KO7A 3QIWC 3L3OC 5KSBE 5F1OB 3VMPA 1QFHA 3UDWA 5FB8A 1EFQA 4NSKB 4G1MB 3EHBD 1WF5A 1S7XB 1XGPB 2IAAC 1DTUA 3DTUB 3MLYL 4RLDA 4OCYH 1K4DA 2ZNXA 2XG5B 3CLFL 4LSUL 3WJMA 1HAUA 1TSHA 3EFFA 3SGJA 1A4BA 1CGTA 1B0GB 4NJAH 5F7HA 5CILL 3V9EA 3OKLB 4YC2B 1KIPB 1HL9A 4R5XA 1FNGB 3HN3A 4M8QB 1U4FA 4PQXA 3CPLB 4TNVK 4H2AA 1G9EA 3MYZA 3KS0H 3I75B 4KKAD 4ZMAT 3FOLB 4F8LA 4ODXB 2ZX9A 4S1RH 1JXFA 5DJXB 3VFSA 3ARED 3IU3B 1ZXKA 4AXWB 1V3KA 5D2NA 5GS1C 4CMHB 4ZX6A 2BVEA 4Z3FA 2CBTA 4WI4A 4HMEA 3UBXB 3T4AB 1IEHA 1VFMA 3S36L 2UZXA 1CGVA 2IH9A 4WRLA 1B6DA 3HE7C 4WJKB 4AENA 4XI5D 4LDCA 4JDEB 4CVUA 1HINL 5A2JH 3KLSA 4OTXL 3BUYA 3C5SB 3OKNB 4UILH 3D7PA 1W15A 2WLLB 5B38B 1SFHA 4Q6IA 5IBTH 3VXOA 3RI5F 1OGTB 3EG9B 3MRPA 1QFWI 1JD7A 1GKEA 1K8DB 3QUML 2QKIB 3CFNA 1VPOH 1GYCA 3KCPB 2AQ1A 3RWIA 1TJGH 3PIQA 4I1PA 4U1KA 1PX3A 2FYVA 1IFGA 4RVBA 1A9BB 1RUKH 1E4WH 5A2CA 1MHHB 4S0TD 1F8TL 1PSKH 4HZ1A 1HKLH 2OYMA 3TL5A 3L4VA 3FB5B 5BJTB 1IBGL 2AKRA 4BRJA 1KCLA 2VDPH 3DUUB 5EBWA 4XBMA 1HCFX 2CO7A 3DVFA 3GEFA 1H3PH 2GFBB 4LSDA 4WJG3 3WL9B 2FEEL 4NM4L 3Q2LA 4DP4X 2ORBL 1O6SA 5CS7A 2O1AA 4AI7A 2GSGA 3OKYA 4NUGH 3QPXH 3P3UA 4N24A 4XP6L 1OTTD 5D7HA 3TWCH 3NPSC 3VNYA 4WTQA 1A6PA 4G8FA 1M4KA 5GS2D 1MKFA 3WIIL 3VI4A 2LU3A 4CSZA 4OCSL 5IFAL 4BIKA 4UQ9A 4NC2B 5GIRB 3Q6FA 3VACA 1ZGLA 3SKUD 1E4WL 1L4IA 1SMOA 2R7EA 2AV7B 3CQQA 3GSOB 1EFXA 3L3JB 5ICYB 2IH8A 1U58A 1IUZA 1JF1B 1RJLB 3K2IA 1NCDL 3ENEA 2XZQH 2KKQA 2B1HH 1EWHA 4QOKD 5T5FH 4GG6E 1V55B 1YZZA 2R83A 2VW4A 3MV7B 4LBEB 1WHPA 2GITB 3DPDA 3KR3H 2Q7NA 1G9ML 5CGYC 1INQA 1MEXH 3SJVB 3UTTD 1BT3A 2LFEA 1CFMA 4F9PA 1QLEL 1WFNA 1MLBA 3PHAA 1KCRL 1K85A 3IT8D 1FZKB 3N0AA 4IYKA 4OQTA 3SGKA 3FU3A 5CAYB 2XA8L 4ONHB 1AO7D 3LD8C 2DN7A 1XDTT 4NWUH 4C54A 5AVXB 3V4UH 2P80A 1CXEA 1S7VA 4P46B 3KPNA 3N85L 5I1GL 3K7UA 1UURA 1DVFA 3UTSD 5FYJD 2ZG3A 2FJGB 2NUTA 2X2JA 4FP8H 1EFXB 3L3JA 2MTPA 4GIOA 2B3RA 4OLVL 5ICYA 2WZPD 1YA5A 3B9AA 4G6AC 4UTAL 4PG9B 1EA9C 3GMNB 4DQAA 5GS2H 1QD0A 4LSUH 4JANA 5I9QC 2ZTBA 2WWMC 2VSCA 3E80A 3Q6FB 5I6KA 3P9LA 5GZOD 1MWAB 5G5DB 3KS0J 2EC8A 3VFNB 3GTTA 4DTGH 2MPAL 3CMOL 3IAPA 3BLBA 1S5HA 3L4TA 3MV8D 5IVNA 2E74C 4IMKA 5DLML 5EEZA 2JKSA 4CVXA 4Y16B 1MHCA 3E7JA 3K71B 3H4FA 1E27A 2IPTH 4NM8L 4HOWA 4HFWA 3K2MC 2F9BT 4M6AA 2A6KA 2R0WL 3BQUD 3GMQA 1MI5E 3OJMB 1P4IL 1U8HA 5DFVC 3POHA 3SGEI 2FWLB 4PTTA 2J2ZB 4ZMOA 4TNWF 1CFTA 1FLRL 5JPNA 3PHSA 4IRSC 1N10A 4HSCX 2W59A 1YN6A 2BIIA 4Z0BL 2AJYH 2FO8A 3IN0A 4KKCC 4J8RB 5BRZA 3WE6B 1ZT4B 1YNKH 3MRHB 5H35A 5KJRH 2NY0C 4R4BB 1UZ8B 4LBEA 3V0GA 4FQXA 1F3JA 4JFVA 1G7QA 4GG6F 2XFXB 3J7HA 3U4BL 3B7RL 3T3PE 4X6FA 2Q7YA 1CBVH 3WD5H 4S1QH 2EIZA 3GMMB 4UDUA 1GS7A 4G72B 4PG2C 4RSYA 3JV6B 2LTQC 2X4OA 3AMLA 1SYVB 2HFEA 4P5KB 4GSQA 2YOAA 5C0FA 5E56A 5IT2H 2R9HD 4B0MM 3BH4A 4NB7A 3MRIA 1I3RB 3MV9A 1NKRA 4NQXB 2EACA 1CYXA 3IFOA 3GNMH 1Z9SB 2Q86B 4PJ7B 4N2DA 3L08A 4QRRA 4R26L 3AVEA 4FTDA 1FNGA 1Q38A 4O2CA 3RVWC 4UNVA 4B0MB 1F42A 2DQCH 2K3TA 1O9ZA 3KL0A 1CMOA 4NI3A 2YPLA 4OVUA 2MCAA 5AB0A 4AYBA 4L1DA 1T80A 2WPGA 3KLAA 2VLJB 2YPVL 3ISWA 4G1MA 4XXWC 3IPBA 2OMTA 5DJAA 4QHNA 4FLHA 5EF0A 4HOMA 3A47A 3HPJB 3I02A 4Z9KB 2G75A 2HTLD 3KPMB 1VADB 2W8CA 1FH2A 2DTML 2CLRB 1KMGA 3UYPB 1WYJA 1P1VA 1CDHA 2BH0A 4G43B 4X9FA 4M1CD 3CQFA 5JPNB 3KPSD 5FDWA 4JAMB 4O2FB 3ZMNA 2AJVL 2WBJB 1VFBB 3IDIA 2OR9H 3DSNB 3WFBL 4XCNA 4ZNEA 3PGCB 5C86A 4QYOA 4KHTL 2XXFA 3X3GH 4J3RA 4HLZH 5JXAL 4UQEA 3ZBMA 1D7DA 3VI3B 3E6HA 1JGEA 5DQ9A 5D7LB 4PS4L 2CO4A 3IMRA 5A2KH 3HNTL 2H8PB 2HX7A 3ECUA 1SXSA 1N3NA 1DQQA 2XQYA 3N44F 1GIGH 2BP8A 2K7PA 5BVPH 2X6AA 1TQTA 2I27N 4OZHE 1GOFA 2CH8A 5FV2A 4O9HL 2AK4E 5TQ2L 3WDIA 7PCYA 3BEVA 4R4ND 2VDML 4FYSA 4UM9D 3H9YA 1LJMA 