3ZLQC

Bace2 xaperone complex
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
112
structure length
112
Chain Sequence
b'QVQLQESGGGLVQPGGSLRLSCAASGFTFSSAIMTWVRQAPGKGREWVSTIGSDGSITTYADSVKGRFTISRDNARNTLYLQMNSLKPEDTAVYYCTSAGRRGPGTQVTVSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-SECRETASE 2
molecule tags Hydrolase/immune system
source organism Homo sapiens
publication title Beta-Secretase (Bace1) Inhibitors with High in Vivo Efficacy Suitable for Clinical Evaluation in Alzheimer'S Disease.
pubmed doi rcsb
total genus 30
structure length 112
sequence length 112
chains with identical sequence D
ec nomenclature
pdb deposition date 2013-02-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3zlqC00
4XBEL 4HH9B 3T3ME 4FTVD 2XKUA 3FQXB 3QPQD 5EOTB 1IM9A 3N85L 1NGYA 4JHWL 4OFPA 3CXHJ 4QHNB 1Z3GL 4O9HH 4MS8C 1EAJA 4C4KT 5IMMA 3EYQD 2AEIT 3MRLA 5K9JH 5HGHB 3JUYA 1HEZA 4X6CF 3VXPA 4KJQC 4MA7H 4ETYA 2VXQL 5IM7B 3HAEG 4JRXD 1AE6L 2HG5A 3REWB 4GAYB 1D5MB 1GC1L 5HY9B 1MI5A 3C8DA 3QWRA 3WCYA 4ZPVA 1GYAA 4Y5XB 3MJ9L 4LL9A 3C5ZC 4BK4A 2HJKA 3BN9D 4X4XB 1Q94A 4M1DL 3VI4F 5KVFH 2X4OA 3IFNL 4M6MH 1T1XA 3WV0A 1BJ8A 1RJYA 1WAAF 5HHOE 2BVYA 3ARXA 5D6CB 4X4MA 1RV6X 2B4CC 5DF0A 5JIHA 5BQ7A 2CD0A 4HJ0C 1RUQH 4JO3H 1GHFL 1EERB 4ZO8A 2V5MA 4U1GB 3EYUH 5C8JA 4GSDH 4GAGH 3SKUD 4HWEH 2E8YA 5HGAA 4GSDL 3TO4D 2W0FB 3L3DB 3OBAA 3WUWG 1GOHA 3ECBB 3STBA 5CBAA 1WTGT 3SGKC 4NYLB 3AFLA 3X3GH 5HDBE 2BOBB 2Q76A 3CMOH 4FG6C 4FP8L 3OXRA 4PLJD 3V6FB 5D7JB 3H7LA 1X4ZA 4OBRA 5F8QC 1S78C 5E08L 2Y06L 3QHFL 4DW2L 5T1LB 2Y9RT 5D6CA 4UIKL 5F7HA 2YD3A 5HHOB 1AP2A 1WK0A 4RFNC 3T65B 3TBSA 2X4UA 1D3CA 5LGJB 2ZP0T 1BZ7A 2FH8A 4NQVB 3HNVL 1YMMB 1JZ2A 2VLKB 4QRSA 1EO5A 1B0GA 3MO1A 3T0EE 2VYRE 1FG2B 3T3MF 4KHXL 3BZFA 1Q9KA 1KIQB 3MLTA 5I15L 2Q86B 3MJ7B 3DO7B 2O5YH 2BY3A 3VD3A 2XQBL 3LKRA 4KTYA 1RK0A 3E1F1 1HSBA 3QEGL 5MI0B 4LBEB 4NQCE 4KROD 2F8OA 2HKFH 1C5BL 4Q9BA 2XA8H 4RA3A 1ZLUH 1H8NA 1MNUL 5DZNA 2IH3B 4PJHF 4MVBD 1NCBL 1ZMYA 3QRFM 3V4UL 4PJAF 2XNAB 3QT2A 2MTPA 3L6FA 4DTGH 2UWEF 4GXUM 4OF0A 1AXTL 3TNNB 4U1IB 5IFAL 1UM5H 4YHKH 4HWNA 1ADQL 1ZS8B 3VD7A 1PAMA 3RWIA 1IGJA 5MEOB 3BZFB 1TVBB 4URTB 3WIHL 3MRJB 1K8IA 1A9EB 4X5LA 4X7DC 4P2RB 1KLGA 1IFHL 1S78D 1T04B 3S37L 5IW6A 2EH7L 4PJCA 2BY1A 1XGPA 2P48B 2GY7B 4NQCB 1NCNA 3H9YA 4KK6D 2CPCA 2J8HA 3U30C 1JZ5A 3BKCL 3MBXL 1PY4A 5CGTA 5GS1B 1Z6JT 5FYJL 3BKYH 4XVTL 4F57H 1IGYB 1BGXL 3R8QA 5EO1A 1D5BB 1H3UA 1A9EA 5IB4A 2CK0H 1YY8B 4N90D 1J0HA 4KRPC 3SN6N 3MLVL 4R7DB 4PRNB 3VFSA 5M7QA 1EEUA 3C9NA 3R06B 3KPSB 2VLRB 3L5IA 4Z0BH 2GJ6E 4AEEA 5E2TL 5E6ID 1B3JA 4OF3A 2X4TB 3GNMH 1U8HA 4UT7H 5DRXA 3OAUH 5CJOH 4KJQD 3T0EC 3CFCL 4LLWA 2E8ZA 4IMKC 3SGEI 4P5TC 1ZGLB 1MFAL 5HYSA 4N68A 3KXFA 5IVXF 2OS7A 5T3XE 3QQ4B 2LU3A 2WQRA 3GHBL 4MNGE 2Q87A 2D7NA 2NY0D 4GKNA 5TE7L 3IDJA 3KYAA 2XG5A 5D7IF 1EXUB 4LSVL 4XI5C 3RVTD 5SX4I 5J1SC 3OKKB 4NC0B 3WNMA 3VCLB 2IGFL 1I1AB 1DDHA 5CINL 5DJ0B 4PS4L 1CT8A 3EYVA 2D03H 1M7IB 5BQ7B 2H9GA 2VKWA 2J2ZA 3H9SB 2R0WL 1II4E 1Y6MR 3L3HA 3T2PA 4GXVL 4RX4D 1HZHL 1IQDA 4WFHD 1TZGL 1HSAA 3OJ2C 5MEPB 4BQCA 4R9HA 2QSQA 4L3EB 1U0QA 3TVMB 2X40A 3NVQA 1BWWA 3QFJE 4M7KH 4AIZB 1EEYA 4PJXE 4ZFZB 3EOAB 1E27B 3U0TB 2MKLC 5ITFA 2DDQH 4NT6A 4I4WB 4RNRA 1PYWA 3BW9A 4N5UA 2XV6B 5I18L 3VXPB 3U2SA 3O9WD 4Y19E 5KS9B 4YHZL 5DHVH 2B0SL 1D6EB 1HIMH 2CDEB 4FNLL 3GSRB 4OCRL 3I75B 5K59E 3MRMA 5F1SA 3FQWA 4KKBD 3P4MB 4N9GB 2CXKA 5GSVA 1QFPA 3F8UB 4M8QA 2HJKB 1R3JA 4RGOH 3AS1A 1JNLH 3ZHLA 4QRQB 2R0LH 3L3GA 3O3EB 3F12B 4M7ZC 3FT4A 1R5VA 3FRUA 2J3SA 5C07A 5EZIL 5ACZA 1I7ZB 3QCVL 1DP0A 4D3CL 5D5ME 3T2OA 3HMWH 1H0DB 1IC1A 3P0YL 4HF5H 1RU9L 3C5SB 5KG9A 2X4QA 2AK4E 2G5RA 4P9ML 4B7LA 1T5XA 4J3OC 2GW5A 1R3JB 3F58H 4XZUB 1QD0A 3TEUA 1INEL 3CCHA 4MA7L 2VXQH 2W65B 1CL7H 2ESVB 2PN5A 4YHOH 4OKDA 1Q9WA 4ZUTA 3HPJA 1CK0H 2ATPA 4KVNH 1OQOA 5I30L 4YDVA 4YZFF 4KWUA 1XIWC 3DOSA 4XNZC 4Z7UB 4PJGB 1WIPA 5DT1L 4MAYD 1FGVL 1P6FA 1H8SA 4GMTH 4I8DA 2W60A 2GCYA 2BMKA 3VXUD 3HI5L 5T1KA 3C60C 3LQAL 3UYRL 1CIDA 1OSZB 3QNZA 4EOWH 1R3LA 4XAWL 1X5HA 4LHJB 4WU7A 3T77A 5KSAC 5C0AB 1Q38A 1VSCA 4UNVA 4HUWA 4LVOC 4OZHA 2AJVH 3IVKA 2Z91A 4UOW1 2W59A 3JWDL 1UT9A 4O5LH 4PREB 1IAIM 3OF6A 3W0WA 1Q8MA 4XC3H 3O2WH 1CD8A 3OJDB 3MA7B 3KHOA 4U2ZA 2NY5C 1F90L 2R1YA 4X9HA 3TVMA 2ADIB 1PQZB 4LSTH 2AV7A 3DV4A 2DTML 4EVNA 1S9XA 1QLFB 3TC9A 1ZK9A 5F7LB 1ZGLA 2RQ8A 2NX5D 2H26A 5FGRA 3KNBB 2AXGA 2F74A 1KNOA 1RUQL 2DQUL 3DX7A 4JO3L 4ZTOL 4WFHE 3T09A 3TBVA 5JHLL 3H42H 4G8GE 2ED9A 4G9FE 3OHXA 5CILL 1UH4A 1WBZB 1FDLH 3CC5A 1F6AA 1MFEH 1I3RB 3RWEB 1EXUA 3QDJD 1FO0B 2VITA 3V52H 4QOKD 2J88L 5EO9A 1VADA 4NGHL 4YC2C 5DK2B 5DRZB 1X5GA 4QRPA 1SJXA 1FYTD 4K2UH 3WO4B 2R1YB 4WWID 4KFZC 3RVVD 2F53B 2R2EA 3VXQB 2IBZX 2MHAA 4Y4FC 1RULL 3UP1A 3GIVB 2EYTB 4XBPA 4QY8B 5CGYC 3B2UD 3ES6B 3R1GH 4FQHB 2NXZD 4OD3H 5ISZD 1G0DA 2Z91B 5ERWB 4ZQKB 4Z7UE 4P5TD 1FVDA 4ERSH 2Z31B 5HPMA 3OX8B 4G6FD 3I6GA 4Y5YA 4H8WL 3VGEA 3W2DL 1PLGL 4ZUUB 4EXKA 2KBGA 1C5BH 1X4XA 1WCQA 4KQ4L 1QSFD 5T1DL 5EU4A 1I9RH 3MV11 2F19H 4M7LT 4MNGA 3L1OL 4HGWB 1CDYA 4PJGA 4BZYA 1DBAH 1WFNA 3P2TA 