4TXVB

Crystal structure of the mixed disulfide intermediate between thioredoxin-like tlpas(c110s) and subunit ii of cytochrome c oxidase coxbpd (c233s)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
142
structure length
142
Chain Sequence
FLELDVPKADLTIKATGKQWYWSYAYPDNGKFEFDSLMAQDKQPRLLGVDNEMVVPVNKVIRVQVTGADVIHAFALPAFGVKIDAIPGRLNETWFKAAKTGMFYGQCSELSGKDHAFMPIAIRVVEDKEFASWVETAKKKFA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How Periplasmic Thioredoxin TlpA Reduces Bacterial Copper Chaperone ScoI and Cytochrome Oxidase Subunit II (CoxB) Prior to Metallation.
pubmed doi rcsb
source organism Bradyrhizobium diazoefficiens
molecule tags Protein binding
molecule keywords Thiol:disulfide interchange protein TlpA
total genus 26
structure length 142
sequence length 142
chains with identical sequence D
ec nomenclature ec 1.9.3.1: Cytochrome-c oxidase.
pdb deposition date 2014-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 4txvB00
2GC7C 3AG4B 5F7BA 5I6MA 1QLEB 1L9PA 1URIA 4W1TA 3AG2B 3X1NA 2GBAA 4JHUA 4FAAB 3NJJA 3X1GA 4A2FA 2I7SA 3TBCA 2AVFA 2H47C 4DPAX 3ABMB 2EINB 4JHVA 1V54B 1M9WA 2LLNA 3PPSA 4F2FA 2TSAA 5B1JC 4HCIA 1FWXA 3FU9A 3NJHA 4CSZA 4YSOA 1IBYA 1NIAA 1X9UA 2R7EA 2YAOA 1AAJA 2PLTA 1JZIA 2E86A 1BXUA 2EILB 4HAKA 2JFCA 3UADA 1JVOA 4G72B 4M3HA 5I6LA 1AG6A 4BWWA 3NSCA 4BDVB 1ZIBA 2YAEA 4HCFA 1ASQA 1W6WA 3AG1B 2HZHA 2B08A 1UATA 2GC4C 2QPDB 2HRGA 4YSPA 3X1BA 2PPAA 1A4CA 3IN2A 3PAZA 2OJ1A 4YSCA 1PNCA 1BYOA 2BHFA 2P80A 1YLBB 3EF4A 1NPNA 5I5JA 1I53A 3NJGA 1J5CA 4DP7X 1AZUA 4A2GA 3JT2A 3X2QB 1NIBA 3N2JA 1M56B 3QJUB 2FWLB 3S8FB 1ASOA 2XV3A 3RYMA 2IDQA 5B1AB 2FQFA 1JZFA 3GYRA 3JTBA 4GY4A 1V10A 1OE3A 2GIMA 2W88A 1NIFA 3S3BB 4YSQA 3FU7A 2FQEA 1GR7A 1NINA 3X1EA 4DPCX 1FFTB 4K9JA 5B7FA 3ZX1A 3IBOA 2EIMB 2GI0A 1FA4A 1SFDA 4BXSV 1MG2C 3AW5A 4E9WA 4KO9A 3ASNB 2YAPA 4KO5A 2X87A 1TEFA 3MBWB 2HLEB 1PLBA 3DTUB 1AZCA 1ASPA 4AKPA 1SHXA 1EZLA 3SBPA 2XV2A 2UXGA 4YSEA 4E9SA 1KBVA 3TASA 2ZWNA 3PLYA 3NJNA 5IY5B 1NZRA 1PZAA 2J56A 2YXWA 1SFHA 2B3IA 2VN3A 2HX8A 1ZDSA 2VM3A 4BDVA 2QDVA 3BVDB 2WO3B 3HB3B 2BWDA 3TA4D 2BP8A 1WS7A 1TU2A 2BW5A 4ENZA 1ZIAA 1MG3C 2AANA 2ZOOA 1PLCA 4RH4A 2P80D 2PPCA 1RZPA 1CYXA 4F2EA 1SF3A 3QQXA 4PAZA 3T6VA 4GXFA 3FQYA 4P5RA 5B7EA 5TK4A 4HHGA 4KNSA 4JKNA 1VLXA 5I28A 3PCYA 5E9NA 2BZCA 3NJFA 2GB2A 5B3SB 2IDSA 3FSZA 2HXAA 1WA0X 1MZZA 3NJKA 3OQRA 4DP6X 3EH3B 4DP0X 3D12B 4HCGA 3FYEB 2XVBA 3H4FA 1DZ0A 1AZNA 2IDTA 1ILSA 1KYAA 1MZYA 1L9RA 2Y69B 2DYSB 5I5MA 3FT0A 4KNTA 3NSYA 3DIVA 3FPXA 5I26A 5I6NA 3OMIB 4ZK8A 3FS9A 4YSDA 4DP2X 3OMNB 1AG0A 1ET7A 1PLAA 1J9TA 4KOCA 4YSTA 2UX6A 3GDCA 4KO7A 5ANHA 2X88A 1IC0A 2VSMB 1SNRA 3FSWA 4KOBA 1NTDA 1E67A 2FTAA 2Q9OA 1GS8A 3EHBB 2N0MA 4YSUA 1V55B 1X9RA 3UAEA 1IUZA 3V9EA 2YAQA 1CYWA 4QKTA 4N8UA 4W9ZA 2YAFA 3QJRB 3EH4B 4DPBX 1HFUA 4G70B 2IAAC 4AKOA 5AFAA 1BYPA 2OV0A 1BAWA 2QPEB 2UX7A 1ETJA 1PAZA 4TXVB 4PCYA 4YSSA 3FU8A 3L45A 3QJSB 1OCCB 3AG3B 3UACA 5D4JA 4AX3A 4E9RA 1JOIA 2YXVA 3NP3A 1GS6X 3FU7B 3NT0A 2ZONA 3T6WA 6PCYA 3EH5B 3SBQA 2HRHA 2TSBA 3UAAA 2XX0A 2CBPA 2CAKA 1E5ZA 5D4HA 3FYIB 4YVUA 4Q89A 1GYCA 4M4RB 1PMYA 3AY2A 1A4BA 4DP9X 8PAZA 1JZGA 3IN0A 4HALA 3SQRA 4BXVA 4KNUA 1SDDB 4X4KA 1BEXA 2FNWA 3DKHA 2FQGA 1ADWA 1BQRA 3FSVA 2QDWA 5B1BB 1BQKA 2XX1A 3IE9A 4GP8B 1GSKA 4UANA 1SDDA 2MTAA 5PAZA 2XXGA 1PNDA 2UXVA 1E30A 2IWKA 2FJSA 4DP1X 3S3CB 2I85A 2EIJB 1WS8A 4G7QB 3CZUB 2WSDA 2H3XC 1AZBA 1RCYA 2MRYA 4DP8X 2W8CA 3HEIB 1ZPUA 4Q8BA 1L9TA 2BP0A 3TU6A 1NDTA 3ABKB 3X1FA 4AZUA 1XMEB 5I5IA 2YARA 4QLWA 2AFNA 4A2DA 1PCSA 2YQBA 5EHFA 3TBBA 3PXLA 4FA7B 1IBZA 3NJMA 1SF5A 1SHWA 3ABLB 5D4IA 2J5WA 1OE2A 3WI9A 1AOZA 1T5KA 2CCWA 3NP4A 3WNIA 1TEGA 2VW4A 3UGEA 1MDAA 2XLLA 2WO2B 2CJ3A 2FT7A 2H5UA 4NB7A 1WA2X 3WG7B 2IDFA 4AKQA 2IH9A 4BWUA 4P5SA 1J5DA 1A3ZA 3SBRA 1AS8A 3FQ2A 1B3IA 5B1JA 3ZDWA 2PCFA 3KW7A 1ID2A 1AQ8A 3T6XA 1AZRA 3QJVB 3WKQA 1QNIA 3UABA 3ZBMA 1OV8A 3MX0B 1A8ZA 1A65A 7PCYA 4A2HA 1NPJA 4E9QA 3FPYA 1XB8A 2HX7A 2JKWA 5I6KA 4UF7C 1OOWA 9PCYA 2FT6A 1SJMA 1CUOA 3CVCA 4E9XA 2QT6A 1W6LA 2ZXWB 2XYBA 1J9RA 2PPDA 2VW7A 3ZIYA 3QJQB 2YAMA 2J57A 4HHWA 4YSRA 1XB3A 4DP4X 5LDUA 1OF0A 2BWIA 2EIKB 3H4HA 2AZAA 1DYZA 2CUAA 2DWSA 3ABGA 1PZBA 1N70A 1HAWA 1PY0A 2YAHA 1R1CA 4HIPA 2DY2A 4EF3A 1GW0A 1KV7A 4NAJA 1JVLA 3GXUB 1ILUA 3OMAB 5AKRA 4A66A 2DWTA 1E65A 2FT8A 5B1KA 1WAEA 3KW8A 3NJLA 3T6ZA 2AZUA 5F7AA 5I6OA 2XWZA 1KBWA 4HZ1A 1NIEA 2UXTA 1AS6A 5AZUA 1ET5A 1KDJA 3FQ1A 1ZV2A 1AR1B 1L9OA 4E9YA 1RKRA 4BWTA 1RZQA 1BXVA 2J55A 1AANA 4A67A 1W8EA 1XB6A 2FQDA 3H56A 2XU9A 3T71A 3C75A 3CDZB 3U25A 4E9TA 2DV6A 5PCYA 1JERA 2IWEA 1J9QA 2PCYA 4G7SB 1JZHA 4L0PB 2IH8A 4MFHA 1J9SA 1JXDA 4BK5C 1M57B 1GY1A 3CVBA 2PPEA 5A7EA 3OM3B 3NJIA 3AZUA 2BO0A 1QHQA 3NYKA 2VW6A 2UXFA 2PP8A 4GP5B 2A3TA 4KO6A 4GP4B 1A4AA 1L9QA 1ZDQA 3V9CA 2PP9A 3NSDA 1KCWA 1BQ5A 1KDIA 2GHZA 2XXFA 2PP7A 3ASOB 4AI7A 2GSMB 1HAUA 1EHKB 1JZEA 3CVDA 3CG8A 2DYRB 1AACA 2VSKB 1JZJA 1ET8A 3FSAA 4GYBA 1OCZB 3T9WA 2BW4A 4WKXA 2JXMA 1NIDA 1F56A 3QJTB 1OE1A 4NERA 5FC9A 4WTQA 4A2EA 2CALA 4YVNA 1JXGA 1OCRB 2OCCB 2XV0A 2IWFA 4E9VA 1TKWA 2VMJA 4A68A 4G71B 2R7EB 2Q5BA 3IEAA 3S3DB 1NICA 3WNJA 4N4YB 1GY2A 4CSPA 4F7KA 1NWOA 4YL4A 7PAZA 3S8GB 2I7OA 4G7RB 2IDUA 3N55A 5TK2A 1L9SA 1CURA 3WKPA 1PF3A 3G5WA 3OD3A 1PZCA 2VM4A 1CC3A 4UAHA 1KCBA 1KGYE 2BP0B 4YSAA 3QPKA 2BP8B 2NRDA 2PPFA 2XUWA 1NWPA 3WIAA 1IKOP 4DP5X 1AS7A 3PAUA 1JXFA 1GS7A 1AIZA 1WA1X 1E5YA 2RACA 3BQVA 2HX9A 3CDZA 6PAZA 1OCOB 2Y1AA 1BXAA 2BZ7A 5I6PA 5B7MA 3ERXA 3NSFA 3PAVA 1N68A
