4B0MB

Complex of the caf1an usher domain, caf1m chaperone and caf1 subunit from yersinia pestis
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
135
structure length
135
Chain Sequence
EPARITLTYKEGAPITIMDNGNIDTELLVGTLTLGGYKTGTTSTSVNFTDAAGDPMYLTFTSQDGNNHQFTTKVIGKDSRDFDISPKVNGENLVGDDVVLATGSQDFFVRSIGSKGGKLAAGKYTDAVTVTVSNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords F1 CAPSULE-ANCHORING PROTEIN
publication title Allosteric Mechanism Controls Traffic in the Chaperone/Usher Pathway.
pubmed doi rcsb
source organism Yersinia pestis
total genus 27
structure length 135
sequence length 135
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF09255 Antig_Caf1 Caf1 Capsule antigen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1310 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4b0mB00
3DPBB 1P5VB 1Z9SB 4B0MB 1P5UC 4AZ8B 3DOSB 1P5UB 4AYFB 3DSNB
chains in the Genus database with same CATH superfamily
1MQKH 5FECB 3Q06A 3UAJA 4PEEA 1MRCH 5DZ9A 4CBZA 5ADPL 2XWDA 2YD3A 4JFXB 1CU4H 2Y7QB 3MYZA 1DEEA 1IGJB 4KOCA 1Z2KA 1IFRA 4OJFL 2HRPH 5HHXH 2FB4L 1ZK5A 4O4YL 2BC4A 4PTUB 2HUHA 3AS0A 1Z32X 2GJJA 2IGTA 4RVBA 2VUOA 5DJXA 3IBOA 3D0VB 4NZFA 4N2BA 4F1SA 4JQIH 2L3BA 1NC4A 3GSNL 3OV6A 3QDMA 1LO4H 3N40P 5CP3H 1XAUA 3Q5TA 2I9LA 2GCYB 2RJMA 2H45A 3C5JB 3UO1H 5HHQA 3PIQB 1UZGA 1WWCA 1TNMA 4OFPA 1GTFA 2JJSA 4UINL 4Z95L 3L3IB 4E41B 2B08A 5C7XL 2CO6B 1AKPA 1JGEB 5DVOA 1F02I 1JHTA 1PQZA 2CNYA 4GQRA 1ZDQA 4N5UA 3QHFH 1AVAA 2TRYA 1ZA3B 5E9DB 4JPWH 4X9HA 4XN2A 3OJDA 2KZBA 4Q6YA 4BFOA 5C9KA 1MRDH 4LP8A 4Y2DC 4M93B 5E2VL 4W6XB 3ZKND 4A7VA 4PJDA 1PZUB 4XMTA 3BPOC 3M86A 1KWGA 4NQXB 3CDZA 4AQ1C 3AXIA 3BJ91 1V10A 2X44D 3FUHA 4IKJA 5TDNB 3CDCA 1H15A 1F45A 1ZLEA 1KDJA 2B2XL 2B5IC 5DURB 5E6UB 1LE5B 1A4CA 3ELQA 3DXAE 3D51A 4Q6IC 3FQTB 2O72A 5BQ7B 3DJZA 2OYKA 4JLRA 1KCSH 2FHFA 4I85A 3L3HB 1BOGA 4ZXBC 3WUWA 4KPHH 3HPLA 3RU8H 3DPDA 1TJMA 3BP4A 2BVPB 5HD8D 32C2B 1J88A 3HIZA 2CDEA 1XGQA 4Z7WA 3ASWA 4JRYD 3A21A 1GGUA 3QUYB 4ZNCD 2QSVA 3CD4A 3CMOH 4ZOAA 5J6HB 4FMVA 4MZRA 4H5SB 2DQFB 3SQBB 5D7KD 3I75A 3V9FA 4R4NC 3W11D 5LXVA 2A9BA 3D8MA 2YJQA 1J9TA 4YDNA 1BOYA 5CD5D 5GGRA 5EF0A 3TNMB 1P4BL 1G43A 4ZUVA 5HYJB 2A73B 3HE6A 4PJ8D 3SDXE 2FHBA 5B21A 2EUWA 1CDBA 1IVTA 4EE2A 2Y72A 5DU7A 3SE9L 5C0GA 4KFZC 2ADIB 3NUKA 2GY7B 3UAEA 5LQBL 1RPUA 1CF1A 1T2QH 3GLZA 4YIQB 5ETUA 2VLLA 4V1DD 3P3RA 2VJ8A 4UQ2B 2EVGA 5AW7B 4G2AA 4YZWA 1B0RA 4GKNA 5DJXB 4UT7L 3HHRB 1LD9A 5LAPA 3I6LE 4K3DL 5AAPA 1U4EA 5ANHA 5D8JH 3IVKA 3QUXC 4JG9A 1ONQB 3NTCH 2HYMA 5EC1B 4HZAA 2UZYA 2P24A 1NC2A 5L4IA 2F8VA 3F5WA 1LE9B 3QB7C 3FTZA 4Y5VA 3OLIA 1J8SA 3AREA 4WI3A 2ZP9A 1NFKA 3BSGA 4HJ1A 1TPXC 3IFPB 2O5YL 4B3VA 5L8LB 5DK0A 5LWYL 1E9QA 1QWUA 1PQZB 4R8WH 3TFBA 1OW0C 5EOCJ 4U05A 1LQBC 3NIFE 4MDIA 3OJDB 3V0HA 1MH5A 4F8QA 4ECNA 4EDWH 1WD9A 2EDFA 2JKTM 3MDJA 5EU3A 3ES6A 3II1A 4A6YL 3FSWA 3IDJA 5B7FA 5KN5A 1NGQH 4PJDB 4EIGB 4MLIA 4BZ1H 3EOTH 3MRGB 5C3LD 1XGUA 3CDZB 3ZE0E 3MRNA 1AQMA 1EBAA 2VLJE 3EJZD 1H15B 2J21A 2VC2H 3U9PL 2IIJA 2OJEB 4YBLC 3DYMA 4AC2A 1FE8L 1LP9A 2ZUQC 4JLRB 1A3QA 1ACXA 5CF3A 5KBLA 1BOGB 4PRAB 3WUWB 3WJMB 5D2NB 1B0WA 1FGVL 1CGSH 1QI4A 3LKNB 5BV7B 5IHHA 1PD1A 1J8HA 2CDEB 2A74A 2OL3A 4QRBA 4D8PA 4Z7WB 1XCQA 2Q1EA 5LNDA 4LDOB 2QHRL 4Y4FA 3ZR6A 2IFFH 4JFHE 5LAXB 4MKMA 1A3LL 1KYOJ 2YSSB 2A9DA 3JV6A 1CO1A 1CI3M 3I75B 2WNGA 4WEBH 2PCPA 2BP3A 4ZQKA 2IC2A 4WRLA 5JDJA 3SDYL 3ARDD 4Y89A 2YD2A 4M61A 2ZD0A 4IGBC 3EDJA 4ZUVB 3HE6B 4NZ8A 1NIDA 4PB9H 3A67L 4DUWA 5CJQH 4OY9A 4NN6B 4G7YH 3CX5K 5D4HA 1J0IA 4K71C 4YNYA 4DIXA 2EO1A 4N1EA 1R3LA 2G3ZA 3WNPA 3AROA 3VWJA 4AWJC 1YEIH 3L2NA 4HV8B 1D7BA 4HHGA 1R3KB 2I32A 5K5YA 2J73A 2VLLB 3CUPA 3VXMA 5KZCD 5B1BB 1B0RB 2DIBA 2PR9A 4GKNB 3B1TA 2PW2A 1LD9B 2VDOH 1J5OL 2FQEA 4TUUA 1D5RA 5H2BB 2WXLA 3T3PF 3FUDA 3FK3A 4KKRA 1UACH 5EUOE 1PDKA 1NCBL 5IB3A 2PR4H 2UZYB 2P24B 1NC2B 4C4BA 3NFPA 