2YZ1A 4K8RH 4LSRH 5F1IB 2A6DB 4JO1H 1UA6H 1QBBA 1L0QA 2AK4A 4Q58C 3FO1B 2ORBH 1PW3A 5E2WL 1CGYA 1U8LA 2B5IB 3IJYB 1W72H 3U1SL 1OWRM 4J3XA 2JJSA 3DX9A 5GISH 5MEPA 1H3GA 4TSCL 3CAFA 2J6EH 4S1QL 2DN7A 2EC8A 5JIPA 2UUDH 1XF1A 2DLTA 4HUMB 2X1WL 4G9FB 4XMPL 4LLVB 1TJIL 4PJGF 2HT3C 2WWKO 2HJLB 2RGSA 4KI5D 2AQ3A 4LVHB 4UTAL 3NZHL 5I19L 4RISH 3K1KC 1YEGL 3OKYA 2R2CA 2OQJB 2ZCKH 5EOQL 1SJVA 4QXGH 2DICA 1M6OB 5EOQH 1RZKH 3L7FA 4Y4HC 4JM4H 4RA0C 3RWIB 4F7EA 5FECB 4JFDE 3O2VL 4DGVH 35C8H 2PYED 5H35B 5CZXC 4EN3A 1WEJH 3SKMA 4C83B 1F4XL 1OTTD 1AHWC 1KB5A 5FCUH 5D9SA 5BXFB 2R0WH 3HFMH 3OKMA 4RRPG 5CWSA 1MIML 2GJJA 5AWNL 4DAGH 1ORQB 4UNTA 3IDIA 1ZXQA 2QQQA 3KXFD 3UZEA 1HCFX 4HIEB 4ENEC 1NGQL 2FIRT 3BPNC 2OTUB 3LPWA 5BRZA 3MV01 4HFUL 5B8CC 3OKDA 3BGFB 5K9OA 3O6KH 3LEYH 3GSNA 3QSKB 1GOFA 1JGVH 2NW3A 1DBBL 4YFDB 1L0XA 3MUJA 1RUKH 1T5WB 5FO7B 4X6CE 1K5NA 5ANMA 2N7BA 4R96A 2KQNA 4NM4L 5EZJA 3AAZA 5C0CD 3QI9D 4M3JA 1UXWA 3V6OA 3D6GA 4JFFB 3AVEA 4OCWL 1P2CB 5C0ND 1G6RL 4FHBD 4NHCH 2IG2H 3K7UA 3B2VL 3MRFB 1YEGH 1KOAA 4Z18A 4G8IA 2R0LL 4WGVB 4NKDB 1K4CB 1A21A 1SEQH 2Y07L 2LTQB 3HMXH 4JZJC 1KEML 4P59L 3MLXH 2D7QA 1YMHB 2APBA 3BKML 1MI5D 3MRNA 1QVOA 4I3SL 1VEMA 4LOUD 4LLYB 5TE6L 3FTGA 5FUOH 1SM3H 3AB0B 5DRNB 1IARB 2A6IA 3SDYL 2Y23A 5TGBA 1GHFH 3UTSB 1GZPB 3KJ4B 1KLUA 4UV7L 1WUNT 1DQJB 1LE9B 1EMTL 4OIIL 2ZUWA 3I6LD 3BQUB 5GS1C 1M71A 3C6LC 4PJXF 5F7UA 3VFPB 4JKPL 2NQCA 2A0LD 2A9MH 3U79A 5C0BB 1IFHH 4XXDB 4MMZC 2GT9B 4N1EA 5BZWB 1YJDL 4JG1L 2VRAA 2BSSB 1Q0YL 2EDFA 2E7BA 2YD4A 2YA0A 2P8LA 4ODSL 3RGVD 1MPAH 4JFZH 1JHTB 3M1BB 1U8JA 4BA8A 4PB0H 3ZZ1A 1IGTA 5JHDB 4Z76B 4KK9D 2Z8VC 4KZDL 3UXFA 5EZOH 2IPKA 5L6YL 4S1RH 2R0KL 3QAZC 1N0XL 4FXLA 2FEDD 1XF2B 5FYKL 1ND0B 1IE5A 1KN2L 4XXDA 3QG6A 4XWGL 2X44D 3F7RA 4XVJH 1KTRL 3L3IB 4OCMC 3MNZB 3SGKA 2VNCA 4MXWL 3M1BA 1D7FA 1QFOA 2VLLA 3JSSA 3IYLW 1XF3A 2AJSL 1VEPA 5BS0B 1F4WL 1MH5A 2CDGB 4NZUL 4HFWA 2DLEA 4J3UA 5E0QA 4AM0A 4J1UB 3GBLA 4JFOB 4R96B 5C86A 3FN0H 4RMWA 1G84A 2WAHA 3QWOB 25C8L 4JO4L 5E7BA 1NUDA 5L8KB 1D5IL 2XTLA 3VFGL 3MCLH 3IAQA 1FIGH 3CDGA 3HE6B 3B43A 5EU5B 2O5XH 1BAFL 4J7RA 4X5WA 2PW1B 3NABH 4Z7WF 5IK3B 1U3YA 2Z35A 4N0FB 3MLRL 1WWBX 3E6HB 1XGTB 4ZOBA 3NACL 3CFKA 5CIPA 1NC2D 2C5DC 4U49A 3LEVH 3CSGA 3RTQA 3H8NA 2YUWA 1IC4H 5LBSL 5F89B 3H9HA 2XFXB 3T2NH 4U1SB 2DLIA 1QBML 3O8XD 2YC1B 3LRHA 5AG9A 3EOTH 4I1NB 5TPWL 4YIQA 5HI5C 3AMLA 3RHWK 2QHRL 4L4TE 4BH7A 2H1PH 2MQ0A 4HIJB 4AT6A 1D9KD 3MUGA 1FRGL 4F15B 1EFXD 3TN0D 4OV5A 1MI5E 3K46A 4IDJH 1LE9A 4CU8A 3BIKA 4JPKL 5FA4B 3A6CL 4JM2A 1JWUA 5JDSA 4YR6A 1UXWB 4IIQA 2Q7NA 3D69B 2FDBP 3I85A 5C09B 3OB0H 1AH1A 4ZOCA 2C3WA 1TENA 5J3HD 3BSZH 4NO0D 2D7PA 4DZ8A 4HZAA 1NAMB 4NPYA 3RWFA 1FFNB 1REIA 2XZZA 4JLRB 2YBRA 3WYRA 3FB6B 1FNFA 2OSLB 3U0PA 1RZ8A 3BD3A 1DTUA 1J0KA 2BX5A 4XBEH 3DX7B 3ALWA 3KLAB 4G6MH 5BJTB 3ZE2E 5GGVY 2A6KA 4KMTL 1I8KA 7FABH 4JQIL 4KTEH 3STZA 2AI0H 1CFSA 1ZSDB 2FSEB 1MHCB 4P2QD 1CFBA 4YXHL 3S34L 1WSST 3GIZL 5IBUB 4X98A 1JGLL 1HHHB 4FFYL 1DL7L 2VLMD 2YD1A 2VMFA 1FORL 5EO9B 2XZAL 1IRAY 3UC0L 4LSPH 5I6XB 4B53A 3KLDA 1BM3H 2YS4A 1BF8A 4G7YH 3GSVB 4HXAH 1CL7L 1A6WH 2HVJA 3BPLB 5JXEA 5I1CL 2BCKB 4I18B 3QDMA 2DL9A 5I8KH 1CLZH 5FK9A 2V2TA 2DBJA 1HXMA 1GGIL 3S5LB 3ARFD 4QHLB 5C2UB 1FBIH 2Q7YA 5IFAH 4WGWB 2QQLL 1U3HB 2ZUQB 3PP4L 4L4TB 4K94H 4V2CB 3VDCA 3LQAH 2AJZA 3VMNA 1KJ3H 2E7CA 3KNBA 4XX1E 5C0RH 3ARBB 2ICWB 4JGJA 3MBED 3S96A 4RISL 4JFHD 5T1KB 3RZCC 4XAKD 4I48B 4N0UB 1A7NL 1RJLB 2R0ZH 3KPRA 5LCVH 3U48A 4L4JA 1T1ZA 5HJ3B 3WFCH 4BJLA 1C7TA 4Z7VE 3E3QC 2XN9A 3ARWA 3CX2A 3O2WL 5FYLD 5CEYA 4AENB 3FKUS 3FQTA 1ETZA 3WS6C 4GH7B 4WW1B 2MSPA 3JVGA 43CAB 3DURA 2AS5M 3BEWA 1ZHNA 3NZ8A 4M1CC 4MA3B 1H15A 5JXEC 4MXQC 2ESVA 4UTBL 3TYGL 4ORGB 3VWKA 2X41A 2X1PA 3ZL4L 4ZMAT 5IOPA 2NXYB 3HHRB 4OZHF 1FYTE 3PHQB 4WUUD 2BFVH 1XIWA 5DLMH 3WL9B 4LCCB 4HEME 2AV1B 2PO6D 3MRKB 5AAWA 5FHAL 5AYUL 5ICZB 5E4IA 3ULVD 3OV6A 4N8CH 1I1YA 1VFOA 3U36A 3KPLB 2OTWA 1NCCL 3BPOB 1UENA 3SGJC 1YN6A 3P4NA 3DMMD 1BWMA 4LRNH 3L7EB 3LN5A 3E8UL 2C9AA 5MEQB 4PPTA 3TESA 4AEHH 1A14H 2VWEC 3X12A 2ICWA 3PWPA 4KUCF 3IKCB 4PY8I 4BFIB 1NLDH 5IB3B 2ZOKB 1YEFL 3KPTA 5A2JH 2AP2A 1QFHA 1OQXA 2VC2H 4HDIB 2NY7L 2SEBB 5ABDE 1X7QA 4LCWD 4OQTH 4YPJA 2FSEA 4WFFE 3D0VA 3ZKXC 1WTLA 5BCAA 5KVMC 3KPOB 4NQEB 5IEHA 5F7FA 5DWUH 2CIIB 15C8H 1MLCA 2ITDA 1MAML 4JFOA 2WWKT 2GJ6A 3E3QE 1PQZA 1FO0L 5E9DB 3FO0H 3PE9A 2WMPA 4UAOC 3VA6A 1TJGL 1SY6H 5HI5D 4YQXL 1IKFH 3CSYA 3VFSB 1W0WA 1YEKL 5I6XC 3WHE0 1KJVA 3H9ZA 3RX7A 3OHXB 5C0GA 5K9QG 4EUPG 2BVPB 4F9PC 4N5EC 3JTTB 1GAFL 2D4FA 3WE6A 3VGAB 1WFTA 4TQEH 3QZWA 4GG6B 1JIBA 5C6TH 2C3HA 3MUGB 4F7CB 1I1RA 2ICEB 4IJ3C 2OLDA 4JHWH 1MJJB 4GKNB 1DQQB 2XG4A 3RIAK 5IMOA 3CFCH 3C2AL 3TZVC 1YNKH 3HE7D 4Z8FL 3OKEB 5EUKA 5GGSA 4F37K 4KZEL 3OKKA 4M7LL 3K3QA 5EOCJ 2Y7QA 4RAHA 1FLRH 2PYEE 4OLUL 3VJ6B 1B88A 4OUUB 1Q9WB 3NZHH 3O9WC 4P57A 3BH8A 2YD7A 4E41B 2XN9E 1HK6A 4I5BB 4H5SA 3ZE2F 4OM1H 3P0VL 5IVZA 4NPYB 3RWFB 4Y4KB 3RPKA 1HXMB 1OB1A 2EE2A 4K23L 3MRJA 1RIUH 2W60B 2P5WB 2DYPD 5J0BA 3WNNA 5J13B 4R90L 5KSBE 1W72A 4ODVL 4XP1H 5FCUL 5CEZD 4J3SA 2I5YH 