3ZLQC

Bace2 xaperone complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
b'QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-SECRETASE 2
publication title Beta-Secretase (Bace1) Inhibitors with High in Vivo Efficacy Suitable for Clinical Evaluation in Alzheimer'S Disease.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/immune system
total genus 30
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zlqC00
1SQ2N 3VW3L 1R3KA 1A3RH 5DO2C 3IDJA 5IGXH 3GSUA 5LJYH 4NJAL 1UZ8B 3K1DA 1IC4L 1Q9LA 3T0EA 3IJYB 4PD4J 2BHUA 2YS4A 5KS9F 1LD9B 3VGDA 4JGUA 3QJFB 4PGZA 4NM4H 3EO9L 3P9MB 5IHLB 5CHNB 2NY7L 3BP7B 2HH0L 1AGCA 4O2CB 2F15A 1DE4A 3PP3H 1T0NA 1YPZF 4EI5C 1FE8H 4LIQL 2NW3B 5LBSL 1NDMA 3I50L 3MRHB 4EIZC 1I7UA 4HHAA 1C08A 3OAYH 1WAAF 4MNHB 4FZ8L 4MJID 4HS6B 4AG4H 2D7QA 4ALAL 3JUZA 3D39D 4L8CA 5MENE 1T5WA 5FGCB 2ICES 5IHUH 4KK6D 1MF2H 3WIHL 1FZMA 2CIKA 4I77H 1URLA 4NT6A 1U95B 3RWIA 1U8QA 5ICYA 4HPYL 1MIML 4FQ2L 1EAPB 5IESH 2OBGA 1CCZA 3HZKA 3D69A 3KPLB 2DM7A 3IDGB 5I1KL 1ITBB 2OR8A 2Q8BH 2BHZA 4DTGL 5KN5A 5CKAA 4PJGE 3MNZA 1ZS8B 1F11B 1ZLVK 1MLBB 2VERN 4NQVA 5D1QD 1CDJA 3SQOH 1BFVL 4K7PX 2XACC 4JFEA 1EEYB 4LK4A 4XCYA 2VLKD 5IFAL 2DD8L 4YFLI 2HT3D 4U6XB 5E5RB 4NKDB 1IFHH 2EXWD 1RY7B 4ZUUA 3WL9A 4J8RA 4HWZB 1JHLH 4GW4B 4Y2DB 1JHTA 2ID5A 3EDDA 3RWHA 1UB5B 4P46D 3OAYK 4WTZA 5HI5D 3H3PL 3GJEA 2BY2A 3QG7H 4YXHH 3TN0A 2FJHB 4IBLT 4RWYH 1M71B 1Q72H 4JM4H 2XTJD 3GMLA 4EQ2A 3PGFL 3F65A 1VEPA 4ZTOH 4YX2H 3WNKA 3WN5C 2L4OA 3BP6A 5IKCB 4BQ8A 4OZHF 1MCQA 4XMKL 1OSPL 1SBSL 1U58B 2GJ6E 1NEZA 4JGMA 1A6PA 3K46A 4GBXB 5GXBB 1T0MB 2YD8A 1B6DA 4Z7NF 3V79C 2CJUL 1CICD 4Z18A 2B4CH 1DZBA 1YC7A 3RA7H 3KPSB 3HMXH 1D9KA 1ED3B 2VISA 4NQEA 4RQQA 4U1MA 3CSBA 4ODXB 1LO3L 1BFSA 4UTAH 3BWAB 4M5YH 1T89A 3TIDB 5BZWA 4JO4L 2HLAA 1GL4B 3ULUF 1H15B 2OXHA 3VG9C 3CFBA 4P9MH 4MDJB 1WWCA 1ZGLP 4NDMA 1T2QL 3ALWA 3DX6B 4H88L 3G5ZA 1HYSC 5DQJA 4MJ6B 3RHWF 3RWDB 4JG1H 5I16A 4O00A 5ENWA 1G9MC 3JTTA 1UM4H 1HHJB 4PJXE 2PF6A 3SBWA 1FO0B 3DVIA 2VL5A 5E4EB 3U6RA 3SE4A 1DQJB 3FQUA 5TE4L 4Y4HC 4OCRL 3QIWA 3NN8B 5TDNB 4KI1A 3DBXA 5I8KH 1LO0H 1C5DB 3NGBC 4IHOA 4LARL 4MQTB 3S36X 4AIXA 1YJDH 2WBJC 3S37H 2IMMA 4EEEA 3DXAB 3QCUL 1MJJB 2PKDA 3LKNA 4XBEH 5HHVH 1QLRA 1A3RL 3KNBB 4P2CG 5IGXL 1AD9A 2VE6A 1QRNB 4ZXBB 3SKOB 1JYVA 1ZT7A 5CAYB 2WIIA 4ZYKB 3AREC 1XR8A 4K8RD 2E27H 4GW5B 3MRPB 2EDFA 4RMUA 5DHYA 3VFUB 4NM4L 7FABL 2CSPA 5IFJA 2NNAB 4UOJA 1BWMA 3BGFC 2B7DT 2VZUA 3GJFK 1M7DA 3JUYA 3IU3B 3O9WA 4H25A 4TSBH 2LVCA 5FA4A 2WIMA 1Z6JT 2FO4A 2M2DA 1BBJB 4Y4KA 4C83B 1CFQB 1HH9A 1FE8L 3HE6A 3IJHA 3G6AA 3RVTD 3ZYIA 1JWMA 4F3FB 4U6TA 4HBCL 4Z95L 1AHWB 1MHHB 4CU7A 3DO7A 3D87B 1SMAA 4JREB 1MIEH 2VC2L 1DBAH 3K3QA 1MFAH 1P9MC 3OKYA 5IB1A 4KDTC 1MF2L 1VGKA 1OHQA 1RSFA 4XXCC 1ZHBB 1BQLH 1T83C 4HV8A 3RGVA 8CGTA 1CD0A 5ADPH 2FBJL 2GK0A 3MUGA 4HKXB 5DJXA 3ET9F 5IROA 5CGYC 1MRDH 5GJSH 5IESL 5J56B 4RX4D 5IMKA 3OX8A 2Q8BL 3EOAA 2YD1A 3TJHD 2E9IA 2QQQA 1EZVX 2DL2A 4PJ9B 2FHCA 4MD4A 4W68A 1JL8A 3ZHKA 1E6OH 3TJEH 2GJJA 5EG6C 4PJFB 3SQOL 1BZQK 1CDBA 4PJ7E 3WE6A 2ADIA 3PWPD 1RUMH 2VN4A 2ICEA 4GRLA 4C4KT 1IFHL 1D3CA 1JHLL 1LNUB 4GQ9H 4KJPD 1CL7I 3U46A 3IVKB 1EUTA 2X70B 3SJVB 3U83A 1AGEB 2VITA 2WMPA 3QG7L 4OTXH 4WW2C 1D7FA 4YXHL 4RWYL 1Q72L 3F7RA 4JM4L 5E08H 3F6LA 4ZTOL 4LHUD 4RNRA 1NUGA 4Z76B 3OG6B 4L4TA 4I8DA 2X4RB 3L6FB 1J0YA 3BH8B 3R0MA 1WBZB 3ARBB 3RVVC 2WP3O 1DJSA 3SKMB 1W0WB 4HZLA 4ZFGL 1XZ0B 1E4KC 1GOHA 2F8XC 3RA7L 1BP3B 3HMXL 1KIUA 3SGJA 3QUMB 4ORZC 5E94B 1SYVA 1CDGA 2OL3H 3MJ6A 4N8VB 5DSCB 4KDVA 3F12A 4XNQA 3VXQB 1I8KB 1SM3H 4UTAL 3O6FD 4M5YL 5F89A 1D6EB 4ONGH 2MSPA 3T8XB 4OM0H 4QT5A 3L3JB 1BQSA 3ZKMD 3ZDXE 2VLRB 3ZHDA 2WUBL 4P3DB 4JY4A 4JG1L 3L7FB 4EVNB 4HXBH 3REVA 4YHNA 4NZJA 1UM4L 1TLKA 1BJ1J 3OKLA 1LQSR 2XQBH 2Q86B 2EDKA 5E6YA 5DXWA 1G0DA 1HXMA 4DFHA 4OLYH 1KJMB 4PJIB 3RZCD 3ESVF 3MRBA 4RAUB 5I8KL 1S9WA 4LPUA 1F4YH 4UTBH 5HDQH 1U92B 2EDEA 2W9DL 4HAFA 4KK5D 4S1DD 3L3KA 4XI5D 3S37L 2VXVH 1UXSA 3PWUA 4M7KH 4XBEL 4FTVA 3L3GA 5HHVL 2GI7A 2BOCB 3CLEH 3QXAA 3QHZL 5F7UA 2V9RA 3ORJA 4WW2F 4H26A 3V0VB 2ORBH 2E27L 1Q9WA 2FECL 5J11B 4OD1L 5C0AB 3ARGC 1V8HA 1KLUA 2AV7A 3CH8A 4Z7UA 1U8HB 2ARJQ 4XPTH 2V2TA 2HFEA 1RZIA 4MHHG 4XP5H 5E70A 4TSBL 4JAMA 4PV9A 3C2SA 2P8MA 3MRQB 1LEGB 3KPRB 5TE7H 1B2WH 4LCCA 1IM3B 4WI6A 2J6EH 1VFAB 3QFJB 5KS9B 5GZOC 2VLJB 2UZIH 4L8SA 4CN6A 1NGXB 1S9XA 2YPKA 3ARVA 2F54A 5L7XH 4APQA 2X09A 1N59B 4Z7OE 5BZDA 1WC7B 1YPZB 4AMKL 4Y5YC 4TVSa 2VKXA 3QPXH 4DUXA 4JFDA 2NY0D 1BQLL 1NGWB 1RURH 4R2GC 2W0FB 3FT3A 3RVWD 4KKLC 4LCWA 5ADPL 5C0GA 4LAQH 35C8H 1P7HL 5CZVL 1MRDL 5GJSL 1HQRA 3ULVD 1X5LA 2YUZA 4QO1A 4K7FB 4EUPG 3FO2B 3B3IA 3U9PH 5EUOA 3CMGA 5I1IH 1RZJC 4L3EA 2OTUB 3TJEL 3QQ4B 4WTXA 2AK1H 3ZL4H 1E28A 5BJTB 2RHEA 15C8L 4OGXH 1GGYA 3VFOB 2R9HC 1RUML 1VFOA 5BS0D 5KSAA 1J1PL 4G8GD 5L2KD 2OLDA 4U6VH 1W8NA 4GQ9L 1HCVA 1D5IH 1GOFA 2YA1A 4DGIH 4OTXL 5I2IA 5IMOB 3U0TB 3NMEA 5E08L 4KVCH 4NRYA 3UYRH 4M43L 4FS0A 3GSNB 5DTFA 5DJ6A 2UWEF 4OUUA 4P5MB 3EYOB 1Q38A 1X4ZA 5D1XD 3SCMD 1IJ9A 4QHUB 2VH5H 3MLRH 