5I17B 5KYWA 1RP9A 2EDYA 3CFMA 3QUYD 4G71B 4KHXL 4NYLA 1XCXA 2H32B 3FSOA 3PNWB 1TEYA 5JPMB 5DMJB 1CK0L 1O5PA 1QABA 3NUKA 1FL6B 5DI8A 1OZTG 2XWBB 3TVMB 2P3XA 3ZZLA 4HU2A 4QLRA 5BO1H 4PJGA 3AU1B 3C08H 3FO0L 3LCYA 4NPJA 3G5ZA 2OX5A 5CJ8A 4B27A 4E41B 3U0PA 3NESA 1U8IA 1NAMH 1ZHLA 5CBEB 3GS7A 4G6AD 4XZ4A 2IPTL 4NM8H 5AOLA 2X89A 1A9BA 2DQDL 2QVMA 2AEOA 3D0AA 1M1XB 5KVMC 4Z7IA 3GLDA 3X3FL 3AADB 3MRCA 5H4YA 1G6RH 3TIDA 1AAJA 1TCMA 4M02A 4N9GB 3ZTNH 1WG3A 5E1HB 1MVUA 4Z95L 1S9YB 4ABVA 1J9RA 3RZCA 1HX0A 5EZJB 4MJIE 2J73A 4Y2OA 3BPNB 5SX4H 3U6XA 4O02A 1RZIA 2NPLX 4JG5A 4U1HB 3LRSA 3NTCH 2AI0H 3BAKA 1HEZA 1PG7X 2D7NA 3FQTB 3LRGA 5JLZA 4Q58C 1RZKL 2GHZA 4AUYA 4BE5A 1DQMH 3V79C 1HHIB 5IOKA 1F2XK 5L2JB 2ICES 3DURB 4XGZA 3BJLA 1HNGA 4M7KL 2V5RA 4MB4A 1J8HA 2GC4C 3RE0A 3V7AE 4URKA 3NGBB 5K9JH 5DEGB 1E43A 3QORD 3V4VL 4E9QA 1RZ7H 3L3GB 4OIIL 5I73C 4JN2A 3W11C 4DGYH 1DEDA 1YSOA 1PY9A 3ABGA 3PCYA 3ZKXC 5BNXD 4I7ZC 2NR6D 4G7YH 5KANG 3SGKC 4XPGH 4XC1L 4RMRA 3FT1A 1WTGT 1ZWIB 3LQMA 4ZPTA 5ICXB 4JFDD 4X6EA 4Z0XA 3D9AH 1PLGH 4UT9L 1F6FB 4E9WA 3OKKB 5K9OA 3QJVB 2KZKA 4EZJA 5J8OA 2V7HA 2C26A 3ZL4H 4AZ8A 4PJ8B 2BJMH 1ILUA 1FAIL 1OGAD 3QJFB 3T1FB 3H7LA 5ID1A 3N9GL 3MMEA 4U6VH 2X1WL 2GPZA 1K8DA 2GSMB 4XTRD 4AV0A 2JJUA 1DBMH 4OFVA 3SPVA 1ANUA 4LEEA 1D2OA 4WWOA 5F70A 2PYED 3TBTB 4XRCA 5DVNA 5F1SA 1CGWA 1RUKL 3RTQC 4DGYL 1NAKL 1PZ2A 4FL4B 4NQCD 3AQYA 1V3JA 1TMQA 1OD7A 3RUGE 4TSBH 1YEKH 3G6JA 1X7TA 5D2NB 2HVBA 3HVDA 5F7EL 5C0IB 3JZYA 3PXHA 1BGXH 1PLGL 4UT9H 3NQ5A 3MJ9A 4LHQB 2CMRH 1F3RB 3NQ0A 1A7QL 3B7UX 2WZ6A 5IESL 1ZTXE 3BW9A 4AEFA 3QDGE 1KTCA 2CWRA 4R84A 5MEQB 1YAZA 5IZ7A 1MCOL 4P5TC 1KTBA 4X8XA 5I8CA 1IAOA 3ET9F 1G7IB 4IRZA 4ZTOL 1QO3A 4PUBL 4U6YA 4KK6C 3CFJA 1N8OE 1JPSH 4XODA 1UQSA 2J4WL 1QR1B 3GJFH 4G8IA 2H1PH 1X9LA 4MAYD 3BFWA 4N2MA 1OWWA 2B20A 1L3NA 5L88H 4FI6A 3WYRA 1E5BA 2WXNA 4J6RH 4QWWD 1NCDH 3AWSA 2EXWC 4H4NA 4YH6A 2OMYB 1SMDA 1KTDB 3CDCA 4OI7A 2X4UB 3QH3A 4ZYKA 2W0FB 4DW2H 1E2WA 3KYKH 4I77L 2MMXA 2Y7QB 3GSRB 4JFFB 5HBBA 1T7YA 2R69L 3NDYE 1O7DE 1PAMA 1T66D 4KNUA 4Q74A 5AW0B 4DQOL 3GGWB 2HT4D 1HYSD 1E4XL 1GJUA 1E8YA 2V9RA 1P5VA 3PP3K 5IV2B 5JDSB 4A2HA 1DVSA 5CEZH 4GSDH 4Y5VA 2EO1A 1QLRA 2ZOUA 4MAYA 3V0HA 5INCB 3VXRB 2V3FA 1U8CB 4ZFGH 2HMID 2AF2A 3V9FA 2OK0L 2W65A 4AQ8C 4NQEE 3NTCL 1FJ1A 3NGBC 4P59H 2Z31A 4JPSA 4WQOA 4PP2A 3LVEA 1KENH 4ONFL 4JY4A 1Z7JA 1YEDA 3DOHA 4A6YB 4KAQH 3ECVA 3GJFB 5EWIH 3UFIA 2FVNA 1JBJA 1R3JB 5JW3H 2XN9A 1X6LA 2OXGB 1Z9MA 1IEAB 4BDVA 2KZWA 2PTUA 2IJ0C 5J9PA 4XBPB 1HCVA 3KPLB 4U1IA 4XBEH 3GSWA 5KN5A 1U92B 3HG1E 4JGMA 4D9QE 4FERA 2I9LA 2MOGA 3BUIA 2QGCA 3H9ZA 4KDTA 5EFIA 3DHUA 4KQ3H 3CUPA 1RH8A 2D7TL 2GI7A 5CJXA 3NJNA 1DJYA 4JLRB 3UBGA 4M6ML 3OTTA 1IFHH 1WSST 2EIDA 2HJKB 3DVNA 1UM4L 4L05A 4JKLA 4KJPC 3FO1B 4AYDC 2CJUH 3FN9A 1ZGLM 4NQCA 1RUPH 4JQIA 5JPMC 1P7BA 4NKDA 1FBIH 4OBSA 4DZBB 4Z7OB 3CBJB 3IBOA 1EEQA 3FRPG 2GBTA 4OD3L 4N5UA 3TNMA 1A2YA 3OKDA 1MJJB 1T1ZA 4X50A 5F96H 5DU7A 1IKNA 2AMUA 2WGNB 3BKMH 2TRHA 5EOTA 3VRIA 5HHQA 3PWJA 4IBYA 5GZOC 2HMIC 3BE1L 4ODVH 3CPUA 2J5WA 3S8FB 5DD6A 1EXUA 3TGXA 2Y06H 2AEQL 3DTXB 2AJYL 4LGRB 2D3LA 1SLVA 2XY2A 1HILB 2DQFB 2Y6TE 1PY0A 2X2HA 2F1AA 3QIWB 4MA7L 3ALPA 3FFCD 3WKML 2XX0A 1F45A 2YD2A 1T1WA 1HXMA 2G2NA 2P4AB 4OD3H 4U6XA 4FG0A 1PJ9A 1OSZB 2X4NB 4TXVB 1KTKE 2X4PA 3MACH 3OXSA 4GG6B 1ITBB 4OUUA 4N28A 3RURA 1ND0B 4B9JA 3QQDB 3I3EA 3GBEA 3FW6A 5A3IC 3II1A 3I2CH 4NC0B 1NC2D 3QSKB 3QBTB 4NRXB 2NYYC 1S7TA 4AQAB 5C92A 3DNKA 5HYQA 1JYXA 4GW4B 3C2AH 4WGVB 4OFQA 3IE4A 3WLWD 4XXCC 4IOIA 2OCJA 2BOLA 3JTTA 5IB2B 5SWSD 1A3ZA 2BY0A 3LIZA 1OALA 4GAYB 5ENWB 3A22A 1KJ2L 1ET7A 2FO1A 4FULA 3O6ML 1M7DB 5FHAL 2PO6B 3NFPB 