5BW7C 3IJSB 1F4XH 3U82B 4AEFA 1J1PH 3SKOA 3JWOL 3CSBA 5BVJB 4H0IA 4FABL 4GBXD 4Y88A 3SDXF 2R56H 1ZSDA 3PWVB 4ZUTB 1W0VA 2P4AB 4JFPB 2V5YA 2VLKE 1OP3K 5KS9A 4Y2DD 2BHUA 3BH9A 3FT3A 5GHWH 1FC1A 4YO0A 4WWKA 4BELD 1INEH 5INCB 3VXUE 2QQNL 3RGVC 4LKCA 2C1OB 3TO2A 3QIUA 1BP3B 2VDLH 3CDFA 2VDLL 2Z93A 2HMIC 1XR8B 2ZSWA 5FDWB 5IVXA 3CFDA 1LMKA 1YY8A 3FRPA 5D2NE 4DUVA 1OGTA 4X8JB 3KWWB 4J3TA 5TH2B 2QTEA 4WO4D 1IGJB 2Q76B 3HC3H 5C9JB 3TBWA 2X4TA 4PV9A 3QUKA 3RWHB 1MY5A 4OD1H 3BT2L 1AGDA 3EOAA 1MCWW 3L3OA 1KBGH 1CLOH 4OLEA 1S9YA 1UB5B 1MCOH 4X0KA 3W81A 1IJ9A 3EHBC 5F7DA 5EU6D 1BJMA 2DD8H 2VABB 4DN4L 4NNXA 1AO7E 2GKIA 2P43B 4U7SA 3UAJC 2YUZA 1GVIA 5BMFH 4FQLH 3ET9F 3JTSB 2VLJD 4XHJC 4NBZB 3S4SA 2BDNL 4ONHA 5B3JF 3EHBD 1S7RB 4IOFC 4MLIA 5A16A 1R5WB 4PRIA 3O3DA 5BZDA 2JLLA 3QIWB 3O3BB 4A6YA 3DI2B 3DHJA 4U6XA 4JVWA 5I1EL 3MV8A 4YK4C 2X4UB 3SKJH 5L2KD 3RDTA 2ZUSA 4QF1B 1G9ML 3CXDL 4PBXA 4ZG1A 3MJ8B 1EBPA 1BFSA 5E1AA 1NMAL 4PJHA 4DKEH 1LK3L 5EU7C 4YFEA 5D1ZB 1N4XL 4QCIB 2ARJQ 2BNRD 4FQJH 3EOBB 2IPTL 1DANU 1E6OL 5GJTH 2VXTL 2D3VA 5KSVA 1S5IL 1MJ7H 2KPNA 4Y7MA 4MVBC 4FQ1H 3HRZB 4P3CH 1SMOA 4LLAA 3T0DA 1OTSC 2FHBA 4ZFGL 3BEVB 5IB1B 1NKRA 1MHPH 3TJHC 4QTHB 2I60H 4PR5B 3TA3C 4ALAH 5HYJB 4Y4HD 3MYJA 2D2OA 3NIFF 4HCRA 3BD5A 4U1JB 2QQKH 2ERJB 4HGWA 2C4FT 2OK0L 3LN4A 4JG0H 4K3HA 3JV4B 3X13B 2DQCL 3IRPX 2X42A 3U4EA 1FE8H 2DQEL 4NCC1 5FDWA 1A4JA 4QHUA 2W07A 5T3ZH 3U9PH 1LDSA 3MGOA 3WDJA 1L6XA 3MNVA 5CEZH 5D8JH 4KRNA 2HVKA 4Q74A 4WIQA 3S36H 4XVUD 3GK8H 2CR3A 3OPZL 2QLVB 1OCWH 3MRIA 2VDML 3D0VB 4P2YA 1V7NL 1G9NH 1RJZA 2ATKB 1PZ5B 1LO0H 5HGHA 1KGCE 3U6RA 3W5NA 4PGDB 4BSJA 4F7CA 1JPGB 4DVBA 1KF9B 3D3VE 4AY0A 3MACH 1QLRA 3KGRA 1KBGL 1P69B 4ODWB 4YH6A 3OXSB 3L9RB 4LKCB 3NMEA 4NUGH 4KJWD 4MJIB 2FECI 5DQJB 3TA3D 4PG9A 2FGZA 1KJVB 2UZXB 2EXYC 4HLZG 4I2XE 5DHXB 3VMPA 4OCSL 5IB2A 2AK4B 1NEZA 4YHIB 2VKXA 2BVPA 2IQ9L 4YQXH 4D0DA 4XPFH 1WEJL 5E99H 2HFGL 2VISB 4LVHC 3JZ7A 4L9LB 1UZ6F 1Z9SA 4YHLH 5ESQA 4BZ2L 5B38G 1VGKB 1G7IA 1HQ4A 1QRNA 1FVDB 5J9PB 5F88A 1R24B 6FABH 5D2LB 4AMKH 1RAMA 3U4BH 2WNGA 5EU3B 1R0AH 2AW2A 1HH6A 4O58L 1W0VB 5DK3A 4PJBE 4BFEA 1NAML 1BQUA 5D96B 4XVSH 4IRJC 3F7VA 1NGPL 1YEIL 4RMRA 4X6EA 3DECA 5FUZH 4MDJA 4HBCL 2B5IC 3O11B 4WU7B 3QIBD 3PXHA 4Y19A 4HAFA 2NY6D 3FRPG 5I1HH 2P5ED 1JN6B 2W0KA 2CRYA 4APQB 2JB5H 2DQIL 3MBXH 3QR2A 1FP5A 4BKLA 4ZAKA 4I2XA 4MLSA 3UO1H 3B6SB 1Z2KA 4JN1H 4JANB 2F5AH 3CIQA 3FB7B 5DXWA 4IMKA 1J8KA 1FYHB 2YEZB 4LSSL 4FNLH 3W9DA 3RZWA 5HHME 1YQ2A 4H1LB 3EOYG 5ENWA 1NFIA 1OGAA 2MPAH 4M6ML 4QYOA 4QO1A 3QPXL 1KIUA 3JV6A 2VDRL 2CIKA 2OP4H 2H2PD 4BFGA 3BZ4B 4ORGA 1JF1A 3C60D 4M48H 3V5KA 2BSED 5IW1B 4YHPB 1XEDA 2I24N 5FYLL 2ZUXA 3SKNA 2HLFC 1YPZB 3RY6A 5IB5B 3KLHD 1CDUA 2PO6A 3VE0A 5C0JA 4L3CA 1NBZA 1LK2B 4QY8A 2IGFH 2E9WA 1HN1A 3AGVA 5FYJE 4XPHH 4JZOA 1KTDA 5IKCA 1WC7B 4G3YL 3SE4A 2W9EH 4MJ6B 1J9CT 3F5WB 3QQNA 3MOQA 4P5KA 1DBJL 3N9GL 1LILA 1J5OL 2AGJH 4ZTPL 43CAA 1U8OB 4P46A 3RX8A 3C60A 2VZSA 1NJ9A 2VZUA 3GMLA 3DX6A 1NDGB 2WBJC 4UDTA 4XP6H 2XN9D 2IQAA 4RAUB 4ZUSA 3P77B 2MOVA 5CZKA 4K3JL 1WBXB 3HG1D 2VXUH 2OMNA 3DTXB 3PGFL 3VE0B 5IOPB 4NUJA 4CDGC 3UMTA 4L9DA 1JK8B 5GRJL 4YHMH 2HFTA 4Q9RH 1A3RH 1XGYL 3WJJC 2AJZB 5DMGD 3VXMB 2X09A 3V5KB 1ZLWH 1X5XA 2ZJSH 1VADB 5GRXG 2ORBL 3RY6C 3CH8A 3I50H 3RUGB 3JWDH 3Q6GL 4U4BA 3EO1B 3ARFA 4NRZA 3RVXC 3PF2A 1MCDA 4U3CA 4PJFA 5CJQL 1D5ZB 5DEGB 4HIHA 4S0TD 3OG6B 4PJEA 4HJGB 5HGBB 1TVHA 2P8MB 4YX2H 2JK5A 3GGWA 3V5DB 4HIIB 1JGDA 2IPTH 5IEHB 3BRFA 3PWNB 1NCDL 3B3IB 1MHEA 1MCPL 3CK0H 3F6LA 2C4FU 3WNLA 1D9KC 3W9DB 1LEIB 3PHQA 4MJ2A 3GSOA 2V17H 4TPRL 5SX5K 3FQUB 1DLHA 1CTNA 4ELMB 4V1DA 4X99A 1Z0NA 5BOPA 3CGTA 5DJZB 2WIMA 1BQHA 4DGVL 1GAFH 1PY9A 2OL3A 4Y1AB 4OQTA 1FNHA 2NLJB 5DJCA 5E2TH 3QEGH 2NY0C 1QSEE 3U83A 1OP9A 4K3EL 1QR1B 1HOCA 4M1GH 4LEXL 5C6WH 5HYQB 1J88A 2H9GB 4OFYD 3NIDE 1PGRB 9CGTA 4LAJH 4PY8J 1AGBB 4RAVA 1CGXA 4OFDA 5JW4Q 4F9PA 3TPKA 4ZS6C 3DMMC 1KV3A 4PGBB 4F7PB 4UZGA 4IM8A 1CFQA 1FORH 1PYWB 3T0WA 4OFIA 2Q7YB 4HIJA 3F7QA 4JPWH 3WEXB 5E5MA 1XF3B 5TDOA 3L1OH 3X3FH 5IIEA 4QGYA 3OXSA 3GJFA 4JQIH 3O2DH 4K7PX 1EO7A 1NFDE 3IFPA 2YOCA 5IROA 5IB4B 4MXQD 2BCKA 2OR9L 4L8SC 4Y16B 3MRDB 2VLRA 3HN3A 4ODUA 3LKNB 5GGTL 3OG4B 1CE1L 4Y19B 3V9FA 1EEZB 2CSPA 2R1XA 4OCYL 1SBSL 2UV3A 4KK8C 3GUTB 1NBVH 5KBNC 5E2VL 2KZ1B 1Z3GH 4Y4HA 3CFEA 3VGHA 3BVNB 4A6YH 3BP4B 4KV5F 5BJTA 3WLBB 3LH2L 5CZVH 4HKXA 5FB8B 4TYUA 4KI1A 3IAGC 4P2OD 3VFUA 1S7XA 2EEBA 1J8HA 3V4VH 5E8PB 1HHHA 4DFHA 4MXVF 1FNGB 1I7TA 2ERJC 2EDYA 3B9KD 3MXVH 1IGFH 3ZE1E 4CW1B 2G5BA 1BD2D 4LU5H 3L3DA 3DURB 5C07E 2XRAL 5F7WC 2YSSB 1OAQH 3B6SA 4IRSC 5BMFL 4R2GD 2HVJB 4FFZL 4R4FL 3UPRB 3H42L 5I1LB 4WW2F 3F7YA 4ONGH 3RDTD 4X8XA 5EN2A 2P24B 4HK3N 3MMEB 4TVPH 1EGJA 2RR3A 1UH3A 2GFBA 3FMGL 2J5LB 1U36A 2CK0L 3QUYA 1NCCH 5JHDE 4PRID 4KY1L 3BESR 1BZ7B 1N7ML 4DZBB 4P49A 3DXAD 1RURH 3OKLA 1OY3B 5A2FA 1A1OB 2BSTB 3MZGB 3PL6D 4O02H 5DVMA 3NN8B 1Q9KB 3T2QA 5AZ2L 4LQFH 4XVSL 4KKAD 3VFPA 3KWWA 5LGHH 5F88B 2DQJL 4CN1A 5KTEH 2K7QA 3O0RH 4OD2B 4PJEF 3VXTB 3GSXB 3EJYC 3V7AG 3DUUB 2YWYA 3QIWC 1F45A 4D9RD 1B4JL 4XNQB 