4TXVB

Crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
FLELDVPKADLTIKATGKQWYWSYAYPDNGKFEFDSLMAQDKQPRLLGVDNEMVVPVNKVIRVQVTGADVIHAFALPAFGVKIDAIPGRLNETWFKAAKTGMFYGQCSELSGKDHAFMPIAIRVVEDKEFASWVETAKKKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Thiol:disulfide interchange protein TlpA
publication title How Periplasmic Thioredoxin TlpA Reduces Bacterial Copper Chaperone ScoI and Cytochrome Oxidase Subunit II (CoxB) Prior to Metallation.
pubmed doi rcsb
source organism Bradyrhizobium diazoefficiens
total genus 26
structure length 142
sequence length 142
chains with identical sequence D
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4txvB00
1URIA 2XUWA 3MX0B 4E9XA 2B3IA 1W6LA 2BP8B 4QLWA 4UANA 3SBRA 2IDSA 1OOWA 1BEXA 1XB6A 1E65A 1ASOA 1A4AA 1T5KA 4AZUA 3OMNB 1JZJA 9PCYA 3X2QB 1BXVA 5I26A 3EH4B 1X9RA 4AKOA 4BWUA 2CJ3A 4YSCA 1PNCA 1VLXA 1XMEB 2W88A 3JTBA 1AZNA 2IWEA 4Q89A 1JXDA 4CSPA 2QT6A 1DYZA 1AZUA 2QPDB 1OF0A 2UXVA 1UATA 1GW0A 1N68A 3QJRB 4HCFA 1KDJA 2YAPA 3AG3B 3PPSA 1ILSA 4KNTA 1CUOA 2Y69B 3S3BB 1GR7A 2IAAC 3NJKA 2I85A 1SHXA 2I7OA 3FU9A 4A67A 4YSTA 3TU6A 1CYXA 4YVUA 4BDVB 2VN3A 4YSOA 3WKPA 1J9QA 1SHWA 2YAOA 4AKPA 4DP6X 5TK4A 3DTUB 2EINB 3WNJA 1HAUA 2XV3A 3H4FA 1AAJA 4DP0X 2YAEA 1L9TA 3FQ2A 2UX7A 1SFHA 5IY5B 2BP0B 2AANA 1ZIBA 1MZYA 2BP8A 3IEAA 1OCZB 5I6LA 1KV7A 3FYIB 4GYBA 2XYBA 2IWFA 2R7EB 3G5WA 3HB3B 2VSMB 4N8UA 2YAQA 3CZUB 3TASA 2JKWA 1ILUA 1NZRA 4YSUA 1GS7A 2PPCA 6PAZA 1IBZA 2E86A 1MG2C 3AG4B 4E9TA 2BW5A 1AS7A 2WO2B 3FSAA 1RKRA 3OD3A 1JOIA 2H5UA 2PPEA 3V9CA 1AACA 2EIJB 5B7EA 4E9WA 3T6VA 1KDIA 1MZZA 2J57A 1KYAA 2FJSA 7PAZA 4BXSV 3BVDB 2PCFA 2AVFA 1V54B 4FAAB 2EIKB 4NERA 3UAEA 1GY1A 3S3CB 4BWWA 1GS6X 4E9QA 4BDVA 2QPEB 4YSQA 3FSWA 4HCIA 3CVCA 3V9EA 4YSAA 3NP4A 5D4JA 1IKOP 6PCYA 4A2FA 3FT0A 1PNDA 2YXWA 3NJHA 1KBWA 1J9TA 4PCYA 4WKXA 2W8CA 4N4YB 4E9VA 4YSEA 1PZAA 2P80A 2DWSA 2EILB 2PP7A 3AW5A 5LDUA 3TA4D 1ETJA 1V10A 2FT8A 3NSDA 2YXVA 5D4HA 3ERXA 3QJTB 1BQRA 5I5JA 4QKTA 2XWZA 4BWTA 5B1AB 2A3TA 3PXLA 3QPKA 2CAKA 2H47C 4GP8B 3N55A 3NJFA 3H56A 2R7EA 1FA4A 1L9RA 2OJ1A 4DPAX 1TEGA 1BAWA 2XU9A 4P5SA 2IDFA 2GC7C 4A68A 2BZ7A 1ET5A 2BW4A 2CBPA 1J5CA 4HAKA 1BXAA 3OMIB 1KCBA 2VM4A 3FPXA 1NTDA 3JT2A 2YARA 4HHWA 2VMJA 1WA1X 3WIAA 4AKQA 4F2FA 2FWLB 1BQKA 3AG2B 2GB2A 3S8FB 4DP5X 3S3DB 3UAAA 2P80D 3NSFA 1M56B 3ABGA 1F56A 2Q9OA 1GS8A 2DY2A 2IDQA 1XB3A 2XX1A 3FU7A 2ZONA 3T9WA 3NP3A 3ZX1A 1N70A 5B1JC 1PY0A 4M3HA 4E9SA 1PF3A 4FA7B 4M4RB 4BK5C 3C75A 1QNIA 4E9RA 1SF5A 1JXGA 3NJMA 4G70B 3AY2A 4K9JA 3SQRA 2HXAA 1JVLA 2QDWA 5A7EA 4NAJA 4DP2X 5I6MA 3IN2A 4NB7A 1A65A 5B1JA 3FQYA 1NINA 2JFCA 3T6XA 3UADA 4MFHA 3FU8A 5I6KA 3QQXA 7PCYA 4YSPA 2PCYA 1ADWA 4G7SB 1B3IA 1WAEA 2QDVA 2PLTA 3SBQA 3PAUA 2JXMA 1OE2A 1IBYA 2FQFA 3TBCA 2HX8A 1EHKB 4ENZA 2VM3A 3NJLA 3T6WA 2VW6A 3ZIYA 4A2EA 4KO5A 2BHFA 4AI7A 1JZGA 1M57B 4KNSA 5AFAA 2CUAA 2HX7A 3CVBA 3QJQB 2PPAA 1ZDQA 3FYEB 8PAZA 2FT6A 1PLAA 5B1BB 1NPNA 2OV0A 2DYRB 4KO9A 4YL4A 1PMYA 1ASPA 2YAHA 2GC4C 1A8ZA 3CDZB 2PP9A 1SFDA 2ZWNA 3OQRA 5FC9A 2IWKA 1NDTA 4G7RB 2OCCB 1RZQA 3EH5B 5AKRA 2FNWA 1ASQA 1W6WA 4F2EA 3WI9A 1KGYE 1R1CA 4YSSA 4A2HA 3FS9A 3GXUB 1L9PA 4HZ1A 3ASNB 4E9YA 1OV8A 2YQBA 1GY2A 4YSRA 1CYWA 1JVOA 2AZAA 5I5IA 3ABMB 3AG1B 1JXFA 1ET8A 4GXFA 1SDDB 4WTQA 1BYOA 1JZEA 4JHVA 4YSDA 1YLBB 4G71B 5TK2A 2X88A 3PAZA 3ABLB 4DP9X 3NJIA 4DP7X 4CSZA 2HZHA 2GI0A 5I5MA 1NIDA 2BP0A 2DWTA 2XX0A 4JKNA 3NYKA 3WG7B 2DV6A 1KCWA 1AG0A 3X1FA 1AANA 1OE3A 1AG6A 5B7MA 4A2GA 3QJUB 2FT7A 1QLEB 3IN0A 1FFTB 1WA0X 5I28A 1NIEA 4A2DA 4DPCX 1X9UA 1HFUA 2XXGA 2FQGA 4DP1X 2ZXWB 2XXFA 3IBOA 2GIMA 3UGEA 4L0PB 3EF4A 1A4CA 1V55B 1RZPA 1SJMA 1L9OA 2BZCA 2UXGA 1AOZA 3X1NA 2AZUA 3WNIA 1AQ8A 4RH4A 1E5ZA 3ASOB 2TSBA 2NRDA 2IDTA 2IH8A 1PLBA 2J5WA 1AIZA 4HALA 4DP4X 2EIMB 1PZBA 3FSZA 1IC0A 3HEIB 2HLEB 2N0MA 5B3SB 2ZOOA 3DKHA 3OM3B 1I53A 1BYPA 1SNRA 2IH9A 1JZHA 2J56A 3SBPA 3OMAB 1SDDA 5I6NA 1NIAA 2UX6A 2VW4A 4ZK8A 2HX9A 4UAHA 1KBVA 3RYMA 2CALA 2WSDA 2I7SA 3NJNA 1E67A 1JERA 2GBAA 1QHQA 3ABKB 1A4BA 3NSCA 1AS8A 2Y1AA 1WA2X 1ZIAA 3NT0A 3ZBMA 1AZRA 2GHZA 2X87A 5F7BA 1CC3A 1PAZA 5E9NA 5AZUA 2RACA 3PCYA 1J5DA 1GYCA 2AFNA 2XV0A 4TXVB 2PP8A 3DIVA 4Q8BA 3T6ZA 3PAVA 2GSMB 4GP5B 5PCYA 1W8EA 4UF7C 2XVBA 1HAWA 4YVNA 1ZPUA 2XV2A 1DZ0A 5EHFA 4DPBX 3PLYA 1NWPA 2XLLA 3QJSB 4W9ZA 1IUZA 1WS7A 2YAFA 3L45A 1CURA 4HCGA 4G72B 3FQ1A 3KW8A 2MTAA 4GP4B 4PAZA 3X1EA 5D4IA 4F7KA 4DP8X 2VW7A 4KOCA 4HIPA 2CCWA 1FWXA 1NIFA 5B7FA 4EF3A 2DYSB 1A3ZA 1BQ5A 3EH3B 4A66A 1L9QA 5B1KA 1J9RA 2FQEA 4KNUA 3S8GB 1EZLA 2LLNA 1AS6A 3KW7A 4BXVA 3NSYA 1ZV2A 3WKQA 2PPFA 2MRYA 3UABA 2TSAA 3H4HA 4G7QB 1M9WA 1J9SA 1XB8A 1ZDSA 3CG8A 3EHBB 3ZDWA 1NICA 3N2JA 3QJVB 1NPJA 3FSVA 1ID2A 2BO0A 3AZUA 2IDUA 4GY4A 1BXUA 1MG3C 2UXTA 1JZIA 2YAMA 3TBBA 1AR1B 1AZCA 2FTAA 3U25A 1GSKA 5I6PA 4HHGA 4KO7A 3T71A 1PLCA 3X1BA 1SF3A 2H3XC 1JZFA 3FU7B 1AZBA 4AX3A 2BWIA 2HRHA 3UACA 1OE1A 4W1TA 5I6OA 3FPYA 1TKWA 3GDCA 3D12B 3CDZA 2UXFA 2VSKB 1E30A 2HRGA 2J55A 1TEFA 4JHUA 4KOBA 1PZCA 2BWDA 2PPDA 1OCOB 3NJGA 2B08A 1TU2A 1RCYA 2FQDA 3GYRA 1MDAA 1NIBA 1OCRB 1WS8A 3NJJA 3IE9A 1L9SA 5F7AA 3X1GA 5ANHA 5PAZA 4P5RA 3MBWB 1NWOA 1ET7A 3BQVA 1E5YA 4KO6A 4X4KA 1OCCB 2Q5BA 3CVDA 2WO3B 1PCSA