3QH3B 1WIPA 2FSEB 3OV6A 5KSUA 3TV3H 1JUFB 3PL6C 1JZ7A 2Z31D 3P4OB 3FTGA 1FSKB 5KOVC 4AIZB 2JIXB 1R5IA 3D0LA 4PR5A 2EIEA 3C8HA 3C5ZD 1HHHA 2D0HA 5GS0C 4PJFE 5MHSD 3TYFB 3KHOA 4J3XA 1HDMB 1XIWC 1DLFL 4YLQT 2GSIA 2OL3L 4FQQA 4BA8A 1NCAH 4PRAB 3QAZC 4Q6IB 2P5EB 4U1HA 3CXHJ 4ONGL 5I76A 3O4LD 1QA9A 4X0KA 1JGLL 5A43C 1ZGLB 4XBGA 4OM0L 3SJVE 4PTUA 2YD7A 3WEXA 5MEQB 4D0BB 2V7NA 4OV5A 4PG9A 4OFDA 4HXBL 2R0LH 2NXYD 5D7JB 4W4NA 4K8RH 2XQBL 3LPGA 4C56D 4KGJA 3SPVB 3QA3A 4N68A 1V05A 4OLYL 4WO4D 4D9RE 3S4SA 3AUVA 1BX2A 1U3HB 5F9WC 3VWJC 5IHZA 1T1XA 4HWBH 4PJ8D 1F4YL 4LLVA 1BVKB 4JN2A 5E2UH 2UVFA 1MWAA 2VXVL 2YR3A 5IEKA 5L0QB 1G6VK 1DBBH 4WV1A 3BPLB 3CLEL 4YPGB 3CDYA 1MREH 3PHSA 2H9GB 5SWQB 4MAYB 2EIZA 5EORH 3VRIA 1UJ3C 4R7NA 1X5KA 1TPXB 4XAWL 3VI3E 5IFHH 1ZMYA 4Y89A 3QZWB 5TH2A 4X9HA 2VLLB 5I1LA 2QHLA 4F7PB 2NY2B 3W0WD 2UUDK 4XPTL 1OB1A 5I1EL 2DLFL 4XP5L 2VLRE 4KUZH 4KXZI 4FNLH 2R2BB 5TE7L 5EBMB 4WWKD 3BZ4A 4O5LL 3WXVH 2J6EL 1HI6A 2XZZA 2ADGA 5B21A 1REIA 4NZUL 2UZIL 3D2UA 1XGYH 3V0AC 1IQDB 5ANMB 3LQAH 4PJIE 4D9QE 2FX9H 5L7XL 4XNMA 4RA0C 5CIPB 3BXNB 1IILE 1RHFA 4IRZH 3GUTA 3BP4B 2HP4A 1B4RA 2R2EA 1CK0H 2XA8H 5EZLB 4KTDH 4XX1G 4FXLA 2Z8RA 3HS0B 2BCKA 3M17A 2YMXH 4LAQL 2AERT 1AQDB 5C6TL 4U6YB 3BPNC 3FB6B 2YN5A 1T5XA 4Y19E 2V5MA 4P2QE 3ISWA 4WEMB 3U9PL 1QO3B 5FO8A 2ATPA 2AXGB 2FLBT 1U91B 2VO5A 1IEAB 2EEDA 3IFPB 3VFPB 4AT6B 4PGDA 4RBPH 2AK1L 1YEIH 3ZL4L 5I9QC 2A74B 1JRHL 3OB0H 3T0EC 4OGXL 4LOUC 1K8IB 1S78D 2PTTA 3EFDH 3KHQA 1XR9A 3LRHA 3ECBA 5A1AA 2OK0H 1RAMA 4A6YB 5HHQB 2WW8A 3QFJE 5KS9E 2F5BH 4U6VL 3VRLF 5KVFH 4WUUA 3D18B 4WW1A 4DGIL 1PEWA 2P5WE 5E9DE 4ZS6C 4N9OB 5KVMC 3MRRB 1KJ2A 2IALA 4HX1A 5J8OA 4KVCL 3UYRL 1R5VA 1YPZE 3I6GA 1J12A 3WV0A 4X6EA 3BEWA 4XPFH 2YPLD 2GTWB 2BC4B 2VH5L 3MLRL 1OLZA 1WAAE 3TV3L 3FB7A 1YN6A 4V1DD 2XWBA 3I02A 1WCBB 5CZXC 5CEZD 5GSVB 3QUKB 3LS5L 3GSOB 4RBPK 3BGMA 1EHLH 2R23B 3HI5H 3AS1A 3GMNA 1RZ7L 3T4AA 1IEBB 2YD9A 2R0KH 5GRYA 3OKNB 1N3NB 3MV7B 1S7VB 1NCAL 2F19L 2W60B 3LB6D 3UBXG 4KJYB 1CE6A 2J3SA 4BSJA 1G9NC 2NY1C 2VIRB 5I71C 4KPHH 2OR9H 5E4IA 2DYPA 3C60D 1UACH 4J1UA 4LLMA 3FB8A 4ZOBA 1AKJB 2R0LL 2D7TL 2DLEA 2ITDA 4JPWH 1TTUA 5HGGS 4K8RL 5E56A 4MXQD 5J0BA 2DLIA 3OF6A 3IFNH 4MA3B 3TN0C 5KAQF 3VXMB 2P47B 3HC4L 3B6SB 3PWVB 3GSWA 2H41A 4GQPH 1YN7B 3DOSA 1IAII 3DPBA 4HWBL 2EKJA 1IAIM 2WNGA 5L9DH 5JQHC 3BI9X 5I15H 5FKAB 1KEMH 2HFTA 1DBBL 1JGDB 5HHOB 1S9VA 3PV7A 3SGDH 3HAEA 4OFPA 3C2AH 2A83A 1KJVB 2G5RA 4CVUA 5EORL 4OZIA 3OKOB 1OTSC 4UOW1 5GGVY 1NBZB 1SJEA 4QGYA 5HD8C 4Z7NE 5IFHL 3IKCB 1N6UA 1D9KC 4BM7A 3QDJD 1FNGA 4F8QA 5F88A 2D9QB 3ARUA 1MEXH 2X7LB 5IMMB 2D4DA 4KUZL 2KZ1B 1T89C 4P2OD 3ULVH 3FZUD 3MYJA 1NAMA 1C16B 3WXVL 1FJ1B 2DRUA 3HZMA 4WI4A 4HCRH 3ULUE 4XNZB 2NX5D 1XGYL 1INEH 1DFBH 4JFFA 1KTLB 4DW2H 3PDOB 5IQ9A 5CMAA 4QRRA 5L88H 2V2XB 1TZHB 2FX9L 4FQCL 1IGCH 2RAMA 4IMKA 1K2DB 3MR9B 3OR7B 4IRZL 4HUUA 3SE4C 1CK0L 2XA8L 2VABB 4KTDL 1IMHC 1A7QH 5EULV 4K71B 4IMLB 4QYOB 5T1MB 2YMXL 5F9DC 1IL1B 3GMRA 4XP6H 4F15B 1OVZA 3NIFF 4Z5RB 3DX7B 4RFNC 5HHXH 1KB5B 1U9KA 4S0SD 2GT9A 1EHXA 4JZOA 4HUWB 4Z7WA 2ICWJ 4W81A 2J8OA 3BP5A 3FQWA 2JJSA 4PLJC 4YBQC 5J13B 4JRXB 3EFDL 1EBPA 3H2WA 5C9JB 2OK0L 1MCEA 3G6JA 3SE3A 5D1ZA 5EU5A 1SVCP 2F5BL 1XGQB 5KVFL 3DMMC 3HLAA 3O9WC 1LEIB 4CMMA 4EXKA 4GOSA 4HK0B 5ANME 4Y4KC 5A16B 1Q1JL 3Q6FB 4KZDH 4KKAD 4LNRB 2F53E 4BQBA 3P9LB 4KV5F 2Z91A 5EO9B 5EO1A 1J8HA 4RDQG 2HTKC 3FQNB 2Q76A 3OJ2C 5DJ0A 1U8JA 4JY5H 5T3XD 1EVUA 2PW2A 2G60H 1DLHB 3ARFD 1JPGB 3U7YL 4LCUA 4JN1H 2EZ0C 5HYJA 4N5ED 1ZWIB 3WIHA 3CFJA 4X80H 4P5KB 4PY8J 3RGVC 4DCQB 4PRPA 1MCWW 5DRXB 3CD4A 2JB5L 2UWEB 3QEHB 3HI6H 4OUOA 5IROC 4M6OH 3MLVH 5JORA 1I1AB 4OFYD 4QCIB 4XPAH 3P30L 2BNQA 2D7MA 4YAQA 2BP3A 2DAVA 3VD4A 1B9ZA 3HR5A 2G75A 1A8JH 1UYWH 5D8JL 1HKFA 2J8UB 1A3LH 4TUOB 1L7IL 3QG6B 1WFOA 2ZWLT 1JK8A 1AGFB 3NA9L 4KPHL 1IGFL 4GRLC 2OR9L 5I8CB 4AH2B 1KTKE 3DHJA 2VAJA 1ACZA 4JPWL 2HT4C 1CFTA 5CSZB 1ZANL 2R1XB 4JZNA 2E9JA 1ZHKA 4PJCB 4Y5XA 1MPAH 3IFNL 4GSDL 4PRHD 3IS1X 1HSBB 5GGTH 5ESVA 4N1HB 2EDTA 3T4YB 4HJGB 4NCC2 3F7VB 5E0QA 5CBEA 2HN7B 1HQ4A 3LSOA 4YHZH 3HRPA 5L9DL 4LF3B 1QFWH 2XTLA 1TQBB 5I15L 5D2LB 2DKSA 1KEML 1M7IB 1G7HA 3LEYH 1E27A 3MREA 1K4CB 4YBLC 4RIRB 1N0XH 3CDFA 3C2AL 5HGBA 3MV7E 2C5DC 3GMPB 5D9SB 1GHFL 4NQSA 4TTGA 4U1JA 4M93C 3QIBB 1FL5A 4PBWD 3SGJC 3QWOA 4L4VA 4F8TA 2R1WB 1RZ8A 3WUZA 2HVKA 2CDGA 1I7TB 2VAAA 3ULVL 1BD2B 5E00B 3IDIA 4BSWB 2JCCB 5D7LA 4M4RA 4HCRL 4U1KA 3GB7B 3J8F7 4YDVA 3JWDC 1INEL 1DFBL 1BAFH 3B5TA 5DMGD 4DW2L 4O02L 2NTFA 5TGBA 2J12B 1AQKH 3U30B 3W9EB 1IGCL 4Y5VB 1A02N 4MXWH 5IVXB 4U1LA 1PW3A 3CFEB 3QR2A 2HJKA 4NZDA 1BIIB 2H2PC 4D0CB 1WTGT 1A7QL 5GISH 1TIUA 5HHOE 1T21B 2HAZA 4XP6L 2V9TA 5HHXL 1J18A 1H5BB 1AO7D 3DUSB 5IEHB 2IANB 3LEXB 1J5OH 2ZOLB 2C1PB 4OCXL 4G9DA 1OTUC 3QUXA 5BV7H 2EDYA 3WDJA 4MJ5A 5DFTA 3CFCL 5DI8B 5GRJH 1IGYA 1HSAA 5B38G 3MZTA 3AAZA 2HA1A 1QPXA 3QUYB 4PGJA 3BQUB 4PGCB 2Z8WC 4N8CH 3QNXA 4YNYA 3SKNB 4GKNA 5GJTH 5T5NF 1NC4A 1A7BA 1YMMD 2NY6D 2Q3AA 3BVNA 4OSUH 4U1SB 3IDNB 4BUGA 3BMWA 3IRPX 3PE9A 1KTRL 4LCCC 