5EA0L 4LRIC 4PJ9A 1JHKL 4ENED 5BVPL 5JUEL 5DI8B 2XWBB 3CZFB 3PGDA 3CVHL 3ARDC 4IMLB 1NCTA 4JRXB 3VFWB 3PWJA 1CVRA 3WN5A 1X9QA 3HB3D 2VB5A 2YPVH 3AMKA 3EYFB 4Q0XH 1QP1A 1F97A 5K9KB 4PS4H 1FV1A 3L5XL 4I0PB 3RVUC 1KPVB 4P2OC 1KB5L 1T2JA 5EN2B 2EDJA 4RGMC 4U1MA 4AT6B 5E1HB 2CR6A 1IQWH 3ZTNH 3OKOA 2OR9H 1N5YH 2Q3ZA 3FONB 3TA3A 4DZBA 1ORQA 5GS1A 4JQXA 2HT3D 1INDH 3GSNL 3MRLB 3KR3H 1EHNA 1A7PL 1RUPL 5HHNA 5AD0A 1E4XH 3C5ZA 2CLZA 1HHIB 5C09A 5I8CA 3QPQC 3REWA 5FYKU 1ZTXH 1MWAB 3MRRB 3QCUH 4MJ4A 1GH7A 2XTJD 1E6JL 1ERNA 4C4KO 1Q1JH 5CBAB 5D7LB 3A67L 3UDWC 3VFRA 2FX7L 1K4DA 4XMKL 3CH1B 4QLRA 5GZND 3ALPA 1L9NA 4JFPA 2VC2L 3S37X 3A6BH 4MJ5B 3WN5C 3GI9H 2EE3A 1LD9B 3O3UN 3QFJB 3EW3B 3QUMB 3HPLA 1BREA 2Y07H 3LIZL 1Q72H 3UTOA 1LO4L 2VZ3A 4HPOH 4JJHA 4G8FB 3F7YB 4QRSB 4PTUB 1MUJA 1K2DB 3ARED 4NN5B 5JPMA 4IS6B 3VFMA 3G5YA 3MLZH 3TCLA 3T04D 3FOMB 5GZNC 1DUYB 3TBVB 4JRYD 2VWEE 1SYVA 1TFHA 3QIUD 4OGAC 3HNSL 2NY2D 4WV1C 1GJIA 4ZFFA 1CLYL 4N0UE 3DVIA 3IFOA 4CVXB 1AGDB 1JGVL 3IFLL 4KK9C 2V9RA 5EBLB 3MGOB 5DURB 5HDQL 1NANH 1INQA 1LO3L 4X6CA 3GHEH 2PXYA 4GBXA 3IDXL 4IJ3B 2XIDA 3T0EA 4D0BA 1NGPH 1S9WA 1YEIH 4HS3B 4HCRL 4PJ7B 4PJ9B 4Q97A 1JGLH 3QUYD 4JM2C 3SKMB 1KPRA 4U6VL 4ZQKA 4MJ5A 2X1XR 4LPYA 1IT9L 3TH2T 4YXKH 2BSRA 1CGWA 2BNQE 4BQBA 3LMJH 3MROA 4H8WC 3DRQB 1ODAA 4HPYL 2XZQL 4JFDA 5IVOA 1PKQE 5ALCL 4WWKD 1K3IA 4G9DB 4NQDE 4F9LC 5E8OA 1SYSB 4Y2DA 3IFPB 1KCUL 3HR5B 4RGNC 3UCRA 1A22B 3NZ8B 3WXWH 4C54A 5AYQA 4R90H 3WUWB 4XBGA 1JRHI 3NPSC 3BSZL 3DETD 2CRIA 4XB7A 3UTTE 3LS4H 2GHWB 2HTLC 3LS5H 1GGTA 5L0QC 3OAYH 5T1LA 4Z7OE 3EKCA 1UWXH 3VJ6A 1KEGH 4XWOC 2NY1D 4N8PA 3MA7A 3H3PH 5DMGC 5E6ZA 3MRFA 4JB9L 4W70A 5KSAD 3H3PL 3P73B 5C08A 3WHXB 5IT2H 4L1HA 1QSEB 5A3ID 3HNTL 2ADIA 5FGCE 4AIXA 1UVQB 3WKML 1WBXA 3S35H 7CGTA 2VDKL 3SDXB 4LNRB 1QLEL 1WZ1L 1MHHB 1CBVH 2FATH 3BWAA 3PWPB 1G9MC 3VFUB 4K7PL 4J3WA 1KCRL 4MA1B 2VO5A 2DIBA 3L3GB 3PGCB 4WHTA 4HH8A 2FJGB 2NXYC 5CZVL 5D1QD 5ITBH 2IBBA 4JCMA 5FHBH 1XH3B 3FL7A 1T03L 3MBEA 4XCNB 2OJZH 3LKOB 2FIKA 3S8WA 1F3DH 3TVMD 2P8PA 3D25B 3NFNA 1JE6A 2WUCH 4JY4B 2ZCLH 4N1CA 4PRPD 4WY7H 3ILQC 2R0KH 4BSVB 3HI1B 5I16A 2B4CL 1S5HA 1IEBB 5F6HI 3VWKB 3OF6D 3UJJH 4H20H 2BY2A 1NJ9B 3A6CH 3O9WB 4P57B 5CIPH 4CNIA 3V7AE 5DQ9A 4UI2A 3B8SA 1NGQH 3UJTH 4J4PA 4HIIA 3OZ9L 4PRBA 1PG7W 5I76A 3WFHA 3BUYA 3QEHA 1KJ3L 4UU9A 3S36X 3RZCB 3O6FB 4OF5A 4S1SH 5C0EA 3QRGH 1I4FB 4GKZB 3P73A 5C08B 3KYNA 1EVUA 4R97C 5CEZL 5HPMB 3GMPB 1T0PB 3CMOL 3S35L 4WVRA 2VDKH 4D8PA 4XH2A 3Q6GH 2VAAB 5EB9A 2LE9A 4JDTH 3LVEA 5DYOB 5I2IA 3E2HC 4OQ1A 4X7TB 4G80A 1S7UA 3BP5B 3PABA 3QYCA 4NJ9H 5ICZA 3TIEA 4I18C 1T3FA 4JFDB 3WJJA 4NQSB 4R26L 5MEND 4NNPH 4OZFG 5FYJH 4HXBH 1G1CA 1A1MB 5ELIA 3MV7A 5L2JB 4RFOL 2BNQD 1YEDB 4MHHI 2G9HA 4ZFGH 4D8PB 1LO2H 2X4NB 4POUB 5EO0A 3RY4A 1QZ1A 1WLHA 3B9AA 5A43C 4JFYA 2HWZL 4NQDD 5DYOA 4V1DE 1I7ZA 4OZIB 1N6QH 2V7HA 4X9IA 2DJSA 5JLZB 5C07D 5DFTA 2BY0A 3HZMB 4TN9A 5IEKA 1G7IB 2EIBA 4DGIL 1IILE 5ILTH 5GGSY 1UVQA 3GB7B 3UROR 2YBRB 3VH8G 3RUGA 1QHPA 3G6JE 4X6DA 2IQ9H 2PW2B 1YEEH 3O6FC 3GMNA 3MV7B 1KJ2B 5DVLA 2PCPB 5CGYD 2QSCH 5D1XD 1KFAL 5K9QI 3LEYL 3KYMA 4UIMA 2F54E 2FX9L 3OR6A 1T7YA 5T5NF 1TETH 5TE7H 3Q0HA 3G5YB 3TCLB 3PWLB 2GY5A 5BRZE 4LSVH 1ZAGA 2AXFA 3QCTH 2RFXB 1EHAA 1JGDB 4OFKA 3RWJB 4NOFA 5E8DL 3ZLQC 4PB9H 4PREA 4CUCA 2OL3H 2VE6B 3A6OA 4QRRB 4F15C 3I6LE 5CP7B 1F3JB 3WXVH 3V0WH 5CJ5A 2ENYA 1Y6NR 1IAOA 2BVQA 1CFTB 3DMMA 5D7SH 3JUZA 1S9WB 4PJ7A 2A9NL 4GLRI 3LRSB 2LU7A 1YDPB 1JZ7A 2WUBH 3C09C 3INUL 4OLVL 1RPQA 4LNRA 2NLJA 5GZOD 5JQ6H 1NSNH 5ICYB 1UYWL 4FQCH 1B6DA 1KCSL 3MRQA 4HX1A 5ID0A 4QOKB 5FM5M 2J6EL 4S1QH 5EBLA 2HN7B 4NFBA 4OCRH 2IH1A 1FYTB 4ACPA 1FFPA 4UQ3B 1VKXB 1FO0A 2VITB 3X11A 5IFHH 1DUZA 1I1FA 3O4LE 2Z92A 4ZSOA 5DRWA 1HYSD 5D93B 1UJTA 3MLWH 2D7TH 2NY3D 1RZKL 1NQBA 3QO0B 3WUWA 4ZXBB 5LXGH 2PF6A 4PJ5A 4G42B 4G6FB 3WIFA 3MV9E 1V3MA 4DK3A 3P11H 4RGNB 5GGRA 1CU4L 2Y25A 3ULUH 2I9LA 1YEJH 4PBVC 2APVA 4B7IA 3MXVL 4LMQE 4YR6B 3BPLC 4KJYA 4U1IA 3RKDD 2DJUA 4QGTA 3QFJA 3BEWB 2QSTA 3DSNA 1OAYL 3DRQA 5IP4A 4TSBL 1KT2B 1TVBA 4XNXH 5KVEH 5FO9A 1QEWB 3CK0L 4HFUH 5HTSA 4ZAKD 4CVZA 4LLQA 4MZ3A 4MNQE 1T2QL 1OGAE 1RZ8B 1EJOL 5CLTA 4HV8A 1DQTA 1MQKH 5FOBB 3QQ4A 1Q94B 4C56B 3NCBB 4Q9QH 4HLJA 1X44A 4PGJA 4GRWB 3L3OB 4ZFFB 4X6EB 2ZKHL 4RMVA 3U4AA 5DLML 2XWTB 4HIXL 1RULH 1AFVH 3HI6H 3P30L 2W9LA 4N8VB 3HI1A 4NRYB 1BZ9A 1RY7B 3IF1B 4WU5B 1I8LA 3O0RL 5DD5H 3J7HA 4JRYE 1UM6H 5B39G 2CMRH 1M4KA 3P9LB 2H8PB 2AJ3A 2F58L 1M1SA 3C6LB 2NW3B 3ZKMC 4P9HH 4JY6B 4K55A 5T3XH 4J8RA 1IQDB 3QJFA 3TF7C 2ZJSL 2EYRB 4HJ0D 1T22B 1XZ0A 3N1PC 5IHZB 2X4RB 5EZIH 2YSSA 2DQHL 1AKJB 4WDIB 1BFVL 5DI8A 5D2LA 1ZVSA 2YMXH 3BPCB 5IHUH 1BVZA 4NQVA 4E41E 1UCBH 3AXLB 3ETBF 5FECA 1DQDL 5HYJA 4HUNB 5I8OL 1A2YA 2H32H 2QHRH 1K6QL 1U8JB 3KXFB 1FL3A 2VDQH 3VXNA 4XCEA 3UPAA 2CDFA 4JM2D 5I1GH 2VQ1B 1IEHA 2EYRA 1FL6B 1MFEL 4YFLI 4MS8D 3JV4A 2BSTA 1KC5L 4BQ8A 5EFIB 4GG8B 5FDYA 3SDCC 3SO3B 4TSAL 4M1GL 4LIQH 3CFBB 3EDJA 2QEJA 3AS0A 3UYRH 1CZ8H 1P7QD 3L6FB 1YMMA 1EHXA 4FQJL 4ISVA 1VGKA 4A2MA 4PR5A 1QQDB 4HUVB 4MD5B 4UUJA 1VA9A 5ETUB 2WLYA 1J8HE 