3ZLQC

Bace2 xaperone complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-SECRETASE 2
publication title Beta-Secretase (Bace1) Inhibitors with High in Vivo Efficacy Suitable for Clinical Evaluation in Alzheimer'S Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 30
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zlqC00
3LZFL 4MJ2A 5BJTA 2G2RA 4NJAL 2EC9U 3BKJH 1TVHA 2YC1B 1MQKH 5F1IB 2NX5B 2JK5A 4N8CH 1ZK9A 2J2ZA 3D2UA 5HHQA 4TRPH 5KOVC 4U1LA 3SDDC 4HW6A 3UTTE 2IANB 4PJIB 1UWEL 4PJ5B 4XTRD 5E7FA 4UQ2A 2VH5H 3STBA 4PJCB 1MPAL 5I17A 3KLSA 3UC0L 2AERT 3QIBC 3KPPB 3PNWA 1ORSA 1UQSB 4PBXA 4M6AA 1U8MA 1T0NA 1DQQA 1EGJH 4KFZC 5FOBA 5HYQB 1I7UA 4DGYL 4XPFH 4M1DH 2UZIH 1DN2A 5GS1C 5CZKA 1JK8A 4PJ9D 4MWFA 3O3EA 4HIJB 2O5YL 2OSLB 2VC2L 1J1OL 3QUYD 4MJIE 4DW2H 2OQJA 4J12A 3CZFB 4LGPB 3SCMA 4HPOH 4NM8L 3PWLB 3VDAA 1AD9B 3ZDXE 1MCBA 2BNQE 3CLFL 3MREA 5GRUL 4GRLB 5EU7E 3IJSA 4J4PA 4KHXL 5DJCA 4BYHA 1ZGLB 4XCEB 4UOW0 2HFGL 2Y36L 4NRXB 4Y88A 3O3DB 3U4EB 4ZUSA 1R3JA 4Z7OE 5EB9A 3DVNB 3HZMA 5F6HJ 2BY3A 5K9KB 4M1CC 4MA1C 2BFVL 3A6OA 4TVPE 4RGNB 4XPHH 3SDAB 3QHTC 4NQED 3GRWH 1A6ZA 1QVOB 1ETZA 2DTMH 1T3FB 1MCDA 1IL1A 3SHSA 2PETA 2X4PA 1XAUA 3QIUD 2DLGA 5GGTA 1MFDH 4F9PC 4BFEA 2H8PA 1NC2B 2V7NB 1G0YR 5FF6B 4JR9H 2GSIA 1MCSA 4WENB 5CSGA 5HVWA 3KNBB 2KQNA 2VLLB 4JFYB 3V0VA 1MFNA 2VLMD 4LCYB 5GSVB 4RWYL 2ADFH 4F33A 3NFSH 4I0PC 2YXFA 4HIXH 4FQCL 5D1QC 4ZYKB 4OZGA 1IGFL 4WHTA 4NO3A 1U8JA 1IFHL 2DQCL 4JFEA 4Q9RL 4M7KH 1R5WA 5MEOB 2A83B 3OPZL 4G42A 3V5HA 5MHSD 1H3UA 4NCC1 5C0ND 1M7IB 1ZTXL 5C0IB 5I74B 1J18A 3HZYA 4NWTH 1CE6B 3FO9B 5EDXA 4XHJC 2VE6A 4PY7A 5C09B 4YHLH 3PWPB 2HT3C 1R5IA 5CS7A 4G7YL 3SE8H 1A6VH 4L4TD 4S1QH 2WIIB 4OFYA 1CTNA 4KROB 3VI4E 1FSKB 3I6GA 1MUJB 3GHBH 3NFNA 2PUQT 3BFOA 4QF1A 3LEVH 1FVCB 4PUBL 3LQMA 4WUUB 3VE0A 4NQCA 1FNEA 4G9DB 4HZLB 1RULH 1JPTH 4BJLA 4RAUA 1WICA 4HJGB 1BIHA 2DQHH 2I5YL 4RCAA 4DUWA 3CD4A 4PV9B 4OF6A 3UTQB 2VLJE 1WZ1L 1UM4L 4JFDA 2HJFA 3WSQH 1H5BB 4IRSC 3BGMB 2J12B 2Z31B 4JANA 1BWWA 3ZSSA 5ANMA 2Q87A 3UTSE 1PSKH 3GSWB 2H32H 3U30C 2AK4B 2ZG3A 4JDTL 1L6XA 5F7NC 4P4KA 4U1SB 4LCUA 3RA7H 1RIUL 3OHXA 2OR9L 2CK0L 2AABL 4W6XB 5I6XC 1T1YA 3QUXA 4H0GA 5ITBL 4R97C 4HK0A 5BS0D 1RU9L 1V7NL 2IC2A 3B3IB 5D96B 5B3JF 1A0QH 4YHZH 3B8YA 1Q0YL 2WP3O 4TOYL 1K9TA 4D2NA 3CPLA 2BJML 3PQYD 3VFGL 3OR7B 4NWUL 2EYRB 3CFKB 4LHQB 4XC1H 5JW4N 1TDQA 5JHLH 3R4DA 2BNRE 2BK8A 3B6SA 3DJ9A 3TPUA 2FWOA 5KOMC 5KSBE 4NO0A 2I9TB 3NTCH 1HH9B 2R29H 1QBLH 1LEGB 1UJ3A 2PXYA 4OD2B 5FECB 4P46D 3AVEA 3RPIB 1CLZL 1LDPL 1A9EB 1MH5A 4CVUA 4PGBA 3MLTA 3ZDZF 1IEAA 4DAGH 5KSUA 5L7XH 3QEGH 4UT7H 5DD0L 2ZCKL 3MO1A 4E5XA 1YEFL 4GMSL 4RRPG 5MEPA 5CBAB 5DYOA 2VDRL 3O8XC 1YY8B 2H2SC 3BRFA 3DO7B 2FEEL 2W0LA 4OCSL 1AR1D 3U6RA 4PRIA 3ETBF 1A4JB 1A6WH 3C5ZB 4XMLH 1T1XB 3BP7B 3WUWB 1ORQB 4KJQD 5F7UA 2BX5A 1KEMH 5IMLB 4JFFB 5F9WC 2OTPA 4WW1B 1IMHC 5HGDB 4HS3A 3ULVL 2ZZUT 4EI6A 2NW3B 3G9VA 4D0CA 1KEGH 1WITA 3IXTA 5T1MB 5HBBA 4LCWB 5FCSH 3SKMA 5I1LA 1JGUH 5B22A 1MWAH 4OZHF 3NA4A 3QDGD 5C0EB 5DK3A 5JA8B 1NBYA 1TTUA 1ZEAL 4K2UH 1ROWA 3LCYA 2VR4A 1PG7L 5I1KH 1WCQA 3ARGB 1F2XK 5EZLB 5ADPL 4ZOEA 3WFEH 15C8H 5D2LA 4XVSL 4PJDB 3D85D 1WVZA 1QNZL 2FYYB 5MERA 3O6ML 3QXDA 4LBEB 4HIIA 4ZFOA 2CGRL 3TN0B 1F6LL 4N9OB 4Z7VE 2FD6L 3FQNA 3MRIB 4FQLH 1CDCA 1FRGH 4FZEL 1C5DA 1U8NB 2AGJH 2VIRB 4U0RB 1OM3L 1CF8H 4X6CB 1CE1H 4PJFF 3VXUE 5CJBA 5GGVH 1MJUH 1N4XH 4TULL 2GK0A 4CJ1A 3BKCH 4YK4C 1CK0L 4MQ7A 1JJUA 1QPPA 4LOUC 5AWNL 2VLRE 3HMXH 4GXUN 4LHUD 1W8OA 1AC6A 3AREB 4QRTB 5JLZB 4MLSA 4EUPB 5KBNC 3X3GH 3L9RB 2CMRL 3IDXL 4MDIA 2YWZA 3SKJL 1OSZB 4ETQB 1BQHB 5F3BB 2J8UA 4Z7UA 2XZAH 4XWGL 3S5LB 3N1QC 4I0CC 4Y2DD 4HXAL 3D39E 3PWUA 3DIFB 3G6DL 3BHBB 4FXKB 5EFIA 5KVGH 1T04B 1EBPA 2WP3T 5KVFH 3LY6A 1D6EA 3E2HC 5CBEA 1BVLA 3DWTA 4KVNH 1WSST 1ZWIA 4ZNEE 1NBZB 1P4LB 5I1DA 3S37L 1IGJB 2V5SA 3VRLE 1IAII 3ARDC 5EUKA 4FTVB 1OOAA 3EDFA 4GXVH 2N1KA 3N1PC 4TVPL 3WBDA 3IFOB 3IGAA 1NLBH 4UOW1 1XZ0A 2W9EL 3S34L 2FGWL 2VITA 5E56A 1EDQA 2GAZA 5HPOA 4OZ4A 2X5PA 2WBJB 3B9KD 5EZIH 4XMPH 3T77A 3I02B 5CIPH 2GT9B 4M9PA 2JCCF 1JHKL 3SDCA 2QADD 3MV9E 4QHKJ 3TZVC 1X9QA 5GISH 1C08A 4XZUB 1S7TA 4G80A 1B4JH 1AIFB 2NXYD 4O5LH 1VFOA 4S0TD 5BV7H 1EHNA 2X4TA 4Y8AA 1SJEA 1F4WH 4R90H 5I2IA 3AU1B 1PFCA 3CGTA 1RZKL 4L9LC 5DJ6A 3RTQB 5ICZB 3P4OB 5FOJA 3RL2A 4B7IA 1A3RH 1AO7E 1ZSDB 4OIBA 1YNTB 5C07A 1AQKH 1WBXA 3KYKL 5DRNB 5T5FL 1WBYA 1W72H 2PR4H 3MOAL 4UBDC 1GZPB 3T0DA 3MRJB 4ODSL 4NBZB 2GTZB 2H2PC 5DUML 5IBUB 3BO8B 3OKDB 3GK8L 5A3ID 4LFHG 3LB6C 3GMPA 1WWWX 1DEEB 5HY9B 2YBRA 1YEEH 4I18B 2NPLX 1LP9A 2E9BA 4JZJA 4HQQH 1D6VH 1I1CA 2F5BH 3QDMB 2JB6B 1G6RH 2Z35A 1ES0A 4KI5C 5DEFB 2NZ9C 5EOCH 4N0CC 1N64H 3FQRB 5CHNA 3W9EA 2FZ3A 5CMAB 1TITA 3C6LD 3TFKC 4RSVA 3FT4B 3ZKMC 5ACLA 2VSDA 2Y6SD 1JGEA 5DHVH 3MNZA 3AB0B 5J7CC 2ORBH 1R5VB 4PRHE 3FQXB 1GGCH 3FQUA 3MA7A 4WFFE 2X4UB 2BMKB 4DFIA 3GFUA 3PHOB 2VAAA 4C57C 3KLAA 4HKJA 3FRUA 2YPLE 2JCCE 3W5NA 3AFLA 2E8YA 5F6IC 3SGDI 1FFPA 1JTTA 1KCUH 5IHBA 3QJFB 3BZEA 5CZXC 5EH1A 1MQ8A 3PABB 5FB8B 