chains in the Genus database with same CATH superfamily
2F0CA 2WVUA 1HZKA 1IRAY 1IGCL 2W0FA 4MSWA 3X12B 4PTUA 1U8MA 2AV7A 3GJFB 4D0CB 1JZ8A 4Y2DA 1OOWA 1QASA 4TNEA 2CHZA 3D25B 5LQBL 1DJSA 2OP4H 2XQYG 1P4IL 5D5MB 1E4XH 1I82A 3E3QC 2Z8VC 1LEIA 3FRPA 3NK4A 3OZKA 1BVZA 2XKUA 3M86A 3NOIA 2VDRH 5CR1A 4U3CA 1X4ZA 4S1RL 3D85B 3O8XD 4Z23A 1XAUA 1GIGL 3NSXA 3UBXI 5FYJH 4JFXA 3IGAB 5I23A 4XE5B 1I75A 2P8PA 2B59B 3Q3GB 4JMNA 4DEPC 1TZIA 2GY5A 5AB0A 3AG3B 1B0GB 3DX7B 1IARB 3QH3A 2EZ0C 3X11B 3DBXA 1BGXL 1J8HA 3Q1SH 2WUBH 4H4NA 1Z32X 1OPGH 2NZIA 5LJYH 1K8DB 3GBNH 3MXVH 2AQPA 1KXHA 2EDOA 5DGRA 2JELL 1PKQA 4H8WH 4LLDA 2BSBA 4YSOA 3LKNB 3HHSA 5D2NA 4POUB 4QOKB 4QGYA 4ZSOE 1J0IA 3RFZB 4Y19B 3BEVA 3B6SA 4OF6A 3ZHLA 4PB9L 2E59A 3IB4A 3MLYH 4Z6AT 4RIRA 4TVUA 4FNPA 3TO4C 4YNYB 1P5UB 3WEBA 1I7TA 3LN5A 4K71C 3RIFF 1UA3A 4E9LA 5D93B 1ZIBA 3IEAA 4G80B 4AEEA 2YIHA 4F7CA 2XN1A 2VSMB 5DD3H 1F42A 3CZUB 3UTTD 4OZHA 5TGBA 3BUYA 4XVOA 2AK4E 3TNMA 2LU5A 1SM3L 2UVFA 5C0CB 4X8GA 5SWZD 3RY6A 3S36H 1E50A 1J0KA 4P99A 2V17H 1CLOL 3EGSA 2GTWA 3W9DB 1Z5HA 4GO9A 3O2WH 2EDHA 2VUYA 3AT9A 1MHPH 3D39E 5FO2A 2LLLA 2F5BL 3V9CA 3TNNA 5KBKA 5IVXF 2D31A 3RWEA 4XNYH 5C08A 1I9IH 4AQZA 2R0ZH 4PB0H 4X7SH 5DT1H 3REWA 3QDGE 1H3GA 1UXLA 2VDRB 3KLQA 2EE9A 2VLLB 4L4VA 2FATH 1AP2A 5FYKD 1DFBH 3SDAB 2JB6A 4M7JH 3UJTL 2NY2B 5DVKA 4G6JH 5MP6L 4LOEA 3LJ3A 4P23C 4GAAA 3TO2A 4XO5A 1M1XB 5HYJD 1ZA6A 5TPWL 2QQKH 5IFHH 2YUZA 4A2FA 3S9DB 4KNQA 2YXWA 3NJHA 5HHQB 4FNSA 5JA9A 5I66B 1ETJA 2KLSA 2YN3A 5DFVC 2EKSA 4MD4A 4X6BA 2L04A 5HDLA 1SYVB 2W1NA 5IOPB 5ENWA 2AV1B 4KMLB 3PGDA 5KBDA 4WY7L 3RJOA 3VFTB 3RI5K 4DPAX 1FVDB 3STLA 4Y5VB 1BAWA 1J05B 1KN2L 2DWEB 2DLFH 1HEZB 2V8LA 2M8XA 3ESNA 4H5SA 2LV4A 2EYSB 3MNMA 4HMEA 1NC4B 2ZCHH 3ELAT 4P5SA 4QRQA 2GC7C 5CGYD 4ZOCA 2BZ7A 1ET5A 5EU5A 1S9XA 3B7RL 4OSUL 1OPOA 3TFKC 1USZA 3FN3A 5EPMA 1BYNA 4DGYL 3QEUB 3OLGA 2K78A 3SKJH 4M7KH 2G0KA 4KXZI 1QACA 4LRNH 1VHPA 1WA1X 1XAKA 2XETA 4G8GB 3E9TA 5I1EH 2DMHA 2W0KA 4QF1A 3O3BB 1KCRH 1EEUA 2DZEA 4UIKH 1ETA1 4ZO6A 1M56B 4LSTL 4QXVA 3QR0A 4D0BA 4KRPC 5FX3A 3VFNA 3ABZA 1D9KA 1CFSB 2E7BA 5CLTA 2K7PA 4NKOB 1DQTA 1E9PB 1CK0H 6TAAA 1SN5A 3G08B 4JRWA 5F3HB 2ICWI 3ELQA 4WI3A 1PF3A 4IRZL 2VL5A 4PLKC 2VXSL 2VABA 4NENA 1CCZA 1FNEA 4M02A 3U7AA 1KNOA 1A4JA 4MXVF 1H0DB 1BD2B 3V52L 5A7EA 5I0VA 3MOQA 5BRPA 2DD8H 4KDTC 3MSPA 2JCCB 4BSVA 3HUJE 1ZLDA 5AEAA 2ZUUA 4RMRA 4IGBC 5A2JH 3IKCB 3GRBA 1PYWB 3L8QA 2YKKA 2A6IB 1R3IL 2XJKA 3KZ8A 3RY4A 4KHXH 1FL6B 3BD4A 2MMXA 2NNAA 3OZ9L 5KSBF 1YYCA 4Y1SA 3NEEA 3H55A 1J5HA 4R7VA 4QNPE 2RFXA 4XCYA 3CSGA 4EAEA 1IBGH 1UHVA 2VXQL 2VZVA 3FFOA 4TQPA 2BFVL 4GMSH 3EFFA 5HTSA 3TX4A 4GRWE 4XBEH 3RIAK 1UOWA 3QUKB 1KLGB 4HFUH 2CUAA 5T5FA 2JQZA 3FQRB 2AQRA 5KJ4A 4XP5L 3U2SA 1PJ9A 3HI1A 3DDFA 3QE5A 3WCYA 2JIXA 4PJBE 4M6AA 4QXUH 1MLBA 4UWQB 2GEQA 5IB2A 3T09A 3P4NA 1TO4A 1CB4A 4XP4H 1OAKH 2Z31A 4LF3A 5BZDA 5E7BA 1XEUA 3ZKMC 1U8QB 2DQHH 1EZSA 3WI9A 1E28A 1QLFB 3AITA 3WOVA 1YNTA 2BM3A 3SIKA 4ZTOH 5GGSB 1LVEA 2BSRA 1KJ3L 3WTVA 1XBRA 2PETA 3EYUH 3Q2CA 4WDIA 2CUIA 5K93A 3DMMC 4JFDA 3U6XS 3H6JA 3ILPA 4MCZA 4P2OB 5DR5H 1P5UC 4H25B 4A7VA 4LSQL 4X5WA 5KN5A 5IK3A 1KGUA 3U2JA 3U36B 3QRLA 3WIFB 3EJZC 4UQIM 5HDQL 5EU6A 2CDGA 3S98A 4JHVA 2HN7A 2E75C 3P3SA 4OGYL 1BZEA 4I0PC 5E6RB 5IHWA 1E6JL 1IC7H 3FT1A 2VDLL 3GMNA 3ILQD 4PU2A 3LRLA 5DRNB 2DWTA 1LL1A 4B7IA 2X4QB 4LLYB 1AG0A 1T1WB 2YUXA 4HS3B 4EIBA 1AXTL 3NAAL 5I82A 1IX2A 3UBHA 4YBQC 4TM9A 4NQEB 5J12B 3NZHL 4K2UL 4BFFA 1DN0B 4DZBB 2Z0UA 1E7UA 4DPCX 2BRQA 1MAKA 3AAZB 3UBFA 4KFMA 2H4EA 1AKPA 4K3GA 3NK3A 5FW8A 4OF8A 3IPBA 4JRXD 3RJDA 3SDAC 1P1ZB 4LLAA 5IJVB 2NY2C 3F64A 4XPFL 1E8YA 1H8OA 3CC5B 3OKNB 4OZIA 1RUPH 4ZMVA 4LFHG 4HISA 4IKJA 5TFSL 2A99A 2KHAA 5DHEA 1F5WA 2Y7LA 2D03L 5JPNA 3OHXA 3VB8A 3I6LE 1H8SA 1T5XA 4LEOA 1DTUA 2DQDL 4N90E 4WEBH 2RB8A 1EHXA 1FCGA 4FNLL 5EU3B 3VJ6B 1EFXA 3GS0A 4GXVL 1BYPA 3W82A 2FSEA 1RP8A 3SO3C 1L3NA 3NTCL 3G6AB 4XNAA 4P5TD 3F7VB 2AABH 3QNZB 2KS0A 5CEZE 2X4TB 1ZA3A 1TJGL 3IU4H 1UUSA 2NY5L 3T4AA 2B1HH 5SWSA 1SXBA 3DUSA 1YEHH 1S7RA 2WQUA 4IS6B 3SQBA 2ATPA 1W16A 3NZSA 5FF6B 3GKZA 4YO0B 4Z3JA 1TYRA 4WO4B 1GYCA 3LPPA 4NSKB 3SN6N 4ETYA 3HN8A 3OR6B 1HH9B 5IMKA 5I2IA 3PQYE 4LCWD 3AM8A 3PV7A 3US1A 5EO0B 4C56A 5B4MD 4ABUA 2Y36L 4UF7C 1JVKA 5EU7C 3O2DL 5FDWB 1BZQK 5GRJL 1OSZB 4WFGD 1SMOA 2XZAH 4O51A 1A64A 4LPYA 4KKBD 2AK4D 5DJAA 4XI5D 2J6WA 4ZS6C 3WKYA 2OSLB 4G5ZL 1V7ML 1BG1A 3DGGB 3VH8A 2A6JA 2J88H 2DJ4A 4WWID 4N8VA 4Y4HA 4FS0A 5HVHC 3MLUL 2CCWA 2GSIA 3GS4A 3BVNA 3O8XB 1RUAL 3HC2A 5BV7L 1JRHL 5IQ7L 4OLUL 4ANUA 1D5IL 1T20A 2CLVB 3S96A 3NCBB 5JOPD 3DPBA 3E3QE 4IMKC 5IVZB 3GBLA 5CLZA 4FYQA 3IDXL 4LGRB 5J6HB 4BXVA 3BSZL 5CHNA 4GKOA 3QQ3A 3SE9L 5AUMA 1TZHA 3BIKB 3MOAH 2OTPA 4S0TD 1CLVA 4R7LA 4R84A 3SDXF 3AGVA 3KS0J 4XWOC 5E5UB 1IAOB 3MFGB 3GRWL 3II1A 3TBTB 1NQBA 5AG8A 4YAQB 3CXFA 3MCLH 1BQSA 2NZ9C 3Q7JA 5AW3B 5T3ZH 5H35A 4RAHA 3DETC 3WUWB 1OAYL 1FN4A 2NDFA 3L4VA 