4TXVB

Crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
FLELDVPKADLTIKATGKQWYWSYAYPDNGKFEFDSLMAQDKQPRLLGVDNEMVVPVNKVIRVQVTGADVIHAFALPAFGVKIDAIPGRLNETWFKAAKTGMFYGQCSELSGKDHAFMPIAIRVVEDKEFASWVETAKKKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol:disulfide interchange protein TlpA
publication title How Periplasmic Thioredoxin TlpA Reduces Bacterial Copper Chaperone ScoI and Cytochrome Oxidase Subunit II (CoxB) Prior to Metallation.
pubmed doi rcsb
source organism Bradyrhizobium diazoefficiens
molecule tags Protein binding
total genus 26
structure length 142
sequence length 142
chains with identical sequence D
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4txvB00
1AZRA 1OCCB 2CAKA 2GHZA 4AKQA 1J9QA 3BVDB 2YAHA 4KO9A 3T71A 1E30A 4DPCX 1KBVA 4G7SB 3OM3B 1UATA 1QLEB 2PP9A 4KNTA 3WNJA 5I26A 4W1TA 2PLTA 1JZJA 3CG8A 3WKQA 5B7FA 3ABMB 3FYEB 5EHFA 1L9SA 1OE3A 3PAZA 3QJSB 3X1FA 3FPXA 1NICA 5F7BA 3HB3B 2IWFA 1ZV2A 1KBWA 2XU9A 1AS7A 3CVCA 4YSEA 4NAJA 3UABA 3NJIA 1DYZA 2XX0A 4N4YB 5B3SB 2PPCA 3ABLB 3EF4A 3GXUB 1ET5A 1M57B 1PZAA 2JXMA 1FFTB 2HX7A 2Y69B 3PLYA 5F7AA 1M56B 4HZ1A 1RKRA 2BP0B 2VW7A 4HHWA 2QDVA 2AZAA 3IE9A 5D4JA 4Q8BA 2IDSA 4DP8X 4GY4A 4WTQA 2DV6A 1B3IA 1AS8A 4HCGA 2EINB 1PZBA 3DIVA 1GSKA 1PNDA 4KNUA 1R1CA 3WIAA 3WNIA 2J57A 3ASNB 4AKOA 4AKPA 4K9JA 4YVNA 1AR1B 5E9NA 3GYRA 1AZUA 3X1GA 2IH9A 2BHFA 4HAKA 1ZIAA 4BWUA 1AOZA 3QQXA 5I6MA 1QNIA 3CVDA 2XX1A 4GP5B 1PCSA 1AZNA 2XXGA 4DPAX 3KW8A 1EZLA 2H5UA 2IAAC 2XLLA 1KCWA 2GSMB 3EH4B 4YSCA 3NSFA 4M4RB 1XB3A 1ILUA 1A65A 4BWWA 2DWTA 1KCBA 2IWKA 2BZ7A 3T6XA 1CC3A 3WI9A 4DPBX 2J55A 2BO0A 1OE2A 3C75A 2WO3B 7PAZA 4KOCA 1AIZA 1PLAA 1SHWA 1A8ZA 4TXVB 3ZBMA 3AG3B 4DP4X 1AG0A 4NB7A 2I7SA 5B1AB 4RH4A 2JFCA 2IWEA 4YSDA 4E9VA 7PCYA 2Y1AA 5I5MA 4YSRA 3ZIYA 1MZYA 2H3XC 3NSYA 2BWDA 5TK4A 2FQDA 4AI7A 3X1EA 4BK5C 1GY2A 2VM4A 3IEAA 3X1BA 3WG7B 3AY2A 1WA1X 3V9CA 4ENZA 1QHQA 3FSVA 1NZRA 2TSAA 4P5SA 4BXVA 3FQYA 1JZHA 2VSMB 1BXAA 2VN3A 3ZDWA 4E9XA 2PCFA 4ZK8A 2PPEA 2Q9OA 2P80D 2BWIA 3JTBA 3IN2A 4DP9X 3FU7B 1SDDA 4A2FA 1CYXA 2FQFA 3UGEA 3KW7A 5AFAA 4KO5A 3AG4B 3V9EA 1NWPA 2XV3A 2BP0A 1WAEA 2UX7A 3S8GB 2YXVA 1BAWA 1IBYA 3GDCA 4UAHA 4CSPA 4A2HA 2XV0A 2UXFA 1JVOA 3AZUA 4KO7A 1IUZA 1SHXA 1OOWA 1F56A 4YSTA 2YQBA 1TEGA 5I6LA 4UF7C 4MFHA 3JT2A 3G5WA 3TU6A 5AKRA 2IDTA 3RYMA 4DP0X 3PAVA 3QJTB 3EH5B 3FSZA 3T6VA 1V10A 1JOIA 1V55B 3QJUB 2EIMB 3NT0A 1L9TA 3NSCA 1NPNA 1AANA 4A2GA 1RZQA 3BQVA 1EHKB 1L9RA 2YARA 4JKNA 3ASOB 1NWOA 1M9WA 4A67A 1NPJA 1MG3C 4YSOA 1J9RA 2GBAA 2GIMA 4HCIA 3TA4D 2VM3A 1ASPA 2HLEB 3NSDA 2QDWA 2PCYA 3L45A 4A2EA 4M3HA 3FQ1A 2HRHA 1ZDQA 2CALA 2TSBA 3UADA 2B3IA 1CYWA 4YSUA 1J5CA 3TBCA 1SDDB 2E86A 4X4KA 8PAZA 1W8EA 2CUAA 3FSWA 2GC4C 4BDVB 5B7MA 1JZEA 4F2FA 1FWXA 1PNCA 1AS6A 1J5DA 4BWTA 4P5RA 1PF3A 4HHGA 3IN0A 1SJMA 2WO2B 1WA2X 1FA4A 1V54B 2OV0A 3FU7A 3HEIB 4G7RB 3AW5A 4KNSA 1VLXA 1BYOA 3NJMA 2FT7A 2YAQA 2MRYA 3NJFA 2I85A 5D4IA 2XVBA 4E9WA 2AANA 3N55A 4Q89A 2UXGA 3FYIB 1MZZA 1HAWA 1MG2C 4FA7B 2CCWA 2B08A 4DP7X 1J9TA 2BZCA 2UXTA 3NJLA 3CVBA 5PCYA 1ADWA 1N68A 1TKWA 4DP6X 2EILB 2YAEA 1WA0X 1AAJA 1MDAA 5B1BB 2ZXWB 5I5JA 2X87A 2YAMA 2P80A 3QPKA 2WSDA 3TBBA 4KOBA 2ZONA 3T6WA 4GXFA 2IDQA 2X88A 4CSZA 2BW5A 2CBPA 3T6ZA 3DKHA 1HAUA 3AG2B 1BEXA 1AACA 3CZUB 4DP1X 1X9UA 4GP8B 2UXVA 3MX0B 1ILSA 2HZHA 1HFUA 1NIAA 2W88A 2XWZA 2IDFA 2Q5BA 1TU2A 1W6WA 5LDUA 1BXVA 4NERA 1J9SA 5I6KA 3NJNA 1BQKA 5I5IA 5ANHA 5I6PA 1JVLA 4BDVA 4YSQA 1CUOA 2A3TA 2HXAA 2QT6A 3FQ2A 1JZIA 1BQ5A 1SFHA 3S3CB 3SQRA 2DWSA 2FWLB 2FJSA 2PPDA 4HCFA 2DY2A 5TK2A 4HIPA 4PCYA 1E5ZA 3NYKA 4E9RA 4WKXA 1A4BA 1GR7A 2OJ1A 2XUWA 1NIDA 3ABKB 9PCYA 2I7OA 3FSAA 4A2DA 2IH8A 1JZGA 3NJKA 2EIJB 2NRDA 2VW6A 1TEFA 3IBOA 3NJJA 1ASOA 2PPAA 2DYRB 2FQGA 4DP5X 3FU9A 1PLBA 3EHBB 4G71B 3OMNB 2GB2A 2DYSB 3H4FA 2YAFA 3QJRB 4E9QA 1BXUA 4G7QB 4YL4A 5A7EA 1WS7A 2PPFA 1A3ZA 3UACA 2BP8A 1ZPUA 1L9PA 1W6LA 3OD3A 4JHUA 1AZBA 3EH3B 1GS8A 2R7EB 1URIA 1GW0A 2PP8A 4E9SA 1DZ0A 2ZOOA 4HALA 2EIKB 3PPSA 1ASQA 1OE1A 2FT6A 1IBZA 1KGYE 2MTAA 4G72B 5D4HA 3NP4A 4G70B 1NDTA 1ETJA 4F2EA 4L0PB 3NJGA 1SF5A 2BW4A 2J5WA 3PXLA 1GY1A 3S3BB 3X2QB 4F7KA 3N2JA 2FQEA 1NTDA 3ZX1A 4JHVA 3WKPA 1L9QA 5I28A 1NIEA 2GC7C 1XMEB 2GI0A 1XB8A 3PAUA 1IC0A 2FT8A 2AZUA 2AVFA 2QPDB 2QPEB 2IDUA 3TASA 3UAAA 1RCYA 1XB6A 3FS9A 1OCOB 2UX6A 1JZFA 4AZUA 3ABGA 3S3DB 3UAEA 2FNWA 1L9OA 4YVUA 1RZPA 3OMIB 2AFNA 1AG6A 1WS8A 2FTAA 1KYAA 4YSSA 2J56A 1SNRA 2HX9A 3QJQB 3X1NA 2VW4A 1I53A 1PZCA 2HX8A 2BP8B 3CDZB 3SBQA 1E65A 2XV2A 5AZUA 6PAZA 4QKTA 1AZCA 4W9ZA 1GS6X 2YAOA 1BYPA 1AQ8A 2H47C 2XYBA 1ET8A 1OCZB 3S8FB 1NIFA 1E5YA 2JKWA 1T5KA 4AX3A 5I6NA 4PAZA 1NIBA 1PY0A 4FAAB 1KDIA 1SF3A 4A66A 5FC9A 2ZWNA 1BQRA 3FT0A 1OCRB 4KO6A 1JERA 5B1JA 1YLBB 3QJVB 4E9TA 3NP3A 4UANA 2R7EA 1A4AA 2OCCB 4E9YA 1JXGA 1ZIBA 4GYBA 2W8CA 1NINA 1PAZA 1N70A 3OQRA 1ZDSA 3T9WA 1ID2A 1PMYA 1KV7A 2CJ3A 1E67A 3SBRA 3AG1B 4A68A 1OF0A 3DTUB 5I6OA 2N0MA 5PAZA 2YAPA 1GS7A 2HRGA 1PLCA 4DP2X 5B1JC 2VMJA 1ET7A 2RACA 1SFDA 2VSKB 2YXWA 3ERXA 1JXDA 1X9RA 4YSAA 3FU8A 1CURA 3FPYA 5B7EA 5IY5B 1KDJA 3SBPA 4GP4B 1A4CA 3MBWB 4N8UA 3NJHA 4EF3A 1JXFA 2LLNA 4BXSV 3D12B 4YSPA 2PP7A 1OV8A 3PCYA 3CDZA 6PCYA 3U25A 5B1KA 4QLWA 2XXFA 1GYCA 1IKOP 3OMAB 3H56A 3H4HA