2OAAA 2DWEA 2N59A 3TT1H 4FTVD 3VA2C 4Y5VB 2R56L 1CLOL 3W81A 3AREB 4G1MB 3VG9C 5IHZA 3IE9A 3IAGC 4P23B 3L4WA 1PLCA 2PYED 4DVRL 5DK0B 5IB5B 1E9QB 3DBSA 1SYSB 1Q0EA 4L48A 4MDIB 1MCSA 2HT4D 4HJIA 4AENB 1MH5B 3MACL 3O2DA 1FZKA 2VDQB 4NO0D 2YGOA 5EU3B 2ZSVB 5HYSA 2VLKD 2HX9A 2R1YB 3ES6B 4H8UA 2Q8AL 1A7OH 5KN5B 3ZSSA 3AWEA 4P2OD 3OD3A 4J3OC 4MJ4A 1CQYA 1OTTD 2AK1L 4GPVA 3SD5A 3FH7A 4DZBA 1PKQA 1MFUA 1U91A 4X6FA 5I5JA 1TF4A 4E68A 2Z9TA 4ZTPL 2GJ6D 4RAVB 3RGVD 2NDGA 5D2LE 4QRUA 2BIOA 4ZMZA 3NCCB 1LP9B 2B4CH 3OGOE 4OZGF 4NAQA 2XRAH 2VXSL 5E23A 4YXLH 1O9VA 1ZGLM 5F6HJ 3FDWA 3IGUA 3TBVA 3VRLF 3PL6A 2O5NA 4HZLB 3QRFM 2V2XA 3CDYA 3V5KA 1TUPA 2OL3B 1J8HB 2A74B 2KL6A 3GBNH 4JREB 4D8PB 1WAPA 1CDHA 2NOYA 3JZYA 1F3JA 5E99H 3P30H 4Y4FB 3BT2H 3CVHL 1ZRUA 3O4OB 3JV6B 3ARBD 5T5NG 3R4DA 3OX8A 3F01A 1W6WA 1QSFA 2PCPB 3ARGA 4ZQKB 2EH7L 1OCRB 1E7UA 1UKTA 4BFKA 4M61B 4GRLB 4YFEA 4LEXL 1GGCL 3LAFA 4IHOB 4OZIF 4Z18A 1T6WA 5LDSA 3LCYA 3TBYA 1JGLH 4POZC 2VABA 1BIIA 5H35A 3QUMA 4WIQA 3BZEA 4YNYB 2AZAA 1LM8V 2I7SA 4QOKB 1H8NA 5E94B 1LEGB 1U3NA 5JHLA 2Q86A 1TOXA 4IHBA 2XHNA 3RTQA 2VL4A 3FT2A 3T2NL 5A3ID 3F65A 3FCSA 3CUPB 2ADFH 4ZOBA 1V7ML 4JPIA 2X88A 1Z1WA 1AIFB 5E51A 3VI3A 1NAML 4JQVA 3BVNA 1NIEA 1IC4L 1DSYA 1G4MA 5IB3B 4K0OA 4NSKA 5B8CC 5ADPH 4X5RA 2OFQA 4XP9L 3ZKNC 1AANA 1FDLL 3NFPB 2DWEB 1CFNA 3KDMB 4OJFH 4MA1C 4JM2D 5IJBC 4B9CA 5IHZB 1RP8A 2FB4H 7FABL 4QXVA 4PWHA 2X6UA 4ZPVA 1ADWA 3SBWC 5ACLA 4LOUD 3PGCA 1AHWA 3UJIL 1RSYA 1O7DC 4XMVA 3GSNH 1S6NA 3ME0B 1XTMA 3WEMA 4O2EA 1FZKB 5HYSB 2P80A 3WO3B 2WTOA 3HI6L 4Z95H 4UINH 4ZAKD 5HD8C 3BQUA 1I85C 3RZCB 5C7XH 3F7RA 3BGFC 1U91B 3BLBA 3FCBA 3ZZ1A 1DHKA 1T3FB 5B22A 1ZHBB 1SBSL 4UZSA 2KI6A 4ORZC 5IMMA 4F7KA 4QO1A 1DQML 5FW8A 3W11C 3WNOA 2K6YA 1FVDA 3W57A 4N22A 2R0KL 4Y16A 1KBBA 4YHLL 3BRFA 3O6LL 5E2VH 3EIFA 4X6EA 3UEQA 5IT2L 3G6DL 2NNCA 2V2XB 1DVUA 4ODBD 1ZLWH 3ECQA 2AAVA 3ULUF 3PHOA 2CHNA 2DWDA 3SO3B 1CR9L 1F3JB 2GTQA 4FHKA 2IXQA 2B2XH 4YXHL 4K7PY 4RA3A 4A7GF 2WXRA 4R84A 2KLSA 4E42A 5EFIA 3B4NA 5C6PB 1QSFB 1ZMYA 2YXMA 3ARGB 3B2MA 4CNIA 1F8TL 4MBOA 3CC1A 4UTCA 4KRLB 5J4MA 3B8SA 3FFDA 4IU2A 3KYAA 5A16A 1EANA 1CICA 3TBYB 2F8IA 3CH8A 2HPTA 5HDWA 2DQIL 4JFPB 5EZLA 4JK0D 5H35B 4PYHA 4WF7A 2E8YA 5IUSA 1TQCB 3G5YA 3FT2B 1ODAA 4G5ZL 5IB2A 1N64L 2FEEI 3FCSB 1WWWX 4H8VA 2MH4A 3EUDA 3ROOA 1P4BH 3PFUA 4OGQC 4MMZA 3VI3B 1EDYA 5ISZD 1U30A 2EYSA 3T65A 1IBYA 4WSKA 3BVNB 3SE9H 1NQBA 3KXFA 4NSKB 4EIUA 3V4PA 1RUAL 5CBAB 1Q1PA 1BZOA 2OP4L 4LOFA 3AW5A 2YGNA 3M45A 1YY8B 4RX4D 2KDYA 4L8SB 4KVCL 4AY0A 3JTSB 4ELDA 4UT7H 3MV8E 5CCKL 1A25A 1PAZA 2WB7A 4BDVA 5JIPA 4K3DH 2HX7A 2BOCA 1AHWB 3CFJB 2H3KA 4B9JA 4Z7NB 3NPSB 3JUZA 5J11C 3K71A 2VWEC 2F9BT 3BVTA 4O2EB 4TNVK 4KKLC 3IWVA 4OVUA 3ZO0A 5FEBA 1K5NA 3QC6X 1K5WA 2C3XA 2CKNA 3CZFB 1K9TA 2K7QA 1FVEB 3BQUB 1PX4A 1TEGA 4KXAA 2R39A 1T5KA 1V05A 3CLWA 5D1ZD 5D2NE 4H88L 2O5YH 5BOJA 4PP2A 3R1GL 1DCLA 3KLAA 3PU7A 4P2CG 5LWYH 1WWBX 1F00I 2BVTA 5IMMB 3FW6A 5ICZA 1UWYA 3N42B 3QJZA 4HIXL 2Z64C 4AW7A 1KIPA 1KENH 2EP6A 1F11A 4QRAA 4U3CA 2HMID 4U0RB 5HHOA 3A23A 1IU1A 4A6YH 3DHJA 1DUZA 3ARDC 3SGJC 4YHYB 2WWNA 1WCBA 1USZA 3L6FA 4X6EB 3WNNA 3RX5A 1UGNA 4LAQL 3K7UA 3PHOB 2DWDB 2R27A 3BPNB 3LIUA 4ODTL 1DQTA 4G80A 4QLRA 5HBBA 4IRJC 1UD2A 4JPSA 2IXQB 1EJOL 3RDTA 3U9PH 5M7QA 3BFOA 3VMOA 1KBVA 3IE4A 1FE8H 3RHWF 4CNIB 5J3HD 3NJLA 3LS5L 1FGVH 1JDDA 1FVCA 3FFDB 1NBZA 2CBPA 2YWZA 1BZ9B 3RIKA 4JY4A 3CPLA 2NZ9C 4PJHF 1XH3A 4M62H 4BKSC 1CICB 3P2BA 4JPKL 5BNXD 4ZX6A 1ICTA 3RVTC 2QHRH 1H3UA 1QO3B 3E38A 4HHWA 4MXWL 5IP4A 3CFNA 4BE6A 1A3LH 1LYQA 4G5AA 4IJTA 4CN4A 1CLZL 3G5YB 3MRLA 1R3IL 3EFFA 1O9ZA 4X50A 3ZO9A 1ILUA 5IB2B 3L3DB 3RY6A 3VD9A 1J0HA 4UCFA 4GP4B 4JGNA 2MMXA 3ROOB 1KCBA 2QQNL 4PJFF 1OZUA 3REVA 3A67H 2OMWA 3R0NA 1QBBA 3AT9A 3FH5A 5E2TL 3T65B 2PPDA 2HT4C 1LQSR 3NSCA 2BM3A 2OW6A 3KXFB 3MLTB 5T1LA 4HULB 3BH8A 3QG6A 4Z7IA 4ZFFB 3PJSB 2NPLX 3N1MC 