2FJGB 4DN3H 1Q0XH 3H9SD 4KZDL 4FFZH 3EO0B 5EFIA 3UTQB 1OAZH 1MCDA 1JI1A 4L8SC 5IV2B 4Q7DA 1ZHNB 3PGCA 2BY0A 1QBMH 4JY5L 1KCLA 1B4JL 3T09A 4APQC 4LVHC 1IAOB 2G60L 1AR1C 4XVUD 2CDEB 1FAIL 4NN6C 1VFUA 4X80L 3VD5A 3K74B 1K3ZA 3QEUB 4NQXB 4S0TD 2IAMC 3BZEA 4Z7QE 5JXEA 1EFXB 4ZODA 3RKDC 4EIGB 3LQZB 5BOPA 3G5YB 5F7DA 4XPAL 1NGQL 5BW7C 1ZVSB 3VXRD 1FPTH 1HEZB 1GGBL 3DRQB 1UYWL 4FOMA 5ACLA 1PKQB 3PIQB 4PV8B 1A3LL 1C7TA 5C07D 4GAFB 1WGOA 3KS0J 3PWNA 4HG4J 5HDOA 5BVJA 1H3XA 5JO5B 1ZT1B 2DQUH 2AJVH 1FGVL 5FUZH 3WIFA 3RVVD 3OAZH 3DUUA 1JN6A 3RIAK 3GSQB 5MEOB 1JV5A 5DWUH 3OPZH 3TBWA 2ESVB 3FOMA 4IOIB 4XCNA 1MPAL 3CDGB 3EYQD 2ZZUT 1KTDA 5GGTL 1FC1A 5SWZD 1AE6H 3BN9C 1X5AA 2BRRH 3NCEB 1MCOH 2IADB 5EN2A 3FHAA 4MA7H 3AU1B 2B5IC 5T3ZE 5JQ6H 1QFWL 3HZVA 4JZJB 3NPZB 1T1YB 2UWEE 2NY3D 2ERJC 3JV6A 3QDGD 3MODH 1JE6A 3QWRD 4Z7UF 1R3KB 1V3MA 4LP5A 1MFNA 3IDJB 3GSUB 4P2YA 4XNYH 1DDHB 2XY2A 2WUCH 2CQVA 2D7OA 3X3FH 3MJ7B 1U8LB 1Q9LB 3SY0A 4Y16B 3PGDA 1LK3H 2ZG1A 3HMXA 4POYA 2MQCA 4HFWB 2PYEB 4OBRA 5CJBA 1B3JA 3AXLA 4WFFE 1PKOA 3TCXA 2GK2A 5C0DA 1DP0A 3OAZK 4HK3N 4P23D 2W59A 1JYXA 3V4PH 3GMQA 2PTVA 5CLWA 3TPUA 2OSLA 4M1CC 1N2RA 5E1HB 3FFCA 2LQRA 2QLVB 3FQTB 1IVLA 1LK2A 4MWFB 2IPTH 1B6UA 1SYSB 4HHAB 3RTQD 4RA3A 2YA0A 5C8JA 2PO6A 1FV1B 1QNZH 2IF7A 3SDCD 3BYTA 3CXHK 3ARGD 5EUOF 4LASH 1EXUB 3OAUH 3CPLA 4N0CC 5ISZA 2CIKB 4K7PH 5GISL 4NO0D 5DS8A 3FO0H 3QHTC 2J7LA 1U8QB 4R4BB 1FYTA 2WWMC 3LKQA 5AYQA 1D5XA 2ADJA 2R2CA 3EOTH 4RMWA 1J5OL 1EV2E 1KACB 5GZOD 4UNUA 2KL6A 3U7AA 4WV1C 3MNZB 3BKYL 3O41B 4S10A 3FCTA 5JHDA 5GRJL 3MBEC 5T3XH 1R24A 4OD3H 4KU1A 4UIMA 4IRSA 2OJEB 1BD2E 1X5JA 1QYGH 1S7WA 4N8CL 4XZUA 1R3LA 5GJTL 3MLPA 4ZUUB 4J8RB 2R2HB 4CJ1A 2VL4A 2FGWH 2CLVA 3HZYA 3ZE0F 2NXZC 4PJDA 5KG9A 3WO4B 4FFZL 2PCPA 1S5HA 4M62H 4QRUA 1OAZL 3JXAA 3WMSA 4PTTA 1QBML 2AJZB 1VCAA 2XIDA 3WJJC 1NC2A 1F42A 2EO9A 4ZAKB 1H0DB 1NEZB 4OGZA 1QSEA 2IANE 1K4DB 4JHZA 3IAGC 1H8SA 1U8IA 4H20L 1CLOH 3VXSD 2H26A 4U31A 1U3ZA 3P40A 3B8YA 1T1WA 5DHVB 2ATKB 4HIJA 4OI8A 1A5FH 5FECA 1OPGH 5JPMA 1FPTL 2MKWA 3AS2A 3Q3GA 4LKCA 4LCYB 1UCBH 2W1NA 1CLZH 5BZWB 1WZKA 4KRNA 3RVUD 43C9A 4AEFA 3CFBB 3E2HC 2P46B 2DQUL 3G5ZB 1G6RH 2AJVL 3QYCA 5DQJB 5J9PA 1QR1B 3F58L 3S36H 1G9MH 2EDOA 4J3UA 5I16B 5EU3B 3OPZL 1BQUA 5FB8A 3L95B 1BOGA 4F2MA 2E6JA 3LZFH 1ORSA 3V9FA 2YXFA 4MA1B 1EJ6A 3VRLE 4N0UB 1DBJH 4M7ZC 2VXQL 3ZDZF 4EOWH 1BVLA 3FQUB 3AGVA 4KROC 2Z8SA 1QOKA 2SEBA 2RB8A 3QJHA 5EC2A 2BRRL 3QIWB 3JV0A 1MCOL 3P4MB 4MA7L 4GXVH 3RI5F 4G9FD 5JW5B 5JQ6L 2YBRB 2H6PA 3F7PC 4Q9QH 3LPWA 4NGHH 5EU6A 4FQHA 3LKNB 2AW2A 2AV1A 4OM1L 1CL7H 1AD9B 4HFUH 4PJ5E 5DJYA 4XNYL 1DEEA 2G5BA 5J1AA 2WUCL 1PKQE 1OW0A 4ISVB 3X3FL 2J88H 2WIIB 1V3KA 1XR8B 4URTB 1EJOH 1LK3L 3BE1H 3D3VA 4JR9H 2OL3A 3KLAA 4M7LH 2BNRE 3MV9D 3QIUA 4JFOA 3V4PL 4DEPB 3CCHA 2ESVE 3V6FA 4JFXB 2XZAH 4LPCA 3O3DB 3HE6B 1OGAD 1FIGH 4JQXC 3G6AB 1JWMB 1CGTA 3B9DA 2IPTL 3W2DL 1AP2A 4FMFA 1F4XL 4XAKE 4PJEB 1PD6A 2M8XA 4TQEH 5EBLB 4ESKA 3MV8B 3MRJB 1Z9LA 1F4HA 4NO5A 3H0TA 4MNGB 4QOKA 1T22A 5DD6A 3BD3A 1BLNA 1WFNA 4LASL 4KY1H 3OAUL 1VGKB 5KSVA 3V7AE 1N5YH 1NCUA 2J5LC 4HV8B 2Z93B 3FO0L 4UV7H 5DK0A 1PX4A 4JRWA 4MDIB 3MUGB 2GEEA 4U6HB 3EOTL 1MI5B 2BVOB 4U3XA 5HHNB 5I73C 3OX8B 4NUJA 4WJ5B 1XCTA 2FRGP 4BZ2H 4MD4B 1NMAH 3SE8H 4JRYB 4MJIA 4QY8A 3S3JA 2VLMD 5T3XL 3D39A 3ABZA 4OD3L 3VH8G 5IT2L 2ADIB 4MS8C 1BHGA 1QYGL 4G7VH 1EHAA 2XNAA 3Q5YA 3AS3A 2CKBH 2NTSP 1MJ7H 1XCQB 2X4OA 4I5BA 5DJCA 4TYUA 1XF5A 2J6EA 3F7QA 1HCFX 2DQFB 3OB8A 4HPOH 4OLVH 5D1QA 4FQXB 2HFFA 5A2IH 3HUJA 1KCRH 3V5KB 3GIZL 4IMKC 3RDTB 2VLKA 5J6GB 2X4UA 3ZYOA 1VFBB 1QR4A 2LU3A 1PG7X 3KLHC 2YSSA 2ARJA 2NZIA 1MELA 1CLOL 1X5GA 1J05B 1CDHA 3SDYH 4QRSA 3TBSA 4P0DA 4P46A 4YHYB 4NZRH 2A1WH 3CVHH 6CGTA 3NIFE 4JFEE 1A0QH 1XGRA 1OPGL 1SYVB 2A73B 2HT2C 3IDYC 1KPUB 3P4NA 1DN2A 5D7KD 5EBWB 3C09B 1JF1A 3F12B 3IETA 3KPTA 1CLZL 3EDEA 2XZQH 3BHBA 5DC9B 1ADQH 2P4AB 2VKWA 3LKPA 4QT5B 4KFZC 2ZUWA 4Y2DD 2JLLA 1KCUL 1G6RL 3O2WH 3S36L 1G9ML 3P0YH 1L0XA 3FQRB 4F33B 1F2QA 1CICA 3LZFL 4MZ3A 4YHNB 5IB4B 2XQYK 4WHTA 4E41B 4OLWH 3TVMC 3OKLB 1X9QA 3VD9A 2R15A 1DBJL 4XGZB 4MLIA 1UFUA 5B39A 1RK0A 3T04D 1MCHA 5C0EA 1HXMB 3PHQB 2E7LC 4KJQC 5HSFA 4OZIF 3NCBB 3V7MA 1BZ7A 3MRBB 4GXVL 4KV5E 4MLSA 1F97A 1DUZA 4I0PB 5JUEH 4NGHL 1BM3H 1JNNL 1UXSB 3PWUB 3I3BA 4FTVB 3L3GB 3D5OF 3FONA 2BJMH 4DKEH 3UTPE 1CL7L 3NTCH 4HFUL 1ZTXH 4NQEE 5BCAA 3KPSD 3FN0H 4IJ3C 4X7TA 2Y5TB 1UWGH 2QQKH 4H26B 1UVQA 1HH6B 4NOBA 1EJOL 3B9EA 4JR9L 1BJ8A 1IGIH 4M7LL 3IXTA 2V2TB 3MFGB 4Q9CA 4X5XB 4ZG1A 3AMKA 2P8MB 3TCLA 5I1JL 3MRKA 2XZAL 3PHOA 1FIGL 1HHIA 1O7SA 1NMBL 2Z9TA 2X89D 4TQEL 3PDGA 2YPKB 2G9HA 3SQBA 5D7SH 4U2ZA 4Y5XC 4N8VG 1T1ZB 1S7QA 3WLWC 4KY1L 4Z7WF 3B2VH 1CGYA 4JFDB 2W91A 4KJWD 4UV7L 3FT3B 1I7RB 3DXAD 4LCWB 3LEVH 5C0GB 1Z3GH 4HWBA 1UG9A 2ZUYA 4RZCB 1KLFA 1I85A 4XB8A 4MSWA 4HBQA 3BN3B 4DN4H 3ZSSA 1QRND 2NY5H 2AJ3A 8FABB 3B3IB 3G6JF 4ZXBD 1DVFC 4ZUTA 2C3XA 4BZ2L 2Z92A 4Y88A 1NMAL 5DK3A 3GHBL 4NPYB 1QVOA 3SE8L 1Q9OA 4K07A 4IOSD 4HIXH 4D0DB 1W72L 3VJ6B 3STLA 3UTZB 5KSAB 4G7VL 1GGCH 