chains in the Genus database with same CATH superfamily
3VMNA 4P2QA 4N2AA 4TQPA 3L3JB 2AK4A 2VC2B 3FT4A 4XAWL 2I25N 3SYPA 2I32A 4DUWA 4NC1E 3G9AB 4F57H 2DBJA 4KUZL 4FG6C 4HJ0C 3X1GA 5GS0H 5CNHA 1A6TA 2CU9A 1DQVA 4NWTH 4XN5A 3SDAC 4MD4B 5AOJA 2I07B 5DYFA 4PJXE 1G7MA 2CO7A 2EE3A 2CPUA 1DANT 4HIIA 4ODBD 3IK2A 3LEVH 4GINA 4KMTL 3TBYB 3MUY1 4GOSA 4TUOA 4XMPH 1IB5A 4LARL 4JHWL 1HH9A 3X13B 1IBYA 1ZSHA 4WHYG 2PW1B 1QUPA 5F1IB 1AO7B 1RMFL 2C5DC 2EILB 1EGJL 2KKQA 5C0CE 3UIYA 1UD2A 3BKYH 3ASWA 2YAEA 4Q56A 4HCFA 4M43L 5C9JB 1A2YB 4L8BB 1OF2A 4WW1A 1FGNL 3QORC 4K8RH 5DQ9A 3RWHB 1I9JH 1NLDH 4TNEA 3V0IA 1NANI 2MNJB 2K7PA 3TP4A 4A7UA 1KCSL 2DICA 1LGVA 1RIHL 3G6DL 4P2OC 2EYRA 2YK1H 3A4DA 3D39D 3MNZB 1J0HA 4S1RL 4UZSA 5CN3A 3S5YA 2Z35B 1RSFA 1X5FA 1QBLH 5F9JB 4XB3A 1UQSB 1V10A 1DZBA 1CVRA 1O7VA 3B9EA 4NO5A 2F7OA 3PU7A 2VNCA 1SOXA 4MKMA 4PJHB 5JDSB 4YO0B 1JF1A 3HUJB 4MNQD 1GHFH 1ZOXA 3M1BB 2VDNB 4AL8C 3RWHA 3RPIB 1XZ0B 5GSVA 5I19H 1XGQA 3BVVA 3ZX1A 3TWCL 5DVPA 4NGHL 1TLMA 1CICD 1SYVA 5I15L 1RUAH 1T6VN 1UD4A 3KYNB 4L3FA 5FYLD 4OGZA 3BPOB 3L9BA 3Q1EA 1NFAA 3MBEB 1OT1A 1SM3H 3STLB 2B0SH 1U2HA 4R4BA 1MCPH 4TNVK 4KTDH 1AZCA 2F53E 2NNFA 2OX5B 3TS8A 5GGSA 3TA3D 2PR4H 3EJYD 2AK1L 2H45A 1G87A 3TVMD 1W2KT 2IADA 3CFJA 3CXDH 1PZAA 3BP7B 4FFYA 4B9FA 5C2BL 2DQDL 4K55A 4X8JB 2VM3A 3QPXL 2IJ0C 3OX8B 2WO3B 3JV4B 3L3OB 3T0XA 5MHSD 3BISA 5DXWA 3N43F 1GZHA 4YNYB 2HJKB 4PJ5E 5CZXD 2ZOOA 4RH4A 4EXKA 4EDWH 4UMGA 4N8VA 2V2TA 3ULVL 3T6VA 1ZA3B 1MY5A 2F54D 2WKOF 4EN3B 1UT2A 2AXGA 1XXFC 3EGSB 4KNSA 1EO5A 1CGWA 4IOFC 4ZPVA 5HHPB 3AAZA 3KPQB 2EAEA 4LEEA 2BZCA 4NO2B 1C12A 1KBGH 5D7JC 4PJIE 4CADA 1JD7A 4MCZA 1QRNA 2RGSA 3OQRA 2V5MA 2P7TA 2VRQA 4PJCF 4HF5H 2YPLD 1TCRB 4JGJA 1I7UB 4PJ8C 1E4JA 3CHQA 5FB8B 3QUKA 4I0PA 2ALWA 2ZXEB 5CSZB 1TJXA 1S46A 2KLSA 2YQ3A 4JMXA 2P5WD 3IMBA 2MOGA 3ILEA 4DP2X 5ACZB 3QB7C 1IC7L 1XL4A 3S37L 4HUCA 5EOQH 4WFGD 1FHGA 5ECJE 5C0BD 2OL3A 4D7PA 4Y4FA 1O7DC 4HDIA 1MW0A 2C3VA 3V0WH 5JYLA 3THMH 1JZ6A 3LPPA 2YUVA 1OCWL 3CVHA 4X6DE 5IJVA 4OJYA 2FWSA 3MUZ1 1AKJA 1VGEL 3BGFB 2DM7A 4Z7UE 3ATAA 3VXUE 5GZOA 3SJVA 4YWGH 3S9DB 3MV7E 2HG5B 1LK2A 2OL3L 4I7ZC 3I75B 1U8OA 4L4TE 4Q6IB 3PY9A 1V7ML 5I1AB 1NGXA 2OV0A 3DYMA 4ODSL 5T1DL 5KVEE 5EOTA 5ICYA 4X8GA 2IANE 4MA1C 2NCMA 2EIZA 3FRUB 5BZZA 3VI3E 2EUWA 1DN2A 1VEOA 3CVHL 4JRXE 1S9VB 2NX5B 1OPGL 2YUWA 4PTUB 4HETA 5C2UB 3APFA 1HHJA 1HE7A 3O4OC 1VJSA 4AIZA 5KSAA 5E0QA 3ZTCC 4JHZA 4LMQI 4PWGA 3KBPA 3DSFL 3EG9B 2JB5H 1YQVL 3B56A 3QISA 5DMKA 1GMIA 3W39B 1CR9H 4P2QE 5ETUB 1QBLL 1EBAA 4X6BA 4BFRA 1A66A 1DUYB 1IILE 3VQ1C 4UQBA 1ZT4B 2BSEA 3IU4H 3SKOB 1DQML 2H4EA 2NOYA 2VR9A 8FABA 5JUEL 4YVUA 4Q89A 3T6QC 3QCVL 4I48A 4QRPE 3LDBB 4PP1C 1EUUA 1EJFA 4LVEA 5E03A 5L88H 2GIYA 1JNNL 3IN0A 5D7IA 4S2SA 3QXVA 1F1DA 1H5BB 1BJMA 1SDDB 2WZPD 3CN4A 5E24E 2OJEA 3JTSB 5A16B 4WFGE 4Z7UF 1ETZA 4YQXL 5EFIA 1EJ6A 3L6FB 3V6BR 3UC0H 1U8HA 3QJFB 4Y16B 3S36X 2CA3A 3N1FC 3SZ6A 3MJ8B 2R0KL 4GP8B 1CF8L 4H1LA 4JFXB 5IB2A 1OHZA 1TQTA 2XA8H 3CFNA 6CGTA 2AABH 3U9PH 1UWEL 5I73C 5DFWH 3DHPA 1LO0H 1O7DE 1N59B 4CADB 2WSDA 4PRHA 4EUPB 2NLJB 2DJSA 3DUSA 3ML8A 4JO4H 1ID5I 3MRRA 4UT6L 4IKJA 4G6KL 4FA6A 3TU6A 3QFJD 4KAQL 4JFHD 4R8WH 5FM5O 4HS6A 2AK1H 4JCWA 3RWCA 4RIRA 1D2OA 4OKVB 4XPBH 3L4CA 3P0VH 5GGVH 4RA3A 3TZVC 2TRHA 3T4AA 1PDKB 4WW2F 4OUUB 4U6HA 2HTKC 2GTQA 3TCXA 5F7FA 2WNKA 4HUXA 4L8SA 4XNUL 4Q0XL 5IHBA 3UPRB 3QCTH 3U7YL 3CFBB 1AFVH 4GLRH 3KYKL 5IF0B 3IJEA 1ZLUH 3UTTA 3VMOA 5CBEB 1RVFL 4PTTB 5EU3A 4B9IA 4F37K 2YD5A 1DVXA 4ZMYA 2XLLA 4LSTL 1EX0A 1BVNP 1NDMA 3CVIH 2BDNH 4OZGF 2H5UA 1YEKL 5LCVH 2EH8L 2IDFA 5D6CA 5C8JA 4JN1L 4HHAB 2IV9A 1UC6A 2MQ3A 4M7ZC 4NQQA 2AJUH 5KAQF 1B6DA 1TJMA 2FO1A 2CE6A 5A2CA 4F7EB 3STZA 1AZRA 1SXAA 2BSBA 1MCBA 4ZTPH 3F85A 4WNSA 3EOAB 4JFFD 5EOTB 5AAWC 2GI7A 1SLWA 5ICYB 1FE8H 2WAHA 1PQZA 3L4WA 4M1DL 5HI4C 2K8MA 3GHEL 3CHSA 5E9AA 4WWOA 1OSZB 1XB8A 2AITA 3AREA 3OMZA 4ZFGL 4YO0A 3I2CH 1UXSB 3QUML 1TZIA 3SE6A 5GQBA 4KZCA 5TDPA 5FYJL 2ICWI 3F7RA 4QYOB 3FT2A 5AKVA 3OPZH 5FYLL 5DRWB 4EEEA 4OF5A 4AEIL 1UT9A 2Z34A 3C9NA 4LHUA 1XD0A 4WO4D 1P4BH 2F8VA 8FABB 3VYPA 2DEYX 4J3SA 4QXWA 1NM9A 3PABA 1XR9B 3MCG1 4ONFH 4NQTA 3S5LB 1C08A 1W15A 4LCWB 1RERA 2O5XH 3VXRD 5IVNA 2ZSVB 1IFHH 5F7AA 2QQLH 3ZYZA 4YDLB 5AD0A 4FTVE 2GY5A 4PJ6A 3LVTA 4Y2DD 5IT2L 2ZSWA 2FAUA 1L9OA 1YYMH 3QDGA 3MC0A 1J8KA 5KW9L 1GKEA 3QEQA 2CZNA 4YEEA 2FBRA 1G7IB 3AC0A 2XT1B 3GJEB 2N56A 2YSSB 2VAAB 4XBGB 3GJFB 1UA6H 2A74A 3DURB 1JZ4A 5EEYA 1MJ8L 5HGHA 2N1KA 2RR3A 4N0CC 1M7DB 1MY7A 3M6DA 2R9HC 4YLQT 3KCPA 3IGFA 4HULB 1K6QL 2PWEA 4OZGB 1PYWB 2QTVA 4G7SB 4MFHA 2HJLA 4FOMA 3MA9H 4DOHB 3HAEH 1QBMH 3VM7A 1IBFA 3HC2A 4X6DA 4KXBA 4R97B 4W6XB 3QDGB 4LLWA 4D0DB 2XWJB 2X4TB 