4B0MB

Complex of the caf1an usher domain, caf1m chaperone and caf1 subunit from yersinia pestis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
b'EPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords F1 CAPSULE-ANCHORING PROTEIN
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
molecule tags Protein transport
total genus 27
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b0mB00
4AYFB 1P5UB 3DOSB 4AZ8B 3DSNB 3DPBB 1Z9SB 1P5UC 1P5VB 4B0MB
chains in the Genus database with same CATH superfamily
5A2CA 4JY4B 4F27A 2O6FA 2NDGA 1BZOA 4OCMC 2HLFD 5T33H 4ZUWB 4IBWA 5EU5B 3TWCL 1LK3H 4M8QB 1MCKA 4R6UA 2YUXA 4I9WE 1TMQA 1XB3A 2EO1A 2OI9C 1JWMA 4XAWL 3HI6H 4HSCX 5DVOA 4YXKH 5FHBH 1S46A 1QSVA 1UUSA 2DM7A 4LSTH 4U3XA 4Y1SA 3DOHA 4OFYA 2PWEA 2DTML 2WVVB 4P9HH 4BCXA 1RLBA 4K3GA 4MJ2A 3S37H 3W39A 3INOA 3DGDA 4XNZC 2QHRH 4ICXA 2ICWB 1B6DA 4IOIB 3EOTL 4OBRA 4OD2B 1KJ3H 1A1NA 4AJVA 1L7TH 3P73A 5DURB 4Y88A 3FQYA 2RACA 2YPLA 5TE7H 1ED3B 3F85A 4CC4A 1AI1L 2ZKHH 3VFPB 1QFWI 3P9LB 1YPZF 5INCB 2W9LA 5F7DB 1MHCA 1IRAY 2ZUQC 3L4VA 4HK3J 3GO1H 2VLME 4G8FA 2IWGA 1KTBA 1D5XB 1YEEH 4JM4H 3MXWH 1OF2A 3L5IA 3BZEB 1RZ8A 5AVUB 4LRNL 5DRZB 5BS0A 1E5CA 1HTYA 4OJAA 1ZTMA 2OZ4H 5E6RB 3OKYA 3FCUB 4Q9QL 1CU4H 4G3YL 1QI4A 4JVUA 5DYOB 5HDRA 3UJTH 4DERA 3WN5C 4UNTA 3MCKB 2QADB 2JK5B 4Z3JA 4X7SH 4PY8J 4A1RA 4YDKH 2CK0H 4JFXB 4UAOB 3QC5X 4MX7B 4KVCL 2YK1H 5AW7B 1HQ4B 1T5KA 4FYSA 3BYTA 4Q14A 2AJUL 3BGAA 4MA3B 2OULB 1PYWA 2VXQH 3KVDD 4GAGL 3D69A 5D1ZC 3ZIYA 1OB0A 1W72A 4I9XA 1T22B 3RWFB 3H9SE 3I75B 1AGCA 2I85A 1E43A 4B9KC 2IJ0C 2NUPB 2VR9A 5C9JA 5DEGA 5DJYA 5BVJB 4TUOB 4N8PA 3BCDA 4CNIB 3CC1A 1LM8V 1T66D 4A63A 4EUPG 2ERJB 2HKHL 2APFA 5F3FA 3TO4A 5IHLB 1Z0NA 2WYZA 5LBVA 1NANI 2XQBL 4MMXB 1E3FA 5L2JA 3SCMA 4TPRH 1MFDH 1T04B 3DSNA 1AD9B 3H4HA 3BUYA 3H56A 3LXBA 4YDZA 4A38A 4ZFFA 1QSEA 4L29A 5T33L 1CGSH 4OUUB 3FQXB 4I77H 4TULH 3LSOA 2VDNB 5F7UA 1YN7A 1LK3L 2MHAA 2CCVA 3QJRB 1INEL 4JRWA 2BY1A 3GJFH 2PTUA 1MWAB 2NCMA 3HI6L 4ZZKA 5FHBL 4KOCA 4WW2C 3T0VA 4JFWA 3QO1A 4FG4A 4RMWA 4BQ8A 1J0JA 4CW1B 4P9HL 3S37L 1I1YB 2BOCA 1TMCB 2QHRL 5D5MA 4R0LB 2K7PA 4JVPA 1KJ3L 1IARB 1A9EB 1A2YA 2XYBA 1UH4A 3JBG7 1L7TL 1YAIA 3OWEA 3KPLA 3QPQD 4I4WB 1KY7A 2X2UA 4IRZA 1EZVX 1DVTA 5J13C 4AZ8A 5IJDC 3IXAB 2HTLC 3GMMB 3QCUH 5TE7L 2ZKHL 3SDXA 3O4LE 3LEVH 2IAMD 4H40A 3ZDYF 2VMCA 3NEXA 5T1DH 1Q9WB 1G9NC 2A4ZA 3ARBB 2B9BA 3VCLA 4GMTH 4RFNB 4AQ1B 4GFTB 4AL8C 5L2KA 3GO1L 5FECA 4JO2H 1YEEL 3MXWL 1KGCE 2VJXA 4NQDD 1JWSA 2ZWLT 1D9KD 4PCYA 1UASA 5ALBH 4WEBH 4J3OG 4PJAE 4YK4C 4B3EA 1ZSDB 4WNQA 2OZ4L 3FTSA 2BVQA 5T5NG 5D55A 1DVFC 1LEKA 1CU4L 1H5BB 4N0FB 2E27H 1F13A 2ATPB 4JANA 1KTLB 4LSPH 2V37A 3VFNA 5D1ZA 4X7SL 4BDVB 5KYWA 4N85A 2Q87A 4UQ3B 4YDKL 1THCA 2CK0L 4RAHA 4LEOA 4GKSB 3GJFK 2ZAHA 4E9WA 1MCRA 2EDWA 2YK1L 4ODXB 2WLLB 2AK1L 3VFVA 4R4NC 2VXQL 4YR6B 1BVNP 2E6QA 4WK0B 4ZXBC 3QUZD 3AITA 3VACA 1FG9C 3OMIB 4HYTB 4NBYB 4PU2A 2LVCA 4PWEA 4HJUA 4R7XA 1HNFA 4FQPA 3QFDB 3QIWD 3QWRA 5F96H 2CU9A 3WSQH 1KLUB 2W81C 3C8KA 3FT2A 2OS7A 3DMMB 2J25A 35C8L 2LQRA 3T1FB 2WWOA 4TPRL 3RVTD 5GS1A 3VW3H 1MFDL 2GHZA 3FQ1A 3OC8A 2AXWA 4JRLA 1OTTD 1J8RA 1H8NA 2OW6A 4AYSA 1CGSL 4OZIA 4PBVC 3NIGE 4I77L 4LZKA 1S3RA 4TULL 4AVKA 4Q9CA 3D50A 4QYOA 4EUPB 1G1YA 4AMKH 2APVA 3GBDA 1K6QH 1KY6A 3MRQB 3T2LA 2J57A 2ZXDA 2HT4C 5L4JA 1OK8A 4JB9H 1RPUA 1BQUA 3OJVC 1BIHA 1MXDA 4KKLD 2EDQA 3ZXAC 4EI6B 3MUUA 2B08A 2H0JA 3GINA 5FLVA 4TQPA 5IROC 2QADC 4NP4H 3MV9D 3QJUB 4XCEB 4DGVH 5FOBB 1OAZH 2R59A 4TLTA 4XH2B 4UAOC 4V1DB 3QCUL 3LQZB 3HB3D 1MZZA 1SPDA 3LEVL 3O3EA 1T3FA 2O1AA 2CBTA 3J8F7 4N2FA 5T1DL 2I69A 1IC1A 1IEBA 3T0AA 4GMTL 5DRXA 3SO3B 1DVFA 3S97C 1HHKA 4ATWA 1WCQA 3IRPX 4ZMXA 3AG3B 4MTMA 5EPMA 4JO2L 3I6KB 4JFOA 1HL8A 3UEZA 3WJJC 4WEBL 1DJWA 2VC2H 4TNEA 4JZNA 2XWTB 4U1MB 4P5KA 5H2BA 3UAFA 2E27L 2ERJC 3QDME 4Z7QE 1Z3RA 4LSPL 3IDMB 4MMXC 4BHUI 4H26B 1XIWD 4OV6F 4ZXBA 2L7JA 1TCMA 1TU2A 4NPJA 2YXMA 4QOKA 1A4AA 3DVNA 4ZUUA 2JWYA 1ETZA 3DHMA 1Z66A 2DYPA 3UBXG 4HUXA 2YD0A 4OZHA 4KZ0A 4WWKB 1D5MB 4PJFA 3OZKA 3CFUA 4P3CH 2P8MA 4IRSA 5FGCE 5C8JA 1IGFH 3L9YA 3D07A 3NJNA 3VWKC 1P6FA 3O0RH 3NJXA 5D7IF 3RNKA 4HCRA 5E9DE 5IVOA 3P77A 1M3JA 4JHUA 1AQMA 2CLZB 5F96L 3GMRB 3WSQL 1GJWA 1A7BA 1U3YA 3PP4H 1AGFB 4F7TA 4R0LC 4NAMA 4PI2A 3EYVB 1A21A 2XXCB 3T6QC 3VW3L 3BUIA 2UY7B 3RWDB 5TDPA 4FQCH 2PUQT 4CA4A 1NGXB 3KNBA 1XO8A 2R0WH 5BRZE 1UT2A 4M5SA 5GGTL 3WKPA 3M45A 1HSAA 1I1RA 1TZIA 2KKQA 4AMKL 2MOQA 5F3BB 3BLBA 3IETA 2GPZA 2IPKB 1K6QL 4GRLD 5HXMA 3DPBB 3T4AA 4W9GC 3ECBB 5IQOA 4Q2ZB 2V9RA 3RBGA 2ITDB 1E6JH 4MNQB 3MRJB 5J12C 1TTBA 3HR6A 1U8JB 1ZHNA 4NP4L 2E7LC 5C97A 2X4TA 4DGVL 1OAZL 2XG4B 3RL2A 2YD2A 3DO7B 1T20A 2Z8WC 3IBEA 5E23A 1I4FA 3S88L 3WJJA 1AHWC 1WIUA 1P84J 2Q3XA 3F7YA 4L4TD 5ENWB 3ABZA 4YFLI 3NCWA 2F0CA 3H0TA 4GKNA 4JN1H 1KNOB 4P2RB 4ZX4A 4JFEB 4MCNA 2FLMA 5C07B 4TXVB 2JXMB 5DZOA 3ZYIA 3MX0A 3LN9A 3SKMB 1FHGA 4PRAA 3QEHA 2VC2L 4JAMB 4JQIH 5D93C 5CD5C 1ZA6B 2CM5A 5FCUH 5GS0H 2DWEA 4MFHA 2Z8SA 4NUJA 4FI7A 2XXGA 5FO8A 5DJAA 4U1IB 4XCYB 4LL4A 