4NWTL 5L2KD 2DLFH 4UIMA 2F54D 4M61B 5T33H 1BLNA 4LSSH 1JWUA 4Z3IA 1VGEL 1DCEA 1RJYA 3D50A 3HG1A 4D0DB 2VDPL 1BAGA 1WEJL 4ENED 2LE9A 1DBBH 2G0LA 4YDLC 5ELIA 2X70A 5DC4B 3DJRA 3Q9PA 5DJCA 1ZJAA 1NJ9B 1U41A 4OUOA 4WHYH 3WS6C 2ODHA 2QVTA 1DDHB 3OB8A 2YAPA 1PLCA 1UATA 4M4RB 2P5WD 1OGAA 5LN4A 2Y5EA 5GGQH 2BIMA 5C0BA 4RGMB 3ZDZF 5C6TH 1BEYL 1L6ZA 1N0LA 1MH5A 2O6EA 4Y1TA 35C8H 3M7OA 4TOYL 1QFUL 5ABAA 3TYFB 1KENL 4LCUA 4M1GL 7CGTA 4Q9RL 4FFZL 4NWTH 3P2BA 1MWOA 2BX5A 3HS0B 5E00A 2LLLA 1ZHNA 1OP3K 4KFZC 3DRQA 3E3QE 3HS8A 3P73A 1XF5B 4ZSOE 1QBML 3NQ1A 4XCYB 2LW3A 1OK8A 1RD6A 2ZCLH 2ZJSL 3GO1H 3WXVL 3GJEA 4P9ML 3RL2A 4YEEA 2YZ8A 4RESB 3QUXA 3WLWC 3MLTB 4XMKL 3E6FB 4BRVA 1RIHH 5BZDB 2EVGA 1HQRB 1VFAB 1EJOL 1JZIA 2A73B 3MJGX 5C6WH 1OQOA 2P52A 1U4EA 4OV5B 4JJOA 2PABA 4J3PA 2VR9A 1AC6A 5F97E 4UQDA 3Q2NA 2V9TA 3C5JB 4LCWB 2VE6A 4Y4HA 5E2VH 4AGLA 3HZMB 3TZVD 3HZKA 3TBBA 4WK0B 5KSAD 3JVGC 4ODSH 3AREC 4OLEA 4J12A 3F62A 2E0PA 3LHPH 3APMA 1DQDH 1X5JA 4Z5RA 3V4UL 1EMTH 1RL1A 3BLPX 3I6LE 2AITA 3T77B 3FRUA 4LIQH 5LCVL 3L4ZA 1SXCA 1CT8B 1U21A 3CDZB 1CIUA 1EZUA 2QELA 4XB3A 4AK1A 5D1ZA 4JQVA 4PR5B 2ZUTA 2F5AH 3B3IB 3QQ9C 2I9TA 1KTRL 3EYQD 1CG9A 4OD2A 4EZKA 2AANA 1I7RA 3L5WB 1U2CA 3QEHB 3U9PL 5E2WH 1FYTD 1D5ZB 2HKHH 3L3KB 4OT1L 3CWGA 2H6PA 3U4KA 5BRQA 5K59E 2KQMA 3Q8BA 5JZ7C 3REWB 3QZNA 5IIEA 4TV3A 3IDNB 4M8UA 4J3OD 1KCBA 5L2KE 1ZVSA 3GRWH 3V6FB 1X9RA 2CIIB 1HHGA 4HZLA 2EXYC 1G1KA 5F88A 4ZUVA 1OKEA 2Z91B 8CGTA 3APCA 3DUSA 5GRYA 4QAWA 2FIKA 2YPKA 4WHYG 4KJYA 4FA6A 3NFPA 4NN5B 4IEFA 1S7WB 3LEXA 2AJXH 1CDYA 3C6LB 4R4FH 1JDCA 1OAZH 1T4KB 4EI6B 1AGEA 1EAPB 4XNAA 4OLXH 5E08L 4AEHL 4NZRL 1GGIL 1YNTB 5FX3A 4HG4J 2N3JA 1ZV5A 2JQMA 1KACB 3VG9B 1YQ2A 4BQ6A 3ARDC 3O8XA 4L9LA 3GDBA 1TSRA 3SE8H 5I18H 2VT0A 1FIGL 2HLAB 1SJHB 4XVTL 2RFXA 3BE1H 1ADQL 3BAIA 1EJ6A 3X1BA 4OTXH 5GJTH 2DWDA 2X9ZA 2FB4H 1FL3A 5BZWA 5EFIB 5IVZA 2FAUA 1UENA 5TFSL 4H1LG 4HEPG 2YSSA 4NO0A 4MA7H 1HC1A 1RSYA 3F04A 1SF3A 4XBPA 1VPOL 1LP9E 1MUJA 4K94L 4HJ0D 4GLRI 3IJHB 4JFFE 5CJ5A 1RZ8A 2VR5A 2XN9B 3HS0C 3B3IA 1CYWA 5I30L 1WLHA 2J8HA 1O7DC 1HI6B 4JPVH 2MFNA 3MA7B 3ESMA 3US9A 4YR6B 1T2JA 4PAZA 1P4BH 4ZW5A 3QIBB 3WHE1 4TSBL 3NIGF 4CDHA 4E2OA 4TOYH 3BVWA 4AVHA 3SKJL 4MAYC 2IC2A 3HNSL 1TVHA 1HVXA 3M17B 4XPBL 1XH1A 3SDDD 3QEQA 1RIVL 3WFHB 3HPLB 4C59B 2W07A 5D2LE 2FB4L 4APXA 4FFYL 4AG4H 3K72A 5BOZG 1QLEB 4WNJA 1MCOH 4N26A 1C7SA 4APQD 2DYRB 3EFDH 2WNWA 5T1LA 4DW2L 3VXUB 4TNWK 3P40A 4NZFA 2XPZA 3JTSA 4HXBL 4Z7UB 2CXKA 3HG4A 3NAAH 4PRHD 4CU8A 3VSVA 3MV8B 3RDTA 2YGQA 1BVKB 1MCDA 4JJ5B 5D1XE 3V0IA 3CX2A 2XZCL 5E2VL 4JLRA 3UADA 1IC7L 3INUH 4MMZC 3QUXC 4PBXA 2PR9A 4F8OA 5MENA 1R33A 5DWUH 2I9LB 4K94C 3FYEB 3EJYD 4GB9A 3OQRA 3WOVA 1JWMA 5TDOB 1NAMB 1LILA 4G9FB 1T5WA 1Y1UA 4KGLA 2GJ6D 3SPGA 2IPUK 1PZUB 1N0LB 3BVVA 1RIUL 2FX7L 2WBWB 4NBZB 3HUJA 1SLXA 4Q8BA 5ABZA 1TQVA 3OHXB 1XD1A 4RMQA 3CFJB 1BW8A 1IKNC 2EQDA 2QHRL 4JVWA 1DJIA 1YG9A 3ARGB 3U9PH 5GGTA 5HJGA 2R0KH 4WO4C 3NMEA 4GUPA 2APVA 5GGVY 4F91B 4J23A 1XMEB 1S9KC 3A6BH 1WS7A 4G3YH 3FO0H 4JDZA 2RBLA 5CJOL 2O5ZL 3BSZL 4NZTH 4AGMA 4LESA 4LT7A 5JNYA 1J12A 4P23C 4HUUA 2NLJA 4MJIB 2VMFA 4E41E 5LQBL 2EILB 3FFCE 1XH0A 4JQIL 4UTAH 5DHXB 1N12A 3UTZA 4FFWC 2Y5QA 4KI5C 2XWJA 1PJWA 1RK0A 3C60A 4JPIA 4MNQB 4E5XG 5I66B 2CDEA 4WY7L 1CQKA 2E7LC 1E3ZA 2N1KA 3J2PA 4IJTA 3GGWA 3GZKA 3TLRA 1QSFD 2ATKA 2VERA 2VXUL 3D4YA 3KM2A 4Y1SA 3UTSA 4CN1A 5FUZL 4JO4L 3T6QC 4HJUA 3IDYB 2P80D 1UD2A 4XAWH 1C9SA 4A2MA 2ZAHA 2YN5A 5BVJB 1R5IA 4EIUA 1JPFB 1YNKL 1NICA 2VLKA 3EOBA 2Q9OA 1QKZH 4ILDA 4UAOB 5FIEA 1ZMYA 2CR3A 5BS0E 2VM3A 3CG8A 5FYLE 4LSTH 5E4AA 4OCMC 3HTLX 4ELMA 2ZWGA 1KLGA 1MFUA 5D7LE 5ISZA 1SOSA 3DVIA 5ESQA 