2WAHA 4ZUVB 4ZAKD 4D0BB 4LSVH 1BZ9B 3NAAH 5IMKA 2Q7YB 3U2SB 3BKJL 1ONQB 3MRGB 1RZ7H 2CQVA 4PRPE 5I1AB 4NC2B 4N8CL 1NCWL 3FB5A 5EU5B 1C8PA 1G0XA 1OGAE 3LEXA 4QT5A 5E1AB 5B4MC 2VR9A 3HE7B 1FYTB 2VH5L 3CDCA 2OMBA 1NGWA 4JM2A 4HH9B 4LNVA 1J8HD 2Y06L 2P48B 4E0RB 3WL9B 5TF0A 1EHLH 1EGJL 4GG8A 4ZD3L 1JGLL 3DX7A 3CVHH 4XPFL 3VFSA 4CVWA 1WZKA 2X7LA 1EAPA 3GJEB 4HUXB 4MJIB 4UAOC 2UZIL 4IJ3B 3OAYH 1KCSH 4UT6H 4L3EA 1LNUB 4GAGH 4DW2L 3CX5J 1EO8H 2BNQB 4HPOL 4AT6B 5FKAB 3W82A 4ZQKA 4MJ6A 5I15H 1X5IA 4OLYH 1XEDA 3AS0A 2GJZA 4JFOB 3G6JE 4QRRE 4D94A 1PYWB 3LV3A 4KKAD 3K80A 4JHWH 5DK0A 2J88H 3DPBA 1FBIH 2AI0L 2FBJH 2I9LA 5E8DL 4HWBA 5A2KH 4BZ2L 4XPHL 1XF5A 1Q9LB 3BOVA 3GRWL 2FB4H 2O5XH 3OR6B 1Z9LA 4OD3L 3GSNA 3VXNB 1KC5H 4EVNB 4OUOA 2GUOA 2UWEF 1X3DA 5JHDA 1TZHB 1MFDL 2XY1A 4R0LA 3Q6FA 3VFUA 3KPSD 4RGOL 3LN5A 4L8SA 4JR9L 5HYFA 4NKOA 4O2FB 5IM7A 2DKMA 2OBGA 4QOKB 4Q9BA 3GNMH 3MSPA 1CL7I 3OGCA 3FONB 4XB7A 5FYKU 2VB5A 2ADFL 4GBXC 1NMCC 4YXKL 2VLKD 3KYMA 4HIXL 4QTHA 2WZPD 4LSRL 4KXZH 2OX5A 3WFZA 4K3GA 2PTVA 1URLA 4HMDA 3Q5YA 3VRJB 5LKNA 4M7KL 4CMHB 2J3SA 1F00I 1TXKA 3VWJC 1IKNA 4K94H 4BZ1H 1BJ1H 3MUJA 4MCYA 4OM1H 3OG4B 4NWTL 3RNKA 4LLAA 2GEEA 2EXWC 3QDJE 3GMMB 3F5WA 3RZWA 1FLRH 2VRAA 3QUMH 1QZ1A 4XVUC 4S1QL 1CICC 5DJZB 2Q8BH 1I7ZB 3M07A 3GHBL 5EO1B 3LEVL 3H7BB 5H8DA 1PBYA 3BZDA 4WW2A 4AIZA 1TVBB 5I8CB 1OHQA 2V5RA 1ZT1A 2LE9A 3S36L 4KDVA 2DKUA 3O6LH 4WY7H 5EBLB 1RULL 2VLJB 5TDPB 4R9HA 3ROOA 3ILQD 1RUQH 3FMGH 3GMRB 3U82B 4N90E 4X5WA 4ORGA 4RFEA 3WSQL 5EOCJ 2FIKA 5D7JB 4KRPD 5J11B 1JV5A 5E94A 5BXFA 1R3HB 1OP3H 3LKRA 5BOZG 1EH9A 1PSKL 4Y1AE 1DDHB 3O41A 3U0WL 4U7KA 4KTYA 1P7QA 4H1LG 1QFOA 4OKVA 3RA7L 1MAJA 4LARH 2DLHA 2CUMA 2YPKA 1QSFA 2AQ1A 4KGLA 4YBLB 5C08D 1ADQH 5ALBH 2CD0A 4JRYA 4F15B 3L7FB 4JY6B 4O00A 1BD2B 3MRHA 4EI5A 1S9YB 3L3KA 4F7TA 1K5NA 4NN5B 3VXQA 2NY1B 2AEWA 4YHZL 3ARSA 5SV3A 4RGNC 5C0AA 3SDAC 2A0LC 1N3NB 2BNRB 1FZMA 4D3CL 3LPWA 4XC1L 5KSBB 5JHLL 4GKSB 4X8JB 1XGTA 1YECH 1BFVH 3RDTD 5FDWA 1I1AD 3NTCL 5ICXB 1H3VA 5GRVK 1QBLL 3KPOA 2OMNA 4Z0BH 2FLBT 1I4FA 5D70L 3PXJA 1FJ1A 3VD5A 3OKMB 5GRJH 3MXWH 3N50A 1JZ6A 4YPJA 4L8DA 4G6MH 5C71A 1X7QA 5D7IF 2YSSA 4DAGL 1S7SA 2NY6B 5L7XL 3QEGL 4UT7L 1XF3A 1IAKB 1NQBA 4LRIA 3ELAT 3BQUA 4WEUD 2C3XA 4LCIL 1DANT 2AP2A 2NXZB 4PD4K 2EO9A 1TTGA 4X8XA 5ICYB 1X5FA 2FEEI 2C4FU 1FNSH 1JFQH 3IT8D 1WWAX 5EU4B 4KJWC 5IVXF 3OG6B 3BUTA 3TA3A 3ARPA 1A6WL 4LLDB 5I74C 1AKJB 3D2UD 4HX1B 3EJYD 3GMLB 5D1ZB 3TBYB 3QSKB 2VUOA 1KEML 4O51A 3CJJA 5J06A 5HHMD 5LAXB 4CVXA 1S9XA 2BVOB 4OFPA 3RKDD 5C0BE 3GJFH 3CSGA 3W5MA 4AEHL 2DLIA 3REVA 3D18B 5C7XH 5CJ8A 1S7RB 3TO4A 1BFOB 4KROC 4PJBA 1KEGL 5HGGS 1FSKC 2ZUXA 3QNXB 1JGUL 3H9HA 4MZ3A 1FGVH 4FQHB 1DLHA 3TO2A 2OTWA 3V4PL 3SCMD 1HNFA 1J0YA 2YPVH 2XZQH 1RVFL 1HYSC 3O9WC 5ID0B 4J4PD 2HWZH 1TLKA 4UI2A 4Q9QH 5EO9A 1H5BC 5ID1A 1QEWA 1LO4H 4Z7VB 1KFAH 3RWEA 3T0AA 1J87A 2Z31C 3FO1A 4OFVA 4LPXA 2YUVA 1RK0B 3VFTA 5ISZA 4BSWB 3L5IA 4RFNB 3QDAA 3SQOH 1KV3A 4HGWA 1QYGH 1RZGB 2ZG2A 2AGJL 2PYEE 3B4NA 3VXUB 4H1LA 1IGTB 3QNZA 4P9HH 4GAYA 1YMMA 5BRZE 5T1DH 1BJ1J 3O6KH 2YD7A 4P5TB 5DXWA 4PB0H 3FHAA 3TVMB 5EIIA 3CC5A 3MUGB 3LRHA 3RUGF 1N4XL 4WJ5B 4WFHE 3BKCL 3GI8H 4XAWL 2FR4B 4NZJA 4ZSOA 1LK2B 4MQXC 2ZUWA 1MRDH 4HJ0D 3HC3H 4ALAH 5D96C 3FB8B 4MA8L 4HFWB 3S6CA 2WWMC 5F6HI 3X3GL 1AGCB 3DHJA 1NJ9A 5JPMA 1N26A 1DQJB 3L3DA 4KQ4H 2HA1A 4BH8A 1BIIB 3DRQB 1DCLA 2BC4A 3U79A 2Z91A 1U3JA 3D39B 2YZ8A 1KCKA 2XZAL 3RIFF 3NABH 2H32B 3NZ8B 5GS0D 5FHBH 4P5MB 5KVGL 4JFED 4X7SH 5KVFL 1UWGH 2A74B 4KVNL 1MJJB 4F7CA 5ENWA 5EZJB 4KZEH 3V6FA 1DE4A 1ZANH 3C9NA 4GXVL 1TFHA 2JJVA 5FA4B 1CBVH 1NLBL 2YXMA 4N1EA 1M7DA 3SDDA 3GB7B 3V4VH 1E6OH 1QTYT 3ARFA 2ZOKB 3GMOA 1BREA 4NSKA 2CDGA 1OAZH 1I9EA 4OIAA 1K85A 5EZIL 4XMPL 5IB1A 2FJHB 3T0XA 4P49A 4DGIL 1ZHNA 5GISL 5CGTA 5IFJB 5LG1A 4NC1C 3LKPA 1B4JL 1JYVA 3AY4C 3BD4A 5BV7L 3SDXF 3C5ZC 5TDNA 1CLOH 5E2UH 1SMOA 4NQCD 4GO6B 5GS1A 1JHLH 4BQ6A 5AD0A 3EHBD 5E2TH 5CJQH 4PG2C 3GSUB 4PJFB 5DJ8A 1AO7B 1E4KA 1U3HB 1FVDA 1JCKA 3ULSA 4OSUH 1HHGB 1KTKE 4G8IA 3ZDYF 5KSVB 1A3RL 3TT3H 1EEYB 2X1PA 3LKSA 5I9QB 1JNJA 4NO2A 4JFDD 3B9DA 1JWMA 1VEPA 1X5AA 1KIQA 2J6EA 1AQKL 2IH1A 3QCUL 4XBEL 5JOEA 1AGEB 5GGSA 4QNPF 1XH3A 1FNHA 1W72L 3FN0H 4RMVA 4EIGB 1RK1B 3D69A 4N68A 1LO3L 4JGJA 2AK1H 1ZS8A 1ZV5A 4KJPD 4JFXA 4JO3L 3GSOB 1GGBH 4ZOCA 1CDBA 1E4WL 3ZT5A 3HR5B 4P4KD 3QPQC 3R8BB 5C9KA 3VDCA 1MF2H 4HQQL 1D6VL 3ARGC 4TSAH 1QFHA 4X6FA 2F5BL 2H41A 3RP1A 2FH6A 1MCOL 3F8UB 1DLFL 1G6RL 4X6DE 3P2TA 2F53D 2CLZB 5DUBB 3W9DB 1CVRA 4JJ5B 5EOCL 1F4YH 3QUXD 4LEOB 1N64L 5F93C 3TN0C 3KYNA 3PWJB 1UXWB 3HRZA 4U0RC 2UZYB 3V7MA 4ZFFA 4FP8H 2XACC 4PRHB 3B9VA 3ZTNH 5LQBH 5GGUA 3BE1H 2VXQH 4Z7QE 5D5MF 3MRFA 2ORBL 2EYTA 1KN4H 3VFRB 1GGCL 4CVZA 2YPLB 2JCCB 1R3LA 3JUYA 4LLWB 5D1QA 2KBGA 3BWAB 2P8PA 4NO0D 2YA2A 4NYLB 5C0GA 2PXYD 5KANI 5C0FA 4ZFGH 2FSEA 3EYQD 4X7TB 1B9ZA 2YKLH 3AREC 5BW7A 3ZHDA 5HI3C 3O2VH 5SX4H 4I3RH 2ESVA 3DVFA 4PTTA 4JJHA 5DVNA 3KS0H 3L6FA 5CSBA 1HQRB 1IQWH 3NAAL 3T2NH 4GRMB 3O3BA 2VLME 4J3WA 5JPNB 1YNLH 3X13B 3EOYG 