3MJ8B 5AB2A 1W0YT 3AU1B 4X5WA 3GSXB 4H25B 2X89D 2A9AA 5DK2A 4H1LA 4I89A 4WF7A 4M56A 3UC2A 4F2ME 4GQRA 1TO4A 5D2NB 4AUYA 2X4NA 4M6OH 3I3DA 4HJIA 3REWA 4AKPA 1AY1H 1KG0A 2N01B 3RGBA 1FLTX 1JV5A 3TCXA 1FZJB 1SLVA 4A7QA 2F61A 2JJVA 4P3CL 5HDBE 2XQYA 3VXRA 1Q9OA 1DUYA 3LRGA 4XBGB 2Y7SA 3O0RL 3RIKA 3VXNB 4D8PA 5TDOA 5D7EA 2ZOKA 2J2ZA 3QR0A 3SPVB 3K6SA 2CRIA 3AG2B 3HI5H 1CVSC 2IH9A 4ELMA 1EEYB 3PP4L 1OM9A 1OSEA 3EBIA 3UBXB 1N9PA 4JPSA 3IJYA 3ZKND 2XJLA 1XCQA 1VFUA 4MZIA 3DUHA 3KPPB 4RRPG 4FQCL 2R4RH 3O2VH 4ONOA 2NY2C 4MA8H 3ZDZF 3KLQA 2R0WL 1A7PH 3RDJA 1HDMB 3RUGE 5CSGA 5I0ZA 3BAKA 3BP7B 4X9BA 4GSUA 3QIUD 3O45A 3WEXB 1A14H 4N0UA 1DVQA 1K2DA 4K7PH 4BXVA 5BUAA 5KZCD 1XR8A 2UXTA 3V0HA 3OR6A 1FFNA 4BWWA 3NIFF 2MWCA 3NFNA 2YFNA 3GUTB 1K4CB 2E7LA 1KCLA 5MEQB 4H0GA 3MRGB 3AT8A 5GGRB 4XNMA 3P69A 1AHWA 3RGVD 4D0DB 1ZPLA 3C09B 4I2XE 1B6UA 4JLRB 5HDQH 1E6JL 3SDDA 4ZMQA 1G7PB 3QYCA 5FCSH 4PP1D 5IB5B 5CD3A 3EYFB 3OLGA 1CGVA 1R3IH 4AIOA 1S5HA 1F1AA 4OFDA 3RI5K 1KIRA 3MUY1 4C4BA 4Z7NE 1NWPA 3K0WA 3KH4A 5HYIA 1CDJA 5HJBA 3GXMA 3BKYH 1TF4A 1JNHB 1B2YA 4L4VD 4BSJA 3GGWA 4JN1L 3F01A 3VX1A 2YWZA 3BRGC 3GWJA 4OCNC 4UAHA 5CP3A 3NP3A 1I75A 1P84K 4KRMB 1MW0A 4JQIL 3CDZB 5FCUL 3AY4A 4IBSA 5GS0L 4D9LH 3IFLH 4G1MB 5KS9F 5FGRA 2BP3A 3L3JB 5FHAH 4ZFZB 1E50A 2H0EA 5B3NA 1BBJA 5BUGA 4ESKA 3F7KA 2ZYSA 1FF5A 3HE7A 4PV9A 3S3CB 5TE6H 3EBAA 1AGDA 4M6OL 5E6UB 1PLBA 1YMMA 1QFPA 1AY1L 4A7GA 4AW4A 2B59B 1DVUA 4OZFB 4WDIA 1FZKB 4Z7UF 1A22B 2AEIT 3TWYA 3ULUD 3QZWG 4NCC2 5CGMA 3HPLB 4FJYA 4BINA 1TVBA 3HI5L 1QA9A 3C60A 1YEJH 3T6WA 2WIIA 1N6VA 4DEUA 4G6MH 4LPTA 4Z23A 3QNXB 4KNQA 3BO8A 3DROB 4I48A 2VMJA 4PJHB 1G7HB 2C3VA 4GBXA 3O2VL 3PGCA 4MA8L 4Y16D 1A7PL 5H4ZA 1X5KA 2NY1B 4HOMA 1A14L 1HH6A 3BEVB 4K7PL 4X9YA 4GP4B 4YHKH 4B53A 3HG1D 1QSZA 4U1HB 5F1SA 2OSYA 3WKYA 3OSVA 2Q7AA 2BRRL 2J1YA 4KHTH 4NQCD 4TVSa 2NCEA 4JRFA 5K69A 3RX8A 1E27B 4D0CB 3GBNH 3BAJA 2GYSA 3B9KB 4OGYH 1CQKA 5HDQL 3OG6B 1C16B 4GG6A 5HVWA 4RRPM 5LQBH 1I8LC 2X9ZA 3FCBA 4RGND 4H5SA 3K80A 5F93C 1A7NH 1CFQB 3C8HA 3H53A 3PWLB 2XN9D 2BIIA 1F4WH 1ZT4A 2CDGB 4F7CB 4G43A 5JXED 3HMXA 5KSVA 3O4LB 3EO1B 2B9AA 5D2NC 5EU3B 4GSRA 1VDGA 2G9KA 2CNZA 2B39A 4GRWH 4I5BB 4TNWK 1E2WA 5AVSB 3VNYA 2N7BA 1E28B 2E6PA 1G9HA 4GEJA 5F89B 2R2EA 4PJAB 2HG5B 2Y7QB 5HD8C 2JCWA 4CSSA 4PRNA 4R9HA 3IFLL 4J27A 1DVXA 4MHHG 1PZSA 3L9RA 5FHAL 3NCXA 1LK2A 4A7UA 4K7FB 3SY0A 3CFKA 4X6CE 1VZIA 4YDVB 5CZVH 5M7QA 2HJLA 1PY0A 4M9PA 3WIHA 1C1EH 3OB0H 5TE6L 4K5PA 1TIUA 5FX3A 3AC0A 3CQPA 1JDAA 2NXZB 4KROB 2F54D 2QQLH 4FFYH 5AW3B 2WVSA 3B83A 2B4CC 1UFGA 4P2OB 1WCBA 3KL3A 3F8UB 4I85A 5JDSB 3ZZ1A 4G6FB 4HS8H 4PB0H 4IK7A 4BE6A 2ZONA 3I02A 3JWOH 4NHUA 3V5DA 4TSCH 1EMTH 3N6YA 3WJLA 1V3MA 3CLWA 2P9RA 1EZVY 2K4WA 4NO0D 1IAII 2VIRB 1YG9A 5EZPA 1YEJL 3WIFA 3C09C 3GSVA 1ULVA 4ANKA 4G5ZH 5ID1A 1N8ZB 5ID0A 4PW9A 1KJ2A 5EBMA 3QDGA 4TVPE 1TZHB 3L1FA 1EXGA 3SYCA 1J8KA 2WIMA 5KOMC 3NIGB 2NPLX 4ANVA 3QZWB 4ZMNA 2Y7OA 4HAFA 2WKOF 1D5ZB 4UBDC 2COVD 3VD5A 4NQUA 4YHKL 1QNIA 1VZHA 5DF0A 3VYPA 4P2CG 2BY0A 3LKQA 3UAJA 5C0AE 3NN8A 3GBNL 4OGYL 3OB0K 2OX5A 3TJEL 4IBZA 5LQBL 4PRHA 1AO7E 5E5MB 1I8IB 3OQ3B 1JGLH 5B39B 1JIBA 1A7NL 2X4PA 1F4WL 5JZ7C 1MCJA 1UB5A 4JL2A 5T5FH 3BEWB 2VQ1B 2DQJH 4E2OA 2BY3A 3CZJA 3CFJB 1XF5B 3IEAA 3M86A 1QLFA 1OQOA 3B2MA 3FQRB 1V7MH 2Y1ZA 4P23D 4PJ7A 5DFTA 4RLDA 4L3FA 3HZMA 1FNAA 3CHPA 4Y1AA 2BCKB 1IZJA 4XVSH 1DQLL 4I0PD 5J9PA 2XY2A 3IDYB 4M61A 4NLHA 4OV5A 3S5ZA 3W82A 2X2IA 2EIZB 4M8UA 1K3ZA 3QDMB 1CD1B 4UF7C 4RAUA 1T2JA 4CRPA 2K6WA 5CZVL 1AHKA 1TSHA 2WAQA 4JCMA 4LQ1A 3WL9B 2K78A 3WTVA 1C1EL 4U1JA 4ABWA 3UOAB 5FKAA 4L8SB 1GL4B 2CRZA 1FL5A 1FO0H 1OK0A 2R15A 1Q0EA 3N44B 5KOVC 3UADA 1WTLA 2JTYA 4ZQKB 1G7QA 4PWKA 2QQLL 4FFYL 4NO2B 2ZCLH 3A6CH 2VN7A 5AW9B 1Y18A 3GDCA 2WV3A 3EHBC 4X7CC 4HS8L 4PB0L 1UC6A 2P3YA 1MCOH 4IMKC 3JWOL 3RB7A 4TSCL 5E9DB 1EMTL 1X5FA 1CT8A 5FUZH 2C3WA 1UXSB 4BSVB 4NIYE 1JK8A 4V33A 4OJCA 2P44B 1TQWA 5C09D 2RFXB 2O5XH 4ONHA 2V7NB 3B9KC 5AKSA 3UGXA 3FQNB 3FU8A 4G5ZL 3E3QE 1DBBH 2VDMB 3LZPA 2ZUVA 1KXTB 2PO6A 3ESPA 4NUMA 1GW6A 2E4TA 4LVHC 2ZKWA 3MLVL 5GRYA 5BRZB 3CH8A 2YO3A 4FQXA 4UCFA 5KSBB 1T0MB 2UYLA 2QJDA 3LHPH 2R4SH 2FJFA 2VLRB 5IEHA 1CLZL 3H7LA 3D09A 1JHTA 3U0PA 1H3TA 2PCFB 3E8UH 4FXKC 3VXUA 2XV2A 2R2HA 1G4RA 1IGTB 2VERA 4KV5E 3RWJB 4R7VA 1OT1A 1KELH 1K8IA 1LO0H 1HZKA 4X4XA 3HBPA 4IJ3B 2Z31D 3CZKA 4U7KA 4L37A 4MJIA 4O51B 1MFNA 2EVHA 1JGLL 5CZKA 5E8DH 5SWSD 2AJZB 3T0WA 1GY1A 3H9SA 1RSFA 5T5FL 1RL1A 1SUHA 3DRTA 2CHZA 3VB9A 2H2PD 4NSKA 3PWVA 2M26A 1V7ML 2NXZC 3UTSA 3NIDF 2J1XA 4XVSL 4HZ1A 3FN9A 1KGJA 3VWJC 4G9DA 3ZX1A 2EEFA 4ODWB 4HUCA 1GY2A 2EXSA 3DA0A 4ZNEE 1HOCA 4DEPB 4GW5B 1F4XH 4HAKA 3HHSB 1PG7W 5A16A 1ZKAA 4HKZB 1DANU 5I73B 2V8LA 3OAYK 1HK6A 2BNRA 1F4HA 5D1QD 1L0QA 3THMH 2PW2B 4F2MB 1S9KC 5M94B 2OR9H 5F1KC 5C0EB 1FO0L 1IVLA 1HZLA 4OU3A 2ZCLL 3A6CL 1N67A 5HHOB 2VSCA 5CSZB 2L04A 3N1QC 1MCOL 1WZMA 5FUZL 4QHUA 1SFHA 2X5PA 5DVNA 4C56D 1ZLDA 5KAQG 1KYUA 3CG8A 4TUJA 3EJCA 4WUKL 1H8OA 1J05A 1DEEB 2O5XL 2VCOA 3L1GA 3I6GB 3SHSA 2KT6A 5J11B 