3CZFA 1FL3B 1FRGH 2GAZA 5C0CB 5F9AC 5F70A 5DQ9A 2CKBL 4NBYB 4LDLB 5C0FB 4PFEA 2UYLB 1MJ7L 4NJ9H 5ALCL 1F3RB 3AM8A 3EJYC 4TUJA 3VGAB 2HJLA 3RWCA 4WIQA 4RX4A 2GFBA 4H1LH 5FV1L 1YEDA 2XWTA 4ACPA 4WTWA 4NRYB 5J12C 1ZEAH 4GS7C 1WSST 4J4PD 4HPOL 1SHMA 4OLVL 5DTFB 4YHPA 4HLJA 3STZA 3H3KA 5HPMA 4M8QA 3O11B 1KCRL 3LH2L 4HS3A 2OTPA 3PWPA 4ETYA 1MI5E 4BKLA 2E6QA 3B2UC 4AZ8A 5DEFB 4KXZH 3FTGB 1LE5B 3SDYL 1P4BL 4NZRL 2A1WL 1HHHB 3CVHL 2B0SH 4PJ9D 5FCSH 4X6CB 1A0QL 1J7VR 1OSZB 4NNPH 2CK2A 2GSIB 2JJUA 4FQQB 4HKBA 4LHUA 2HTKD 1XF4B 5DEGA 1IGTA 1XF3A 3HMWH 1TETL 3MRMA 5I76B 1ETZB 4TOYH 5L8LB 1AI1H 4X0KB 1ADQL 1QUNA 4DOHB 1CDIA 2CLZB 1OP3H 1L6ZA 4OZFH 5ADOL 1RUKL 2RCSH 4PTUB 4ZD3L 1KPVA 1WVZA 5FYLE 4MQ7B 2FBOJ 3O2WL 3SJVD 3QO0A 3K4DA 3P0YL 4P3CH 4PG9B 4MCYB 5AAMA 1DTUA 4D3CL 3T77A 2KZWA 4TUKL 2XFXB 3S96B 1M6OB 4HIHA 4P59L 5ERWA 4NN7B 5GQBA 3QQ9C 1WFUA 5GSRA 4NQDB 1QSFB 3KYNA 3MNVA 4L4TE 2GIYA 4PRIB 4TPRH 5MP6H 4JHWH 4XPHH 3U36A 1VPOH 1Y0LA 4F7TA 3TZVC 4G43A 3O6FA 3FT4A 4D9RD 1T1XB 1NLDH 4PY7B 1RZKC 1WIOA 4KI5F 5JUEL 3MV11 5KZCB 1BM3L 3WHXB 1YZZA 3ARBD 1IT9L 3ZKNC 1MWAB 3MLZH 4IDLA 1OAQH 4RGNC 4LEXH 4F7CB 1CVSC 3O6LL 5DJ2A 2BJML 3NTCL 4QHLA 2IC2A 3FN0L 3BIKA 1AIFA 1HOCB 1WBYA 5IBLD 1FGNH 1ZV5A 3RWJA 2EIZB 3VU2A 5JXEC 2RGSA 3UPRA 5TF0A 1OP3K 1NGPH 3NOIA 5F7HA 1BF8A 1VEMA 4N0FB 1IGIL 2I5YL 5T33H 4XVTH 3RZCA 1AJ7L 2D31A 2D0GA 2FDBP 1HYRC 4ODUA 4NCC1 4ZDHB 3RUGF 2VLRD 2GSGA 3AVEA 4UAOC 4HH9A 1RVFH 1HI6B 3VFMB 1FVCA 3B43A 3EYFA 5AUMA 5JDSB 1WZLA 3P73A 5CP7B 1GGTA 2DBJA 4FRWA 4ZPVA 5D7SL 3U0PA 3NFSH 4GXUM 5E8PA 1PZ5A 4Z0BH 1BEYH 4HG4K 3NPSB 4FTVE 3K2UL 4XC3L 3M17B 1TJIH 3LEVL 5FXCH 1UH3A 1Z3GL 4Z77B 3KLDA 1RZFL 4Z78A 1S7SB 3HPJA 4DN4L 5I8EB 5EU4A 4PP2B 4LSVH 4GW1A 1T5XB 2NY5L 5KVEH 2VRAA 1QQDA 3QQ3A 2B1AH 4XWOC 2QTEA 3O4OC 4LSRH 3L5IA 1OQXA 4HIXL 3GGWB 2VDLH 4Z7UE 5F1NB 5C0AD 1S7TB 3QDHA 1VKXA 1NQBA 5DMKA 1FVEA 5FV2A 1XR9B 5CBAA 2H2PD 3ECBB 2WP3T 1FRGL 1IAIH 3KPRD 2BVQA 1XGUB 3NCMA 1YEJH 3HG1B 5LGHH 4WUUB 3RL2A 2QKIB 2CR3A 1I8IA 3NFPA 2VLJD 3CDCA 1G7PA 3UC0L 2F54E 1JZ6A 4L9LA 4HX1B 4HCRA 5K9KA 4W4OA 1R5VB 3EYVA 5JLZB 1ZEAL 5IHBA 2A0LD 3R1GL 4X6EB 4PUBH 3BEWB 4JFDE 3GRWL 3QZWG 1ZHLA 2EC9U 4GMSH 4LCWE 1DBMH 5IBTL 1YN6B 2XWBB 4G8GA 5L2KA 4I3GA 2VTFA 1QG3A 1A1NA 5H94A 5EUOE 5IM7A 4CVXA 4QGTA 4LLDA 2O26U 4I4WB 3FO9B 1ZA6A 2EO1A 3IU4H 2B0SL 3NAAH 1G0XA 2UY6A 5C0NC 4M6NH 1SEBB 3GMNB 5BO1L 1IGJB 4EDXA 5I66B 4NNPL 3SGEI 5KJRH 3M8OH 2FL5A 4Z0XB 3HMWL 4TOYL 1AI1L 1G9NH 5D1XA 3SCMA 1AGDA 1ZLWK 1A6ZB 3REWA 5C2BH 4IRSC 2P1YA 4HUVA 1MFEH 2RCSL 2EDDA 2PETA 4OLUH 2Z31A 4EI6B 3S37X 3FB8B 3C6LB 3VG0L 1QZ1A 2NY4C 2O5ZH 5T1KB 3C5ZA 3MA7A 3RKDD 2ITDB 3QXDA 4E0RB 4WFEE 3VGHA 5ESQA 3BISA 1RZGA 3DYPA 4JPKH 4GRWH 5I74B 5TQ2H 4PGBB 3ZE0E 4WWID 4TPRL 1AFVH 4JHWL 4NWUH 1VPOL 2QADC 4UV4H 3S88H 3CMOH 1VFMA 3O4LA 1CQYA 1NLDL 3TWCH 4KRPC 4I48A 1TXKA 1X4XA 3S3SA 2JIXD 4JLRA 5INDA 5EOQH 2P48B 1OAQL 5I75C 4X6CE 1T6VN 1FO0H 4KMTH 3HAEB 4KQ4H 1FGNL 4MA1C 4OZIB 5BMFH 4X98B 1YEHH 3B9KB 4GG6A 3BIAX 4C56A 4DOHE 4UZGA 1NGPL 2P5ED 4MA8H 4YJZL 2CMRH 2W0PA 4WO4A 1CXIA 2I60H 2JB6A 1PJ9A 4NUGH 4XVTL 3K80A 4GJTB 2EYTA 4PJ8A 1GZQA 3QCTH 1RJYA 3DI3B 4ORGB 5BOZG 1ONQA 1RVFL 4OV6F 1AH1A 4ELMB 3QO1B 1QSFE 3BSZH 3ULUD 2DMBA 5IQ9B 5F6IC 2DIAA 2M26A 3LOWA 3PP4H 3R8BB 2EC9T 4HUNB 3RNKA 1A6WH 3HCVA 3V95A 3NFSL 4Z0BL 1U3HD 1TDQA 2HTLD 5TQ0H 1BEYL 5GGTA 1KFAH 3UP1A 4P2RB 1G7JA 2PYFA 5D71H 3W0WA 4BH7B 3ZDZE 3QRGH 1MHCA 3L5XH 2PNDA 1V7NH 1TJIL 4DQOH 3CLFH 4D8PA 1LEKB 4X8JB 5B3NA 4LSVL 3MA9H 4H0HB 5KVEL 3ZT7A 1KT2B 1UKQA 2B1AL 4JZOB 4QXGH 3WFHB 4Z7WB 4C55A 1A9EA 2AKRA 2ZUQB 4LSRL 3I6KA 3JSSA 4HUXA 5DVKA 2VDLL 1OW0C 4PJDF 3MSPA 3OSKA 1XEDA 3B5GA 2NY2D 4C54A 2MCG1 4CMHC 1ZSDA 3RY6A 4GUPA 3JWNC 2VDQH 1I4FA 1IAIL 3D25A 5D1ZB 5EU5B 2BNUB 1J8KA 4JM2B 3WFCL 5LGHL 1BZ9B 4R6UA 2H3NB 2FYYB 4LKXA 4CMMB 3GFUA 4OQ1A 3GO1H 2FNBA 1QFPA 3LIZH 1DSFH 4LLUB 1Y6NR 2Z91B 2X4NB 3EKCA 4DZ8A 1DN0B 2IFGA 4PUBL 4WI2A 1J8HB 3FKUS 4GMTH 4GMSL 2Y7QA 5CEXB 3RAJH 4AEIH 5ETUB 5IF0A 2VMFA 1DBML 2PW2B 1MOEA 1J10A 1NLBH 3FOLB 4LCUB 4RISH 3LD8C 5HYJB 1KGCD 3W9DB 3CFJB 4C59B 4G6ML 2PUQT 3RIFK 3UZQA 2RFXA 3IU4L 3O2VH 2H45A 3NAAL 3K4AA 4M6NL 5JORB 1KPRA 5KJRL 4XP4L 2WLYA 4EN3A 3M8OL 3UTTB 4LMQI 1RJZB 2YPLA 3N1MC 4WUUE 2VQUA 5C2BL 3U4EA 1BFOB 3GSRA 3RX7A 4NN5B 1MFEL 3HC0A 4V1DA 3LKOB 5B8CC 5FYKE 4ELKA 4FFWC 4KK6C 5GZNC 5GS1A 3THML 3V8CA 2DLGA 5BQ7A 2OI9B 3MX0A 1JMZA 3BZDA 2DI9A 3QUMH 1NCWH 1JWSB 3CFDA 2JKXA 1GGIH 4JZNB 4LLYA 2J8HA 4JPKL 3VWKA 2X42A 4X4XB 5TQ2L 3VGFA 4JFPB 1CFNA 3SEPA 1AFVL 4BK5A 4NWUL 3ARYA 4UV4L 3S88L 3CMOL 2D0FA 3ROOB 5D1QC 2ICCA 1HNGA 3UROR 5FGRA 3PQYB 5EZOH 4LVNB 4BH8A 1EO7A 2HT3C 1EA9C 5IMLB 3X3GH 3C60A 3QEGH 1Z5LB 2EXWC 3MREB 1FO0L 5DRZA 4FQIH 3MUZ1 5HDLA 4KQ4L 1FFOB 1MVUA 1EVTC 4N90E 4JANA 4P46C 5FYJH 1YEHL 1PQZA 4NQSB 4XCEA 5HI5C 4HDIB 3MV7D 1FL5B 4I13B 2XTJC 2CMRL 4G3YL 2I60L 4L4VB 4NUGL 1ZVYA 1RZ8B 3CSYA 2GJZB 2DN7A 2HVKB 1BF2A 4NSKA 2XV6B 3QCTL 4JFYB 4K3DH 2IPUK 1A6AB 1I9IH 4R9HA 1MCLA 3TH3T 5TPWH 2ZUUA 3S6CA 1G7IA 2Z35B 