2ZKHL 1OTTC 1TQWA 1DJSA 1PLGL 4W4OC 3ZIMA 4RWYL 5DVPA 1E3ZA 4HOZA 4ODSL 1J5OH 1JDCA 1JCVA 1MW1A 1T4WA 3FUJA 3OZKA 4OGAC 4BK4A 4PJGF 4FLRA 1LEKA 3EO0A 4P5MA 2NSXA 1XMEB 1JPGB 3COOA 1NCBH 4XAWL 1I7UA 1T21B 3INUL 1ULVA 3OPUA 1EHKB 1K5NB 2G5UA 1CE6A 4P9ML 3LXAA 2R56H 1CLOH 4JW3A 2OMZA 4WFGE 3WFEL 2YHGA 3GI9L 2WQSA 3ZQ9A 3RBGA 5BCAA 4MS6A 1CYXA 3KLAB 4DVRH 4PS4L 5DHYA 2WINB 5AW6B 5ICZB 2VLME 4J2XA 4U1MB 3DV6A 5K1VA 2YD4A 3ARBC 3MACH 3MO1B 5BRZD 1INQB 2Q8AH 2ICEC 4BFBD 2ZCHL 1DUZB 4R9HA 3L6FB 2YQGA 1BMGA 4J3OH 4O5LL 4PJFA 3V0WL 2AK1H 2HT2D 1ORQA 1P4UA 1H0DB 1WITA 4G80B 3L2MA 3NJGA 3PY9A 3QCTL 4ZTPH 5C0IB 2AXGA 3FT4A 3KAAA 3RDTB 4Z78B 2XWBA 4XAKE 1SMOA 3TH3T 3QWNA 4AGQA 4QOKE 5FA4A 5A3IC 5CLXA 3S4SB 4M7ZC 2VXSH 3BN3B 2WPGA 3DX1A 1IBBA 2FQGA 4N86A 1FVCB 1MHEA 4YBQD 3QUZD 4EN3C 4I9WE 4NCC2 3T1FA 3B2DC 1DVXA 4JY4B 3CPLB 4E9RA 1XH3B 1AGCB 1UYWL 4NQCD 2YLHA 3OKNA 5DQ9A 1OV8A 5LLIC 5JPMA 3CVHH 4LCWD 4PWGA 1URZA 3K8LA 4FYQA 2BRQA 4L4TA 4JM2C 5E70A 3UTPD 1A9EA 2H47C 3MRLB 4P4RA 2HN7A 3EFFB 5JYMA 1G84A 3DMMB 3ZL2A 4F93B 5FO2A 1A7NH 2VCOA 1HK6A 2EH7H 4FCAA 4LEXH 1GGCH 3VX1A 4UQAA 1T6BX 4MA3B 2YAPA 4X99A 1NUFA 5L2KE 1TO5A 4N2KA 1WPCA 1N59A 2F7IA 2AJZA 3KPTA 4R7NA 5ABZA 3QG6B 3EYSL 3FHAA 3T77A 3UP1A 1JZ2A 4M29A 5IOPB 1XGRA 2FX9L 5DD6A 2ZAIA 1DSFL 3T2NH 3KPNA 1D7FA 4IRSA 4MD5A 43C9A 5I75C 5DRZA 4U1HB 3AFLA 2XY1A 2QPFA 1V7MH 3LXUX 2C7FA 3KEDA 4GW5A 4AYFA 3STLB 1IKNC 3GT6A 1GZHA 3GXTA 3ZDWA 5IQMA 2CUMA 4MVBC 3QUKA 1PZDA 2XTJC 4L18A 4FAAB 2FEDC 4G9DA 1U8HB 4P5MB 1IC4H 2JB5L 1UASA 5ILTL 1YYML 3QFGA 2F1EA 1I7UB 1ZVSB 4XP9H 1UB5B 1IL1A 1FDLH 1CC3A 2Z92B 5M95B 1CE6B 4Y9CA 5IEHA 1OCWL 4HWZA 2OMZB 4N25A 3TIDA 3D0LB 3HG5A 7FABH 1CYWA 1S7WB 2D7OA 2B7DT 4OZFG 1AO7E 1ID5I 3NA4A 5I74B 5DHYB 1JWUA 1NGPL 3UJIH 4BFFA 1G9NC 3QRGH 3DV6B 1RZ8A 1G9NL 3ZBMA 2JIXD 4LPTA 2Z7ZA 1IUZA 2IQAA 4CC4A 2VZSA 1MHCB 1F4XL 3HI6H 3TIEB 2RTTA 3ZHNA 1XH0A 3D0AA 3QIUD 1EX0A 2KKQA 1I1YA 1Z5HA 4JKWA 3FMGL 4LCCB 2APBA 1GVIA 4NO5A 1T1XB 1LMIA 4N0UE 3LNHA 3D7PA 1N5AA 3PWNA 3X1GA 1SBSH 3FT4B 3DJTA 4IDLA 3ML8A 1DQMH 5K9JL 3VYNA 5FA4B 2YAEA 4YHLH 2R0KH 4CL7A 2XG5A 3FTSA 2I5YL 2XI9A 3BXNA 3O6LH 3UBXA 5BJTA 1UD6A 4NUJB 5ICXA 5IT2H 4JO4H 3QI9B 3G6DH 2HVBA 1SGKA 3HUJA 4WFFD 2ZXEB 1FL3A 1QEXA 3B9EA 1CR9H 3H7LA 4JCWA 1TQTA 5DQ9B 5TTRA 1B6UA 1KC5L 3O8XD 5JPMB 4F8PA 2RH0A 1H6FA 2IMNA 4L4TB 3NCMA 4QHLA 1A9EB 3DRTB 3FTUA 4P4RB 1DQLL 2HN7B 5JHDA 3MREA 1OF0A 2IEPA 1E5ZA 4CMHB 4OW6A 1MFBL 1TSHA 5B39G 2UVFA 2HT3D 4J1UA 3ZTDC 3CZEA 4X99B 5HI4D 2DQIH 4MJIB 4DP7X 1DZ0A 2D3VA 2F53E 3KGTA 4KC3B 2AJZB 1ZT1A 2HCZX 3R7QA 4R2GD 2D73A 1EGJA 4FXGC 4NPYA 1MI5A 3GMNB 3IRPX 4AGPA 4FNLL 1DBBL 1T5XB 1OE3A 3KPNB 4G5ZH 4IRSB 1N64H 4YFDB 5D1ZC 5EA0L 2BW4A 3LZRA 4BSWB 1GMIA 4DP2X 4AYFB 1RZPA 2PXYD 3FKUS 1A6ZA 3U79A 5A43C 5K39A 5CSZA 3VXRB 1QHQA 4Z3HA 4PMFA 4RGNB 5JHBA 1PS3A 1Y7VA 2BXYA 1F41A 1RUAH 1IL1B 4XMWA 2ZSWB 2HJFA 2OP4H 4WSJA 4XMXA 3RVWD 2OJZL 3UGXA 5IEHB 3N43B 4HWZB 2X05A 4L3AA 2VR4A 2Y5QA 3KPPA 2P28B 4KVCH 4WQOA 1ADQA 2G2RA 5CCKH 2YPKA 1V8HA 3WO4C 1XH1A 1JWUB 3UDWC 2BFVL 3ABMB 2K3TA 1A7PL 1W72A 3L45A 1SLVA 2WOBA 4QXGL 2IQAB 3FJTA 3LN9A 5J3HC 4CGUB 1KFGA 1YQVL 2Q6WA 1OGAE 2FJUB 4E9SA 2XWJB 3TGXA 4NO5B 2L7JA 4H88H 1N5AB 2WVUA 3PWNB 3R1GH 4H8PA 4O51A 3STZB 4JJHA 5I66A 3QEGL 3BCFA 3QDGD 1WBZA 1U8PA 4HIXH 4RAHA 4WSGA 4TYUA 2ED7A 4BXVA 5MEND 4B9GA 1REIA 4JRXE 3FXIC 1S7SA 2C34A 4FXKC 3L3KA 2XG5B 3KLDA 2J8UE 3BXNB 5ICXB 4Z7UE 1HQ4B 3ZL4L 1BX2A 3U6XS 5KS9E 4LAQH 1S8DA 4ODTH 3VACA 2MKLC 3HUJB 3M17A 4JE4B 1FL3B 3DUSB 3N5AA 1EJOH 1LWHA 3VXQA 5IEKA 3V5HB 4B9ZA 4P8QA 4F7MA 2PWEA 1KCWA 3A6CL 3BAEH 4GQPH 3LS5H 3MREB 2WYIA 4QTIL 4CSZA 1HS6A 3T9WA 3QJTB 4KQ0A 4ZT1A 2QKIA 4J1UB 5D96B 4JPKH 4NO3A 4XNZC 3Q05A 5IVXA 3DECA 1I1CA 3HFFA 3NIGF 2C4XA 4MXWH 1ZLUK 4K07A 4NPYB 3OR7A 3ELAT 4PU2A 2VQ1B 1MI5B 1CLZH 2H0FA 1R3IH 2W1NA 3IMRA 4X4MA 4HIPA 4L9LC 2OMNA 5E2UL 