4JFFD 4MD0B 5CLWA 5B8CB 4LSUH 1UB6A 4GXUN 1RVFH 1HSBB 1FH5L 3BIKB 5B4MD 3G6JB 3RIFF 2HLAA 4Z8FH 3CH1A 4QHMB 3VH8B 2AEPH 3BYYA 4MDJB 2FR4B 4OIBA 4PGDA 2J8UA 3QWRD 2JCCE 5C92A 1KTKE 4DQOL 1MJUL 4Z7WB 2BRQA 2YD2A 5KZCB 1DUZB 1G6RH 1MWAL 2VDQL 4Z7VA 3IDYC 3B9EA 3X3FL 1JPSH 2VL5B 2DBLL 5EZLA 2OCFD 3KPQB 1IKNC 2QKIB 2FEEI 1A5FH 1H5BA 3BQUD 4ONFL 3UTTB 3VFNB 1BFTA 4QT5B 4G9FA 3ORJA 4IEFB 1MFCL 4ZS7L 1FIGL 4N8VA 1FJ1B 4NRYA 2J7LA 1AQKL 1YN7A 3GFUA 3V0AC 2WWMD 3WFZA 2DDQL 4NRXB 4TTDC 1BIIA 2X4PB 1U92B 2C4XA 5FUZL 3S88L 4TUOA 3RL1B 1GOGA 1RK0B 2QQLH 3VI4E 4EN3D 4XNUL 3QJFB 1DE4B 1HNGA 2AEQL 3FO2B 1E4JA 4U1KB 2Y5TB 3FB5B 5C0CA 1VENA 1AJ7L 3IDNA 3MFFA 5HI4C 5TE4L 3GSOB 5DA0B 2R4RH 3QUMA 1T66D 4ZDHB 4J6RH 5EIVA 4F58L 1BBDH 4KVCL 2IAMD 3DARA 4UDUA 1TETL 5SWZE 1M05B 2HTKC 4X5XB 3RAJL 1EUUA 1XGQB 5GQBA 1EHLL 5T1MB 1JI1A 1RZ7H 3PP3H 1MNUH 3HUJB 2KH2B 4XPHL 3ZTJH 3WKNA 5H35A 2LTQC 2UVEA 1CG9B 3ARDD 3IXTA 1DQQA 3D18B 4PJFB 2DBLH 3RWCA 2VXSL 3VXTA 4D9QE 3WIFB 1IC7H 1RIHH 3LKSB 3P4LA 4M5YH 3S4SG 2M2DA 3QO0A 1F58H 3ZT6A 4WI4A 2CKBB 1HHJA 4MCYA 2UY6A 3ES6A 4AL8H 2FH6A 4XB8A 2FZ3B 1NFDF 3LN4B 4JG1H 4MMXC 4MQ7A 4K3DH 3OKDB 5FYKE 5E03A 4ODHL 3X11B 3MUY1 5F7YC 1BX2A 2WSKA 4M00A 1CICA 1ZA3A 4WW2B 5IHBA 5KSBF 3WO4C 5E2WH 1F4YL 1BOYA 3DGGB 3QUXD 4KDTA 2OMBA 4GRWE 5I1IL 1CBVL 1YYLH 4G8GB 4HV8B 2IFFH 3ARGA 3VI3F 2AERT 2R29H 4IOFD 4HZLA 5JLZA 1MIEH 3FAWA 2CGRH 4GAGL 4HWEL 3CLFH 4XHJD 1NAKH 5FCSH 3FN0L 4YDLC 4P5TA 5CSGA 2X2YA 1B9ZA 3D39A 1RZFL 3IF1A 3ZKNC 5ISZA 4X6DB 5EFIA 1FZJB 2DLHA 1IAMA 3EYOB 3QG7H 5DJ8B 4LLQB 4AG4L 4ETQB 4YGVB 4H26B 3GM8A 3T3PF 4OF6A 4M62H 1IGIL 3FT2A 1R3HA 3LQMA 5EWIL 2BRRL 3O45B 3QXDA 3BP7B 4MDIA 3OX8A 1EMTH 1I9IH 3KS0H 2FGWL 1LQSR 3QFDA 1U8QA 3MCLL 1JVKA 4ZNEE 2CUHA 4OT1L 4Z6AT 1FNLA 4OLXL 1QA9B 2W9DH 4LPXA 1DJSA 1G1YA 4P2RE 5BO1L 5EIIA 1N5YL 1Q0XL 4MCZB 3MNWA 2HFFA 1CFTA 3W82A 2EE6A 2NX5A 2R2EB 3FN3A 1J87A 4TULL 3O4LB 3TFKC 2R8SL 2V7HB 4Y5VC 1VERA 4DKEL 4MQSB 5GGUA 3UYPA 2C3VB 3DTXA 4ZXBA 5EBWB 1DN0B 5H37H 3UBXA 1S7VA 2IBGA 1UM6L 4TUKL 2ZPKH 4PP2A 4RAVB 3QDJE 4LAQH 3WD5H 4M5ZL 3W0WD 4M4PA 8FABA 1B4JH 1G7QB 3N50A 3VXOB 3H9SE 3S6CA 1S7QA 2ICEA 5EUOB 4QXGL 4FQLL 2MQ3A 4ZYKA 3MV9A 4Y5VB 1MELA 3BMWA 1ED3A 1R5IB 5IMOB 1RQ5A 3L3HB 4OZ4B 2GJZA 2Z31C 4LLVA 5DMJB 2YMXL 1A3RL 4ZS6D 1PLGH 2GITA 5L8LB 4R0LC 3BP7A 1W0YT 3WJLA 1A7QL 3LZFH 4RSVA 3T4AA 5FGCB 1YQVH 5FGBC 1UEMA 4OIAA 1VFBB 5D71L 3BE1L 1QSFA 2CQVA 3QFDB 4I9WE 1IAII 3SDAC 1A0QH 2W9DL 2WK2A 1BGXH 3GMPA 1D5XA 3HUJF 5J3HC 4QYOB 1YJDH 3VXOA 3ARBD 1C8PA 2DM2A 1ZANL 4MQXC 4ZPTB 1A6UL 1J0JA 4RX4A 3RBGA 5H8DA 4X7TA 2FBJH 4R6UA 2E7MA 5ICXA 2JIXB 2V9QA 6FABL 3IJHB 2KQMA 3SE3A 3KPMA 2EH7H 5J56B 2EIDA 2ICWI 2LVCA 4L3CB 1C12B 4RFOH 2AXFB 4MAYA 4NQEA 3HZKA 1KELL 4QRPD 5CKGA 1CXFA 3MUHL 1E6OH 5GS0L 3BO8A 1KTDB 2OJZL 1A7OH 4EJ1C 1ZHNB 1U92A 4KTDH 4XVTH 1IM3B 2V2XA 1X5IA 3HAEA 4K3GA 3K81A 5GGTH 1T21A 4FFVC 2O5ZL 4QRTA 2HKFL 5TE6H 2B1HL 1YYMH 5JA8B 5J6GA 1G0YR 1ONQB 4CADA 5HVGB 4QTIH 3KPRD 3AM8A 3BZEA 1YNKL 4WEMB 4NQCA 5DUPL 3ROLB 2C7UB 1XH3A 1F3RB 3OKNB 4GAFB 1ES0B 1MEXH 4L4VA 4TRPL 2WBWB 4KQ3L 3ARGD 4JGMA 1CTOA 3VFTB 3D25A 3NFNB 2BJMH 5GGUB 2OSLA 2ID5A 4X5WB 1HKLH 5JNYA 3TYFB 3QHFH 3BDXA 5I16B 3G5ZB 1TCRB 3U9PL 4TULH 1XIWB 5FF6B 3MRPA 4LCYB 4P2CG 1HWGB 1VGEL 1X6LA 5L88H 4R7DA 1K85A 4XAKE 1V8HA 1DUYA 1P4LA 1PKOA 1U95B 3WFCL 3ZE0F 1S7WB 5DDHB 2NMSA 4JFFE 5FYLE 4Q6YA 1ZT7A 4KPHL 4J6RL 4F58H 4HUVA 1PJ9A 1QO3A 1U6AL 1KENL 1MHPL 4IRJB 2EIZB 1KCUH 5DQ9B 4KJPD 5KOMC 4G8EB 3NH7H 3D69A 4FTVB 3MV7E 3QHZH 4NNYB 5CILH 4YPGA 4P5MA 4M7ZB 3BD4A 3G04B 5IFHL 1IL1B 4WUUE 1E28A 4XP4H 1UM5L 4YHKL 4K7PY 3JV0A 1VCAA 3E6HA 2GCYB 4NHUA 4NQSA 4U6HB 1DLFL 1RZJH 4X4YA 2MWCA 3U0WL 2WLZA 8FABB 3E8UH 5DJAB 1T7ZA 3GHBH 4MA3A 5HHNB 4NO0A 4CU7A 1T5WA 5FO7A 5HVWA 5I2IB 1P4BL 4UINL 1BVKB 2A77L 1NLDL 3SGEH 1IBGH 2FJHB 2Y5TA 4OI9A 5L88L 4FQQB 3DGCR 1Z9LA 2ADGB 2FD6H 3O11A 5IR1B 3AREC 4XNQA 4G6ML 1ZLWK 2FWOB 3TN0A 3VG0H 4KI5F 1QQDA 1A6VH 4NKDA 3SY0B 1PEZA 1SHMA 3TYGH 4M7LH 5IFJB 3SCMD 2MCPH 3QH3A 1KPUB 4CVUA 1C08B 1KG0A 1MREL 2GSIA 3O9WA 2VR4A 3VXRE 4HBQA 3V8CA 2OJEB 1R3HB 4M93B 3SQBA 4U3XA 5DSCA 1JJUA 1CXLA 2C3XA 3KYOB 5IV2A 2UWEE 2Z35B 4EIGB 4HMCA 3SDCB 2F9BT 3BGMA 4Z7OF 4R4BA 1BPVA 3MA9L 4G43B 4BH7B 4PGEB 2YC1A 3EFFB 3CFJA 3P4OB 5DHVB 1AI1H 4PP1C 4OT1H 1EVTC 4LEXH 1FDLL 1DFBL 3WSQH 1YMMD 4AQ1B 3KPSE 3VXRB 1A6TA 4GW1A 4NSKA 3QO1A 1YJDC 3NACH 2FJFB 2QQNH 4ZUVB 1PG7L 4D0BB 3ARDA 4WDIA 4MJIE 4KRPB 1PFCA 3J8F7 2VXVH 2DKSA 3KPPA 3HB3C 1IM9D 1BFOA 1OF2A 5K9JL 5HI4D 3M8OL 4UIKH 1MWAA 5IM7A 5DJ6A 5EOCH 4BZ1H 4YDKL 1IAIH 3UTPD 2V7NA 3Q5OA 1FL5B 2Y1VA 4LSRL 2L4OA 4U1NB 3GO1H 1J7VR 1F6LL 4FQCL 3P3YA 3VFOB 1LO3H 3Q1SL 4JO2L 3SDCA 4XCCH 1ZHKB 3ISWA 2GTZA 2WUBL 5I1AA 1N8ZA 3IGAA 3X14A 1N6UA 5IMKB 1DQLL 1SEBA 5C8JB 1PSKH 1HQRB 4N8CL 4LARL 4IRZL 5GRUH 4KK5C 3ULVH 5ADOH 2BNRB 5HYSG 3ULVL 1CR9H 1MFDH 5E5MB 5TDOB 1I3UA 1ZOXA 1QO3B 2GIYA 4NJAH 2XICA 4PJFF 3RDTC 1X5LA 3DVNB 4PY7A 3PWVA 2RJMA 3BKJH 4P4KA 4KROB 1JYVA 12E8H 1FVEA 1JF5A 5DFVD 1ACZA 3NTCH 5JZ7D 1AC6A 4NNYA 3HRZA 3KXFE 2FEDC 1P9MA 