3GMOB 3KM2A 3PGDA 1EHLH 4MXQD 1FYTB 1JCVA 3BPOC 3E8UL 3SD2A 3NSDA 4MAUL 2H1XA 2HN7A 1FYTD 2DQHL 3PWLA 3FT4B 3HPJA 1FVDA 2FYYB 3RJDA 1HINH 5HHME 4IRSB 1M7DA 4QTIH 3FN0L 1JZEA 1CDUA 2V33A 4YH6A 4JO5A 3VFGH 2GABA 5GS0D 5TDNB 3ECWA 3WGVB 4OCXH 2W0PA 3D1MC 2AKRB 3I3EA 2WN3A 1FGVH 5AW1B 5CAYB 1QSFA 4NFDA 4JRYE 5FDWA 4FNSA 5LN8A 4FQCH 4B41A 1CD9B 3LY6A 4WHYH 1OCRB 3O6KL 4FEIA 4GKLA 4U05A 4G2AA 3V95A 4KK5C 2O5ZH 5E9DD 4EZLA 3NZHH 3APDA 4MMXC 4P9HL 3WFDL 5GS1C 2E9BA 3N1GC 2W95A 2GG1A 4EDXA 4JQVA 3D2TA 1QFHA 1FZMB 3UBHA 3UC2A 1JGLL 2APVA 5DZPA 5E8DH 3N55A 4ELKA 3T0ED 1JZ2A 4C59B 1RUKH 4ODVH 1CLCA 1DLFH 1WPCA 4QRRB 4DVBA 1LE5B 4POZC 1F3RB 2NW2A 4QAMB 2BNQB 3AS0A 1KCVL 4HOMA 4IIQB 2I9LA 1J7VR 5C0AD 1QTYT 4JFED 2PPFA 4Y2DC 4M3JA 3SDDB 1AS7A 4IYKA 5E9DA 4BHUI 1QSVA 2XCMC 2Q8AL 1TSRA 3FTSA 1ML0A 3QK0A 4X4XA 2HX9A 4KH9A 3ULUL 1DBAH 3D18A 4MJIA 2E0PA 2PO6C 3W11D 4G8EB 3PAVA 4XP5L 4OI8A 5LUMA 2F68X 3L9RB 2KL6A 1E4WH 2WBXA 4M7JL 3C8KA 5CKAA 3WBDA 1JPEA 4Y5XC 3RVXD 3BD5A 5F7HA 4UM9D 1QKZH 1AE6L 2GJ6B 2Z1PA 1G1YA 4JK0D 2WNWA 2H47C 3G5XB 3SDXF 3KLHC 1G94A 4M56A 3SDDA 2NT0A 4NIYE 2HLAB 3ARSA 3PPSA 2BH0A 3JWOH 5DMIH 2TSAA 5B1JC 5FYLH 3L4TA 2N1TE 3BZFA 1GZPA 2BCKA 2Z4TA 2IC2A 2A9CA 1H6TA 3EJCA 1DEEA 5C0RH 1A64A 1AD9A 1I85C 3OHXC 3UYPB 5CCKH 1HJBC 2AW2A 4NAQA 4M1DH 3UADA 2WM0A 4BDVB 1FPTH 5T3ZL 5L2KD 1XV8A 2Q7AA 1NBVL 1NUGA 3AG1B 3L3HA 4MS8D 5MENE 1CLVA 2D3NA 1ZCRA 2O5YH 3AQYA 2QPDB 2HRGA 4K7PH 5E95B 5GRJH 1CFVL 5CEZL 1U95A 2G9KA 3PDDA 5BOZG 1LQSR 1YLBB 4HIEB 2SEBB 4X83A 4Y2DA 1D5MA 3HI5L 3PQYA 1AZUA 1DQLL 4LLDA 2MPAH 2EH8H 1MCHA 5E4EB 1KCRH 2BVUA 3VXNB 4ETYA 5B8CB 3MRJA 4YDKL 5C6TH 3WS3A 1NAKH 2JH2A 4UMSA 5INDB 1OE3A 1S9KC 2I26N 4JCMA 5LBSA 3ULSA 1JN6B 4QXGL 5IB3B 1V7NL 1XF1A 3KH4A 3S3BB 3A22A 3QQ3B 2H6PB 3QC6X 2G2NA 4MSWB 1TYRA 4DPCX 3KR3H 1QSZA 3B7TA 4KKNA 3MNWB 4LU5L 1VACB 4HK0A 3CBKB 4XN8A 4DESA 5LCVA 3K71B 2CHWA 4XN1A 4J3WA 3NZHL 2F7QA 2GSIA 3WHE0 4MJ5B 3F58L 4QEGA 2F15A 4B27A 1MAJA 1HDMA 3GF8A 1FZKA 3D4GA 3RPIA 3N0AA 3BUYB 4E9WA 5GGSY 1XF4A 1P1ZB 2C9SA 4FFZL 3PWPD 1X6NA 4M93C 4E5XB 2ODHA 2IVFC 3WY4A 1T0NB 2X3BA 2IPUG 5AVVB 3RVTD 4APXA 5CJXC 5TDOB 1CD8A 4J28A 3RIFK 5IB1A 2C1OB 5JLZB 3QRFM 3ILPB 4YE0A 3U2IA 3IXTB 3WTWA 1KLFA 2JJTC 3SPVA 4ZMQA 2V8MA 2XZAH 4M3KB 1IO4C 1ZDSA 3UBXA 3N85L 4XPHL 1R5WB 2BVTA 5DHDA 4AYDC 4JKWA 4LCWA 4ZMPA 5CEYA 4ENZA 1PLCA 3LZRA 2DQTH 3UTTD 4DFIA 4NZJA 5ALBL 4BZ1A 1BAGA 1T4KB 1E6JL 2A99A 2E6PA 5DGRA 5HJ3B 4X0NA 5KSUA 1FFNB 4P5RA 1FAIH 3G6AA 5F71A 4ZQKA 5TK4A 5L88L 1YECL 4G1EA 2XN9D 4J3XA 4PLJD 4Z5RB 1S3KL 2JJSC 4TUKH 3ZL2A 3BH9B 4JRYD 2NY4D 4H7VA 3B43A 5MEQA 3QUXB 2NY4B 2VRKA 3QQ4B 3MFFA 2X6AA 3ZW3A 1H3XA 5D5ME 1ZT4A 4N90D 4H2AA 5IFJA 4YBLC 1LK3H 1SUHA 2HVJB 5T3XL 2AJYH 2VSCA 4ALAH 4H8WH 2H2SC 2E6QA 4PVBA 4EI5D 5JO5B 4LESA 3QO1A 4RAVB 3JZYA 5DT1H 5JPMC 2E75C 3DBSA 3WFEH 4GO9A 1MELA 4JM4L 2XI9A 4OGQC 3VFOA 4JJHA 5KWYC 1QUNB 4YGVB 3NCXA 4GW5B 4OT1H 1JNJA 1WWAX 1UUNA 4FZ8L 1EHXA 4TKWA 1J1PH 5EO1A 2R2EB 5EIIG 1T5XA 1QI5A 2VN5A 5C09D 1KLGA 1VRSA 2C3GA 4Y9GA 1ZLVH 4OZHA 3CH1A 4G80A 1ED3A 2E4FA 2WJ5A 1HEHC 4IRZH 5KBNC 1JWSB 3P11H 4IRSA 1WLHA 4KJPC 3ZKQD 1FIEA 3V4VB 1CFNB 3IDYB 3VVVA 3RX7A 1L7IL 4S1SH 3EJYC 3HHRB 4PHXA 4EIBA 3SN6N 3WYRA 4QKTA 5DA4A 1THAA 3IFNL 4KJYA 3SPHA 4OGXH 1QO3A 43C9A 5AVQB 2VDOL 4NEHB 5DC4B 4XP6H 1T66C 1NQBA 3MUHL 5FKAA 4FMKA 2BP3A 3ECVA 3MREA 2ZOLB 3VWKB 1MQKL 3Q05A 1WD9A 2G4EA 2VZOA 5JIDA 4LSSL 3GRWA 4GLRI 4PCYA 2LAGB 3FUJA 4BCYA 4NGHH 3HZMB 1F3JA 4QIRA 2XTJE 3QO0B 4HX1B 4KJQD 4G9FB 3RKPA 3O4LD 3U0WL 3VRLF 5F6HJ 5KSBB 1IGFH 3EO1A 1XH2A 5CHNA 2K4WA 3HZYB 1MHPL 5C0EA 3SPCA 1REIA 4HIHA 5FX3A 1BMGA 4M02A 1U8MA 2KLRA 1DJHA 5HDQL 5BZWB 3VH8A 3T8XB 1HX0A 2WO4A 2YHGA 5KYWB 4LLVB 3ZHFA 1FNEB 4BH8A 3RZCD 1BEYL 2LTQC 4HYTB 4PY7B 4APXB 4R4FL 3UO1L 2VLKB 1XCQB 4FI6A 5CP3A 2JLLA 1BDYA 3E8VA 1IGCL 4PW4A 5C1MB 3UAFA 5MEND 4L1LA 5KSVB 1F3JB 1HHKB 4GT7A 3ZL4H 3HZVB 1NSNH 2IGLA 1EFQA 4MAYC 2EDLA 4KV5E 5DZLA 3UZEC 3WE6A 2IBZY 4P3CL 3L9RA 3FULA 1R0AH 1KIQB 1AJ7L 1KFAH 3Q8AA 3N04A 4XGZA 3LPOA 3QWQB 1KCLA 4QYOA 1HIMH 4DP1X 1S9XB 5DHVH 3O0RH 3DO7B 1UASA 4N2HA 5IIEB 3MXVH 3X14B 1DSYA 1EEQA 3QDJD 3ZKMD 2R27A 2F18A 5FUOH 5LVEA 1MEXH 2W0FA 2SODB 4R90H 3QYMA 3IU3A 4AQ8A 2YARA 2G75A 4CNIB 5I19L 2BCKB 3LQAC 3LPFA 4XBMA 4A2DA 1V3JA 4JRXB 2XYCA 2BVQA 1KN2L 1Z9LA 1G9NC 5EZLB 4Q97A 2F19H 1VADB 2DQ6A 3EGXB 3FBQA 3VFOB 2B1OA 1HEZA 2VDKL 1RIUH 1ETA1 4H8HA 3P4OB 3PUCA 3RTQD 1J18A 1SHWA 2D9QB 2DQEH 4MYWB 4NKIL 3V4UH 3NP4A 3QORD 4HT1L 1DQIA 4I2XB 3QORB 2M1KA 3KPLA 3P0YH 2Y4SA 4JNXA 3EJSA 3HG1A 4F24A 1QD0A 4AH2B 3SE9H 3OB8A 1SXBA 4HT1H 2VL5B 4BKTC 2SEBA 1AP2A 3PWJA 3E9UA 5K9KB 5JHLL 3SKMB 1JF6A 5LJYH 4XOEA 3ESOA 3V6ZA 5GGRA 3MROA 4NQCE 4QTHA 5MEOA 4L3EA 4HLZH 4Z8FH 5K59F 3MGOA 3WKQA 2R51A 4YHNB 1HU8A 4UAOC 2E59A 2H3NB 1T6BX 3RG1C 1N6VA 4AJYV 3ZYIA 5CCGE 1ZPLA 1CDIA 4R90L 1D5RA 4FG4A 4HUUB 1QSFE 5TTRA 5IEHA 1G7JA 2BINA 3T09A 3VD0A 4YEFA 2BY2A 2D7TH 4AH2A 2OSLA 4NZRL 3QPXH 1JJUA 4IRJB 4RRPM 3SDCB 2PXYC 2ADYA 2WD0A 2DBLL 2AZAA 1F11A 1KENL 1QEXA 2FATH 3WJLC 2QVMA 4EZMA 3EDJA 5F6HI 1R1CA 2NXYD 1ICTA 