1KPUB 3DPDA 4UU9A 2YFOA 1VKXB 5ICXB 2IGLA 4FQQA 4RDQF 1Q72H 2BRRH 3V55A 1H15B 1KOAA 3ARFC 3FTYA 5L2JA 2NSXA 3QDJA 2FK9A 4FERA 4JCWA 2GITA 3ULSA 3UTTB 1P69B 2FUQA 2WUCL 1RERA 4JQVA 3EYFA 3SE3C 3QIUA 1GJWA 2AXHA 1SYSB 4FTVB 2OTUA 1E30A 1KPVB 1WISA 3V5DA 1OCOB 4FCAA 3V4PH 4AYBA 4FQIL 1CFTB 1BFOA 1NGXB 2XQ0A 4WGVB 4ZI8A 4ODHH 3KVPA 4L3FA 3EKCA 3G5ZB 2DWDA 2LW3A 3NJJA 4F8PA 1WUNT 5FUOL 5DWPA 3VD5A 2V7NB 2YD2A 2YZ8A 4RMTA 1D6EA 3BN9D 1NWOA 3HG4A 5DRZB 3OLIA 4KO6A 3D48R 4PUBH 3VX0A 1F11B 3BPCA 4DO4A 1BLIA 1HT6A 3ZYIA 4YHLL 1HHHA 3UGXA 1N6QH 2YPLA 4FG6C 3SKOB 2Y6SC 4JFOA 4Y5XC 5HYJB 3E8VA 4L4TD 1CE6A 2JI3A 3L4UA 2BXZA 1UXWB 1XB6A 1E9OA 3K7UA 2GTZB 5HHXL 2HVKA 4I1PA 3FO2B 3RDTD 5EIIG 1HX0A 2CJTA 5EMYA 4FQXA 2HTKC 3MREB 3KJ6L 4QYAA 5IW1A 3CFCH 2UWEA 2P5PA 4LZKA 1MCKA 2ZCLH 2V5SA 2YSSB 4XNXH 5E08L 5JNYB 2VM9A 4KDWA 5HI3D 4DW2L 4LHUB 3O3AB 1NGPL 2KDYA 5TDOA 4YFLF 1FUNA 1FDLL 4HCFA 4MYPA 5IVXA 4MAYA 4N2OA 4P46C 2E6QA 3TPUB 1TTGA 1K2DA 4ERSH 3PWNB 5ICUA 4I85A 3O11B 5I15L 3KXFE 5DJ2A 2ODHA 5F1OB 1X5FA 1ZGLB 2O5ZH 3THMH 1EIBA 1X6NA 2GI7A 3QULB 3A67L 4GQZA 5F7DA 2Y7OA 4LU5H 5I18L 4FQ2H 4DAGL 1U95B 5AVXB 4DP6X 4HK3J 4JZJA 1A6UH 4Q9RH 2EINB 4OLZL 5I1AA 1WIPA 5JDSB 4YHPA 4B9KC 3SD2A 1JMZA 1C1EH 4G7VH 3V4PB 4AM0B 4XNMB 2QVKA 3P3UA 2F53E 1OAQH 1NCIA 2WVVB 3PP3K 4JY6B 3EBGA 4XVJH 1Q0EA 2VMCA 1A5FL 4WWKB 1AQMA 1UB5A 2Y1VA 3DNKA 4ODWB 5L8LB 1FGVL 4NAMA 4Q0XL 1UWFA 2H2SC 4JN1H 2CCLA 2DTMH 2VDPL 3WKMH 3CVHA 4JLRB 1CICA 2EO9A 2ICWJ 4FQJH 4YWGH 1UOVA 4WW1A 3MGOB 5TH2B 3P4MA 1Q0YL 3W9EB 3E38A 4IBWA 4M3JA 3BP5A 1FLRH 3OD3A 3UP6A 3HMXH 2DJUA 3G5XA 3LV3A 4PJ9B 5HVGB 1VFBB 1MZZA 3OJDB 5ANMB 4F7PA 4Y1AD 2WWKO 3IS0X 2VNCA 2XIIA 4V1DE 1QW9A 1VGKA 4J3BA 3VMNA 4FAAB 2R27A 2GAZB 4F27A 1MIEL 3QZNA 1G7JB 3L5WB 4P4RA 5LG1A 1DDTA 1NDMB 2I07B 1RPQA 1MEXH 25C8L 1L9MA 3GIZH 2Z3FA 3T4YB 4B95C 1U3ZA 2PW2B 1GYVA 1GGIH 1A1NA 1WYJA 2XWJA 4N0UA 5DJ6B 4MCMA 2R1XA 4B97A 1R3HA 3BGFB 1EPFA 1AXSB 2PP7A 1G9HA 4QJ3B 5TF1L 4ZO9A 3DVFA 3U1PA 1JWSB 1U42A 3ARGD 2I60H 2C4XA 3K2MC 1JTPA 2H1PH 5FO7A 1JHLL 2J71A 4LPVA 1Y6NR 1HHKA 3H8NA 3S3PA 1FA4A 2X3BA 4U1NA 4F58H 2PO6D 3TPKA 4HPOL 4NS0A 1TEGA 2ZWKA 3MZGB 1TFPA 4XXDA 2XU9A 2QPFA 1T3FA 2JKLA 1E90A 2FYVA 3V6FA 1HSAA 3WJMA 5ITBH 5I1HL 3NCFB 5GZOD 4PJXB 3TL5A 3I6LD 3EYQC 3SKMB 5KSBA 5FHBH 3LYRA 4N90D 2CBPA 5ETUA 1Q9KB 1B3JA 2BWQA 4OLYH 4AEIH 3FCGA 3T2OA 1J5CA 4HEPG 5K1VA 2CLRB 1AMXA 3GHBL 5KSAC 1BBJA 2XXMB 1HNGA 2OYMA 1L4IA 4HD5A 4XO9A 1AGBA 5I74B 4ZFZB 3NFNA 2BNUA 4LHJB 1LWJA 4FXLA 1EH9A 1JXJA 3L5IA 3S36X 3MRGB 1KTLB 3KPQA 2ZOKB 3IRZA 4R5TA 2OX5A 3SPVB 3TZVA 3U6RA 5BW7C 1XCTB 3EJQA 4JEGB 5JA8B 2IWGA 4ORGB 5HDBE 5EBWA 1OGTB 2XZZA 1I4FA 3CLWA 5CSBA 4DP2X 5LQBH 2WGNB 3MJ7B 2QL1A 1P4IH 3H3BC 4Y8DC 4JRXB 1O6SB 3B2UC 2D8KA 2ZXQA 5D55A 5E8DL 2V5YA 3BZ4A 1Q0XL 4MZIA 5JXAL 4S1RH 3BZEA 1VDGA 1YPZE 3P2DA 1GIGH 2Q86B 3FTUA 2OL3L 2RD0A 1B3IA 4P5KB 3CLFH 5D7JA 3KJ4C 1RZFH 3HRZA 3L17A 4MZ2A 3R18A 5J1AA 2ORBL 4IRJB 4GB9A 5KVFE 4QXGL 5JO5A 5KZCD 3TBCA 1F13A 2KT6A 1DVQA 4UYPA 5CCGE 3UZVA 4JDZB 2CKBA 1M57B 4WHYH 1WZAA 2BVYA 1X5IA 5DDHB 3QNYB 1P7KB 2VDNH 3B2PA 4MNQA 1U8KB 8PAZA 5HVFB 2CIIB 2GJ6E 1PLAA 2QZ5A 3L3JA 4P5TB 2HJKA 1M7DB 1BQLH 4P4KB 5F3BB 2WCGA 3HR6A 1M05A 3V5HB 3KLAA 1XCQB 1VCAA 3OQRA 1MHCA 3QA3B 2F5AH 1U92A 4PP1C 1WBYB 3EH5B 2MQ3A 4OFDA 3S37L 1J11A 4X83A 1IBDA 2EZ0D 4QCIA 3N1FC 2QADC 3CUPB 3ZQ9A 3QI9C 4Z7WB 4JY5L 3FS9A 4AENB 1GAFL 2CRZA 1UCTA 4LPCA 1NJ9A 4LCWB 2AW2A 3FQXB 2WB7A 1GY2A 1SM3H 2DQTL 5LNEA 4PJ5E 2QVTA 2GHWB 3DWTA 5I5IA 1OM9A 4G8GE 1IGIL 2IFFL 2W81C 1CLOH 3LRHA 5CD5C 5HD8D 5A6IA 4DHLA 4APQC 2RAMA 3N40P 2X3CA 3TO4D 3GI8L 3PAZA 4G8FA 4DP9X 2F5BH 2ZNXA 4N2BA 1TTUA 3CFDA 1AHWC 5EU7E 2WQSA 1KC5L 4FHBD 3IFOA 3WG7B 1AGCB 1XR9A 2G4GA 4WEEA 4BKLB 5LWYL 4NOBA 2ZOLA 5FFOA 3UJTH 5DQDL 5FO8A 2FT7A 1K5NB 4FJ6A 5MP6H 3RLSA 3D3VB 3RX7A 2QKIC 2O61A 3P3YA 4FXKA 1QFWI 5IB4B 2XXGA 4DP1X 1FZKA 3UGEA 1LO3L 4M9PA 1A4CA 3BT2L 3TV3H 4UTAA 3QYMA 1H3PL 3MI6A 4M1GL 4O02B 3TGXA 5CSZA 2VDNB 5T1LA 4UOZA 4WK0B 4UCFA 3HA0A 1ZSDB 4M43L 4QWWD 2IDTA 3FTGB 1KEGL 5IBTL 3E7JA 4EVNB 4Z7UB 1GYWA 3FSZA 4X9GA 2DYPD 5CJBA 1DUYA 1JS4A 1TTRA 3CFTA 3HS0A 4ZX3A 3IFLL 3BFQG 1JI2A 3O6FC 1YECL 5L6YL 3MYJB 3OM3B 1QI3A 1K4CB 2IH9A 3OKKA 4N2MA 4I87A 5GJSL 1FL3A 3ECBB 4EIZC 4OSUH 4FABL 5J0BA 2DQCH 3MZTA 4DGYH 3RPKA 4ZK8A 4TTDC 2CALA 3LRSA 2BVUA 4AGQA 1IVTA 3SGKA 5D1QA 3IJEA 3BP6A 2FL5A 4RMVA 3T3PB 1JPSL 4AC2A 1JUFB 4W9KC 2GUOA 4AUUA 3FF7A 3SDXA 1R5WA 4LSTH 3JV5A 2BVQA 4HD9A 4W70A 4ZO8A 3MV7A 4ZZFA 2HSIA 4GW4B 4F9PA 1LGVA 3ZKQD 4KVPA 1JGVL 3CFEA 3BKJL 3FTWA 4XVSL 4TUJB 3G6JF 1RP9A 5FHAL 1WLHA 5L4FA 1Y18B 2VXSH 4U0RC 1H6TA 4PWFA 5J6GB 5KANG 4YVNA 1AMYA 5TD4A 3V52H 1BREA 3CE1A 3FB8A 4Z76A 4L4TB 2A9DA 1LO5A 4XC1L 4ZPVA 3QCUL 3F5WA 2HB0A 4Q6IB 4A39A 1OD9A 2Z93A 1OSEA 4MD0A 1A7RL 1FVEB 3RDTB 4KQ3L 1A4KA 4AQEB 1PZUB 4PRHB 3LSOA 5F88A 4PAZA 3UL4A 5EEUA 4R97B 2G3ZA 3FFCA 1KUMA 1R3IH 1S7XA 4LHUG 5KSUB 3OB8A 3OZ9H 4XMPL 2IO5A 3RVXD 5AW0B 1T2XA 4DPRA 1JPFB 3EG9A 1HSBA 1FYTB 1Z9SB 2FQEA 4TUKL 4FQHB 4U6TA 2X89D 4GT7A 4AQAA 