1DBBL 2EDTA 2XY1A 4PAZA 1CR9H 1GA2A 3VA2C 5IHZB 2DJSA 2V2WB 4UIKH 1AYRA 4N28A 1L4IA 2VR4A 1AR1C 3TX4A 2MJWA 1ND0A 3QVAA 3NZUA 3LHPL 2R4SL 4X6FB 2YRZA 1SVCP 3MNMA 2PMZA 1BSIA 3E8UL 3ES6B 1KTJA 3JUZA 4D9RD 1NC2D 4E41D 3QH3B 2J8UE 2LTQB 4JREB 4NKQB 4YO0B 4HPHA 1KELL 1LO0L 3FXIC 3QIBC 1O6SA 3AQXA 1NBYB 5IVXF 3DX6A 1OTSD 4XXDA 2F7RA 4OF5A 5FV1L 1KDJA 4E9RA 2X4QB 5E8DL 4Z7NB 3RYMA 2DLEA 3KM1A 3VXMA 4E9SA 5F9WB 1XGTA 5ACMA 5HDWA 3VWJA 3DXAD 3BH8A 1EAOA 4L8SC 5KN5B 1EAJA 4JY6A 5CZXD 3MRMB 4GUPB 3T4YA 2CBMA 3LRLA 2E5EA 3WTWA 4Q4IA 3JT2A 4DUXA 1YY8A 4HJGA 4K8RD 4JM0A 5GSRB 5LNDA 4EXPX 5I6PA 5CR8A 1KBVA 2X6CA 1AZUA 5CBEA 2EDLA 1FVCB 3ETBJ 1TPXB 2X2JA 2FK9A 3MRDB 4Q8BA 2UY6A 5LN8A 3TCLB 1F4XL 2AXFA 1JZ5A 3O2DH 1KJVA 3OHXC 4CSTA 5IMLB 1WBZA 1E8WA 4XGZA 4ZZFA 3LH9A 1AGBB 4GINA 1ZT1A 4FG6C 3THML 3NRFA 4AKQA 5JORA 1VESA 4XRCA 1W16A 5ABZA 1M7IB 3VXOA 4HIQA 1NMCC 2BJMH 1NUNB 1I31A 2E6JA 4Z1PA 4ZMWA 3VD2A 1MI5D 4X6EA 5D6CA 3KYNA 2NNRA 4JZOA 4PBDA 1MUJA 3BE1L 5IW6A 1G84A 5JPNB 1D6EA 1W15A 1FL3A 4IJ3C 2ZSWB 1D2PA 5LHDA 4X4YA 2WBJC 3N04A 5F8QC 3PWNA 4A2LA 3VVWA 1CR9L 4U0QB 1FFQA 3DK2A 4HS3B 4ZS6C 4UIKL 2JB6A 1X9LA 4ZAKB 2G5RA 3LDBC 2LLLA 3QIBA 1JZHA 4K07A 4GXUM 43CAB 3M8OH 5KYXB 3MI6A 4R4BA 4YSAA 2QHLA 1CYGA 3MLRH 3HLAB 3D33A 5H35A 1R3HA 1KT2B 2ICWI 4HEMA 4XMLH 4FP8H 4PIBA 4Q7DA 2Z92B 5FUOL 1I9RH 2KPNA 3W0WD 4Y4FA 4OVVA 2FJHA 4A04A 3TPUA 4A7SA 4DGIH 3MRBA 4M93B 4YEFA 4DEPC 3GI9H 2P24B 3HZVB 3BAIA 5T1KB 1I7RB 3EJYC 3F05A 3K5SA 4FXTA 1UEYA 3O81A 5I73C 3N2JA 1LWRA 4KH2A 4K94H 1CURA 5CINH 4NQSB 4M5TA 2GBVA 3HAEH 5EOCH 3D85A 1QVOA 3UGUA 1E6OH 1QFWH 4UNIA 4XNUH 3F7VA 1GH7A 1NFKA 2OSLA 3OHXA 4O9HH 3L3HA 5IR1A 2BSRA 2IPTH 5J0BA 3UG3A 5T1LA 4NLAA 1JL8A 5EG6C 4F15B 2GBTA 1N4XH 5D8JH 2E9BA 3AWFA 2IVFC 4G6JH 1XGYH 3EGDB 4PGDA 3RVUC 5I1LA 4HLZH 4W6WB 4MQ7B 3O2DL 2JJTA 3OGCA 5CEZD 1A1NB 2UWEA 4GYBA 2PR4H 3WUWA 5J11C 1YA5A 2IH8A 3X11B 4L5FE 3G5YB 3ZYZA 1C5CH 2D2CC 1WAAA 1ZVHA 3Q8BA 4S1QH 2AF2A 5D2LF 4CADB 4ELKB 5FM5O 3CBKB 1CDYA 1BAFH 3LZFH 4ZW8A 1WZLA 1KEGH 4EI5B 2BJML 3CAFA 3WHXB 4C83B 3BSZH 1WBXA 2HSIA 1ZOXA 5DQ9A 5AVQB 2UZIH 1DJYA 2MOVA 2E7BA 1MJUH 1YMHB 5DO8A 1IQDA 2WBJA 4Y2DC 2X1QA 2QMJA 2IXQA 4KVPA 1EO5A 1PBYA 3MO1B 4MDIB 4XXCA 4WENB 3MLZH 4IGBD 3BAXA 2AXGB 2W60B 3QI9C 4J4PD 4PJIE 2D3LA 1OM3H 4CVXB 1SJHA 3MGOB 1U8HA 2G75B 1SMAA 1M1SA 3LY6A 4Y2OA 4Z3EA 4Z5RA 3PL6A 1L9TA 5D72H 3DTUB 3GLAA 2ZF9A 5DO2D 5DZAA 4E9TA 3BWAB 3M8OL 4NO5A 1KB5B 1X7QB 4NZUH 1OALA 3D05A 3MLRL 4QRBA 1QHPA 4LHUD 4XC3L 3QEUB 1IKOP 1SYVB 1MNNA 4FP8L 5DXWA 1PX3A 3K7UA 3JZ7A 1I9RL 3QEQA 5DEGB 2MOGA 5C0AB 2YGOA 4BZ2A 5LDUA 2FJUB 2DQMA 4HD9A 4DGIL 2P1YA 1TPXC 4XHJC 5E2JA 5D4QA 1A02N 1E90A 2J5LB 3GI9L 2A6IA 3TO4B 3NABH 3WY3A 5J1AB 5JYLA 1AO7B 3CU7A 1UG9A 2WXPA 4LDCA 1G7JA 1ZLUH 3D4ZA 4K94L 3VMOA 2ESVA 1SMDA 4WJ5A 5DEJA 5EOCL 4DP5X 1JYNA 3FFCD 1ZS8B 1QFWL 4WI8A 1YN7B 1Y07A 3BISA 4YBLC 4XNUL 4FHBD 4GMSH 3RIFF 2W5PA 4N5ED 2YZ1A 4O9HL 4Y4HB 5GGSB 1BFVH 2J6EL 5IT2H 1N4XL 3PGDB 1GKOA 1CXIA 5D8JL 1KPRB 4G6JL 1SN0A 1XGYL 2BOCB 4G9FA 4MZRA 4G8GA 1A1MA 1U0QA 2EKSB 4J3BA 2D7QA 4U6XB 4EXKA 2PYEA 3HFFA 2JSFA 3MCG1 3ZE0F 1A2YB 2PR4L 5JO5B 4MXQD 3PWJA 1C5CL 4D9QE 4S1QL 6PAZA 4Y2DA 4P4RB 3E38A 1BAFL 5LG1A 3SODB 4ZAKC 1KEGL 1GHFH 1M3IA 3BSZL 3QI9A 4XCNA 2BIQA 2UZIL 2P42B 4I2XA 1MJUL 1Q38A 2BNQE 1BVNT 2WXHA 4YBHA 3SQBA 3B9EA 3QUMB 4NBZB 4M03A 1PQZA 3MRCA 4WSKA 3LKSA 1LQSR 5EB9A 3NEEA 2BXYA 3MLZL 2QDVA 2HVKB 4B50A 4QY8A 1R19A 3MLSH 3BXNB 3GZPA 1ZLUK 1U6AH 5E8PB 3W56A 1A4JB 5BOJA 2XWRA 1N2RB 2W65A 1DHKA 1OM3L 1AP2B 3GMQA 5KYWB 2P5WE 2HYMA 3SKOA 3OTTA 2GY5A 3H9ZA 3IJSA 5D72L 2B15A 4XNXL 3DO4A 3ORJA 5E6ZA 2X1PA 3HE6A 1ORQB 1YNTB 1MFCH 4FLQA 4L3CA 3HUJF 4PG9B 3VXTA 3D5OF 3PQYD 3ULUF 1OGPA 4NZUL 4JRYE 4GH7B 1S7QA 3K71B 4YUEH 2WZ5A 1J8HD 1M9SA 3IBOA 4MA7H 4F15C 2BFGA 3GI8H 2QGBA 4NRYB 4P57A 4LOUD 5DMJB 3FT4B 3NABL 1FL6A 2BW4A 5HVHB 1N0LA 2GC4C 2OXHB 4ONFH 2IWKA 4NKIH 1PF3A 4BELD 3T2OA 3CVHB 4U3SA 2KHAA 4Q52A 4I18B 4OZIB 2ZXBA 3FO9A 4S0TD 4XWOC 5HI4C 3GMPA 2Z64C 2JKTM 4WEEA 4EI5C 4ZUTA 1KB9J 2C1PA 1TQTA 4N2MA 3FOLA 5AW4B 3V4PH 4DK3A 1RERA 3QNYA 4O2CB 2VTFA 3LKRB 1CQYA 3ROLB 1BFVL 4AKOA 2B3RA 1EDHA 1PKQE 5IT2L 2DWDA 4QRRA 4OZGA 4KBPA 5DT1H 4BFJA 4LARH 5FB8A 2VUOA 3WO3B 2H3XC 2XRAH 4DESA 2NY6D 3SYPA 4M9OA 4NNYB 2JKXA 3H3PH 3NCEB 1FV1A 3ZRCC 3T0EE 2OQJA 1FYTA 1II4E 4LDOB 3Q6FB 3V0VA 1LGVA 2E9WA 2EC9U 4OAWB 4U31A 2CNYA 3GZKA 4ZJ9A 2BINA 1YYLH 4KJWD 1U3NA 4NHCH 4BK8A 4Y5YA 2VAAA 3AGWA 3RHWF 3DURA 1T0PB 3ZGIA 1GHFL 3PAZA 1IUZA 1SXCA 4HW6A 3U79A 1QABA 3EG9B 1JHLH 4WWOA 5DSCB 3AM8C 2DMBA 4POZD 5EPMB 4IEFA 5B1CA 4HDIB 1OANA 4OLWH 1J0KA 3PAYA 4KDTA 1JFQH 1K4DB 1K3IA 4JFOB 5K1VA 3CMGA 1EFXB 3JTSA 2VO8A 3U0WH 4GT7A 1HHGA 4MAZA 3V0DA 2VN5A 4JZNB 3FKUS 2Q6WA 5H2BB 4KWUA 3MLSL 2Y6TE 3WY1A 1U6AL 3TVMD 2RJMA 5KVDH 4P5TD 2J5LC 4EPSA 4QRUB 2FO8A 5T1JA 3QDJD 1UWGH 4FTVE 4ZUSB 2Q2LA 4UTBA 5DJ8B 4HKXA 2GEEA 4MKMA 4FQQB 4W6XB 3SJVA 2VISA 4ZUUB 1B0RA 1UH2A 1AKJB 1LEGA 2Y5EA 3CMOH 5KTEL 4FQLH 1H6TA 1UA6H 4Y4HC 4YUEL 5JLZB 2VDOB 2WZ6A 