2D7OA 5IJBC 3FU6A 4ZPTB 3L3OC 3PXHA 3BRGC 1FF5A 2XTJD 2R9HD 2CRYA 4Z3IA 4GBXD 4WRLA 2D0GA 4Y0GA 4LCIH 2PR9A 3WFCH 3FT3A 1ND0A 3K4DA 4AW7A 5TGBA 5C0IA 5C0GA 3FB8B 3ISWA 4XNQA 2ITCA 5T5FL 3SE8H 3LN4A 3WN5A 1XQ4A 5DR5L 1LVEA 4QTFA 1MW3A 5JZ7C 4L4TA 1I3VA 5BXFA 4XB8A 4Y19D 3IF1A 3ZDYE 4D8PA 4X80H 4WI2A 4HF5L 2DYPD 2A4ZA 4XC1L 1Q9LA 2I5YH 5E1GA 3K8MA 4ZS7L 43CAB 3VG0L 1QX1A 3CDZB 3IWUA 3PS6A 1MF2H 4F9PA 3QG7H 3BPCA 3HE6D 2XETA 2IWEA 4RMBA 4F27A 1ZHBB 2DEWX 1J9QA 3DK0A 3IFOB 4N26A 3IJ7A 5GRVK 1CZ8L 5D7KE 4IQHA 4GAJH 4ZMZA 1Y1DA 1KT2A 3GWJA 1YEHL 1AGCB 1YHPA 5IHUH 2GK0B 4HFWB 4NHUB 1PYWA 4M7ZB 2BOLA 5ALBH 4KO6A 3S35H 4XNZB 4R7NA 3TNNA 4AV5A 4J3UA 1WE5A 2Z31D 2CO7B 2WLMA 2Y06H 5CGMA 2QBWA 5DZVA 2VZVA 2Q7YB 3K8LA 2VQ1B 2XWJA 3GMOA 1EHKB 1R46A 2WINB 1SLVA 1THCA 2GJZB 3CG8A 1N9PA 1CXKA 2AQQA 2QFRA 5FDYA 3DDFA 4WHTA 2OXGB 4OH2A 5CD3B 3T9WA 5CR8A 3KHOA 2EVGA 4A1RA 3MRNB 4OJFL 3MJ6A 2VDPB 4HXBH 4WKXA 5LQBH 4PJ7B 5FUZH 1I31A 2XY1A 2XN9E 4F7CB 1Z5LB 3GSQA 1EHAA 4F15C 3GBDA 4KMTH 1OKEA 3FF8A 1M1SA 5EC2B 4E9VA 1KXVC 1JWUA 2X9WA 3GBMH 4ABQA 3IEAA 2VR3A 3ZO0A 1DBAL 2R2BA 4MMZC 5DZAA 4P5TB 3UAJA 1D7BA 3MRDA 3HNSL 2NSMA 1B2WL 2OQJA 3TXAA 3D0LA 5AZEL 1QHOA 1IL1B 5ID1B 2P3YA 1IVTA 4X4YB 5F7NC 4KJWC 1WZMA 2W07B 4XOBA 5A2AA 3VCLA 1FNGA 4FTVA 4H8WL 5FF6B 4PRIE 4AG4H 5IB4B 4U49A 5E2VL 1QSEB 4AQ8C 1JGDB 3WEMA 4EIZC 4PJAE 2C4FT 4OCNC 1QYGH 1IEBA 1O7SA 4P99A 5A40E 2ZKXA 1GS7A 2NW2B 1E5YA 1E9OB 5BZWA 3TCLA 2FD6L 3VH8B 2R2BB 3QZBA 5KVGH 4PJCA 5BQ7B 1INQB 2BVYA 3FUHA 4QO1B 3EXJA 1TQWA 2YQGA 1KB5H 5IBLC 4APQA 2QQNH 2OZ4L 1P7QD 5I1JL 4IRSD 3X3FL 4RRPA 5ICZA 1MREL 2GFBB 2QZQA 4Q74A 4R4ND 4K3JL 4LRIC 2B4CC 2ZYIA 2BP5M 1NMAH 3CZFA 1JRHL 2UV3A 2GITA 1I82A 4QRPA 4X4ME 5CJ5A 4NOFA 5E6RB 3W9EB 1A7NH 2LLNA 3G04A 3OXSA 4OBRA 1O5PA 1WGOA 4Y9BA 2XPGA 3TYFA 2QADD 3MJ9H 2QSCL 5TJWK 1EXUA 4FCAA 2ZAIA 3JWOL 4AZ8A 2J88H 5HGAB 3RDTC 3LVEA 4UTCA 4OFDA 2GFBA 2R2HA 3MQIA 3RDTD 1KMGA 1PG7W 3B83A 2XWTA 3EGSA 4G72B 3ESPA 1TJGL 3B2UC 3AFLA 5EV7A 4RFOH 2HZHA 4L1HA 3RWFA 5I6XC 2I9TA 3ENEA 5H2BA 5J3HC 1UCBL 4MCZB 4R2GB 3NCEB 5AWNL 5A43C 4NLHA 1J8HB 2OW7A 3IDGB 3CTTA 4YBHA 2W0KA 1PG7L 2B4CL 1BYOA 3OVUB 3PGCB 3SIKA 4XNXL 4QT5B 4GO8A 3KPMB 1N8OE 1NPNA 2H26A 2HT3D 4DHLA 3QIWC 4E41D 4K3JH 1YEGL 1UADC 3STLA 2CDGB 2FWLB 3QJUB 4IDJL 1OAUH 4ZOCA 5B1AB 5CF3A 1M4KA 5KYUB 4XP9L 2D7PA 4LDEB 1N26A 3C87A 3PWNB 4HJUA 5HGBB 3FSOA 1A9EA 3ZDXB 5FGCB 3G6JA 4NCC2 4NQEE 4QYAA 1QNZH 1HNGA 5IM7B 3NCMA 3ROOB 2B16A 3C5SA 4HH8A 3BN9C 2WYIA 4OJAA 2LU3A 3T1FA 3G6JE 3D0LB 3KXFD 2CNZA 1IMHC 5H4ZA 3HFML 4IMKA 2R0LH 1F6AB 1HCYA 1JRHH 3OPZL 1IAOA 4HMCA 5C0AE 4ZRGA 3SDYL 3QIUC 4ZXBA 5IEHB 1JHTB 2VLJD 1VCBC 3PP3K 4AKPA 2Z65C 3WEXB 3NZSA 4LAJH 2EIZB 5IG7B 2R8SL 1BA9A 2XV2A 3CFDB 4NZTH 3GQFA 3GXFA 4YK4C 4E9SA 3QWNA 3Q6FB 4FERA 1DVFC 1MIMH 2ZWNA 1P1ZA 3BFOA 1A7BA 1KPVB 3RBGA 4BE6A 4POZD 4LE8A 1U2CA 1ZHKB 5E1HB 3DUUA 4RAUA 2BNQE 1XL6A 2FJUB 1EAJA 5LGKA 2NNAA 4APQB 4KMLB 2WSKA 4LZKA 2R1YA 3M8OH 1I7UA 4APQD 1R6VA 3L7EB 4XCCL 5DMYA 2YD2A 2RFXA 3RWDB 5E2TH 4G7YH 5ICXB 3VD2A 4JO3L 4HP5A 4I13B 4L1TA 5D9SA 1YN6B 4XCYA 4C4KT 3WO4C 5C97A 4JFQB 2YGQA 3IFLL 2B9AA 4XXDB 4LDCA 4NQDA 1UXSA 2E47A 1BZ9B 1ZGLA 5GGQH 4UT9A 3SE3C 4YS4A 1N18A 3MPCA 3BQUD 2HWZL 3EOTL 2J8UE 4ONGL 3CN3A 4HKBB 4W9KC 3UBFA 3B9KA 2PWDA 1WC7B 3IDJA 5I26A 4QXVA 2WXHA 2ZNWA 3VGAC 1A1OA 4YSDA 3X17A 4H8PA 2VXUL 4JO4L 5CU9A 2IQ9L 5IT2H 1TZGL 3HMWH 3D7PA 2K3TA 2G3ZA 1J9CT 3GDCA 4G43A 4I77H 1J8HA 3O3DB 4OJDH 3BPNB 2GJRA 3CHRA 3BRFA 2P8PA 1I8AA 4W4OC 3CX5J 4NPYA 5EBMB 1E67A 4NSKB 1X5ZA 4U1MB 4XNMB 5SWQA 2M2DA 2Z8SA 2GJZA 2XA8L 3RUGA 3CPLA 5DI8B 1I8MB 1MJJA 4W9ZA 4L8SB 3RVTC 1G9NL 1IGIL 3LN5A 1J5HA 4CVXB 4Z77B 1NCDL 5EIIB 3ISYA 3MV8D 4GAJL 1M7IB 1H3PH 4N8CH 4AEEA 1U21A 4PVLA 4KK9C 1OANA 2CKBA 1OAKL 3G08B 1A4KA 1H5BA 4MMXB 5FKPB 3VXPB 3LB6D 3H9SA 2J6EH 3X11A 1I3GH 4KHTH 4GEJA 4BZ2L 1D6EB 3VXSE 1GS6X 4UDTA 3CC5A 3QJFA 3EADA 4B3EA 3MA9L 3BW9B 1ZT7B 5F1IA 1R3LB 2Y5TA 2A9NH 4JAMB 3EDFA 3GM8A 5CEXA 5KSBA 3HPJB 5B38B 1TVBA 2E56A 4CVXA 2MOQA 4AL8L 2H8PB 1GCYA 1OP9A 2JCCA 1OF2B 1LL1A 1A4BA 1Q0XL 3HNTL 4YX2H 3WAJA 1OSYA 4ACTA 2Y36L 4H0HB 4HKJA 1B2WH 3VFVB 3V4PB 3RIKA 1OPGH 3KGRA 2QQLL 1KG0A 1XH3A 1KENH 5C09B 2UWEB 1G9HA 4PJAB 4Y7MA 1R34A 4PJIF 1ZWIB 4HEMA 1J1OL 1BQKA 1NBYB 1U93B 2EXSA 5E4AA 4WHCA 3RGVC 3RVXC 3UCRA 4DEPC 4JANA 2W65A 1UFUA 1UACL 3QZOA 1LTXA 5C3TA 3B5TA 3VXME 1VGEH 3WHE1 3REWB 3SQBA 4PUBL 2OYPA 2OSLB 1I7TB 1EAQA 2V8LA 2FLMA 4QF1A 1QWHA 3U30C 1R0AL 3SKJH 5AUMA 3TIEA 1PSKH 4HV8B 1IGML 3I6LD 3UROR 4B95C 1FN4A 5FECB 1D5ZB 4N2DA 1K5NA 2FUTA 2VJ0A 4X7EC 3TVMC 3CX5K 3P3UA 4GUCA 1SN0A 4MNGE 3RGVA 3BVTA 3GSXB 2BSDA 3BSGA 2KDGA 3GIVB 4R7VA 2ATAA 4EQ2A 1PEZA 2X5PA 4FP8H 2ZX6A 2UUDK 1Q0EA 4LCUA 5E5MA 2DMGA 3AQZA 3GI9L 1MUJB 2Y3NA 1N67A 3FFCA 1SF5A 5SWZD 3KPSA 1A21A 2K6ZA 3QRGH 4CSTA 3KJ4B 1E42A 1M9SA 3QEGL 4PGDB 1LWRA 2DWDA 4GMSL 3NOIA 1ODAA 1YMHA 3LOWA 5I24A 4JR9L 3S34L 4FLHA 4NPYB 1WBXA 2ICWB 5AW7B 2NPLX 3BN3B 3U1PA 4ZW3A 3QHTC 2IPTH 3FT2B 4TVPE 5DYOB 2B1AL 1U3HC 1DBBH 4QAWA 3VI3F 2FJFB 4JFZH 4YXLH 2VLKE 2ZCKH 3GIVA 5T5FH 1RQ5A 1IM9A 2HN7B 