chains in the Genus database with same CATH superfamily
1AZRA 4UB0L 5DJDA 3V8OA 3ULVL 1QLEL 4GSDL 4FABH 4KGJA 2ETWA 2GHZA 3BVDB 3ARGA 3QNZA 2YZ1A 4ZO7A 5FUZL 2J5LC 2A77H 2FECI 2F54E 3QUMB 4P2RA 3G08B 5ETUB 3VG0H 4N8CH 4BQBA 5GGSA 3LN9A 4Q2ZA 2VOTA 4QPEA 1VFOA 3HNVH 2BXYA 3QUGA 4MQ7B 4NQEB 5I6XB 2BSTA 2VISB 3GJEB 4QRAA 1U91A 5AW7B 4RFOH 5I9QC 3D3VB 4ZXBC 3KBFA 3HG1A 2WOYA 4CC0A 1OP5K 2HJKB 2X9YA 1S78D 5ES4B 3STZB 1HX0A 1I7UB 3QIBC 3QFDA 5FUCC 1H5BC 2DEXX 2OS7A 4E0RB 3IVKA 2CR3A 2K78A 3WV0A 4NAJA 3TPKA 3WXVH 3DXAE 4YGAB 1OHQA 4Y8AA 1BMWA 5D7LB 1JZDC 3MBED 1D7FA 1P6WA 2AF2A 2YQ3A 3BOVA 4NP4L 2NPLX 4D8PA 1SXSA 4ZMYA 1I1RA 4TUJB 4AK1A 4GY4A 5E94B 4HK0B 2EYSB 4P46B 5AG8A 3NRFA 3F8UB 2KZBA 5HVGB 4HC1A 2IG2H 3A0OA 1KTLB 2EYRA 4JDEA 4RRPG 5FIEA 4LCCC 3I9IA 1CG9B 1WISA 3VGDA 4FG2A 1TTGA 3F6JA 1T0OA 3SYAA 1WC7A 4XPTL 1N5AB 2E9GA 5IFHH 3OB8A 4FZ8L 1YDPA 1WAPA 3H42H 3QQXA 4RGND 3KGUA 4Z76A 4V11A 4MNGE 5A2JH 2H5UA 3FT9A 4G42B 2ZCKL 3DI3B 3SDXF 4YQXL 1J10A 1CICC 2IWKA 2BVOA 2X4TB 3II2A 4APQA 4XN4A 3I02B 4FFYA 1K85A 2N7BA 1PZUB 4M61B 3AT8A 4OFIA 2CIIA 4ANXA 5T3ZH 3IAGC 4R90H 3TJHC 2JQMA 3FC8A 4F15C 1JPST 1ZVNA 2VQ1B 4ZX6A 2AP2A 3U0WH 2Y2WA 5D1ZC 4LEEA 3ARFA 4AYEC 2W07A 3D4CA 1MEXH 3ZZLA 2P28B 4Y19B 4JKLA 3QUYA 3QUZB 1TJGL 4ZJ9A 2CGRL 1UG9A 3D6GA 1NGWA 4CBZA 2IFGA 1BFSA 5TDNB 2ZNWA 4M48L 4OLZL 1ETA1 1UEYA 1HILA 2J6EA 1VKXB 1P7QD 3UDWA 3V95A 5CCGE 3TEZA 3BMVA 4EE2A 1TSHA 3JTBA 1RULL 4FYRA 4N6QA 1KXTA 3Q7JA 3WDJA 4CC4A 2D4FA 1V7NH 2DIJA 4A2FA 1AHMA 1CYXA 3WY1A 1U30A 1W8NA 4XMUA 2QSTA 5EEUA 4WY7L 4YH6A 1MRCH 1T4KA 4HJJL 3QRBA 5E2VH 3KM2A 4F7MA 2IADA 3D85A 4B60A 4P8QA 1TQBB 2YXVA 4NWTL 4X8JA 1U8QB 1FVEB 4IEFB 4TSCH 3VDCA 3FT3B 1DQLL 5F7YC 4LSSL 3KHQA 3EUDA 1HHJA 5CM1A 2NY4D 1HCFX 2HPTA 1IKNC 4HWUA 4EXKA 4XAWH 3EW3B 4HJEA 2OJZH 4Y5XA 1A7QL 1ZTXL 4X98A 1VADA 2ICWJ 4UZSA 1BPLB 1DSYA 3DX1A 4JG0L 3UAFA 2IV8A 4PJIB 4I3RL 1G0DA 4M56A 2WANA 4NLAA 3RUGF 1CL7H 2WNWA 3CFQA 4YXHH 3BSHA 3B2VL 1A6AB 1CS6A 2D7MA 1IQDB 2J6EL 3FCBA 1C16B 1HZHL 4LSRH 1JZ8A 2BIQA 2WN2A 3L45A 2X70B 4X7TA 2ILLA 3C5SB 3FUDA 3HFML 2KDGA 3BUIA 4V2BA 1DJIA 2XPGA 3ARQA 4OGYH 4OF5A 1BLNB 4HUWB 4MDIA 4I87A 1SY6H 1F2XK 2WBWB 8PAZA 3GRGA 2UZIH 3STLA 3QNYA 3QI9D 5F0PB 3QAQA 4XMKL 2ZYHA 2CA4A 1FWXA 1DVTA 1EMTH 2UZYB 3HR6A 3DSFH 3ZHKA 4OB5H 4LKCB 4MAZA 4K5OA 3ZL2A 3BC9A 1Q8MA 3H7BB 1O7VA 4PB0H 1CVRA 3LPOA 4QRPE 4HH8A 4TNWF 5C0GB 5CFAA 5LVEA 1ZSDB 4BCYA 1HNGA 3EYSL 3EFFB 1AI1L 4PR5B 4HPYH 3EG9A 5EG6C 3TZVB 2I85A 2XVBA 2WPGA 5E9DD 1XF3A 3EFOA 4AYID 3FXIC 1IEBA 1AZVA 1RV6X 2HG5B 2J43A 4DP7X 4M5ZH 3LQZB 1INDL 2Y7OA 5HVHB 4XC3L 2CBOA 5E23A 3RNQB 2A6KA 2IQ9L 5E4EB 4WK0B 3P4NA 1M3JA 1R9FA 1IGJA 2YUVA 5EBMA 4BFNA 1Q94A 4FULA 1AJ7H 1FRGL 1D6VL 5I5JA 1E8WA 3MUJA 4P57A 4P23A 3DPDA 4I0PA 3OKLA 3TO4D 2BNQA 1E5UI 5KSAD 3RAJL 4JM4H 1KFAH 5C7XL 1V8HA 3QXDA 4JFOA 2DBLH 3TF7C 3TH2T 4ZTOL 2AK4E 2DYPD 3CXFA 5DTFB 4U1NA 2V0AA 4P4KB 3U2JA 3JYBA 4XMWA 4DP1X 1CTNA 1F4XL 4ANWA 2I69A 4KV5E 5LNGA 3QEHB 32C2A 5E95B 1BBJB 5AW9B 3T2QA 4KROD 5C7ZA 5EEXA 1YY8B 1Z3GL 1E6JL 1BZ9A 5K59E 1DDHB 1ZOXA 5AVZB 3SCMC 1FLTX 4XBGA 5HPMA 2YBRA 1DLHB 1XGYH 1BLIA 3IJEB 4FQJL 2JKIS 2VDMH 2YLHA 4M8VA 4XP6L 4BDVA 4F8PA 1SQ2N 2FEDC 4I77L 1QI4A 2WIIB 4I9WD 4B9CA 3AFLA 1FVCB 4DZBB 1FZJA 1HC1A 4NZRL 5E5UB 4HUKB 2OP4L 1R3KB 1JZIA 5FYJD 4PS3A 4K7PL 4KKRA 1H3XA 2JB6B 3L3GA 3L3KB 1UQSA 3HLAB 4HQQH 4KKBD 3HRZA 2H8PA 3BUYB 1GOGA 3CZSA 1T5WB 4YHPA 5KYXB 2XUWA 4BHUI 3KPLB 4OF6A 4WGKA 2IALB 3Q43A 3CSGA 2WXKA 3BFWA 2Q7YA 3GSNB 5ABZA 5SWZD 4Y4KB 3QYMA 5IHLB 5EO0A 3J2PA 4HEME 1IM9A 4ZZKA 3MUGA 1N59B 1T80A 2BLFA 1WEJL 2A9ML 1DQDH 2VM9A 4KK5C 5DLLA 4A6YL 4K7FA 5BJTB 2QGCA 1ORSA 4AQ1A 3OKDA 4UNVA 2HT4D 4S1DD 1KY6A 4WI8A 4DOHB 3VI3F 2PP8A 4W4OC 1DZ0A 3ARED 1JWMB 3LZFL 4XPHL 2XN0A 1MAJA 1R4XA 1M9SA 1MCPL 4UT9A 4Y9CA 3ESUF 5FHAH 5TE4H 4NUJB 2L0DA 3T2PA 3B3BA 4FNPA 4JQIH 1MWAH 3FO2A 1X7TA 2VXSL 3S3BB 2CCVA 1NBZB 2HFEB 4LCWB 4P9MH 2IJ0C 1KCRL 2W1NA 1GH7A 2X09A 4XCCL 2J72A 3VXTA 5E08L 5F8QC 4OH2A 4UTBH 1CDJA 1QWHA 4AEHH 1XMEB 2YLKA 3GXPA 2VDLL 4E5XB 4J12A 5CO1A 1CDIA 3TCTA 4HOWA 5IHZA 1BQHG 4MNGA 2EDHA 5JPNC 4JVPA 2NR6A 5JLZB 2DQTH 2Q7NA 4RGOL 1BAFH 1BA9A 4L2YA 3SGKA 3GFUA 1RIUL 3ZT5A 1BAGA 3T8XB 3ZDYF 5BUAA 3PNWB 4F93B 4RFEA 1ID5I 1YHPA 2OXHB 3CBRA 3QK0A 1DSWA 2DKMA 1IL1B 3EJYD 3GINA 1GGYA 2ZCHL 4CUCA 1X5AA 2CDGB 5E2UH 4N9GB 4NX0A 4I9XA 2N7SA 2BY2A 1UVQB 4NRYA 4Z0XA 3C5JA 4GKNA 2O6DA 1L7TL 1KENH 3I6LE 5L6YL 1WE5A 3S7GA 4UT9L 5EIVA 1U8NB 4BRVA 3KJ4C 2EP6A 2KQMA 4N8VB 4ODHL 3E2HC 3M17B 4O51B 1KFGA 2J1KA 1SN2A 3L1GA 2ENQA 3GXNA 3U6XS 5EB9A 2ZUXA 4EPSA 3HKZA 1XGZA 3W38A 2QKIB 5D1XD 3BZ4A 1UT9A 1S8DB 3MGTB 4DSYA 3GC3A 3L3IB 1GHFH 2WTRA 4M7JL 4CGUB 3ZVVA 3ULSB 2HB0A 1CXFA 2F8VA 1HWHB 3ALXA 1V7ML 2ZIDA 2YS4A 2C7UB 4C83A 3HS8A 4EJ1C 4MVBD 1WBZA 1H6FA 2J8UE 3P0VH 2QADB 5KJ7E 4BSVA 5I1EL 5FCSH 2X38A 4LVNB 4GG6A 4PG9A 4G59C 1BVZA 4GIOA 5FHBH 