1R3KB 5C0BA 4IMLA 2AXJA 5HHVL 4P3WA 1KG0B 3OB0K 4M1DH 5F21B 1B4RA 1JPST 4YDKH 5AZEL 3QDGB 1W8NA 5F7MC 5KSUA 4O9HL 2YXFA 5AEAA 1ZHLB 4HK0A 2QKIA 4OSUH 4RFNB 3FO0L 5D5MA 3RY5A 4D9RE 3LQZB 2AGJL 3FQRA 1JUFA 3MR9A 4FQ1L 3LOWA 4NC2B 4W6WB 4L4VD 1MCIA 4UV7H 5IB3A 3GBML 4P2QE 1U41A 3DVNA 3ROOA 3TWCL 4GMSL 3RA7H 3X13A 2DB8A 5L2KE 2C7UA 2VLME 4TPRH 3CX5K 4NQCD 1LK3H 3EFFA 1DQJA 1MVUA 2Z9TA 1G6VK 1B0RB 1OAXH 1OP5H 4FQPA 4M6NH 1CLZL 1R3LB 3MJ6A 4FZEL 2FX8L 5HGDB 3FB8A 4HC1L 3WL9A 5TFSL 2MFNA 2R2HA 4XMKH 5BRZD 3NIFE 4KQ3H 1IL1A 5E4EB 1TIUA 4PJGE 5BOZG 1LEGB 5ALCH 1DEEB 4FTVA 3E6FB 1D5ZA 5DEGA 1CF8L 3LD8C 4L3ED 5I9QB 1DBMH 2CKBL 1OARH 3MYZA 3BP5A 2ADJB 3KPSD 4LOUC 5D8JL 2ATPB 4NN7C 3C8HA 4TOYL 5GS2D 2PCPA 3WEXA 3VRLF 2FO4B 3TO4A 2JJWA 4E5XA 3ZKMD 3CFEB 3P40A 5IF0A 2SEBA 4AJ0A 4KQ4H 2ZWLT 2JIXA 5DC4B 5MENA 4LPWA 4LP4A 3VXME 4NO5A 2OX5A 4S1SL 1WV7T 3SGDH 3KPOA 3FT3B 1VESA 4OF8A 3EFDL 3F6IA 3Q5YA 4F33B 4ODUB 1TZGH 1AR1D 4KKLC 5JW5B 4KKNA 4QXUL 4NSKB 5IG7B 2OTWB 3KPLA 4WI7A 4KY1H 5F70A 5F96L 2VZVA 4JDVB 2R1WA 3HZMA 4RIRB 4JRXA 3VFWA 1L6ZA 1QR1A 2H3NA 1CDHA 3CSYB 1L7IH 1FNSL 1X5ZA 5D1XA 4ZAKC 2IANB 5IUSA 3IU4L 1KB9K 3QIBB 2CO6B 2DWEB 1RZJL 5FHBL 2FECL 4GRWH 4K2UL 4I18A 3MV9D 2NY6B 1W72B 4PGZA 4V1DB 3O4LA 4X99B 2PYFB 5T3ZD 1TJHH 3JWOC 4C57C 3NCEB 4KPHH 3BHBB 5J6HB 4W4OA 3NBNA 3QG7L 3DROA 4HG4J 1LGVA 1CFQB 2YD5A 4W4NA 2WIIB 1MJJA 4YLQT 2BK8A 3E2HB 2Z8RA 3WNOA 2O61A 4IOIA 1JWMA 2OI9B 1KJ2L 5EUKB 5GGSB 4TVPE 5DJYB 2Z93B 4LCWE 3K2UH 1MCWM 3D5OF 4G42A 5D1QA 2E9BA 1DL7H 1MCNA 1PKQB 3NCJL 3ZDYF 1VFAA 4J4PC 4WI8A 2GJZB 5FM8A 5F9DC 2E7HA 4AK1A 4HIEA 2ZG2A 2DKMA 4OGYL 4PD4K 5JOFB 1G7JA 1KT2A 4GOSA 2VSCA 1INDL 4YDVB 1D6EA 1SJHB 4G7VL 3CFIC 3P4NB 4I77H 5IIEB 4I3RH 3RU8H 3BPOC 2XYCA 2OTPA 5EU7E 3BX7C 3FHQA 1WIUA 4OLZH 2VLRE 3ZE0E 1ZTXL 1DLHB 1EZVY 1RUML 4LCCC 4NWUL 2DQIH 3I84A 2BMKB 3UBXB 4QRQA 1ZLUK 4MA8L 4HXBL 3VMOA 4EI5B 3QXVA 1NFIB 1OGAB 3HC0A 1KN2H 5E4EC 3UEZA 3QUZA 3BT2H 4PJBF 4HUWB 1JF6A 4F8TA 1UACH 4WENB 4MA1C 4PJEB 3BZ4A 1PDKA 5CBEA 3RNQB 4G6KL 4DKAA 4MAYB 1X5JA 3WO3B 3PDDA 4NO5B 1U91A 5JPNB 4XI5D 3HG1B 3G08B 3NIGF 3JXAA 4OUOA 3MXWL 1OAYH 3PQYB 1S9KC 3VD9A 3B83A 2AJUH 3IB4A 5ILTL 4EZMA 3SDDD 2Q3AA 2FLBT 1F13A 5I1DB 1CICD 4NC1E 4JN2B 2AXGB 3VXMD 3N9GH 5B38A 3HPJB 2VJXA 4PRAA 3RWGA 3SBWC 5L0QB 3QUZB 3T0ED 3B5TA 3GMOB 1BQHB 4MJ6A 3ZT5A 3QDAA 5JHLH 5KVDH 4N9OB 1ZHBB 3ULVF 1UCTA 4KDWA 1OM3L 5ISZB 3HKFA 3VXUA 4QHLA 5F1OB 5D2NC 5DMKB 5ICXB 2HT2C 3DUSA 3ULVC 3TGXA 2BVUA 1OLLA 5IBTH 4JRXE 4XH2B 1CE6B 3L3IA 2CRZA 2IJ0C 3U46B 1S8DA 2FJGA 1SEQL 3FFDB 5GGQH 3VRIB 4JCLA 5E24E 3ZTJG 1SVZA 3UO1L 2E6PA 3N0PB 5IG7A 5JOEA 1VB9A 2FCBA 4RBPK 3EYOA 4X6CB 1S9VB 5AYUH 3G6JF 4XWGH 3PIQB 1ZHLA 4QHUB 3DRTA 1OSZA 3GMRA 5H2BA 1NUNB 4QTIL 3IS0X 3OZ9H 2F53D 1U8IA 2V7NB 5J1AB 5DD0L 4WI2A 3FO9B 4GMTL 1FGVH 3QRGL 5EO0B 1CN4A 5GSRB 4HS8L 5JOFA 4JVPA 3OGCB 5HSFA 1BZQK 4GW4A 5KN5B 1LEGA 4LMQI 4DEPB 1FCGA 3MRIB 1KACB 5DMIL 1NCUA 3ZMRA 3T4YB 1AO7D 5TDNA 2I25N 5C0RL 4G9FD 3GBMH 3VWJB 4Z7QE 1I9IL 1Q0YH 2YRLA 1J1OL 4XT1C 5F97E 4N90E 4ZOAA 4ZUWB 4G9DA 3D39D 3I75A 4P46B 4R8WH 1BJ1J 4O2FA 5I1JH 2A9ML 3B9DA 4OLXH 2FLRT 1HDMB 4NQEE 1S5IH 2EXYD 2IADB 5CUSH 1TLKA 3GSQA 1U8PB 2IAMC 5DFVC 4PLKC 2UY7A 2W9EL 1LE5B 2LU4A 3EYSL 4LSTL 3WS3B 5F3BA 1ZT1A 3PXJA 4HXAL 4PRPA 4LVNC 3BN3B 1NAKL 1EFQA 1JYWA 1HSAB 1Y6KR 4FZ8L 4K9EC 5I19H 5SWQA 1HNFA 1NAMA 4D0CA 4EN3C 1CD1A 3GI8L 4Y16D 4NDMB 1DSFH 4H0GA 5DD3L 1B0WA 4O5LL 4GAYA 1QSZA 1CXIA 4TTDD 1U8KB 2DF3A 4JFFA 4K3JH 3LKRB 5KW9H 3O4OB 5MEOA 2X1OA 2I27N 5I18H 3Q6FB 3HE6C 1ZWIA 1A6WL 2XY1A 3EJZC 2GSIB 3W39A 3U7YL 3R0NA 2B20A 2K9UA 4ODTL 3TT1L 2NY1C 2J6EA 1R5WA 3TM6A 2P8LB 2NCMA 2Z8WC 1OAKH 1URLA 4Y2OA 3QI9B 4AM0B 4GG8A 4QHNA 3QQ3B 5JR1L 5JA9A 4JFED 1EA9C 2EO1A 4MNQB 1UWEL 1KN4L 1D6VH 1P6AB 1K2DA 4ODWA 3HZYB 4U1MB 1EAPA 2OZ4L 1WWAX 2DQEH 2JJSC 4P9HC 3FB8B 4Q6IB 3CDYA 4I0PC 3BWAB 4WWKC 3C5ZD 4U1HB 1ZVYA 5E6IA 1NBYA 4PJ8C 4NQTA 5ESAB 1RZJC 3EJJX 3RVWD 2QADD 3GEWB 4LSQH 1MI5B 3TLRA 3O3DB 5BZDB 5IQ9A 2R8SH 3S98A 4LRIA 4L29A 3VI3E 3STZB 3IDNB 1S3KH 4U1SA 4S0SD 5IMKA 1FZMB 2F8XC 2E6JA 5DJDB 4XNYH 1XF4B 2R2BB 5GS0H 2YPLB 4R2GB 2L0DA 4D0CB 5SWQB 1U93A 3BFOA 4NWTL 3ZYIA 5ETUA 4LHQB 4F80A 1VDGA 3CLEL 1QBMH 3CXHK 4M61B 5FHAH 3SOBH 4FQIL 2IF7A 5JIIA 4JQVA 1P1ZA 3DVGA 4PRNA 4LDEB 3O2DA 1GGIH 1HWHB 1NGWA 3TH3T 5KAQG 3MODL 1UZ6E 3QXTA 4I2XB 5I74C 1GZPA 4GUPB 2MCG1 1MRFL 3MOAH 3MROB 3ELAT 4ZFOL 4ZUWA 1IGCH 2IFGA 4UB0H 4NZRL 1T7WA 3ILPB 1EX0A 1ACYL 4JJ5A 5DUML 1L0YA 3QCVH 4OGYH 3X14B 4ZPVB 4LLUB 4GRMB 4TUOB 3RL1A 1A6TB 4GW1B 3JWDC 3TT3H 2L7JA 4WI6A 1CD0A 2D31A 5LCVL 4FFWD 5CEZE 1AY1L 4X4ME 5HYEA 2X89D 1V3LA 4NJ9L 2V6HA 5C1MB 4PJCE 3CMGA 5CCKL 5J4MA 3D39E 1T83A 2G75A 4NKQB 4JY6A 1RI8A 4OTXH 4DKFL 4JPIB 3KPPB 4ZO6A 1S7SA 4QF1A 1E28B 1OWWA 2YPLA 5CUSL 5HDBF 3UTQA 1B90A 5TQ0L 1DVFD 2AI0L 3EUUA 3CLEH 2AJYL 4PJ5D 1UB5A 3LDBC 5BS0D 3NA9L 1JZ8A 3ULUD 5L6YH 5SWSD 5EZOL 5TDPB 2XTJC 3CVHA 3W39B 1KPVA 4HUXB 4DVRL 4M7JH 2D7MA 1P4IH 1WZLA 4G8EA 5DD1H 3SJVA 2XA8L 1XR9B 5KW9L 3FCTB 3MCKA 3F62A 5F9WB 3C9NB 3R06A 4KGLA 2R1XB 4HCRH 