1UXSB 5TH2A 2I25N 1HI6A 1UM6H 5KANG 3PP3K 1OGAB 3F7VB 4LHJB 1MAMH 2GITB 3MLZL 1U93B 4ORZC 3VH8B 3IETB 4PRID 3G5VA 5EU6B 2AXGB 3F7RA 1WF5A 1CGSL 5MHSE 1HH6A 1FE8H 3AROA 3C60A 4I77H 4OLUH 1TZIA 4YHIB 5E8NA 3UZQA 3UPRA 5D71H 2QSQA 4IRJB 5LBSH 4LLVA 2R2HA 3O2DA 5IHZA 4HWZA 4LSTH 5DTFB 2WBJC 1KCSL 3CFCH 4UT6L 2EDRA 4GAGL 3UTPD 3DLQR 4PRNA 4CN1A 1HYRC 4L4TE 4IRSA 3O45B 4L8CB 4MS8C 3MFFA 5I15L 4OLYL 1YMHB 4QRRB 4MMZC 3IDIA 1U8PA 1KJ3L 3RTQC 3QCVH 1T0PB 3KYOA 1HWGB 1OB1A 3QZWB 4HIEA 1M1SA 1T5WB 4DKFH 4A6YH 4JHWL 2MJWA 4C54A 4B50A 2CO7B 2J88L 4ODVL 1CLYL 1FBIL 5H35B 3ZKND 3BXNB 4MAUH 5DJ2A 1AC0A 3IS0X 5C9JA 1L6ZA 5FM8A 3MTRA 5DRWA 2VKXA 2FB4L 4OJFH 2ZSVA 4M43H 1KC5L 2OJZH 5L2KA 4ODWB 4XNMB 5CIPB 4I18C 3U46B 2VZ3A 1T7VA 1NL0H 4G9FB 5BV7B 1FNLA 4NCDA 5TQ2H 4CN6A 5IB4B 3GNML 2BRRL 4NUGH 3ZE2E 3ZYJA 1VADA 3WIFB 3MJ7B 5HHNB 2NY4D 5BZDB 4RDQG 1BP3B 4LASH 2AJYL 4WHDA 3QI9A 5CAYB 2AJUH 1KCRH 2HJKA 3HMWL 4XMKH 3ECBB 5BS0E 2BSRA 3ULVC 3PL6A 3OWEA 1T89A 2EE3A 2A2QT 1MCWM 1YJDC 5EOTA 3AB0C 2NY0D 3PQYE 1NPUA 4K94L 3HNVH 1CFQA 4M93B 4BZ1L 1NCNA 4XB8A 3WIHA 5BVJB 1R24B 4PGZA 3CIQA 1EMTH 4HKBB 1A2YA 3BEWA 3D9AH 2VQ1B 3QDJB 2Y5TB 2G5BB 1S5HB 1IM9A 1TCRB 1ZT7A 4PJGF 1PDKA 4PJEA 4X7FC 3DXAA 4POYA 5SWSA 2OP4L 1HSBA 4M7LH 4Y89A 3WNLA 3MCG1 1FLRL 1G6RB 1S7UA 1A1OB 1A6TB 4JKPH 5DDHB 1YEHL 4KKLC 1PKQA 1F4AA 1S7XA 5IG7B 2Q8BL 1EJOH 4W4NA 4Y5VB 4AQ1B 5C0CA 2IQAB 3X3FH 3BRDA 1NCCH 1FG2A 3UYOD 2R69H 5JNYB 2E5EA 5D1XA 3SDCD 5I8EB 3TC9A 3SOBH 4WY7L 1XF1A 5C0DA 4XI5D 3HE7C 1BVZA 3HLAA 5INCA 2X1XR 1RUQL 2YRZA 3FMGL 3VW3H 1BJMA 4HS6B 2EE9A 5CILH 2ENYA 1KJ2B 3U7WH 3E3QE 2XTJD 4OAWA 2DM3A 4P3DA 4Y1AB 4IIQB 4OF7A 4IJ3C 1G7MB 4H25B 3MLWH 5C07D 1KNOB 1WAAF 1S5IH 3HTLX 4PJHE 4UUJB 4HUWA 5ECJE 3QO0B 1I7RB 2ATPA 4YAQA 1JPGA 2EDEA 5F88A 5I16B 4WDIB 5EU7C 3X14A 4EBQH 4XP4L 4QHKI 1Q9KB 3VRIA 5FYKH 4OBSA 4OV5B 3QDGE 5CP7B 1ADQL 1IGYA 5KVMC 5ALBL 3TH2T 1FZKB 3SGKC 3TH3T 3VXTB 4JFQA 5D7SH 1CU4L 2X4SB 5IBLD 5ESVA 4R2GD 1J5OH 1JHTA 2YR3A 4OZIE 4F7EB 3RZCB 3KS0J 3MACH 3VFVA 1MJ8H 4LPVA 2XA3A 2H1PH 5DHYA 1S9WB 1DZBA 3DETC 3QO1B 4UU9A 1M71A 3ROLA 2XKNB 3D0LA 3VWKA 1MLBA 5BQ7A 1TJIH 1YECL 4MA3A 4HPYH 4LNRA 4MD5A 3G9AB 4WU5A 5F7HA 1R3IH 2VABA 1U8LA 3HAEH 2OL3H 3CSBA 1RHHB 1NMAL 4Z0BL 4JFHE 2AVGA 2Q6WA 1LD9B 5J6GA 3MXWL 4G6ML 3QQ3B 2R2BB 1FV1B 5ETUA 4U6YA 1RZKC 1T5XB 5HHVL 3GKZA 4PLJC 5IR1B 1QFWL 1HHHA 5GHWH 4Y19B 3GSRB 4LSPH 1IBGH 1IE5A 2DQEH 3SDYH 1FNSL 1JFQL 4CMHC 3CFJB 4FN0A 3MRBA 3OKLA 1OVZA 2QKIB 3RWCB 3FZUD 2XTLA 1F45A 3SKOA 4N8VB 1K8DB 1QFWM 1T83A 1X5HA 4KTEH 5C0BB 3QEQA 1QUNA 4E41B 1VACA 4JM2D 1P4BL 2J8OA 3REWA 4ZTOH 3PWNA 4JRXA 2FL5B 1XCTA 5C7XL 1OY3B 1WJ3A 2ZCHL 4JHAL 5IW6B 2HG5B 2PNDA 4PJXF 3OXRA 3CDYA 4L9LA 1ZLWK 1JPSH 2APFA 1DVFA 3ARBB 3BVNB 2VDMH 1WBZA 2ARJQ 4L3ED 2R0ZL 1E28B 5KAQG 6CGTA 1P69B 1BOGB 5LCVH 1OP9A 5IP4A 4GRWF 4PP2A 1KUMA 2CKBA 2XZQL 5DMGC 4U7MA 3RVUD 2WANA 3KJ6H 3ME0A 2HWZL 4H88H 4Q9QL 4LRNH 3MLVL 4EN3B 5D7JC 1LO4L 3H9SA 4M7ZB 4WGVB 4XCFL 1KFAL 3C6SB 4ZO9A 5E1HB 5J11C 3K4AA 2K3TA 4WWKB 2C4XA 1YC8A 1P6AB 2HYMA 5D7IB 2NY7H 2NY2D 2HFFA 2V2XA 1G7IA 5GGRB 5BRZB 4U1IA 4P9HL 5E95B 5T1DL 3O6KL 4KK5D 4PB0L 3LQAH 4LFHD 4NKDB 5JHDD 3GI8L 3QWQB 4ZPVA 4F15C 1NFDF 4BFIB 1MRDL 4A2LA 3HC3L 4BKLB 4NN5C 1P6FA 3VCLA 1EFQA 2NY1C 4CU6A 4RMTA 5F7WC 3EYOA 1CLCA 2DWDA 4KQ4L 2P8LA 5SWQB 4QHMA 5DMKA 5DFWH 4M48L 2QEJA 2FECL 1N6VA 3FOLB 2CH8A 1LE5A 5FHBL 3S3PA 3LH2L 2PW1B 5KVEH 3RPKA 1UWGL 3BD5A 1MY7A 1P2CB 3GIZH 1ZANL 2GJ6A 5IKCA 3SGJA 3CCHA 4HAFA 4XC3H 5E08H 1TQBB 1NC4A 3CNKA 5E5MB 3DI3B 1E6OL 3DMMB 1JF6A 1AXSB 1EJ6A 5JQ6H 2F8XC 5A2IH 4O4YH 2NXZC 1OAZL 3TJEH 4ODXA 1AD0A 1N6UA 4KKBC 4JZOB 3V6OA 4H0HB 3JWDH 1NANH 1H0DA 3CU7A 2MNUA 5TF1L 4AQOA 3WO3B 4LLMB 1DBKH 3ZKQD 1CLOL 5E2UL 2CSPA 1JHLL 1VKXA 1N7ML 4RZCB 5E2TL 2MPAL 3WDJA 4YUEH 3TYFB 1JF1A 2XRAH 4OSUL 1PZUB 4RBPH 1QSVA 1NLDH 1T21A 3LKNB 2DQJH 4HXBH 1YEGH 1YN6A 3DX6B 4FQXA 3L5JA 2MKWA 4LLQB 1J8HE 2W9DH 1P84J 4JDVB 4KJYB 5C92A 3MXVH 3FN0L 1DR9A 2X1WL 1KPRA 4IDJH 4Y16B 1JTOA 2AK1L 4OGAD 1VFMA 3LQZB 3QUYB 3N85H 5CWSB 1N5YH 2EKSA 2VJXA 1GGBL 2CXGA 1P7QD 4U1KA 4U1HB 3VA2C 1A7BA 4NQSB 5KSAA 1MF2L 4TSAL 3BT2H 1EX0A 5B8CB 4P3CL 4S10A 4X6DB 4Y4HA 1BF2A 4XRCB 4KTDH 1QSFD 4ONHA 1AGBA 4M61A 4X4YA 4ZO6A 5BZWB 3V8CA 4E42B 4H8WH 2DL9A 5A16A 1H3TA 4JRYD 1FC2D 1F4YL 2GKIA 3D0VB 1JP5A 3QUKA 3LKQB 1GL4B 3HG1B 2E7HA 4JB9H 1PG7X 2F54A 3GJFB 2XPGA 2X2YA 3QT2A 2N4IA 4M3KB 4JQVA 5C0AD 1NEZB 3PWVB 3ZTNL 3V7AG 5LQBL 4G6JL 3BE1L 2VXQL 2FJFB 4K55A 1FFRA 4P5TC 1T22A 3BPOC 4PJ7A 3HI1A 3TVMC 3MQIA 3RWJA 2UUDK 2HVKB 3OKEB 5CGYD 3RY6A 3C5JA 5F9JB 2IPTL 4ZFGL 3BPNB 1T66C 3EYSH 3KPSE 3VMPA 3BKYH 4W4OA 1G7LB 3O2VL 2X40A 2FX7H 2IQ9H 4PGEB 5K9OB 4I3RL 3QWOB 5DA4A 1UG9A 4MNHB 1IQWL 4TTGA 2JJTA 1A5FH 4Q6IB 2YD8A 5DGQA 2IH3A 3TIEB 1PVHA 3BQUD 3ULUF 2VN7A 3DV4B 1SHMA 1UM6L 2VLKE 1XGUA 5HHPB 1MAML 3VI3E 4YHNA 3QH3A 4GW4B 1I3GH 3AXLA 1N5AA 3W39A 3TA3D 2YC1A 3MLUH 3RIAK 5F1IA 4RISH 4Z78B 2B4CH 3L3IB 3IDUA 4OLUL 5GSRB 2XQBL 1HIMH 2O5ZL 5D71L 3JV6A 2IANA 4KK8D 4PJIA 