3TBVA 4G9FB 2WXJA 2VDRB 3GDBA 4MJIB 1SN5A 2H7WA 4DP2X 4LFHD 4WFEE 3UJJH 4P5KA 1FH2A 1BVKB 1JNLL 4X6DF 2YXWA 4Z78B 5IP4A 1RZIB 4YSAA 3FFDA 3D33A 4XI5D 3WFEH 1U8MA 4NM4H 3MJ9H 3EAKA 4P2YA 4L3FA 2Q76B 2DBJA 2J1ZA 4ODBD 3WN5C 1DLFL 3OR6A 1S9VB 3ORJA 3MTXA 1IGTA 1YYLH 3S4SG 4E42A 3DSNB 4IRSC 1IC7L 4Z7NB 3W56A 4LPXA 4DUVA 4LPCA 3GGWA 1DEEB 4NQDA 1T0MA 4KI5E 5ERWA 3VXUE 4GW4A 3LHAA 3D50A 4KU1A 4BKSC 1QLRA 3VFTA 1BD2E 4WI6A 3FT4B 4ISVA 3QWRD 5K9KA 3ARZA 4XNUL 1MXGA 5KBMA 1DFXA 1QSZA 3VRLE 3ZDXE 1XVSA 1XSIA 2WK2A 2ATPB 3OG4B 3QGVA 5CKAA 1E4KC 1KBVA 2CO6B 2WBJD 2XN1A 3C5ZC 4JJHA 4PRAB 3T2LA 4EN3B 2ZKHH 2WB7A 2WXQA 1LQBC 1NBYB 1PY4A 3EJCA 4P3WA 5DRNA 1C5DB 2WLNA 4LVOC 4LKXA 5DHMC 5ANME 2ZAHA 4YZWA 4AYFB 4L9DA 5GRUH 4NENB 5EHFA 2GKIA 3R8BB 4L9LB 3ME0A 3VTTA 2NZ9D 4OT1H 2UY7B 1EWHA 2D4DA 3GO1H 4HSCX 1E2ZA 3HBGA 4DESA 5J57B 3CVCA 1MJ8L 3IGAA 1YEGL 1FFOA 2Z91B 4QHLA 2QLVB 3EYUL 5KEZA 4AWJC 2V9QA 4M9OA 3VX0A 5A2IH 3TF4A 3GMPA 2O61B 4OGXL 1YEWA 3UAJD 5T8IA 3OTTA 3IFNL 3RU8H 4HCGA 1NANH 3KDMB 1MAKA 5EO1A 3AC0A 1P5VB 4XP9L 2WXHA 4X5WB 3VWJB 1SVCP 1H8OA 2YUWA 3DX8A 3P2DA 1M6OA 2G5RA 1EEZA 4GBXC 3PP3H 3OF6A 2FE0A 1HEHC 1EERB 2R0KL 3FW6A 1M7UA 4N2NA 2QSQA 5I6MA 1CIUA 4PJ8D 5B1CA 2I27N 3FO0L 2I26N 2QSCL 2PXYA 4X7DC 5D1QB 3JWNH 4YSCA 4TUKH 4LCUB 3G5ZB 2X9WA 2FWSA 5C70A 1SEBB 2BFVL 5JZ7C 1OGTA 1DE4A 1SJEA 4QTFA 2XIDA 1T2QL 1T1XA 4PJGB 4Q7DA 4KJYA 1A8ZA 2Z35A 4K4KA 4DP4X 5L8LB 3T0ED 3Q8EA 3U7WH 5JHDA 3HPJB 4RIRA 1F4WH 4XBEH 4J3WA 2UZPA 1XTLA 4LDOB 2WZPA 4KZDL 3VGAC 4PBVC 4QWWD 3LMJL 3R7QA 3WEXB 1L0XA 3V0GA 5E8EA 2FQDA 5GGQH 3RURA 4NQSA 3FUKA 2QVIA 4Y1AB 2XWBA 3L95B 4U6YB 5SX5H 4MXQD 5J1TC 2G0KA 1WA1X 2G4GA 3PGFL 1H3UA 1SMOA 2D7PA 5AWNL 3OC8A 5KBNC 3C6LB 2ROYA 3K72A 4JGNA 3V5KB 1UCBL 1ZWIB 3Q6GH 5CLWA 5IB1B 1TSRA 1DO6A 1G94A 1MUJB 1LEIB 1YEIH 4OCMC 4K5PA 5DA4A 4TNGA 5DJZA 4UINH 3U7YL 4G5ZH 4CN1A 3WLBB 5CIPB 4X6FB 3MXWH 4IGBC 1A5FL 1JRHH 2KPNA 5CEXA 1MRFH 3BMWA 1C5CL 1T1ZB 3QC6X 3MNMA 4OCRH 3OLGA 1DVZA 1KJVA 3HZVB 4J3TA 4GAFB 2UYLB 3SDCA 3MOAH 1T04A 2IBGA 4MA7H 5BW7C 3JUZA 4PJHF 5C0JB 1O7SA 4UF7C 3G5WA 4CMMB 2OQJA 8CGTA 4QXUL 1KJ2H 1J5IA 3RI5K 4JFEA 4Z7OF 3N43B 1J0KA 3QRLA 4IIQC 2ICCA 2Y5QA 5BZWB 4N25A 1NPNA 2XG4B 5D7SH 5EO9B 1AANA 5I1GH 4MDJA 4ZFOA 4FFVC 1JV5B 4DIXA 5KG9B 1P4BL 3QORD 4JKNA 1WCBB 4M4RA 2Y2TA 4PJXF 4W6WB 4WW2C 2DLFL 5C0DB 2D7NA 3DUUB 1Y6NR 3RLSA 1TUPA 2GIMA 3OJMB 4LLWB 5CEZL 3GHPA 4OZHF 3QFJA 3NDYE 4LRNH 1E4JA 2MHAA 1OAKH 3ECWA 3KYNB 5BRZE 2AJYH 1W72A 1R3JB 4X4XB 3ZW3A 5I1DA 3ML8A 1TTAA 4XNQA 5I8CA 2Y25A 3MI6A 3V52H 4TVPD 3U48A 4GRLB 2Q8AH 4J2XA 3LCYA 4OF7A 2A9CA 3MUY1 3FSWA 3KYOB 4Y7OC 2YSSB 1KIQA 2KDYA 2PR4L 1W9XA 2QQKL 2W92A 5D9SB 3LD8B 2ZXBA 3OR7B 4W6YB 1FSKB 1ZEAL 2EH8H 3T04D 1FA4A 2HN7A 2OV0A 3K7UA 3PQYD 3VXNA 4BBWA 2B1AH 1VLXA 1MHPL 4JFDD 1B0WA 4ZX5A 5IMKA 1G7JA 3VFPA 4I18C 4UTAH 4ZFOL 5ALCH 4Q89A 1LL1A 2P46B 1Z9OA 4L4VB 3CUPB 5GZOC 4ODVL 3CK0H 4G8IA 4P5TD 5GSRA 2Y7SA 1OT1A 2Z4QA 1FZKA 1NGYB 2J8UA 2QTEA 3V7AG 4PJ5B 1ADWA 1NMAH 3AXLA 4OGAC 1OM3H 4W6XB 4Z7UB 3T1WA 2WW8A 4PJ7E 3ULAB 2NZ1A 4Q97A 2NYYD 1AAJA 1W72L 3Q01A 4UAOB 5AAWA 5T3ZE 1QA9B 3ROOB 1HINL 4PJ9D 2YAMA 1WO2A 1SXZA 2IPUG 3GM8A 3JT0A 4G7YL 3QPKA 3RKPA 2WSDA 1L6XA 3TBBA 2AJSL 5EULV 1PZSA 3LN4A 4P99A 2XY2A 5DURD 5CJ5A 3UBXA 5LKNA 3RTQC 3BSZA 4AV5A 1OY3B 5J3HC 3P9LB 5H35A 4U3HA 2IANE 2ZWLT 4NO2A 2C3GA 2QR0B 1S7XB 4PJFE 4PY8I 2OJEA 2VDQL 2VSCA 3GBDA 5L4MA 4UILH 2F8IA 4DT2A 2ESVB 1NEZA 2AW2A 3LPGA 2HG0A 3PWPD 4LLMB 2EECA 3OKMA 3W39B 3WU1A 3VG9B 4P2CG 4FEIA 4L18A 1SOXA 3VXUA 1JF1B 4X9FA 5HYJE 1R75A 3H7LA 3V5HA 2QQQA 4LAQL 4ZMPA 2Y5TB 2Y7LA 3MRIB 3TXAA 1S9WA 4LOUC 4ODWA 1WICA 1BBDH 4LSQL 4R26H 1G9NH 1H9VA 2BRRL 5DHVB 2EEBA 3O8XA 4G3YL 4UQEA 5FGRA 5K1JA 3C8DA 4XVSL 3P30H 2QGDA 1NCCH 5ANMA 5ABAA 1BOYA 1CF1A 4HPOH 3EYFA 2NTFA 4N87A 3BSZL 3G6JF 1QQDB 3FFCD 3FU9A 5AL0A 3EHBB 2Y1YA 4G71B 5IM7B 5FF6B 5D2LB 3VFVA 4N2AA 3KPRA 3OMNB 2H3NA 4OFVA 4TVSa 1L9MA 2VLJB 3CCHB 4JO3L 2FJUB 5KOVC 2DWDA 4OBSA 4FI8A 4JZJA 1JVKA 3RWGA 2ZKWA 3GSOB 4FMVA 4NJAH 4GINA 1OW0C 3ISRA 2V7NA 2FGZA 3BDYH 4XHJD 5HSFA 3BH9A 2MQ0A 4V2CB 4F7TB 2QSVA 1USZA 5JW4R 1NCHA 5EOTA 1BJ1J 4NHCH 3KMDA 1GPOH 5HHXH 2ZNXA 3HS0B 5F9DC 4B41A 4X50A 1PBYA 1ZGLM 5JHBA 1KCKA 4YE4H 3NJGA 2BW4A 5GS3A 5KVEH 5TQ0L 4HUUB 1DJWA 2OBGA 1UWYA 3TN0B 3N2JA 1J5OL 3MX0A 1XR9A 4UUJB 4AOFA 2IH1A 1FV1A 2FATH 1LO2L 3G9VA 4B7LA 2FEEI 3FT2A 1MCHA 1GC1L 1RFDH 2BVPA 2VLLA 5IROC 1SRDA 1DQVA 3HBPA 1A7BA 4HD5A 2QPEB 1UOWA 3VXRE 1JNNH 5DC4B 1BJ1H 4L5FL 4AE0A 2EABA 1NSNL 4QCIA 3UAEA 3LIZH 3FTGA 3SGDI 4R4FL 4O4YL 1KTDA 2J5LB 4P05A 5EBWA 4IKLA 4N3TA 5B38B 1G1CA 3CLFL 1UCTA 4F7PA 4XNZC 1J8HD 1DQJB 1S7UB 3IMWA 4BZ1A 5MEPA 3N1FC 3IDMB 1PZCA 5HHVH 5I9QB 5FO7A 2LAAA 4ZXBB 3WS3B 1KG0A 2WP3O 4R7XA 3SBQA 3PPEA 2WQ8A 1E65A 4GNKB 6PAZA 4QKTA 1EJ6A 3UP6A 3U30C 2OR7A 3QIBB 3JWNC 4YLCA 2EO7A 1EFQA 1OD7A 4BH8B 2P26A 1H5BB 1A9EA 4PS4H 3MRHA 4PGDB 4CJ0A 1YG9A 4DUWA 2AJVH 4DGIL 4RNRA 4MB5A 1PY0A 2XETA 3ENEA 1KDIA 5F88B 4UQ3B 1SF3A 4L3EB 1FO0A 2ZWNA 1JGVL 1T6WA 5AL8A 2BSSB 3GB7A 2D0HA 5F9JA 5GRWA 4LLVB 