4EJ1C 2BS9A 1CYGA 3I02A 1OZTG 1P7KA 1Z9SA 3RTQA 3T6XA 4JFZL 4ILDA 1MQKH 3UABA 4HKXA 3ZBMA 4JZJB 4KZDH 3LXUX 1Z2KA 5DK2B 1IGMH 3BPNC 4LCIL 4ODUA 3ZE2B 2NYYD 3ZU8A 3G08A 1IZKA 4PJBA 3UJJL 5F89A 1RXLA 4UF7C 5J56B 4OGYL 3ZGHA 4HWEH 3M07A 2GCYB 3MUGA 3IDMB 5D7LA 2X4OB 5H8DA 1GC1C 1NAMA 3QRLA 4FNQA 4AVKA 4NKOA 1CLYH 4M62H 3VFNB 5F6IC 1MCPL 1T80A 2EIKB 3ABGA 3EGDB 2MKLC 4HIPA 2LU5A 4KTEL 5F7EH 5IROD 1GW0A 4JDEB 1EQWA 1DJWA 5CN1A 2P8MA 4QRRA 1ITBB 3BUQA 4MDJA 2VDOH 4HKJB 1KTJA 2IAMA 4OD1L 1KCUL 2VGLM 4AQ1B 1QQDB 1R3JA 1TDQA 2IADB 2IXQA 2VC2H 3CFJB 3DPDA 3UOAB 1RAMA 3GMPA 2K4AA 4ADIA 2ZKHH 2V7NB 4PRNB 1LLAA 3T2QA 1GGIL 1BXVA 4YHYB 1MPAL 2HA1A 1PIFA 4DKFL 1UVQB 1IVLA 1JHLH 3QNYA 1E3FA 4BSWB 5J6HB 3G5VA 2FEDC 1M2VA 1I7ZB 3DRQB 5PCYA 1CLOH 1UOWA 4CW1A 3QUMB 2Z0UA 1KCSH 1BM3H 1T22A 4N20A 3QEHA 4WUUE 1Q9LB 1ADQL 2EDMA 2ZPKL 4H26A 4CJ1A 3WLWD 3MLRL 4N2IA 5FDWB 4C4BA 4HMDA 5AALA 4Y5VB 2YPKA 1T89A 3N44B 1IGIH 4UIMA 1YEEL 3DLQR 4MA3B 4N28A 3I9PA 1L9QA 1XIWB 1AYRA 5ALCL 1PX3A 5SX4I 1YRKA 5JR1H 1AY1H 1XIWD 2PWFA 5ESAA 2EXYC 1GGUA 1N6UA 2P28B 1JP5A 1MWAL 4J12A 4KRPC 4NLAA 5DVKA 3KPSB 3U2SB 3O45A 1HAUA 3BUTA 4O51A 1OD7A 4NWUL 2WXJA 4R7NB 3TNNB 1A1MA 3WUWA 3S5LG 4QHLA 4W6YB 2QLYA 5AVSB 4QGYA 3Q01A 1OSZA 3IYLW 1S8DB 1B90A 3QNFA 4KVNH 4B7IA 1T1WA 2XKNA 3O0RL 1ULVA 4OCSH 4P4KD 3QJTB 3BKCL 4ZD3L 1NJ9B 1S7SB 3HNTH 5D1ZD 1MXDA 2CALA 4P4KB 4UNUA 4JE4B 5EWIL 4E68A 1SOSA 1TMQA 3MLTA 2QV4A 3MRIB 3O41B 4QHMB 3ZL4L 2HFEB 4JFYB 3V0WL 1XIWA 2VMJA 1LK3L 1QLEH 3EFFB 4XPAL 1NICA 1P6AB 3WHXA 4DTGH 1GY2A 4YJZL 3C60C 4G8FB 2MPAL 5BV7H 3FAXA 3ARQA 4BSJA 3S8GB 3TWCH 2X6MA 4OVUA 4LLDB 1MCOH 1A1MB 2XN0A 5LLIC 3OD3A 5F89B 5GS2H 5L4JA 2NLJA 1A3LL 3PNRB 1TENA 5E4EC 2Y0SA 4K7FA 5TF0A 3TX4A 4ORGB 3I6SA 1GYUA 5LDSA 3QEGH 1KZQA 1EV2E 3HAEG 2VSDA 3DV6B 2X0UA 3AUVA 3PJLA 4JQVC 2H32A 3QQ3A 2W9DL 4B6ZA 1OGAD 5FYJE 2ERJC 3KL5A 4OUUA 2NQ3A 2CDEB 5SWZA 2OMNA 4P3WA 1FH5H 3KLAA 3IJ9A 5JXEA 5I0WA 1EFXD 3ZHNA 1VF5C 3MBXL 3RIAK 2BZ7A 4J6IA 3MOQA 4IJTA 4HS8H 3QXUA 1YDPA 3GMNA 2IAMB 2B3RA 2ZXAA 1QOKA 1F6FB 3CXFA 2WSPA 5J7CC 2IAMD 3MLUH 4JHUA 4PRBA 1BD2E 1X5MA 2VR4A 3CSPA 1L7IH 1YY9D 2AJZA 5AW4B 4Z0XB 2VQTA 4O02H 2WANA 5IB1B 3DX2A 2BFVL 4OGXL 1BG9A 5I82A 3F58H 3L7FB 1U8HB 5GRJL 5IKCA 3NSJA 4PB0L 3V4VL 1IAIH 5E2UH 1CPUA 5JXAH 4P9MH 1T7XA 5FA4A 1Y18B 4F80A 3NFNA 1TPXC 5BVPH 1A14H 2HFFB 2P24A 1MI5D 1RULL 1W0VA 4RZCB 5CM1A 5EU6D 1NCWH 3GHBH 1LO3H 3N41F 2QVIA 3OXSB 2X3CA 1X44A 4U3CA 1MRDL 1QHPA 5DJ2A 5AW6B 1BXUA 3R8BB 4HAKA 1TQCB 1FN4B 4XE5B 3LKPA 5DO8A 3KWXA 4BWWA 2YPVA 4KUZH 2JIXA 1ASQA 4NT6B 5KUMA 4KZ0A 2NW3A 4X9YA 2CJTA 4KZEL 3JV5A 3VFUB 4JL1A 3SYCA 1MW1A 1B0IA 3K2MC 3SJVB 3BKJL 1OAXH 1OGSA 4W4NA 1A6AA 1A4CA 2GJ6E 2WLIA 2JCCF 3MTRA 5BV7B 4YHIB 2ENQA 4S1DD 4B0MB 2BSRA 1QABA 1DSFL 2KHAA 4G9DA 1UD5A 3NJGA 3PYCA 4KKBD 4MB1A 3GJFH 5IEKB 1BGXL 4LSPL 3ULAB 3EJQA 4QOKA 1JE6A 4DVBB 3WTXA 4N8CL 2MTPA 5DO2C 2VN7A 3IDNB 4NZTL 2V9TA 1F0LA 4GIPD 1E43A 4Z3TA 1GR7A 4P9HH 2ZCLL 1FH2A 3MYZA 5E2JA 3ZKND 4MAZA 4PH8A 5K33A 4Z0BL 1LE9B 3J27A 4FG0A 4IBYA 3BVXA 3TOPA 3QYCA 1WZ1L 1AR1C 2BSTA 2X9YA 3VFPB 1RJCA 3VFMA 2AQ1A 5DK2A 4G5ZH 2BC4B 5HHXH 1LEGA 2MOVA 4I1PA 2DH3A 3FZUD 4JHAH 3NRQA 5GIRB 3LEVL 2FL5A 3RUGF 1E4XH 1KYUA 4ONHA 4ZZFA 5JA8B 1WFUA 5KN5B 4PU2A 1H8LA 3DTUB 3QHZH 1EXHA 3UTQA 2IPUK 3X12A 3B9AA 1ETB1 3TL5A 2BNRE 5JIHA 1MJJB 2VXUH 3FUDA 3QXDB 1GC1H 3PWLB 1WIPA 2CD0A 4NWTL 3AM8C 3ZUNC 3ZDZF 1TZOA 4ZTOL 2B59B 3D85D 2ED8A 3HB3B 4JDEA 2Q86A 2ZTBA 4Y1AA 4AK1A 1NFDB 2XZCL 1RZKL 2JJWA 2UY7A 4MA8H 4YXKH 4EN3C 1E5AA 1C12B 4HEPA 1AH1A 1AGDA 3IRCA 4P23B 2B9BA 1X5GA 2VMDA 4EN3D 1RLBA 1R9FA 1P5VA 3D8MA 3IJSB 4PJ8B 5EU7C 1U9KA 3H9HA 1VLXA 2F54B 4N6QA 4NNYA 4UZUA 1NCOA 5H94B 1DVSA 4DKTA 1T1ZB 2KZWA 5B3SB 5TQ0L 4E9LA 1BQLH 3PP4H 2YMXL 2YSSA 4MBOA 3TZVA 3UPRA 1MCWW 4UUJB 1G7JB 2FIRT 1UENA 3AS3A 4KI5E 3PWVB 4FQ1H 4DP6X 2KZBA 5JHAA 1M71A 3LNEA 2JCCB 3GRGA 3GGWB 4CN4A 3B2XA 1TU2B 3CXHJ 4NC1C 5LGJB 1QRKA 5D5MA 2NY6B 3NSYA 2X28A 3VXNA 4H26B 5C0DB 2O5XL 2WUBL 4WK0B 1INDL 4P2RA 3WS3B 3BIKB 1NUFA 5DRNB 3WTTA 2HT2C 2I9LB 4M7KH 4YFLF 4IMKC 3GMLA 3TBVA 2VDRB 4NUPA 1EVTC 3ZE1F 3K8KA 1KXTA 1QLRA 2AQ2A 4KI5C 4A04A 3HE7A 5EORL 1UWGH 4AY0A 5ECGA 3MXWH 5GRUH 4B50A 4Z7QE 3CXHK 3QP3A 1E4KA 1E5BA 4B3VA 3FFOA 4YSUA 5AG8A 1SJXA 3IETA 2NY7H 2QQKL 1XHHA 1PJWA 2FIKA 2DI9A 3MLSL 1TZIB 4WJG3 1NFIB 2OXHB 3CFKB 3FQNB 3P4OA 3VSUA 1XO8A 4BH8B 5IJDC 1TYEB 1DVZA 5DHXB 4G6FD 2KC0A 1BYPA 5KSAB 5BMFH 2WHVA 2YBRB 1JPGA 1QNZL 3GSXA 1GH7A 3H9YA 4ZTPL 4NBXB 4FQLL 2WBKA 2FHBA 3GSRB 5E2VH 2EO1A 3RWJB 5JLZA 1QW8A 1S7UA 1ACYH 2FJHB 4AMWA 1OCCB 2JKNA 5T3ZD 2LQRA 4LDLB 3SCMB 1P53A 4XMLH 4LO9A 3I84A 3SGEI 2GK0A 4NHUA 2V9UA 2R0LL 2Q6WB 4C56A 3C09C 2WKOA 4XNDA 4I5BB 1JZ7A 2DMKA 5GGRB 1PFCA 3SBQA 3UAAA 3BEWB 3BKMH 2BOCB 5D7IB 4XGZB 3IJYB 3OZ9L 1UGNA 3UIZA 3ZLQC 3FOMB 4WO4B 5DMGD 5L4IA 2AEQL 4M1CD 3EOBA 1U3NA 4OF8A 1ODUA 4J4PD 1QPKA 1UA3A 2VR7A 3BP6A 4MQXC 2YMOA 1UURA 1P7KB 1Z9SB 4UOJA 5D7LE 1F97A 2Y23A 4KZEH 4NDMA 1BYNA 3F3HA 4ZFOA 2X53A 3B6SA 3WFDH 3EFDH 5GGSB 2UY7B 4ODUB 3UJIL 3ZVVA 1L5GB 4RWYH 1E4XL 2A6KB 4JZJC 1UEMA 3O3AA 