2QQNH 1XF5A 3BD4A 1A6ZB 2VDKB 2HXAA 4QRPA 5K39B 3AY2A 3DX8A 2WYHA 3D85D 5E2TH 3NG5A 3OPZL 3OLDA 4Q9QL 4IBYA 4NC2B 5G55A 1Z0MA 5F9AC 2IFGA 4NT6A 3VRIA 2QV4A 4P07A 4U3HA 1MFCH 2HJFB 5IFJB 4V2CB 2ZKHH 4W9JC 5D7JA 1VFAA 1ETZB 1PLGH 2KLRA 4RWYH 5C1MB 5IJDC 3B8YA 2ADYA 5IROA 1FO0L 4MRBA 4ODSH 3KR3L 3TS8A 2DMCA 3E6HA 1UB6A 4PCSA 3T8VA 4ZW5A 3VWKD 1URLA 4XAWH 2QFPA 3INUH 2DJ4A 3K6DA 5KSAD 3H2PA 3KWWA 2Q6WB 2DKUA 2YIHA 2CUHA 3F6LA 4HEME 4P9MH 3Q3GB 5EMYA 3CFUA 4OUOA 5E8DL 4BQCA 3WFEH 3IDXL 3TEZA 3GI9H 4B7LA 3C09B 4O51B 2NY1C 4PS4H 1I4FA 4AL8C 4MMYB 4P0DA 4Z7QB 5B7EA 2NQDA 1NINA 2X4RA 3AS1A 2AW2A 3M88A 1S7SB 5LB1A 5B7MA 3L3KB 2ZCHH 4D0CA 3LY6A 4QT5B 3AGWA 2A6DA 4XMUA 4H25A 4O5LH 1I1FA 3FNKA 3V0WH 2W5PA 2BSDA 4LIQE 1L9MA 2R23B 1NUGA 3QCTH 1MCKA 4UNVA 2PTVA 4QHNA 5IEKB 4AQZA 5KSBA 1B0IA 4WO4B 3MRKA 1Y1DA 1ZV2A 2Y0SA 3IJYA 1GSKA 2XVBA 4LRIA 5ALCL 3KLHC 3WY3A 3H9SA 1NFAA 1OALA 2W95A 5EOTA 2FO1A 1PD6A 3P9LB 2ENYA 3OKEA 3IJHA 1Q38A 1UYWH 3OG4B 4LDEB 4YQXL 4G8AC 2QPEB 4NO3B 3SQOL 3WTXA 4OT1L 4X9YA 3UOAB 1X5AA 2Z0BA 3DARA 4DP0X 4KXZH 5GGTL 4HLZG 5GS2H 3MX0A 2J8OA 3OR7B 4KZCA 1JE6A 2NY4C 1OK8A 2V7HA 1Y6NR 2CGZA 3PXLA 3Q5OA 2YLKA 3HMXL 5DHVH 3SDAB 3ZRSA 2YN5A 5JW4R 5AVRB 3CHXA 1VFBA 3LRMA 1RY7B 2Y36L 4QRPB 4XNYL 3DX8B 3I3EA 2WB1A 2WLLA 4JY5L 4Y4HC 2WLNA 5IVZB 3SJVD 3EGSA 3EYSH 4JRFA 3V55A 5K9KA 3L13A 2FX9H 4LZKA 1DSFH 1JK8A 4KV5E 5ABDE 5D7JB 1CXFA 1L0XA 1U8MA 2KUTA 3QJUB 4TQ8A 3L3JA 5DI8A 2VRAA 4J6IA 4JRWA 4WKXA 2PTUA 2YUVA 3E6HB 3RWHA 4HXBL 3MRDA 4D9RE 3SY6A 2N0KA 4FL4B 4DQAA 2PNDA 2JB5H 5ILTH 3DURA 1YYMH 1ZHLA 2RFXA 4UILL 4PW4A 1BYOA 2EDDA 5E6IC 1XT5A 3IU4L 1OCWH 2EDRA 5KVDE 3IRCA 4NCDA 3IDMB 4A2GA 5IHBA 1J0JA 4KU1A 1NGPH 1I4FB 4P4KD 5E00A 1G9NH 1U42A 3HC0A 4Z3FA 3FN3A 3HZMA 4Z9KB 3SBRA 1WICA 3BSZA 3JQOB 1F4XH 4AGMA 2F0CA 2O30A 4D0CB 1L9TA 3S8GB 4F2MA 1JOIA 5GISL 1MHPL 2LOEA 5BOZG 3FMGH 3ZTNL 2BVQA 4HWBL 5GSRB 5F89A 2IPUG 3VSQA 3W0WB 3GYRA 5EU6D 4PJXE 1I8IB 1S3KL 2F08A 2YD9A 4IIQC 5DJ8B 1V3KA 3GLDA 3QDAA 2VKXA 1FNHA 1HSBA 1A6UH 4LSQL 5K9JH 1B4TA 4GP8B 4AGOA 4R2GC 3MRKB 3QH3B 3PWJA 3ZTEA 1YMHB 3IJYB 1QWHA 2VTFA 4X6CE 4GEIA 2I5YH 2N4IA 1RH8A 1YHPA 1GS6X 1QI5A 5EOTB 1PFOA 3QZNA 1U3HB 3OKEB 4HJTA 3GI8L 3IJHB 3K0YA 3TXAA 3NJVA 1W91A 2QADB 4OBSA 4EZJA 4ODXA 1KC5H 3FOMA 1T20A 4RGNE 4NBXB 2ZONA 3B7SA 4U1NA 1NPUA 5FKAA 1DQLH 2FH6A 3I6GA 1LK3L 3KE0A 3KYNA 4TVPE 3K46A 5FO7B 1MFBH 1SNRA 5IBUG 5IK3A 3DV4A 5C3TA 1WUZA 5DJAA 2DIEA 2UX7A 3ARFC 3O0RH 4LHJB 4PRPB 1K2DA 5EEVA 2XWRA 4WO0A 3EGSB 5DJ0B 3IMVA 1QPXA 4WCYL 4Z3GA 2WKLA 3MA9L 1JK8B 3ARRA 3GFUA 4FNLH 1DBBH 1RZJC 3ETTA 3ULVE 2GEQA 1RZJL 1WAAF 2AQTA 5EA0H 4HK0B 2BVYA 2ITCB 4Y19D 2BNQB 1YCSA 4X8JB 4NUQA 4RZKA 3RWHB 5KBDA 5AB1A 1NEUA 4K5NA 1E6OL 2ED8A 4OIFA 4XN8A 5D7IB 3IN0A 1SXCA 5GQBA 3CSBA 1AFVL 3DURB 1ZHLB 3DIFA 1CGTA 5FW6A 2RFXB 5BO0D 1PLAA 4NPKA 2OJZH 4UM8A 4GRMB 2XXGA 1SDDA 1JYVA 3RWIB 5C71A 5D93B 4HUXA 5JW4Q 2PO6C 3BSHA 1BYPA 2BFVH 3H2QA 1A7PH 2IG2L 1HAUA 2QZQA 2ZE0A 4QXGH 4V1DA 3HZMB 4JFDA 4PJIE 1MAJA 1CDUA 1YQVH 4P2RD 5DVNA 2BIIA 4F7EA 1P1VA 5DRNA 4Y1AE 3EFDL 1E7VA 2BVQB 5D1XD 2XZZA 5IQLA 5EU7E 3PJLA 3QEGH 3LZFL 4LLMA 5F9WC 3IGAA 4NIYE 5DO2C 3VXSA 3PWJB 4WWKC 4GI8A 4N8CL 4L1DA 2GSMB 1ZANL 1IGFL 1OT1A 3GGWA 1M3IA 3S3BB 3ZL4H 5I8CA 3QAQA 2ZOOA 3RAJL 3DOIA 5C0AE 1EXGA 5AFAA 1FFNA 4BD4A 4ODXB 4HJUA 3FOMB 1J9RA 4RMTA 2X9WA 3MRFA 2QMKA 5FKAB 3A6CH 4HQQL 1X5JA 3I6GB 1FNGB 2LW3A 4LLVA 2V9QA 1JN6B 4QTIH 2GC7C 3KYNB 3G6JF 4GINA 4AM0Q 4K7PL 4BCXA 1KUMA 2DV6A 2X89D 1KYDA 5CMAA 4ZMNA 4PREB 1DN0A 3KCPA 4H2CA 4ZPTA 3WIHA 1VEPA 3KWVA 2X1XR 5HPOA 2JFCA 4DO6A 4MWFA 1XGPA 5E1QA 1AHKA 5DUML 1YAZA 4NGHL 1CFQA 3R18A 2CAKA 3MR9A 4PWIA 1IC5L 2GG1A 1V7NL 4RGMB 5E2UH 3O9WD 3AUVA 4IK7A 3KPQA 4RRPA 4Z7OB 3QWOA 1UJ3A 1II4E 3OPZH 4EMZA 2C3GA 4Q9QH 3QWRD 4KH9A 1E9OA 1WSST 3DIFB 4P9HC 1N8ZB 4Z7QE 3RI5F 4P9HL 4HKBB 5F0JB 4X6DB 1YLBB 4OV6F 1S9VB 3P4LA 