5LBSL 1C5BH 3IXAB 4LSTL 3LAFA 2OJEB 3CFCL 3SJVB 2AEIT 4L4TB 4EDXB 1UQSA 3TO4D 1KTLB 4L5FL 2PCPA 5HYQA 1A1MB 4NQDA 2R2CA 4AEIL 2X9WA 4AYFA 4C56A 4GG6F 3Q2CA 1A1NB 1V7ML 4GMTH 3BIAX 3C2AL 3LS4L 4HIJA 5D5MB 1U3HC 1DQTA 3DHMA 1INDH 3PWLA 4DKFL 1AD9A 5I9QC 4A6YL 5GRXG 4GRLA 4BH7B 4Z7WF 1ZGLA 4XCEA 4MD0B 5C3TA 4DTGL 1F97A 5ISZD 1NCAH 2VL5A 1G9NL 3O3DA 4OJFL 4M43L 1T7ZA 4PV8B 3DVNA 5GS0H 4NRZB 2OJZL 4MYWB 4GW5A 3WNPA 5HVFB 2VUYA 1OPGL 4XVTH 1YMMD 2H6PB 3HPJB 3LRSB 1U8IB 1IM3B 1NL0L 1VGEH 3HUJE 1QVOA 2HFTA 5TQ2L 3PV6B 3TP4A 4NUGL 5J1AB 5DEZA 1JGDA 2C7UB 3WE6B 3JTSB 1YQ2A 2EDQA 3O3AA 2EZ0D 3AMKA 1FVEA 4NQVB 5C08E 2F58H 5C0JA 4LASL 1NC2A 2AJUL 2V7NA 4XMKL 3U0PB 4XH2B 4KXZI 3T8XA 1PY4A 3CLEL 5HYJB 3KNBA 1JNHA 4P5KB 3GMNB 2Y7QB 2VLLA 3OJDA 3PQYB 1QRNB 4FMFA 1XIWA 4JFYA 2A38A 1HDMB 3U36B 2A6IA 5GSVA 4K23H 1I3RB 5LWYH 3HNVL 3HNTL 3BZ4B 1NGPH 4P2OA 1FFNA 4ZYKA 1EMTL 1EXUA 1YY9D 2M8XA 4CAGA 5L2JA 3D9AL 1U8HB 4PB9L 3L1OH 2VR5A 5MEOA 5I19H 4NDMB 2APXA 5EPMA 5DS8B 3WJLA 1M7IA 4WEMB 4LSDA 2APTA 2V5MA 4JKPL 5DHVA 3EOTL 5IIEB 5CUSH 3SDDD 1NKOA 1EJOL 2VDLL 2YD5A 1NCCL 4NOFA 5D72H 3UJTH 3QNYB 3GUTA 1K2DA 4KC3B 1AHWB 1SBBA 3QA3B 2R69L 5C09A 3C09B 5ADOL 3PWPA 1UB6B 3NCYP 2VDPH 1A21A 1SEBB 1TPXB 4P2QB 1F3JB 1FNGB 3PJSB 4LLUB 2APVA 3KYAA 2FATH 3ZO0A 1IKFH 4JZNB 1FVCA 4YIQB 1MY5A 5IEHB 5IHUH 1CFSB 1GZQB 1MIMH 5I1JH 3Q6GH 4UT9L 1FZOB 2YEZB 4LAQH 4IRJC 4G9DA 1J1PH 1RPQA 1ED3B 3EJJX 1J7VR 4PV9A 5HHME 5AEAA 3M1BB 3MLWL 1H3PH 1S5IL 3C08H 4HGMA 1EPFA 2P47B 4NO5B 4BSVA 3V0AC 4XCYA 1H5BA 3BGMA 2VNCA 4QTIH 5B39B 3TGXA 1T7YA 4OFKA 3QDGB 3VFWB 1HQ4B 3T4YA 4OFDA 1O7SA 3CVHA 3PIQB 1UC6A 3SQBA 2AK4A 5D7SL 1CG9A 3LSOB 4OZIB 4YQXL 5E99H 2DS4A 3EYFB 1T20A 2OXGA 2X41A 3TNMA 4YX2H 1MJ8L 3RWIA 2ICES 2H1PL 3UJIL 1I9JH 4M62L 1L9MA 4BQ9A 1K8IA 1TJIL 6FABL 5H2BB 2CK2A 3B3IA 1T1WB 1GOHA 4RWHA 4R4FH 1R3IL 5DVKA 2IALB 3OAYK 2V9RA 3STLA 2P8MA 3BP6B 4HV8B 2FDBP 2ZSWB 3CSYB 2IWGA 5BV7C 2NR6C 4MA7H 4RGMB 5KN5B 1F3RB 3DGGB 5D1QD 5GQBA 2IGFH 2RR3A 2ZOLA 1GAFL 5DEGA 3K8MA 1CFNA 1YYMH 3A6BH 1FZJA 4MAYC 2I26N 1N8ZB 4OCWH 1TCMA 1QFWI 1QKZH 1YPZF 3RI5F 4A6YB 1PX4A 1U8OB 2ESVD 3RPIA 43C9B 4K8RL 5GXBB 5IMMB 1FCCA 1UZ8B 2DQEL 1A9EA 1Q94B 1DANU 4KK6C 3M17A 4OGYH 3SDYL 5DFVC 5J89A 4ESKA 4ZXBA 1T1ZB 4ZUTA 5KG9B 3TNNB 3ARZA 4EDWH 4JO2L 4M93C 5E4EB 1TZGH 4G3YH 1ZHBA 1SQ2N 4YZFE 5FYJD 3FTGB 4OZGE 3WNMA 5CBAA 2OR8A 1Q9WA 2W65B 3DO7A 1Z9MA 4QHUB 4JFEE 4KTEL 1E4XH 1WK0A 1A4JA 4ZTOL 3C60D 4F9LC 4G43B 5HGBA 1ORQA 2BVPA 4HF5L 1HCVA 5TDOA 1CZ8H 3B8SA 4Y5VC 1GH7A 3KPRE 1JPSL 4HEPG 3TT1H 3UBXB 5F7EH 2VDML 5HGDA 3V8OA 4PTUB 5FGCB 2NW3A 4CKVX 1J0JA 5LCVL 3U9UB 5FO8B 5JXEA 1QR1B 4IRSD 4ZPTA 5T1MA 3MYJB 3FB7B 4JPIB 5IW1B 3KJ6L 2D7PA 5TE7H 5DUPH 2PW2B 3KDMB 3MR9B 4LRNL 5C0EA 8FABA 5D7LB 1A7PH 3NCCB 1HWHB 4NQCE 2FO4B 2NCMA 2RCSH 4FQ1H 3D5OF 3PGFH 4IIQC 4JO4H 3STZA 2EDTA 3TBWA 1G0DA 1JYNA 5DD6A 2NY7L 5J6HB 4JFDE 3MRNB 25C8H 4PJDA 3TBTB 3WXVH 4G7VH 3JTTB 3LKOB 2VDOL 3L3HA 2PYFA 3MRPA 3HCVB 2VXVL 3LQAL 5ANME 5L2KD 3P77B 3BGFB 1OAKH 4N5ED 1U8NA 3QP3A 2YK1H 5J0BA 1EHXA 1QBAA 4X4XB 4J1UB 2OK0H 3WFCH 4AMKH 1WQVT 1NGYB 3RZCC 1LO0H 2XA8H 1J0ZA 1EK3A 4JCLA 5FHAH 2P5EA 2WK2A 1P9MC 1W0VB 4J6RL 4UIMB 5DMYA 3C6LB 2IPKB 1U8KA 1IQDA 1RZJC 3QI9D 4WO4B 2VDQL 3AREA 3PL6D 2FECI 4KI5F 4XGZB 4BFBD 5I8OH 1C7TA 4XBGA 5KVEL 1OL0A 2Q1EA 4IMKC 1OSZA 3WJJC 4BELD 5AG8A 3VFMB 3K4DA 3S5LA 3LN4B 2FH8A 3H0TB 5HGHB 4XC3L 5FYJU 2CLVA 1S7VA 5E08L 1IT9H 1NAMA 3DIFA 4CNIB 1T04A 1LK3H 4ONGH 4M7JH 1IM9D 3VG9B 1SY6A 1X5GA 3DXAD 3FHQA 3ZL4L 5EZOL 5JQ6L 5SWSD 3I2CL 3IAGC 1UZ6E 4KQ3H 4O4YL 5EC2A 2BXZA 3TJEL 4FTVA 1N6QH 3IFOA 4L1HA 2IAMA 3JWDL 5C0CD 3IS1X 2DQIL 4I48A 1CXIA 4Y8DC 2BCKB 2JLLA 5DQ9B 4I5BB 5MEQB 2J8HA 2QQQA 5D1XD 4OGXH 2WBJA 4OCMC 4N9GA 4NFBA 1IZKA 4MDJB 5E6ZA 3I02A 1CFTA 4UTAH 2GT9A 4KDTC 5D6CA 3HAEB 5F7DA 5FO9A 2XRAL 4PRIE 1NLDL 2OM5A 4H0IA 1FORH 2DQJL 2X4OA 4KV5E 1YEGL 1J8HB 2A1WH 4IS6A 1KG0B 2ATKA 2XY2A 2VZUA 4NRYA 3G5XB 4XPBH 3AU1A 1P1ZA 3QXAA 3MXVL 3DTXA 3R06A 1ZVSB 2A77H 4IDJL 4XBPB 3ARBC 2AS5M 3KPQB 1ZSDA 3GZKA 1N5YL 4HAGA 4FQQA 3IDMA 5DRNA 3UTPE 3BT2L 3BDXA 4PGCA 4K94C 1MLCB 4KTDL 2W59A 2A6JA 3MRJA 2X09A 4NQEA 4H8WL 2YRPA 4EN3C 3BO8A 3O6FB 4NN6B 5L8JB 4M7ZC 1P7KA 3MRLA 3N9GH 1GYAA 1DEEA 1Z5LB 4X7DC 4WWKC 2BVYA 2CDFA 1ULVA 3QIUA 2V5YA 4WU7B 4G6AC 4XPTL 3IDGB 1BBJA 2FGZA 5E8EB 3UJJH 3RVWC 5D2LE 2JB6A 1NAKH 4XP1L 1MCJA 2Y4SA 1IZJA 1U2HA 3NH7L 1MFEH 5DEFA 2H45A 3QJHA 4WUKH 1NFKA 2NW2B 2X4QB 3MRDA 2Z8SA 1YC7A 4PFEA 5I18L 3RL1B 4IMLB 1XR9A 1EO5A 3VU2A 3EYSL 4YHKH 3DO3A 3BKYL 4OLZH 2DI9A 5ALCL 1R5VA 5T33L 3WUZA 1JF5A 2R9HC 5SX4I 1UYWH 1YEKL 2NTSP 4OUUB 3T1FA 1UACH 3S9DB 1ZOXA 4DWHA 2HTKC 4D0DB 4Z8FL 3F7PC 1IC5L 5HDQH 1I1YB 4PP1C 2R4RH 3QJFA 3PABA 5FB8A 1JZ4A 2WBWB 1JZ5A 4N8PA 3CDGA 4D0BA 1U92A 5EIVA 1BZ9A 3TH4T 4O2CB 3MCLH 3D3VD 5HI4C 1G7JA 2J8UE 1LMKA 4F7PB 5I1AA 3HZKA 4Z7UE 4RISL 5ESQB 5EU5A 5IMOB 1TQBC 2P44B 1HIML 1M4KA 3DMMC 3QEQD 9CGTA 1FYTA 3MZGB 1XCQB 4AY0A 1JYXA 1MFAL 2V2WB 4QY8A 4HWBH 4JRXD 4HH9A 1I9RL 4F57L 5CJOL 3BP4B 