5C3LD 3VXQA 3DX8B 1AS6A 4TF4A 1SUHA 2WPGA 2CRIA 3PUUA 4OAWA 2C3VB 4CVWA 4FFTA 4Z3IA 3DOSA 4GSXA 3ML8A 5ISZA 5C2BL 3MBEC 3G04B 4IRJC 4Z8FL 1ZVYA 5F9AC 3CG8A 5CP7A 3VFVA 1ETB1 4MDIB 1EAPB 2O4EA 1Y0LA 3L4TA 5F9OL 3CFBA 4X9YA 1E4XI 4YR6B 5L8KB 2ICES 1QNZL 3UZQB 2NXYB 4KITB 4AV0A 2IOIA 5I6PA 5DEJA 2HFEA 1ADQL 1MJ7H 3LEXA 1KJ3H 3OPUA 4UDTA 4G9DB 4CMMB 1NCOA 4QR7A 4KVCL 1E5CA 2X0VA 3DO3A 4EN3A 5FO9B 2FIRT 2B14A 4KVNL 4HCRL 3VXRA 2OPCA 5DQJB 3ZDZB 2YK1L 4PY7A 3BQUA 2J1XA 2C3HA 4X6DA 3FO9B 2J55A 3QIBB 2YXMA 2NLJB 2VH5H 4PBXA 3RIFK 3NIFF 3ZKMD 1RCYA 1XTMA 2JKIS 4D9QE 1WS8A 1MWOA 2EDWA 2WLKA 2APFA 4FI8A 1L9SA 2ILLA 2H3NA 1NOAA 2MCAA 4PW9A 1C5BL 3PG2A 4Y1AB 1ET7A 2CDFB 4P57B 1OAZH 2ARJQ 5DA4A 3NZHH 2UZXA 2XG4A 3PREA 3AUWB 4LARL 3QFDB 4HC1L 3L9BA 4Z7VE 2APBA 4X6EB 4G1EB 1AR1C 2B3IA 4U1IA 1G7MB 4JQIL 4XCEA 3D69A 4I0PD 4EPSA 4AGLA 3UGUA 3H6AA 3AADB 4WJKB 2WZ0A 1S3KL 4MB5A 2AS5M 3QPQC 3CSTA 3HW7A 2X0WA 3M1BA 5CP3A 2ALWA 3ARGB 2IQAA 2V2WA 2NTFB 2W88A 1EEYB 2D03H 2H6PB 3IETA 3OR7A 3CWGA 3Q8AA 3QO0A 3S34L 3WXWH 3QFJA 4B6ZA 4DKTA 1RZKL 2NY7L 2F7QA 1CFBA 3JWNC 4IDJH 3NACL 1YJDL 3HG1A 2DQDH 1UATA 3QXTA 5C0DA 1GW0A 3UEQA 2QLVB 2FDBP 2NY3C 2OXGB 1F3RB 1XDTT 1DQQB 2WWNA 1Z3RA 1H6EA 4PRDB 3C08L 4RBPH 5HPOA 5D8JH 3LIZA 1I1AC 4H0LC 1S7VA 3LQZA 1D5ZA 4JPIB 8FABB 1CYXA 1F8TH 2NY5H 3ATBA 1UM4H 1A6VL 2QV2A 4OJFH 3QUYB 2Q2EB 5IHHA 1MHEA 5IWLA 1YMMB 3QS2A 5IESH 2YFNA 3WNJA 1R24B 4EE2A 2CBTA 3U1SL 4OCWL 2IADA 1TITA 4KGJA 3SOTA 1NANI 1CL7L 3NA9L 4W9FC 3ES6A 3LNGA 1PY9A 2O5XL 2CO1A 1L5GA 5JHDA 4KRLB 4WWNA 5EZPA 1BVKB 4MWFA 3HR5A 1P4LB 5CGBA 1GGBL 4R8WL 2Y36H 2DMCA 2E7LC 1GGTA 1N8ZB 3O2DH 3V6BR 5IFJA 5GRJH 1IBHA 5MEQA 4JZNB 4PLNC 1E2VA 3B2VL 1KACB 4P2YA 4CVXB 4RFNC 1T7XA 2OMZB 4G5ZH 3RAJH 4NQVA 1O5PA 2WO2B 2JB5L 5DD5L 2ZPKL 1CVSC 2YRPA 2GW5A 3WO4B 3TJPA 2DH3A 2P28B 2X4OA 5D2LF 5D1XA 2Y3NA 4AMXA 1YY9C 2PTTB 1GZHA 5HGDB 5AW4B 1JRHH 5IQ7H 4OLUH 3MLWL 2PCFA 1D5IH 2W95A 3IAGC 4D3CL 5KZCB 1PVHA 4FI7A 3IDXH 3E6FB 5DJ0A 3BSZH 4BDVA 2XOTA 4HCIA 3BLKA 1D5RA 4CBPA 2P3YA 2A9BA 4ZS6D 5INCB 3WD5L 5H94B 3GRWH 1CMOA 4YDLB 1RURH 5KJRH 3NSDA 2MJWA 2BOBB 3BP4A 3G6DH 2LAAA 1FFNB 5LN4A 5ELIA 4ODXB 3ZE0F 1G7LA 1NGYA 4QKTA 2XWZA 3IGUA 4HS8L 3F3HA 3UTSE 5J89A 3B2DC 2A3TA 1OAYH 4X80L 4CC0A 1GOHA 2XWEA 3C6LA 2H47C 1GPOL 2EXTA 2R69L 4FG2A 4RQQA 5T3ZE 5I71B 1QEXA 4J3OC 4F7TA 2HJFB 3DXAA 4Y4FD 5C0ND 5HHNA 1UFGA 2ZYSA 3HNSL 3K1DA 1V5JA 4RGOH 2RQ8A 4O5LL 3HZVB 2NNRA 4MA8L 1HNYA 4JQXC 2WUCH 5ESVA 2C7UB 2NZ9D 3ZRFC 1D7FA 3MLTB 3QJHB 5DRXA 2NXYC 5F71A 4YHKL 2NUTA 2DAVA 5DJXA 4AKQA 4YK4B 1DCLA 4B96A 3ULVD 3I9GL 3SGJC 1OSPL 4FQIH 3MGAA 4XXCA 1XGPA 5ITFA 3UAAA 2NW3B 4Q97A 4QJ4B 1JF5A 5D4QA 2DL2A 3C12A 3NSFA 4PIBA 1NEZA 3MXWL 5FUOH 3INOA 1CFVL 4G9FA 4NZJA 3GSWB 2CIKA 4GIAA 1EXUA 5IQOA 1A1OB 1F1AA 3TA3B 1SLXA 4HUVA 4NQCE 1AQDB 4BK5C 1Z9PA 1KCVH 3TCXA 2A5UA 3V6ZB 1FLTX 1AJ7L 1E2ZA 3ZU8A 5KG9A 1RZGA 3IJYA 4A38A 1JN6A 3EGXB 4LCYA 1SOXA 5IKCA 4WHYG 4RNRB 2QDWA 3A6OA 4F5CA 5I16A 4YIQB 2G2RB 2FJFA 4ICXA 1K9TA 3KE0A 3ZHNA 1FI8C 5F93C 3FCSA 4F80A 1AGFA 2YD7A 2ITCA 3L3KB 4ZFOL 3ZRCC 1F58L 5E08H 3LX9A 3EDJA 5L2KD 4X5XB 4XP9H 3FCTA 5MEOA 1NGPH 5GSRA 2QDVA 1FDLH 5BRQA 3PAUA 5BQ7A 5C07A 4FG6D 5CBAB 1AGEB 1QSEA 3H0TA 4FADA 3GI9L 2VIRA 5I15H 2H8PB 4WTZA 1XIWC 3W3BA 4YHOH 3UC0L 4I3GA 5AFAA 1X6LA 3A67H 4UT9L 1USQA 3CVBA 1U4EA 5I18H 3ARBA 3IRCA 4P2QE 3ZDXB 3IJ9A 4JK0D 1C8QA 2QHRL 1A6PA 1A9BA 3GXFA 3ZTNL 3IMTA 2ED6A 5I9QB 1RMFL 4NIKB 4OLZH 2JJUA 1N8OE 5ACLA 5E56A 4M62H 4W6WB 4XB8A 1XH1A 2WW8A 3TN0D 2F08A 3M1CA 5MHSD 1F1GA 2W9DL 5CSGA 2CGRH 1T2QL 1G1YA 1A5FH 4PHZA 1OM3L 3MRPA 4A2HA 4YPGB 5A2KH 4LPTA 1FGVH 2YGQA 3MC0A 3VSTA 2YQBA 1ECZA 2VDPH 3Q2WA 1KB5A 2XFXB 1FF5A 4FNUA 4KBPA 4TVPE 2HT2C 1JXFA 4L1LA 2Q7YA 4KROD 3C8DA 1NFAA 1Q0YH 3QG7L 5FGCB 4OJCA 5I76A 1VCBC 4EBQL 1ACCA 4N0YL 4U6HA 5ESQA 4LLQA 4NC0B 4CSZA 4OTXH 3PWLB 5BNXD 3PWUB 5AVQB 2C3WA 3RUGB 3GJEB 1D7BA 3VWJC 1CGUA 2WLHA 3UZEA 4CA4A 3QWRA 5B38A 4BH8A 5B7MA 1U9KA 4U7SA 2ZE0A 4HKZA 2OZ4L 3RL2B 3LXBA 4KJPD 1LP9B 5FKAA 2WQ8A 5EO1B 1NCCH 5F21B 25C8H 1TO5A 2FQGA 4CGUB 1VEPA 3IBOA 1DN2A 3L95B 5C97A 1DVUA 3VRJB 2HT3D 1PGRB 3G6JA 3QZOA 3G9VA 5CD3B 3UG5A 1V55B 1RZPA 5FYLD 5TF1H 2GJJA 4N3TA 1CXFA 2J2ZA 4MA3A 1FZJA 1F18A 1O0VA 2GJZA 4J27A 2X4RB 1JHLH 4MNGB 3SCMB 4GRMB 5CF3A 4CKVX 3PGCA 1WZLA 1PW3A 4Y2DC 5A6MA 3J7HA 5F96H 3C5ZA 3MYZA 3N04A 1NDGB 4NO0D 3I6KA 1GW6A 3RWJB 4L1HA 2V9QA 2OMWA 2GKIA 3OMAB 2J4WH 4I18B 3U4KA 3WTWA 3ILDA 5C09E 2H32H 1SVCP 3FW6A 3N85L 1KBVA 4NT6B 3GHBH 1B4LA 2HMIC 4NBXB 3QJFA 3DO7B 2VDPB 3UOAB 4ZTPL 4I0KA 2BMKA 4AG4H 4FOMA 3BRGC 4JX0A 2HLFC 5FECA 3NRFA 5EN3A 5HJDA 5IF0B 4ONHB 5F7UA 4FLSA 3BEWB 5I8EB 2N7BA 5C0AD 4XXWA 3LDBB 3HPJB 5I1LA 5EC1A 3FRUA 4YK4C 2CUHA 3C9NB 4UYQA 3FOLA 4Z7WE 4XH2B 4E5XB 5C0EA 2WSKA 5SWZA 5A3IC 4K8RL 5JYMA 2CBMA 3PNWA 1ZK9A 4ZO7A 2Z35B 2DBLL 4P2RE 3HUJF 3L7FA 4CMHB 5JPMA 1GC1L 3IDUA 4HBCL 3IMVA 4BSWB 3PWVB 3TA3C 4KV5E 2FJGA 2R39A 4TNVF 1S5HA 5E8DH 5BV7C 2PWGA 2A73A 1Q0XH 4QNPF 5JXAH 1H5BB 3CHOA 3HBZA 1J12A 2VW7A 3GMPA 3W37A 2FLMA 2OL3H 2RTTA 2Q6WA 