1XR8A 3MODL 4BJLA 4XN8A 1JWUB 1Q9LA 4ZYKA 4MQSB 5I1JL 3IU3A 4M1DL 1N5YH 2VTFA 3DVGB 4KKLC 4IBZA 2BVQB 1A4KB 2P5EE 4A7VA 2JB5H 4H13C 1YMMD 1C08B 1LTXA 1AGEA 5TTRA 3RHWK 1EIBA 3F7VB 1GIGH 4MD5A 4BZ1L 4CL7A 2GITA 2X4OA 5D71H 3P11H 1F58H 2F53B 2XIIA 2J25A 3QQ9C 3HHSA 2JJWA 1JYXA 4IBVA 4IRZH 4MCNA 4XN7A 5AVVB 3CXDL 4LRIC 1EO8H 2X4PB 4UDTB 1D5MA 3L7FB 2D7TH 1IAIH 3CN1A 1A14H 1IGYA 2UVFA 2YJQA 3IWVA 2D2CC 4HIXH 4WI0B 2DWEA 1UA6H 2YPLD 3OGCA 3ROLA 4JDVB 4NIKB 4F15B 2XJKA 5FYJH 2R9HD 4DGUA 4NP9A 1HEJC 1AQKL 5D1ZB 5CCKL 1RMFH 1FO0L 1JPGB 3HE6D 5DR5H 2WUBH 3NJHA 4MHHG 1UZ6F 4GAJH 5TFSL 3X14B 4EF3A 2APBA 4BXSV 3KLQA 1G1KA 3O9WA 1CD0A 1WBYB 2FO4A 3CDZA 4HYTB 3LKOA 4KJPC 1DBBL 1T7ZA 5KVFH 3BPNC 3NK4A 3T8VA 4DTGL 1JNJA 4EIUA 1R47A 4Y4FC 4ZMOA 1OCCB 4JFSA 2WWMD 4B9ZA 2J88H 4X99A 1A02N 4L2LA 3MRQB 4FQLL 1THCA 2QELA 4M93B 4PJIF 1HTYA 3SYPA 4JQVC 4U1MB 3Q13A 4ONHA 3M6DA 5DUBB 3CDYA 4V33A 4XVJH 2A77L 1E7UA 3FRPA 1OAJA 2GJ6D 4M6AA 4MB1A 3VG0L 2XZQH 2R1XA 3IJSB 5HHMB 3ABMB 3UIYA 5G4NA 4DCQA 4R5XA 1OE3A 3OKOA 2GEQA 1KUMA 1S78C 2EC9T 3JTTB 3AAZA 1MFDH 2Y7NA 1KBWA 2LTQC 1RZGB 2XU9A 5IT2L 5I75B 4YSEA 5KYUA 4JDTH 2OMWA 1DYZA 1HHKA 4PJ7A 1ZXQA 5K33A 3FO9A 3MO1B 1TYRA 2HX7A 2Z31D 4G8GB 4LARH 2HFTA 2SEBB 1RKRA 4U1GC 1FN4B 5D4JA 2WXRA 1RZ7H 3ZHFA 4YFEA 2H45A 4LMQI 2PNDA 1PZBA 4ZPTB 3RGVA 3S37H 3IRCA 2ZAIA 5TE6L 4AKOA 4PRBB 4MX7A 4CAGA 3E3QC 5F7DB 5DVKA 2EDQA 3U36B 1DVFC 1JGEB 3KPNB 2IG2L 3HI1A 1NDGA 4N90E 5DC2A 5L0QC 1MVUA 5DHDA 4PJFA 1BFTA 3GSXB 1XXFC 1XWVA 1NAMB 2B16A 4N0CD 2EXYD 3O6LL 4X5QA 1MPAH 3OHXB 1PFCA 1OAUH 3PYCA 5EOQH 2ZWYA 2OR9L 5IFHL 1YQ2A 2W0KA 1RLBA 4XXCC 5FB8B 3T4YA 3H42L 1P84J 4HISA 4I13B 3O4LA 5DK0B 3RKDC 4CGTA 3MRLA 4HHAB 1FBIL 3CZFB 2BNUB 2ZXAA 1B90A 3ZHDA 1KIRB 1TJMA 5JTWA 1U3YA 4PTTB 5CAYB 5EU6D 5IHUH 3VTMA 2AHIA 4EIGB 3BPCB 4O00A 4R4BA 5T3ZL 4R90L 4Z1PA 4YSRA 1Q0YL 2NW2A 3DO7A 3N3EA 2JI3A 3BKCL 3U0WL 2FJFA 4HD9A 4P9HH 1QSED 2ADGB 2P43B 5K9JH 1IO4C 43CAA 3GSUB 3R1GL 1YVLA 1N6QL 2G5BA 4PV8A 3CVIH 4PW4A 5JOFB 1FYHB 4FNSA 4ZRGA 4YGVA 2BC4A 2H32A 2HAZA 4LLUB 4F8LA 1JZHA 3D7PA 4OLVH 4C4BA 5B8CA 3V4PB 5FK9A 4RWYH 3PDOB 4G5AA 4KKZA 3NSJA 2EEXA 5GSVA 1CDGA 2X0WA 3B6SB 3IDYB 3Q2VA 4H1LH 3DI2B 4JKKA 3EYVA 1AHWC 4APXB 1SJHA 4CJ1A 3VFGH 4AYSA 1G9NC 1EJOH 1AGBB 3QYNA 1L7IL 3TFKC 3TYFB 3MLRH 4PG2A 3S8GB 1MRCL 1NMCC 4JO4H 4GMTH 3QDHA 4LPTA 1SY6A 1SHXA 2ICWA 4JMNA 4AITA 3D39B 1FNEA 3OX8B 4ETQA 3MRCB 2HVBA 3JT2A 1UB5A 3BJ91 3V4VH 3Q9PA 1IIIA 1WFOA 5DSCB 3TBYB 3QXTA 4GSRA 5GRJH 5E5LA 5A16B 5AOMA 3IFLL 3QDJE 5CU9A 1L9TA 1OF2B 2JKTM 4TMPA 2R27A 5C0RH 1AYOA 4KY2A 2XTLA 4FQHA 4N3UA 5AZ2H 1JN6A 1NOFA 1NPJA 3B7TA 1URZA 1MLBA 1HHHA 3SD5A 5CZKA 5KVGL 1ED3A 1ZHKA 4PRHE 4QRBA 4YXHL 2BWQA 3IFOB 5DUMH 4OV5B 1JAEA 1DANT 3RVXC 4YR6B 3ELAT 4BZYA 1SYSB 2D73A 1Z5LA 5CCJA 5LG1A 4U6TA 5BVPH 2EDXA 2J1XA 5EIQA 1CLVA 4UOW1 3G5XA 1YUHA 3V6OE 5JXED 5KS9B 1KYOK 3WBDA 1TR7A 2R1WA 4OGYL 5DJCB 2CZNA 2Z7YA 3HZYA 5HPOA 4Y5YA 2H9GA 1QHPA 2AXHA 2EACA 5JOPD 3LN5A 4R7DB 5DYOA 4U2ZA 4H8WH 2NX5D 4Q52A 1VFBB 3B9KC 2ZX8A 1ZHBB 5TF1H 1EMTL 1WRFA 2OPCA 3DSFL 5CP7A 4OB5L 2BIOA 2F7PA 5IBTL 3B8YA 4FG6D 5GS1C 3TEXA 1XF1A 5A6MA 3D4ZA 2OMBA 3L1OH 3BJLA 1JNHA 5J12B 5FCUH 1GGUA 4OIBA 2VRKA 2B5IC 1PKQB 1MQKH 2XZCH 4QY8B 2XWJB 3GJFB 2IAMD 3C2SA 4YC2C 2HJLA 4PVMA 4PRPB 1CD1A 3JWNE 3RX9A 1RURH 5K39A 3JWOH 3ECQA 1JP5A 4M5ZL 3HE7D 1MI5D 3QNXB 1JTOA 1ZS8B 4K23H 3TCLB 3UTPD 3BAXA 2FUTA 3OWEA 2PO6A 4AT6B 1A7PH 5E6ZA 3D2UA 4JW3A 1AJ7L 1KY7A 1AY1L 1UJ3A 3ECBA 2JCCE 4GG8B 1KYDA 3U6RB 2DQFA 3S3PA 1CK0H 1CFSA 4PV9B 5CBEA 1PG7H 4N26A 1P6FA 2E27H 4Z0BL 5HJBA 1L0YA 1KFAL 1COBA 3F05A 4XNMA 4Y4HB 1RP8A 2QZ5A 1BWWA 3LSOA 4IRJD 3ML9A 5F1KC 5FM5O 3KH4A 3L3OB 5E00B 4JAMA 5JMRA 1WD9A 2WGXA 1MCRA 1ZLWK 4X6CB 2X5PA 3BAYA 5C0CB 1NQBA 5L4JA 3L4VA 1RZJH 5KN5B 2E6PA 3VYNA 5BVJB 1TLMA 5DK2A 4LHUG 4BFOA 1AO7B 1GMIA 1BQKA 3GPEA 2D3NA 3KJ4B 4KGLA 2QGBA 2MOGA 4BH7B 2K3TA 2WZAA 3IWUA 1UXLA 4NFCA 1XGYL 1KJ3L 1TVBB 4HSAC 4OJCA 3K6OA 2QVTA 2VDML 2AQ1A 2FB4L 3S3CB 4N2GA 5CHNB 3SPHA 2A99A 3VGEA 4KHXH 2I24N 1KTCA 1AXTL 4AEIH 2VC2H 4KMTH 3NGBB 1ZGLP 4HU2A 1WFUA 4JQIA 1MWAA 9PCYA 3FAWA 4JFVA 4FYSA 5EZJB 1BM3H 2FJHA 3OLDA 4EI6A 3FB7B 1ZHNB 3HAEG 1YNLL 4OI8A 4UTBA 4KXZI 2OL3H 2D03H 2N01B 3P3TA 4CNIB 2XXCB 3B3IA 2AJ3A 1A21A 2P24B 4NO3B 4UMSA 4WTXA 4XOBA 4KRPB 5FGCE 3E6FB 2BNRA 5KANG 4Z7NF 1XF2B 1X4YA 4JPKL 3KYMB 1A3ZA 3CDFA 1XIWB 4DK5A 3HB3D 3MSPA 1LYQA 2R51A 4HIIA 4CSSA 1V3MA 4HWBH 4R0LB 1U0QA 2DMCA 3FF7A 1BQLH 3DUHA 1EZUA 2A6DB 2HT4C 2NY0C 1GW0A 2WCSA 4PJEE 2P45B 1S9YB 2MH4A 4NWUH 1NEZG 1Q9WB 3FRUA 1JUFA 3IXTB 3PPSA 5JOEA 4AJYV 1EBPA 2FT6A 1ZA6A 2EXTA 3D0LA 1XH0A 2OM5A 3ZO0A 2XIBA 3MXVH 4R9HA 1CFTA 5C8JB 1QFWM 5HGBB 1K4CA 2Z4TA 1XBRA 4V1DB 2VITA 4ACTA 1UUNA 4I3SH 5FHAL 2BS71 1KT2B 5TE4L 2CM5A 1DQKA 5ALBH 1AR1D 1MWAL 5GISL 5L4IA 4UIKH 1G6RA 4MJ6B 3GI9H 2EUZA 2XZAH 1EGJA 1CPUA 4TVPH 2GI0A 5TQ2H 5ID0A 4MGXA 1JFQL 3DUSA 2HT3C 3UAAA 2J1YA 4UTBL 2B3RA 5EA0L 1NGQH 3BQUA 2AJXH 1WVZA 4I7ZC 1BQHB 2X4SB 5DQ9B 3PREA 1INQA 3LXCA 1RZFH 3LKNB 3KEDA 5G4OA 3CFKB 4IBWA 3MHZA 