4HS8H 2O61B 1JWUA 4NZUH 1DSFL 1SJVA 1GRWA 1DVFD 3QUZB 4TSCL 3GJEA 4HUXA 5GGTL 5SWZB 5IV2B 1CD8A 1REIA 2BSSB 4XTRC 4GMTL 2I07A 2EXYC 5IK3B 3MJ9H 4HT1H 1INDL 4IDLA 1OGTB 4G8FB 4AT6A 4UBDD 3R8QA 2PF6A 1FAKT 1SJXA 3DROA 2H2PD 5EU3A 3TCLA 4KRPB 3H9SD 4AM0A 4GAJL 2Z8WC 1QO3B 4HFUH 4RMUA 2IFGA 4PJCF 4ZODA 2F74B 2QQNH 1FFOB 1NCAL 2XTJE 4X0KB 1D9KA 2N7BA 3BMVA 2EC8A 3MGOB 4Y16C 4XNYL 1KTDB 4P4RB 3QUYC 1UWXK 3RWGB 5GS0L 3T3PF 4LHUG 5C07E 5E5UB 3CFDB 3HUJB 3P4NB 4XVTL 4ZDHA 4KI5D 4QXGL 4N0CD 5B8CC 4ENED 1IGMH 3BH8B 1VGEL 1Q9LA 3T65B 1GC1H 1K6QH 3OAZH 1GGYA 3OR6A 5C08B 3IDJB 2N7AA 3VXNA 2P24B 2Q76A 1WTGT 4XXCA 2D0FA 4EVNA 5CEYB 1NDMB 1XGPA 2F58L 1TZHA 4TUJB 1PEZA 3MROA 3ZTJG 3EOBB 4ELMF 4Y5XA 1QFPA 4PS4H 5C8JB 1IC4H 3L95B 4QOKA 3ALXA 1OQOA 3NBNA 4JY4A 3EIFA 3MLXL 2R56H 5IT2H 5EN2B 4ZUUA 2GFBA 3U4BH 4K23L 1TNNA 3FO0L 1NGPL 3RDTB 2IPUG 4PREA 1UVQB 4ZUWA 2YD6A 5LGJB 4DGVL 3C8HA 3BZFB 1U9KA 3L1OL 2Z93A 3WEXA 4GG6B 2ADGA 3I3EA 5I19L 5EUOF 2R1XB 2GJ6D 4NHUB 5E6IB 4BZYA 3K2MC 1HZHL 1Y0LA 1NC4D 3Q0HA 1DBBH 5CUSL 2F9BT 3KPNA 4Q6IC 1K4CB 4NPYA 5B4MD 5AG9A 4U31A 3UJTL 4X4MA 5BJTB 5B38G 1G9MH 1IAOA 1PZ5B 2G2RB 3S96B 1KIRB 3GMMA 4XNUH 1HNGA 2VDPL 5ESAA 3TEUA 2CLRA 2LTQB 1I7TA 5EO0A 1TVHB 1I1RA 4P9HC 2FATL 1INEH 3D2UB 3H7BA 4U1LB 1OWRM 1JBJA 1TVBA 5I8CA 5L88H 5AZEH 1MIML 5I1JL 3Q6GL 5FGBC 1AI1H 4UQ2B 1CXEA 2A6KB 2JF1A 5TDPA 3ZT6A 1J1PL 2I60H 1INQA 1A9BA 4JN2A 4YDVA 4X80H 1B4RA 5IJKC 1H3PL 4FQXD 1U8MB 1T0NB 3C08L 1DQQB 1XGQA 2GSGA 3BW9A 1I7UB 5FOBB 3VGGA 5JW5B 1J05A 5D7JA 2X44D 4QTIL 5GZND 3TLRA 2OYPA 5CINH 1JK8B 3AS2A 2OQJB 2HFEA 1DDHA 1PJ9A 2CKNA 1I85C 5FEBA 2DJSA 4L3EE 4Q0XH 5HTSA 5KSAD 4ZS7H 3VD9A 4HWNA 2EDDA 4Y4HD 2PTUA 5DJCB 5E99L 2AJZB 3TCXA 4K3HA 5F9OL 3NIFF 4TNWF 3P0VH 4YX2L 2IF7A 4ZUSB 2DYPB 2R23A 1R3JB 1T2QH 3NFPB 1CQYA 3HZMB 3L7FA 4XNXL 3AM8C 1I9JL 1BD2A 3FFCA 4UV4H 1JI1A 2F54D 3I6KA 5IUSA 3QHZH 1NMBH 4R4FL 3VXSA 3EW3B 3PHQA 1MCCA 2D7TH 2DQTH 1IL1B 4GRWH 1N3NA 2X4PB 5FDYA 4MA7L 4U1JB 1JGVH 2IGFL 4PJAF 4V1DA 2H8PB 3A6BL 1YYML 3WO4B 3SE4A 5ICXA 5JHDE 4M6OH 4RAVA 2GSIB 1QKZL 1OAYH 1HXMB 3V0VB 5DD1H 1KPUA 5EBWA 1UEYA 3BGAA 35C8L 2ITDA 1CGUA 4F33B 5I30H 1U58A 3INUH 4EDWL 4XVJL 5HGAA 4UB0H 4OZGB 4G3YL 1M05B 4WHTB 3K7UA 1R6VA 2NYYC 4JFEB 1C1EH 3WFBH 1BPVA 1LHZA 4WI2A 1A6UL 3T3MF 4G42B 3MUY1 5IEKB 5F7MC 4KDWA 4I9WD 5EU4A 3FFDB 3KPTA 2NX5D 3HZYB 3JV4A 3DURB 3EYUL 4ZFOL 4POUB 3KPRB 5D1ZA 3GMLA 1ZLUK 2D03L 4M1GH 4UINH 2DMCA 2QHLA 3TBYA 4U6XA 2IAND 2VE6B 4N0FB 2D2OA 1W2KT 1X5JA 4IM8A 5LAXA 2IPUK 3TT1L 2BVOA 5F7EL 1AHWC 1AR1C 3C09C 4LKXB 4H1LH 4BK5A 5CEXB 1RSFA 1JI2A 1TPXC 3D18A 3C5SA 3MJGX 4QF1B 1S7RA 2ICWA 1HHKA 4LPYA 1X5LA 4JQXC 2HLAA 4NQDD 4OLVH 1XGYH 3QNXA 1YEJH 5IFAH 4C56D 3E3QC 4NQCB 3O81A 4KJQC 5TE7L 5DUPL 4R4NC 4FQHA 1A7PL 1G6VK 4QHNA 2RCSL 3CMOH 3LPFA 3PGFL 5DC4B 3IKKA 3NACL 4JO4L 4JFDB 3TWCH 1B88A 4GRLD 1IGIH 3H7LA 3L5XH 1G7HA 3P9WB 25C8L 4JVPA 4JANB 3S4SG 3WXVL 3MRCB 1YPZB 1YEIH 1KJVA 4G7VL 1CD1A 1FIEA 1RK0A 1MCHA 4Y4FA 4PGJA 4BSWA 1NKRA 2B1HH 1OAKL 1Q72L 1RUKH 3P0YL 5IVZA 4P4KB 4WFGD 5GJSH 1RUAL 2YK1L 4OLXH 3OHXB 3WFCL 4AMKL 4B53A 1MAKA 3I9GL 1AP2A 2V9QA 1QSFE 4P5TA 1LO0L 4GSDH 3E6HA 4JE4B 1T1YB 2Z92B 1C7SA 1EUTA 2YS4A 3F65A 1E6JH 3RWFA 4JRYE 1ZLSL 4HC1A 4FS0A 2BXYA 1BLNA 1NC2D 1VPOH 3UDWC 5FGSA 3FB8A 5EORH 4XP6H 5I8OL 4X98A 3CPLB 1XIWD 5J9PB 5C0AE 5J3HD 3NIDF 1H15A 1BIIA 3DRQA 3B6SB 4NZDA 4TNVF 4RGMC 3LEYH 4P2OD 3RX5A 1VFAA 4LF3A 4NNYB 4B7LA 4X6CF 1DBMH 2C3WA 4MGXA 1IT9L 2DIBA 4P5MA 3RBSA 1NH6A 3VH8G 2JJWA 4ONGL 4M7JL 4U4BA 2A74A 4OZHA 1UA6H 1MJJA 2J6EH 5SV4A 5IB5B 1UH4A 4KQ3L 1MH5B 4LEXH 3FKUS 3MLTB 2OL3A 4K7PY 3VD4A 1IEAB 2FCBA 1N6QL 2EDJA 1VFBB 3ZE1E 5HI5D 3MO1B 5FA4A 3BJLA 1NANI 3FB6B 1G9NC 1A7OH 3GB7A 5DO2C 5E4EC 5MEPB 2FX8H 5DYOB 4X5XB 4PD4J 5HHOA 2KZ1B 3GSQA 5C09D 3PWPD 2Z8RA 4DKAA 1WC7A 4Y7MA 5L8LB 4UTAL 5IW3A 1HHJA 4KROD 1B2WH 4TQEH 1RJLB 5IFJA 1FORL 1Z0NA 2A1WL 2ZUSA 4ZS6D 5HJ3B 1KB5A 3BDBA 4UDUA 5E2WH 5MP6H 4XPBL 5FYLD 3L5WB 3KG5A 4PJFA 1C12A 1U3HA 2A77L 4MVBD 1J0HA 3IVKB 4EEEA 4EI6B 3B9KC 1MFCL 4S1RH 4O58H 3F12A 4D0CB 3AGVA 3IXTB 2Z4QB 5HD8D 2ICEA 5I1LB 1HCFX 4PJBE 4K9EC 4LQ1A 5K9QG 2HMID 1NGXA 3WKML 3U4AA 3IFLH 5E03A 1RK1A 5E9DA 1NBYB 1QBBA 2IMMA 2AK4D 1F6AA 1FDLH 3HR5A 4JM4L 2C1PB 3QFJE 2MOVA 4C4KO 3NIDE 5D2LB 4L4VA 5MERB 1PD6A 5AZ2H 2BVUA 2EDNA 4PIRF 3UJJL 4HIIB 3LVEA 4ZFOB 3VXMB 3S4SA 4UDTA 1TJHH 3W9DA 1MFEL 4LEOA 3FQNB 5FYJH 1MFBH 5DR5H 5A3IC 5F71A 1NCBH 3BGFC 1RUPL 3QBTB 2Y07H 3M45A 1F4HA 1O5DT 2FBOJ 4NZTH 2Z9TA 1FNFA 2YUWA 4QWWD 1P7HL 2HRPH 5T3XD 1JUFA 1YMME 1R3KA 4HD9A 1V3LA 3VFRA 2GK0B 2JCCA 1UYWL 4MQ7B 4LLWA 2NY4B 2ZG1A 1MIEH 2YMXH 3DOSA 4NYLA 3O2DH 3MJ8A 3C6LC 2QR0A 1UACL 4ZSOE 3L3GB 4X7TA 2LU3A 4Z77A 2R4RL 4HCRA 5CD3B 4K07A 1RZFH 1HE7A 2Y6SC 3KJ4B 4Z0XB 1KT2A 2EDHA 1I9IL 2NY5L 5GZOD 4JPWL 4ZXBD 2J8UB 1HQRA 2ZUVA 4GRMA 4XX1G 3H6JA 3ULVF 3X13A 3MA9H 1Y6KR 4WFED 4KAQH 4Z18A 1I8MB 3PWUB 5EFIB 1ZA6A 1CDJA 4U05A 3C8KA 1OGAA 3F7VA 1D6EB 4UAOB 5CBEB 1QPXA 5SX5K 4L29A 2AEPH 3H3KA 3IKCB 1U93A 3VH8A 3VG9C 4GW1B 1Q8MA 