5IY5B 4H8PA 4JRXE 5C07E 2BSTA 3NK3A 4BDVB 4OLWL 4YXHL 2OZ4H 3ZDWA 1AO7E 2IWKA 5GGSB 3EBGA 3WFDL 5K33A 4FNUA 2J3SA 5I1AB 3O3BB 1CDCA 3CIQA 1XEDA 3M6DA 3RWEA 1IO4C 3RQ3A 3RNKA 4GKLA 3BP6A 3I50L 2XN9E 1TJGL 4BSVB 1ORSA 5KZCD 2VO5A 5C7XL 3CSFA 4XP1H 1KZYA 2V8MA 2EO9A 4HQQH 4TVPH 5D70L 3P9WB 5E51A 2I26N 4NNXB 3H3BC 3VFRB 2AHLA 15C8H 1MJ7H 2V33A 1L9NA 3QXDB 3F58L 1CBVL 5D7IF 2EDKA 2VAJA 5HY9A 3BOVA 3S34H 3BCDA 3V4VA 4TMPA 4J3OF 2NNFA 4I9WD 5SWQB 5M95B 1T2QL 1COBA 4LHJB 4MDRA 3FUIA 3GYRA 1CYGA 1TLKA 1PD1A 2CHXA 2I60H 2LV4A 3BXNB 5IT2L 3QPXL 5CCJA 4ZOBA 4U6VL 3ZKXB 4YBQD 3BDYL 5EZJA 3QJSB 4I0PA 5FPIA 2AQNA 2BFVL 3B37A 4R3SA 3AXHA 2P46B 4XB7A 1U33A 5C0CB 1YYML 4ZMYA 1M57B 3MJWA 1CS6A 5EZIL 4MMZB 1QSFA 3QZLA 1X5KA 3MGOB 5D2LB 2K6YA 3TBWB 1UYWH 1DBAL 1Z1WA 1ACZA 4X98A 5B39G 5CMAA 3KPPB 2X12A 2Y2WA 3A24A 3VM7A 3S34L 3QDJA 4WU5A 5JO5A 3DTDA 4QHPA 4QOKE 1J8SA 2D3VA 5HD8D 4BSWB 3BGFC 1FZMA 5IJDC 2A9CA 1JZ6A 4LLVA 2NX5A 4OF0A 3L7FA 1YRKA 2GJ6A 3IFLH 4JY4B 2XWTB 3N43F 2W95A 3UBHA 3UO1H 3BIAX 4LARH 35C8L 3LRKA 4MCNA 3RWHA 5KVEH 2Y9WA 2R56L 3DROA 1U8NA 1A7OL 2KLRA 2W9EL 5HDRA 4TVPD 5H94B 2CK0H 5HVWA 1JHKH 1UM5H 3P2DA 3I9GL 4PW3A 4NRYB 5ITBL 1RIVH 2J6EL 1ADQA 4KJWC 4JCMA 2HSIA 4MAYB 1THCA 1OZUA 5I5JA 5BV7B 1NBZA 4XO4A 4P5TB 2AJ3A 5CZXC 1D5IH 3ZVVA 5FO2A 4XOBA 1J9QA 2XWZA 1QSEA 3LS5H 4HUCA 4PRDB 2WQSA 4M48H 1E67A 3Q3GB 1YNLL 1AXTL 3B2UD 2AABL 5FYJE 1JGLH 1VKXB 1BQHB 4XMKH 1AZZC 1BEYH 3PQYE 1JZ8A 4BFRA 4WO0A 3D3VE 5JHDD 4D87A 1J0KA 5EF1A 1ACYH 1JZEA 2BSDA 4GAAA 2DWYA 1QPKA 3FQ1A 1BYNA 2P24B 3NCBB 1Q94A 3QYNA 2DF3A 4V1DE 3W39A 4JB9L 2A1WH 1MRFH 5EZLA 2CDGB 2E8YA 4PY8J 3T0XA 1GS8A 2X2UA 1TTUA 4TM9A 2BZDA 5B39A 3Q1SL 3EFOB 1BFVH 3OLIA 4IMLA 4UM9B 4U2YA 3TFKD 3GIVA 4YO0A 4DP1X 3DBXB 1C5BL 5T3ZE 2VLJA 4KK9D 4LP8A 1BAFL 1G9MC 2DQDH 2Q3XA 2IEPA 4LSTL 3TXAA 1EHXA 3KWTA 2EDQA 4QTIH 2D3NA 5I8EA 1BOGB 2YPLB 1KEGL 1H8LA 3U6XS 3AM8C 2FR4A 2CDFB 1IAKA 1J8HE 1DQML 3KH3A 4M7ZC 3PNWA 3IXAA 3UTTE 2O5YH 3HE6B 5D7JA 5F7FA 2GCYA 4CA4A 4KUZH 4C4BA 1H9VA 4P9HL 4QRRB 1XGRB 1JWSA 4KDWA 2R2CA 2VDOB 2VXQH 1E5YA 1AD0B 4P3CL 2O26U 3MOAL 3GTNA 1I3RA 3KBEA 4PGCA 4PJFE 5K9JL 3I6LD 5CZKA 1HH6A 3NZHH 1II4E 5EEUA 3SQRA 4ZMXA 2HRHA 2OJEB 2HWZH 3JV6A 4JHUA 3LX9A 5CFAA 3OLDA 2YEVB 5JYLA 3V5DB 2N7SA 6PCYA 3O8XD 1T66C 3EJQA 3STLA 5KANI 4XC1H 4D9LL 1LE5A 3NN8A 4GQ9H 4WI9A 1Y07A 1JNLL 3MBWB 1MFMA 2ZSWA 2OMWB 1GZQA 5F7DB 5E9DB 5JIKA 2WXQA 3B9EA 4POUB 3KPTA 1GPOH 5FYKD 3WCYA 2Y1AA 1MCCA 3CLWA 4FQXD 1FNAA 1AD9B 4PWGA 5E6IB 5D1XC 1CDGA 1PKQB 5BXFB 1J0IA 4LRNL 3IMUA 4HW6A 2FZ3B 4X9IA 3TPUA 5EMYA 1CR9L 1JGVL 1ZK5A 5CINH 5B3SB 3SD2A 4HIIA 3QJTB 3OKKA 1CGYA 1A65A 3OF6D 4ODTH 1OE1A 3W0WA 3KNBB 1EGJH 2HLFC 5B1AB 3WNKA 3B6SA 2XU9A 3ZPDA 5I26A 3FU7B 2J2ZA 1IC4L 1QFWH 4RDQF 3L5JA 2CUIA 4GAGL 1P84K 3G5ZB 3S5LB 3U0PB 1WRFA 3SDAB 2WD0A 5TE4H 3MLWH 4G42B 4DCQB 1XIWD 2AJXL 3D12B 4B7LA 1M53A 3MNZA 1FAIH 2BJML 3ARFD 5D55A 3EOTH 5DI8B 4HFUH 3AROA 4Q9QL 1N6VA 2EIKB 2WOBA 5DRZA 3DBSA 3BP4A 3RGVD 2E27H 2VMJA 2WSDA 3D3VD 3F65A 3LN5A 1JZDC 5GGRA 1ET8A 1I1FB 3BAXA 1KCVL 5CD5D 5BMFH 5HHME 3D69A 3VCLA 1MSPA 4RGNC 2V37A 2EIMB 4PUBH 1AZNA 4J6IA 1VJSA 1U3HB 4NAMA 4UUJB 1P5UA 1JPSL 1ZLWK 1ZLUK 3REVB 1NBYA 1HOCA 4PRPA 5JHDE 1A6ZB 4DK5A 2W9EH 3W82A 1BPLB 1NGYA 5H37G 2C9SA 1UASA 2IDTA 3E6HB 5JW4Q 2EDNA 3GBMH 3FQ4A 3KPNB 4PJCA 1A7QH 1L0YA 5C08A 3EOAB 5DDHA 4N20A 2UX7A 1A1OB 2CRIA 5I1HH 3A67H 5J3HC 1A6AA 1PU0A 1RXLA 2ZUVA 3BQUB 4E9YA 5FDWB 2ORBH 1CURA 1EQWA 3D2UD 1RPUA 2W91A 3MLSL 3QUGA 4PRPD 2IANA 5EBGA 5BRZB 5EEYA 3MV7D 4MWFB 4B9FA 1OF0A 4C4UA 4NFBA 4PIBA 4QHKI 2FJFB 2A7BA 2E9JA 2OMTB 4MTMA 4ELKB 1QTYT 1A6AB 2Y7OA 3IDGA 4PJAA 4K7PX 