2E3VA 2D31A 2OI9C 4K3EH 4PJDE 2XCMC 3C5ZB 1XH2A 1JHKH 4H5SB 1NL0L 3F12B 3VXMB 1AP2A 1LJMA 2NNAA 1E4XI 3EJYC 3TNMB 5FA3B 2FSEA 4XTRD 5A3IC 2VW4A 2FWOB 3FUNA 3UTTD 2HJFB 5DUJA 4L3AA 1S3RA 2F68X 3IYLW 3GTVA 5E2UL 1GS6X 1L4IA 3MCKB 4MRCA 2EDLA 1BIIA 5ELIA 1F4YH 1ET8A 5EZOL 1X5KA 3UBFA 4QIRA 2VLRD 2IPTL 1HEZA 4QJ3B 1E5YA 3A22A 1X5FA 1YNTA 1I85A 4MD0B 4A66A 2HWZL 5F1NB 4D94A 1YJDH 4KO6A 2A74B 1G6RL 4Y16A 3MJ9A 3QJVB 1EGJL 5JPMA 3QZWG 2IH3A 2R23A 2Z8SA 3DROA 4GUPB 1EAPA 3WFCH 4O5LH 4AYDC 3C60D 4P4RB 2A1WH 3T3PE 4GSXA 3UJTL 3PY9A 2EE2A 4RGMC 1A7OL 1ID2A 3T9WA 4PP1C 5HGDB 4GBXB 3AG1B 3O6FA 3DTUB 2BIMA 4XXDA 1BV8A 2BVUA 3H2PA 5T1MA 3P0VL 3BI9X 5J11B 2AAVA 2C9AA 2C1OA 3KPSB 2BY3A 3I6SA 4WSJA 2XY1A 4NO0A 2YAPA 4FQXA 4WRLA 1A3LH 2UWEE 5DZAA 2J7LA 3K6DA 3VWKD 3D34A 4QRRD 4AENB 1UWXK 5B1JC 5HGGS 1ET7A 3UPRA 3GS4A 4CKVX 4XCYA 3QDJA 4XH2A 3GNMH 4ABVA 2GK0A 3DGGB 1PZ3A 1XGRB 3CZEA 2L7EA 1KPUB 4PLJC 1A1MB 2F18A 3VXSA 1X3DA 2OMZB 3MCG1 3LNDA 3UJIH 1PJWA 4ANKA 4QYOB 2KLSA 1G7QA 4HGKC 1F6LL 4C56D 5EOCJ 4NCC1 2PF6A 3ZRFC 3AM8A 4PRHA 1A4CA 1BP3B 2WXNA 2ADIA 5E6RB 3WFEL 2ADFL 3D3VD 4GI6A 3MJ9L 4NKMA 4NM4L 2WNKA 4BFIA 3BUTA 3HC2A 1AQHA 2QZQA 2VDPH 3KWXA 3W37A 5KVDL 3SN6N 5HHNA 3U1SH 1JL8A 5LQBH 3LZQA 3V6OA 1BSIA 3UZEC 1IBGH 5T1LD 3S4SB 5EN3A 3H9SB 2MKLC 4L3CB 3OMZA 3GUTA 1YSOA 2EZ0D 1FFQA 3WL9B 4BFFA 1R6VA 4DVRH 3CFCH 3AT0A 4NC1E 2G3MA 3N43F 4JFFB 5E1GA 1YC7A 5D7LD 5A2BA 3KLHD 2X3AA 4UDUA 4KO9A 5EOCH 5I30H 5IOPB 5EEZA 4J23A 1E30A 3T6QC 3SBWC 1T21B 2DQJL 3EYOB 5HDOA 5KVEE 1FLRH 1JHTA 1FYTD 2BERA 2Z1KA 1QLEB 4KTEL 4P46D 1F13A 4JK0D 3IGFA 1O9VA 4ZFGH 3SDDB 5I26A 1U8CB 3V6FB 2MNUA 3VRJA 1KLGB 1OK8A 2YFOA 1JK8A 4MJ5A 3FYEB 2OMXB 3X11A 3X1FA 4U1HB 3GXTA 1YEEH 5GRUL 2OW6A 4UBDC 4KKAC 1LWHA 4H8WC 3UBHA 3CX5J 2E8YA 5DJAB 5JIHA 1T1YA 5CWSB 2NCEA 1NGXA 4IIQB 1CZ8H 3GO1L 1CTOA 2EAEA 2A4ZA 4HHWA 2CDEB 2VMFA 1YNKH 2XQ0A 3CLWA 4HLEA 3GJFK 4MD4A 2CKBA 4NI6A 4XVTL 5HI5D 3I75B 2JCCA 3VYPA 5B3NA 5E9DE 1OLZA 4EEEA 1BX2B 4XN5A 3MV8E 3MLWL 3RU8L 3Q0HA 3UO1H 3HTLX 4Q14A 4MS8C 3NZ8A 4KH2A 3QUZD 3ZE0B 4Y9BA 4Z95L 4P2QD 2G2PA 4GXVH 4ZT1A 1M7DA 1XCXA 4ZQTA 3ARGB 2F1AA 2X89D 2X6CA 5CF3A 5EU5B 4PD4K 1NFKA 4XNXL 5CJXA 1XX9C 4P2RB 3UG5A 1W0WA 4U3SB 4MMZA 3FRPG 4NYLA 4Z7UF 3O3DA 4XNDA 2R59A 1HSAA 5DI8A 15C8H 2BSTB 1U91B 5HI4C 1X44A 3U4BH 3FH5A 4TUKL 4UT7H 4JPSA 4FQPA 3LVEA 1G5GA 2AQRA 3IDUA 3K3QA 4MA3A 5I2IA 5B1AB 3NZHH 5HY9A 1TZAA 2V4LA 4FP8H 1Y1DA 4JQXA 1HI6A 3QFDB 3TV8A 4I18B 3HUJB 4WTZG 5KSBE 4JCWA 3F58H 1N10A 5E2TH 4ODTH 3IVKB 1UD8A 3TESA 5HD8D 4XBEL 2CIKA 1CE6B 2CKBL 1U8HA 1KJ2A 3F7LA 2B59A 4IMLA 1UOVA 2A0LC 4EDWL 3FSVA 4MKTA 3FTZA 3BP7B 1RJZA 1BXAA 2JKLA 3BKMH 4C4KT 3LRMA 4I9WE 1HWGB 5E8DH 3W11C 2ODIA 5FYJE 5LBVA 4HH9B 5L88H 3Q6GL 2QPUA 1YEIL 3BDXA 3N40F 4PJEA 3CC1A 1BAWA 1YDPB 3PDGA 1OGSA 2P8LA 1KTKE 3PWLA 1ZE3H 1IMHC 1MRFL 4JFXB 5KVFE 5SWZE 2XYCA 2NOYA 3GXDA 4OCRL 3ULUF 2O72A 5I6LA 2XRAH 4F33A 4MFHA 2I9TB 3TU6A 2EDYA 1VESA 5BO1H 4J27A 4B27A 4APQB 5JR1H 3MOAL 3PAVA 3I6GA 4DKEL 4X9IA 2CIIB 4M3KB 5I66A 3UC0L 4TLKA 5D2LF 4X8XA 4KV5F 4PH8A 4LPUA 2ZPKH 2BM3A 1ZT1A 2YARA 3OV6A 3P40A 3CHOA 5E99H 4F8OA 2W07B 5K59F 4D0BB 4LL4A 4WQOA 4L8BB 3MBEA 5D7SL 2EVIA 3QORC 3CFMA 1QR1A 4Y2DD 2C9PA 4X7SH 4KKCC 1B0GB 1QFWI 3QUYB 2JQAA 3IDIA 1MFMA 5JDJA 3B5TA 4LPVA 4RMUA 2JCWA 4JHBA 3TPUA 2EDDA 4ZBJA 5I76B 3EF7A 4EI0A 1HILB 2YO3A 2LR4A 4JNXA 3SOTA 4LRNL 1OAKL 3RDTA 4NUGH 1KXTB 3SKNB 4YSUA 1RL1A 4POZD 4DGWC 2CUMA 3VFOA 2LFGA 4H88H 1J1XL 2B0SH 2F0CA 2Q8AL 5IMLB 1T5XA 3B2MA 2ICEC 1V3LA 1AS6A 4ZO8A 3MMEA 3VXOA 2F1EA 4X9HA 2IADB 3D85B 4P5RA 1JPTH 3Q2WA 3LDBC 1K2DB 1WA2X 2GAZA 3BKJH 2CRIA 3THMH 3GXFA 1SXAA 1RUML 4K8RL 3FCSB 3IAPA 2EH8L 3QJZA 2Z7ZA 4HJGA 3IDJA 3V0VA 4P4KD 3DVFA 4YXKL 2DQEH 1VADB 4H20L 1KSRA 4EQ2A 3SE4C 4PYHA 5ALCL 4J8RA 4B50A 5FA4A 3BWUC 1XV8A 2NQCA 3KPOA 4OFKA 2JK5B 4FXKA 2F7RA 5I17B 3MVSA 5INCA 3S6CA 3QIWC 5DO2D 4YHLH 4JRLA 5LJYH 4PS8A 4ZO9A 3N0AA 4QUOA 4GUQA 3WNKA 5IK3A 2HFGH 2Z93A 2FWUA 1HK6A 2YA2A 4E41B 2R0ZH 5HDLA 3US0A 1OQXA 2FR4A 1GAFH 1LEGB 1LM8V 3BE1L 3FBKA 4Z3EA 5CEYA 2FX7H 5F8RC 4FQ1H 1QASA 4NKDA 5DJ8A 3LIUA 1EFXD 2I60H 1PVHA 4CSZA 2VQTA 4AQAA 1XZWA 1I8UA 3NA9H 1W8OA 3STLB 3QNYB 8FABA 3VSQA 4FXTA 3FTYA 2HLFC 3ECUA 4JPVL 4P2AA 4XVOA 4Y4KD 4XGZA 1AIFA 4W9GC 1PGRB 4W9IC 5J89A 4NERA 3QWQB 5LDSA 5HDQH 5CSBA 4I89A 4AMXA 4CN6A 3CSPA 2IGTA 4YSQA 3F6IA 1ZCRA 3EG9B 4RMRA 1RVFH 4K9EC 1X7QA 3MLPA 1DBAL 3TJEL 2DEYX 5E6SB 6TAAA 3N85H 2YKLL 4CU7A 5GZND 3Q2NA 3O0RH 1LK2A 1NFDA 4X5PA 1PYWA 5I73C 1KCSH 1CMOA 1IGJB 3NIDE 5EBMB 2GG1A 3GRBA 5IMMA 3S0PA 4ZUWA 2K3HA 5IMOA 4X42A 3P30L 2YPKB 1LEIA 1RPKA 2OZ4H 3OKLB 4LCWD 1U8LA 4R97C 2GB2A 4WSKA 5CUSH 5IIEB 2C8NA 2GABA 1WAAA 3QXDB 4JFOB 5IV2A 2KL6A 5L2JA 5F7UA 1TVDA 3QI9A 3UP1A 4WJKB 4Z77A 5A7EA 2LHAA 2X4NB 3C09C 3QDMB 1T22B 3QCVH 4XO3A 3VNZA 4U1NB 4EZLA 3ARDC 3DC0A 4NZ8A 1PG7X 3K2UH 3VE0A 1BIHA 3L3JA 5DJ6A 1GS8A 2VDOL 1G9MC 4QXTA 4UQ2A 3ZTNH 32C2B 3A6CL 2F9BT 1LD9A 4A6YB 2XWTA 5ADOL 1D6EB 2MTAA 2YWYA 3BDYL 4Y88A 2D0FA 2X4QB 1UT1A 1FZMA 4X8CA 3VMNA 1RJYA 4HX1A 4F2EA 2P47B 