3BPLB 3ROOA 3TESA 1NIFA 3BVXA 4GRWF 3U30B 3HE6D 4XT1C 2WP3T 4MA1B 2ORBH 2Q8AL 3K71B 4QXGH 5D9SA 3MBXL 1DANT 4PV9B 1R0AL 4F3FB 4FZEL 5CJQL 4G1MB 3DARA 4BZ2L 4DERA 1RY7B 2WXGA 4ZW7A 3F58L 2W9EL 2NNXA 4Z9KB 4IW4C 3JWNE 2VAJA 1T83C 2DIEA 2GBTA 2P7TB 5GHWL 3NJXA 4M6ML 4NUJA 1TT6A 2QSQA 2VLRB 1URZA 5IW6A 3F00A 1E4WL 3DIDA 1T1ZB 2Z4QA 3ATDA 3MV8B 2EJ1A 3MJ8B 2LGNA 2NX5E 4Y4KD 3OPZL 3G5VA 4BQCA 4LDEB 1Y1UA 4J3XA 3J8F7 1EERB 2EDKA 3JYBA 4AUJA 3FB5B 1BW8A 3I50L 2VE6B 3HLAA 1W0VB 3EZJB 5FFGA 2D3JA 4JY5H 2FIKA 5KYWB 4AL8L 2NUPB 5HHPB 1GAFH 3KPRA 1AVAA 3MNWB 5E4OA 3ZMRA 2O93L 2DQTH 5DSCB 4RAVA 1T0OA 3DYPA 4PWHA 4WFFD 4WUUA 3NFPA 3QWOB 2ESVA 1IGIH 2IFFH 2EXSA 1NAMA 3D12B 3GDCA 4N8CL 5E4EB 3N1QC 5AZ2L 3ULVH 4L29A 1HQ4A 5AWNL 1OK8A 5D6CA 3O4LD 5B8CC 1TVBB 3FTVA 3GI8H 3HPLA 3FQNB 4LT7A 3DVIA 2VQ1A 2QADD 2V2XB 2FGWL 3QI9D 4F15C 3VXNA 1D5MB 1RI8A 2WLIA 1OSYA 2B3RA 4NUQA 3L3IB 2JK5A 3UTQB 2XICA 5LWYH 4CJ0A 3SEPA 3L16A 5CZRA 5DQDH 3ZKSD 4G59C 1E5YA 2EH7L 1U6AH 4UOJA 2NPLX 1QYGL 3LS4L 5D1ZA 3RWIB 1KLUA 3DURB 3FO1B 4XZUA 3BZ5A 1QSFB 4E9XA 1LO3H 4NQCD 1D9KC 5E8PB 5HHOA 1BEXA 2VN4A 2V6HA 3BT2H 4F92B 1H3PH 4M1GH 2AVGA 4CU8A 5C8JA 4HIQA 3FB6B 3JVGA 1BJ8A 2IQ9H 2QQNL 2WNWA 4WHTA 3P77B 1TETL 3N41B 3QDMA 3BDBA 4U3HA 2IAMA 1KIQB 2E9BA 4OCRL 5DZOA 3NPSB 1EAJA 2AKRA 1T0NA 4M43H 1AD0B 4WI4A 5IMOB 5IBTH 1WZ1L 3GNMH 1QW8A 4DN3L 3E80A 5A2AA 1AZUA 2ZSWB 5BVJA 1DVFC 3AREA 5G5DB 5FDYA 1PLGL 4WFEE 1FYTE 1KTJA 4A2LA 5LBSL 5GGVY 4Y4FB 1N68A 3UYPA 1YECH 5A7BA 1J9CT 5GRUL 3R8BB 4H1LH 1Q9LB 4PGCA 4XO3A 5H37A 5D2LA 3FT9A 4U49A 1E40A 2HUEA 3V6OA 2AXGB 1MAJA 2P24A 4P2CG 4JO8A 4N26A 4O58L 2I85A 1SHXA 3OKOB 4AQ8C 4UDUB 1MJJB 1G1OA 4JREB 2VISB 2D2OA 4GINA 4PRID 5MERA 2Z92B 4NJAL 5E94B 1DDHA 1YEGL 4A7QA 3APDA 1MCQA 4IEFA 2IPUK 4XP1L 1J88A 4XNQB 2WBJC 4CJ1A 2BS9A 4R7DA 1QUNA 2YPVL 1AD9A 3O6FD 4PJFE 5EIVA 2YAEA 1JGVH 3D2UD 1I85C 2G5UA 2YMTA 4ELME 4F2ME 3BKJH 5KYUA 3V0WH 5LKNA 4XVSH 1SHSA 4H2CA 4I13B 3K6FA 3CN4A 5FHAH 5JHAA 4P8QA 1OAUL 1JV2A 2B4CH 4EIUA 2JJTC 1FORL 3LDBC 3E0GA 4UMSA 2C9UA 5HY9A 3ZL4H 4I9WE 4M1CC 1S4IA 3GFUA 2WQVA 4UI2A 3QCUH 3WDIA 2Z31C 4R0LB 5F9JB 2CHXA 2ZOTA 1AZVA 4URTB 1GCYA 4YJZL 2DKUA 3LNEA 2XWTB 4G6AC 3F12B 4OQTL 4TVPD 2EVFA 3WMQA 1ICTA 4K3HA 4CMHC 2VERN 4CC4C 5I1DB 4GI9A 1RHHB 3V8OA 4FEMA 3X3FL 1JK9A 2YD9A 2A38A 3V4UL 2OMXA 5L2KB 3UPRA 3UBGA 4BXSV 3RQ3A 2A83A 3WE1A 4OCYL 4TUKH 3IFPA 2Y9RT 2XXCB 1BX2A 1NC2A 1ORQB 3JZYA 2JMRA 5GSVB 5M7QA 4QXTA 5GZNA 1RHFA 2E0PA 1OD7A 5DVOA 3RVWC 4GQPH 3V9EA 5A16A 4HKBA 5T33H 1JFQL 4O2CA 1YEEL 1MHHA 1QPKA 3KPSE 4H1LB 4ODTL 5DMGD 5FYLH 2BS71 1G1KA 2PYEE 1CFNB 2WTPA 4FNRA 5H4YA 4WKXA 3UIZA 5IOPA 4GW5B 4LRIA 5EEVA 1KMGA 5C71A 3OX8B 4XX1E 2EILB 5CEYA 4NRZB 4DKEH 1V10A 4FL4C 4HX1B 5M94B 4MTMA 2WV3A 3MRQB 1I1FB 5EF2A 5IROA 4EZJA 1KJVB 1OTUD 2JJSA 1HXMB 3GSQA 4I4WA 4EDXA 3E1ZA 2YO3A 1EHNA 3NJFA 5DO8A 1QNZH 5F2FA 1TXKA 3TN0B 2H1LM 5DYFA 4ELDA 1IEAB 3BCDA 1EEZA 2X4PA 5LGHH 3MNZA 5F7EL 5DEGA 1ADQH 1NGZA 1U33A 1MIML 5I0YA 2J8UE 3K72B 4JG0L 2LVCA 3N42F 4KVCH 2OLDA 2DQGL 3SDDA 2HAZA 4HCRH 4D9RE 5DWUL 4AMWA 2J8OA 2YK1H 5KOMC 1WT5C 4FE9A 3WS3A 1ES0A 1IGYB 1OT4A 4ZSOA 3Q8BA 4KROB 4MD5B 4BYHA 1YMME 3HRPA 2Z91B 1JPGA 1KY6A 4GAJL 1F2XK 1P1VA 3L2NA 3NCYS 2GEEA 3DYOA 4KKRA 2H9GA 4WJ5A 5C0RL 2Y0SA 2M83A 5J57B 4KAQL 2NR6A 2XTJD 5F8QC 4UINL 2HPOA 5JQ6H 1BMWA 3DRTB 1AO7E 3VDBA 4AGMA 2BOCB 1C5BH 1P0SE 5CCJA 4KJYA 1T6VN 3BUDA 2XBDA 4LARH 1II4E 2AI0L 1Q90A 3CDGB 3VFOB 3RX5A 4HC1H 2PCPA 2LABA 1RIHL 1UVQB 2J1YA 3RY5A 1N2RA 4JQIH 4B41A 1OGAD 2P45B 3H9ZA 3KD4A 4NB7A 4NQSA 3HIZA 1SY6H 5D7IB 2X12A 3D39A 1UM6L 2PW1B 1IEBA 1CD9B 4GLRH 2DIBA 2XVKA 3S34H 5ILTL 2C1PA 4PLJD 1E9QB 1ZHBA 4YSPA 4PJGE 3QDGA 1RZKH 4PTTB 3VXSE 2NY7H 5KVEH 3GS7A 1KEML 3NACH 4N0CC 4XMKL 1QFHA 3EDDA 3N5AA 2OZNA 1E8ZA 3A4FA 1AR1D 1OE2A 1ZS8A 5C92A 1UACH 1N5YL 4WLCA 3VQMA 3DV6B 5IJCC 3NPSC 5CKGA 4OGXL 1HOEA 4BCXA 4IHOA 2VITA 3QRFM 2PXYB 3BKYH 1UGKA 3QPQD 3MR9B 5C0FA 2SODB 4KO9A 4NI6A 3B83A 4MLSA 3IWUA 3WMSA 1EDQA 1A6VH 4U6XA 2AXFA 3VYOA 1PMYA 2P8MB 2GC4C 4YLQT 3RBSA 3IM1A 4HW6A 5FOBB 3AWEA 3BFWA 5ICYA 4OCWH 4FQPA 2NY3D 2XKNB 5C0AB 5FGBC 5HHMD 1YO4A 4E5XG 5LXGH 3LH8A 4PBVC 3NA9H 2FSDA 4LLVB 1O6VA 3LKOB 1W6WA 3PHQB 2O5XH 1UJ3A 5IQ9B 2WNGA 3I9IA 1GGBH 4R8WH 1HQRB 2QSCL 3DSFL 3MUGA 5DUJA 3BT0A 4FI6A 1T6BX 4HUUB 2OMNA 1F6AA 4I2XB 1QPPA 1J8HE 3UJIL 1ZVNA 3B2VH 1BPVA 2Z7ZA 3AU1A 1QA9B 2VLJE 1PZ5A 5CU9A 1UKQA 4IJTA 2KZWA 2ADJA 1UFUA 3OKDA 2QKSA 4NFBA 4H44C 5J4MA 2JB5H 3PHOB 2PWHA 2HVBA 2ZPKH 4JDTH 5DD5H 3VXTA 4EI0A 3O6KL 5GRZA 1OOAA 2HT4D 4B5ZA 1NIDA 2YUWA 2K4WA 1NGWB 1KCWA 2D9QB 4JE0A 4JQVC 2F54D 5B39B 3QWQB 3HE6B 4R96A 4UQBA 1KYOK 3WTUA 4BFJA 4D3CH 3WN5C 2F8XC 1FRGL 1LILA 3MLRL 3B3IB 4XOCA 4MB1A 4GKLA 4YDZA 4IRSB 3WEXA 1HFUA 4OZHE 3RTQA 5BMFL 1V7NL 2DJSA 5IUSA 3DVGA 3LN4B 1YEWA 4NP9A 2W59A 1UD2A 2IGTA 2W07B 4XBGB 1VADB 2X70B 3HE7D 3PJSA 5HYIA 4H40A 3HUJA 3MPCA 2NW2B 3FCBA 1C12B 3KMDA 1YY9D 4H88L 1LEGA 3I84A 4HS8H 5GJTL 1WH0A 4AIZB 4X80H 1W2KT 3MRHA 4Y4KB 3M46A 2F6AA 2CPUA 1N5AB 1GPOH 2R69H 3ETBJ 3QIWB 4NHUB 4KTDL 2XRAH 