1MVUB 2OAAA 1FP5A 3LNHA 4GB9A 1R6VA 5I6LA 4MA7L 3OM3B 2J8UB 4DCQA 4P3DB 2NXYC 3IN2A 3UTOA 5B22A 1YEHH 1CYXA 3GI8L 5GZOC 3NJIA 4XNQB 4KNTA 4NC1E 1JZ6A 3KXFA 5FW6A 5SV4A 3P9MB 3FZUD 3IGAB 2HAZA 1E5AA 2EO9A 4IRJB 2EICA 1FFTB 5JR1H 4ONFL 2SEBB 4NKIL 5CSBA 1WAEA 3GJEB 4PJ9B 5I0YA 5K59F 4DPAX 4LLVA 5DUPL 3RQ3A 1K5WA 2XNAB 2N4IA 1RZJC 1EPFA 1X9UA 2CUIA 1JPFB 2GJZA 2VNCA 3U4EB 3HS0A 1Q9KA 3V4PL 3FU7B 2I07A 3TIEA 4KXDA 1JUFB 1LDPH 4NCC1 3FB8A 3KPOB 3QXUA 5B4MD 3CVIH 4HH8A 4G7VH 3KPRD 4HIEA 4PP2B 1KB9K 5DT1L 1OGAA 4LARL 4LF3B 1O75A 1CK0H 5DZVA 5DZLA 5HGHA 2XRAL 3ECUA 2F74A 5BO1H 1RHFA 3N55A 3H3PL 1QNZH 3E3QC 1JWUA 2CJUL 3EFDL 1JNNH 1ZHNB 3V8OA 4AE0A 1WJ3A 5JIHA 3QEGH 4QHKI 1H6FA 2UXGA 3L2LA 2V7HA 1YYLL 4NHCL 3BWZA 1E4JA 2ZNXA 4AQEA 4UT9A 2PETA 1I3RA 3F7YB 4KJPD 3H8NA 3P2BA 1OSZB 1JHLL 1AXTH 2OMNA 1N26A 3H0TB 1NDGB 1P7QB 2EYTB 2NSQA 3KVQA 4OLWL 4XNYH 1JFQL 4ZX3A 3U0WL 5C0CD 5E94A 3Q3GA 1CD9B 5J6GB 1UEMA 5EOTA 1O5DT 5KVDL 1NCOA 1REIA 1UWGL 5HVHC 2VXSH 5HGBA 4J3UA 4HUWA 4QJ3B 2QQKH 1OOWA 4JFHE 4KUZH 1I1FA 1ZA3B 3FOMA 4WNJA 4FD0A 3T3MF 3OHMB 1IEAB 3IU3A 4QHNA 3LRSA 1J5DA 3BD4A 2F1EA 5H94A 4G8EB 4I18C 3VI3F 5IM7A 5T3ZD 32C2B 5GZOA 2V8MA 3PP3H 2C1OA 2HJFA 4UILH 1BZ7A 4FQLL 1DR9A 1UA6L 1NKRA 2Y2TA 1Q9OB 2NQDA 3RX5A 3JVGA 5DMYA 4Y4KA 4APQB 2ZOLB 4MJJA 4D8PB 5ISZD 4LO9A 2HPOA 4N2EA 2ZIDA 1YEHL 4ZX5A 3WMPA 2F53D 3MRIA 3TZVA 2QPDB 2J8HA 2NNCA 2JQZA 5B1BB 1OAUH 3ZRFC 3IN0A 3KGSA 2IANB 3EJSA 5JR1L 2O6CA 1QSFE 4D3CH 4GQQA 2EYSB 2VLKE 1XCTB 2NY5H 4HUUA 1Z9SA 1KXQA 2ZX9A 4HIJA 3FS9A 3UABA 3AMKA 1FNLA 4IJTA 1FQ9C 2BWQA 3LKOA 3UIZA 5F7LB 2OMZA 3B9DA 4XVTH 2YD8A 4QTFA 2Z4TA 3NGBC 4MD5B 4TUUA 1R3LA 2UZXB 2A7BA 3CFEA 1LDPL 1FFNB 4LCYB 5FDWB 3IT8D 1DZBA 3AVEA 4NYLA 3CVIL 3HNVH 2ISDA 3WS3B 4ZW6A 1UOLA 4G7VL 2BIOA 4BZ1H 2OW7A 3ROOA 1ZS2A 1CK0L 3KS0H 4TNVK 1H8SA 4UINH 3KLSA 4AEEA 4S1RH 1Y0LA 1QNZL 4IOSA 2JKSA 4EVNB 3O3DA 3QEGL 1OPGH 1NEZG 1BA9A 4N90D 3KWUA 2QVTA 4MSWA 5CGYC 3U4KA 5JW5A 4QNPF 1A6ZA 3UTPD 1L0YA 1X7SA 2VLJA 3HS8A 3NQIA 4Q56A 2Y7LA 1MW2A 1AXTL 2FIKA 1MPAH 3OJDB 4BCYA 1QZ1A 1ZIBA 4LL9A 3E2HB 1WHOA 1YYCA 3Q5YA 1YN6A 1KGXA 4CBPA 4LMQE 1HEZB 3RKDC 4J8RA 2A9NH 3LV3A 4JFDA 3NESA 4XMTA 4PJIB 3NJFA 4JPWH 4IRJC 4AK2A 4ECNA 2VXSL 1KIPA 1XSKA 2QQKL 4KUZL 4BWUA 3HZYA 3QA3B 4PJ9C 3C75A 3D08A 1M53A 1F90H 1KF9B 4J2QA 4CU6A 3KYOA 4NENB 1NCGA 2MCPL 4P07A 3HNSH 4R97B 2CJTA 3GTVA 3U9WA 2CKBB 1MAKA 3II1A 4K5LA 5DJDB 1DE4A 4JPQA 4LLWA 3ZE2F 5BQ7A 5G4OA 4I13B 4AJ0A 2LLGA 3KDPB 1JN6A 1G1CA 4P9HC 4FN0A 4NRXA 4QI3A 1BCIA 1MCLA 1S7XA 5J3HC 5AUMA 4EDXB 2X1OA 2JMRA 3NZ8A 3LQAH 4S10A 4W9EC 1OAUL 5TTRA 4UZUA 3UP6A 4D3CL 4L0YA 4BFGA 2NY5L 2C3VB 5CJXC 2TAAA 5IK3A 4QRPE 3UCRA 5EV7A 2X0WA 5DVLA 4Z0XB 2LGNA 3Q5OA 4XVTL 1E8XA 3WN6A 2GIMA 2H2SD 3S3BB 5ACLA 4JRXA 4KK6D 1G9MH 3IGFA 4QT5B 3UYPB 5E8EB 2ZJSL 3BIKB 1VEPA 1CVRA 2HG0A 2WZPA 1YPZE 4NIKB 4BZ1L 4RBPK 5AZEH 1YUHA 2FZ3A 3GSNL 1EIBA 5L8LB 3GKWH 1U92A 3CLEH 4UINL 1P7HL 2A6KA 4N22A 4S1RL 4JE0A 1MFAH 4FC3E 4N1CA 1LE9B 5EOQH 5K39A 2QT6A 1FVEB 5FYKH 5D1XA 4OFVA 4N25A 1OPGL 3RAJH 3TYFA 3GXNA 2BSSA 3L3OA 4DOHE 3CTTA 3RG1C 3RWEA 3SE6A 1M71A 3ILPA 2FLRT 3OKNA 2PXYB 4J3OF 2HRGA 1S9WB 2XWJA 1S9XB 2BNQB 1MPAL 3M07A 1UACL 4EI0A 1R24B 3FCSA 3QR1A 5DHEA 2Y69B 4ILDA 4IW4C 1NEZB 4APQC 2G5BA 4XN9A 5IV2A 3NJGA 2P80A 3LD8B 1QEWB 4PRNB 5G4NA 1IAIH 3UO8B 1P2CA 2A9NL 1Q1PA 4Y9FA 4JCLA 5LAXB 4JPWL 4DPRA 3CFKB 2EZ0D 3VRLF 2P5WB 2W92A 4I8DA 2I9TB 1CDHA 2YAMA 3QP3A 3D39A 2GI7A 3B3IA 3Q9QA 5HSFA 2DB8A 4QO1A 1WP6A 3TA3D 1F90L 3U7AA 4JM2C 3BESR 3HNSL 4OGZA 4YHOL 4KPHH 4OLYL 4JRYB 1LD9B 3HI1A 3CZLA 3O8XC 1LVEA 4PJGA 2ADGA 5T3XH 3RIAF 3ZL2A 2DQGH 3DETD 3EF4A 5HGAB 2CO6A 3HA0A 4HSQA 4AVHA 4UOW1 4RESB 8CGTA 3DBXB 1MDTA 4JN2A 5CJXA 2F6AA 1F3RB 1ONQA 3EFOB 3PHQB 3LQAL 4YEEA 1UT1A 5F7AA 3GSVB 4AGQA 2WHVA 1T1YB 2MNJB 2ENQA 1V54B 3SE4C 2NY3B 3OL2A 2TSAA 3QFJA 4OB5H 2BWIA 1ZRUA 3T9WA 5I5RA 2EH8H 1HAWA 2Y06H 4FI6A 4PS3A 2OZ4A 3L5WB 3FB5A 1ID5I 1FA4A 1OT2A 1TJGL 1S3KL 3V0JA 4DP8X 5TGBB 2A4CA 3OF6A 2ZUSA 3N50A 5CMAB 4YN3A 4F91B 4CGTA 5DRNA 2FHBA 2XIBA 3O9WC 5F7EL 1G9ML 1FH2A 5IBLD 1K85A 4AEIH 4EMZA 3X12A 1PKQB 2YSTA 5GGUB 3KL0A 5AZEL 1KCUH 2VXQA 3GKWL 4X7TB 2V4LA 4Q9RH 3MBEC 4GW1A 5D7LA 2ZKXA 1V3LA 2AKRB 1MFAL 3IMRA 1J88A 5EOQL 2GITB 4YXHH 5FYKL 5BS0D 2ICEB 5BOPA 2EXYD 3RAJL 3SBQA 1KTDB 2ZAIA 3QUYC 4HJEA 1AXSB 4WSJA 3RWHA 3MR9B 1NC4A 3L17A 4DGWC 4W9LC 4C58B 4LOFA 3GLZA 3BGFC 2FO4B 4DGUA 4B3VA 4H8VA 4JL1A 4ZYKA 3FHEA 3O6FB 4L1LA 4PLJC 1ZJBA 4GW4A 1ACZA 4FQ1H 1LO4H 1JPGA 1IAIL 1GGCH 3GJFA 5TFSH 3NP4A 2B5IB 1G5AA 4HWZA 5IB4A 5IJBC 3FB6A 4FTVB 4QHMA 2G2RB 3O8XA 3BUTA 3GK8H 5LBSA 4A37A 3WFHB 4LPUA 1I9IH 1KCKA 1I1AA 3AXHA 3EJJX 3BPCB 4NRZB 5EDSA 5E1IA 3T71A 4Q9BA 4KHXH 3SCMD 1HNYA 4KPHL 2VDKB 4UQBA 4ORGB 3BH9B 3ZPDA 1QSED 5T3XL 4Z78B 4AYMC 4JKPL 3WE6A 2DQGL 5FOJA 1A1OA 3LHAA 1PZBA 7PAZA 4FFZA 5F97E 2AP2A 4UOZA 1Q4NX 4IU2A 1GYAA 1CD0A 2YJLA 3AFLA 1KPVA 1KGYE 1NFAA 4OB5L 1EHLL 3U83A 3PXLA 3O9WA 5HYJA 2V2XA 2EH8L 1M6OA 1ZHKA 3TNMB 2Y06L 5E4IA 3HJEA 3ZMRA 1JD9A 2AQTA 