5DEZA 4MZRA 1PG7L 4X7EC 4YZFF 1IAII 1D6VL 3SODB 1XAUA 2ICWI 3Q1SH 4H2CA 2A99A 1IARB 1TEFA 3FFOA 2W9LA 4EBQL 3QUYA 2VSKB 3UDWC 5I38A 3VD7A 4JJHA 4R9HA 1TU2B 4BV1A 5DK0A 4EJ1C 2BSSA 3NJHA 4P59L 3C5ZD 5C0BD 3WO4B 1A0QH 1AS6A 5E2TL 4KDVA 4JNXA 4C8XA 5AW4B 2XJKA 5IW6A 2A9DA 4L3ED 4PJ8C 2MNJB 4XMZA 3VX1A 3SQBA 4NERA 3SGDI 3KPSE 4PJHF 3P4OB 3TH3T 4N8UA 4NZ8A 1K3ZA 3F7QA 4P46C 5PAZA 3EJTA 1FSKC 2JI2A 4WV1C 4G8FB 1XGUA 5IREA 3H4HA 1Z3GL 2VNCA 3HLAA 3KVQA 5AW7B 3KLHC 2ROXA 2E6PA 1LYQA 5LUMA 2K78A 4HWBA 3HAEA 1CFBA 2CO7B 1R0AL 4P2OA 3FU5A 1HDMB 1ACYL 4D7BA 3CN0A 2BSRB 2CLVA 4PBDA 3PL6B 2JI1A 1E4JA 5DZVA 4AQ8A 4ZW3A 4UTBL 1RKRA 3QFJD 4OBRA 1T7ZA 1FC1A 1TTRA 4IDJL 4U0QB 4D0BB 3C5XA 4RGOH 1K9TA 3RVUC 1JV5B 1M71B 1QBBA 2ID5A 4P2RE 3LPWA 4E0RA 4LRNH 3GLEA 3QVAA 4IKNA 1OGTA 4U0RB 3M1BB 1Z3GH 3MFFB 1WS8A 1D9KB 2EE3A 4ATTA 4FQJL 4Z7QF 5E9DA 2IH3A 3A3YB 2APWA 2G5BB 1JZ5A 4BK5A 3TS8A 5HI3D 1S9VB 1IC4H 4JFDE 1KXTB 3BPCA 1HZKA 2DMGA 4LZKA 5DXWA 2UZXB 1OO2A 1HCYA 3T0WA 1E9PB 2HYMA 2VLJD 2R0WH 4GUCA 4WDIA 1AQMA 1JF6A 3WO3B 4EOWL 1A5FL 3AREB 2DWXA 5FUCC 3OWEA 2GJRA 4NNPH 5DGRA 2Z7ZA 3P9LB 5FCSH 5HPOA 3B83A 3AREA 2F5BH 5CZXD 4NT6B 1F1DA 1JMZA 4X42A 4A7GA 5J1TC 1XHHA 2VXTL 2Y9RT 3QCUH 4A63A 5D7JB 4PTUA 2ZYSA 3LTVA 3BH8A 1JZGA 4RBPK 1H19A 4N2FA 1NBCA 4OAWA 2YMXH 1HKLL 5FO9B 4KX7A 1K4DB 1T7WA 3T2NH 4P2YA 1GSMA 3IDXL 2PXYA 2RD0A 2H4EA 3HE7B 3NIDE 2ITFA 4LASL 4W9IC 4M8VA 4MNGB 1MCKA 1QSED 1RZFH 4PRNB 4AM0Q 4P3DA 4TRPL 3MU3A 4FYRA 4P57A 3DV6B 3AWTA 5IB1A 2ZUYA 5C2BL 4K3GA 4YPGB 4Z6AT 3BQUA 2Q8AL 1XL4A 1NM4A 3LXBA 4Y2NA 4JKPL 3SYQA 4ZI8A 4HS3B 1QSVA 2A6KB 2VR3A 1UYWL 1JP5A 3GLZA 4X80H 4XVSH 5DF0A 5JZ7D 1P7KB 4QCIB 3HB3B 2ZICA 1KB9J 5MERA 2WQRA 4M7JL 1P69B 2EDTA 4PJDB 1CTOA 1IGYA 3MR9A 3SDAC 4GRLD 1E0OB 1I1CA 3CN4A 3UBXA 4ODWA 5GS0D 4YE4L 3K6SB 3SB3A 5F6HJ 4YZWA 3BDYH 4LVHB 3WUWG 1OY3B 3S3JA 3F12A 1SRDA 3QRLA 4NRYA 1V3MA 5AZ2L 1CBJA 4W68A 1H3GA 4LHUB 4QHUA 4XWGL 3VI4B 4CKVX 5DUJA 1BBDL 1A64A 5GGUA 1KG0B 3GQFA 4LFHG 1G94A 3GKWH 4X7SH 5EC1B 2PYEE 2DZEA 1A7OH 3MRFA 3RB5A 3ULSA 3CLEH 1IAKB 1WWCA 4KVCL 3PJSB 2ISDA 3AW5A 4KPHH 2HT3D 3QEGL 4NN7C 1INEL 1TO5A 2QQNL 1CXIA 4X5WA 1IX2A 4JHWL 2CHWA 3RVUD 1G0YR 2YRPA 3T4YB 4LLMA 4EN2A 1MJ8L 4QKXB 2DJMA 2O6PA 1UXLA 3UTOA 1JFQL 3FT2A 1UH4A 4YO0B 1NGWA 2OK0H 1NFDA 3NRQA 3FRPA 1WC7B 1D6EA 2QR0A 3NIFE 3N40F 4IU2B 4I48B 4WW1B 5AZ2H 4RMWA 2IANB 2R56H 4F7TB 4PRID 1AO7B 3VSTA 3BKCL 2F8OA 1GCFA 1RP8A 3TIEA 5J4MA 1A9VA 5C0CA 4C55A 5HHNB 4AIZB 5AW6B 5HJDA 3CFCH 2CKBA 3B7SA 3VJ6B 3INOA 4AGQA 5CIPB 5ALCH 2X0UA 5F72S 4UMGA 1QW9A 4GP8B 4ZO9A 2ZKHH 2DBLH 3S37H 5DK3A 2YXMA 4HV8B 5D7KE 2XYCA 4OI8A 5IHZB 1IC7H 3KAAA 3BI9X 1KELH 4DP2X 3BKYH 3IS1X 2IG2L 1E6JL 5GSVA 3QO0B 3MBEC 2FECL 3L4XA 3R4DA 4ZO6A 3NCJH 2R1YB 1XEUA 4UT9A 3ZKND 4GAFB 1SYSA 1ZHKA 1DQIA 1OT1A 3FONA 1ETB1 2NZ1A 4Z3TA 2Z65C 4JZOB 1JRHI 1G9NC 4AGNA 5F3FA 2APXA 2UZIL 3P77B 3RX7A 2FX7H 2QZQA 2CJUL 3WGVB 5B7FA 1H3UA 4M8QA 3U2IA 4YFEA 3C12A 4FD0A 3MXVH 3SD5A 1MELA 1S78C 4QMEA 5ESAA 1OP3H 1SXAA 1F97A 1OIOA 1XSJA 3QQ3A 1RCYA 3L9EA 3QG7H 5DWPA 4DCQA 1TYJA 3AXLA 5T3XH 1ADWA 1YMHA 1IVLA 4M7LT 1NPUA 5JUEH 4NUQA 1YHPA 4HJEA 4JZJB 5D72H 3VSUA 2IALA 1KN4L 2PO6C 4JRYB 4N0YL 5DMKA 4IGBC 5DC9B 2E46A 4AJ0A 2Q76A 2V2XB 1F4AA 3WO4C 5CZVL 4PYHA 5DZOA 4P2OD 4G6KH 3ARGC 2ITDB 3CK0L 4S1SH 5GPRA 2WZ0A 1GZPB 3MGTA 2NYYD 1FC2D 1MHEA 3MRPB 4O02L 5F0LB 3ARXA 2QQKL 4J28A 4QAMB 2BIOA 2IOIA 5AAMA 5FUZH 3MRQA 3GBNH 2JB6A 4M43H 1PLBA 4R26H 4HJGA 1R6VA 1GC1H 2VLRA 4ZX4A 3HR5A 3MROA 1U95A 3NZ8B 4XX1E 5EIQA 4JKPH 4IM8A 3RVVD 4JGNA 5I0DA 3NIFF 2RR3A 1T3FA 3NZUA 1MCWW 3N6YA 1CFNB 5HYJB 4YVUA 2JNZA 3TNNA 4HFUL 3COOA 2EIBA 1LLAA 