3IETA 5EUKB 3M8OH 5EU6A 1IAIM 3S88H 1X5ZA 3IGAB 4HWBL 2BZDA 5F1OB 1XZ0B 4UQ3B 2KQMA 4YHIA 2VITB 4HS8L 5HVGB 3GSNL 2XZCL 4NZUL 4OZFG 4IRJA 1GHFH 3VMOA 3P4LA 3T77B 5DTFA 3SDCB 1FL6A 4QXWA 3RWHA 4JG0L 1C08B 2FX9H 2X70A 4K3EL 3Q5TA 5JXED 1S7TB 3N1FC 2X89A 4G80B 4N0YH 1SYVA 4HT1L 2X4TB 4PGDA 4K3JL 3O45A 3WKNA 2ITCA 1SJEB 3ARUA 3EYVA 5I2IB 4J3XA 5AUMA 1HOCA 5DJ6B 4HFUL 1MNUL 2XTJB 2IMNA 3FN9A 4OQTA 1YN7A 2VQUA 3RL2B 2I27N 2QQNL 5K59E 3QPQD 4MD4B 1PX3A 2OZ4H 2DLFH 2VXSH 3NZHH 4K8RC 4NJ9H 1WBYB 3AAZA 4P57A 1A6PA 2R2EA 4F2MB 3E0GA 3WIHH 3FQTB 1K6QL 2LVEA 3ZDXF 3ZHKA 1X6LA 2YBRB 3O6FC 4NN6C 1MHHA 2DLEA 4MXWH 1D7FA 4ODWA 4XNMA 4I2XA 4QRPA 3U46A 4KKAC 1I1AA 4R2GB 2DDQH 4HMEA 2GCYA 4G9FA 4HWUA 1DP0A 1IC4L 1ES0B 4RBPK 3VWJB 4Z7OF 2P5ED 4YDKH 2CJUH 5CHNB 3W9EB 3OL2A 2R56L 5IT2L 3QRFM 1XGRA 3HA0A 3MJ7A 5HHNA 1D5MB 3OJ2C 4C4KT 3ARED 1KENH 1R0AH 1RIVL 1N0XH 5DLMH 2RB8A 1JGEB 4NUJA 1OAXL 2BNUA 3MNZB 2DIAA 4KU1A 2RIKA 1BBDH 3MA7B 4TUOB 1CICB 2VAAB 2FHBA 3FRUB 4HKJB 1GGUA 3BSZH 4HKBA 4P3WA 4KUCF 1DBBL 1FFPB 1CDGA 2R4SL 2VQ1A 4OB5H 2Y5TA 1GSMA 1G9ML 3MLPA 3RVTC 1W8NA 2GY7B 2ADJA 4FTVD 4XNUL 3T0EA 4WWID 4LMQE 4F9LA 2IAMD 1OSPH 1INEL 4Y5VA 3FB5B 2IQAA 2XOTA 3LQAC 5IB2A 4C83A 2WBJD 1GXEA 5AZEL 4QT5B 5FUOH 1AI1L 4WEBH 5GRVL 4U49A 3JVGA 1CGTA 3BP5B 5M94B 4RX4A 1NGWB 4EJ1C 4JM2B 2I60L 5DMJB 1Z3GH 1I3UA 4PJ8A 4MS8D 1QBMH 2UWEA 3L7EA 4GG8B 3LHPH 2EIEA 4ELMB 3VFSB 1KJ2A 3DX8B 1EAPB 3EDJA 4OZFA 1CIUA 3QUZC 3IU3A 3VI4F 4C55A 1W0WB 4IIQA 4L3EB 3QPXL 2BHZA 3JWOH 1Q0XL 4UUJA 3IJYA 4Q0XL 1KLGB 4R8WL 3QO0A 1I7RA 3ILQC 1BMGA 4ZQKB 4MJ6B 4NKMA 1TNMA 4DOHE 4KRPC 3P0VL 5F9AC 1B90A 2BSED 3V0WH 5EUOB 4YBQD 1CXLA 3IF1B 1T2QL 4J3OC 3VXTA 5DK0B 1WLHA 3ILPA 2BOBA 2G5RA 2I9LB 1C16A 4F7EA 3RZCA 3QHZL 2DBJA 2DD8H 5D9SA 3ULUC 3JWDC 4K7FA 2DQDH 1CL7L 1ZLWH 1P9MA 2D7TL 1ZT4B 3TPKA 2DQTL 3GSNB 1VESA 5T1LB 4XXDA 3QFDB 1QSEB 3O4LA 3QO1A 3I85A 2DN7A 5JHDB 3L3JA 4R0LB 2DOCA 3VFUB 4HUUB 3TV3H 5L2KE 3RJQB 2W38A 1JWSA 3KLHD 3LN5B 4G6FD 1M6OA 4M6OL 4QGYA 4L8SB 3W81A 2R39A 3TBVB 4CW1B 5IROC 1KN2H 3DVGB 1OAYL 3NMEA 4QYOA 3I50H 5DD1L 5IVOA 1OP5H 2DMBA 3X11A 2L4OA 4HLZG 1SBSL 2BY1A 2R0WL 5I30L 1BZQK 3INUL 4QTHB 3MLYL 4Z7NE 5IR1A 5LXGL 2MMXA 4Y19A 3RDTC 3WFBL 2E6JA 4M6NH 3VFPA 2ADIA 2CKBH 2KPNA 5KSBF 3MRQB 1E4XI 1JNLL 1I8LC 4MCYB 4RNRA 3WLWD 2XICA 1RUMH 4H20H 1CXKA 4U6VH 4H8WC 5E6IC 4NCC2 3RNKB 1T4KB 1UKTA 4LKCA 3P9LA 5FV1L 2CIIA 3TIDB 5IESH 1FYTD 4PJEE 4JG1H 4E41A 1QFUH 3DXAE 5SWSE 3F7QA 4YE4H 3O9WB 2LTQC 3CUPA 1PKQE 2HG5A 2E9WA 4OLVL 4AIZB 1FLTX 1XGYL 4PG9B 1ZT1B 4XNQA 3EJYC 1KULA 1EHAA 2E7CA 4D9QD 4JEGB 3AS1A 3ROOB 5JOFA 3RKDC 3X12A 1OT1A 2CUIA 3MMEA 4PJAB 3G5YA 3TWCL 4ORGB 4RFEB 2ZUQC 1IGIL 3DYOA 3L5XL 5CJXA 5E94B 1TENA 1U2CA 5BXFB 3NCBB 2F53A 5EA0H 3LKRB 1D9KD 5K33A 5F44A 5CEZH 3O41B 1JN6A 3JZ7A 1JPFB 3V6BR 3BPLB 4LU5H 3H3BC 2AJXH 1PQZB 2B1HL 3OAUH 5D7IA 1RUKL 3HI5H 1P7QB 1GIGH 5F1SA 3A67L 5JZ7C 5LJYH 2IADB 4P0DA 5DURB 4J4PC 4X99B 4GSDL 3WXWH 2HTLD 2B1AL 1IVLA 4QRSA 5IVXA 4H5SA 2WIMA 1F90H 4BFIA 4EI5B 3L3KB 4F7TB 4GS7B 3VXQB 3B43A 5GGRY 2CPCA 4Z7VF 3H42H 4BKLA 3GHEH 4QOKD 1MELA 3LN9A 5C0AB 4XP6L 1JNNH 4AEEA 1FZMB 2DF3A 2VAJA 4K7PX 2HLFC 3AC0A 5JO5A 4FFWC 3B9EA 1BF8A 1XGTB 5SWQA 1ITCA 4Z9KB 1JVKA 2X05A 5FDWB 4ERSH 5ILTL 3WO4C 1DBML 3KPOB 1SYSB 3VGEA 1QA9B 3UTZB 4X6BA 4PRBB 1UA6L 4CL7A 1P2CA 2J6EL 2FJGA 4HJJH 3PDDA 1KJMA 2PN5A 4Q97A 3MBEA 1AXIB 2WUBH 5GRWA 4DN3H 5GJTH 1S7SB 4LGSB 1XF3B 5DJXA 5LVEA 3ZE0E 3KXFA 5L6YL 3MGTA 1A7OL 3DMMA 5D6DA 2FX8L 1I8KA 2D4FA 3O2WH 2E7BA 4G8GB 3BISA 3TA3B 1KLUB 1T2JA 2WQRA 2VDNH 3NCJH 3RWDA 3WD5L 1KBGH 2WMPA 4LLMA 5K93A 2UUDH 1AE6H 4ODHH 4U6HA 3VRLF 5FUZL 1MRFH 4O51B 5MP6L 5MENB 4U1GB 4RZCA 1RFDH 3KHOA 2BRQA 12E8H 3QEQE 1VCAA 4UTBH 3LKNA 1F3DH 4O58L 4S1RL 3REVB 3RUGA 3PDOA 2ZPKH 4PJBB 3DX6A 4JRXE 2AV1B 5D7JD 3CAFA 3H9HB 4KJYA 4RA0C 3SY0A 3IFLL 4G5ZL 1DQLH 2X42A 4Y16A 3TO2B 3T2QA 1TVDA 3EHBC 4ZOAA 2G60H 3QFJB 1P4IH 1NGQL 4GUPB 3HI6H 3QEHB 4WI8A 4N0UB 2H3NA 4NQSA 2MSPA 1CR9H 3BDYH 5F7LB 5CZVL 1SVCP 5EO9B 5AZ2L 4HWEH 1QEWB 3RWEB 4E42A 1OAQH 3FO1B 3OMZA 3EGSB 5I1CH 3H9SE 1ND0A 1TJHL 1MCQA 5IQ9B 1BD2D 3FFCD 3MV01 3LKQA 1RV6X 3HG1A 4LP5A 1MFBL 5DR5L 4KJPC 2DQFA 1GOFA 1NCBL 4MJ5A 4P4KC 4H1LB 3VXSD 2NY1D 3QNZB 4NZTL 3TJHC 1YMMB 2IBZX 5T1KB 3RIFK 3QIWA 1IC7L 1WISA 4O02H 4M02A 1HEZA 4NP4H 4OKDA 1ZGLP 1E4JA 4V1DD 3QUXC 1AJ7H 2HVKA 5JW4R 2YMXL 4NM4H 5F96H 3O2DL 1KF9B 3WHE0 5F9JA 2DIJA 3SDXA 1A64A 3V5DA 4JKMA 1NJ9B 4M6ML 5DGRA 1RZFL 4PGEA 5K9OA 3L3DB 3QWOA 4BH8B 1YUHA 4HG4K 3EO9L 4P59H 3IU4H 4MNHA 2BC4B 3V6ZB 2NY6D 2Z91B 4N5UA 4YHOL 3SBWA 2AJ3A 3TIEA 3MA9L 4KAQL 5HYSG 4YO0A 2NXZD 2PXYC 5IWLC 4F7CB 1RD6A 5ENWB 2AEPL 2XN9A 3HFMH 3N0PB 4MSWB 4KI1A 1DE4B 3M8OL 4DZBB 4PRAB 3S88L 4AIOA 4DZ8A 2R1WA 2CUHA 4I8DA 2GJ6E 5D1ZD 3PE9A 1EZVX 2F5AH 4HEME 3ARFB 1S9VB 1YZZA 1Z9SA 3GMOB 4KKNA 3MRRB 1A3LH 3MX0A 4JFPA 4NSKB 5E0QA 1P5UA 1VENA 5IB1B 2BY0A 1W0YT 4TTDD 3ES6B 2OJEA 3SJVA 1ZHNB 4IOFD 2Q20A 3UO1H 2FX9L 4HUVB 1U95A 4EDXA 3LKPB 4N0YL 3V6OE 2BDNH 1QLEL 2H26B 3QYCA 3ARQA 