1TNNA 4XBGB 5AOKA 2DW5A 2YBRB 4NHCL 5E9DA 3TWCL 5HHXL 5HPMB 2VL4A 5C0BE 4OZ4A 3COOA 2YZ8A 3TVMC 5EF2A 1JDCA 5JW4Q 2JJVA 4MAUL 2BOBA 3A23A 4KZCA 5KVEL 3FTUA 4LXFA 3FUIA 1AXSA 3L4WA 1UQSB 3HRZB 5G5DB 4YNYA 1A47A 2FATL 2YMTA 4YHPB 2DOCA 1NC2D 1RFDL 4ZMZA 3EKCA 3I9AA 1EHXA 1JZFA 3RPKA 4HP5A 3WDHA 2QV4A 3R8QA 3TO4A 3AADB 1D9KC 5KSAA 3A4AA 2Q7YB 2VDLB 3M07A 2ZOWA 2ZT9C 5ENWB 4GW5B 5F1IA 4RCAA 1DEDA 4AGPA 2VMEA 5FO2A 3KBHE 4AGOA 3R0NA 3FB6B 3MUGB 2DYPA 1I31A 3B9DA 5JHLL 2R83A 3FDWA 5D6DA 5D5ME 5DRZA 2VXQH 5E51A 3G6DH 5KSBA 1LO3H 2BOLA 5IFJB 2QADD 4HS8H 5K9OB 3P4OA 4MNQD 5DMKA 1ORSB 4AQ1B 2B39A 3OKDB 2AABH 2EDBA 1HVXA 1BYPA 2VUKA 4JM0A 1P6AB 1U36A 4XP1L 5IREA 2H0PA 4MJJA 4XVUC 3I3DA 1ZT4B 3S8FB 4YHML 3M1CA 1U8OB 3LOWA 4PAZA 3NABL 1SUJA 2G2RB 4PN6A 3SZ6A 1T7WA 4AQOA 1BGXL 2P5PA 1BZ8A 4DN3L 4DKTA 2OTWA 4GKZA 4RDBA 4NO5A 2AJVL 4U1GB 5F96H 3WUWB 4CVUA 3T0EE 2BK8A 3ZXAC 5SWQB 4IOFC 1WF5A 3LNEA 1CLZH 2IQAB 3LNHA 5B21A 1LLAA 1WT5A 3VXTB 5FM4A 3WJMA 1VIWA 3BO8B 3LQAL 2J73A 3EBGA 4K94H 4S2SA 5GJTH 3O6MH 3CPUA 4MNGB 1DVFB 3CBJB 5SWZA 4AH2B 1BOGB 7FABH 5L0QB 3D06A 2R8SH 5ACLA 1R0AL 2PWEA 1T7VA 3EYQD 1QRKA 4OU3A 1WBXA 4RFEB 3OJDA 3Q3GA 4QI3A 1USQA 2COQA 2H2SC 2QFPA 3S34H 4HWZB 5EZPA 1A6ZA 5D71L 1MHEB 2JI1A 3P11L 1F58L 3K6IA 4J6IA 2ITFA 3DOSA 1TENA 4X6BA 2FJGB 4Z0XB 3C5JB 1EO8L 3AREA 5GRYA 4RVBA 4EN3D 5IY5B 2AEIT 1OB1B 2D7TL 1IAIL 3RNKB 1A14L 4ZNEE 5I8KH 2R9HC 2K7QA 1UA6L 4JY6B 4B0MB 2AEPL 2MOVA 1ZK9A 5D2NC 1NGZA 4WW1A 4LBEB 4N22A 3MU3A 3WJLA 4LP8A 3BZ4B 2DPKA 2W0PA 3UMNA 4GAJL 2Z8WC 3MUUA 5AYUL 1U2HA 3O45B 5KAQG 5AW8B 2WTRB 4ZAKC 3UTZB 2VNCA 1RZ8A 3MNVA 3MQIA 2PMZA 5IG7A 3KZ8A 4TOYH 3VMPA 2FYYA 5ICZA 2LV4A 3MCLL 5I1KH 4NZFA 4HU8A 1FFNA 3G5YA 3DRTB 1PX4A 3WNJA 4GG6B 2YD3A 3SKJH 1AGCA 1ERNA 2GSGA 4HJIA 1M2OA 3VJ6B 3VWJD 1NMCB 2F54D 3QO0B 4FD0A 1NUDA 3NPZB 1P53A 4XVJL 4NKOA 4XPBH 1XCQA 2B1HH 5E6IC 4CRPA 1ZKAA 1MF2L 2VDNH 1UXWB 3MFFB 4P5KB 4M6OH 3ISYA 4OKVB 4XO4A 3SDXE 4CADA 4YDKL 2EIZA 2WYHA 3CFTA 3QZNA 4HG4J 2A6JA 2WVTA 4U4BA 2XX0A 4NOFA 1MFDL 4RAUA 3VFRA 3MJ7B 3GXUB 5D1QD 3FK3A 4NPKA 1MJJA 3QPXH 3HG4A 1CO1A 2Z31C 4JFDE 1DUZA 4KRMB 5D1XA 4AIEA 3T0DA 2RGSA 3AITA 3U4KA 4UOW0 3OR6B 4LARL 3CVHB 3V0JA 1MAML 1IGTB 2JTDA 1O6TA 3JV5A 4M1CC 4MSWA 4E42B 1RZ7L 2ZJSH 3RWCB 1OAZL 3GD1C 4YFLF 4NQDB 4WHYG 2HLAA 3S37L 3GYRA 5ERWB 2QLYA 4GW4B 3KLAB 5DGQA 5HDRA 3V8CA 1UKSA 3VFTB 1XCWA 3DLQR 5EUOB 4Y1AD 3MRJB 4BWUA 4GOSA 1OK0A 1AOZA 5IB2A 2JJTA 5D7JA 4HV8B 3AQXA 2CRZA 1JF5A 1QNIA 3TTSA 4BK5A 4JY5H 1YYMH 3Q5TA 4NFBA 5EORH 3GBLA 2IPUK 3NCWA 4W93A 2K6ZA 5IJBC 2UUDH 3LY6A 5D96B 1MPAL 2APSA 4BWWA 1OAUL 4LKXB 1YQVL 3B9KB 3WHXB 2XJLA 2A6IB 2CMRH 1JTTA 2WY3B 3C75A 3REWB 4TNEA 5GJSH 5FDYA 1C12A 2J3SA 5CBAA 5T33L 5CZXC 4RH4A 2DJUA 3WYRA 1LHZA 3BEVB 1P4IL 4N2HA 4E2OA 4RZKA 3LEXB 3K5RA 5I16A 2B5IB 2AJZA 5FUOH 1YPZB 3AVEA 4UM9A 4NNPL 1FFOB 4EMZA 1ZVSA 4WHTA 2PTTB 4YC2B 4ODSH 3UCRA 4AQ8C 5A6LA 3MJWA 3S36X 1MNUH 4P9HL 2ROXA 5K9JL 3IDGA 3RPBA 3CN0A 3FQYA 3D18A 4U1IA 5F9OH 5JYLA 4X6CF 2VN3A 3CVIL 5IKCA 2PCFA 2Z9TA 3RUGE 2EJ1A 1NPUA 2BWIA 2X3BA 4POUB 2RB8A 5EEYA 5EBLA 4LGRB 2OYMA 5EO1B 2ZG3A 2XKNB 3QWRA 3CDGA 1WYJA 4RSYA 5DHYA 1SM3H 3IAQA 1M6OB 4L1DA 1EEZB 4QGYA 4TSAH 5FGBC 2W38A 4UQBA 3C6EA 3FUEA 1OGAB 1OP3H 4M7LL 2WBJA 2W5PA 1LE5A 3UG3A 4RA3A 5H2BA 2A83B 4G1EB 3QUMH 2PXYB 3QPQD 4UV7H 1RHHA 3QISA 3ZGHA 3FFCE 2H4EA 4X4MA 1AD0B 3AU1A 1YEKL 4Q9QH 2AXGA 1CTMA 4HF5H 5IGXH 3MV7B 4GRLD 1IKFH 4L8DB 1OGTB 4P48A 5EF0A 4M1GL 4B5ZA 4NFDA 2YRBA 3RFZA 1FCGA 5IR1B 2I07A 1TPXB 3BWAA 3O3BB 5KW9H 3KWWA 4W4NA 5GRJL 1IC1A 5JHDB 5I5RA 2YQGA 2XG5A 1BG1A 3DX7A 4OZIB 5J5EA 1KGCD 4IBLT 4KVNH 5E8EB 3UAJA 5K5YA 1M4KA 3OKKA 4PU2A 1J9RA 3K4ZA 4JY4B 5C0RL 4HMDA 2Y5EA 1NCIA 2XWBB 1PKOA 3RIFK 1TCRB 3DRQB 3QO1A 5HGHB 4TQEH 3ZDZB 1KULA 3BZEA 1SHSA 4H8QA 2Z34A 2P7TA 3S5LG 5DUML 3CH1A 4TKWA 4WUKL 2CJSA 3DJZA 5D5MA 3BUPA 4OD3H 3VD9A 1GJIA 2ZOLA 4X4KA 5BVPL 1T83A 4KFMA 4PJ5D 2R4SH 3H3PH 1Q4NX 3A47A 1N9PA 4F2FA 4PJ8A 2XKUA 3CBKB 3SQBB 1PTZA 3WN6A 1I1YA 3W5NA 2O5XH 3P2BA 4LSTH 3IMTA 1OTTD 5BNXD 1I8LC 2EDRA 1F90H 1MH5B 4GO8A 1XCTA 3FU7A 4QRQA 3HEIB 4G7RB 2CNYA 3SDCB 3WE6B 1YMHA 4AG4H 4DKFH 4AIZB 2LGNA 2NY0B 4Q6YA 4G8FA 3NJMA 1OQOA 3EO9H 5AZEL 4QRPD 2GFBA 2OQJB 1KGIA 4HKXA 4NPYA 3T0EA 5AUMA 2PKDA 2AC0A 4UYQA 1XGTA 1UB6A 1Z9SA 4JE0A 4NZUL 4LU5H 4ERSL 2FX8H 4JFEB 3UYRL 4U0RC 5GGTL 5EC2B 3WKMH 4MDJB 4ZFOB 4DQOL 3K2MC 5F3BB 3VDBA 1TKWA 2ESVD 1D3CA 1HKFA 4GT0A 5I1IL 3WTXA 3WXWL 1RURL 3INUH 2FCBA 3HE7C 4BKTC 3GTTA 3QCTL 3QFJB 4ZD3L 4LQ1A 4WVRA 3DO4A 1D5RA 4HUXB 4K23L 1OB0A 2V2WA 5L9DH 1N3NA 4OCNC 3BD4A 5IESH 1W72B 1TYEB 2Q3ZA 3OXSA 5I1DB 5I8CB 4XNQB 4RSVA 3E1F1 3VXPB 4YDVA 3FQTB 1FH5L 2C9UA 1UM4L 3AG2B 2WBXA 1CK0L 2IPKB 3ARBA 1KIQB 2G3ZA 1YEHH 1NC4D 2CXGA 3ARRA 4K2UH 3ULUD 1ZGLA 4JZOA 3NIGB 1AKJB 1RZKH 2Y24A 4M5YH 2OYKA 1YMME 4ATWA 2CLVA 3EHBD 1I7RA 1TU2A 3IXAA 2W9DL 1PAMA 1O7DE 2OLDA 3VXNB 2Y6SC 2VDQB 4HWBA 3P77B 3VQ1C 3JVGA 2AITA 4TUOA 3RY6C 1QNZL 3VFPB 1G7JB 1RZJL 4K3JH 3VI3E 3HOGA 4M5SA 4LHUB 3GHBH 4OJAA 3RRQA 3FONB 5AAMA 4WLCA 1RUPL 4F57L 4GAGL 