5GIRA 3IDIB 3JV4B 1FNLA 4O2EB 3JWDH 4UI2A 4U1KB 2YD5A 4YDVB 3UXFA 5DD3H 3BSZL 3VXMD 2YWYA 4PPTA 4R7DB 2DI8A 2C3HA 5TGBB 1ZAGA 1FLTX 4HXAH 5DVOA 5F3BA 5ICZA 1A6WL 1SJXA 4GAJH 3RUGB 4MQXD 1I7ZB 3QDJA 4L29A 2HJKB 5DGRA 5TQ0L 4AYFA 1JGEB 2BFVH 5D71L 4WU5B 5DK2B 2IQAB 3HI1A 3EOYG 1T0PB 1V7NL 1F6AA 2OS7A 4CNIA 2DQHH 3MJ8B 3VCLA 3O3EA 4HT1H 5I17B 4P2OA 3Q0HA 1PBYA 2VQ1A 4OZIE 3D6GA 4XCCL 3OKMA 5FO7B 1GZPA 4U05A 3C8KB 2NX5A 3H7BB 4LLQA 1MVFA 1MAML 1MH5B 4QRTA 4M1DH 5MEPB 1MCSA 4R8WH 1X6LA 4MJ4A 3QXVA 1IGYB 4RGOH 2VSDA 4RMSA 3O3AB 5LCVH 1H3WM 3P0GB 3WO3B 1NCNA 1VHPA 4PRNA 4KK9D 4YQXL 3QNXB 1E4JA 4GKNB 1NC4B 3BVNB 3HUJF 5C0RH 4QRRE 1HIMH 4U2YA 3GO1L 2OQJB 5E8EA 2W65A 3LIZL 1DSFL 4L3AA 4P2RE 3IFOA 4GMTL 2APVA 3PGCB 4PYHA 1HXYA 3V0WH 4K8RC 2O61A 5M95B 1NLBL 2EXYC 5E8DH 4RISL 2YPVL 3JZ7A 5F6HI 4OLEA 3ZE2F 3FT2A 5MI0C 3ARSA 2KDGA 5AD0B 1FL6A 4Z7WE 3VE0A 3RQ3A 3BZEB 3O2VL 1I85C 1DUYA 3CX5J 1OARL 3UZVB 5DJDB 5TDPB 5D2NB 3RVTC 1CZ8H 4ZFZA 5KBNC 4K9EL 4AQ1B 1A1OB 3B8SA 4JRXD 1YY8B 3G6JE 5M94B 1ND0B 4Q2ZA 1UH4A 2P8PA 2GITB 5EUKA 4HJ0D 1ACYH 2V6HA 3ARFA 5BVJB 4LSQH 3KLHD 1MJ8H 4OAWA 4PGEA 4LIQE 4MMXC 4U33A 3DUUB 5DYOA 3EYSH 1JV5B 5FO9A 1X3DA 3QUML 3TBWB 1NCWL 3AS0A 3NACH 1J8HE 3AM8C 4I3SH 1GGIL 2I9TB 4XC1H 4RGMB 3W11D 5JHLH 2R4SL 4IDJL 1KTDB 4OFYA 3I9GH 3TJHC 2ZUSA 1CD8A 3WN5A 5BXFB 1JWUA 2DMCA 1UWEH 4YIQA 5HYJE 3HNTH 2B39A 3ROLA 3QNZB 3SO3B 3UBXB 4PRPE 3TEUA 4LAJH 5EZOL 2MOVA 4AENA 3VMOA 4PJHB 1T7WA 3B5HA 3X3GL 4UDUA 5T3ZD 2VDNH 3IDMB 1RUQH 3MYZA 4FQIL 5CGTA 3RY5A 4OLXH 3DGGB 2H8PA 5FHAH 4PJAA 3C5SA 3NCFB 1OP5H 5DF0A 2IGFH 1L7TH 1QACA 4KJQD 3AXLB 1A6VH 1HHKA 3MLUH 4K3DL 5C0DB 1ROWA 5CUSH 3BEVA 1R6VA 5TPWL 5CINH 5FFLA 3WFZA 3GMQB 3TPUB 4KQ3H 3VFVA 2JE8A 3FFCB 1OM3H 5C92A 4WHCA 5DD3L 1G6RA 3WDHA 4LU5H 3FB5B 1JPTL 2MQ0A 4ZNCD 2PO6B 3K1KC 4GAJL 1JNHA 1UQSB 2FB4H 3PQYE 1F45A 1FP5A 1W8OA 5ISZB 25C8H 4H8WC 5K9OA 2DQHL 3O6FC 3TO4C 4HT1L 1JPFB 3NABL 1T4KA 1P6FA 2B1HH 4PJBA 3QRFM 1HINH 3BO8B 1CBVH 3ZKMC 4KI5E 3RHWK 4HQQH 3S5LA 1MCFA 3QIBD 4M1DL 4L4VE 4R8WL 5JHDB 4WDIB 5LXGH 2D2OA 4JDZA 4UIMB 5F7WC 3A6CL 5J1SC 1YMHA 2YC1B 1MCCA 1CT8A 1S7WB 3LCYA 5BRZB 3WXWH 4JPIA 5D7LE 4XZUB 4X6FB 1R3LB 3RZCC 4BYHA 3HZYB 3V7AG 5C0RL 1JHKH 4KK5C 5KAQG 1AO7A 1HIML 4PJDB 5FOBB 2W9EH 5KG9B 5TFSL 1DVFD 5I0DA 1S5HB 3RUGE 3KWWA 5E1AA 2P44B 3I75B 1SMOA 3INUH 5C0JB 1RUAH 4PTTB 2Q7YA 3V0WL 4ODHL 5CEYA 4KDTA 1INQA 4JFZH 1EPFA 1FG2A 3SN6N 2EICA 3FHQA 5L6YH 3EDKA 3SDXA 2DL9A 1YMMA 3L7EA 1MQKH 3EJYD 1U8OB 5KVDH 3GSNL 4GAGH 3QCVH 1ORQB 2HFGH 3H9SA 4IRJC 2D3VA 2CIIB 4HIJB 4MB5A 1CZ8L 5FECB 2F58H 4N9GB 1WWAX 5IB2B 3Q3GB 1YNTA 1L9NA 4TVPD 3UJTH 1PFCA 4X4YB 1PSKH 2ED9A 3QUYD 4QHKJ 1GH7A 3BQUD 2Y6SD 3MRFA 1W72A 3OKEA 1ACYL 4OBSA 43C9B 3QDMB 1NFIA 4QRQB 3B2UD 5KANG 3ZE1F 1JJUA 4LSQL 5D5MB 3MOBL 1MJ8L 1QKZH 2NY0C 5J9PB 5CJ5A 5HGAB 3RVWC 3EYSL 3V4UH 4NC1E 4OD2A 1WWBX 5FYKH 5FB8B 3NACL 4F2MB 2YRZA 1ORSB 4I3SL 4XC1L 4M3KB 3ULVC 4O4YH 5JHLL 4M9PA 5IW6B 3I9GL 3TO2B 2I9LB 4XPBH 4L9LC 4ZUVB 4HKJB 4W4OC 1BVLB 1KOAA 3VXRA 4ZS7H 4RGNE 4ZUSB 4JQIH 4QRPB 3HNTL 5C07A 4I9WD 3QNYA 5H35B 5EBGA 3W39A 4F58H 2ICWA 3E6HA 4G42B 4BFGA 5EU6B 2C3VB 3HNVL 5F1IA 1RUQL 3HR6A 5HBBA 2YK1H 1EFXD 3ULUL 4WTZG 4ERSH 3MRDA 1M05A 2KQMA 4B7LA 2G5BB 5J1AB 1CXLA 1DQLL 2XPGA 3CVHA 5FHAL 4UBDD 4NYLA 3VFGH 1J0HA 2CXKA 1TFHA 4FXKA 4XCFH 3KLAB 2GCYB 2DWDA 5CJQL 1A6VL 1R3IH 3MLUL 1NEZG 3QIUB 4JFOB 4I18A 5CINL 1ADQA 1JF6A 3SHSA 4KQ3L 4O51A 1OM3L 5ITFA 1X7QA 2MHAB 1NBVH 1NBYB 2VDKL 2ESVD 3QDGA 3QWRA 1L0QA 1A4JA 3BPOC 2FHFA 4JDTH 2C1OA 1H3VA 1A6TA 4UDTA 1B88A 1RIVH 4QOKB 1T22B 3M1BA 4GFTB 5ID0B 3O8XC 2LTQB 1S9YA 1TVDA 4BJLA 25C8L 1OWWA 5DK0B 3T1WA 4FQLH 3TNNA 4ZUWA 4JHBA 4MMZC 1CBVL 2ZCHL 4HQQL 4V2BA 3UO1H 3SKJH 1EO5A 5DRWA 5DJZB 3RTQA 4Y16D 3SDDB 5LXGL 4MJIB 4RMTA 3ULVF 4FP8H 2PYED 1IC7H 2MTPA 3SDCA 1N64H 3FRPA 5FA3A 1XH3A 5A2JH 2CK0H 3T65B 2HVJA 3ARGA 4WCYL 3T0XA 1WF5A 1TJHH 2EC8A 4YHKH 1V7MH 3FFCE 1E4WH 4WO4C 3WXWL 3U79A 3NH7L 2HMID 4NO0A 3KYKH 3S7GA 3KPNA 3IDXH 3GMOA 4DAGH 2VXUH 4YK4C 5DJ8A 3TBTA 4UNTA 1PG7H 2X4OB 5C09B 2W9EL 4X6BA 4U0QB 3P11L 4XVJL 3MOAH 1WQVT 2BSSA 3GI9H 4M7JH 3ZKSD 4WGWB 3ALPA 3DV6A 3RWFA 2WINB 4L8DA 3INUL 5ISZE 1RUAL 4U7KA 1TCRB 3WKMH 1A4KB 3HUJB 2VDRL 1FYTE 4JFZL 2X4UB 1XGPB 3KXFA 3EFFA 2BMKA 3WUWA 5L6YL 2ARJB 4KHTH 1UKSA 5D7IA 4QRSB 1TZGH 5KVDL 3TBSB 3WSQH 3QUZC 5JHDE 4GAGL 3QCVL 1KBGL 3BUYA 4IS6B 2HFGL 1BQHA 4WWKC 4HLZG 4JPVH 3VW3H 2F58L 3VD7A 1TVHA 5EO0A 2FWOB 1D5MA 3UJTL 3RL1B 1JF1B 1PSKL 2PXYB 4I2XA 2F74A 3T3MF 4M48L 5C1MB 4NCDA 4PJGB 5EOTB 4RMQA 4LHQB 4PJDE 3GHEH 3MMEA 3Q5OA 2MWCA 1HK6A 3EO9H 4NQUA 2YN3A 3KPPA 1U8MA 3V4UL 3VXSA 1CICB 3UAJD 1KIRB 4NZTL 4O4YL 3V6OA 4LGPB 4M61B 1RK0B 4XPBL 3K8MA 1I1YA 4GKSB 4H1LA 5HPOA 1PYWA 2V5RA 4L3CA 4ZSOB 3O6KH 4B53A 3S97C 4MHHI 4ZAKD 3CGTA 4ALAH 4EDWL 4F58L 3GRWA 3VGGA 1DUZB 1CTNA 1DQMH 3GMMA 4P5TB 5IIEB 3UX9B 5ACZB 1A3QA 2YK1L 4G5ZH 4LSDA 2EKSA 2GJ6B 4HPYH 3L5HA 1YUHA 2IPKA 3EO1A 1E0OB 4DTGH 1GOGA 1IZKA 4AM0A 4KK8C 2FHBA 4OFIA 1LWRA 1N8ZA 5C3TA 1S7UB 1I1RA 3WJLA 4KRPD 