5EBLA 1R5WA 2ZUXA 1SBBA 1SDDB 3QQ9D 5LVEA 1FO0H 2WTPA 1V5JA 3KR3H 2BJML 5IQNA 4HUWA 1MG3C 2VM9A 4WUKL 2R2EB 2H2PC 4I2XA 3BW9A 2G4GA 4YSSA 3U36A 4JFDB 3ABLB 3NDZE 5I1JL 4G72B 2Z8VC 3D69B 5CP7A 5LGHL 2VL5A 3C6SA 4KJQC 4F7EB 3WFDL 3BWZA 5E8DH 4MQ7B 3IDXH 3TC9A 2CALA 5E4EB 4WWPA 4XO3A 3F7YA 1KG0A 4NUGL 4F9PC 1GAFL 2DMBA 4NQEE 4HF5L 2PWGA 4KKCD 3IDIA 3JV0A 3TZVA 3VXSB 1JFQL 2Z31D 3TO2A 5DVLA 4MXVE 5IJKA 3B34A 2PYEA 3OGCA 1NFDA 1MKFA 3DTDA 5SWSE 2BVOA 2OV0A 1W8EA 2YBRA 5LDUA 1VRSA 2OMXB 4H2AA 1IEHA 2VMJA 3DX4A 5AEAA 4N28A 1FFNB 5C0BD 5SWZD 2Q76B 3IXAA 4NN7B 3IN2A 4UQBA 4P2OA 1NPNA 5FX3A 1UD4A 3OF6D 3BT0A 3QRLA 3RWGB 4CW1A 5DHDA 2YD8A 2P42B 5ALCH 4LLVB 2W81C 1TVDA 5EC2A 2FK9A 1SXAA 3W5NA 3RGVA 1SRDA 4PJAE 2G60L 3HG1E 5FDYA 4F3FA 1E3FA 2A4EA 5CMAB 3ISYA 4QRSA 4YQXH 4WFHE 3SQOH 1DN0B 3KCPB 3UZEC 2J55A 3SYAA 5IHLB 4OT1H 7PAZA 4YSAA 4MCYB 4PRIE 5DT1L 1IAKA 4JM2F 5GGTH 1H5BB 5IJVB 5KVGE 1GZPB 3BJLA 4M7JL 2NYYD 3P3UA 4O02L 3HMXH 3GO1L 1LGVA 3MR9B 4HC1A 5HDRA 4GSQA 2JCCE 4XNYH 3KPQB 5KBKA 3QWOB 1SJEB 2CDFA 5CJ5A 5D1QA 1HHGA 4JY5H 5JIHA 3N9GL 1E9OB 3KJ6L 4XBMA 4Y5XA 2XPGA 5I8EA 3KW7A 4YHPA 2H32A 3CFIC 3S0PA 3DDFA 4Z7VE 4NZDA 5JXEC 1BXAA 4XXCA 1XSJA 2GJZB 1PVHA 2X4QB 5I1LA 5TDOA 1XIWB 4HXBH 5HGBA 4I2XB 1ZY9A 5C0JA 2AITA 4PJ9C 4ANVA 4DO4A 4MNQA 4TSCL 3U36B 4ZMPA 4K8RD 1HZHL 1ZGLB 1GJWA 2HFFA 4UILH 4Y9GA 3KVQA 3C6SB 3QDJA 2J4WL 3IU4H 3AB0C 4WFEE 3CQFA 4UV7L 1KB9J 2JXMA 4P57A 3BKML 1CTMA 3F7YB 1KG0B 4H26A 5L6YL 1A6PA 4ZUTB 1G9EA 3KYMA 3MRHA 3PAUA 5B3NA 4G8GA 1M9SA 2C4FU 3TZVB 2EZ0D 3TO2B 1CXIA 3IPFA 4XO5A 3QPKA 1I7ZA 4NX0A 4AT6B 3OGCB 1NFDB 4G6FB 1MHPH 5GISH 4NQDE 4HWBH 2BVOB 2EDLA 2H0JA 2YBRB 3ZTNH 4ETQA 3CZNA 1DQKA 1NL0L 4F8TA 1CVSC 5FFOA 1S3KH 4KTDL 5JIDA 5KUMA 2E0PA 4GXVL 4LSQH 1XBRA 4D9QD 4ZAKA 5CGBA 4FKKA 4MD4B 4GAJL 3GK8L 3UBXI 3O4LE 1WFUA 4PTTA 4BE5A 2Z91B 3HZVB 1KBPA 1RIVL 5EC2B 1GMEA 1RJLB 3ZUNC 5A2BA 4A04A 2M8XA 1D9KB 1IARB 2YRLA 3GI8H 3TBCA 2BNQE 1AJ7L 5LNEA 1TQUA 3HS9A 2ZJSL 1MOEA 2K3HA 3GRWA 3F00A 3PGDA 4YDLC 3C8DA 2UWEE 4X4ZA 4UT6L 5FGBA 1U8IA 2XXMB 4LLAA 4WHDA 2GBAA 3C8KB 1LK3H 2JKXA 3TA4D 1K3ZA 5I0DA 2XWXA 4TL4A 2WXQA 3VD3A 5CZXC 1JK9A 4FFZA 3IMWA 3C60D 1HHGB 5D1QB 4MAYD 43CAB 4BKTC 1MW0A 1QPKA 4HAKA 4Y5XB 4GQZA 3FT1A 2D2OA 4UNTA 1DTUA 2F1BA 2XPGB 4WCYH 1NMCC 2R0WL 4YHPB 2H32B 3MA9H 5DFTA 3FQRA 1OHQA 3HEIB 1A1NB 3QZWA 1D5IL 5D1XC 3VD5A 1I8LA 1RZJH 1G7IB 5IB1B 1YO4A 4TLTA 2Q7YA 2NCMA 3DPBA 2ZXDA 5DS1A 1HOEA 5TDOB 1DVFD 4HJEA 3ESOA 1E6OH 2A5UA 4F20A 5C0JB 1MFDL 2Y2WA 4MNQB 4G9FD 3QEQB 1AFVH 1TCRA 1PF3A 5DYOA 1DBAL 1WBYA 1WZMA 3BUQA 4BWUA 2QBWA 4FG6D 2VN6A 1YEHL 3QDJB 1ZLUH 3BD3A 3EGDA 3C08L 4GQQA 4Y8DC 1ACZA 1BLNA 3L5XH 4KROC 4P57B 1MCQA 4L1BA 2NY6D 4UQCA 1IAIL 4PMEA 4GBXA 3KYMB 3MRHB 5IHWA 4G8GB 2IG2H 1HH9B 2X9YA 1E90A 1MREL 3RZWA 1JPTL 5GZNC 1QW8A 2FSDA 3CQQA 4HIHB 3EFDH 1D6VL 2DIAA 3GIZL 4ETQB 5AOJA 4FG2A 1KPRA 4QF1A 3CFEA 4GIPD 4XX5A 3GMQA 1K85A 1WHOA 1WIUA 4YDVA 5D7LE 4ZSOA 3ZZSA 2WM0A 5JLZA 2OXHA 3LZFH 3APDA 5T5FA 3RQ3A 3ILDA 2IDQA 3H3PH 3O3BA 5D4IA 3WFHA 4N8CH 1XF4B 5HDLA 1TITA 3ILEA 4OM1L 4WTZA 4N0FA 2WBKA 3MOAL 1ZANH 1IGFH 1PTZA 2WCGA 5FFGA 2IOIA 3O9WC 3EYFA 4LDCA 1KGJA 4KX7A 4G6AD 4ZMVA 4AVJA 4PLKD 1P5UC 4GLRI 5IW3A 2V37A 2BSEA 4HK3N 1PSKL 1XF3A 4WHYG 2EIZA 3PGDB 4R97B 5JIQA 2XN9D 2IALA 1CS6A 1OCZB 4HQQH 4L23A 3KM2A 3O6FD 1U8IB 4HFWB 4X6DE 2IOMA 2VDNL 4TQEL 1BEXA 3D3VA 3QC5X 5AVSB 4K7PH 1BXXA 1FAIL 4ATWA 4X4YA 1JK9B 4ZTOL 1A5FL 1OPGL 3K2IA 1A4KB 3DI2B 3BC9A 3L3OB 2WD0A 1J10A 4QTHA 2FDBP 3GXDA 2G3NA 4FGMA 4U1IA 5DMIL 1Q4NX 2J57A 4CVZA 5BW7C 2IAMB 3KL0A 5DUMH 3QZWB 4NGHH 1AIZA 2YJLA 1U2HA 3ZE2B 1IC5H 1V7NH 1VIWA 2EADA 3KJ4B 3M1OA 4DZ8A 3VFPA 4KKCC 1NKGA 4FA6A 3GS0A 1NGXA 4WDIA 3MV7D 4DPBX 2HA1A 3ZE1E 4JFEE 4QGTA 2FL5B 1F13A 4P9HH 5JPNC 2F18A 3WS3A 3EGDB 1BZEA 3LNEA 1BLNB 3L8QA 4X2UA 5EEZA 3O6ML 2VDRL 2HKHL 2AGJH 2BJMH 5JDSA 1YEDA 3WIIL 3GSQA 