1F02I 3VGAB 3MJ6A 4DP4X 1TTCA 1PZBA 1BZ7B 1IC0A 3BW9B 3MV9A 1XL4A 1EGJA 2HLEB 2IDCA 3PWJA 2QMJA 3N06B 2Q3AA 5GS1A 2GY7B 4O5LH 4X7TB 3IDMA 4CW1A 1FNAA 5AOLA 3DJRA 3ISWA 1HCVA 4YHKH 1IO4C 4OI8A 3G5YB 4OZFG 2VXVH 2XQYA 2YN5A 2ADIA 4X7FC 4X5RA 4LKCB 2X2YA 3I9GH 1A6WL 1MPAL 1OSPH 3N50A 4UQ2A 2QGDA 2F8IA 4J3OD 4MAYC 3O4LB 5E6UB 1AS8A 4HUWA 3RRQA 3I6GA 1AKJA 4GAYB 3HVDA 3MXWH 4KPHH 1XF3A 4DGVL 3BPNC 3H9SB 3DA0A 4S2SA 3PS6A 1CFVH 2AQNA 5HDBF 4GNKB 5KEZA 2EDJA 4WVRA 4L0YA 3POHA 2EEFA 1NUDA 4Z0BL 5I73B 5JORB 4P05A 5EOTA 2FO4A 3QZMA 1M1SA 1S7QB 2YWYA 1UA6L 4U3SB 5AVWB 3VXMD 5EFIB 1B2WL 1EO8L 2VOTA 3ECQA 4B7LA 1AJ7H 2VDOH 4N1CA 5JOFB 2JKRM 1JYXA 4N2AA 4J3TA 1YPZF 4RGMB 4HF5L 4HJJL 5GS0D 5DJYB 4EUPH 2QGEA 3RWFB 5DHDA 1U3HA 4I9WD 3QB7C 2CHNA 5IZ7A 4G3YH 4AVKA 3EO9L 3KPMA 1VZGA 1F58H 3QEQD 4X4YB 5I8CB 4GKSB 3BHBB 1WFTA 1HJCA 2VSCA 1CICC 2E47A 4I1RA 1DE4B 3QUMA 1H3XA 1HKLL 2DQJH 1YYML 3GI9H 4BZ1H 2XTSA 1EZLA 2C8NA 3P0VL 1SXZA 1ZT7B 1IQDA 3QR2A 5DO2C 3UC0H 2G9HA 3WHE0 2OR9L 3L9RA 4OVVA 1IM9A 2VJ0A 4XHJC 2N0KA 2PNDA 3GMMA 4WZ9A 4QRUB 4HV8B 2QHRH 3DO4A 5DJCB 3C5SA 2N7AA 3EHBB 4GKNA 4OZGB 4LB8A 3ZDWA 5FA4A 3L3OA 1RMFH 1R3JB 2XPGA 4QO1B 3FO0L 4PRBB 1AFVL 1BVOA 1NPJA 4BUGA 4DZ8A 1YC7A 1P6WA 3D8MA 2RCSH 2W9DH 1T2QH 1DR9A 3TBBA 1MVUA 3GSRB 3D2UB 4NQXB 2P5WD 1OM3H 2WNXA 1T1YA 1ECYA 3LZOA 4Q2ZB 3DX3A 2Q3ZA 3O41B 2R4RL 3W57A 3T71A 2BSSA 3TJEL 4E0RB 4IOSD 3SE4A 1PIFA 1WFNA 3T3MB 4XBPB 1MI5E 2O30A 1TKWA 3U0TB 4ICWA 5EO9B 4AEHL 2YGOA 3GSXB 5B22A 1Q94B 1K6QL 2VDOB 3QG7H 1WWCA 1BFVL 1UD8A 2HRGA 4D9RD 4EBQH 1QSVA 3OKLB 4C55A 4L8DA 2R1WA 3ECWA 1TYEB 5IMLB 4ZX6A 1E7VA 1KCLA 2I25N 2AQ2A 3L7EA 1WGOA 1DSFH 4EUPB 2R2EA 5C0GA 1AXIB 4NNYB 1CD8A 5TE7L 5GGRB 2Y06L 4ZFOB 5BZWA 2UY7A 5DZVA 1AY1L 2OZ4H 3PQYA 4GW1A 5HJ3B 2MQGA 3SGDH 5GXBB 3RL1A 4WK4B 3VFPB 3BH9B 1GH7A 4KY1H 1UD4A 5CMAB 4H1LG 2EYTB 1K4DA 1M7UA 2VYRE 2VQTA 3OF6D 4J23A 2LE9A 2YEQA 1S7SA 3MX0B 4ABWA 1R9FA 5LAXB 4EI5D 3QORD 2VSDA 1MSPA 2F74B 4JDVB 3UMNA 5HYSB 1JWUB 3TZVC 3MVSA 3R1GL 4M7LH 1RZKC 3M7OA 3OMNB 4CN4A 4TTGA 8CGTA 3VWJD 3KPNA 1LDSA 1YJDC 3CFIC 4G43A 4XRCA 1NBZA 2VDQL 4G6KL 4IRSC 1TQBC 3BAXA 3TFBA 1MQKL 2XWBB 3T8VA 3AS1A 15C8L 3QDAA 1AZNA 4U1SA 3CZFA 4UT6L 3IMRA 2LTQC 3CFQA 1SJHA 4HU8A 4B9IA 2GT9B 5BRZD 4IKIA 1TR7A 4Y2NA 2BVOB 2X9YA 3MRRB 1IJNA 2YAPA 4TULL 1M2VB 1UXSA 1Z5LB 4AK1A 1HH6B 4OUUA 1U8OB 4NZFA 4WCYH 5A2BA 5BPPA 2IGFL 3ALWA 4Y2LA 3IWVA 3S37X 2HH0L 2EIBA 2AQSA 4YN3A 2BNQE 4CL7A 1GSMA 3AXLA 5E00B 3TU6A 4ZTPH 3HZKB 5DK0B 2VN3A 1U3NA 4HETA 4Y2DD 4L37A 4HAFA 4N86A 4UBDC 2BSEA 1B0RA 3C5XA 3BAEL 3ALXA 3VGGA 4WNQB 3U9PL 4BE5A 2J6EA 3PL6C 4M8QB 2XTJB 1L9TA 3GLAA 4FXGB 4P9HL 1IZJA 3MNDA 3CN3A 4Q4IA 1OKEA 3C09C 3VFMB 2BP0B 4K8RH 2AANA 2JTYA 5TDPB 4BCYA 1JF1B 2BP8A 5JIQA 5TE4H 1EK3A 4X6FB 1XGTA 2DBLH 3ZZQA 4POZD 1GC1H 1ORSA 1D5XB 4KK6D 4PJ7B 2H0PA 2HLFD 4HBCH 4XWGL 4W9LC 1HTYA 3ISRA 6PAZA 1AQHA 3PV6A 4MJIB 1IBZA 2YWZA 1SOKA 1GZQB 2Y7QB 1OGAB 1J8HD 4KK5D 4QTHA 1XD0A 4AW4A 4NM8L 1RUQL 5IHLB 4ZUTA 1QQDA 2V2TB 3RIKA 2EADA 4C54A 3ZE2E 4QDGA 3IXTA 4G8EA 4WV1B 1HEJC 4CU7A 3DTXA 5F1NB 1T0MB 3REVA 7PAZA 4OCSH 2K3HA 1R19A 3MBXH 2AVFA 5BJTA 3F7LA 3B8SA 1R0AH 4WKZB 2AK1L 2CDEB 4FZEH 5CJQH 5KVGE 4JDEA 3P3TA 3IVKB 1QSFE 3QHTC 2BVPA 4HLJA 4AUYA 2P5EB 1T21A 1W8NA 3F58H 3NP4A 4TQ8A 3TEWA 2AJ3B 1VPOL 5GHWH 4AVHA 4M6MH 2EEDA 3KBFA 3JV4B 3DIFB 5FK9B 4P23A 2MPVA 1NMCB 3OPZH 2Y2YA 3L08A 1CFMA 3BUQA 5E5MB 2PR4H 3B5GA 2CAKA 2XZCH 3DRQA 2W60B 1PFCA 3N0AA 5HHMB 1R3LA 3I50H 3IJSB 2Y22A 5ID0A 4ZMYA 1CYGA 5C08D 4XB7A 3LZQA 1T66C 3DJ9A 2IDFA 2MEJB 3KXFA 4TUOA 1UKTA 4L4VD 1R5VA 4H13C 4R4BB 3OC8A 4ZD3L 5FUCC 1IL1B 5I1HH 1BWWA 1ZE3C 5AZ2H 4N8CH 4RGND 4F93B 1KCBA 4HJUA 4MS8D 5AWNH 1U30A 3HKZA 2VMJA 1JYNA 2RH0A 1MJ8H 4KK9C 3BVTA 5HGHB 4YZWA 2FGWH 1GGCL 4NN7B 4Z77B 4RZCB 2A4EA 2F53A 3NZ8A 4Z7VF 4J2QA 2XG5B 1XFPA 4I5BA 2AC0A 5CM1A 3AS3A 4JGJA 2F54B 3SGKC 1XF2B 1Z2KA 4F8LA 4MLIA 1QYGH 2FLBT 2QSVA 3LS4H 4K9EL 3DK2A 2WLLB 1A14L 4R7NA 1X7QB 4BFGA 5GS0H 1SEQL 3AY2A 5J5EA 4B0MB 2ZX6A 5IBUB 4JKMA 4F9PC 3Q9PA 1K8IB 3CFKA 4YDJB 5C0JA 1BM7A 1R75A 3HE7B 2E7HA 3JTTA 2YD0A 1NINA 5J11C 4IBUA 1TETH 3MHZA 1MFEL 1NFIB 4OCRH 3ZT7A 1FNFA 2ZP8A 3FU8A 3D0AA 5C1MB 1WZ1H 4DN3H 2VLME 4LBAA 3TBYA 2YKLH 4V1DA 3PP4L 1T89C 4BFRA 2JKSA 2ZOWA 1VFUA 4KDTA 4LBEB 4PJEB 5LBSH 4JO2H 5K39A 2VERA 1ERNA 2AEPH 4IGBA 4XC3L 3KPPB 3UROR 2QMKA 3X12A 1D9KD 3KNBB 5CN3A 4UQDA 1WEJL 3WAJA 3OQ3B 3I02A 4ENZA 3CFJA 3QBTB 4O58H 4YHMH 3KGUA 3D25A 1G6RL 1QUPA 1FZMB 1QO3B 1KJMA 4M7LT 4ZMZA 1SEBB 1S9WB 5E1AA 1HS6A 5FPIA 4AVIA 1F6LL 2OV0A 4LMQE 4NJAH 1YEGH 2F7OA 4LAJH 3TH3T 1RSYA 4UTBH 1PTZA 5AB9A 3DI3B 1E42A 1PDKB 2UWEE 1BFTA 2YPVH 3VI4E 3W1ZA 5DCCA 1P84J 1Z9LA 5CJOL 4PRPE 3FBQA 1RU9L 3NEXA 4OJDH 1NPUA 4X6CB 2EXYC 2GG1A 3WFBH 3WJLC 1IC1A 5K9KB 2ZXBA 2DEYX 3PWPE 4X0KA 3MO1A 1K8DA 1FORH 3VXMB 1RXLA 3ATAA 4V2BA 3UYRL 5CILH 4L3EE 1DLHB 2Y5TA 3N0PB 3WMPA 4ES8A 2D7NA 2WQWA 3LKNA 1CU4L 3MUJA 4KQ4L 3NQIA 3AG1B 4JHAL 5HGGS 1YEDB 1OB1B 3CJJA 4LP5A 1BLNA 4X5PA 5DHYB 4WTQA 2C9PA 3CCHA 5TK2A 3DMMA 4S1SL 5HJBA 1P5UA 1W91A 