4UV7H 4LCCC 4XO8A 4EUPA 1MVUB 1JZ5A 1DVUA 4IGBD 3K4ZA 4PB9H 4ETQA 3DETC 2FECL 2WZAA 3FOMA 2PN5A 3PFUA 4KRMB 4WO4A 3SKNA 2E7HA 1UZ8B 1XFPA 2WOBA 3FN0H 4GSUA 4IOIA 3LEYL 1UD8A 3VGHA 1NCBL 3DIDA 1RCYA 4WGWB 4C83A 2F7IA 1SEBA 3MRCB 3JZ7A 3S88L 4O02A 1JV5B 4HUVA 2VERN 3MOAH 1AP2B 3PWJB 2FD6H 2P8MB 2V7HB 4YDIL 3V0VA 5DD0H 3TEUA 2V17H 1OT2A 3FO9A 3QG7L 2EICA 4ECNA 4FQ2H 4KDVA 1YEGH 5C0BA 4UWQB 4CU7A 2ITDA 1QSFB 4XO9A 2QHRH 4QRFA 3QDAA 4KK9D 1BREA 2EYRB 5D6CB 2B4CH 5DR5H 3R06B 4HZAA 3P9WB 4LRNH 1WZ1H 5E5MB 2VW4A 3PXJA 3VFUA 4XNBA 2YXMA 2WO2B 4Y5XA 4HJJL 2NYYC 1Y6NR 3LIZH 4E41A 3ULVD 1USQA 4MAYA 1ZTXL 4OLWH 4NB7A 4OFYD 4ERSL 4U3SA 4QHNA 5T1KA 4AIXA 5MEPA 5C08D 3EYUH 1AS8A 4KDTA 2CLZA 4PM1A 4FYTA 2C8NA 3WY2A 3KW7A 4XO3A 2G2RB 1CDCA 3VB8A 4ZSOA 4KV5F 4UZGA 3H42H 1A65A 2EXTA 3VGFA 5JW4N 3DIFA 4U0RC 4A2HA 4Y19A 2J6WA 1SBBA 3BSHA 3IU4L 2RCSH 4LBAA 4MVBD 3TBWA 5BW7A 3LKSB 2YRBA 4M7LL 2GT9B 2H7WA 3RB5A 3AGWA 3C5JA 3PV7A 4HAFA 1IKNA 5I6XB 1OWRM 4HK0B 2CGRH 5ANMA 1XB3A 3BAYA 3O3EA 4ENEC 3GINA 4U4IA 1HN1A 5I76B 2D0FA 1A1NA 2F5BL 4CJ0A 3DJ9A 1BBJB 1HKFA 3FXIC 4YZWA 2D7NA 4XVUD 2H26B 5IJKC 1TR7A 1T66D 3DOHA 5DJ6A 4PCKA 2VZ3A 3GPEA 1VKXB 1KBWA 4OZIA 4F9PC 5AZUA 4A6YB 1ET5A 1NANH 1T0PB 3FQ1A 3SPVB 1W8NA 1A3QA 3A67H 4KKLC 1C8QA 2B59A 1JK8A 1KPRB 4FNTA 1R47A 2BDNL 4RA0C 4J3BA 3H56A 4EI5C 3IFPB 1OM9A 1A3LH 3QXTA 4LGRB 3U25A 3G5YB 4E9TA 1KN2H 3V0GA 1CL7I 3FO2B 2AXFB 3H7BB 3TBTA 3L95A 3DO4A 3OGCA 4ACPA 4ISVB 4XZUB 4K7PY 4WWNA 2H1PH 2Y7OA 4L3CA 4L0PB 3CDFA 2AQ3A 2E9JA 1G7PA 1DBBL 1QMUA 3GS7A 2WAQA 3GSUA 5EO9B 1E2ZA 3QJOA 2J8HA 3HG1D 4ZXBB 5J6HA 1FH5L 1I1FB 4FHKA 4XHJC 5MERB 3HG1B 5FPIA 1E28A 4FA8A 4UTBA 1XCWA 5K9OB 1QP1A 1IAIL 3I9AA 3AXIA 3A6BL 3I9IA 3P73B 4XI5D 2G5BB 1LO2H 3FCBA 3FU5A 5HHNB 1Z5HA 4S1SL 4HUMB 3V0EA 5J1SC 3ZZLA 5D7IE 4JDVA 2GSMB 4N0FA 4G8IA 1AXTL 1M05B 1ZVSB 2VSKB 1IGYA 4QRQA 4X9HA 5JMOC 2IANB 1IBGH 1KGIA 3VI3B 1HCZA 4LSSH 4HS8L 3Q8FA 4YHPB 1RZJC 4ZMVA 3NFNB 5DFVC 4A2EA 3OTTA 5EF3A 3FTUA 3EOYG 3E3QE 2VDNH 3D50A 1OP5H 4GAAA 3LZPA 3MR9B 4N90E 5DEGA 2FIKB 1YEIL 2DI7A 4ALAL 1J11A 4EE2A 1AXSA 5AB2A 5DRZB 1W9XA 3V0AC 3LYRA 4WJKB 1KJ3L 1L0PA 3BE1L 3P9MA 1G0DA 2W80C 5I23A 4G7RB 1JPGB 5TPWL 4WFEE 1PF3A 2WVVB 2I5YL 3BQUA 2JLPA 3VWJD 5F1KC 4HISA 3FO0L 4RGNC 3WN6A 4EAEA 1RJLB 5C08E 1UM5H 2X1QA 1TVDA 3UAJC 4LIQL 2R39A 3SOTA 4DP5X 4EI6A 4BFIA 3AREB 1VCAA 3KBFA 4F58H 4OLWL 3C5SB 5ITFB 2MCPH 1AIZA 4X6CA 4HGWA 5E00A 3TH2T 1A1NB 4KX7A 1CDHA 4LIQH 1FNEA 4DZBA 2KYIA 2XHNA 2BXZA 4DN4H 4FQPA 4M7LH 5I6MA 4MZ2A 3CPLB 2YBGA 5D2NC 4ZBJA 3VRJB 1QR4A 1IAKA 2Y72A 4YHLL 4YZFF 4JX0A 2MNWA 3LDBC 1MI5A 1R5VA 2AAAA 3UTZB 1W8OA 4GRLB 3TBCA 3FU3A 4MJ6A 3UTTE 5BRZE 3ABMB 4PLKD 2LOEA 2X4SA 3ZRSA 2FH8A 3MV9D 4E2OA 3ZQXA 1Q1PA 3RHWK 5DD5H 3GD1C 3OB0H 5F9DC 4G83A 3KLQA 1W0WB 3SQOH 4Q2ZB 1YN7B 3SKJL 4R5XA 3A21A 1QSEE 4LOFA 1UKQA 1S78D 4I9WE 1ORSB 3QEQB 2PTTB 4B53A 5A3IC 5LGYA 3QXDA 3ARBD 2R7EA 4PS8A 5FYKD 4JG1L 4HBCL 3IGUA 5A3ID 1S7XA 5KVGE 3QZPA 4V1DD 4F7CA 4KKQA 5E8OB 2B1AH 1IC5H 3DV4B 2ZP8A 4Z7OF 2IQ9H 2VDML 5AW9B 1PX4A 4JO8A 4I18C 5BW7C 3US1A 3IN2A 2P4AB 3F6IA 5DJ8A 5GGTH 2ITDB 1X9QA 2HH0H 2ENPA 4MB4A 2EZ0D 3ECUA 3EF4A 4X5XA 5I5JA 3DMMD 3FW6A 1O9ZA 2ROXA 3GRWH 2J2ZA 2JJVA 5I1GH 1NGZA 1IC4L 4GSQA 4PV9A 3HZMA 5HYJA 1S7VA 1QATA 2WTPA 2FYYA 3CLWA 3GYRA 3NA4A 5F7WC 4P5MB 3IGAB 1GGCL 4N9GA 1DVFB 3BZ4A 1H0DB 4XP6L 4GKSA 3MV7D 1RSYA 3C8HA 2N7AA 2VXSL 2X0VA 3Q2NA 1U8MB 1ZT1A 4R2GC 3QIWA 1KWGA 1VAHA 2GW5A 2XY2A 3RY4A 3WFZA 1WZLA 5B7FA 2PCFB 2FCBA 4LEXH 4M6NH 4PLOB 5DHVB 3RDTA 3MBWA 3BIKA 1T0NA 2Z64C 1E5UI 4LSDA 3W38A 4KTDL 4G9FD 4PIBA 2J73A 3ZMEA 5FM8A 1MG2C 4ELDA 3ARGC 2Q76A 4LLYA 2YAPA 2YGVA 2YC1A 2J20A 1MFBH 5EBLB 1HHIA 1SBSL 2A73B 3HG1E 2WB7A 3Q3GA 1S9VA 2NX5A 2X44D 4OLYL 3VD7A 3PLYA 5E56A 3TIDB 4AXWB 5IK3A 5ID0B 4FI8A 1CFTB 3RPBA 1JMZA 2VN3A 2DJ4A 2UZYA 2MCAA 1MCJA 1XGYH 2X1OA 3QDJE 5EA0L 5EZOH 5L4MA 1WS7A 1R24A 2XACC 4H1LG 5I1KL 1MG3C 3L3IA 3T3PB 1K72A 4EUPG 3U79A 3DURA 1TQCC 1SF3A 4G3YL 4HKXB 4OZIF 5I18L 5HSFA 5CBAA 2VLRB 2BHUA 3LKOA 2IALB 4YHYC 2E7LC 5E6UB 1JV2A 1WA0X 3FNKA 4G5AA 5IQ9B 4B0MM 4X9GA 4WUKH 4K71C 4KTYA 4FKEA 3EH3B 2UWEF 1YY9C 4D3CH 4YDJA 4EI5B 2AXFA 3H7BA 4IBWA 4HQQL 2H2PC 4KROD 3QG6A 2O5ZL 4AM0B 4XBPA 4HJTA 1ILSA 3QCUL 4ZO8A 2CJUH 3CFIC 5IBUG 3OF6A 3OR6A 3GZOA 3MV9E 3O6FD 3Q8EA 5CO1A 3SBWA 3QNXA 3OMIB 4PWFA 2QJDA 3DVNA 4WI8A 4U3HA 4K3DH 4EXPX 2BK8A 4JPSA 1B0RB 3UTSB 1S5IH 3ESMA 4L3EB 4P2RB 5SWSD 2V17L 4PVNA 2VUKA 3RA7H 4HUWA 3TT1H 4UTBH 2Q9OA 2D73A 2YD0A 1JGUL 1HQ4A 3EHBB 1RV6X 4TOYL 3TVMB 4Z7QB 3QJZA 1UZ8A 4IOIB 4PWHA 1PZUB 2YAQA 3DJRA 4IDJH 3DJZA 2AERT 3D85B 4GKZA 4N8UA 3LH2H 3VD5A 2PETA 5GRUL 5I9QC 2Y7NA 4FQCL 1CBJA 4AKOA 1J0KA 4PY8J 5ACLA 3UZQB 4IS6B 1SYSA 3O3BB 1ECZA 5IV2B 1NAKL 4A6YL 4WWKC 4PB9L 4XVSL 2LU4A 2NUPA 3VWKD 2X12A 1CICB 4OLXL 5DUJA 5T1JA 1G7MB 5DHEA 2C1PA 4KFZC 3AG3B 1JFHA 3D39E 1N7MH 2V5RA 1HSBA 1MOEA 2DQGL 4TQIA 4ZYKB 3UACA 5KYXB 1S3KH 1RUKL 1XCTA 4TUKL 4B5ZA 4E9RA 1HINL 2IG2H 5IBTL 1TJGH 4LKCB 4LSQL 3KJ6L 4LPVA 1NCTA 2JTYA 3HC4H 1KB5L 5M95B 3EH5B 5C0ND 2P42B 3FQWA 2DIEA 2VJXA 4MZ3A 4MAYB 4OF7A 