4W9GC 4GBXB 1TQSA 4WUKH 3PWPA 1JNHA 1X7QB 2Y7OA 3KBHE 1SJHA 4YSQA 5LXGL 4RZCA 5I1JH 2UZXA 1EFQA 4W1TA 5LGHH 1HVXA 3PWUA 3WFDH 5ITFA 1NCTA 4NDMB 4YVUA 4XPAL 1KPRB 3CFEB 4NUGH 5LBSA 2R1XA 3GMQB 1ZLDA 1GAFH 4JFFD 4ZSOB 2QV2A 3D2TA 1TU2B 4G8FB 4HF5H 1R3HA 1U8QA 4HSCX 2APFA 2MOVA 2ZX5A 1I31A 3WFHB 1FV1A 2EIJB 1JFQH 4A2MA 1LK2A 2NYYC 4NZJA 3B1UA 3PLYA 4ONHA 2E86A 1LEIB 4N0FB 3MSPA 1CF8L 2H2SD 3UH8A 1GC1L 2H9GA 4EUPH 1B3JA 1PY9A 1KYUA 3EYFB 2AXHA 1RIHL 5BRZA 4N5ED 4HT1L 5IQ7L 2K6ZA 2EIZB 2R69A 2IALB 1B0GA 3UPRB 1HEHC 4F2EA 4KVNL 1GGBL 3D3VB 3STBA 1GS7A 2MFNA 2UZPA 2G60H 1EJ8A 3DUHA 5HGAA 4NFDA 4GXFA 2MWCA 2CLRA 2ZF9A 3GHEL 4QTHB 4K8RC 5GGQL 3MRPB 4KUZL 5DT1H 5CN2A 1J5HA 3PABB 3U25A 4KRMB 4U1IB 3QUZA 5CFHA 1SLXA 3EJJX 3HBGA 3HI1A 4JUSA 4NLHA 4PG2C 5F1IB 4CVZB 1GJUA 1TTCA 1OAYL 4LSVL 4JQIA 4M7JH 2HP4A 4O02H 5TH2B 1F3DJ 4ZMXA 1AY1L 4KI5D 3GO1H 4WK0B 2YXVA 4OUUA 4U2ZA 3FT9A 2NW3A 3QJHA 5CP3A 5DEFA 4JZJA 1KYOK 4LCWA 4DZ8B 2HTLD 4UUJA 4APQD 3QDME 4WDIB 1NGXB 4XOAA 3D4CA 3N9GH 1KXVA 4XGZA 2BIMA 3BP6A 3KJ6H 2WQXA 2O6FA 1DUYA 4HUCA 4WK2B 3EJRA 2Y23A 3DBXA 3WS3B 4HAFA 1OP5H 2DQCL 3U46B 1LO3L 4K5MA 2EICA 1QHPA 3G08A 2VLRD 3T2LA 2O93L 3D50A 4XO4A 1G5AA 5JDSB 4Z0XA 1RERA 3PWPB 4UZUA 4GYBA 4K94C 4OZGB 1H3GA 1QAWA 1SJHB 4K94L 4TSCH 5JOPE 4GUOA 1J1PL 4OLEA 1HZHH 3GSWA 3VFSB 2E74C 2UZXB 4UDTA 5BZZA 1E8XA 4HCFA 4AMKL 3PWUB 2J4WH 3LKRA 3N6YA 1CBVL 3VTTA 5ITFB 2A1WL 4UV7H 4HUUA 1TNNA 1RHHA 3BKMH 5L6YH 4J3BA 2R1XB 4WI9A 4WW2A 2ZUTA 3ZDXF 3E1F1 3Q2WA 5FUCE 3V4VH 4ADGA 5T3ZD 4J6RL 2CR0A 1U8QB 2B9BA 3OKDB 1J9CT 5I6NA 1V27A 1NOAA 3L95A 3UC0L 4OGXL 3QULA 1FV1B 2XFXA 1DBJL 1LK2B 4OLUL 4FXTA 4LIQL 4CU8A 3OWRA 3MRRA 4R90L 2H9GB 2FR4A 4GFXA 1C7TA 4JR9L 4LDLB 2V9TA 5GGRY 4P5TD 1NL0H 2NT1A 4YJZL 4ZMQA 2YUWA 4KTDH 4QYOA 1S7VA 4FFVC 4N0CC 4AXWA 4GXVH 2LLLA 2V5MA 3AS2A 5MEQB 2HRHA 3EH1A 3F7VA 3BMWA 1HTYA 3EKCA 4GAJH 4KKBD 3GK8H 5FYJE 5C09E 1WD8A 3RIAK 3SD2A 3ZTCC 4YXKL 3QVAA 5I9QB 4BBWA 1RIVH 2X1PA 4FYRA 5ACZA 3QIWA 1EVUA 1ZSHA 4DKAA 2QSCL 1AJ7H 3U83A 2D9CA 1YMMD 1EDHA 2WNKA 3SIKA 5FXCH 2ZJSH 5IF0A 1PCSA 2IANA 2I85A 3GSVA 5J9PA 3NVQA 3FAXA 4I89A 4XCFL 4FG6C 4KDWA 4X9GA 2GSGA 2XA8L 4YSEA 4WKZB 2H8PA 1C12A 4UT6H 1KTKE 1PZ5A 3D18B 1WA1X 3KZ8A 4DAGL 3GZPA 5E8EB 3BLPX 5IV2A 5EO1A 2NW3B 1RAMA 3NRQA 4G43A 4JZJB 3GPSA 3O8XA 1SUHA 4XRCA 5DD0L 3FUKA 2WZPD 4WV1A 5BPPA 3BOVA 4PYGA 2AK4B 1DUYB 4IMKA 4XWOD 3FQUA 4XT1C 2V2TB 3EF4A 2FNBA 2R0WH 2FO8A 1WH0A 1D5IH 3C87A 4ZO9A 1WAEA 2D0GA 5TD4A 4TNEA 3OKMA 1MCLA 3TF7C 3ABKB 3BWAB 4Z0XB 3MXWL 1XFPA 1VCAA 1AZCA 4OFQA 5CXPA 2ZPKL 5DRWB 3EH2A 4DUVA 4AYGA 1ECYA 1MFDH 2ENPA 2XN0A 4AK2A 2NLJA 5GS0D 1F5WA 1FJ1B 4UDTB 1DBAH 3RL1B 3Q1EA 2L4OA 5KVDL 1YEWA 2BZCA 2PXYA 1YEHH 3LKRB 5DZJA 1SXBA 1LMKA 3C08H 4MX7B 2K45A 2EE2A 1GA2A 1AXTL 3C6LD 4TNWF 4G6AC 1RHHB 5IBUB 5AW0B 4HG4J 3LKSB 4F92B 1IAIH 1FZOA 4L37B 4ILDA 1RJZA 5KSVA 3UTQA 1DQVA 4TTGA 1MREH 3SDDC 2KDGA 1NIAA 2XFXB 3O6FC 4UTAL 5LGJB 4I0PC 3RKPA 1JPTH 5DCCA 4ZBJA 2X2JA 3N1QC 1D6VH 3GIZH 4P2QD 3T09A 3KWXA 4U6HA 1N70A 1L7IL 5ECJE 3FU9A 4QYOB 2NX5A 3X3GL 4C56E 4AXWB 1OCCB 2OYMA 5MP6L 1CGVA 4MSWB 2EC9U 2H6UA 2JKJA 3MMEB 3TWCL 2ENSA 4OBRA 5F9JB 3DKHA 4OM1H 5D6DC 2C26A 3MOAH 3QARA 5AZ2L 2YS4A 3S96A 3QIWB 4KUCD 4RRPG 3BIAX 2V3FA 1G94A 4HHAA 5FWRA 3NJMA 1TMCB 1OGSA 5MEOA 4M7KL 2IANB 1PSKH 4OGYL 4JG5A 2GSGB 3C5ZC 2P5EE 1PZ5B 2VDNH 2XQYA 2WLYA 4TQEH 5C97A 3SYPA 5IV2B 3GXPA 5EO1B 3VXME 2F2HA 1FAIH 4JFTA 4XRCB 4ZTOH 5EOCL 1A5FH 1OPGH 2QLVB 4HVBA 3TO4B 2JE8A 1ZLVH 1HI6A 1FRGL 1AOHA 5C0RL 3ULVL 3HAEG 4HPOL 1DQIA 3FQUB 2DB8A 1FC2D 5DMIH 4C55A 3SYQA 5KYWA 2BNUA 3QORA 3OKMB 4IKNA 4HH9B 5K1NA 2NXZD 1BD2A 2WXGA 4PR5A 3OHXB 1ND0A 1F6AA 4YEEA 5F7DA 2EE0A 4RIRB 2NLJB 1JTTA 2WIMA 1QRNE 4UM9A 3WD5L 4A1RA 3FQ1A 1LVEA 3E9UA 5GJSL 1NMAH 2GFBA 3CK0L 2VC2B 3TNNA 3D85A 4GS7C 2ZX9A 1FFPA 3O6MH 1PKQE 2VDRH 3BISA 2HKHH 3O11A 4JGUA 3SGDH 4OZHF 4B50A 