1FFNB 3VB8A 3GT6A 4Z7UE 3D25B 3US0A 2AEIT 4NZRH 2FT7A 2GCYB 1KBBA 1JVLA 2R51A 2VZTA 3LOWA 1FGNH 5I19L 2HKAA 1RK1B 2XPGB 4R96A 3S4SB 2CR0A 5FC9A 2IFGA 4R90H 4BBWA 4KK8D 3L1FA 5A1AA 3CNKA 3MCKB 4KXDA 1NIBA 2Y7NA 1K8IA 2XG5A 4X6CE 4YSPA 4MA1B 2ZOKA 2IADB 4JFEA 5CP7B 2VSDA 4FXLA 1PEZA 4MXWL 4LNRA 3QI9C 1QRKA 3GM0A 4WEMB 5ISZB 5D1XD 1BG1A 3JWDH 4FLOA 4LFHD 3P9MA 1C5DA 2E27L 2XNAA 3L81A 1IQDA 2M83A 1CXKA 2OL3H 4I3RL 4Y9FA 2W81C 4DKFL 3MCYA 4GJTB 3WUZA 3WENA 4ABQA 2CDGA 4N22A 3VWJC 3MVSA 3BD3A 4WF7A 3VU1A 1EK3A 1WZ1H 4WFFD 2PF6A 2VXVH 1GIGL 5BVPL 1CFQB 3KWVA 4GNKB 5AENA 3CFEB 1CGXA 4R3SB 5EO9A 4P5SA 3P3SA 5I1DB 2OSWA 3RAJL 3NOIA 2Y6SD 3QPQD 3W2DL 1T6VN 2XHNA 1I9RH 2PR4H 1LNLA 4Y4KA 2H26B 2CBOA 4DO4A 2ZOLB 4LF3B 2DWEB 2DDQL 2IWGA 4PS8A 4CBPA 2A6IB 3OC8A 3UC2A 3FZUD 4QHLB 1KIQB 1FDLL 5C3LD 1BM3H 5B3NA 2NY6D 4Y89A 4E9SA 1M7UA 4KOCA 1JGIA 4NNXA 3VFRA 4UILL 2AXGA 5FK9A 5D1QB 1WO2A 2GIYA 4BSVA 1EUTA 2OMZA 4KK9C 2CPCA 3VD3A 2ZWSA 3JWNG 4P2QD 5IHUL 1T89A 1ZE3C 5GGSA 1F1AA 1S7SB 3W0WD 3IJYA 3HUJB 4GXUM 3MUGA 4WKXA 4LLAA 3W2DH 4NRZB 1RZ8B 4DQOH 4K7FA 4RGMC 3MXVL 4A37A 1WZLA 4X4YB 5I76A 1UA6H 3X1EA 3ULUL 1SNRA 2IF7A 3QXAA 5KBPA 2HT4C 1U30A 4D94A 3FTZA 5EIIA 3UMNA 5L2KB 1XF3A 2EKSA 4D8OA 1GHFL 4B9PA 4OZIA 2IFFL 2PPDA 3NEXA 1A7NH 3WFZA 2DYPB 1AGFA 2XFGB 3OB0H 5JQ6H 5EUOB 1CLCA 1N2RA 2XVGA 4ADJA 3HMWH 3D4CA 3NJGA 3RDJA 4DEWA 1MDTA 5DJ6A 5HGDB 4AQZA 3T71A 1XGYH 4NKIL 3TYGL 4S1SL 4EN3B 2FGZA 5DD5L 4YEFA 4JB9H 3GXDA 3AFLA 3VXMD 1CFVL 4KAQL 3RWGA 4DVBA 1DVQA 2EUZA 2DQGH 3L3DB 4ZQKA 3FCTA 1JPST 4OKVB 1PYWB 3RP1A 3VXUD 4QJ5B 1V54B 2VJ0A 4KK8C 5EZPA 1DQJA 4RDBA 3NCJL 3FS9A 2VLME 4XT1C 5I1EL 4ZD3L 4N0FB 1KGXA 2ENQA 3JBG7 2Q3AA 2WC7A 4FMVA 3WHXB 5E94A 1YY9C 3DX9A 1TVHB 4NQVA 4F5CE 2NY5H 3GUTA 1GTFA 2D31B 2CIIA 3QCTL 4HZLB 3ZLQC 4F7PA 1R46A 1T21B 4OZ4A 4OB5L 2VN3A 3EH4B 5DSCB 3TO2A 3FUKA 2A74C 1ZKAA 2PYFB 4J6TA 3GXPA 4LL4A 2HVJB 5T3XL 1YY8B 5ESQB 5IFJA 3QP3A 4EUPG 2NY7L 1NGQH 1OEZW 4KRPC 2FHFA 3ULVD 2F74B 2XTJD 4NJ9H 3CHPA 4U2ZA 2HWZL 4HCGA 4NUPA 3HHSB 1URIA 4UI2A 4BA8A 4A39A 1NC4B 4S0HA 3WU1A 2OTWB 5F6IC 2YLKA 1CB4A 3T0ED 2B4CH 2QV2A 4G6KL 1AFVL 3L54A 5BVJA 3VYNA 1L9PA 4TPRL 3KPRA 5I0VA 1FFPA 2UVEA 2D9QB 1LD9B 4N85A 3V7AG 5LVEA 3GTVA 2PETA 4PGBB 4OCXL 1KPRB 2AGJH 3WJLC 4WW2C 4OB5H 4K94H 1TENA 1Y1DA 4OVVA 1MNUH 4HWZA 2VJ8A 5I15H 2FH6A 4ODHL 2NR6C 4KQ0A 1C8QA 2BHUA 5DJYB 1AQKL 3UAJA 5EUOE 5TH2B 4H25A 4JW3A 2ZCKH 4JRYD 1NPNA 4JX0A 2Z92A 1HHKA 4KJYB 4G83A 2FGWH 2R23B 4R7DB 3VXSD 2OXHA 1I7ZB 3E6FA 1JPGB 3RU8L 3HPLA 2XLLA 1OTSD 2GJPA 1CICC 3K5RA 4HWEH 5F88B 1QA9B 1BECA 3RKDC 2PPAA 2K7QA 3SKMA 4KI5D 1U8OB 4PJIF 5KSVA 5AZEH 1EO8L 5DJDA 2P5EA 3EJPA 2PUQT 3PLYA 3HS0A 7PAZA 3OHXA 5F89A 2Q2EB 4JEGB 2AGJL 3EJYC 1KXQA 3TASA 1YY8A 2AVGA 3PQYD 3RBGA 5IFJB 4UNUA 4OD2B 3C8DA 4Y5VC 2Q0ZX 1ZSHA 2EUWA 3ZYJA 3O9WB 3WV0A 2AXHA 4V1DD 1F86A 2P5EB 4MMYB 3MGAA 2J6EH 4ZS7H 4FZEH 3ZJAA 5FR3A 3FHQA 5KVFH 4E9LA 1LDPH 3TN0C 2B1AH 4QXGH 3KLKA 1WFUA 5I1CH 1N70A 3ARQA 3L3IA 3K2UH 1RLWA 3ZE0B 3PYCA 2HVKA 3ARFC 2ESVB 4I5BB 2C8NA 2P3YA 1YNTA 1WFTA 4GG8B 4OKDA 5EU4A 3VFGH 2EADA 4KKQA 5IOPB 5KYYB 3SPJA 3A6CH 3HMWL 4Y4FD 4NBXB 4Y19A 4GW1A 3QA3A 1IGML 5ITBH 3O6FA 5DD0H 1IC0A 3X12A 1WTLA 3K72B 1BIIA 3HBQA 3HFMH 3RY4A 2EYRA 2ZKMX 3SDXB 3QCVL 3GRBA 5EO1B 3EO9H 4CADA 4FG4A 4XO8A 3K3QA 1MFAH 4IS6B 2F53B 1GW6A 4XCEB 2NCMA 1WCBB 3QI9A 5KYUA 1UXWB 2R29A 2R29L 5MP6H 5CLYA 3AQZA 5AKTA 3P11H 4N68A 4FQHA 4KC3B 4HLJA 2GSIA 3HC0B 1ECZA 2VLRD 2BOBB 3PP3H 2DM4A 3CZUB 2ZWDA 1WZMA 4WFED 4TUKH 5B3JE 4R7XA 4NQCE 4KTEH 2Y1ZA 2VDNB 1NCJA 1Z5YD 3RNQA 4JO4H 3F85A 1ZV2A 4LLUA 1D3CA 1XSKA 2AK4B 2Z8VC 3GHBH 1IBZA 2FO4A 4X5QA 3NBNA 3CDZA 