4FABH 4YDIH 1KLFB 3SDYH 4UTAH 4BSWA 4P46B 5ESVB 2PXYC 2IAMA 1BZQK 3NRPA 5MENE 2ATAA 5GSVB 2HVJA 3IDUA 3MBEA 5GGVH 3O41A 1CE6A 5E03A 2EXWD 4FXLA 4AEIL 2ZXGA 2R2HB 3QE5A 3L1OH 3ME0A 4UM9A 1OP5H 2E46A 3P3TA 1KCUL 2WNKA 5F1IA 4F7PB 5EIIG 5L2KD 3L7EB 3KZ8A 3LD8C 1UFUA 1JK9B 5AYUL 4Q9RL 5IKCB 3H85A 3UP1A 4JFUA 4YXHL 3D3VA 1AZBA 2OM5A 1LL1A 1PDKB 3QQ9D 3DRTB 1TNMA 5LG6A 1T89C 3ZMEA 1INDH 3LMJH 1BD2A 1MREH 3WD5H 2DEWX 3QXWA 5AW8B 3G6AA 5D1ZD 3ZO0A 4F33A 1SJVA 4RWYH 4KITB 2X44D 3GB7A 1K9TA 5E51A 4AGOA 3GZQA 2EDMA 3QXDB 3FULA 2E0PA 1GKEA 3RWGB 4XO4A 2FQFA 1VZGA 4Q6KA 5CS7A 2IALB 4FQ1L 3V6FB 3B2UD 5HGDA 1JERA 1LO4L 3K5RA 4QMEA 5AG8A 2GBAA 3H1ZA 5I8EA 5A16B 3W9EA 1GGCL 1J9SA 1LXMA 4HZAA 5TFSL 4GUOA 2XG5A 5EZJB 3M6DA 3FO1A 3IFNL 2NY3C 5K33A 1YDPB 2ZXWB 4X98A 5IG7A 1OLLA 2FSEB 2HB0A 3QG6B 5D7IE 1M9WA 5E2UH 2CBPA 3IXTA 4AQZA 5J6HA 3GK8L 3QWRD 4QRSA 4PJHF 1I9IL 1VEMA 3DX9A 4JKKA 4PTUA 4BH7B 2EDJA 4QD2E 3N1GC 1NPNA 3STLB 4KHXL 2OR7A 5EC1A 3OR7A 1OP5K 2IEPA 4NNXB 3D4CA 5A3ID 2A9DA 1PSKH 2AEPL 4QHUB 2VABA 4KKBD 2WBXA 5L88H 2WO3B 1ZSHA 1GJIA 3TA4D 1R75A 2GK2A 1CLOH 2UXFA 1QWNA 5BZWB 2G9HA 4H4NA 1UADC 1GCYA 1AIZA 2BNUB 2D7TH 1QSFB 2HRLA 4MXVE 4GIPD 5EEYA 4J39A 4HPYH 3T0EC 2VLKB 3GUFA 4S2SB 2HTLD 3NAAL 2FX8H 2ICEC 2AAVA 1OP4A 2I9LA 4FABL 4YDIL 3SDYL 4UTAL 4K15A 2X9XA 4GSXA 3QISA 5AAMA 2ALWA 3FQTA 3WFDH 3MRRA 2NY4B 1B4RA 3NT0A 2AV1B 1RXLA 3WFCH 1E0OB 1KCVH 5FYJE 1XH3B 4ZW3A 3WTSA 1BBDH 1P5VA 4ADIA 3O6FC 3VFUA 1UD3A 2CO7A 5GS0C 3MJ7B 3L1OL 5GRXG 1LO5B 1DVFD 4PJAF 1O6SB 3ECVA 5PAZA 1T89A 7FABH 1P6AB 5DQJA 3VA6A 3ZK0A 4HALA 4NC2B 3BZFA 4EZKA 4GP5B 4OQ1A 1A0QL 1G9NH 2ICWJ 2B5IC 1WHPA 2CUMA 1J5HA 4AL8H 3IRCA 2UZPA 4PW4A 3VXMB 1UGKA 2ALAA 2J20A 3TBSB 4ENED 2I27N 2MPAH 1INDL 1A3ZA 1U8PA 3QYNA 3MUHL 5FYLE 1MREL 5B38A 3WD5L 2KZBA 4XMPH 3QWQB 3ETTA 4QKTA 4ZXBD 4RWYL 1GZQB 5DFVC 2FATH 2VRAA 2V33A 1KCRH 4QOKD 5JOEA 1LWJA 5FWQA 3PDOB 4JJOA 4TRPL 1MHHB 4NNPL 3B37A 1JTPA 3SQRA 3UDWA 2DYPD 3C5ZB 1KIUA 2OMTA 4NC1C 3BVVA 2X28A 1R17A 4AV4A 3DTDA 4IRSD 3QQ4B 5C2UB 2H0FA 3QZNA 1XXFC 5IWLA 3ABMB 4UOW0 4ZTOH 4KTGA 3RPIA 1OV8A 4AC2A 5ILTH 3PIQB 5FO2A 3C08H 3N42B 3RY5A 2Z34A 3T65B 2DQDL 2FR4B 1HXMA 3RWIA 5FO9A 3AREC 4P46C 3WXVH 3FTGA 1U8OB 5KW9L 2FRGP 2H6PA 3BQUB 2Q3ZA 5B3SB 1NIDA 4BXSV 2HJKA 2QMKA 4NKOB 2CCWA 5JHDE 1XSOA 3LN5B 3ZDZE 3ZHFA 1DJGA 3T0EA 1PSKL 3G6JA 3KPSE 3U9UA 2CDEB 5GRUH 1U8MB 2HT4D 4AGNA 2JTDA 3NPSB 4PYGA 1XGPA 5L88L 4YNYB 2C7UA 5IW6B 4PWIA 1CLOL 3FQUA 4URKA 2EE9A 3NIFE 2D7TL 4HGWA 4N6RB 3MV7E 4A6YA 3QXVA 1YO4A 5FFLA 4PJBF 5F0MB 3WFEH 2AANA 4WU7A 3FCTB 4ZUVA 4OZ4A 2GUOA 1IM9A 3TPKA 1S9VA 4KKAC 3WFDL 4KK9C 4K0OA 4XR8C 2FJGB 1R3HB 2H9GA 2WY3B 1BBDL 2MRYA 2DW5A 2IDQA 4Y4FB 1HHHB 3HZKA 4MRBA 1VACB 2DQEH 4L3AA 4N68A 7FABL 1CI3M 4IHOB 2MCAA 1GZPA 1MHEA 1WWBX 2NMSA 4ZFOB 5JA9A 4X8JB 4F7KA 4HZLA 4AQ8C 4KJYB 2NW3A 4DOHB 3K91A 4AUJA 1OWWA 2MPAL 2J71A 3ETSA 4PS7A 2H8PB 4RWHA 2YMTA 2XPGB 3N44F 4BK4A 1EJ8A 4FHKA 4YHPB 2OSLB 2MTPA 2AZUA 2WXJA 2FATL 3ARFB 3CSFA 1RCYA 3MA7A 3PHOA 4FL4B 3CXDH 1KCRL 3RJQB 3VWKD 2Z7ZA 4ANXA 2OMUB 1YC8A 4JQXC 2ATKB 3G5ZB 3ARDC 1BVLA 1D7FA 5FW7A 3QXAB 3AREA 3DRQB 2WLIA 3VXRD 4B9IA 5I0VA 2AZAA 2CCLA 3EGSB 4FCHA 4JHVA 4ZTOL 4MJHA 2VR3A 4Z7UE 5ILTL 3MOQA 3SDAC 1AHMA 1MWAH 4MMZB 1CCZA 3S3PA 1MCIA 2YKLH 4DF9A 4RNRB 5IMMB 5KSBF 4DKAA 2NQCA 5JIPA 3HVDA 4MB5A 2NY4C 4PG2C 4UU9A 1KOAA 1RHHA 2WKGA 2C5DC 1VADA 4L0ZA 1TVHA 4BD4A 3QJSB 3NCBB 2F7OA 4NO3A 2BMKA 1MCHA 4Y5VB 5GRUL 3APNA 1QRNE 2N7SA 3IFPA 3DJZA 1I8KA 4X5PA 4WGKA 2GFBA 4WFHD 4XPGH 4B7LA 2PPCA 5E1AB 4PSRA 1OD7A 3SE8H 4YDJA 5FFOA 2IADA 3CDCA 3SDDD 2YMXH 2MKLC 4LNRA 1MVFA 1F97A 1CYWA 2YD4A 5BPPA 1P5UC 5F0PB 5C0IB 2WXIA 2A74A 4KTEH 2CPUA 1EJOH 2JKRM 3X14B 1FC1A 2DTSA 2DAVA 5CD5D 4NKDA 3KYAA 3N1PC 5KSAC 2DQEL 4AOFA 4AITA 4QPEA 3KYMB 2DM3A 4QWWD 2WW8A 4GG8B 5GJTH 1DCEA 4JFFE 1VHPA 2MCG1 1SEQL 4LLUA 3V5KA 4LDLB 5EBWB 2FYYB 4W4OC 2Z93B 3BZ4A 1CL7I 4JDEB 1NQBA 2H45A 5FC9A 3GSWA 4LLQB 3BPLB 4QRTB 1D7BA 3Q8CA 4WJ5B 1I7ZB 3HIZA 2CRYA 1RZGB 4JQXA 1EERB 5DUMH 4EQ2A 3ARDA 3OX8A 4OD1H 4DFHA 3ELQA 4L8BA 4ODHH 1X5JA 4GFXA 1FNGB 3HE7D 3JWOC 3OKKB 4U6HA 4KQ3H 3CXDL 4A68A 3DGGB 2WAHA 5HHNB 3FC8A 4KJQD 1P4IH 4FQHB 2ETWA 3MC0A 3SDAA 4I3SH 1YMMD 1AOHA 4XP5L 5C0FB 3EJQA 3LPWA 4G8GB 1A1MB 4HIIA 5DZNA 3LYRA 3LJ3A 3LKNB 4Y2LA 3ZTNH 5E7BA 1F1GA 1MY7A 4EUPH 5DGRA 2NY2D 1AZNA 1RD6A 3MROB 1MWAL 1T4KA 4W6YB 3CU1A 3H7BA 4BKSC 1T1XA 2YKLL 1IMHC 5CO1A 4CVZA 3AT0A 4CC0A 1LEIA 3B2VH 2QR0A 5SWQB 4GBXD 1UQSB 2MNUA 3X3GH 1GVIA 1Q90A 1ZEAH 2FCBA 3STZB 1R5VB 4LEEA 3HG1A 2V3DA 2ZUXA 2XVGA 1RJZB 4B96A 5HYQB 7CGTA 1DN0B 1J7VR 1F0LA 1NBZA 5E4EB 4G8IA 4XPGL 5D7JB 2NTFA 4LCCA 4JO3H 1RVFL 1JSYA 3MJGX 4LVNB 1XAKA 2AEWA 5EU4A 4LCVA 4PCTA 3WKNA 3SE8L 2BHYA 3K0YA 4U6YB 5AW1B 3SKOB 2VUKA 4Z7NF 2QKIB 2IOIA 1SXSA 3RPKA 2V5SA 4GAYB 4RFEB 3K2UH 5KSAA 1TTFA 5J1SC 2HKFH 5E95B 1S7QB 2OPCA 3ARFC 4HS6A 4PRDA 4NN5B 3ERXA 1EJOL 1NKGA 3UG4A 3QWNA 4NB7A 4HWNA 3VFTB 2EJ1A 3NJLA 2IGFL 3QFGA 3D12B 1NJ9B 5EFIA 1WITA 1I8AA 2IDTA 4J3OH 5D6DA 1LP9A 1N70A 3GHBH 