3SO5A 1PFOA 3IDIB 3RGVC 3IDJB 1UWYA 3X3FH 3QEQB 3FAWA 4DGIL 1JIBA 5T1MB 1DQIA 2P43B 4G80A 1MLCA 3VB9A 1JHKH 5DMJB 2JIXD 1NOFA 3OJ2C 4OCYH 2DM3A 2ENJA 4JG9A 4NKDA 3NABL 3MRBA 3HG5A 1XR8B 3P4LA 3IDNB 4M1CD 4QT5B 3RZCC 3ZHFA 1I8KB 3O0RL 2Z31D 3KEHA 4JFZL 2XSKA 4AT6B 1JFQH 1YEEH 1TQSA 4ODTH 1UTDA 2O6FA 4UQEA 4Y5YB 3OL2A 4LE8A 3BVVA 1XEDA 1NL0H 1WBZA 2J3SA 4P3DA 4JFDD 5GGSY 4HUKB 3X1NA 3UAJC 2AZUA 3VACA 2WB1A 2E27L 3ASOB 4B53A 1FH5H 1IGTB 1OCWL 4XCCL 5E9AA 3SDAA 1PLBA 4JO3L 2Z8RA 3NN8B 2IBZX 3D9AH 5F7EH 2AJVL 2P5WB 1MIMH 1NMCC 4KJQC 1KBBA 1S7UB 4JG0H 1KGIA 4QRRB 2DQGH 3ENEA 2AITA 3D18B 1W80A 5DWUH 4ATTA 3GLZA 2GJ6A 1WE5A 4UAHA 1I3RB 1XVSA 3RYMA 4N0UE 2Q76A 5EH1A 3OLEA 3ULUD 3NJNA 1RVFL 1SYVA 3GSUB 4W9EC 2CCVA 3JV6B 2R29L 3MGTA 5EIIA 2AV1A 2OA9A 2HKFL 3CMOL 2EUZA 4URKA 4EUPG 1JE6A 5C0RH 2ZWYA 3V0VB 4C47A 2Y1AA 3VFTA 4Q56A 2H3KA 4KAQH 4UINH 3BUTA 1LE9B 1NC4A 1M3JA 5CCKL 3K8KA 1GC1C 2AFNA 4JB9H 2X0UA 1RZJL 4S11A 4TSAH 1KSRA 1YN6B 2PP8A 1WFIA 3WLBB 2AI0H 1YEFH 4TKWA 1PQZB 2XN9E 1YEJH 1KFAH 1I7RB 1RIHH 5AW8B 3RE0A 5IVNA 5EEZA 1UH2A 1MFAL 4PJ5A 1A6TB 3H2QA 4G8GA 1V3KA 4PS8A 2CLZB 3QARA 3RNKA 3CQFA 1EFXD 1MFDL 4EI5B 4ZUSB 4LXFA 5E9DE 1P84K 5DS8B 4WENB 3QT2A 4LL9A 5IR1B 1MRFL 3CSBA 1UM6H 4MJHA 3MRNB 3SKNA 2MTAA 4RCAA 1OL0A 1NFDE 2VXUH 4GP4B 3GXIA 3X1EA 1SBSL 1DFXA 1F4AA 3DSNA 4NKOA 3CH8A 1E9PA 5FUZH 3RA7L 5JW5B 1KEMH 5SWSD 4XMKH 3PDGA 2VR8A 4P5MB 5E8EB 3F04A 3ZE1B 3MCKB 1N5YH 1KF9B 3UCQA 2CO7A 1X5JA 3MNVA 1UQSA 2JWYA 4OGXH 1H0DA 5FIEA 5DJDA 2WXIA 3OAWA 4TPRH 1AQKH 2R1YB 4GRLC 4J4PC 4ZAKC 4HOZA 3LMJL 4XHQA 4FFZL 2O5YL 5MI0B 5D1XC 5E24E 5KBLA 3MLXH 4IMKA 4S1QL 2C3XA 4F8TA 5K5YA 5F7LB 1NICA 4PTUB 4KUCF 2AV7B 4JFHE 1PZDA 2AHIA 2AJZA 4AL8C 4PJXF 1R47A 3UPAA 2J43A 3FSVA 3KS0H 3NCJL 1CT8B 4YH6A 5FKPB 2XDHA 4AEFA 4K5OA 3GSNL 1XGZA 2C26A 2UXTA 4QEGA 1LEIB 5D7LB 1B88A 3FRPB 1XTLA 2EABA 1CPUA 3I74A 4G82A 1GSKA 4IJ3B 4Y4HD 1QVOB 4ZYKA 1F3DJ 2QSCH 3DSFH 3IJ7A 5D7KD 3EGDA 1KLGA 3QUKA 1TCRA 5JHLL 1SF3A 5E6IB 3C60C 4FC3E 3UJIH 4GXUM 2P8PB 3IMBA 3C6LC 4X0NA 3L4XA 3EF7A 4NUMA 4MNQE 1HYSC 2C9VA 3ATFA 3K4AA 1G0XA 1Q4NX 3ARFA 4LSUL 4PCTA 3DBXB 2ROXA 4X9IA 5GRVL 3O6KH 1W15A 1U8QA 1P6AB 3D4CA 1NBYB 1PKQB 3SE3A 2O26U 3MMEB 5ANHA 5D2NB 5GGSA 3BEVB 2ZCZA 4XNZB 3ZKXC 2NY4C 3MLRH 3LXAA 1YHPA 1UT1A 4FZ8L 5FA3B 4P2OA 4CNIA 1PX4A 3D87B 2BIPA 4H25A 3ZVVA 2AEOA 4ZS7L 3MRCB 3KYKH 1FJ1B 1I7TB 3LN5B 3LXCA 1V7NH 5ESAB 3U36A 1W6LA 4R3SA 3OG6B 3VAEA 1OTSD 3OMZA 4HEPA 2IDSA 2QJDA 4XVUC 4HKJA 4F7CB 2X42A 1A4AA 2BZDA 3QDJD 4FG4A 3X2QB 5TGBB 3BUYB 5GJTH 4JL1A 3QIUD 4Y5XA 1T1WA 5F9WC 2V3EA 4HS3A 5IBLC 1MNNA 3A4AA 4Y5YC 2GTWB 3WTXA 3MRFA 1QFWL 2AAVA 1DN0A 4PGEB 4ALAH 4DZBA 2VLKE 2F7IA 3RWEB 2D31B 3BAKA 3BRFA 5C08B 1QMUA 5DTFB 4DOHE 4Y2OA 1RLWA 1K85A 3REWB 3IJ8A 3NIDB 4L4VB 5J13C 1IKFH 1B2YA 1P1ZA 1GYUA 2N3JA 2FZ3B 3FTSA 1D3CA 4OZGE 4P46A 4RGNB 5BZZA 2CBOA 4L8CB 2V0AA 2YPLD 1MPAH 3TO2B 4Z7WF 4N2GA 1J9QA 1SHWA 1NCJA 2QELA 1FFPB 4NBYB 3RVUD 5ECJE 1B9ZA 5IT2L 3L5XL 5FUCE 4FQXD 4CC1A 4MMYB 4HS6B 1ZGLM 2EKSB 4MD4B 5EU3A 5KTEL 4Z0BH 3ML9A 3KR3L 2MNJB 3M1OA 5ENWB 1MZYA 3PGDB 4FDWA 3WY3A 3EFOB 2BY0A 4U05A 4KV5F 1EO8H 1MFBL 3HB3B 4UZGA 2WWKT 1ETZA 4MJ4A 3F7VA 5IBUG 3Q8CA 3STLB 3VU1A 3NPZB 2B5IB 4MAYD 3BMVA 4H5SB 4XVTL 4R90L 4PI0A 4WEUD 5T5FH 1F2QA 3ISYA 1OWWA 3NFSL 1BOGA 3LHPH 3RVVC 2BJML 4IKKA 1U8CA 2F58L 1S9XB 5EU5B 4YO0A 4AYID 4AIOA 4NIYE 1RKRA 4WO4A 4W9GC 1HZHH 3BIAX 3U7YL 1HL4A 2P1YA 3LD8B 4NSKA 4HJSA 4N0FB 4WU7A 2A9MH 3MV7E 1AYOA 3QG6A 4FQLL 1FAIL 4GO6B 4BE6A 1H3VA 3WUZA 5EO0A 1MN4A 4WI2A 2B1OA 2X9ZA 4Z7VA 3CN0A 3R4RA 1LMKA 4GQQA 5I30L 3FSWA 4UOQA 3CVCA 5AYQA 1DLFL 2OR9H 1JF6A 1TIUA 1RZ8A 3OKEA 1F45A 3AVEA 1WQVT 1FFOA 3KWXA 4ATWA 2OSLA 2WTRA 2VL5B 2OCFD 3H2PA 5LDUA 2YQGA 2VABB 5GRWA 2O1AA 4A7GF 1FNEB 3FO0H 1AFVH 1CICD 3T08A 1A4JB 4MHHG 1HDMA 4ANVA 4JNXA 1Q8MA 35C8H 3N55A 2C34A 3E8UL 2WZAA 3ZDYE 1KIRA 3QHZL 1ZTXL 2DICA 2VQ4A 4UAOB 4Z0XA 5DO2D 3TH4T 4NCDA 1ZV9A 2R4RH 2Y3AA 3TJEH 1ZMYA 4JMXA 4NQDE 4G6FB 2NYYC 2NNAB 2X4NB 3MODL 5C9JA 3S3JA 2WJ5A 2WXLA 1IFHL 2D3VA 3C2AL 3TBTA 3LNFA 4W68A 4YAQA 4Y9GA 2OP4L 4WSJA 1IAIH 1BFVH 4LCCB 4LIQE 4KU1A 4LLMA 3OSVA 3GQFA 1BQKA 2GB2A 2PCXA 1X5AA 4DP5X 4IOIB 5IEHA 1VKXA 3W39B 3GO1H 1UENA 4P9ML 1ESOA 5FYJL 2E8ZA 5KSAA 3UXFA 1H15A 2Y06H 3EJYD 3HI1B 3AB0C 2ICWB 2JIXB 3TBWB 2J5LC 1BVNP 3QQ9D 5GRXG 5IB2B 3P4NB 1ACXA 1E43A 2VDKL 4M3HA 4AVJA 1ITCA 4LF3B 2WUBL 2J73A 4B5EA 1HVXA 2IFGA 5BZDB 1SYSA 1NCNA 1JXGA 2YA2A 3NJMA 4ZPTA 2HFGH 2FB4H 5BW7A 4NAJA 3B2XA 1PEZA 3R1GH 3DYMA 1NGXA 3DHPA 3SGEI 3V5KA 4MQXC 4X6DE 3V4LA 3VSUA 4WDIB 3G5ZA 2VDQH 4G6KH 4JFDB 1XD1A 3CMGA 4MCZB 1MQKH 1J10A 5E9DD 4L9LC 2V7NA 15C8H 4MCYA 5KN5B 1EVTC 1KYDA 1YEKL 4UT6H 4L23A 2DTSA 5JPMC 5I17A 5DRZA 1S78D 5EU6B 4Z7OB 2CDGB 1F11A 1V3LA 3P4OB 2HN7B 4GBXB 4DF9A 1KIPA 2CR6A 4TULH 5ERWA 2C4FT 2M2DA 3VDCA 5DD3L 1J87A 2NXZB 3SKOA 2P5EE 2CA4A 3EBHA 3TZVD 3VGDA 2GTZA 2HH0H 3DVNA 1QI4A 3FUDA 3L6FA 2A9NL 2I24N 1THCA 4PJFF 5HDRA 3RTLA 2EC9U 1H3UA 4ELMF 1IE4A 1MCJA 4KKCD 3A23A 3UTSA 1MHPL 2YSSA 5JNYA 1LEKA 2H26A 4D0DA 4UIMA 