1E7UA 2G5RA 4QRPB 1U8OA 1OAQL 2BVPB 2VISB 4OLZH 2BM3A 3GUTB 4GKNB 3NIDF 5ACMA 1U8PB 3FU8A 3FT3A 4YUEH 5D1QA 5F7NC 4CADB 3T8XA 1NDMB 2DD8H 4HDIA 1BD2A 3DI3B 4ENEC 1NFDE 4EQ3A 2CO6B 4MB5A 5LBSH 4MCYA 4TULH 12E8H 2W60A 1PYWA 1OARH 5HSFA 1A4KA 2GUYA 2F19L 4F9LA 4PRBA 3EBIA 2OZ4L 4EI5C 4A68A 1ZVNA 3O4OC 4P0DA 2AJZA 4W9KC 5KSBF 4KHXH 4R2GC 3FCSB 4IBQA 1KPRA 3LZOA 3BPOB 5DD3H 3CC1A 1CFQA 1UZ6E 2YD7A 3RJDA 4H8UA 3SPCA 4FKEA 4Z8FL 1YUHB 3MRMB 5L9DH 2KZ1B 1NCCL 8FABB 4O51B 3UTQB 4YFLF 4LLWB 4U1NA 4WEBL 3TWYA 4UQBA 3ARRA 3SKOA 2ZWKA 3RL1B 1CUOA 4KGJA 1EX0A 4MJHA 2E9WA 1UWFA 3BKJL 1I7RB 3L5WA 1DSWA 4W4OC 2IV8A 3RIFF 3NACH 1NIFA 1QZ1A 3Q13A 4KKBC 4OCRH 4Y19E 4EIZC 5DMGC 2WSPA 3EYUH 3ARPA 3GLAA 4Z1PA 2E86A 4PRPE 3P69A 4DPBX 2O6CA 1AI1L 3BVUA 3L7EA 5EOQH 3BGMB 5FHAH 3LRLA 3GSNB 3LNHA 2EYSA 5TE4L 4L3AA 4HIEB 5E8EA 2AK4D 3BX7C 3WE1A 4WEUD 2XKNB 3HG1B 4G5ZH 3JYCA 4PJ8D 4OW6A 4D2NA 4D7PA 5HHQB 1B9KA 3LMJH 1R3KB 1E6OL 3O6FB 4PPTA 3F83A 3HZMA 4H25B 4MDJA 1J86A 2IAMC 3IFPA 3EF4A 3U1SL 5TFSH 3S88L 2Z35A 1B4RA 3H3PL 4AM0A 1T5XA 1F4WH 2V8LA 4L8BA 4G59C 1VGKA 4FZ8L 4GRLA 4X7TA 1MIMH 1DANT 2BWDA 4PEEA 3SY0B 3VE0B 4XPGL 3WD5L 2HG5A 2ITDA 3ZMRA 4TNFA 3NA9H 5F1IB 5FECB 5AYUH 1IGTA 2IOOA 4XMPL 3T2LA 3NH7H 1DL7L 1JGLL 3BWSA 4EAEA 5DFVD 1DSFH 4CMMB 2FL5B 3VFVA 1U8LA 4FC3E 4UYPA 4P2QB 5FOJA 4XZUA 4G8IB 5C0BB 2XXGA 1BYPA 3T3MB 4BINA 1NCHA 5HHXL 1G7PA 4MJ2A 5F8QC 3CAFA 2P8PA 2UXVA 5DRWA 1S5IH 4RNRA 4Z77A 4KXZH 4F7PB 1G1CA 2OMZB 1X5XA 2EO7A 3G9AB 1IV8A 2IWEA 2R8SL 4MA8H 2X70B 3VMNA 3WEMA 1NEZG 2EICA 2OXHB 1BJMA 3DI2B 1KYOK 4MQSB 1AP2A 5DMYA 3SY6A 5LCVH 3K2UL 4YL9A 5D93C 2GQHA 3QUMB 1F6AA 3OJ2C 4FFYA 3HG3A 2R1WB 1A2YB 3HA0A 1OVZA 3MLUH 1KCSH 5BV7L 2C3HA 1NLBH 2A4EA 5IB2A 1HNFA 3U2JA 3T2PA 1SFDA 2EUVA 1NGZA 1QRNE 4PRIB 2R0ZH 2BWQA 3GC3A 3GINA 4XN7A 4BWWA 5AW5B 1N2RB 1ZIBA 4EO5A 3U48A 5TF0A 4NLHA 5HHOB 3GSUB 4A2DA 1GZPA 4YDVB 5E9DE 4G80B 4RISL 2YFNA 3QORC 3HBGA 2ZXWB 1QLFA 2OZ4A 3ULUD 4MBOA 1FWXA 3WAKA 1HN1A 5K1JA 1M2OA 1DJZA 3Q06A 2AZAA 3U4EB 4HJJH 4XXDA 3EKCA 5EU3B 4ZSOB 1XZWA 4Z7UF 2EIEA 2FSDA 4YHPB 4H1LH 1G1YA 3DJZA 1QVOA 4OF6A 2BY3A 2ZOKB 1EEZB 5CP7A 3ZKNC 4L4TB 5F3HB 5D6CA 4S2SA 4OZ4B 5F9DC 3MTRA 4KTEL 5GS3A 3LN4A 3GMLB 3BZDA 4BSJA 5CWSA 4RDQG 1HH9B 2G2PA 1MFDH 1JSYA 4M62L 2FD6L 5CEZL 1E5ZA 1FORH 3LZFH 3QFJA 4XVJH 4OM1H 3HZ3A 2FATH 5ITFB 3MRGA 1NM9A 1N64H 2X89D 3FQTA 5JORB 4KX8A 3BD4A 3WSQH 2EDJA 2R2HB 1W8NA 1BHGA 1SPDA 4JHBA 4K9EC 4TTGA 1F11B 3QWOB 3TEWA 2ZWYA 3VXSB 4N2HA 3T2OA 2AJSL 1PBYA 2TSAA 2WCPA 4AEIL 4RA0C 3WNPA 4XRCB 1QFOA 2X1XR 4RWYH 5CF3A 3LAFA 1CE6B 1F58H 1H15A 2YQGA 4FHKA 5DEJA 4UOZA 3D08A 3SHSA 3BT2L 4NO2B 2JCCE 2CJ3A 3TIDB 2WINB 5IMLA 1T0MA 1YO4A 2W0FA 2WBJC 4B6ZA 2YMXL 1TO4A 3L1OH 5GRVK 4JRFA 4LK4A 2FSEB 5KTEH 1AKPA 5KBMA 5M7QA 3P9MB 3UZVA 4IU3B 1M3JA 4HYTB 4X6EB 3K1DA 2WXFA 15C8L 1MJ7L 2Z31C 1NGWB 1V3LA 1IBFA 3PAUA 4MB3A 1CJYA 4LNRB 4HJ0C 1TZOA 4LU5H 1Q9WB 1G4MA 4I4WB 4TLUA 2JH2A 1FFQA 1KB5L 1R3JA 1XR9A 4UU9B 3QQ3B 1IEBB 1E2ZA 3BH8B 5L7XH 1PW3A 4YDKH 2RGSA 5I8CB 2ZCKL 3IF1A 4BQCA 2BFGA 5FOBB 1QEXA 5B8CC 1QYGH 3OSKA 3HUJF 1KF9B 4P2RD 1F3DJ 4GEIA 2DIAA 5MEPA 4JZOA 4XN2A 4FQLH 2AQ3A 2E76C 2Z6FA 3EYSH 2H8PA 4DN3H 2P43B 2XG4B 4LPVA 3ILQD 3B9VA 4ODWB 2DWEA 4ODVL 1ZS8A 2WKLA 3D5OF 4X4XA 1BIHA 2VLRB 5CHNA 5FF6A 2R2EB 1RZIB 4G1EB 2F7RA 3MRQB 2VL5A 2NY5C 4PJ5A 1MVUB 3VFGL 3IDIB 4EVNA 3ML8A 4OY9A 1KJ2A 4QRRD 1E4KA 5KSAB 2C3GA 2PP9A 1LEKA 3L48A 4LARL 5SV3A 2OMYA 3SE4C 1F8TH 1UACL 1D9KC 3D0VA 4ZAKB 1IGFH 2BIQA 3TN0A 4XNUL 1VADA 5HYJE 1JFQH 4U3SA 1WXCA 1R17A 1IB5A 1NOLA 1TPXC 5CGTA 3A6BL 2LHAA 1SXNA 1G6RB 2PXYB 4O5LH 1D5BB 1RVFL 2R29H 2BNQE 1L7TH 2AQPA 4HOXA 2PTTB 