1HI6B 1N0LB 4JDVB 4N20A 5E6IA 4J8QA 2VZVA 3F04A 3GBLA 4HLZG 3JTTB 3JYBA 3TN0C 2MTAA 3QAZB 1SJEA 4OIIL 4RMRA 4MMZC 3V6OE 5DUML 1URLA 4N8VA 4UT6L 2IQ9H 1UZ6F 4OD1L 1RIHH 1XF3B 4ODHL 3MBWB 1JF6A 3G5XA 3SZKC 3HHMA 4ZMTA 4KQ3L 3M1BA 4N2HA 3CWGA 5JUEH 1F2XK 2YSSA 4FMVA 2FWSA 1P4IL 1RJLA 1UD6A 4OZGB 5IQ9A 4I3SL 4Y5VC 1ACYL 4LE8A 4QRPA 2V3FA 1HCZA 5TK4A 4HOWA 2Q7YB 4OCSH 3GBMH 3L3KB 5SWZA 3ZTNL 3BFOA 5D7IB 3WLBA 3IFOA 2XUWA 4WI0A 5CWSB 3WLWD 1XGUB 2ZF8A 3UH8A 3HR5A 5A7BA 3MAWA 3KPMB 1W6LA 3VXQA 1G7IB 4G72B 1MLCB 4FFVC 4XP9H 5KAQF 3QDGD 3B2VL 1NGYB 5AL0A 5IIEA 3JV6B 1S8DB 1T7WA 3X3GL 3WNLA 3EUUA 3A21A 2PPAA 3VJ6A 3CD4A 3KMDA 3B56A 1LE5A 2H6OA 4AG4H 1PS3A 3QJFA 1LJMA 3CH1A 1PPIA 1HCFX 3FU6A 4LIQH 3FQ4A 4WHCA 2XU9A 3GSQB 3H3BC 4XNDA 3GSRA 2NLJA 3OKDB 3R4DA 3LH2H 1ODAA 3AAZA 4JO3L 4LK4A 4P2QA 5F72S 2YXFA 3UAJD 5E00B 2Y4SA 3POHA 2ADFL 4HJTA 2GCYA 3BPLC 4FG2A 1ECZA 1TETH 4GI9A 3CN0A 1W8OA 1IO4C 4MAUH 5CN2A 3WTUA 4LGPB 3GSOB 3V4UL 3K2UL 1JF1A 1QFHA 3SGDI 3B34A 5GS2D 2HKFL 2XTJE 2ITCB 2CK2A 4P23A 3SDCB 1RK0A 1IE4A 1ZTXH 2RBLA 3TN0A 5HD8D 2WTRA 3C2AL 3IDGB 1FO0A 1EBAA 2BDNH 3LIZH 4XN7A 3VDAA 2F1BA 1BMWA 2C3XA 3NIDE 4K8RL 3RIAK 4Y1AD 2VH5H 2ARJQ 3OKLB 3BHBA 2LU5A 3MBXH 4DZ8A 1U93A 4K3DH 2WWNA 2ZCKH 2OFQA 2NY0B 4NT6B 4LCUB 5CLTA 3SKNB 2Q86B 3APCA 4A39A 4E0RB 1ACCA 2IQ9L 5GGQL 4PREA 3VSQA 1RIHL 1S2EA 4K3HA 3BVUA 5K5YA 2VL5B 1CZ8H 2DLTA 3WELA 1WGVA 3SPCA 4Y19A 5JUEL 5CEYB 3V6BR 4POUB 1AIFA 4LVOC 4PSPA 1G0YR 3FB7A 1OGAB 1YAZA 1A6TB 3UTZB 1HXKA 4YZFF 2KPWA 2HUEA 2YMOA 5I8OH 4OCSL 5E4EC 2CUAA 1UENA 4R90H 1C5DA 5D7JC 1JWUB 3EO0A 4TKWA 3UTTB 5KJ7E 5F7KC 4OT1H 3UBHA 3DX4A 5EO9A 3EGXA 3FO2A 1YC7A 2JKLA 3D34A 1FVDB 2QKIC 4U1LB 3MGAA 4NXSA 4YHYB 3EOBA 3MNZA 4N0YH 2F58H 2OR8A 1I3RB 4XCFH 2ADYA 4UBDD 1FUNA 1PFOA 2VLMD 2PO6D 1OHZA 1Z32X 1ZT7B 3FBKA 4XP9L 2BSTA 1TXKA 4X6DA 5BW7C 3U2JA 5JHDB 1EX0A 3E6FA 5A2BA 4FQXD 3KPSB 4NN5C 5EIVA 4TQEH 3OKMA 2O61B 2E7DA 4AG4L 3PWPE 4KAQH 3CIAA 1T21A 3WGUB 4LIQL 5HYSA 4U4IA 4XXWC 5EUKA 3SB3A 5C0GB 2WXOA 3NIFB 5DVMA 2RAMA 3VXUD 5BVPH 3LH2L 4UQ2B 3VSTA 1FC2D 1UM5H 5JZ7D 5HBBA 1U3HB 5ABDE 1I1FB 5FYKU 1SNRA 1TETL 5SWSA 3IU3B 3DHPA 4MAUL 4W9KC 4N2KA 5IVXE 1NGPH 2NUTB 1RY7B 4MJID 3WEAA 3H2PA 4NZRH 3RTQA 4MCYA 2C1OB 2PCXA 3HRZA 1RK1A 4TMPA 3L8QA 2JJSC 4HKBA 1BZ7B 1EJ6A 3EOAB 1KLGB 2BVOB 2RIKA 2GJJA 1DSFL 3H9SD 3WEBA 5TH2B 1GS8A 1I9JH 3D25A 2FWOA 1ZTXL 4Y4KB 4MASA 2PW1B 4IS6A 1DL7H 2BDNL 3LIZL 4NEHB 5JIIA 4M02A 3VI4A 4HHGA 1FZOA 3DV6A 3UTSD 3JUYA 2FUTA 3BDXA 3MYZA 1VJSA 3B8YA 3QNFA 1UXMA 5D5MF 3T09A 4PJEA 4K3DL 3V6ZB 1JNLH 4HT1H 2ZCKL 1VFBA 1E4XI 5BUPA 1HSBB 3MV9E 5JHBA 1YEFH 3OMNB 2VYRE 4OZFH 1QPPA 2C9SA 3LKOB 2H26B 4JDZA 3VU1A 3CSTA 3MUGB 1KACB 5CR1A 2NZ1A 3RURA 2CIIB 3EHBD 2BNRD 1CZ8L 1FG2A 1WFNA 2EE2A 3Q8FA 4LLYB 4OQTL 3CFEB 3TLRA 4OI8A 4IBTA 5I5JA 1PJ9A 4WTWA 1NPUA 4PBWD 1KXVA 3WTYA 4N4YB 2BVEA 2IO5A 2YEVB 2WBKA 3QJTB 5ERWA 1SBSL 2IG2H 1NAKH 1PIFA 4RZKA 3N41F 4G8AC 1EZSA 3KLHC 5H37A 5I8OL 4RQQA 4R90L 3SQOH 3LNDA 3VFMA 2KLTA 4Z7UB 4OT1L 3GM8A 2RB8A 3IK2A 1VFOA 3RFZA 4AVIA 1I53A 1Q94A 2EDYA 2WUCH 1F8TH 3N85H 4N0YL 4Y0GA 2F58L 1BFOB 3KLLA 4JFPA 4XCFL 1NCDH 3L3DB 5F6HJ 4F1SA 1QWHA 2HCZX 4F5CA 1JRHI 2DQIL 3BT0A 4HP5A 4BH8B 3SDCC 4TQEL 1AZVA 4J3VA 3FQWB 3CBJB 4A7VA 1XL4A 1NC2A 1QRNB 2QZ5A 3GF8A 3QORA 2DH3A 3EADA 2PWGA 4KAQL 1WE5A 4MXWL 3A4DA 5DK3A 3DK0A 5EEUA 1MFEH 4J8RB 4JFDB 2IAAC 1BXAA 4K94C 4ETYA 5BVPL 3VE0B 2X7LB 1CICC 1QLEL 1GPOL 4X99A 1UM5L 5DHVB 3T8XA 1HHJB 5BOZG 2VXVH 3TOPA 1P4LB 4OJFH 1R47A 1J5OH 1QR1A 1J1XL 1J9CT 1NGPL 3P3SA 4BUHA 4OZIF 1XTLA 3D0AA 4NZRL 4NPYA 5C3LD 4P2YA 3HG2A 4IDJL 1ORSB 1IAOB 3VWJD 4OTXL 1I9JL 2O6PA 5KG9B 2R51A 1HXYA 2ORBH 4P5MB 5CEXB 4FFTA 1DL7L 5DJ2A 4W9CC 3WKQA 4DQAA 4TOYH 5GRJH 3Q6GH 4JFFB 3ZKMD 5JW4R 4H8PA 3IAGC 3I85A 5BZDA 4HT1L 4UUJA 2NZ9C 3AWEA 1H15B 3VTAA 3GD1C 1KPUB 2IBBA 3GMOB 4HH9B 3IAQA 1KV3A 1YEFL 2C4FT 4ZSOA 3NFSH 5IHHA 2J3SA 2UZYA 4WW1B 4AENA 1Q72H 3ZKSD 3TEYA 2HFGH 1M7DB 3S96A 2WVTA 4L4TE 5CFAA 3DDFA 1S7UB 5D2LE 1H3VA 2CRMA 3K72A 4YMPA 2ADIB 5EORH 3E1ZA 1JGUH 4R5TA 4F8LA 2Q20A 3IJ7A 3B8SA 3L5HA 4LEBA 3A22A 4X4MA 2IG2L 3VB8A 1NAKL 4KZCA 4WHTB 5TDNA 1Z5HA 2V5MA 4ZO8A 1XGQA 3F5WA 2P5EA 4XX1E 1T6WA 2WXQA 2YUZA 3SQOL 1EEQA 4HXBH 3KPTA 1IC4H 4HK0B 2K6ZA 5D1XB 1U3HC 2Z4QA 4S11A 1KYAA 2WQWA 2BSSB 3KLKA 1CTOA 1JOIA 1AR1D 5I8CB 2WUCL 3FT3B 1F8TL 4OH2A 1USZA 3N85L 2DZEA 4JZJB 2AV7B 2BW5A 3D52A 3U4AA 1NCDL 3ZT7A 4KK5C 2AQSA 3EH5B 2NYYD 3AS2A 1B9ZA 4KFZC 4O5LH 4W9FC 3RDTC 3Q1EA 4M29A 4OZHF 5C9KA 4PJFF 5E8OA 1WIOA 4NUGH 5DUJA 3HAEA 3NBNA 5EA0H 3QIBD 4GQ9H 4O4YH 2J8UF 4RX4A 4U3CA 2CGRH 5C0BB 5CZRA 1DJSA 3KW7A 4N0CC 3QDMD 3X13B 1IT9H 1MFEL 1BM3H 1ZV2A 2HLAA 1U91B 4WLCA 1EZUA 1IGMH 1BJ1J 2J55A 2YAQA 4MMYB 4GAAA 4OVUA 5T1MA 3ULVF 2AJ3A 4G6AD 4PS8A 2WZAA 2VXVL 1MIEH 2C34A 4OJFL 1WV7T 1J5OL 4PV8A 3PAVA 4Q6IB 1PEZA 5EU7E 1CUOA 3BI9X 5LN4A 3VFWA 3D2UA 1UXWA 4UWQB 3IS1X 3PWUA 3WS6A 3G6DH 4ES9A 5F0JB 3D85D 3CZNA 2E75C 4YIQB 5I30H 2ORBL 2Z7YA 3TL5A 2X4UB 1AG0A 3RY6A 3ARGC 3T6VA 2PYFB 3U7YH 3N0AA 