4G8IB 4GXUM 2DY2A 4N2LA 1A6TA 3NYKA 1A7RH 2Z4QB 1NLBH 4N24A 2J8UB 3NZUA 4NN5B 2CO4A 2DEWX 4KHXL 3ZT6A 2EIJB 3D25A 4Y2OB 5C9JB 1DQQB 3ARPA 5IQ7H 3O4OB 5J6SA 1Q9KA 1N8ZA 3SQOL 1LMIA 4Y5VA 3TN0D 1BM3L 2BCMA 3QEUA 1Y7VA 4F2MB 1R33A 4JHZA 4JO2L 3DTXA 3HAEB 3QJRB 1IVLA 3K80A 2P1YA 4XNBA 3CZNA 3O2VH 4KH9A 1KLUB 5DEGA 3SDXA 2YRZA 4KQ0A 3IK2A 3ZDYE 1SN0A 2GTWA 3U0PA 2JKNA 3OAZK 1C7TA 4HWBL 4AGMA 3PQYA 3FB8A 2YD4A 4ZQKA 2EIKB 1IFHH 3HC4H 4JFDA 1BQLL 2QJDA 3HN5A 4CVZB 1HE8A 2YUZA 4PY7B 1ZLEA 4LEXH 4KX7A 5DC0A 1EQWA 1NEZB 2GJ6E 3WDIA 3CSYB 4NWUL 4K8RC 3CFNA 2Q86B 1LEKA 3TA3C 4Z23A 5LGKA 4M7ZC 1MY7A 4ORGB 3ULVF 3TGXA 4FMKA 4JGUA 4M03A 1L3WA 2P48B 2Y4SA 1RK7A 3AB0B 4IKIA 4P5TA 4ZXBD 5DRWB 4WWOA 3L9RA 2WBKA 4YDIL 5JW4M 4P2OC 1NIEA 2ATKA 3QIBD 3V5HB 4FADA 3CN4A 1E9OA 2O6CA 4KZ0A 2GSIA 4ODWB 4EAEA 1E4HA 4UIKL 3GI9L 1WWWX 5IVXB 2XZAL 4PJ9A 3F7YB 4TVPL 5TQ2L 1O75A 4DPRA 1E9QA 4AZUA 1ZJBA 3OKYA 1OSZA 3M1OA 1U3HC 3AT9A 5C0IA 3RP1A 1NJ9A 5ANMB 4KQ3L 1IGFH 1I1FA 3WFHA 3VFVB 3L3DB 1U58A 2WTPA 1N64H 3KPRB 4WW2F 2H3NB 3MRGB 3NH7H 4YSSA 1WV7T 4G6JH 1JHKL 4MA1B 1N7ML 2DWDB 4XCFH 1O5DT 2ZWZA 5F1SA 5EIIA 4JZJB 3RE0A 2EDWA 1V3JA 4R2GC 4K3GA 3LYRA 3L7EA 3AS0A 1P5UC 2WJ5A 5IJVA 5ITBL 3ZE0F 4HFWB 3BH9B 4ZO6A 2VR7A 3PWPA 1LP9A 4ANVA 2AXWA 2KZWA 3DV6A 3I6LD 4HXBH 4X6DE 4ZI8A 4X0KA 1KPRB 1TOXA 3IJ7A 5BZXA 4QRTA 5DVOA 4HSQA 4PGBB 2YGNA 1CICD 3DV4B 1QBML 3RZCC 1DSFH 4TYUA 1IQWH 2O5YH 3GLZA 5EU6E 3BVUA 2ZUTA 1A4AA 4E9YA 4GYBA 1FV1B 5JQ6L 4YDZA 3QZWB 5DEZA 4YHZL 2BMKA 2KQNA 1N70A 3PJLA 1EH9A 4NSKA 3AWFA 5D1ZD 1QSEE 3C60C 3DYOA 3HUJF 4OFYD 4YK4B 7TAAA 5C9KA 4A68A 3P69A 3KVQA 3N44B 2VN7A 3FFCA 3CNKA 4OJDH 4OFDA 3HHMA 4HDIA 4HUCA 1S7VB 2DTSA 3FTGB 5LN8A 3GSNH 3Q2CA 5F2FA 1JPSH 4NZTH 3X13A 1KTDB 1CF8H 1E2WA 5EBWB 3VWKC 5DD0H 3CN2A 4YPGA 1NOAA 1MCSA 4Q9CA 1KACB 3OG6B 5CJOH 3MRBB 3PWJA 3QW9A 4F7PB 2E6QA 1GKEA 1OO2A 1RJCA 2CGZA 2AAAA 3BISA 5E8PA 5MEPB 1P7BA 3U9UA 5I19L 2TRHA 1AQDA 2DZEA 5FO7B 3GNML 2Y7QA 1BQSA 1KG0B 1N18A 1I9IL 4M6MH 4PJAB 3NRPA 1A22B 3Q06A 1L3NA 3CWGA 3BWSA 3PHQB 3WELA 4GP4B 4H4NA 2VAAA 2DQ6A 3MBWB 3T3ME 5IB4B 5I6XC 4B9PA 3MRHB 2C9SA 1U95A 3IM1A 3B9AA 5HHMD 2JJSC 4RNRB 2PYFB 3S98A 3ZQWA 5DVLA 5I18L 1FO0B 3U25A 3BAKA 3V5DA 3GB7B 5F9JB 3GTNA 2R56L 2P42B 2VDPL 3OMAB 4U1KA 3U1SL 2Z0BA 4C57C 3EOBA 5JDSA 2WKGA 1CGSH 4FFZH 2E74C 3OWRA 4ZYKB 5IJKA 4IKNA 2NXYB 4J6RH 1I8MA 1NCAH 2OKMA 2NY7H 2YAHA 4G8GD 2C9XA 3CFCL 3SPVA 1BD2D 1Y1UA 4LF3B 2VR5A 1UATA 3QHTC 1X4XA 4KNTA 1AGEB 5JA8B 2WWKO 5JW3H 3QJOA 4TTGA 1J8HA 3FH8A 1HESA 1MDTA 2GITB 4ZFGL 2UVEA 3P4MA 2ZUUA 1TTFA 5ESVA 5F89A 4JJ5A 3SDYH 3ZR5A 2OMVB 4NRZB 3DIDA 4BM7A 2WTOA 1YEEL 3H8NA 5JOPE 3PDDA 1PFOA 1H3PH 2NX5E 4RFNB 2WINA 2DWEB 3ROLB 3OGCB 1O0VA 1E50A 4XB3A 1FFTB 2YC1B 4DN4L 1BVNP 4ZNCD 2DQGL 5JIQA 4G1MA 1HXMA 2BP0B 5LAXA 3FCUB 3L5JA 6FABL 1AQMA 3M45A 4LDLB 1CZ8L 2AK1H 4WTQA 5FYKL 3H3BC 4WO0A 4OI7A 5T5FL 1OAYL 1C9SA 1GSKA 3A24A 5DLMH 4EBQH 5HI5C 4WFHD 1ROCA 2OULB 2GBUA 3QWOA 2X9ZA 3O9WB 4NKIH 3F01A 4Q6IA 2V5RA 5KJ4A 5DQJA 2BIHA 1HH9A 3FUFA 3UO1L 1MFAH 2WVVA 3FOLA 2R2HA 3NCEB 3UBGA 2R2EB 2YUXA 3F84A 3FO1A 1MI5E 1CDCA 1JJUA 1EO5A 3UTPE 2FK9A 2JLPA 4P5MA 5E8OA 4CSTA 1UENA 4JO8A 4MJ4A 4XO8A 4GXVL 1RP9A 2ICEB 4W9KC 1CC3A 4LVHB 4DO4A 2IVFC 3VI3A 5GIRB 3FRPB 3LDBB 3X17A 2R1XB 4KOCA 2QQLH 3V79C 3QRGH 1J5HA 2VDRH 4WWID 1SXCA 2W60B 2PTUA 3OKOB 3I9GL 4Y9FA 3U4BL 1W80A 2X05A 4UT7L 2YPLA 4E9VA 1A9VA 2IC2A 1NBVH 1EXUA 1ULVA 1TQBC 3NZHL 3SE8H 1MZYA 3Q05A 2NYKA 4FP8L 5KYUB 1BZ7A 2OMWB 1HXYB 3HE6A 2WLLB 3GUFA 1LNUA 3B7RL 3D39D 4U05A 3IEAA 2DS4A 5E2TL 1W16A 1M2VB 4Z7OE 2O6FA 4P5SA 4H0HB 1U92A 1CLCA 5CD3A 3QIWB 3SCMD 3PGCA 4PJXE 4AJVA 3RGVB 1SEQH 3T65B 3KPPA 4DNLA 3BKML 2FEDD 1UD3A 4WJ5B 4UCFA 4KVPA 4OZHE 3CHRA 5DD6B 2ODHA 2DKSA 4BA0A 1I9RH 3Q1SH 3BAJA 1MVUB 2C3VB 3U2IA 2WUCH 5EU4A 4FCAA 4QAMB 2YGPA 4MLSA 1P2CA 3K6NA 1BYNA 2GJ6A 2GJPA 1J12A 3AY4C 1KBPA 3CMGA 5ISZB 1RSFA 5EZIH 2R1YA 3O4LB 3L48A 3S35H 4AUYA 1A6VH 4F92B 4OM1H 2EE0A 1JZ6A 5ILTH 1JOIA 5BMFL 4N1HB 3KAAA 3IMBA 1RUKH 2BSRA 2XTJC 1JDAA 3R4DA 5HJ3A 3BP5A 3MLXH 3PWNB 5IQ9A 2R69H 2DF3A 5FDWA 2IBZX 4JM2A 4KK5D 1NUFA 2VABA 2XFXA 2NW2B 5TGBA 3DO7B 4YSOA 2ZPKL 3EOTH 4HUNB 3PP4L 1G7HA 4WWPA 3RWIA 43CAB 2E4FA 1I8IA 3SKMA 4HWEH 3GRWH 3NSDA 4Y1SA 4UOJA 1JCVA 2BC4B 2H32B 5G4MA 3TZVC 5I73B 1DO5A 2PWFA 4LLAA 1FAIL 4OZFA 2TSBA 2BVTA 5FK9B 1CYWA 4F7EA 1UH4A 4PRPD 3RA7H 1FFPA 3VSUA 4LIQL 4QF1A 3RIFF 5HVHC 5BRZD 1KIPB 3LNGA 1N6UA 3WEAA 1KWKA 4ZFQA 2P5WA 5EN2A 1EO7A 1BFVL 5J9PA 1MLCA 1S7QB 1Z9MA 1FZOA 1B9KA 3C09B 3EJPA 2WO2B 3VU1A 4XPFL 2L8AA 4X6DA 3I9PA 5MENB 2CR6A 1JPTL 2ICWB 2XPZA 4U6VH 1IAKA 4GFXA 5F7EH 3BT0A 2WKOA 3BKJL 3THML 2NY2C 1KZYA 2C3HA 3HI6H 3EFDH 4E9WA 2HRPH 3HG2A 4OLUH 3SE6A 4X9GA 1YEFL 3FYIB 3PABB 5L2KA 2A9NH 3BX7C 3UTTE 3OJ2C 3QT2A 1DCEA 1QSEA 3HG0A 3CVBA 4M62L 3QDAA 1N68A 4F5CE 5C0CD 3VNYA 1JN6B 2V17H 4O02H 3SGEH 3KR3L 4X4ZA 4EKJA 2YAEA 1MLBB 2VLRE 2DIAA 4PGJA 1HHHB 4WK4B 5DD1L 5KBDA 1AO7D 1DBMH 1DJYA 5DO2C 1ZHKB 2YXFA 2HVJA 5GS0L 3IFPA 4YHLL 5C09D 1KC5L 3N5AA 1NLDH 4QXGH 3T1FA 2CDFB 3P1VA 1CGXA 