4G9FA 1VADB 3T1FA 3I2CL 4DKDC 4OZFA 3PHOB 5GGSY 4WFGD 1U93A 1NBVL 5I6XB 1U8KA 4XXDB 4MAUH 5GS1C 1YY9D 4XH2A 4LVOB 4P3WA 1FFNA 2BY3A 3B4NA 3ZHLA 4RMRA 1GYAA 1MHEA 4PBVC 4HWUA 4LPWA 1RIVL 3QIWD 4R26L 3QPQD 4HJJH 3PGFH 2YRPA 5E8NA 1ES0A 5EU6E 3ILQD 5DFVD 4PJXB 3MLXH 3LB6C 3G08B 4ZFFA 1MFDH 3MV9A 4FQLL 3FFDA 4XVSH 4K7PY 4MSWB 3KJ4B 1NANI 1KIQB 5C08A 1OGAA 3C60C 4DKAA 2AEPH 1F90L 3SKJL 1XF2A 2Z92B 1QVOB 2ZNXA 1C12B 3LKRB 1EEQA 4FP8L 5E5MA 1IC7L 4MXQC 4ZO9A 3OXRA 4Z7VA 2IH3A 2CK0L 3FQXA 3KDMA 1TJHL 3K4ZA 3OQ3B 3CVIL 2QR0B 4YHKL 1V7ML 1NFDA 4YC2C 3UJJH 1E4WL 4Y8AA 5FK9A 1CXHA 4OGAD 4X6DA 1TTFA 3IDXL 5F44A 5L8JB 2VXUL 2ZSWA 3RWCB 2DQGH 2ZUXA 3MV8D 4QOKE 1J88A 1UZ8A 3U48A 3MOAL 3UMTA 3GI9L 4M7JL 4TVPH 3LDBC 1OWRM 3K81A 1MQ8A 5GPRA 1TZIB 5HPMB 3QJFA 5JOPE 3EW3B 4JJ5B 4QNPF 2JELL 3P9MA 5CHNA 3BP7A 4YHMH 5TE4H 1EBAA 1MI5D 3NZHH 4KHTL 3MOQA 1FZOA 2V5YA 5DR5H 1TZGL 2NW3A 4P2OC 3LHPH 3FZUC 4MJIE 1OT1A 3D39E 4ZOAA 4MNHA 4JRYD 4Z6AT 3MZGB 4HS6A 1CIDA 2DM2A 1VESA 4LHUB 4HKBB 1P7KB 3ES6B 4WUKL 3KYAA 4CGTA 2XG5A 4MGXA 1MCRA 2W38A 1A21A 3VXNB 1U95A 5T3ZL 5BVPL 5C09E 3GHEL 5I8OH 7FABH 5TJWK 1ZLVH 3RIAF 3TIEB 3PABA 3BH9B 1EAPA 4Y4FB 1UM5H 3KPLA 3IDGA 4PJ7B 1FBIH 3T77B 3B83A 2AGJL 4HIHB 1ZS8A 2A6KB 2R56L 1F11A 3HUJE 1MLBA 3KYNB 5HHPA 2VLKE 4FQXD 4HBCH 1H3UA 3U36B 3O6KL 4QKXB 4DUVA 4F7TB 4F7MB 4Z95H 2AABL 3RDTD 1RZKH 3MROA 3C9NA 4NQCD 4N0YL 2VC2H 2O5YH 1DQML 4AK1A 4HWZA 2AJXH 4FFWD 1OD9A 3HE7B 4GW4A 4JB9L 4Y2DA 5GZND 2Q8AL 4IEFB 5DMJB 1KEGH 4G5ZL 5DJ2B 2XTJE 1NDGB 4QHLB 4XRCA 2FJHA 1WBYB 2FBJH 3BAEH 1LMKA 4WY7L 3ZE2E 4YDLB 4GAYB 1DL7H 3ZKXC 4KKAC 4U1IA 1U8NA 2GHWB 4M03A 4C57C 3H9ZA 1U58A 2D31B 1HILB 1T0MA 2C4XA 2GSGB 3S34L 3ARFC 3K8KA 2HRPL 4MAUL 2VN7A 2G2RB 3CX5K 4MD0A 1JFQH 4N5EC 4E41D 2YXMA 5HYIA 4R0LC 5LGJA 3KPSA 3BZFB 4ZSOE 1PEZA 1ED3A 4YFLF 3GBNL 1JNLH 4ODXA 3N1FC 3U0PB 4D9LL 3SGEH 3FO1B 4HJJL 6FABH 4OF5A 5HYFA 3BWAA 1PZ5B 3V52L 1G1CA 3TIDA 1EZVY 1X6NA 2X5PA 4I0PD 1H15A 3DURA 3MLXL 4MJ2A 2WQRA 4XT1C 5F96H 1MFDL 4MDJA 4QTIH 4XVSL 4YDJB 4MJ6A 3CH1B 3HPJB 3RWDA 4Z78B 4JY6A 5HI3D 4NO3A 4GW1B 1J0KA 2AEPL 4YR6B 2X89A 4QXUH 4EBQH 3MGTB 1MFCL 1IRAY 4KMLB 1FO0A 4IIQB 4ZFGH 3IB4A 1EHNA 1DQJA 5DMKB 3QXUA 3WFBH 4HD9A 4RMVA 3RZWA 3NN8A 5TDNA 3UTSD 3S4SG 3ZYJA 2ZG2A 3UJJL 1C5DA 4LQ1A 2BVQB 2EDRA 3DXAA 1F58H 5LAXA 1MJJA 2APXA 4POZD 3RL2B 2P8LB 2XY1A 2DQGL 3LN4B 2HJFB 1N0LA 1QRNA 4GRMB 2AXHA 5DZNA 4ZXBA 4QF1B 3SKOA 2WUBH 3GJFH 5D6CA 4TVPL 4DZBA 1DR9A 3UBXI 4GW5A 3MRPA 3L3OB 5HI4D 1G84A 3VFUA 1H3PL 4JFDD 2NNAA 4NO2B 3DVNB 3VH8B 4YHML 3IU3A 4G8GB 4LCWD 4WHYH 3VI4F 5L2KB 1A1NB 4C83A 1CFQA 3NZHL 5IM7B 3TBVB 2Z4QB 5DR5L 2J1KA 1ZA6B 2A9NH 2NYYD 3LHPL 1MRCH 2W9DH 2CPCA 2EDBA 4N1EA 4NHCL 1OL0A 2K3TA 1Q9KB 1CGVA 1WZMA 4EDXB 2A6JB 2FX8H 1AHWA 1MHHA 3KYOA 2DQJH 3QHZH 2FL5B 5DMGC 4J4PA 1QBAA 1R3JB 1OOAA 2BX5A 5KSAD 1YC8A 5D1XB 3SCMB 4RAVB 3RPIA 3DNKA 4CUCA 2A6IB 2EXYD 5C0CD 2R8SH 4OD1H 3REWB 1NAKH 3ARZA 5I8OL 1OGTB 4HKXA 2Z31B 4KKNA 3DMMA 2W0LA 1UM5L 4UOW0 5C70A 2ZJSH 1K5NB 3WNMA 5JIKA 1FBIL 3C5ZB 3MA7B 3RU8L 3RNQA 2I27N 5C2UB 3K7UA 4ONOA 3PWPE 3TYGH 1VDGA 4Q9RH 3JWOL 1RZKL 5FF6A 2O5YL 2RQ8A 2YZ1A 4PJAF 4I48B 5SWSA 5HVFB 2AJXL 4AMKH 5INDB 1LNUA 1GC1L 3DLQR 1Q0YH 4YHOH 1KEGL 3IVKA 2X70A 3SJVA 3RX5A 43CAB 5K9QG 2NY6C 2QJDA 3BAEL 5CZVH 2DJSA 3L1OH 2NXYB 5I1GH 3MRGA 1DL7L 5ESAA 1LDSA 3M07A 4LLWA 2P7TB 4Z76A 1WISA 4R97C 3ZMRA 2DDQH 3QBTB 1T3FA 2AK4B 2EYTB 5EOCH 3L6FA 4PJ8B 3BH8A 5F7LB 15C8H 1X5YA 3UEZA 4WI3A 3GIVA 1J1PH 3Q5TA 4XVUC 5MERB 2CXGA 1W0WA 4CDHA 1JFQL 4OCMC 2BVPB 1CFSB 1JBJA 1F4WH 3PNWB 4HGWB 4NQDD 1E6JH 1QSFD 3G5VB 3QUMA 4PJBF 4PRID 5F1OB 4AEEA 5E94A 1JNLL 4GKZB 3F8UB 3RNKB 1L6XA 6FABL 3HCVB 5JTWA 1I8KA 2IWGA 2R29H 4M43H 1TQCC 5DQDH 2R0WL 3W0WB 5DDHA 3RJDA 1A9BB 1MHCB 1NGYB 1QLFB 5DLMH 3L3JA 4IOFD 2C26A 5F96L 1RIHH 4NRZB 3MXWH 4QTIL 1TNNA 1F2XK 3KG5A 1MSPA 4R4FH 3ARQA 5T1LB 3L7FA 4EVNA 1MRFH 4QXUL 2BHYA 4EBQL 5F93C 1YNLL 2CD0A 3ZTJG 2AKRB 2PTUA 2Q86A 1FG9C 3SDAB 4ZFOB 4POUB 1G9EA 3GK8H 5D93B 5HGDB 3EYQC 3WFBL 3H9YA 5IW1B 1KJMA 1DLFH 2X1QA 3WLBB 2CUHA 4S2SB 4R3SB 5CD3B 5SX5H 4LSUH 1U92A 1CXFA 5D96B 3TO4D 1F58L 1JGLH 3CFKB 4I18C 4LKXB 2BOCA 2NY3C 3HAEG 3V0VA 1S3KH 3SDXF 4DZ8B 1GSMA 5I19L 2Y7QB 5C0AA 4Q97A 4OZGA 5IF0B 5FKPB 3R4DA 3IF1B 1FVDA 2NCMA 1A2YB 2EEAA 4P4KB 1UJTA 3MRQA 1LEGA 5HVHC 3KPRA 5DVNA 1IM3A 1IAKA 1DQDH 1VACB 2ZOKA 3UJIH 4P23C 2A9NL 1MRCL 2KKQA 4PYGA 4DJMA 4NKOB 4Q58C 5IWLA 2VLJA 1F3DH 4F7EB 3QEQD 3VFTB 1NGXA 2O5XL 2FX8L 4UUJB 2DQJL 4EN3B 5SX5K 5BV7B 3ARDC 1N59A 3RTQC 2DBLL 3EZJB 4Y19B 4XAWH 2ENYA 4P2QB 5J6HB 4EKXA 2ICWI 2VQTA 3QFDB 1RULL 3SDCC 1NGWA 2R8SL 1NAKL 2W0FA 3GSRB 4BSVA 3ULVE 1PAMA 3HG1D 4WUUD 4W6WB 5I1EH 1J0IA 2DLFH 2DQDL 2ZJSL 1R5WB 3MUY1 1CGSH 3FO2A 2C3WA 4IRJD 5LWYH 4O5LH 5EC1B 4HUMB 3VWKB 2NLJB 3PDDA 4GG8B 3QQ4A 4NZUH 3TYGL 2P5WB 4Q9RL 4G8GE 5E9DB 5L2KE 3VFOA 5C6PB 3RVXD 3TA3B 3D85B 4CADB 1Q0YL 4YHOL 4BH8B 3DARA 4U1GC 1YYLL 1RFDH 1OY3B 3DYMA 2IAMA 5C6TH 4PY8I 3L1OL 1PQZB 5I1GL 2UZYB 3GSNA 4N90D 5BW7A 4HIIB 5E6IB 3VFRB 3OXSB 5C86A 2NY5C 