4MNHA 1U8PA 4S2SA 3U9UB 5FOJA 1OAXL 1QBAA 1FG2A 4TVPD 1G9MH 1EAPB 3BGFC 2APFA 5K9KA 1ZT1B 3U7AA 4MA8H 1CDJA 5KJRH 4L8SB 3GNML 2FGWH 4QHKI 1U8LB 2P1YA 3PNWA 2BVOA 4HEPG 5GSRA 4OZGF 4NFCA 3O6ML 5TDPA 1JPTH 1HYRC 4PRDA 3HNVH 4GBXC 5J1AA 2QBWA 1G7LB 1N3NA 2QADC 3H7BB 1S9XB 5DJDA 3RGHA 4RQQB 3P0YH 3I6KB 3VFGH 3TN0B 1A4JB 2I5YL 3VWJA 4CVWA 2VLRD 5DQDH 5TDNB 3VFVA 1X5AA 3SGDI 3JV5A 1A2YB 4WI9A 4WTWA 3PIQA 3CFJB 3TNMB 2A74A 4LHUD 3WNKA 4XRCB 2YD6A 2EKSB 3BXNA 2NZ9C 3PWUB 3T77B 1EEZA 3H3BC 2IADA 3WMSA 3I9GH 4HX1B 5I1IH 5DC9B 1QUNA 5FV2A 5BXFA 4R0LB 4YHYC 3T4YA 4HIXH 5CJBA 1I85C 3TO4C 3TIEB 3X12B 1U95A 4MD5A 4UUJB 5T1DH 3MJ9H 2E6QA 1G7PB 2IMNA 4HKXB 3MRGA 3O6MH 4OFYA 2X1QA 1ZA6A 4YDIL 1P7HL 4ZUUA 1HHKA 4PLKD 1I3GL 2AV7B 3DV4B 4IRSD 2YKLL 1TZHA 1J8HB 1J1XL 3MTRA 2I9TB 3BGAA 1P53A 1MF2L 1IGFL 1FSKB 1CGTA 2FWOA 2Q8AL 5IWLA 2Q8AH 1OLZA 1IBGL 1LE5A 1MOEA 5DR5L 4NCDA 2RFXA 4PJ8B 4WWKB 5C0IA 1P2CA 2K7PA 5IVZB 4XCFH 4HULB 3D2UA 2JJTC 4HWUA 4PJEE 2IMMA 2WW8A 2DWDB 1XGRB 3TO2B 4M03A 1VACB 3K8LA 1YN6B 4YHPA 4NUGL 2WINA 1NBYB 2NY3C 5ESAA 3IJSA 4J12A 4X7EC 5C0GB 2PW2A 1HYSC 2BNUA 2YPLE 4Q6IA 4WTZG 4E0RA 3SDAA 4L4TD 4F7TA 4IBLT 4Y4FB 2NY1B 5SWSE 2UUDK 2E5EA 2OL3B 3NCYP 4Y1AA 1FPTL 1S7WA 1EIBA 3PWLA 4XC1H 3S3SA 3QDMB 2EYSB 3WFBH 2WBJA 5CBEB 2BP3A 3O4OC 3REVB 5DHYB 1CFNA 3BZEB 1S9YB 5M95B 1AGCA 2EDLA 4CN6A 5HBBA 1MLCB 4UT6L 3IKKA 3MA9H 2FX8H 5ITFB 4H0HB 5TH2A 3VFTA 3T8XA 1J0ZA 4OBSA 4OUUA 4XX1G 4RMTA 3D3VB 4X7SL 2P5WE 3CLFL 4FZ8H 1NGXA 5AG8A 5T3XL 2YWZA 5F3BB 4P3CL 4P46C 1XGRA 5SWZB 2FYYA 5DJ0A 1FFNA 4DKDC 5FO9B 4OSUL 1JNNH 3O3EA 3RJQB 4XVJL 5IJKC 2V2XB 2PTUA 1TQCB 5JIKA 1WF5A 2P5EA 2VQTA 3WJLC 3O6KL 3MBEC 2QSCL 2YHGA 4Z78A 3HFML 2CJUH 5ANME 5C08D 3OGOE 1A4KB 3B2UC 5EUOE 4PRBB 5FM4A 5IJKA 2JK5B 1F58L 1RSFA 1CFNB 3QZWG 4GKSA 1F6AB 2XWJB 3MRHA 3LKOA 3VRJB 1CDIA 4X6FB 4I5BA 1XMWA 3CUPB 3ARFC 4XMLH 4UV4L 1SQ2N 1GIGL 1FG9C 1YMME 5F7NC 3T2NL 4F7MB 1KJ2A 5GRUL 3EGSB 1HCVA 4HLZH 1MCCA 3D2UD 1CQYA 1Q9LA 1GPOL 3MRQB 3ZKND 4JFDD 3SKNB 1OARL 1TITA 1KIPB 1XR9A 3CVIL 1UH2A 4UILH 4WUUB 2IALB 5JW5A 3I50L 1Z9MA 3WLWD 2HA1A 5CEYB 4PP2B 4JVUA 2DS4A 1ADQA 3RVXD 1BJ1H 4H88L 4N0YH 5D2NB 3QDJB 4KAQL 3VD5A 5HHMB 4YHML 1F3JA 2G9HB 4XXCA 4FQ2L 2NZ9D 1R3IH 4G80B 1ZA6B 3VXSD 5LVEA 4HK3J 1RHHA 2VDRH 1DBKH 4OLWH 5F72S 3AC0A 3EYUL 4W81A 4L9LC 1ZHBA 5A40E 2NXZB 4JDVA 3PWNA 3RX5A 1CI5A 3O81A 5JORB 1NDMB 4NM8L 4WEBH 1AHWA 4NZDA 4YHLL 2AXHA 5EPMB 3KR3L 5T1MA 4HUUA 3ULVE 1R3KA 1YPZA 3PNWB 5C0BE 3BXNB 3NCYS 2BVTA 3PWUA 3VRLE 5EO1B 1KPRB 1RMFL 2YZ8A 4N0FA 4FA8A 5B8CA 2ZOKA 2ESVE 1MRCL 2Y6SC 1H3PH 2BSRB 1MCJA 5EH1A 1NLBH 4JFZL 1G7MB 3WFEH 5IROC 5HHXL 5HHQA 5J6HA 5ESVA 1NCWH 2W0PA 2GUOA 1F4HA 3WFHB 1T03H 3PDGA 4YIQB 5ADPH 5C6PB 1G7PA 4JFXB 2WUCL 1CFSB 2R4RL 4Y2DB 4RZCB 4FMKA 2O5YL 3PDOB 2XOTA 4MX7B 2F54A 4K9EL 1JTOA 2XKNB 1PG7X 1TJGH 5GXBB 4MCZA 4K23H 4UT7L 4C55A 2HJFB 5HGDA 4U2YA 4K94L 4CJ1A 4IIQB 3TV3H 5E2JA 5B39B 1JHTA 4D0DB 1QKZH 1N6QL 4U6YA 2MPAL 4OI8A 3K2UL 2Y5EA 2DWDA 3SJVD 1A6UH 1UM4L 2H3NB 4P23B 1GZQB 2D9QB 1U8HB 4LGPB 4PTTA 1VFUA 2OI9C 3I3BA 1GGUA 1BHGA 5J8OA 4TNVF 1A64A 2H6PB 5DJ2B 5GGTA 2X4PA 1MCBA 3QDME 5JQ6L 5IT2L 1NAMH 3CX5J 3TBYB 3Q3GA 1TZHB 2LFGA 1D5IH 4HBCH 3EYSH 5FYJU 3H6JA 4Y5XA 3IFOB 4ZOEA 4CVXA 4D9QD 3MACL 2HAZA 4WFED 4GUPA 1E6JH 1XCTA 4FFYH 3FQNA 4OGXL 2AQ1A 3DIFA 3HCVB 3KPQA 1CT8B 3OKLB 3QIBC 1G9NL 4NQXB 4WUKH 5JO5B 2BFVL 4ZAKB 2PXYD 1TCMA 2YN5A 3U4EB 4PJ7E 1RZIA 2QV2A 4HPYH 1U42A 3AUVA 4J1UA 4PJAE 2FB4L 1KENH 2AJUL 1Q9OA 3KYKH 4PRHD 4WFGD 4C56D 2V9TA 5D7JD 4WRLA 1WVZA 4GO6B 1IC5H 3DSFH 2UWEA 4LCIL 4L8BB 5CKAA 3DSFL 4WO4B 3HC4H 2VLLB 2YPKA 5DJXA 3FB5A 3PL6A 4HS8H 4YJZL 2BHZA 4YK4B 5D1ZD 5I73B 3VXSE 3DIFB 3HCVA 3ULUC 1MH5B 1JYXA 5J9PA 2OZ4H 3ME0A 2VLKD 3FJTA 3QIWA 4OB5H 1YY9D 2W0FA 1MSPA 3OAZH 1CYGA 1HQRA 2P46B 4BFBD 5E7FA 4WI5A 2P24A 3BKJL 2M26A 2COQA 1K9TA 3BI9X 4NN7B 5LAXA 3M07A 1TZIA 2X5PA 4PGCA 1N59B 5MI0C 2CLVA 5D7LA 2VLJB 2BSSA 3BP4A 2CKNA 3CD4A 4U31A 5I9QC 4HGMA 3LD8B 4LQFL 3QP3A 2D31B 2FJHA 1FJ1A 1CU4H 3ULUL 3UTSD 5J06A 2RCSL 2AJYH 2DKUA 1WGOA 2E7LC 4P2OA 2VISA 5CP3A 4ZNCD 5D7IE 4H25B 5DT1H 1A7NH 3GI8H 1C16B 4GRLB 4KTDL 1HI6B 4AIOA 4OZFB 2A38A 4WHCA 4JFEA 5ALBL 1TDQA 4YEFA 2GK2A 3OL2A 5IVXE 5BZWA 2XWBA 3M17A 4BUHA 3MNZA 1HIML 3NFPA 4E42B 4GRLC 3RGVB 3UZQA 4M6NL 4NM4H 3OB8A 2Q8BL 3UTTA 5BV7L 2CLRA 1HZHH 1G7MA 1KXVC 5HHQB 3HS0A 1W2KT 3W0WE 5HI3D 1UFUA 3WUZA 4PJDA 5F8RC 3G5XA 1D5MA 1CL7I 3QG6B 1IGYA 5DRNA 4EOWL 3NIDF 4LLDA 2JCCA 3TPUA 2Y6SD 1U8KA 5D7LE 1GRWA 4X4XA 5J13C 5A2KH 1V7MH 5KSBA 2XZCL 5DEZA 1OTSD 4W6XB 3RVWC 3RKDC 5D7JA 3OKEA 1JL8A 5DEFA 4C58B 4KZDH 2XQYG 5DK0B 2XY2A 1DN2A 5DJCB 1KJMB 2CK2A 4PRIE 1NCDH 4JFQB 1C08A 2YXMA 2QJDA 5C0AE 5JW4R 4MNQA 1E4WL 1CD1B 3BDBA 2W92A 3EJYD 2NTFA 3TZVB 3V52L 3GKWH 4L8BA 1H3TA 4UOW0 3MRNB 5LJYH 1Y18B 3QXWA 2PR4L 4JPVH 3G5ZA 5TQ2H 5J6GB 4FTVE 4PLJC 4K8RD 4QRUA 4R4BB 3HE6D 3FTGB 4TNWK 43C9A 4QWWC 4FQ2H 4EEEA 2DQCH 5GZOC 3AY4C 2B1HH 5KTEL 5JORA 1A02N 4JDZA 3ZSSA 2JJUA 5DDHA 5TF0A 4DOHB 4HWBH 5D72L 5LWYL 4OD1L 3HE7A 5DRZA 2EDEA 4Q9RL 4BQ9A 1TJIH 1IKNA 2VE6A 