2NXYB 3EADA 3WIIH 1I1AC 5EORL 1RJZB 3NSYA 3HRZA 4BIKA 4A66A 4TUJA 4MJ6B 5LXGH 5CLWA 4AQAA 3QAZC 5EN2A 4X0KB 3U4AA 2FO4B 3FUNA 2Z65C 3RYMA 3VWKA 4XPAH 1TDQA 1H8OA 5ESQB 2MIZA 4K5PA 3T3PE 2NX5B 2WBJA 2APTA 3F6JA 5KSAA 4WW1A 3MRBB 1SHWA 3RILA 3B3BA 2Z93B 4XI5D 4UNIA 5HJBA 4OF6A 3RWCA 2PCXA 2WQAA 3FSOA 5DZOA 4X9IA 2E46A 4CMMA 1CF8H 1U2CA 3PDOA 2MNUA 3MLVL 1GC1H 2LLNA 2H6PA 3S96B 1OSYA 3V79C 3MU3A 1QX1A 3BVXA 3O3EA 1RIHH 3WY4A 1KPUA 2WCSA 4HT1H 4XHJD 5JQHC 5IQ7H 1GOFA 1I8MA 3GSOA 5MEOB 1V3JA 1F6LL 1UUNA 2JCWA 4NWUL 3OSVA 2WKOF 4G11A 2BP8B 4L0ZA 1NGYA 4HIEA 2WZ5A 2YMXL 2JSFA 5LG1A 2VDOB 4KVNH 1NDMB 1GGBH 4LGRB 2NY3B 1ZVYA 1GL4B 3G5VA 3DETD 5TQ0L 5T8IA 4LPUA 1P7KB 3EBAA 4NRYA 3VM7A 2OZ4L 1WFMA 3CSGA 2AP2A 3GHEH 4PIBA 1HI6B 5GGQH 4X4KA 2Y25A 1JHLL 2CO2A 1BQRA 4KUZH 4OZGE 1CXLA 3SE4A 1E2VA 2KH2B 3UBFA 4YK4C 4M4RB 2EVIA 2N7BA 3MLRL 3VRLE 3PDGA 1OAYH 4LSVH 3DX3A 3C5XA 2BNUB 3EF7A 3QORB 4Q7DA 3T3MF 1AY1H 4PRHD 4ANUA 3LIZL 3N1GC 1BGXL 3QR0A 3UG4A 1BD2B 4N2LA 5KUKA 1EWHA 4PR5B 1SOXA 5GRVK 5HHNA 1I3UA 5CJXA 4FNQA 1F6AB 1I7TB 4KGLA 4E5XG 2VO5A 1AXIB 15C8L 2K8QA 3ZDZB 4UM9B 2IH3A 1Z5LA 3LN5A 2GSIA 4NEHB 2DQCH 2GFBB 1LO3H 1JZ3A 5I0XA 3IFLL 1P6AB 4OZIE 1F56A 1FFPB 3MBWA 1ZTMA 4UQDA 5I6LA 4M6OL 4F7TA 1JV5B 4D8OA 1YNKL 3QFDA 5ESAA 3HRZB 4K94H 5DRXA 4OD2A 5DA0B 3D2UA 1J1PH 4AQAB 2AJ3B 4AMKH 2Z4TA 3Q2VA 5IJCC 1AR1B 2YZ8A 5AAMA 2XN1A 1CBVH 3NFNA 4I3SL 2A1WH 2OYPA 2ZNXA 3W9DA 4PVBA 4NNXA 4Q6IA 4A2LA 2WBJB 2Q7NA 4J6RH 4MQXC 1X44A 4WW1B 4ZNEA 1BZ7B 4KKQA 3GDCA 3KPRB 3QHTC 4ZXBA 3UP6A 4RSYA 4OGXH 3UC0H 1JXDA 3VDCA 3MCYA 4UOQA 4E41D 4LPYA 1DBJH 2YRZA 2QFRA 1NWOA 2XETA 3A24A 3PPSA 1KV7A 3GIVA 4OLUH 2J2ZB 4LIQH 4OSUL 4CMMB 2VSDA 4X7FC 1YNTF 5DMJB 3IGKA 3PDOB 2GBUA 3EUUA 4R90H 5CCJA 3ZRFC 2H6PB 4ZG1A 5J13C 4JR9H 3MNWA 4P4KA 4W9CC 1OSPL 3O3EB 1T80A 4PS7A 1ZXQA 1WYJA 5E9DD 2IWFA 3NRFA 3GSOB 2DDQL 1WC7B 4ABVA 1MVUB 3RNKB 3QR2A 4PJ5B 4FQCL 3P0GB 4HIEB 1F4WL 1IV8A 2BNRE 4MNGA 5EU6A 3F62A 2Z7WA 3G5VB 5F7KC 1H6EA 4GB9A 1T22A 5DURD 2VZ3A 4G8EA 4GSRA 2QSCH 4U6YB 4XNXL 3T0XA 1RZIB 1L6ZA 4KOBA 2FJGA 5KVGL 1N12A 1U41A 3SKJL 3FQXB 1IGCL 5EH1A 2EDWA 4MMXA 1ESOA 1OGTB 5BVPL 4KFMA 4XCFH 4ONOA 4Y5YA 1KACB 2XA8H 3V4LA 2JV6A 2AV7B 3SCMA 2V5YA 4ZRGA 1OXYA 2LVEA 1G9HA 2PMZA 3RJDA 3C6LC 4ANKA 4DAGH 5IKCA 3GSNB 3ULUE 3CZSA 4I3GA 3QUYD 2W38A 4K2UL 3VU2A 3WHXA 5DD0H 3L4XA 5D5MF 4KO9A 5HHNB 1HT6A 2YAFA 3W37A 1FFOA 2CBOA 4N90E 1G7LA 3MRQB 2F74B 2IH3B 2J43A 4M5ZL 3M8OL 1XXFC 2ARWA 3VFVB 2YPVA 1YNTA 1JV2B 2KZ1B 2R2CA 5HYJD 1DFXA 1T89C 4LPXA 1T03H 1DBML 4WNQA 3FU5A 3MBWB 4FYSA 1WT5C 4A2EA 1CURA 1KGCE 3MV9D 3MXWH 4DP4X 4F7TB 3UAJD 4F37F 2HVJA 2J12B 2ZPKH 3T0EA 4A6YA 3LNIA 4BQBA 1EFXA 4I5BB 1U9KA 4E9TA 5DRXB 2I07A 4M8QB 1NCCL 2Q2EB 3BPOB 4U49A 5HHOE 4ZTEA 3IAPA 8FABA 5KVDH 5JHMA 3NFNB 1D5BA 3NJJA 1AXTH 3IFOB 4G8IA 1AAJA 3W9DB 1SF3A 2R9HD 4Q6IB 5IMOA 4ZFOA 4ZXBB 4U6TA 1AS7A 3OC8A 3EFOB 3FO0L 3V6OE 4Z77B 4UTAH 3K91A 3GIVB 3L9RA 4NYLB 2Y06L 5E7FA 1AD9B 1SMAA 4JDTL 5DHXB 1HILA 2VXVL 4X8GA 3AS3A 1ORSA 5HHMB 3MNWB 5GRUL 3HCVB 1HH6B 1HL8A 1L7IH 4J8RA 4ZMOA 1MCRA 3C6EA 5L4FA 2RR3A 3X3GH 4BZYA 5MP6H 4QRRE 3GUTA 2C7UA 1E50A 1GGTA 1JWMA 1R9FA 3NSFA 2XPZA 4KNSA 2X3AA 4PQXA 5D1ZI 2FEEL 3VH8A 3RX8A 5L8JB 1Z5YD 3TWCH 4WLCA 2WLMA 3B9VA 4MNGB 3F8UB 1UJTA 2VW6A 1JZFA 3GMMA 5AZ2H 1WBXA 1DFBL 1NBYA 2XTLA 4IW4C 4FQLL 3V0FA 4G8EB 3UERA 3VTMA 4K5LA 4YVNA 2FJGB 3ZT7A 3W38A 2CD0A 1PG7W 4M7KH 5AW5B 3TESA 4OGYH 3MJ8B 2X4SA 4XPBL 1MJ8L 4AVHA 4J3SA 5BUAA 3ZQXA 2EC9T 1CD1A 4RETB 3CV5A 5IKCB 2WSDA 4DKFL 1OP3K 4CSSA 4JDVA 3UTTA 3WHXB 4Z5RB 4Q4IA 3LZQA 5EOCH 1T2XA 2WN3A 2EEAA 5GZOD 2D2CC 1G7LB 2WK2A 1FRGH 4WUUE 2K70A 4XTRC 3WS6C 3ARXA 5C0RH 5DJCA 3ULVH 4HUVB 1ANUA 4HPOH 1WISA 2EDMA 4Y7MA 1BVKA 1TPXB 2X89A 3T6VA 3HE6D 5DVMA 5BZWA 3GLEA 2H0EA 4BK8A 4WI4A 3TJPA 3WEXA 3NZSA 4PJHE 3QS3A 4MS8C 3M1CA 4N2IA 1Q9OA 3VFUB 3NOIA 4JM4L 2HVJB 5AB9A 3T0EB 