3EYOA 1K8DB 5KW9H 3CC5A 4QHUA 2DDQL 2Q6WA 5F7YC 5DRNB 2FSEA 3R0NA 5EOCL 1JRHH 1JUFA 4NSKB 4ODTH 3P4OA 4AIZA 1G7IB 2JIXA 3C6LD 4ZO7A 3T3ME 4XBPB 5A2LH 5T1KD 3ARTA 1BJMA 5MHSE 2A6DB 4PRDA 4YO0A 1F4WL 3AB0B 4NP4H 4R4ND 3TYFA 1CFVH 1E6JL 3H7LA 2X41A 3STBA 3V6OC 5ICZB 4ODVH 5EU7C 2R29L 4PRAA 4Q6IA 2P5EA 4K3EH 4QTHB 5EZJB 2XICA 4L29B 3QI9B 5DQDL 3H9HA 4S1RH 1ZGLA 5DLML 1F6AB 4CNIB 4OCYH 1RIHL 4UB0H 3VCLB 3MXWL 5MEQA 2VQ1B 3FN3A 4G80A 4R4FL 3RVUC 4MX7A 4LPVA 4ZPTB 4NWTL 1MRFL 1GZPB 3B9KD 1P1ZB 1JTTA 2XN9A 5HJ3B 3SPVA 3LS5H 5HYSB 1BECA 4OZHB 3GK8L 4MD5B 3E1F1 2AK4E 1RZ7H 2Y72A 3O8XD 3DETC 5JZ7C 5EA0H 4LSUL 3SKUD 1AXSB 4J6RL 2F19H 3G04A 1KN2H 3H6JA 1PY4A 3WJLC 4U0RC 3VXTB 5GGSB 5KSBA 2BRQA 4EI5B 4UU9B 4KAQH 2YKLL 2UUDH 5E8EB 2W65B 5SWQA 2EH8H 2FEEI 3O81A 3ARPA 3DX8B 1U8PB 1S3KL 3OKKA 4NBXB 1KG0A 3I3EA 3QZWA 5D7IF 1SJHB 2D7TH 3W0WE 1I8MB 4P2RD 1F3JB 1P5VA 3GSVA 3A67L 4NNYB 2O61B 4CBPA 5DJAB 5FYKU 1HZHH 2P43B 3HC4H 1I1CA 3DJ9A 4CN4A 2R2BA 3FT2B 3ELAT 5EBMA 1DQDL 3UJIL 4L8BB 3VE0B 4LL9A 5F7NC 1DUYB 1IQDA 1MUJA 5ANMA 1MCPH 2DQCH 2DTMH 4PLKD 3X17A 5CIPA 3MBEA 2ED7A 3BXNA 5HDBF 3BP4A 1AY1H 1KXTB 5EZLA 5EUKB 2DM4A 4YEFA 4JM2D 3H42H 1TTGA 2VXSH 3DIFA 5HY9B 3O2DH 1CGSL 3QUZD 1QO3A 1BOYA 5LWYL 2Q3ZA 5B22A 2ITCA 2AXGA 3IFPA 4F37K 4AT6A 1J8HD 1VEOA 3QULB 3GSXB 2A74A 3WN5B 1BPVA 4R96A 5IOPA 1JWUB 1K8IA 2H2SD 3WJJA 1YDPB 3DECA 5F9JB 3ROLB 3PV6B 4FQCH 3PWLB 4LDOB 5HYJD 2F53B 2OJZL 5HHQA 4DVRH 3KGRA 3AY4C 2Z0BA 4AENB 4C58B 4E42B 4UINL 3U0WL 5DMYA 1RFDL 3D18A 4NFBA 4QNPE 5GGRA 3WHE0 4XTRC 3MRRA 1UENA 3HPLB 3OR6A 2H8PB 2YPLE 5A3IC 3UTTD 5E7FA 3IJSA 3C5SB 1LVEA 3VXPA 1A7NL 4K55A 1E4XI 4CU6A 5KW9L 2BC4A 4V1DE 3BJLA 3MRLA 2DQEH 1HHKB 4BUHA 3QXTA 4ZMAT 1QSVA 2QQNL 4ODTL 4QHMB 3VG9B 5GSVA 5JW4M 3LKSB 3QUKA 4J3WA 1JPST 1Z0NA 3GSOA 2AEIT 3LN5B 4NP4L 2R23A 3UDWA 1CFVL 2YRLA 1Q1JH 3OKNA 1WK0A 1N3NA 4J23A 4BFBD 1S7VA 4M9OA 4ODVL 2VDML 1JNHB 4K3EL 4KK8D 4X7FC 4XHQA 4XNUH 4KJYA 4Y4HB 4H8WH 4PD4K 2R0ZH 4S1RL 2V2WB 3UYPA 4JFHD 3PQYD 4OCYL 2VIRA 1CYGA 4UB0L 1ZLSH 3NGBB 4Z7VF 2WBJB 2YOCA 1RU9H 3U7YH 1A47A 3QT2A 2XKNA 4Y2DC 1NFDF 4NHUB 1CDYA 4X6DF 3MRCA 4MA3A 1G7QB 2JB5H 4KI5D 1U2HA 3VXMA 3AREB 1NJ9B 3PWVA 3B6SA 4LP4A 1YN7A 5K9JH 3P30H 5EA0L 1FNSH 3I85A 2R1YB 5D8JH 3OKDA 5DURB 3BGFB 4M5ZH 4NC2B 3X12A 2EYRA 1KN2L 1L7IH 1XGTA 4BZYA 3FN9A 1MAJA 2J4WL 2M1KA 4GBXC 3NA9H 1JGDA 5DHXB 4KAQL 4Y1AB 3T2NH 4JQXA 5C0BD 1IGFH 3Q48A 1OT2A 1KJVA 2EH8L 2JK5B 2XXMB 1NBZA 4GXUN 1FNEB 3KWWB 3P9WB 5E1AB 2MKLC 3MRIB 3RRQA 2QQLH 1ZANH 3U82B 4UILH 2Q7YB 3R06B 2C7UA 2HG5B 5ELIA 4GSDH 4NKIH 5F7EL 5CEYB 5E2JA 4FFVC 1INQB 4X4MA 5IMMA 1HZHL 1FG2B 4OLZH 1C16A 3D0VB 5K93A 1FJ1A 2X40A 5H2BB 2NX5E 1YMMB 5KVGH 2K7PA 3MRNA 4OZHE 4NRXB 1KTLA 3PDOA 3T0AA 2Q1EA 1MCPL 2DQCL 2V2XA 3ARRA 2DTML 4B41A 4F9LA 1YNTB 2UV3A 2BY1A 1GHFH 3MR9A 3OR7A 3EOBA 5E4EC 4KKCD 3BYYA 1AY1L 2X2YA 3MRFB 1ZE3C 4QYOA 4IMLA 3IFLL 3AC0A 2H32H 5CP3H 1IL1A 3H42L 1N26A 3DX7A 2VXSL 4KJWC 3C87A 3O2DL 2CKBB 5IW3A 4OD2B 4WW2B 2WV3A 2AJUH 4HUWA 4HGMA 3C8DA 3TM6A 3MJGX 4U1NB 1XMWA 2K7QA 3ILPB 1GRWA 4ZXBC 5CD5D 2Y9RT 4O02H 4YFEA 4JRXA 3T2QA 1UGNA 4WFHE 1TVBA 3ZSTA 5C9JA 4ZQKB 2XZCH 4WNQB 4YE4H 2DWEB 4DVRL 1NL0L 1XGQA 1WZ1H 5FM5M 5LVEA 2WM0A 1FH5H 5CCKL 2WK2A 4QEGA 5C71A 1LEIA 5FOJA 4HK0A 3EZ8A 1Y18A 2ARWA 3MQIA 3Q6FA 3UTOA 4I1NB 3VI4E 2X4TB 1P4LB 4LNRA 5D70H 4YHIB 3VMNA 4OCXH 2D7NA 5T3XE 3FQNA 4PRBA 4ETQB 5TE6H 2BDNH 1AHWC 4JREC 3CFCH 4OFVA 2DQEL 4J4PC 1DBKH 1CS6A 2CR6A 2JF1A 3CFIC 1IARB 2LFGA 1P5UA 1ZWIA 3BPCB 4P5KA 2QSTA 4GRWF 4NBZB 3L3HB 4DCQA 1OAYH 5DRXA 3QDGB 4TTDD 5DUBB 2UWEA 3QEHA 2D4FA 1A4JB 1EFQA 4WU7B 4OT1H 4H5SB 5DUPL 1A6TB 4QCIA 3TVMA 1BFTA 4PJ9C 5DGQA 4JFQB 5HGHA 3M1BB 2J8UA 4XB7A 4TUOA 3L5JA 4XNUL 3QG6A 2E7LA 4E9LA 4H8WL 2R0ZL 3EAKA 4QXTB 2E5EA 1AGFA 5AZ2H 3T08A 1ZLSL 4JO2H 1B4JH 5I8CA 4K94H 1RU9L 1FAIH 4AH2A 4AL8H 1IM9B 4YUEL 4MCZB 2E9BA 4PJAE 1I9JL 3CZJA 3DWTA 5CSZA 2E8YA 1U42A 2R1XA 4PJCA 4G8IB 3MFFA 5I0ZA 2D03H 1IGMH 3BD5A 2ADFH 3B9AA 4CU8A 5HHMD 3T4YA 4HJGA 1NGQH 5K9JL 3F7VA 2HVJB 3ARGB 1FNSL 2HN7A 1GGBH 4K9EC 1OAUH 4M5ZL 4LF3A 3IXAB 1B0WA 1C1EH 3KPNB 5D2LA 3NFNB 3RWEA 4HSQA 1T20B 3T2NL 1K4CA 4RIRA 3VFWB 5I18H 3ARBC 4OKDA 4X6BB 3I6LE 3GMPA 3ARXA 4QHNB 5D9SA 2LV4A 1WT5C 1FGVH 1UA6H 2QQLL 3RWFB 5IBLC 1J11A 4L8DB 4UILL 2DS4A 2LU4A 5IQ7H 4NKIL 5FUCC 2R1WA 5E8OB 3CX2A 4Y5YB 5ID1B 4PJBE 3KXFB 1T2XA 4OLZL 2BMKB 4R2GB 4P99A 3RIFF 2VR5A 3BFOA 3MGOB 3RWGA 5KVGL 4BSWA 5LG1A 2JCCA 3CXDH 4HGKC 1RD6A 4EUPH 3GB7A 1N5AB 1ZA3A 1QEWB 4X5WB 1P7QB 4QWWD 4CW1B 1DVFA 5JHDD 1YQ2A 5EO0B 2DF3A 1PLGL 3W9EA 4Y5VA 5IVXA 3CFEA 4TULL 3RY4A 3WS6A 3O3BB 4D0CA 5BRZD 1BJ1H 4WEBH 2OTWB 1L4IA 5FUOL 1AO7E 1T21A 4Y1AE 2FR4B 2VZTA 3KPPB 1H5BA 5T1DL 2IBGA 3DUSA 3VXSB 3LEXA 1NEUA 2XI9A 1NUNB 1NANH 2AJUL 3MBXL 1R0AH 2DICA 2XA3A 4L3CB 2APBA 3KPMA 3DTXA 5EZIH 5J11C 3QUYA 1UZ6F 2Q87A 3BQUA 2XZCL 4F80A 4PGCA 4YE4L 3SDXE 1YMME 5H8DA 3KYMB 3PL6B 1WZ1L 2E7MA 3PWJA 1FH5L 4U1SA 1TITA 3V5HA 2FIRT 2FJGA 2EKSB 1YUHB 5D70L 3C6SA 5IWLC 1XIWB 3U1SH 1NMCB 1ZHNA 5TE6L 2BDNL 1PY9A 