3MV8D 4OZIE 25C8H 3R0MA 4JO4H 4Z7VF 2I07B 5C08E 3EAKA 2C1PB 3STLA 4U1HA 5IVXB 3HC3L 4FQHA 1FZKB 1T0NA 3GMOA 4U05A 3S37H 5HJ3A 5IW3A 3FO9A 3B9KC 2Z4QA 2ICWJ 2D7OA 3GJEB 1EO8L 5DS8A 2FL5A 3P11L 4H1LG 1U2CA 1LEKB 5A2LH 4P23A 3RWDA 4MQTB 3HZKB 3WE6B 4K8RL 1U3ZA 4YBHA 1U58A 3X17A 4NFDA 2H6PA 5DJ2A 5D1XC 4UTAH 3MJ9A 4ZO9A 2PR4H 4JPVL 5CHNA 2F19L 3IKCA 4NP4H 4YBLB 5C09E 3MUZ1 5F96H 2XTJE 5DRWB 1S5HB 1JBJA 1IAKA 3D85D 3NA4A 4PV8B 1NCBH 3S88H 3HG1E 2HYMA 1I1YB 5CP7A 1KCSH 5I15H 3M45A 4MB5A 4HIHB 4WFFD 3VWKC 1K4CA 4Y2DC 1LWRA 4LFHD 4X4YB 4YDIH 4APQD 1AQKH 3RWGB 2YUXA 1T5XB 1N26A 4JM2F 4DAGL 4EUPH 4XPAH 3OJDA 4R7NB 4XGZB 4UDTB 1AGBA 1K8DB 4Z78B 5GRVK 5ICYA 1QNZH 1IM3A 5CEXB 4PFEA 2IPUG 4JM4L 3OR7B 4KZEH 2RHEA 4ODHH 4I48A 4N0UA 3HNTH 5IMMB 4NBYB 4ELMA 4JRWA 1QR4A 1A6VL 5ID0B 2XN9B 2H41A 2P7TB 1NDMA 3C8KB 4P4RB 2YR3A 2Y06H 4S10A 2DL2A 2F54D 3QUMH 4M6OH 1AGFA 5GGQL 2FO1A 1RIVL 3LRSA 4R7NA 1OHQA 5C0AD 4BZ1L 1T0MB 4CN4A 4FQXB 2DTMH 2NY4B 4HKBB 4P2QA 1NSNL 2BERA 2F53A 3GMRB 2EYSA 5JNYB 4FFVD 3SE4C 5IMLA 4NT6B 2AV1A 3V6ZB 2R23B 3MRCB 1U8MA 2ZUUA 4Z7QF 1LHZA 5AUMA 1JNJA 4JY4A 4XP4L 1EZVX 3HI6L 2LAAA 1UXSB 4L5FH 1DQMH 2X7LB 2AEQH 4UQ2A 5KVFL 1JYNA 1DQML 2NX5B 3ILQD 1KNOB 4XMPH 1OW0C 4MYWB 4EVNB 1G0XA 4JHBA 2FNBA 4OZIA 4I3SH 5FKPA 1YEFH 1MHHA 2AQ2A 1F8TL 2ZSVA 1B2WL 1J10A 4ZD3H 5ITBL 3U1SH 4HS6B 3V6ZA 3D9AH 2ZUTA 2KDGA 3KYKL 3CDCA 4XNXL 5DK2A 1YNLL 3ZDZF 4C59B 3DVFA 3C5JB 1N0LA 5D7KD 5ID1A 1JNHB 4U0RB 5EUOA 2VUOA 5GS0C 4CMHC 4TOYH 1KXTB 2MQCA 1TCRA 1AR1C 4UQ2B 2FIKB 1BQLH 5I1EH 1JGEB 1HILA 2A6JA 4LLDB 1NGZA 3GMLB 3FT4B 3VCLA 4KXZH 2BJML 2C1PA 3STLB 2R2HB 5DZOA 2Z31D 5FKPB 3SBWA 1ETZB 1CFVL 4PJDE 1PX4A 3FOLA 4GQ9L 3C5SA 2DMKA 3R4DA 4OKVA 5GRJH 2PETA 4Y89A 2DTSA 3OSKA 2JIXD 2X7LA 5I1HL 4OFVA 1JTTA 1Q0XH 2B2XH 2V2WA 4G8GA 1MIMH 1R5IA 5AWNH 3RWDB 2ED7A 4KMQA 4R26H 5J11C 1I7UB 2IBZY 1KXQE 1EPFA 3ZSTA 1R24A 2ICES 4H26A 1PZUB 1DR9A 3KS0J 3RPIB 4ZDHA 4WUUA 1Y18A 4DOHE 1BEYL 1UWXK 2X70B 1B2WH 3R8BB 2YK1H 1QFWM 4ESKA 3EDEA 1I8KB 4OCLC 2VQUA 4NKMA 2EDOA 3HUJA 1PG7H 3MCKB 1M7XA 4K9EH 3QHZL 2B1AH 4NIKB 5CJXC 2FATL 2BOCA 2Y36H 1EDQA 4JLRA 4Z5RA 4OZGB 5SWSA 5E8DH 5IJVB 1D9KA 1TZIB 4PGCB 2VZOA 1WCBA 4DN3L 3V4UH 5HHVH 2EIEA 2V5RA 3SDAB 2DLFH 3BIAX 1QLFA 2M8XA 4MAUH 2VXSH 2DWEA 5C7XH 1ZANH 3RTQD 4JE4B 1BVLA 3VXRA 2NY7H 2NY2C 2DIJA 5EORH 1NGWB 2AKRB 4E41D 4P2OB 3H9HB 4X6BB 4ISVB 1YUHA 2PYEB 3I3EA 5GISL 4YE4H 4YHZH 4HKJB 4P4RA 4TSAH 1I3VA 3F7VB 5IF0B 1YMHA 4LRNL 3GJFH 2P5WD 3MYJB 5F1KC 5EU5A 4QEGA 3S36L 4JHZA 2HLAB 5I0DA 3QAZB 4PRHE 1FL5A 2A9NH 4PV8A 1E4WH 4BUGA 3LEVL 5CJOL 4LHUA 1ZGLP 1ZV5A 2EZ0C 4N0RA 3ZYZA 4QWWD 1E4KC 5HD8D 2EDNA 4ORZC 3TO4B 4XVUC 4XGZA 3ZYOA 4K7FB 4ZFOB 5GS3A 3D9AL 3G5XB 1JFQH 3MO1B 1H8OA 1MCOL 5LGKA 3FB7A 5JXAH 1HQ4B 1QRNB 3T1WA 2ZCLL 5C0CB 3DXAB 5FIEA 2JCCB 3MODH 1M7DB 1DE4A 1IC5L 1A5FL 4JPKH 4Z7WE 4QXWA 2J5LC 3MLPA 3U7WL 4XPBL 1ZEAH 3KDMB 3KPNA 1IGML 2R4SL 1QACA 1YEEL 5C0DB 1MFBH 5E00A 3VFVB 4IRSA 2R1WB 3HNSH 3PV6A 3IDMB 1JPGA 2HFGH 1FV1B 3QWQB 4PJCF 1T89C 4DVBB 5KANI 1LD9A 5F9OH 4NM8H 4TUJA 4Z7NE 3AB0C 3IXTB 4K71B 3RWCB 3TN0C 3IU4H 2HTKD 4O4YH 2F53E 4JZJA 5D2LE 2EDTA 5E1AB 3KVQA 2DMBA 4LLYA 5I66A 1D5BA 1MUJB 1EO8H 4XCEB 3RKPA 1XGTA 5KJRL 1ZHKA 5L7XL 5HI3C 4NOBA 1RJZB 2ATKA 1GIGH 3I2CL 4YPGB 3GSXA 1U8NA 4F3FB 3NGBB 1A9BB 4J3VA 3S34H 2EC9U 2CUMA 2GAZA 1ZE3C 4P59H 4PRIB 1MVUB 4KRMB 4N0YL 1UWGH 4POZC 1A6ZA 2X6MA 3MRBB 3WXWL 4JJ5B 3FQXA 1GGCL 4F2MB 1X4YA 2J8UE 1YNTB 4JQXC 5CSZA 1HE7A 4P9MH 1LO2L 4HD9A 3LN9A 4PY7B 4KDVA 5FYJD 1NBVL 2YRZA 4FG6D 5HHOD 4IRZH 2NY5L 4LSSH 1RU9H 3RRQA 2XTJB 2NY5H 4D2NA 1O0VA 2XA3A 1OAKL 5I71C 2IPKB 3FCTA 3LDBB 1N64L 4M9PA 2F15A 1O5DT 1ADQH 4Z76A 3JWNC 3NCJH 5DTFB 5JW4N 3VDBA 4ZSOB 3GBNL 3RI5F 3QI9A 4KUCD 3IGAB 4FOMA 4LPVA 1GCFA 4CJ0A 4P2RA 2VH5L 4HJJL 1KFAH 3JBG7 4LIQL 1T1XB 4I0KA 1XGPB 3VGBA 4X7FC 3AAZB 2DLGA 5IBTL 1TTFA 4ODXB 3KYOA 5IV2B 3ZKSD 4BQ6A 5E6IB 5EU6E 5KSBB 5HYJE 3DBXA 1YZZA 5BVPH 3QEUB 4NHCL 3QZWB 5K9OB 2Z8SA 2CDGA 3NFSH 3RNKB 3WXVL 2VUYA 4ALAL 3EOTL 3FFCD 4XCYA 4PJIF 5DJAA 5TPWH 1ZVSB 5L2KA 4M62L 1ITBB 5DWUL 3SOBL 5DURD 3PWPE 1UACL 4Q9QL 2NY0B 4WCYL 4XTRD 1HXYB 3QO1B 3JWOH 1EV2E 1UQSA 5HVHC 3RQ3A 2PXYC 2A6IB 1IQWL 3B9VA 1A7QH 1FZOB 3LZFL 3TBSB 5LKNA 1SY6A 2VIRA 4HHAA 1NMBL 3FQNB 4F8QA 3O8XB 2VQ1A 4NHUB 2FHFA 2H2SD 2PNDA 2ITDB 2MMXA 1B0GB 1OB1B 4GQPH 1I75A 4LF3B 4RGNE 1D9KB 2OYPA 5CJQH 1A3LH 2EC9T 1RFDH 2BOCB 1EFXB 1RHFA 3SKJL 4PJIA 5IWLC 4TRPH 3QDJA 1QOKA 3IDGA 3RPIA 3DX8B 1W8OA 1JRHL 2ZG3A 5ERWA 1U8IB 1ZGLM 1JRHH 2DQFB 4MJID 4ZO7A 4O51B 1P4LB 1FZMA 4OTXL 4DKFH 2HH0H 3FFDA 1F6FB 4WO4A 3UTZB 4MXVE 4Y5YB 5GIRA 2AK4D 4JFXA 4KUZH 2NY2B 4W68A 1QFWL 2GI7A 1ONQA 4YBQD 1KB9J 1I85A 4WFGE 3HE7C 3FHAA 4JREB 3LPGA 5C0DA 2JB5L 2B8OT 3ESUF 2DD8L 5KVEL 2ZUVA 4WCYH 3MREB 1ES0A 4L4VB 3TBTB 5DD3H 3V5HB 3SO3C 1I1AD 4F7EB 2G60H 3RHWF 2XPGB 1CXHA 2YPKB 5DJXB 3H9SD 5C0CE 5FF6A 4D9LL 2VL4A 4AQOA 2IH1B 4QKXB 4YHNA 2WBJB 1UCBL 1U8NB 4EIZC 1FIEA 2DYPA 3MGAA 5BRZB 3GRWL 5FGSA 5I1GL 3UPCA 1QEWA 5KOVC 3T0AA 2ADGA 3C2SA 1YPZF 2X4SB 5D5MF 4PD4J 2ESVD 3V4VL 2VH5H 4HJJH 1