4TOYL 4W9ZA 5GGVY 2F7IA 5GRJL 3Q6GL 1MCPL 5T1LD 3C5XA 3SE9H 3EYQC 1UA7A 2H1PH 3BP6B 3FUKA 5HYFA 3FT1A 2F8VA 4YGVB 2C9XA 4ONGL 2F8XC 5IB2A 1NBVH 3SOBL 1MW3A 1WEJH 4LBEB 1TQSA 4XAKD 1WZAA 3U9PH 4MJ6B 3UTQA 2N1TE 2OTWB 2QV2A 1GC1H 1B0IA 3NFSL 3T2PA 3ZE0E 1JXGA 1TJXA 3O3AB 5A2IH 3L5XH 2HFGL 1MH5B 5EUOA 1NZRA 3MV7A 4L4VE 4DN4H 2VDMH 4F7EA 5EORL 3F7QA 1JGUL 1B0GA 2BHUA 3TNNA 4DP0X 3GPSA 1FE8H 4AQOA 2Z35B 2BP8A 3KJ4B 2AK4A 4IGBA 1CFMA 3BUBA 4PJ8C 2WBJD 4OCRH 3TBYB 2CH8A 4XTRC 2XIIA 1XH0A 1DBJH 4HXBL 1IC4L 4PR5A 1UWXH 2HMID 3RDTA 4F37F 2YA2A 3O3BA 3UZEC 1WICA 2QSCH 4G82A 4E42B 3HKFA 2PCYA 3U1PA 4PLKC 2CGYA 3GXUB 1X9QA 4OCWH 1BHGA 1N5AB 3E1F1 3PL6D 3VTMA 3WEMA 4NUGL 3VXSE 1SYSA 1TKWA 4JPIB 3I6LD 4GQ9L 3CNKA 3CFBB 2IDSA 4O4YL 2CGRL 3HUJE 3HFMH 3MFGB 2JIXA 1NGWB 4XPTH 5KS9A 3ULUE 3RTLA 3EJYD 3QJHA 4MS8C 1BM3L 3H2WA 4IM8A 4AEFA 1F6AB 4ELMF 5IB4B 3TF4A 2DWXA 2ED6A 1S7TA 3IMTA 4PJ5E 3QEQD 4PRPA 4QHMB 4XMKH 4WI7A 1GIGH 4HUVA 5INDB 4RMSA 1DQJB 1MIEL 1AC0A 3EH4B 3VYNA 3TTSA 1UYWH 3ARGA 1AVAA 5IF0A 3CN3A 5F1NA 2XTJB 1D5RA 2AMGA 1ES0B 2FT6A 4QTHA 5K9QI 4O2EA 1QBAA 1WZ1L 2GJ6A 3RLSA 2ESVD 2GSGB 2X0UA 3G6DL 4NQEE 5ACZB 2HPTA 1T83C 2HFFB 4YHNB 2EE0A 4PV1C 4HOZA 1F3JA 4OGAD 3MRNA 3RVUD 3H2QA 2LV4A 1CFBA 4APXB 1UWXK 3NH7H 1Z5YD 3NIDB 3U7YL 3O11B 5IW1A 1SJXA 1O6TA 3EBHA 4NQCE 3SE9L 2DMCA 1J0HA 1U95A 5DHYB 3QAQA 4RGNE 1NBVL 2EE3A 3FRPG 1WEJL 5HHPB 3MFFA 7PCYA 4G9FD 3U9PL 2XN9E 2R23B 2PYED 5MHSD 1GC1L 4JZJC 2OL3H 3GS4A 5I6OA 3VYOA 1J87A 1LLAA 2BIPA 3A4FA 3L5XL 4PJ8A 1IQWH 1Q8MA 4U1NB 5HP5A 1SUJA 4Y2DD 3WAJA 5AFAA 5IFHH 3KR3H 1JV2B 2H5UA 3KHQA 3GSNB 4GRMB 4DN4L 2BOBA 2VDML 3OXRA 1Z7JA 4NQDB 4QKXB 4RETB 4WUUE 4XC1H 3ME0B 1D9KB 1T1WB 2OKMA 3QI9D 2X3BA 1FE8L 2R1YA 1S9YA 4YHIB 5ECGA 1M2VB 4LCWE 5DFAA 4OCRL 1ZHLA 2YC1B 1HNGA 5K9OA 4BA0A 2NRDA 5FS5A 3LPOA 3WO4C 2EQDA 4X8GA 1U2HA 2EP6A 4NN6B 2OXGB 4HUKB 3P2TA 2QSCL 3UROR 3QHTC 4LPCA 4PJDE 4Q6IC 4OF6A 1BM7A 2HLFC 5IEKA 4D0BA 4YDLC 2Q8AH 2F54E 5I8KH 2WXLA 4OCWL 4WKZA 3OKOB 3E8VA 5AOMA 2ZG2A 4A7GF 5I1DA 2DLIA 3QUZB 1JGEA 1OZUA 1FSKC 3HE6D 4XHJD 5EEXA 3S5LB 5JOFA 2IH1B 3TV3H 3G5VB 3HFML 4XPTL 3MKGA 3W9EB 1NL0H 3QIWB 4WGVB 2XG5B 1Z9LA 1MCCA 3U30C 3V0WL 2ICCA 5I26A 4XMKL 3UFIA 1GIGL 5E5UB 3L6FA 1BOGA 1T83A 3PF2A 2YFOA 3TBBA 4BKLA 2F5BH 1L3NA 1UYWL 2B0SH 3MOAH 5EC2A 1DDHA 2FECI 3GQFA 3MTXA 2IDFA 4BHUA 3HCVA 4OLXH 1OSPL 5K59E 1EO7A 3IJHB 2E86A 4HKJB 3TJHD 3C12A 3ISYA 5DJ6B 3IGUA 3E7JA 4FKHA 3NH7L 3QPKA 1J48A 3KJ4C 2PTTB 5EBLB 2DMGA 2W07A 3LKPB 3AJ7A 2YWYA 4EIUA 4GG6F 4KRPD 3CC5B 3V7AE 4QRRD 2KUTA 1HINH 3KCPA 1ET7A 1BLIA 2EVJA 4WTQA 4PJCA 3MV9B 1E9PA 4XB8A 2JI1A 1OE2A 1U8QB 1YEGH 2ZAGA 4AYFB 2VZOA 4XX1G 5AWNH 4I88A 1U8CA 1SEBB 1NFIA 2FL5B 2OL3L 1FYTD 2WKOA 2BVPA 3CUPB 4LMQI 2VDLL 2H41A 5JNYB 3G04A 4NC0B 1IQWL 3IDIA 2KH2B 5IFHL 3KR3L 1P5VB 2BC4B 3FRPB 3W3BA 4XC1L 3V79C 3MRKA 3H9HA 3RNQB 1U58B 2RD0A 3ASWA 2YOCA 5CIPB 5DQJB 3WE1A 3LAFA 2VSKB 3K46A 2NX5A 2EUWA 1QBLH 1SDDA 1T66C 5GJSL 3EDDA 4P5TA 4AGMA 3EJZD 3QHZH 3DOSA 5C0DA 3SPIA 1OB1A 1XIWB 1A6AA 1CG9A 1BVKB 3T8MA 1U8IA 1DQTA 2EIJB 2P7TB 4PGEB 1SN5A 5AW0B 2QELA 2XTJC 5E5RB 2Q8AL 5F3HA 5I8KL 3SJVD 2OMYB 3T3ME 3GS7A 3ARVA 5ADPH 1EXUB 3DX7B 2MSPA 3VI3E 2VJ0A 4XI5C 4XOAA 1JMZA 3TV3L 3H4FA 3U6XS 4JS7A 4ADGA 1M42A 1KZQA 3BH4A 4L23A 4L3EA 5EU6A 1NTDA 1NL0L 4TQHA 4PGBB 2P52A 5B1KA 5AAWC 5C09E 2F5AH 2NY5C 4BBWA 1ZGLB 5IJKC 3IDXH 4K2UH 5DS8B 1BQHG 1RJYA 2GIXA 2OJZH 3IGLA 1QKZH 2CE6A 1ZGLM 5HI4D 3KXFD 3TBTB 1A4CA 5I17A 2HT3D 1W2KT 2F5BL 1KUMA 3MOAL 3FTGB 4M3HA 1O7DE 5ANMA 3MRPA 4DO4A 4DPBX 1WO2A 5AL8A 4RVBA 2R9HD 2LVEA 5I28A 5CN3A 2VITA 1NBQA 1G6RA 2DKUA 2YKKA 1D9KC 4GRLB 1IBBA 3AY2A 2EEAA 2X6UA 2VGLM 1GCFA 5LB1A 3L4XA 4KNUA 1YJDC 4JFYB 4MA1B 4TVPD 5KVGE 1HINL 5DRWB 2RQEA 3QC6X 4NN6C 4RISH 4WU7B 2OYKA 3D1MC 2EIBA 2MMXA 4R3SB 4FQ2L 3NUKA 3DBSA 5AWNL 4BFIA 3LZOA 2BM3A 4BK5A 2CXKA 4E5XA 3EYUH 5F7WC 2GKIA 1IM3A 1ZLSH 2YPKB 4L4TB 4PJ7F 5KYUB 3BN9D 5EWIH 1NH6A 2AJXH 3G5WA 2XFXB 4QNPE 3GSUB 2X70A 2WWKO 3HHRB 3HPJA 5TQ2H 5C0CA 5DJZA 1L9QA 3ZZLA 3UMNA 2Y2YA 3PXHA 3CE1A 3KGUA 4DPCX 5IQMA 4M3KB 1QBLL 3L5JA 4PS4L 3UZVA 4BFRA 4LB8A 1KB5H 1FCGA 2TRYA 3KPQA 3NCYS 4PTTB 2QBWA 3QHZL 1ODUA 1VFAA 4B97A 1VGKB 1HYRC 3RVTC 3UYRH 3B3BA 2VQTA 3PJSA 4GKZA 5D1QE 3NCMA 4QHLA 1OTTC 2R7EB 2J5WA 3WU1A 1W0VA 4UQEA 1FCCA 2JCCA 2X4RA 5IJKA 1XV8A 3LZLA 2PN5A 2NXYD 4FYQA 2KDYA 3LQAC 5GZOD 2JKNA 5E4AA 2WSKA 1N59A 1PW3A 4L9LC 5ISZA 3P11H 4C56E 1HL9A 3ZE2E 2A73B 2R1XA 1HE8A 2Y0SA 2F5AL 1SOQA 2X4OA 3IDXL 3PNRB 4K2UL 4KKLC 4UV4H 3ULSA 3TZVD 2OJZL 1BIIB 2XKNB 4BZ1A 1QKZL 5LLIC 1JGVH 4K3EH 3WEOA 2C26A 5DC4B 2YIHA 4KNSA 5K93A 1G9MC 1F42A 1JVKA 1P7KA 4WZ9A 2EDDA 1G7LA 5HY9B 2Y2WA 1X5ZA 4UU9B 3QIUB 4FA8A 5J57B 4ORZC 1PMYA 5ICYA 3BN3B 2NDFA 1BQHB 3CQFA 3CLFH 1V55B 5KZCB 4KY1H 3LTVA 1D2OA 2JV6A 4JHAH 4IRZH 4L8DB 2ADJB 1HQRA 1X5IA 3BMVA 1A7QH 2W0KA 4OM1H 4E41E 1X5GA 1U8LA 5EZIH 4ZMPA 3D0LA 5I1AB 1JI2A 3RGVB 5FGSA 1WK0A 1SLXA 3K4ZA 4L1BA 3I9GL 5LBGA 4LRIC 3VAEA 2XWBA 2WLJA 3MRFB 1CL7H 3AQYA 4RISL 5ETUB 3S4SA 1A9BA 