1QHOA 1G1YA 5DJ8B 1BAFH 4YPGA 1A1NA 1HKLH 3ARXA 4OCRH 2GI7A 4G8IB 1I85A 4OD1H 5D5MA 5AAMA 3LKSB 3GMQB 1NBVH 1KIQB 2DLFL 3QQ9C 5DZLA 2VXSL 3NZHL 5GGSB 3OTTA 4QRQA 4BH7A 5AAWA 3D69B 3WIHL 5DT1H 1ZS8B 4Y4FD 3U9PH 5B3NA 4UIKH 1HSAA 4JFXB 3HE6B 4U2ZA 2HKFH 1OWWA 4X6EB 3EFDH 2P5WA 4TPRH 4X6FB 3FN3A 2F19H 3CH1A 3K2UH 3HPJA 2V9TA 2YN3A 2DDQL 3LRSA 3G6JF 1IM3A 1BEYL 1IEBB 3S7GA 4P5TD 2WV3A 3ZKNC 1A7QL 3GI9L 4LCCB 4YGVA 2CJUL 4WVRA 5J1AA 2H9GB 2UY6A 3KYNB 3QHFL 5FYKD 3JTSA 4G8EB 1NUDA 2F15A 5BMFL 1KENL 1T66D 3HRZB 1R0AL 1EEUA 3T2PA 3U0PA 4XH2A 1N0XL 4ZFFB 2F54E 5DLML 3Q3GB 2DI8A 5GGUB 5HYJA 4P5KA 2Y7QA 3MRFB 1FFQA 1QRNA 3UYRH 4CVZB 1BBDL 1HDMA 1I3RA 1R3LB 4BFGA 5IJVB 3D39D 4M9OA 4PJ7E 1MQKL 3A6CH 3OXSA 5FYLH 2NY4C 3BSZL 5C0FB 1X4ZA 3UTTB 2FSEB 1AQDA 4TRPL 4OB5L 1X5XA 3D25A 7CGTA 1F3DJ 3NVQA 5GRYA 1UT9A 4KGJA 3L6FB 5DS8A 5DVMA 2C3GA 3KJ4C 4FQPA 2AEQH 3O3BB 2PKDA 1U41A 4YFEA 5IIEA 5TH2B 2NY0C 4DKEH 3TF7C 5F89B 1HI6B 3V9FA 5I0DA 5HHOD 4QXTA 3MV8E 3RJDA 5HYSA 3QNYA 4NQXA 4M1DL 4P23A 3W11C 3QA3A 1LILA 4WEBL 4HBCH 4M5YH 3G5VB 4Y4KA 4YGAB 4LIQH 4P2QA 2ZKHH 3CU1A 3UYPA 1Z3GL 4I9WE 1HH6B 3C60B 1CXFA 1QBML 1TZIB 4JZNA 3WDHA 1Y6MR 3GSXA 5E8NB 2VYRE 2EECA 3LHPL 3UPRB 4NQTA 1UB5A 1CFSA 5HDOA 3L3OA 1FZOA 2R2HB 5IHZB 4HWZB 1U3HD 1DFBH 1MPAH 2IANE 1ZHKA 2Y1VA 3BWUC 4PJIE 1X5KA 5H94A 3SKNA 5E8OA 1XF2B 1ED3A 3SDCC 4R7NA 4PRNB 1OTTD 4OLEA 3JWOL 5T3XH 5JORA 4DOHB 5DWUH 3P4MA 4P48A 5E70A 2X6MA 5C2BH 5E9DD 4F8TA 4NQDE 4KMQA 3IDIB 1HQ4A 1TIUA 2A9NH 1HKFA 1U8PB 2W0FB 2DTML 4C56E 2O5YH 2VC2H 3UAJC 2OTUA 2XTJC 3KYOB 1H3GA 3VDBA 1OB1B 1WIPA 1A4KA 2V2TB 2CXKA 4L4VD 2JELH 3MPCA 4KHXH 5DJ2B 1OLZA 4P2RA 5C9JB 5DRWB 3MJ9A 1K4DA 4PJGA 1YYLH 2ZSVB 4MXQD 2EICA 2JB5H 3NFSL 5FKPA 5H2BA 4JZJC 3TV3L 1QOKA 3KHQA 4WFGE 5IBLC 1CTOA 4R2GC 1VGKB 2JIXA 1KN2L 4P2YA 1KPVB 2W0KA 1OLLA 4ZFZA 2YPLD 3I50L 4OI7A 1VADB 3DGGA 3SPVA 3ARVA 1PLGH 3BIKA 5E7BA 1S78D 1O7VA 2LVCA 5MI0B 3QI9B 4X9BA 3WV0A 2BSRB 2HJLA 3PL6B 2XV6B 2BHYA 1MI5A 4J7RA 1N59A 2Y5EA 1U8OA 5GPRA 4M6NL 5IMMA 4RWYH 2CKBL 4YHLL 1Q94A 1QHPA 3V7AE 1J9CT 3SE8L 1A6VL 3TNNA 4YHPA 2KDGA 1PG7W 1WAAA 4MX7A 4FXLA 1RUML 4H20L 1YEDA 5AYQA 1OGAD 4YDJA 1IFHH 3BN3B 2DQCH 3OAZK 3DXAB 5IESL 4WI5A 1HSBB 4JGMA 5DVLA 1IRAY 5EU6D 1JPTL 4JG1L 1QFUL 1ZTXH 2DQHL 1S7UB 3NA9H 4YE4L 2OCFD 1PKQB 5AYUH 2J7LA 4QO1A 4G43A 4GLRH 4X7CC 3MV7E 4IRJD 1LE9A 3FZUC 4RQQB 1YQVH 2JJUA 2DTSA 3F7YA 4APQB 3UTSB 2BVTA 3OKNA 3UBXA 4F8QA 1HN1A 4WV1A 5C09E 1NUGA 2VN4A 3PWPE 2X89D 1WWBX 3HLAB 5JW3H 2ZJSH 4JM2C 2A73A 3WNNA 1QR1A 2HAZA 4PUBH 3S97C 3QEUA 1ZHLB 2PW2A 3KDMA 4OAWB 5D7LA 4P3DB 2DQGH 4NBXB 3BAEH 3BUYB 5FK9B 3WHE1 4MXVE 5EA0L 5FYLE 4X4ZA 4D9LH 4EUPH 1MJ7H 3UEZA 4HUWB 4LU5L 1RY7B 2AJXL 4ZNCD 4RFOH 2ATPB 3DX9A 3OAUL 4LL9A 1JPGB 4YAQB 4Q9CA 5CFHA 1GIGL 3K81A 1EEZA 1OW0A 5J6HA 3MRNA 1UKSA 2NY5C 1A0QL 2YWYA 2DKSA 3JTTA 3VRIB 4GT7A 3LKOA 4Y5YA 1NCDH 1LO5A 1IGYB 1BX2B 1U91B 3WXWL 1NAMH 2PO6B 3IJHB 4JDTH 4JFQB 1SY6H 4C59B 4QRPD 2AK4E 5ESVB 1F90L 5DK2B 1A6AA 1QD0A 3BKMH 1U6AH 2OR9H 2R29L 1G7PA 4G9FD 2KUTA 3QISA 2CK0H 2NY2C 3H42L 4LIQE 3GHEL 3VFVB 1ZE3C 4OBRA 4JFZH 3FQWA 1JNNL 5DHYB 4UU9B 4NHCH 3ROLB 1W0VA 4C58B 3D0LB 3VWKB 4KK5C 2EIZA 4UIMA 1MLBB 3WFDH 2N56A 4MA3B 1ITBB 4WO4A 4LNRB 4ERSL 4WU5B 1G7QB 3KR3H 4R0LC 3V79C 4PJXA 1UJTA 3GGWA 4TOYH 4JDZB 5GIRA 2K1MA 4CU8A 4L8SC 2Q6WB 5J6GB 2HN7A 2B0SH 5T3XE 3THMH 1CT8A 5DRXB 2ZUTA 5ETUB 4S2SA 5D8JH 4U6YB 2WUBL 4DN3L 3W0WE 1LEIB 3LN4A 4XMLL 3VXOB 4MHHI 3H0TA 1HHHB 3GM8A 3NCFB 3R1GH 3SEPA 3QG7H 3O2WL 4EQ3A 2CO6B 3RGHA 3T0ED 4NIKB 3IDNB 1MHCA 2JJSC 3MRBB 1IKNC 2JTDA 3OKLB 2ZCKH 4JPVH 5DD0H 1EVUA 5IF0B 2VDNL 3NCJL 4GMSH 4MQSB 1KBGL 1ACZA 3SKOB 2BCKA 4MHHG 3DBXA 1AE6L 4ODHL 5MEQA 4WFEE 3IFPA 1F2QA 1MWAL 4R26H 3T2OA 3LS5H 1MRFL 3LMJH 3QEQB 4RX4D 5KZCD 4KVCH 5D2NA 3UPAA 4K2UL 2IFFH 3OKKA 4JY5H 1RFDL 3REWB 4O9HH 4PJ8D 5I1KL 4UTBL 4JRXB 4OTXH 1XCTB 4XP5H 2Q3ZA 1KG0A 4RMSA 2XWJA 2ZPKL 3WFEL 3OXRB 15C8L 1NFDA 4H26A 4S1DC 5HYEA 4M8QB 5F3HB 3VGDA 3VD3A 5D4QA 1DVFB 4LDEB 1DQMH 4Y1AD 3KPLA 3TBSA 4YR6B 1WBZB 5DVOA 1RQ5A 3MRKA 1VDGA 1DQLL 4XBPA 3KPQA 3O11A 5DD3H 2NTFA 4FQLL 3DRTB 1FRGL 3HI6L 3IFNH 3P30H 1YJDH 2WUCH 4XWOC 5IHLB 4KWUA 5IFHH 1BQUA 5ERWA 1CF8L 4KPHH 4LMQI 2W9LA 3H9SB 1CE1L 2MHAA 1OAQL 3BPOB 2UY7A 5GGVL 5I1CL 2C1OB 3O6FA 3ALWA 2VLRB 1MJUL 1U3YA 2QSTA 5ADPH 4U1MA 4WU7A 3BPLC 2V2XB 3HMXL 1G7IB 4U1NA 5TE6H 3IDGA 1UCTA 3O6MH 4U1IB 3RZCD 4O2EB 5C6WH 5A40E 2CGRH 1FO0A 2VQTA 4I4WB 3DUUB 2XWBA 4POZD 4O02L 3O4LD 5KS9F 3EO0B 1DTUA 4MNQA 1HILA 3EFFA 4LQFH 4DCQB 1AJ7L 3VGHA 5A1AA 5F96L 4X6DF 4EI5C 4IMLA 4GS7C 3U1SH 5I73B 3J8F7 4ONOA 3WLBA 2P5EE 4P59L 1QQDA 5AWNH 3IU4L 1X4XA 4OUUA 5C70A 4X9HA 5DQJB 3S98A 2V5TA 4Y19D 1LE5B 5CGYC 1UWXH 4Z7QF 1I1YA 1ACYH 1BWMA 2Z0BA 4WNQA 3MV9B 3QIBA 3SKJH 1UCBH 2DM4A 5ITFB 1KGCD 3DSNA 2XWTB 2GJ6B 3IDYB 4Z76B 1BQLH 1B0GB 2HKHH 4F7PA 4HXAH 5FA3A 5DJDA 4O5LL 1LDSA 4LRIC 1F4WL 5J13B 2GQHA 2HT4D 4R90L 3S37H 4E41D 3WIIH 3FT3B 4ODXB 4MCZB 5ACZA 2V2WA 4PRDA 2W9EH 3HNSH 2XI9A 4NNXB 3TA3C 5CD5D 1H0DB 4NN7B 4UMGA 