4LHUA 4XNYL 3TLRA 5FC9A 3U9PH 1I31A 3D52A 4EKXA 3EAKA 4PB0L 3QFJE 4P9HH 4M6OH 1TU2B 2XNAB 4X7SL 5DT1L 5E6ZA 3TPUA 4OZIB 2BVEA 4HJTA 3PWNA 4M7JL 1OW0A 3O11A 4HP5A 5E6YA 4DGUA 3VGBA 7TAAA 1O9VA 1ZGLA 5D7JD 5JPNB 3QULA 3OHXB 4GG8A 3ASNB 1WTGT 1QRKA 5DD6B 3OB0K 4DK5A 4QUOA 1T5XB 5EUOB 2ZUWA 1TDQA 1SLWA 3L3HA 3OWEA 4LEOB 4S0HA 3IPEA 4XOBA 4X42A 3FUJA 2MCPH 2DWXA 3T0BA 4NDMA 4E41B 2FSEB 3WN6A 1D6VH 4NM8H 1RUQH 3ZMNA 3LQAC 3VWKC 3MLVL 2IJ0C 4NBZB 4AGOA 5D7SH 4F8NA 1CI5A 4MNQD 4QRAA 4XNMA 3QYNA 1LE5A 1HCYA 3ZKNC 4LOUD 5AVTB 4KHTL 4LSDA 4JKNA 2VDQB 2YRZA 4JPWH 4HIIB 4WWKA 3T4AB 4KI5C 2ZNWA 2YA0A 4KXCA 5DU7A 5SWSB 4APQA 3DUSB 4DNLA 1J5IA 1S7RB 1QFPA 4ODWA 4Q58C 2ATPB 2ZCHL 3QJUB 3GWJA 3OKMA 5DFAA 4OV5B 3PJLA 4JLRA 4JN2A 3GBDA 3LD8C 3VFRA 3UFIA 5TH2A 3NSJA 2GIMA 1VPOH 4M7KL 5IMKB 5I2IB 1JP5A 4ACPA 5JYLA 4C56B 2QKIA 3F65A 2FH8A 5I1EL 4JFEE 4PJ9A 1J0HA 1VA9A 4XAWL 4CVZA 3OJDA 5D1ZC 1MAML 4M29A 4O51B 2TSBA 1JNJA 4HIJA 4PJEE 2J5WA 4XTRD 1IGML 3MRDA 4NN6C 2A6JB 2DQUL 3FB7A 4N8VB 4Y4HB 1U2YA 3BVNB 3BMWA 2D7OA 2IAMC 5CGMA 4FJYA 1T20B 4P2QA 3S96B 3S4SB 4CDHA 1ZGLP 2GBAA 1RK0A 1HESA 1SBBA 4QHKI 5CHNB 3QQ3B 3PRZA 5AUMB 1I1RA 1TZHB 1A4BA 3NSCA 1CD1B 2ATKA 3APCA 1SDYA 1UD3A 4IKNA 4XN5A 3A0OA 3NT0A 4MGXA 5IB1A 2HVJB 4KHXL 1T66D 5T1LD 4ZFGL 5AZUA 3CQPA 1EAQA 3PCYA 4LCCC 5F0JB 1J5DA 2D0GA 3DXAE 3SSGA 4PJXA 3M17A 5CNHA 5I1JL 3GK8L 1FN4B 1IBGL 4TNWF 2R15A 4UU9B 2C1OA 5KS9E 1A14H 4XBEL 4HFUL 1SEQH 4FQQB 2XV2A 1DZ0A 4MJJA 1WFMA 1NWPA 3QJSB 4ILDA 4IHBA 2OQJB 4PJGF 4HYTB 4YEEA 5F1IB 4PWJA 2WN3A 4ZFZA 1WS7A 4UQAA 5KUMA 5L2JB 1PG7H 3W11D 4G72B 3UBXG 2C3GA 3QDJB 3ULSB 1YY8A 2GITB 4QXUL 5T3XD 3OWRA 1KTLA 4DSYA 2FX8L 2ZOKA 4R2GC 1KG0A 3QIUB 3HMXA 5D1QD 2OTUB 3BESR 3TCTA 1WSST 4XP4L 4OT1L 1OAKL 1EMTH 1KXVC 1XCTA 2VMFA 3ZZLA 4EF3A 4X99A 2WZ6A 2EYRB 5FOJA 3MV7D 1QBML 1SRDA 1OGTA 1DP0A 4PJ6A 5ECGA 3EYUL 2VO5A 3MJ7A 1G6RH 3NSYA 3E6HB 3Q2LA 1D6EB 3JSSA 3WKQA 3SGDI 2FE0A 1YA5A 4F5CE 1M9WA 1J9SA 4GBXC 1BBDL 2IMMA 5F70A 1I8IB 1P4UA 1HHHB 2YPLB 2NXZC 1ZHNB 3BPOC 4JFOB 4P5KA 3Q05A 1E9OB 2ZUSA 1CXIA 2HVKB 5CJOH 1CDIA 3MBEA 4IRJA 1RU9H 3WSQH 3ILEA 2XWDA 4JM2B 1O75A 5IW1B 4A55A 4R26H 3FFCD 4NRXA 3F62A 2ARWA 5DDHA 3QNYA 1P7KA 4U6YB 5IROC 5C09A 1U8KA 4GSDH 3UYRH 1JZFA 4L2YA 5TDOB 4XAKE 2JJSC 4KI1A 3QEHA 2FEDC 4KQ4H 5I6OA 3FPYA 5IVXB 1M71A 4P4KA 4ZODA 4JHAH 1U4FA 3AXHA 3V5HA 2KLTA 3R06B 1RUPL 1TEFA 3GDBA 4RLDA 5DJ2B 3CV5A 3GD1C 1WBYA 1JGIA 5ISZD 4S1SH 2VQUA 4OF3A 3VGHA 4DGIH 3CUPA 4RRPG 3KVQA 4GT0A 2AEIT 4Z7WA 2RJMA 4UQ3A 3P1VA 3ZSSA 4JZJB 3S97C 1QBBA 4WEBL 1PD6A 5I1AB 2P4AB 1MRCL 4YHPB 5KYYA 3CVDA 3H9YA 3O0RH 4P2RA 4ABVA 2K1MA 2YOCA 1GZPB 3BD5A 5J8OA 4DKAA 2F9BT 2OMBA 2K6ZA 1A3RL 3ZT6A 4PPTA 3CQQA 2A0LD 2BCKB 1G7IA 1CDYA 4YDKH 1E65A 1G6RB 3IU4L 1CQKA 4EN3D 4J3VA 4AZUA 1O9WA 1XGUA 2B1HL 3F83A 3UTZB 3VXRD 9PCYA 4OKVA 1PBYA 1FO0A 5DMIH 1AGCA 3O9WC 2YQ3A 4GUOA 1OCWH 3BZFB 4IIQB 4LNRB 3S5LB 4S10A 3RFRA 3VG9B 3P4MB 3QAZC 1DYZA 4RMSA 2APXA 1K5NA 1TJXA 3VUAA 3D3VA 2AJVH 3BP5B 4KKAC 3G5XB 3L48A 1ZEAL 3LV3B 5K59E 4LESA 2YXFA 4K5PA 3S3BB 4LL1A 4KJWC 2QPSA 4F7PB 5FM4A 4CDGC 3NJKA 3NDYE 3DX6A 1VGKB 1JZ7A 2APVA 1PL3A 1S8DB 2E9GA 4FLOA 4JKWA 1G43A 4L3CA 5CXPA 1OWRM 4HK0B 1RVFH 4LCUA 2HKFH 3CMOH 3ZUNC 4PHXA 2NX5A 2WWMC 4KY2A 3MBWA 3N44F 3PABA 4IU2B 1A1NB 2XWJB 4EVNA 5I75C 1I1AA 4PP2B 5DQ9B 1R3HB 3E2HB 2XV3A 3FT3B 4YFDB 5FYKL 1CR9L 4KJQD 5CCKH 1TQCB 3DV4A 5HGAB 1RZJH 2AEQL 3TVMB 3WFHB 3ARZA 2A74C 3CXHJ 5FO7B 2OSYA 3B7SA 3QFJD 1HHKB 1DVTA 1X5KA 3K80A 5HVWA 4MAUL 2NY0B 3G5WA 5AKVA 4U1NB 4DIXA 3HG1D 4HDIB 1ILUA 4BKSC 3SDYL 1MFDH 4XXDB 1T3FB 3HHMA 3V6FB 1BZ9A 1HSAB 4NAQA 1XV8A 4Y16C 3QS3A 5KSBB 4DVRL 4E9TA 1EV2E 4M93C 3VI3E 5EC2A 4PJ8C 1JZ4A 3RA7H 5B7EA 1NUGA 3W0WB 4E9WA 1BBJB 3K8LA 4OFKA 3T6VA 2CPCA 1KTRL 1RZ7L 2NY1D 4PM1A 3LVTA 1Q72L 1Y18A 1UUNA 1ZOXA 2BRRL 1V54B 2G3MA 3L5HA 4IYKA 2WLNA 2BNUB 4HHAA 3BGMA 4JG1L 4NXKA 3GEWB 1OY3B 3S3CB 3INUL 1TVHA 2J12B 3U6RB 5JHDD 4JPKL 4Q6IA 2O5YH 5KBPA 5CZXD 2FR4B 2WY3B 4E9VA 2K7QA 4K55A 1PZAA 4PRHA 4OKDA 5ID1A 4MASA 3V4PL 2YXVA 5EBWB 1BQRA 5IGXL 3NCJH 4BWTA 1HZLA 1U8HA 1YSOA 3C87A 4MS6A 1JPFA 4BFIA 1FYTA 1Z9SA 3DOIA 4FQHA 4WGWB 3VXUE 2WZPA 5L9DH 5E2TH 3BZ4B 4E42A 1AI1L 1XF5A 1Y6MR 3K5RA 4JGUA 5D1XD 1MCNA 2C3VA 3BISA 1ZXKA 5GISH 5AQ0A 1N6QL 1UEYA 2EXWD 3MROB 5D7JB 3FL7A 3V2AR 5BS0B 3HRZB 2OR8A 5DVLA 2HKAA 2ZUTA 1G9ML 1ZJAA 3SDCC 5J1AB 3VXPA 4FXTA 2GABA 4JM2C 4PG9A 3VTTA 2VM4A 1BA9A 4EIGB 3PNRB 1DJYA 3UZVB 2OI9B 3O4OC 3ZLQC 4NP4L 5KYXA 4JQXA 5GS1C 43CAA 4JAMB 1AIFA 2ZCLL 3CZKA 5J1TC 3GUTB 4XNXL 4K9EC 3S2CA 1H19A 3L3JB 3QZWG 2HJKB 4XMLL 5DMKA 4ELMA 1UOKA 4F2MA 1M05B 2WXJA 3SGJA 3KLAB 2D4FA 4CMMA 5IREA 4M8UA 3C6LD 4G42A 2CMRL 3ZX1A 1HYSD 4IRZA 1HWHB 4ZS7H 3DXAD 1M4KA 2IMNA 2I9TA 3QIBA 4WUUE 2B39A 3BVWA 4KI5E 2NLJA 2ESVE 4LU5L 1BECA 4Q4EA 5T3XH 3BWAB 1F4XH 4BK5A 4Q9RL 5F8RC 4JFFE 5L4MA 3CXHK 2Q87A 3HC0A 4NC1C 4S1DD 1C1EL 4PBWD 1OAXL 3V0IA 2NCEA 3HAEH 3QQXA 2CDFA 4P57A 1QFWH 2ZJSH 4N8VG 4G8FB 2E9JA 4XO4A 2IV9A 1J8RA 4ZBJA 5KYNA 4X6EA 4G1EA 4XVUD 4OGQC 3IFOB 4G9FD 2VXQA 1NCTA 1XR9B