4BQ9A 1XIWC 1OLZA 3QUMH 1L0XA 1CFTB 2VWEE 3NJHA 3NEOA 4P4KC 4K5MA 1U33A 3PWPA 1N10A 3EXLA 4IOSD 4LLAA 3ZE0B 5AKRA 3DXAE 4LKXB 4Z7WA 5DK0B 3LRHA 3EYUL 5HPMA 3IGKA 4JY5H 4L4VB 5EZLA 1JZDC 5EWIL 1IAMA 2AJXL 2VQUA 4JHZA 3W57A 3P4NA 2VLJD 2BLFA 3JV0A 3O6KH 3BMWA 3CDYA 3PDGA 4FXGA 5C08A 5TQ2L 2VZTA 1PY4A 3BLKA 1CE1H 4WCYH 5MEPB 5F9JB 2ZCZA 4HJ0D 1KB5L 4NFBA 4WO4C 1KCBA 4PJXA 1F4YH 3UYRL 2WNXA 1TQCB 2A6DA 4L9LA 5C7XH 3DV4B 4FE9A 4M3JA 5MP6H 5I71C 5KUKA 3VRLE 1IC0A 4NKMA 4U6HB 4TSBL 4H8WH 4N2NA 2Y5TB 1MJJB 3EZ8A 1WC7B 5CHNB 4ZT1A 1O9WA 3CDFA 1TEFA 3HUJB 1MI5E 1XGRA 2EVIA 4GRLC 4KKRA 4R4FH 4HMDA 3P30H 4HBCH 3CVHH 4HIIB 1RK7A 5DJCA 1XGZA 1R3KB 4XAWH 5K1NA 1QWUA 4G11A 3JXAA 2XZQH 1IAKA 2VZUA 2L7QA 4MA1C 4RCAA 4UV4L 1B4JH 5GPRA 4ZODA 2Z65C 4K3EL 5IQLA 1IBFA 1M56B 3V0GA 3WENA 1RAMA 5E9NA 2O30A 1HHIB 4Y16B 4G1EA 2EVGA 2VW4A 4G83A 1DJHA 2W0FA 5F71A 3V7AG 1SXAA 2ZWNA 5DD3H 4ZO7A 2V6HA 2YAFA 2IOMA 3CLFL 4F8PA 1WFTA 1TLKA 4KY1L 1TZAA 2DF3A 3A4EA 4JHAL 2E74C 1AI1H 4LRIA 4IRZL 5D4IA 4OLVH 3CZGA 3VRIB 1CI5A 5JMOC 1A7QL 5DA4A 5TD4A 2EUZA 2EIEA 2O26U 4XNBA 4JRXD 5EZIL 4G42B 2SODB 3E0GA 4NQCB 2BK8A 2WBWB 4M5YH 1AD0B 3W0WE 5CUSH 4LCCB 5HHQB 4P2RE 3FU0A 1KJMB 4JKMA 1AGEA 2O4EA 1YNKH 4RGNB 2QGCA 1CL7L 1K72A 1E7VA 5IMKB 2OLDA 2XN9B 3QUML 1XZWA 1UD2A 4XP4H 5MERA 3GM0A 1RURH 4LLMB 3Q2VA 2DH2A 4P04A 5CJQH 2F7QA 1E9OA 3DTXA 1KBPA 2J7LA 4JY5L 4YQXL 3KH3A 2VE6A 2XV0A 3FUHA 3U6XA 4EJ1C 3DYPA 2L3BA 4WO4A 4X8CA 3DO3A 3O6KL 5HHVH 1MRCL 2QEJA 3RKDD 4XODA 2W8CA 1BPLB 5KYYA 1CE1L 3CCHA 4WCYL 4IU3A 5DLML 4KKCD 4GIAA 4ZMOA 1IIIA 4URTB 4JKLA 3TBWA 1NFDA 3QUXC 2IQAB 2OMWA 1L7IH 1S7SB 4QRFA 4PJ9D 4AM0A 5CEZE 5ITFA 1SJEB 3VD3A 1NCNA 2VDOH 4ZNCD 1F4YL 4H2CA 4YSSA 4Y7OC 5E0FA 3RA7H 4DKFH 2Q7NA 3CPLB 4PJDB 4CILA 5EU7C 5C7XL 3RZCC 1J1OH 1OKEA 5MP6L 3HZ3A 3EJTA 2YHGA 3VQMA 1LMKA 3D39D 3QIUC 2F54B 4H8WL 3KBEA 5F8RC 3P4OA 1TITA 3N1FC 5ICXB 4LGSB 1MWOA 2EYRA 4GKLA 4MYPA 1X5AA 3ULVH 5J3HD 5G5DA 3RY4A 2J4WH 2YEZB 3ZIMA 4R4FL 3P30L 1V7NH 4HBCL 1INEH 2DBLH 2X09A 3CVHL 3QUKA 4NO0B 2VQ4A 4MWFB 2CO4A 3RGVC 4G70B 4WSGA 3U0TB 1JZ7A 2XZQL 3VH8A 2X40A 1BPVA 1B4JL 3IFOB 4PP1C 4XE0A 3IKCB 1RZIA 4CJ1A 5D2LA 4YPGB 1IGYB 5IFAH 4X7DC 4ETQA 2X6AA 1G7MB 2XVBA 3BJLA 3QFJD 4UOJA 3BP4A 3SGDH 4W81A 1INQA 1T5XB 2X0VA 5DD3L 3DARA 1M1XB 4BE5A 4UYPA 4J12A 3OF6D 1H9DA 2DWYA 3BOVA 3K2IA 4OLVL 2AQ1A 3ILEA 2I26N 1ESOA 2WB1A 3QJXA 4M5YL 3T0XA 5CUSL 2B7DT 4ZD3H 3WMQA 4U6VH 3L81A 1YY9D 2OMXB 2VW6A 2YA1A 3AB0C 5JIKA 1J9QA 1YNKL 3FRUA 2FBJH 1NDMA 4KX8A 1I7UB 4XP4L 1TCRA 5D7LD 1RURL 1TQCC 3ATAA 3CX5J 4QGYA 1PZ5A 3VQLA 1L9MA 4DIXA 1JF1B 5CJQL 1FJ1A 3VXPB 2X2HA 3BWUF 4JO8A 1KWKA 4H13C 5KBPA 2C9UA 4P23B 3KW8A 3OXSB 5FUCE 1NC4D 1T4WA 3BFQG 1CDCA 3QUXA 2QPUA 1OGTA 4FTDA 4DO6A 2MKWA 1XDTT 1JVOA 3QNZA 4I0PB 4PMFA 1S7VA 5HHVL 5BNXD 1WBYB 4EN3A 2AK1H 3KM2A 3ULUC 5DJ0B 3DVIA 2E8ZA 4MD4B 2W59A 4MAYC 2VKXA 2UWEF 4QJ5B 1MF2H 5IB1A 1L7IL 4W93A 3O4OC 3BYYA 1HZHH 3LCYA 4HEPA 5HJ3B 4NQVA 1SMOA 2ED8A 1WAAF 2VDOL 1JZ3A 4JM2D 3RA7L 5MI0B 4DKFL 1J0YA 2B1OA 2CJ3A 3SD2A 5CILH 3ZJAA 2GTWA 4HCRL 4TS6A 4Y16C 1J1OL 3ECWA 3O8XD 4KI5D 4OKVA 35C8H 5CBAA 3C9NB 1TFHA 1TTAA 3C5SA 5JHMA 1SDAB 2P8PA 3CGTA 3T3MB 4Z7VA 1I1AD 4PJHE 1RUAH 4U3HA 5FK9A 3L3GA 4AXWB 3ZTDC 1BX2B 3VI3B 3ULVL 5B8CC 4WWPA 1AS8A 3VD9A 1VRSA 2YJQA 1JPEA 3NYKA 2J4WL 4UM8B 2R2CA 4WV1B 1UKTA 4ZTPH 4D7PA 4CMMA 1V7NL 2VW7A 2DBLL 5C09B 1CFNA 2OSWA 4DVBB 5DD6B 5FA3B 3QUGA 2Q9OA 2EEDA 2M8XA 1ZK9A 2XWDA 3EDJA 1NEPA 2LHAA 5L7XH 2OYMA 3ALWA 1UTDA 5IFAL 3KDMB 2N59A 3MMEA 1EHKB 3U25A 1MFUA 3DOIA 2GABA 1PNCA 3O9WD 3ZTCC 2O6DA 5HYJD 5I1JH 4YSOA 4X6DB 3TO2B 3DUUB 3H55A 3L08A 5C7ZA 2I7OA 3ATBA 3D0VA 2ITEA 1T0NA 1UD5A 3E6FB 3PQYE 3V9FA 1Z1WA 3OKMB 5DDHB 2D8KA 4X6BB 4WI6A 3O0LA 4L5FH 4WGWB 5DA0B 5FA4A 1J8HE 1GRWA 4LKCA 3RGHA 3L7FA 4XBPB 3MBED 1V8HA 3MV8A 4M8VA 5I18H 1SDYA 2XTLA 2A83A 2XQYK 3CZFA 4ZD3L 3WN5A 3IJ9A 2Z31B 3DI3B 4U6VL 4UM9D 3QUYD 4AYDC 1SBBA 1MLBB 1OTUC 3TBVB 3MCYA 1E4XH 3DUSB 1L9RA 2GW5A 2FBJL 4B6ZA 5SWSB 3VXSA 3Q13A 4MD0B 4NM4H 5DD5H 2W0PA 4POYA 4ANUA 3D3VD 1F45A 2R2BA 1CFSB 1XZ0A 4YVUA 4WWNA 2XPYA 4L8CA 2Z6FA 5J7CC 1HKFA 4F2FA 3QRLA 2BIHA 1BD2D 1T2QH 3CX5K 2FAUA 2KZKA 1FZOB 3PCYA 2CGZA 5J06A 2WPGA 1H0DA 4NQTA 4HXAH 4Z8FH 2AQQA 2A9BA 3GRBA 1FN4A 3PXJA 2CKBH 1MF2L 4MNGA 2XLLA 4B9CA 1HZHL 1L9SA 1QLRB 1D6VH 3CK0H 1V3JA 4BM7A 5D1QB 3MREA 4H88L 4HIHA 1B0WA 4BJLA 2IGTA 4QJ4B 1BEXA 4NDMA 5CILL 5B8CA 2WP3T 4UDUA 1WFMA 3GNMH 3RRQA 4ZPTB 1KXHA 3KCWA 2I25N 3NSYA 2ZSVA 3ZUCA 1FG2B 2GSIB 3OB8A 4CN1A 2WXKA 1ZY9A 3R1GL 4GPVA 4ISVA 3V0AC 3T77A 3P2DA 3OKEA 1RUAL 5ESQA 1LYQA 3TT3H 4F8OA 4WW2A 4ADJA 2C3HA 3EH1A 3WJMB 5GGTH 5AD0A 4YPJA 5TE4H 4ZTPL 2YXWA 1UZ8B 4DSYA 3UCQA 4C56B 2MQ3A 3ZE2B 3U1SL 1TTCA 2UV3A 1XMEB 5HVGB 2EXTA 4YVNA 1HC1A 3QDJE 4QDGA 1PX8A 4LSVH 4N86A 5L7XL 5EO0B 4PRIA 3RWCB 4LT7A 3ZDXF 4WU5A 3CDGB 1JAEA 1NGZA 2BNQD 5I1JL 3MN8A 4LCWA 4PJBE 5CP7B 3QQ3A 3RILA 4JHBA 4QCIA 3RL1B 2MH4A 4Q4EA 3H54A 5IOPB 3S88H 3N0PB 2CLRA 4L5FL 1NC2B 3TIDA 4E41B 3U6RB 4I0PC 1JYWA 2X6BA 3JWNG 1N12A 4E9LA