2ZUYA 5F96L 4XCCH 1E7VA 2A7BA 3KJ6H 1BGXH 1O75A 4YR6B 3REWA 3SQBB 4NJ9L 4ONGH 3UX9B 4Z1PA 5I1HH 5C0CD 4ELMB 4XNXH 1SMOA 5CCKL 2JIXD 5ITBL 4A7VA 2FEEI 5L2KA 1MFDL 1II4E 3JVGC 4WEBH 4BFIB 8PAZA 3SQRA 1CFTA 5HHMB 2F5AL 3V6FB 5F3BA 1K5NB 1PZ3A 5KVEH 3A6CL 1PAMA 1LDPL 1PKOA 1UOVA 4IBLT 2FQGA 3KGTA 4RGMB 1RZFH 1RPKA 1BQRA 2JKRM 5IMKA 3FH5A 1X6LA 4DF9A 3L3KB 3PV6A 3V10A 1CDGA 1DJIA 4WKZA 4UANA 5D1QB 3NPSB 3C5JB 4KKZA 4MAUH 1MRDH 3MRHA 3AXLA 4HWBA 2LT9A 2N0KA 2OCFD 1DLHA 2DF3A 3GSNA 3RY6C 4KI5D 1P69B 1R3JB 4UIKH 5IM7A 4YPGA 4QMEA 1TOXA 1A7QH 1SDYA 4JKMA 4ONOA 4DSYA 4KU1A 1I1AB 4ZDHB 1JZ3A 2FLRT 3QUZA 2GKIA 4M6ML 4BH7A 4WLCA 2EDBA 1KPUB 4JRXD 4XCEB 2FE0A 1JTTA 4J3VA 1NCAL 2ZJSL 1PCSA 4KX8A 4AQEB 3MJ8A 4HQQH 4P3DB 4RNRB 1L0YA 3QIBB 4KX9A 5BUAA 1RLWA 4H1LH 2DRUA 2E9WA 2ED9A 2L7EA 3D25A 3AU1A 4CVZA 5DEJA 3X3GL 5KSAC 1M1XB 2GTWB 5D4IA 3ZHKA 4XNYH 3C8DA 3QEQE 5AYUH 4F1SA 3BGMB 3GSNH 3D69B 5KVMC 1T2XA 3QXWA 4U1IB 4YHKH 5CLYA 4FFTA 4ZT1A 1SVBA 1U8NA 1QYGL 4X6DB 4X8JA 4POYA 5I1EL 4Q58C 4OLVH 1EZSA 4BH7B 3QDHA 2NY7L 2QQKH 1Y1UA 1SQMA 3HCVB 3MLVL 5KOMC 3E80A 3TT3H 4L3CB 4XP9H 5IKCB 5FO2A 1J87A 2YGOA 5AVYB 4Z7AA 5JHDE 1IBHA 3PHAA 4JN1H 3BPLB 3ZY7A 4O51B 3BJLA 4PQXA 1ZLWK 3D25B 4G6AC 3BP5A 2ADFL 5D1XC 3UGUA 3UXFA 3VXQB 4CVZB 3WD5L 3WIIL 2CLZB 4IRJA 5D1ZA 1CB4A 2JE8A 2Q0ZX 3SDCA 4WTXA 1CL7L 4M9PA 3KVDD 4X7TA 1WF5A 2YO3A 2LV4A 5EU6A 4FQIL 3JUZA 5AWNH 4ZFGH 1W6LA 3L8QA 3HRZC 1CF8H 5HYSB 2RJMA 2V3EA 4ZZKA 4CKQA 1OF0A 1A25A 4JY4B 3OHXB 4NNPH 1G6VK 2WNXA 3H85A 3UBXB 4RRPG 1I7ZA 3VB9A 2X05A 5IW6B 3EOAA 3OMAB 5C07D 4UT6H 5IG7A 3D2UD 5IEKA 4PSPA 1MFMA 5D1ZB 3T0AA 2AZUA 3BC9A 1T4KA 4UDUB 5HJ3A 1NIEA 1HWGB 1EBPA 1U92B 4K3DL 1VA9A 2APFA 2XKUA 2W60A 2AJXH 4NSKA 2Y2YA 3MUUA 1IARB 3KPNA 3MOBL 4YDMA 1GKOA 4NUJB 3ALPA 3N1PC 3HS0C 4ZTOH 2WQWA 1Z7JA 3GSOA 4M4PA 1N5AB 3DPBA 1AQDA 5C0AA 1CD1A 1E0OB 3P02A 4YGAB 4YBQD 2NT1A 4X6DF 4IU2A 3MRLA 4KVNL 2W9DH 1N0XH 1GGTA 3NRPA 3TT1L 5KVGL 2WCGA 1EZUA 1LMIA 3FTGB 2EEFA 3ZE1E 1DDTA 1A7PL 2DW5A 3F7YA 5DS8B 5FFGA 3W2DH 5IFAL 3E6HA 3TA3B 2FSDA 5IVXF 2MCG1 1CDYA 4AM0Q 1ZGLB 2D3JA 2PP8A 4PGCA 2PYED 5IVOA 2A3TA 2PCXA 3CDCA 1HNFA 3N1MC 1U30A 3L3DA 4B9KC 5HJGA 4AQEA 2Z91B 3BN9D 2Y5TB 5CD3A 3HB3C 1KCWA 4FJYA 5FWRA 1HZLA 1BQUA 4A6YH 1YQVH 3POCA 3V5DA 4GMTH 2OYLA 1KJMB 2QVKA 2VLJA 4C58B 4MMYB 3F7PC 2GUOB 4Z8FL 1JGUH 3A4FA 4F33A 2JKIS 5DD5L 2VQ4A 5DC2A 3P77B 1BECA 1YG9A 1MJUL 3HUJF 1R17A 1A14L 2JI2A 3KLSA 2ARJB 1AC6A 2DTSA 5DHMC 5AAMA 1FYTA 1XT5A 2HVBA 3CZGA 3OKMA 4L37A 1JD9A 2ZE0A 5FA3A 5LAPA 2NY3D 3VGEA 4LEOB 2HB0A 2FX9L 2HKHL 4HKZB 4Q9RH 1JUFA 3U48A 3S8WA 4MKTA 1TNNA 1CXLA 4Z0BH 4DN4L 3MR9A 1XH0A 1BVLA 5DRZA 5D5MB 5F9AC 1NKRA 1TIUA 4JCLA 2YRZA 2OMVA 1QFUL 4PHZA 5KVFL 5ELIA 2E7CA 5FF6A 3QUMH 2Y2TA 1C16A 2NRDA 4QO1A 3K6NA 4M6OH 1CE1L 4FXLA 4FQQB 4UQ3A 2XC8A 2R23B 2AEIT 3BQVA 3BDXA 1FBIH 3VXRE 4LLUB 3MODH 1ZVHA 4L4VE 4I85A 1W0VB 5SWZE 3QAZC 4CGTA 2VDKH 3OJ2C 1I4FB 3EJTA 1BWWA 1A3RL 1W72A 3VXRA 3LKPB 2YFOA 4GS7B 4GW4A 4HOWA 1NSNL 2GVYA 3NJJA 2AVFA 4CVUA 1G7IA 2AV7A 5GJSH 3EBHA 2K7QA 1EGJA 1SZNA 3CAFA 3RWJA 1J0YA 5E8PA 2R23A 4X4XB 2R2HB 3MXVL 1IBGL 3DOSB 4FMFA 4XOAA 1OM3H 2J25A 3O6ML 4Z7WE 5C71A 4OZGA 2OX5A 1MFBL 2PABA 3MKGA 3KBEA 1CQKA 4TRPL 4UQCA 4Y2OA 4J2XA 1CJYA 3RBSA 1FVEB 3K7UA 3ZE1B 2ZT9C 2OMYB 5D7SL 4DAGH 1I1AA 1ZIBA 3UJJH 5SWQB 3O6LH 3SGJA 2GTZA 3LKQB 3U0WH 5CJOH 5F88A 1ZHBA 2J1KA 1FO0H 3IFOA 3KL3A 3KS0J 4JO2H 3SDXA 5BS0A 2HJFA 3SDAA 2PYFA 2JI3A 2DQMA 7FABH 1ZANL 4L8DB 5IHLB 1KT2B 1QACA 4XPFL 1M3IA 3SYQA 5B4MC 7TAAA 2PTVA 4PI2A 3ZDYF 1NL0H 1C08B 2HTLD 4C4UA 4DP7X 5LNGA 4WI6A 5D96C 3P3YA 4JZOB 1FL6B 5DJ8B 2OZNA 1YC7A 2A9NL 1HT6A 1JZFA 1U8NB 2E27H 3VG9C 3VTTA 4CKVX 1X4YA 3HN5A 1H15B 3WNNA 3OJVC 4KAQH 4R8WL 1WCBB 3FU7A 4G6ML 1V3LA 4IBZA 3ZZSA 3QFDA 5IMLA 2W1NA 3VG9B 2CSPA 3X1EA 1KWKA 3TURA 3QH3A 4PBXA 3O6MH 3KPTA 1SVZA 3QFJB 4TQHA 1CXHA 3KYAA 2Z1KA 1KYOJ 1UM6H 4LMQE 4Y4HC 1Z5LA 3GSQB 2WBWB 2YGPA 5A2FA 1YNLH 2C3HA 4XMVA 3IBOA 4CL7A 1VZIA 1ZLWH 1KTLB 2WVTA 1CFSB 1F58H 4GMTL 4W9FC 1CFQB 1YJDL 4OD1H 4G7VH 1WAAA 5DD3H 1PLBA 3E3QC 4GRLC 4ZPTA 4AK2A 2IMMA 4Y4FD 5K69A 5C7XH 3TVMA 2ZPKH 3ATDA 3ULSB 4UIMB 3R4RA 1PKQE 2UXGA 4NKOB 1Q8MA 1P0SE 4U6YA 5BRZA 2H6PA 3S37H 2BNUB 5GZND 2G3NA 4TQEL 4WFED 1D6VH 3FFDB 1EAPB 2VN6A 4JJ5A 3RLSA 3S5ZA 3WSQH 1KGUA 2CNYA 4P2AA 1IFRA 4QRSA 3STBA 4DW2L 4X4ZA 5DHYB 2GJ6D 4KXZH 2YD4A 2DIJA 2G60L 3RWEB 4Y5VC 3WJJA 2BPBA 1QFUH 4ERSH 1CYXA 1NMCB 3AB0B 4P57A 4JFVA 4Z7VF 1O5DT 3RHWF 4E42A 1W91A 3GRBA 1RIUL 3IJHB 3KR3L 4L29A 3GLAA 2PXYA 5K39A 1ACXA 3DMMC 2FSEB 7FABL 2BIHA 2J1WA 2EXYD 5E4OA 2R2CA 1NL0L 3AGVA 1C5BL 1GZQA 2AEWA 3QW9A 3WHXB 4BSVB 5EU6E 1PW3A 1UVQA 2XQYK 2C3WA 3TJEL 5FEBA 5CBAB 4HCGA 4GRMB 3P9LB 4WW2B 1M2VB 3DRQA 4NN7B 3BP4A 5E6SB 5GJTL 1DZ0A 2EEXA 1AZNA 2DM3A 3KDMB 3UYRH 4YWGL 1IIIA 1L9RA 1KJ3H 3BE1H 3ETBJ 5AKSA 5L2KB 3HMWL 3FT0A 4G43B 5TPWH 4EVNA 3G6JF 5E2TL 3WELA 2P8PB 3EYSL 4KJPD 4BZ1H 4ZK8A 3FQRB 5I74B 3PE9A 3OMNB 4XVJH 4MLIA 1IKFL 3EHBC 5ADOL 2ITFA 3BAEH 2PXYB 3P11L 1WO2A 4KOCA 1XGUA 2XZAL 25C8H 5SWZB 1D7FA 3HVDA 2JSFA 3ZTJG 1F4YL 5AW3B 2ALAA 5EEVA 2XTJC 2R59A 