3BKYH 4AM0B 3QAZB 4I3RL 2A0LC 1IAOA 1DBKL 1N8ZB 2PR4H 1KENH 1RJLB 3QDMD 2CDEA 4TNWK 1KELH 1OAYL 4HC1H 3QEUA 3DX9A 2C4FT 3BWUC 1CD1A 4RRPA 2X9YA 4DKFH 5CEZH 5DVMA 3N06B 1EFXA 4OT1L 3VXRE 4FQPA 3G5YA 2MNUA 2ZPKL 1ZVSA 1MHEB 2VJXA 1ZXQA 5C07E 2L7UA 3DRQA 1PKQA 4QRPD 3BD4A 2RIKA 3PIQA 2BOBA 4PV8A 2PN5A 3TZVA 5IK3B 5F8RC 3VWJB 5F9WB 5AZ2L 4PREA 4JO2L 4J3VA 1KSRA 5JO5A 3MV9B 1AGBA 1ZT1A 4K94L 4RAHA 3G6DH 5FCUH 2P24B 4AL8L 2OP4H 5C08B 3GSQA 5F7MC 1DQTA 1A22B 1UADC 2IBZX 1OGAB 2X1XR 4IOIA 3A0OA 4H20H 2V5SA 4JDVB 4KVNH 5ICXA 1UJ3B 2D03L 1EO8H 2Y36H 3U4AA 1IGML 5B39G 2ADFL 4BK4A 5JIIA 3ULSB 5JPNA 3OXRB 4Z7VB 2IH3B 3FQXB 2E7HA 4P4RB 3KDMB 1SY6H 4PJ5B 1EH9A 2X4PA 4P57A 3AU1A 2DJ4A 1OAUL 5JXAH 3VXUB 3QDGE 4JZJA 5FK9B 1T1YA 1PZUB 4O58H 1C1EL 2FJFA 5F72S 5K33A 4OZGF 2IH1B 3LRGA 5A40E 1FSKC 5I18L 2AQ2A 1DDHA 3HKFA 4RSVA 2BNRB 4OCWL 3F58H 3MJ7A 1U8LA 1KULA 1UA6L 4Y16A 4QOKD 1AC0A 2APFA 2HWZH 3NZ8A 5IQ7L 3DUHA 2PYEA 4HFWA 4WI8A 1MNUH 5EIIA 2VXQH 1D5ZB 4Q6IC 4LSSH 5JOPD 3QWQB 4DGYH 2DOCA 1A7OH 4G7YH 4MB3A 1P4IH 3CXDL 1FZOB 4FQJH 3FQTA 5GGRY 1G0YR 3BPNB 5I1DB 4MWFA 2VSCA 1SYSA 3SDDD 1FV1A 4OM1H 3DV4A 5D7JC 4P9HC 1VERA 5CSBA 1OCWH 5FGBA 3ULUC 3CU1A 5I9QB 3T0EB 1EXUA 2MMXA 1S9KC 5ECJE 4WEBL 4PLOB 1U3HC 2HTLC 4R4BA 1NFKA 3PABB 1QTYT 5C09D 1AGCB 1NH6A 1F8TH 1DE4B 5L0QC 1EDQA 1T0NB 1R0AL 3BPLC 5C6WH 3O41A 5GRVK 1VSCA 4MAYC 1NDMB 4M6MH 1S7XA 5HHPB 3W2DH 1I7UB 2MJWA 4W6XB 1F4XH 1TPXC 3ARDD 2UY7A 3GJFA 3KXFE 1C08B 1JTPA 1LP9A 5EZIL 2OJEA 3WHE1 3MROB 3C9NB 3PP3K 1I9EA 4L8CB 1T5WB 4JVWA 2NY2C 5D7IE 1FN4A 2R2HA 5MEND 1FZMB 4NT6B 3RWIB 5ICYB 4XRCB 5E6ZA 4I2XE 3HZKB 3D69B 1L0YA 3U1SL 2PXYD 4U1IB 2VYRE 5KN5B 2AJZA 1U8NB 3A6OA 2DIJA 5TF1H 3O0RH 1FDLL 4ZAKA 1H8NA 2PR4L 1KENL 4NQVB 1H0DA 1ZGLM 4JFEB 3VXSE 5IT2H 2NY1B 4OZ4A 1K4DA 4XCYB 5HDBE 5I71B 1KELL 4YEEA 4HC1L 1P53A 3V6OE 5CSGA 5CEZL 4DKFL 5EU7E 3WL9B 4MD0B 3QB7C 5A2FA 1JHTB 3RWHB 5DHVA 5LGJB 4MQSB 2BVUA 1A64A 2ATKA 2XG4A 2N7BA 3GJEB 3T2PA 3TN0B 3JVGA 3GMLB 4LHUG 4GRWB 4LCYA 5E2TH 2EYSA 5LQBL 1UC6A 2EDJA 3BP6B 5DMIH 3DURB 4P5TD 1P2CA 2X4QA 3EUUA 5AAWA 2H1PL 3GIZH 4NQTA 3G6DL 5FCUL 1QR1A 2OP4L 1M1SA 3MPCA 4JY6B 3CAFA 4NO3B 2E8ZA 5EU3A 2GJ6D 3L95A 4JG0L 5IJVA 2N1KA 4OFKA 4N0UA 3IS0X 4KVNL 5GS3A 1EO8L 2Y36L 5KSBF 2VZSA 1HHGA 1D9KB 4G9FE 1K9TA 5ACMA 1SY6L 2VISB 4NQEB 4RQQB 4U1MB 1M4KA 2X6MA 3IAPA 3P4MA 4WGVB 1OD7A 2RBLA 1FCCA 5JW5A 3S3PA 5JXAL 2YBRA 3WDIA 4OCSL 4O58L 1XF1A 1AXTH 5LAXB 2HLAB 3GBMH 4UT7H 1H8OA 1NPUA 1KCUH 4NDMB 1XFPA 2Y1VA 4ISVA 5D6CB 4DZBB 2LAAA 5ENWB 3UDWC 2HWZL 3JTTB 5KOMC 5GRVL 1MNUL 3MV9E 2BSED 2VL5B 3DETD 5JZ7D 3U6RB 4MNQA 4LSSL 3D48R 3FL7A 5C08E 4DGYL 1A7OL 4G7YL 1OGAE 1P4IL 3DBXB 4JFXA 3O3DA 4FQJL 4RFNB 4IHOB 3BOVA 1OAKH 2IFFH 1JNNH 4PJEA 5EBLA 1QLRB 2GTZA 3MV8A 4Z7VE 3MRJA 4AG4L 2VE6B 1X44A 3KYOB 1C5CH 1OCWL 1MJUH 2DLHA 1NFDE 4MNGA 1HKLH 3KLSA 1ZT7B 3VXUE 5IHUL 4X6DE 1PGRB 4NFCA 3RPIB 3RJQB 5DHYB 4I77L 2N56A 3OG4B 4YDKH 1RHHA 4MYWB 2Z93A 2IJ0C 4MQXC 5FIEA 2AQ1A 4MDIA 5IFJB 3N1GC 3ARWA 4U6HA 3DMMB 1MI5A 4X83A 2BVOA 4H25B 5HHNA 1M7DB 3O9WB 5FA4B 4LQFH 3N1QC 1F8TL 4Y4KB 2FO4B 3LV3A 5I1JH 3RNQB 4WJ5A 4KUCD 1HH9B 2VLME 3IJHB 5CWSA 1NMBH 4JRYA 4TSCH 4M6ML 4OF7A 1JI2A 4ONHA 2YEZA 2BXZA 5FF6B 3DO7B 1KN4H 4ODBD 2EECA 5J89A 4AEHH 1I3RA 5SWSB 4JO3H 3EYUH 5IB1B 4FA8A 2CUMA 4KK9C 1XCQA 1LO5A 3RGVB 1ITCA 4JCLA 2GK0B 4Y7MA 5DJXB 3TPKA 2CUIA 4XNZC 5FGCE 1YA5A 1P84J 4YX2L 3T0EE 5IMKB 2DQFA 3MRGB 3EOAB 2ZNWA 5F71A 5ESAB 4LLWB 4FQXA 4KGLA 5ITBH 3GHBH 1RMFH 5TF1L 4F9LC 3O0RL 3V5KA 1T3FB 3RDTA 5J6GA 4NQCA 1W72H 5FM5O 1VFBA 2X1WL 3HA0A 4G6AC 4KRLB 3WE6B 5B8CA 4K71C 3OJDA 2VR9A 2ICEB 3GIVB 4GRLB 4Y4FD 1A14H 5L8KB 1J05A 3BKJH 3L9RA 1UXWA 4F15C 2B4CL 4XTRD 5ALCH 3U46B 5D7KE 3MLTA 4BFIA 2VITB 5A3ID 2A73A 5EBWA 1QLEH 1KPUA 1V5JA 4L1HA 1JP5A 3NIDF 1MCIA 5E2TL 4RNRB 5T5FH 5DMIL 5DDHB 5J13C 4P9ML 3HE7D 3MJ9H 4L4TB 1ODAA 3LH2H 4HJ0C 3DSFH 1GXEA 3FQRA 4F33A 5IB4A 4YBLB 4E41A 5IVNA 4Q74A 1P4BH 5B3JF 4XGZA 4UQ3A 4HZLB 4N0RA 3K2MC 4M93B 4TNVF 2EDXA 3W11C 3PHQA 32C2A 3CSGA 1ZOXA 4HS8H 1LO0L 1I8LA 3V8OA 4XNQB 4I0PA 3LY6A 5F89B 1TETH 1YJDL 3F6IA 5F3HA 1AXTL 1FQ9C 3F7YA 3KPSE 5ADOH 1FIEA 3GBML 4UT7L 1RUKH 1U2CA 5IB5A 4ZD3H 3HTLX 5IP4A 3KPOA 1TNMA 5JNYA 2Y5TA 1S8DA 4GRWE 4JY4B 1HH6A 2AJSH 3REVB 3IT8D 2AEQH 2W9LA 4D3CH 1I1AC 4TUKH 4OZGB 4P59H 1CLCA 4HH8A 1FVDB 3UTSA 1T80A 1BVZA 4X5XA 1FZKA 5I1HH 2QHRH 1IAKB 1S9WB 2ZOKB 4GBXD 1OAKL 2IFFL 3L3KB 4X7EC 1IT9H 2OXGA 1GCFA 1BWWA 3P0VH 3O6LH 2FLRT 1C5CL 4FXGA 1Z9OA 1MIEL 1MJUL 3QXAB 2ZKHH 1DBAL 1T1ZA 4JVPA 1HKLL 1MFAL 3T0WA 4Y0GA 4OF3A 3T0VA 3DXAE 1Q9WB 4FFVD 4WEUD 4YDKL 4Z7QF 5DEZA 4BSVB 1I7RA 4OIAA 1KLUB 2AV7B 3VA2C 4RZCA 1QRNE 2I5YH 4Z7UB 2HFEB 1RZIB 1TQBC 1AJ7H 4JAMB 4PV9B 4LQFL 8FABA 4LCCB 1A7RH 2CH8A 4NPYA 1E6OL 1O0VA 4TSCL 4D0DA 2DTSA 5LKNA 1W2KT 3VJ6A 4L8SB 4UT6H 3QIBC 1S9XB 3UTZA 1KN4L 2F54B 4AEHL 1MCBA 4LVHB 4APQB 1U3YA 1FL3A 5BZDB 5D72H 5C0CA 4JO3L 3EYUL 4NN6B 3GBLA 3EHBC 5HYQA 5C0FA 2ZCKH 2UYLA 2RJMA 2A2QT 1MCWM 3K2UH 1T7XA 2AI0H 4XC3H 2I07A 2IAMB 2XXCB 5FDWA 1RZFH 1HQRB 3