3B2VL 2AV1B 4ZZFA 4K23L 3V4PB 4ISVA 2A38A 3ZY7A 2A83B 3NPYA 4H20H 3CFTA 3E8UL 5EEWA 3RRQA 5MEQA 4F15B 1IAIL 4KNTA 3PG2A 4GY4A 1UD5A 3EUDA 3QNFA 4LHUA 4ETQA 3L5XL 2NY1D 2ZXAA 2NXYD 2WB7A 5CCGE 2VOTA 3LPPA 3SE9H 4NO3B 1SYSB 1ZHKB 5JW3L 3T0EA 4YWGL 2OMNA 3UBXI 2A0LD 4XOCA 2BRQA 3I6GA 5IFHH 3APDA 5T8IA 3GSQA 4BK8A 1RUMH 1EPFA 4P07A 4JUTA 3OAYK 1SLWA 1F2QA 3VD9A 4ZTPH 1PQZA 1TQBB 5JIQA 2X6BA 2QPSA 2QDVA 4AIZA 3U79A 2UWEA 3OD3A 1Q9OA 3RWDB 4XPHH 2DQHL 4JAMA 3FAXA 4O2FA 3QJOA 3RGBA 2XN2A 1E9QA 4HKJA 1WFJA 1BQ5A 3QG6A 4P57B 3ABMB 1H3XA 4QO1B 2JWYA 2L4OA 1F58L 4HMDA 3VXPB 1KYDA 2E3VA 1EJFA 4JZJC 4OJYA 4PJ9A 3R06A 4MQ7A 3K4DA 4JM2C 4LRIC 5DJAB 2YD4A 3KWXA 2IDFA 1Q8MA 1WAEA 1JHLH 4PJGB 2KQNA 3HNVH 1FVDA 2WVVA 3EDJA 3IDXH 3RJOA 1OARL 4HFWB 1IIKA 1M42A 4ES9A 1WE5A 4X8JB 1G7JA 1MIEH 2NY5L 1V5JA 3CH1A 4GSRA 1LK2B 1KGCE 3IGUA 5K1VA 4PJ5E 1TNNA 4E68A 3UXFA 4XX1G 4JFWA 4KMQA 4QXTA 4IGBD 2J88L 4L29B 4BH8A 4GXVH 2NOYA 1U3HA 4I1RA 4UUJA 1UWGH 5T1MB 4DO6A 4DTGL 3IDMA 2BC4B 4NAQA 2KYIA 3EYUL 4V1DB 2BXYA 5L6YL 4L29A 4Z76B 1L7IH 4KZDL 4YZFE 2GTQA 2OMUA 5DK0B 1LK2A 3Q5TA 3JWOC 3OM3B 4LCYB 5IHZA 5KJRL 1KJMB 1UGNA 2FK9A 3VI3A 3OAZK 1NC4D 3L1GA 3LVTA 5GQBA 2B59B 4IHOA 4KKPA 3U0TB 1X5FA 5E6UB 4UV7L 1W0YT 4NKMA 4G42A 4HS3A 2Q8BH 1FQ9C 1WIPA 2OL3L 3PGCA 3MFFA 3UL4A 3QR2A 1SOKA 3DIDA 5JR1L 2N56A 1NCAL 2B77A 4YPGA 4MQTB 3ULUE 3S88H 4RX4A 2NX5E 1C12A 1LO4H 3ILEA 1ZLSH 2R59A 3U2SA 4F24A 1YEFH 3OPZH 1JD9A 4G82A 4FMFA 2NY2B 1BVNT 1D5XA 1RZ7L 2EDLA 3EGSA 1Q9KB 4OIIH 4B41A 2HUEA 5E6IA 5AD0A 4AJYV 3GMPA 4K7PY 2WIIA 3DIFA 2WLZA 5KOVC 1K3IA 4G2AA 1LWRA 2VUKA 2NW3A 1RZJC 4JO1L 4PJDE 4ONGL 3WTVA 1I1YB 2B59A 2QGEA 2AEQH 4IHOB 3V5KA 3TT3H 4DKDC 3KXFE 3ZYOA 3WY3A 4FKHA 1QSEE 1MZZA 4EDXA 3KYNB 3D0LB 5BS0B 3FN3A 5E5MB 5AOMA 5AOIA 5JIMA 1KXHA 2AV7A 2C5DC 2DV6A 2XVKA 3ETBF 5KVGE 1O0VA 2VM9A 4RFNC 4EN3D 3FTWA 3QRFM 3MV9B 4NQXA 2Z9TA 3N1GC 2NNCA 1OP5K 2XTSA 3SJVE 2BSCA 5AVZB 4PGCB 4LPUA 1X9UA 2K3HA 5C71A 3GKZA 1K4CB 3BAEL 4A6YH 4XNZC 2R4RL 4X9GA 1ADQH 1KCKA 2ZP8A 3CVHB 4KKAC 2JJSA 4AYEC 5IGXL 3AQDA 1DL7H 4JO5A 5GJSH 1NFKA 1F3JB 3VDBA 1J5DA 4ORZC 3SYPA 4IJ3B 2DAVA 1QI4A 2CPUA 5SWZA 1M56B 2R39A 1A7NL 4I3SH 4LIQE 1T03L 4Z7OF 1KYOJ 3HRPA 3R06B 1MY5A 4P4RB 3M8OH 5DA0B 5IB1B 1TLMA 4KKRA 2DQEL 3AB0B 4MMXB 4QRUA 5LWYH 4F7MB 4IRJD 2TAAA 1AE6L 2WKOF 2XI9A 2Z8WC 4GQRA 1ULVA 3ARBD 2R0ZL 3IGFA 1LEKB 3CSTA 3RWIB 2OL3A 4C47A 2WZ5A 5HDQH 1IRAY 4KROC 4PJFA 1LMKA 1QEWB 1TZGH 3JT2A 1PQZB 4HBCH 4YBHA 3IFNL 1BQHA 2XXMB 1IM3B 2H41A 3NEOA 4HSQA 1T1YB 3I6GB 4F5CA 2FWSA 3WELA 3ETBJ 3DECA 2Q86A 2FX8H 2IGFL 3CVCA 3REVA 1S9WA 4I77H 1PIFA 3JWDC 3NM8A 2YEZA 3SQBB 2VLKD 2RB8A 1GGTA 1S9WB 4L37A 4FXGB 2Q7AA 4NCDA 4PJ9C 4TNGA 2J56A 3HC4L 4F93B 4JK0D 3WNMA 3H9SE 4JR9H 5AAWC 1N18A 2YAFA 3IXAB 3KHQA 4M43L 4JL1A 3QUYB 4PGEB 3D30A 3DWTA 4XMWA 4YXKL 4X0KB 1G7MA 2K4WA 2WQVA 2WTRA 1XR9B 5D71H 4JPWH 4X99B 4JRYE 3B9KD 3SQOH 3TFBA 1SDAB 4RBPH 4H88H 4XMTA 3PDGA 3MLWL 4EI5D 1E28A 3QCTH 3FB5A 3UZEC 5LBVA 4E0RB 1R3LB 1Q9KA 3ORJA 2Z4TA 4PW4A 1CE1L 4HD9A 4Y0GA 3T0DA 4H26A 2XIIA 4TNEA 4WVRA 5AFAA 4P4RA 5ES4B 2YIHA 2CLVB 2EXYD 1WH0A 1VRSA 3UGEA 1TKWB 4AEHH 4JFXB 2HFFA 5DZ9A 4QT5A 1GY1A 4MXQD 4Y1AE 5I6PA 2WBJD 4HD7A 5C08B 2EYTB 2JELH 1JS4A 5FYKU 1OHZA 3Q5YA 4GEJA 1GRWA 1ZA6B 4Y16A 4LCYA 3QS3A 4WIQA 4WEBH 5IG7B 1G43A 1J0JA 3MRBA 4HGMA 1XCTB 2OV0A 2R2BA 3R1GL 1WZKA 1FH5H 1ML0A 3QHFH 4A7QA 4GS7B 4P5TA 3IAQA 1OM3H 1FYTB 4AYSA 4YQXL 4Z76A 3VFNA 5BUGA 3W6WA 1XB3A 1JXDA 3S37X 4HD4A 1DO6A 4KKLC 1A4JB 5AVWB 4LCIH 4BH8B 3FHEA 1X5AA 2VABA 5EDSA 3NACL 1TTCA 4PJXE 4D9RE 4YPJA 2BSSB 4IOSA 2IANE 1XGQA 4X6DF 1Z6JT 3QDMA 3WEOA 1YLBB 3EOYG 1A02N 1TQSA 2E4FA 3V4PA