3S34H 1P53A 1F8TH 2PR4L 1VKXB 3GBNH 5SWZA 1KYOK 1BAFL 1RZ8A 1UFUA 1JF1B 4U3HA 1CFVH 4U1GC 5K9JH 2JKXA 4OD1L 2AQ2A 1DBAH 5IK3A 2AV7A 1YEEL 4FG6D 1ERNA 1YN6B 1NBVL 4FQXB 5KS9E 1OGTA 2NLJA 4Z5RA 1Z0MA 4YNYB 3TO4C 2D3VA 3WN5B 2AAVA 4JO1H 1QO3A 1KPRB 2RFXA 3ET9F 5DT1L 4HIHA 4YWGH 2FO1A 1WT5C 1EUUA 4R4BA 5IB3A 4F9PA 4P4RA 4U1KB 2HKFL 3RVWD 5F21B 2XNAB 2R1YA 3EFDL 4Y4HB 2F19L 3K2UL 4ONHB 3P4NA 4FFYH 1L4IA 4M61B 4X4YB 4ODSH 4EQ2A 5DUMH 3RGVB 4LVOB 3IDJA 4NQEE 1MWAB 4I0PA 2P24A 2RAMA 3QUKB 2P7TA 5CEYA 2BVQB 1T6WA 3VGAB 4TUJA 2F54B 5CKAA 3EOBA 2XPGB 5IROA 4KMLB 1KCUL 3U7AA 5JW4Q 5HSFA 2UYLA 4DVBB 3IRPX 4XPAH 1T22B 4PJ7B 4LSVL 4PRPB 5EN2A 4TSBH 2HTKD 3WHXA 4B41A 1RZ7L 3A6CL 4PP1D 2EZ0C 5FYLL 3I3BA 3BZFA 4XCCH 3QG6B 3ZE2F 4YFLI 4GG6A 5A2JH 1SJHB 5TFSH 4KHTH 3MBED 3T09A 3NGBB 2AEQL 1N0LA 2AXFB 3KXFD 2YD4A 3MV8B 4BUGA 1EHLL 1K4CA 3DMMD 3EOAA 1XGUB 3B2UC 3MRMB 4PBWD 5I1GH 3CVHL 1YY9C 3V5KB 2WNGA 4YHNB 3MNVB 3QH3B 4Z7WA 1PZ5A 1BZ7B 2VZVA 3AXLB 3VXRA 3S96A 1KIRA 1N5AB 3W39B 4HBCL 4M5YL 4OIIH 4LIQL 2ZKHL 4I1NB 1EO8L 5C1MB 5I76A 3NIGE 1NCWH 3QXTA 2J1KA 4X83A 5KTEH 4W6YB 3JV6B 3ARFC 4ODUA 1RI8A 4OCYH 3G6JB 4DQOH 2F8OA 2EXYD 2A6KA 1DFBL 1WFUA 3FCTA 2Y25A 5IVNA 1FYTE 2Y06H 5FO7A 3KPMB 3VA6A 2PCPB 5HDLA 4ZD3H 5T3XL 1JGLH 5JW5A 5DWUL 3EKCA 4NQDB 2DWEA 2FBJL 3ESVF 4C56B 1P5VA 1FN4B 5IGXH 2UVFA 5C2BL 5CP3A 1SEQH 2CIKA 4HHAA 4KKCD 4Y16D 4FFZH 2A9NL 4KRNA 2O5XL 1KB9K 1E4KC 5BVPH 1MRCH 5KW9H 3DUSA 4ELKB 3O0RH 5HVHB 4J2XA 3ZTJH 2E27H 4DEPB 4D9QE 5JDJA 1A8JH 1VFUA 2Z8VC 1ZVYA 5L9DH 2Q86A 2GTWA 4AEFA 2JELL 1SMAA 1CIDA 2AJZA 1OAUH 1ZLUH 2VL5B 4PJHF 1YYLL 2DYPA 2ZP0T 5E5RB 4CADA 3HG1D 3NFPA 4MAYB 2R0KH 2JB5L 4GW5B 4OCNC 1Z9OA 3HE6C 2AI0H 5E8DH 3K4ZA 3ORJA 4BZ2H 2OZ4A 4JN1H 1OF2B 3QIWD 3QB7C 4OD3H 1H8NA 3MNWA 1W72B 1JGDB 4LCCC 4U3CA 5F7YC 4AK1A 3O3AB 1FVEB 1PLGL 4OM1L 4U1JA 4OZIF 5C86A 2C3VB 2P43B 5C0JB 4WTZA 1D5ZB 1OARH 4RGOH 1NCTA 3O8XA 4GKNB 3T8XB 2C3HA 1JNHB 1IAMA 1HXMA 3OJDB 3SGEH 1XIWB 1WZMA 4QOKE 2A6IB 1QR4A 4K3DH 2XFXA 3H3PH 3QUML 4K71B 4J23A 4YXKH 5TGBA 3UPCA 1HINH 1N2RB 2D31B 4LSRH 1D5XA 1FFNB 4MLIA 4P2OB 1EXUB 5LGHH 5I66A 4RAHA 5L2JB 3BH9B 1M05A 2ARJB 4MNGA 4UV7H 2XN9D 3WS3A 5BW7C 3O6LL 5EPMB 5IEKA 1XFPA 3NPZB 3KAAA 2VISA 3FFDA 3NA9L 5DHVB 3CVIH 3QQ4A 5AYUL 3DURA 3MV7B 4KH2A 3KPRA 4NQUA 4F37F 1I8IA 3GUTB 4N0FA 2GJJA 1K2DB 1YQVL 2X4NB 4BM7A 1OTUD 4X4ME 32C2A 1EO7A 1KIPB 3SJVD 1QP1A 3OBAA 3HS0A 3BD3A 4LKXA 4UNUA 5CEXA 5JW3L 2ZJSL 1IARB 5DI8B 1NBQA 4OI8A 2M1KA 3C60C 2YOCA 3F6IA 1A3QA 4LARL 3S36H 3CFBB 2B8OT 4HC1H 2EEBA 3B83A 2DQGL 3BAEL 5HXMA 3RKPA 1NGZA 4D9LL 1AGFA 1IGCH 1MJ7L 4RA3A 4MB4A 1ZLVH 5TE4H 4P9MH 1FL3A 4BSVB 4RFOL 3HC4H 4XCYB 1LQSR 4K7PH 2YD2A 3MRCA 1YPZA 3T4YB 3N06B 2HT2D 2V17H 3EJZC 1NCDL 1JZ8A 3CVHB 3D1MC 3U0WH 3PGDA 4L3CA 2NY3D 2V7HA 4X9FA 1NAML 3DSFH 1CG9B 2P5WD 1BFVL 1SY6L 3UXFA 3E6FB 1WEJH 3P9MB 3NPSB 3BKML 1U6AL 3KGRA 3C8DA 1T20B 3TNMB 4F7MB 4DVRH 3RWIB 4JHZA 1WZLA 4JFZL 5GRJL 4QGTA 2Z92A 2LABA 3RI5K 2XKUA 2ID5A 4NHCL 5T5NF 1K8IB 3WFDL 4FRWA 1BD2E 3FFCE 4OV6F 4N5EC 3KR3L 4WCYH 3STLB 3QULA 5HYJD 2P8MB 1J86A 4R6UA 2PTTA 3G5ZB 5DJ0B 3ARDA 1QRND 3VXSE 4R3SA 1XF4B 1WGOA 5BCAA 5I71B 2EYSB 2B0SL 4D3CH 5J9PA 3VFOB 2WINB 1U3ZA 2SEBA 1S8DB 3THML 3W0WB 1KB5H 2ZOLB 5DEGB 5D8JL 1CFNB 4HUNB 5J56B 1FZJB 1GGTA 4NNYA 3KWWB 3D3VA 2NYYD 4V1DE 3VXPA 5MI0C 3QI9C 4JQIH 1MOEA 5D70H 5IWLA 3PDGA 3PF2A 3CH8A 3R1GL 3PL6C 5CCKH 4JPKH 4F3FB 3WYRA 3QG7L 2G75A 3TZVA 1T89C 3QXVA 5IB5A 3M17B 3RBGA 3LDBB 4RMRA 2W60B 4ZXBB 4ZUTB 1VFBA 4JPVL 1Q9OA 1Y6NR 1ZHBB 3FB6A 4LCIH 4X5XA 1Q9WB 4P23D 5F1NA 4R26L 2RBLA 3LS5L 3S35H 1FGVL 2FIRT 2YRLA 3HB3C 3LMJL 4Y4KD 4KVCL 4P2QD 1RZIA 2IFFL 4JY5L 1QLRA 3I75A 4O9HL 4S0SD 1RJLA 3FT2A 5FUCE 3BX7C 4OTXL 2YPVL 4XP5L 3SE3C 4FZ8H 5HGBB 2BVPB 5C2UB 4R4ND 5TDOB 1AGDA 3CFEA 5HJ3A 3U7YH 1I1FB 2YA0A 2B5IB 1RJZA 1OP5K 1DQML 3L5WA 4IEFB 2GHWB 4APQC 4GH7B 5D1XC 4D8PB 3IVKA 1G9EA 2PYEB 4AEHH 2XXCB 3SQOL 1RURH 1XR8B 5DD3L 4ZPTB 1QYGL 3IFNL 3P30L 3QUMB 1YJDL 2Z4QA 3EZ8A 2WUCL 1FL5B 5F9DC 2EDLA 5IFHL 2OS7A 8FABB 5B3JE 4KPHL 3RAJH 5SX5H 3V4PH 3OKOA 3BJ91 3STZB 1RVFH 3TBWB 2C1PA 4HCRH 5DD6B 5TE6L 4P2RD 2ICWJ 4ALAL 1DUYA 3VXMA 1FC1A 1JIBA 3L3HB 5E00B 2PYFB 3MRPB 3MUZ1 1WCBB 3RNQB 2MQ0A 3IB4A 3S3SA 4LQFL 2PO6C 3GSVA 3ZDZE 3BEVA 4HKXA 2CRYA 4JFHD 3NABL 4DK3A 1FP5A 3ZKXB 2JIXD 2BOCB 4FFVD 1TETH 3U1SL 4L9DA 5EWIH 4X7SL 3ABZA 4QRUA 2P5EB 3VFNA 4KZEL 4ZO7A 5E2VH 4BUHA 4XAWH 3GIVA 3PV7A 4QXUH 5DRZA 1U8KB 1IQDB 4HUKB 2XG4A 3VWKC 1CBVL 5FYKE 4TN9A 1J0IA 3L3GA 3V4VL 2HVJA 1MI5D 3VJ6A 4MA8H 4XBGB 1ACYL 2ZUYA 3OB0K 5CD3A 3JWOC 1RJYA 1U8QB 4Z0XA 1UCBL 1L7IH 5E8PA 4OCXH 1DQDH 2QQKH 4XCNA 5EBMB 5DO2D 1T0MB 1BQLL 3HC0B 2HKHL 4OQTH 2CLVB 1S7VB 1I8MA 1NAMB 2NNAA 2EIBA 1Y18B 3RVXD 4PR5A 3JV0A 2XIDA 1YDPA 1EFXA 3IKCA 1NDGB 4GW1A 5CJQL 3HPLB 5J12B 4OZHE 5EC2B 3WMSA 3WIIL 3FOMA 3TT3L 2E9JA 4I0KA 2IAMB 3HNSL 4UQ3A 2AQ3A 4I48B 3VI3F 3NCEB 4ISVB 1F8TL 4RRPA 3RHWF 5JDSA 2BSTA 1PW3A 4N9GB 5HHOE 3H9YA 1CFTB 3GBNL 1MCWW 5D6CB 1LGVA 4PJ9B 1T83C 5F7DB 4DGIH 1CCZA 5FO9B