3ZE1B 3BESR 3G5XB 1D9KB 1GAFL 3QHZH 4A7GF 1YUHB 4ZX4A 1PG7W 1BHGA 2FX7L 2NLJA 2R1WB 4I48A 3G6JE 4MB4A 4WJG3 5CIPH 2I60L 1MRDL 3N6YA 4GP8B 1FE8H 5DJYA 1WHOA 5IBUG 1U93A 3NA9L 1GRWA 1VJSA 1MCFA 2IAND 2XWZA 2H26A 4KXZH 5IB3A 2HVKB 1O6SB 3AACA 4PJDF 5TE7L 5I0ZA 1BXVA 2VO5A 3WNMA 5B3JF 4QRRE 1R5WA 4KRPD 3BXNB 1Q1PA 3K0YA 4KVCH 1JNHB 4IBQA 4QXVA 3GMLB 5HDQL 4GMSH 3MLYH 5FAAA 1VEOA 3ILPB 5GPRA 5FFOA 2K1MA 2Y36H 1I1CA 3MRNB 5SWSB 3ILDA 2NT1A 1CD1B 2A5UA 5A2CA 5K39B 4YIQA 4LK4A 4NQEE 2WYZA 5HYJD 5CSZA 1KGWA 2VDMB 4A2DA 1IRAY 3HJEA 3N85L 35C8H 1O9WA 2NRDA 2Y3AA 3D3VE 3EUUA 1CT8B 3EJTA 3IBOA 2ZX7A 3O0RL 4UIMA 4V1DD 1CR9H 2LVCA 1KCSL 3V10A 2Q6WA 3QHFH 1OTUD 5EU3A 3D2UB 4HJTA 5JXEA 3JXAA 3NQIA 1DVYA 1BXUA 2DQFB 1GOHA 2X41A 4MAYC 3AGWA 4NQTA 3MFGB 5CBEB 5CUSL 1U8JA 1ZPUA 4J39A 4P3CH 3CFDB 3OD3A 3BFQG 2GUOB 2XNAA 5D7LE 1G1OA 4AVJA 2NX5A 5HXMA 4PJBB 3EH3B 3CIQA 3LSOB 4FGMA 1XDTT 5E7BA 5BQ7A 3JBG7 4ZOBA 4HK3J 3QR1A 3VCLA 2UWEF 1S9KC 3K2UL 1DVQA 3L4ZA 2VLKA 2OZNA 2VXQA 3U4EA 3C5ZD 3ZTNL 4K73A 4S0HA 3VXMD 4PUBL 1E4XH 4B9FA 4OQTH 3RWFA 1DJGA 1SF5A 5HYFA 4GG6F 4LSVL 3UZVA 3KLLA 5D2NB 3X2QB 2IAMA 3FAXA 4AQEA 4JHVA 3WKPA 2Z8RA 5I1AA 1OGPA 1UUSA 2R4RH 1I7TB 1TTRA 2YEVB 4GIPD 1MI5A 3X3GL 4YWGL 2W9EH 3FS9A 4ZAKB 1D5ZA 3S8WA 1IC4H 2FBJH 2MJWA 3TEUA 4JHWL 1XXDC 3V0FA 2FNWA 1LE9B 2QKIC 2FJHB 5GGVL 4O2CA 4EI6B 2BH0A 4G8EA 2BIIA 4UU9A 2B20A 2FTAA 5DUPL 4K0OA 3B3IB 2AJ3B 4YDNA 4ELMF 4ENEC 4WEBH 3SEPA 4UM8B 4I88A 4Y19E 2BNRB 4GAYA 4IRJA 4PJHA 3ARWA 1VEMA 1FG2A 4HIIB 4TQ8A 3U82B 4GBXD 1AZCA 5E6IB 2VXQL 2J44A 3V6BR 2RTTA 4ZMLA 1WH0A 3WGUB 2QQNH 5EUOF 3KPSD 3EDFA 4LVNC 5MERA 2AABL 3EGDB 3FRUB 1JUFB 1II4E 3B2DC 3A3YB 3H9HA 3K8MA 1Z5YD 2DDQH 4LVEA 4FAAB 4TNVF 4PJXA 1S7TB 5IB5B 1N2RA 1K4CB 1ANUA 5JZ7D 2VERA 2F7IA 2W94A 1MN4A 1L6PA 2YR3A 1R3LA 1U33A 1ZRUA 3M1BA 2EC9U 3RILA 4MZRA 1AH1A 1UZ6E 1PAZA 2E47A 2CXKA 4G9DA 2BOCA 1G6RB 1TTCA 2V3DA 1ZDSA 3QQ3B 1CLZL 3NDZE 1OHZA 5IBLC 5ID0B 3QXAA 4AZ8A 4FNLL 4NRXA 1DBJL 2XSKA 1J0YA 2O5ZL 1YPZF 3ULUH 5BV7L 1NGPH 3MLVH 1IX2A 3PFQA 4K94L 4S1QL 3A4DA 3BQUB 5GJTL 5CGMA 5I8EA 3G6AA 4KMLB 2RR3A 2NY6B 3FN9A 4RETB 4LLQA 4PRDB 7FABL 3H9SD 1MFCL 2AQNA 2R8SL 3EYQC 3GK8H 4PJIE 5EFIA 3M8OL 4QTIL 1U2YA 4JFFD 2BY0A 4DVBB 2FSEB 4J4PC 5BS0A 3EOAB 2V2XA 2I25N 3V2AR 5FEBA 2EKSB 3FPYA 4G8AC 4IGBD 3ULVD 4PB9H 3DIFA 2IFFL 1NDMA 4EN3C 3IDNB 3LXAA 1BIIB 3SDDD 3QDGB 1QO3B 1RU9H 5L8KB 4NEHB 2NMSA 3O3AB 2BINA 5CMAB 3BKYH 5I8KL 4F7CB 3QCUL 1JXFA 1G7IB 5DS8B 3D12B 4JN2A 3WE1A 2WXMA 3GMQB 4L9LC 2PP7A 5SV4A 4NGHH 1PZ2A 3POCA 6PCYA 3WKYA 1GYCA 3JZYA 1LMKA 2ZG1A 4Y16B 4MA8L 5GGRB 4EDXA 2ARWA 3KWVA 5JPMB 2IH3B 2R23B 3DROB 1EAPB 4MNHA 4H26A 1TJHH 1AKPA 3UG4A 3BPLB 2Z65C 2M8XA 4NN7B 4NN6C 3UBXI 4GW1A 2NZIA 2Q3XA 3G9AB 3EJZD 4FFVD 3T71A 2J71A 5E4OA 1JPFB 4OZIF 5ESQB 3O6FB 3E8UH 4XXDB 4KK6C 5KANI 2LVEA 3BPOB 4NI3A 5T1MB 4TOYL 1R46A 4TN9A 2V2TB 1K8DA 3K6SA 2OYLA 1JZJA 1QD0A 4NO0B 5I1KL 1CFVL 1QW8A 4FQXB 4IS6A 3ZR6A 1CDBA 3ZDZF 1EUTA 1D5XB 3CLEH 1ZJAA 1ACCA 3QJSB 1BJ8A 3SKJL 2AKRA 4ZMQA 3TIDA 4JRYB 1JXKA 3LJ3A 4XCYB 3MLZH 4PREA 2K45A 3ARGD 5IFAL 2B8OT 2B9AA 4HW6A 3VXSB 3K4AA 2NY3C 2OTUB 1DL7H 3MYZA 4M6OL 1QSFA 2VLRA 2I5YH 4U4IA 3DYMA 4OAWB 1PZAA 5F6HI 4F58L 2Y69B 5F7AA 5DZNA 2B14A 1H6UA 4X9BA 2ADIB 3TTYA 3WLWC 1KNOA 4NKMB 4BFIB 4L8SC 3DX9A 5I0WA 2EINB 5TF0A 1KIUA 3QBTB 5HVFB 4KDTC 1CDUA 3VD1A 3DOHA 2BIPA 3ISWA 5E9NA 1QWNA 4PP2A 1Z66A 4XAKD 1AZUA 3LS5L 4HULB 3GUTB 1HIMH 2X4RB 4RMBA 1W15A 2XHNA 3FSOA 5FKPB 3RVVD 5GZOD 1XZ0A 3P9WB 1YYCA 5EPMA 2A73A 5EH1A 2RJMA 1PEWA 1IT9L 2DQHL 4R7NA 4UDUB 3W2DL 3WENA 1FNAA 1XD1A 4S1RH 4OGAD 4YDJA 5BXFB 2XLLA 2YIHA 3C6LC 5H94B 4HKJA 3NSFA 4QRRA 1NCNA 2VN5A 4JY5L 1PLGH 3WI9A 3VRJB 5HDBB 1F00I 4FG4A 4NDMB 4IK7A 4MJ5B 4X0NA 5K9QI 3AG3B 1TVHA 3P0YH 2ENYA 4K3DH 2CM6A 2JFCA 4PGCA 1YN6B 4QHNA 1UTDA 2E59A 3RTQD 2FRGP 4C56A 5EDSA 3MNZB 3H1ZA 3WMPA 1HL9A 2CK2A 4JG9A 3ZIYA 4DKDC 3BUDA 1T1YB 1CFNA 4JS7A 3D3VA 1E6OH 5AOJA 3V9CA 4ENZA 2H0JA 3FMGH 3Q5YA 1KLFB 5FUOL 4HOXA 4BK4A 4FQ2H 1T89C 3NIGF 1UURA 3STZA 2M26A 1YEJH 1IGCH 4UMGA 4YHNA 3ALPA 4ZX3A 1PSKH 2Z0UA 2CKBB 4MD4B 5T1LA 1MNUL 4IKKA 1K8IB 4E0RA 4DP9X 1IE4A 1IJ9A 1HSBA 3ZGIA 5F9OL 2BFGA 3O2DH 9CGTA 3MZGB 2C3XA 4DOHE 1ITBB 3APCA 4KO5A 2DN7A 1ODUA 5D7LA 2ZUQB 4MWFA 4HVBA 3WJJC 3NZ8B 4AGQA 3FU0A 3FQNA 2UX7A 4TUJA 1SM3L 4HK0A 2EXSA 1FYTA 4P46A 4N2MA 2DQUL 4LOUD 2QMJA 4Q56A 2VXUL 4TV3A 5K69A 3B7YA 2NNCA 2VJ0A 1Y6KR 1FDLH 2Z1PA 3MV9B 4MMZB 4ODUB 4NYLB 1CG9A 2QTVA 4LCWE 3DOIA 4UV7L 3VD5A 1T7YA 1DJXA 3EH5B 4GRLC 3AQYA 5KYYB 4M7KH 4Q9QL 4HF5L 5IGXL 4WI2A 3VW3H 1ZANL 2AXJA 4FHBD 4IU2B 2GJZA 2GY7B 3DECA 3VACA 4Z7IA 3FN0H 1OARH 4G42A 5FFGA 2K0RA 4P06A 2K9UA 2EDOA 3GS0A 3EXJA 5KW9L 1NCBH 3LD8C 5KTEH 1GYUA 1FSKC 1MG3C 3BAIA 2C9RA 3I02A 1JFHA 1SLUA 2CIKB 3GMNA 4MMXC 1NEUA 1U8HB 4I0KA 1KPVB 3MOBH 4IMLB 4KRNA 1H3WM 5I1CH 4KVNL 3ECVA 4PVNA 4PCKA 5AB1A 1LDPH 4D9LL 1RJZB 1F6AB 2Y72A 4UT6H 4S1SH 4EKXA 4KJWD 3S5LB 4J3OG 2FGWH 1KXVC 4YUEH 3MLUL 2Y2YA 3QUZA 4P2QA 4OD3L 3NIDF 2X89A 4FXGA 2IMNA 3CJJA 4OTXH 2LOEA 4P59L 5TDNA 3RWJB 5M7QA </