2BRRL 3VQ2C 2Y7LA 4FQHB 4GRMA 2B39A 4KKRA 3C60D 4F2ME 3ZKXB 4KKCD 3ZDYB 4GRWF 5DS1A 1AD0B 4CSSA 4PV8B 1S8DA 1T04A 2C9PA 3S2CA 1XF5A 5DJCB 2CBQA 4G70B 1BZ7A 1AXTH 2AJ3A 2IAAC 1TYJA 5IQMA 3L95B 3MLYH 3CXDL 3EZ8A 4OKVA 3R06A 4Y4KD 1ETJA 2TRYA 3O2WH 1T5XB 3L7FA 4UDTB 4NRXB 4OLVL 2NX5E 3RTLA 2APTA 5T1KD 5DZOA 4WF7A 4TTDC 2MHAA 3CFEA 3NBNA 2MKWA 3FCGA 4OFYA 1NCJA 2H1PL 2VDMB 1G5GA 1CWVA 1PY9A 4S1RH 5LGHH 3W57A 4QUOA 1K9TA 4FLQA 3ZJAA 4GUPB 4R3SB 4IEFA 3NCYS 2C1PB 2Z31C 1G5AA 2JJTA 3R19A 4KROB 5IOPB 3C12A 3DHUA 2C9AA 1WUZA 5BVJA 1E5ZA 2BERA 1PKQB 1J5OH 3SDYH 3B7RL 2H2PD 4KROC 5CN2A 2FHCA 3B7YA 5BZDA 3FUMA 3WCYA 4DP9X 4E36A 4HALA 4GPVA 3B1UA 3ZMRA 3K2UH 4JJ5B 1X7SA 1YPZA 2ORBH 2WWNA 5TF1H 4XN9A 4W9EC 1AE6H 2QDWA 5B1CA 3RWGA 4GUPA 4LARH 4R3SA 1A6ZA 4FFZH 3M46A 1RUML 1MJUH 4FQJH 2BOBA 4DPRA 4FZEL 1BBJA 1PNDA 2EVIA 3LV3A 2UXVA 4LHUD 2FJGB 5JORA 4G6JL 4H5SA 4AV4A 1MHCA 4PMFA 1MFUA 1ND0B 4MSWA 5BS0E 3MJ9L 2KQMA 3WD5H 3IMTA 4WU7A 4WENB 5KZCD 2YD3A 4J2QA 2LVEA 5BOJA 3ELAT 1LK2B 1HHKA 3UZEA 1HILB 4EOWL 1RZKC 1RMFH 4O2FB 1UHVA 1K8DA 4WEMB 3TT3L 1Z3RA 3QO1B 5F3FA 2EH7L 1MFCL 2L04A 3MO1A 4ZOEA 1HDMB 3AB0C 1CI3M 1NMCC 3TTYA 4N0RA 4BZ2A 3IFPA 4EVNB 1HHJB 4AIZB 1HCVA 1DO6A 4LOUC 1YECH 1OWWA 3CSYA 4NQSB 4FA7B 2W60B 4RDBA 4RBPH 5D1XB 3VX0A 4XCEA 3ABLB 3VWKC 1E9QA 1OW0C 2CCLA 1JBJA 3NPZB 4KXZI 4L5FH 3TGXA 2R56H 1HESA 1G7PB 1WH0A 3BFWA 1FNLA 4DWHA 4AC4A 2X2YA 3X3GH 4PW3A 3I02B 5E1AB 4Q52A 2R0WH 2F53A 3K5RA 1WA2X 2CDFB 3UP6A 2IH9A 3MX0A 4OB5L 4BWUA 1OEZW 3FZUC 2VO8A 4H20L 1J5DA 2R69L 4QNPE 1IGJB 4BZ2H 1AQ8A 1ORQB 3ESUF 3VFGL 3GZQA 3QJVB 4J1UB 1RZKH 4MA8L 1CT8A 3GZKA 5F7DA 4FX5A 4PJGB 1UA6L 1KJVA 3CN2A 4P46B 4XNMA 2NTSP 3GXNA 3EYVA 1DQTA 2QQNL 1H3PL 4I2XA 3IVKA 4G9FA 4KDTC 4V1DB 4N5UA 4TF4A 1BFOA 1P84J 4TPRH 2QKIA 3CVCA 2CDFA 2HP4A 2PPDA 4L8SC 2VL5A 3QI9C 3RI5F 4YSRA 4JO1L 4PRHB 3QFJE 2CUAA 1V7NH 1HAWA 1XTLA 4QRPD 1O6VA 4GT0A 4U7MA 3L3GA 2DY2A 2VE6B 3KYMB 4ZJ9A 4JPIA 4BA8A 4F7PB 1PS3A 5EORH 5KYYA 1XSIA 3ZDXF 1T0OA 1AZZC 5HYJD 3C2AL 3OG4B 4X4YA 2E74C 4P2QB 5LG1A 3S4SG 1IAMA 2ICES 1KNOB 5HYJB 4FTVB 2ZUXA 4P2QD 2UXTA 4OF0A 5IB4A 1AS6A 3H54A 4XWGL 5CEXB 3LNGA 4FXTA 2IPKB 4HJGA 3TV3H 4Z78B 3WJLA 1OY3B 1AHWA 4CMMB 2EXWD 2Q86B 3FOLB 3L5XH 2R29A 5BMFL 2B1HL 2XVGA 5D93C 2Q20A 1P4LB 1IX2A 3CWGA 5IMMA 2BOBB 5FFOA 1UKTA 3MV7A 4LSPH 2OMVB 2JB6B 3ZMNA 3NIFF 4YFDB 4TUOB 1IQDB 1B4TA 5SV4A 3I9GL 3ETSA 3M45A 3OB0K 3WO4B 3S3JA 1MI5B 1SN2A 3SB3A 1VFBA 4DZ8A 1HILA 4NKQB 5CJBA 3NJIA 3BT0A 3QSKB 2FWOB 4HWZA 5ISZA 4IOSD 4G7YL 2ESVA 3O4LE 1INEL 3VW3H 1P6FA 3HC0B 4CDHA 5E7FA 4WTZG 4TVSa 1KELH 1KZYA 1A4JB 1PZ2A 5C0DA 4ZW5A 4MJJA 2PF6A 5DK0A 1ESOA 1QKZL 4P2OA 5DRNA 1AACA 1RFDL 2DPKA 2ICEC 3SDXE 2IBBA 2XBDA 1KBPA 2EKSB 4NN5B 4JGNA 1R19A 1F56A 3NCCB 3Q6GH 1YAIA 2J88L 4CAGA 3V4LA 2F8IA 1EPFA 3PP4L 2ARJQ 5FC9A 4JRYB 4WTQA 3OJDA 1GZPB 4YVNA 4IKLA 1MH5B 3FCSB 4WY7L 3REVB 3OQ3B 4YN3A 4G71B 1KJ2A 3JTTA 3P77A 2G30A 1LP9F 3PJNA 2ICEA 3LAFA 3GHEH 1TZHA 2W59A 4JL2A 3EJZD 2AJ3B 3MJ7B 2NSXA 5I1GL 1D5IL 5GPRA 5TK2A 1L9SA 4L8CA 2BNRB 2JELL 4XVTH 5DJYA 3K2IA 3VRJA 3DVGA 4LP5A 3GJEA 3O6FB 2OI9C 1N4XH 5KYUA 4GRWH 1OVZA 1OP5K 4YSAA 4M7LT 2YMXH 4GAGH 4Y8AA 3DX9A 1YNKL 3MYJA 3OAUH 4WUUD 5JHLH 2DM2A 2UWEE 2RIKA 3VG0H 4FYSA 2A0LD 5EC2A 2OTWA 3NGBC 3EH1A 2EUVA 5TQ0H 4FKKA 1P4IH 5J13C 3TBSB 2QPFA 1DANU 4Z95H 3A24A 4HUWB 4JPIB 4F7PA 2UWEA 1IEHA 4H8QA 1U58A 2WWMD 4GG8B 5JQIB 2YS4A 1B0WA 5B7MA 1GYWA 4TSAL 3MRBA 1ZWIA 1N68A 5BV7L 2EP6A 4TS6A 2XQYA 3BAWA 1L9PA 4JG1H 2BRRH 2BHYA 1SBSH 2ZXQA 4PCTA 2XZCH 3UC0L 4BRJA 3EBAA 3ZQWA 1JZDC 2ZKWA 3DVIA 3WFCL 12E8L 2VH5H 2HFFA 1U8PB 4ZPVB 5HHPA 4TNFA 3RWGB 4Y4KA 3ZOAA 2UY6A 3KPOA 4A37A 2KDYA 2OP4L 4NZRH 4NRZB 4PRDB 2JB6A 5C0FB 1OTUC 3RGVB 4PWIA 3UYRL 4R83A 1AY1L 3AADB 3E2HC 3P0YL 1A7NL 3D6GA 4HMEA 2HFTA 4YSOA 4L9LB 4FFZA 3RWDA 5EN2B 1IT9L 5LB1A 5TF1L 2Q1EA 3K91A 3ARFC 1VGKB 2JFCA 3FFCB 5I0XA 1U36A 2VWEC 3IGAA 1EAPA 4P3CH 4FG6D 4HJ0D 3FQXA 4MNQA 1UFGA 5JXED 1KYFA 1U8PA 2C4XA 1K8IA 3ARFB 3IETB 1JS4A 2JQMA 3AABA 4JRWA 3MO1B 2B08A 1B4LA 4YSCA 4JFEA 4HU2A 3I6KB 1S7RB 2Y24A 3K3QA 4GG6B 4X6EB 1MLBB 2Z7UA 3N2JA 4OCRL 5DMGC 1M56B 1VKXA 3BHBB 3EDKA 3RYMA 5ES4B 4Z7VA 2HG5A 3JVGA 2YA2A 1EEZB 4NFBA 2HVJA 3LPGA 1KCUH 4MNQB 3BUPA 5DA0B 5DC9B 2O26U 4DERA 1PU0A 4HGKC 1IGFL 2WP3O 2Y5QA 4LPXA 4Z7OE 3HMXL 3SHSA 1IV8A 5HXMA 3OX8A 4J1UA 3KPRD 4GW5A 3MBEC 5SV3A 2GI0A 4P4KA 1FYHB 3BAJA 4Y5YA 5I1CH 1ZK9A 4XZUA 2VLRE 4JJOA 4BXSV 1RZJL 3SCMD 1XGUB 1AFVL 3LTVA 4ZMLA 1G7QA 3TF7C 5EH1A 2R4RL 5JQ6H 4KO9A 2A5UA 2WWOA 5DWUH 1H3GA 5FYJD 1F4YH 5L7XH 3D3VB 4F7TB 1RUQL 4HIJA 4ZAKC 5JA9A 4HXBL 1KGXA 4L3ED 3ZT7A 1JYXA 4ADGA 3WTSA 1IKFH 1SGKA 1AD9B 5IY5B 2ZYHA 2J56A 2R1XA 3B8SA 2Q7YA 1R4XA 2HX8A 3MRGB 4XVOA 1OP3H 1A47A 1FFNA 5HHOE 3MRBB 4DO4A 3AY4C 3NZ8B 4FDWA 4KXDA 5DJ6B 1DQMH 3L6FA 3O9WC 3TONA 2P80D 4EKJA 1Q38A 1TVBB 4LSUH 3O9WD 1L3WA 2G3XA 3TH4T 3FQYA 3QWOA 4P48A 1S7XB 3GRWL 1IGCH 4ELMA 4NZFA 4PJ8D 1L0QA 2JB5L 4PR5B 1IC4H 1TTBA 3CFDA 4ES8A 2IPTL 4HIQA 3ILQC 1QAWA 3FOLA 3L4YA 5HBBA 1P5UB 4NQCA 4RMRA 3VE0A 4BA0A 4GQPH 4ZNEA 1J05B 5I0YA 3NJKA 4XI5C 3ARDA 4JR9H