4A6YB 1EFXB 2I07B 2OR9L 2WWMC 3WD5H 4V33A 5L88L 1J1XL 1UD3A 1Y1UA 5E8NA 3BAKA 2ZXQA 4LCVA 3ZKSD 8FABB 1RPKA 5GJSH 4UQ9A 3DX6A 3NQIA 3CK0H 3TV3H 3IPBA 2H1PL 1D5BB 4N9OB 4PJFE 1NIBA 4EDXA 4ELMF 1ROCA 3FRPG 1U0QA 1JGVL 4YBLB 1R19A 2IPKB 4XHJC 3OAYK 1E43A 3V0DA 3AADB 5EORH 4HCGA 3QFJA 2IDFA 4I48B 1NC2D 5GRVL 1QACA 5I0VA 5I76B 3ARED 4AVIA 3LEVL 1GYVA 3L9RB 3UYPA 2WO4A 5I8KL 3QQ4A 2P49B 3H56A 4P23D 1ORSB 3MGOA 4ZMAT 5LCVA 3HB3C 3CVHA 2K1MA 4PP1D 3HS0C 2WJ5A 4PJGE 3NIGB 4J8RB 1GGYA 4ZUWA 4FULA 3IMUA 3GUTB 2C7UB 4IMLA 3FZUD 1A3RL 1LL1A 1YPZF 3VH8B 4KO7A 2R4RL 3FFCB 1NEPA 3D1MC 4YE0A 3MLVH 1RK0A 1WBXB 5ITBL 1MCEA 2C9RA 1LO0L 1NBYB 1K72A 4K71B 4IS6A 1BF5A 3KNBA 1C9SA 3RGHA 1WDAA 3MFFA 5I17A 3MUZ1 3G6AA 2DQDL 1X9UA 2ADGA 4NWUH 2X4SB 1QVOA 1Z9MA 4KXCA 2H3XC 3CE1A 2ENQA 1RUML 2YMXH 2LU5A 1WVZA 4M8RA 2JMRA 1NAMA 2B3IA 1J8HD 3L4UA 2QVIA 4U4BA 2VT0A 2Q3AA 3UTTB 5TQ0H 4Y4FD 2OZ4H 3RIFF 2K7PA 1JHLH 3EO1B 1XD1A 3WE1A 2Q87A 5DJCB 3V2AR 4LNRB 4L8CA 3LB6D 5C8JB 4PJCA 4GRLD 3MLRH 3SBWA 5BZWB 5D9SB 3LIZH 1BGXH 4F91B 4ABQA 2VSCA 4KRPC 4I4WA 3RPIB 3BUYA 3FQYA 4CU6A 1Q9OB 4XCEA 2DLTA 3U1QA 3K6OA 3CIAA 4DW2L 1EAPB 5JW4M 15C8H 4KKNA 4EZLA 3WDJA 4F7PA 1V55B 2N0MA 2QQKL 1P6FA 1EH9A 5E8NB 4AYBA 1ZIBA 4U7MA 4XPHL 2VN7A 3DX6B 3GS4A 4H4NA 4YHIA 5I5IA 5C07A 5JIKA 4JDZA 4M1DL 4LMQI 3IFLH 4HD9A 3U9UB 3V6ZB 3ZXAC 4AEEA 4EDXB 1WUNT 4FKHA 4M6OH 2Z7UA 3QFJB 4XVSL 2LFEA 4M93C 2YGPA 2W9LA 2JKIS 4OKVA 5BS0A 2PKDA 4ODHL 4DJMA 1HE7A 4PJ5E 3UYPB 4ICWA 3CBRA 1OQXA 3QQ4B 3GMPA 4I3SH 5MERA 3MGOB 5ECGA 3P3TA 3CVHB 4WHTB 3VFNB 3ZUCA 3WFCL 2EUZA 1L3WA 5FF6B 1CT8A 4IU3A 1JXFA 1S7XB 2EDKA 1L3NA 4GSXA 4PGCA 3UO8B 5JHDE 3RZCD 3VD7A 5AW8B 1O9WA 3QK0A 4EI0A 4PS8A 1E9PA 1P84J 3RUGA 1G7QA 1OSPH 1U8JB 3KNBB 2IWGA 1EHLL 2K78A 2DMHA 2GTWA 3KW8A 3MFFB 2N56A 2DDQH 2YMOA 5I17B 2X38A 4I88A 1QVOB 3GWJA 1O5PA 3VI4B 4HUKB 4FQCH 1TTUA 1F4WH 3WENA 1NAMB 2EIMB 2NY2B 3K72B 3SKNA 4WGWB 5B8CB 4XNXH 3UMNA 1Z9NA 5KVGH 2D31A 1ZHKA 3SKJH 1R17A 5F7MC 1IGCH 1HQRA 1UCTA 4MA1B 4ONGL 4MD0A 1QSFD 5BVPH 1TVBA 3ARGD 4L8CB 1TZHB 3U48A 5IWLA 4PJCB 5CEZL 1EEZA 3DTUB 5KJ4A 2CJSA 3Q6GL 2XV0A 4RMUA 5JA9A 3TBWA 3EOAA 1B3IA 4I4WB 4K2UH 4K9EC 4K9EL 1FLTX 4XCEB 3UTOA 2DOCA 1G7MA 4DQOL 1NMBL 1AQDA 1RIUL 2Z8RA 2X0VA 4Q2ZA 3SN6N 2DLFL 4F7PB 4M5ZH 5FM5O 1A9BA 3MCG1 3M8OH 4FLSA 3OC5A 4CU7A 2FIKA 2R83A 3BGFB 1HNGA 3B2VL 3HZYB 2C9VA 1FCCA 4WK4B 4EXPX 5C07B 3T0BA 3GZKA 1DBMH 2PPAA 2CR6A 3SGKC 5I28A 4MAYA 1XSOA 1BV8A 2BOLA 3BUBA 2ZOKA 3O3AA 4ENED 1ZPLA 2MNWA 5KG9B 1Q9WB 2E47A 3VNYA 4AYID 3LRSB 5DD3L 1NCCH 1D2OA 4RCAA 2BY3A 1AG0A 5BS0B 3NSDA 5MHSE 3WAJA 2MJWA 3GKZA 4FNSA 4IRJA 1DVFA 5FUCC 1X4YA 4A7UA 1IAIM 2CR3A 1U8NA 1F3RB 1KWKA 4RLDA 4PJBA 5AL8A 4N3TA 3V0AC 3DX9B 2FD6L 2P80D 4U1JB 1D5MA 4TOYL 1O6TA 1O6VA 3F58L 4Z0BL 5TK2A 3VXTA 4DEPC 2F7OA 3FTVA 3FO0H 4PGCB 5BV7C 1N2RB 3BQUD 2ZQKA 4GUPA 4TSBL 2XZCL 4QCIA 3FTXA 3UTSA 4EJ1C 3ETBF 4KTYA 2Y06H 3B9KC 4JDTH 3ZDYF 2ZWZA 1E9PB 3MQIA 3RY4A 2VXVH 3RUGB 4UT9L 2QTVA 3D87B 5GRUH 1G7QB 3CC5A 4X9BA 4OCYL 3ZKMC 4AJWA 1M2VA 4FJYA 4LHUA 3BWSA 3AU1A 4LLQA 1LTXA 1WA2X 2DYSB 1MXGA 1ZSDA 3FFOA 4Y16D 3LD8C 3E8VA 4MGXA 3L4YA 3HE6C 2D4DA 3PUCA 3OKLA 3SKNB 1TVHA 4OKDA 3SE8H 1DFBH 1QSEB 2C9AA 4FQLH 3ECWA 4YMPA 4OFYA 1BEYL 2PPFA 1M1SA 5CILL 2D31B 4PS3A 4DP5X 5KEZA 1MN4A 2L7EA 4JFUA 1HQRB 5E1IA 3VTAA 5C0DA 4XPBH 1MJ8H 1TVBB 1W2KT 1HHKA 3F7QA 4FLHA 1EEZB 1F2QA 1RV6X 5GXBB 4JFVA 5GRJH 1L6PA 4DKFH 1CICD 1FSKB 4AE0A 2N1KA 5J11B 5GRXG 1IGYA 5FIEA 5H37G 1G7MB 3UX9B 2VAJA 3B43A 1AQDB 1DN2A 4AVKA 5IMLA 1BDYA 2F5BL 1T0NA 1A9BB 1JJUA 2YUZA 1Y6KR 2ATKA 3PAZA 1TCMA 4FNTA 5B4MD 2MCAA 3U30C 2FIKB 3D39A 4AYEC 1A0QL 3S97C 3O0LA 5C0CE 1AHMA 3ALPA 4PJ7A 2BPBA 2FATL 1BF8A 5CEYB 1QABA 5HPMA 4JM4H 3B83A 3KXFD 5FUOL 4HS3B 2BDNL 3NIGE 4LBAA 4NKOA 2OR9H 1IBDA 1XBDA 35C8L 5ICYA 5L88H 1J1XH 3FHEA 1HINH 1JXKA 2IPUK 3QO0A 4HJ0C 2YPLE 5KVFE 3Q1SL 3CU1A 1FYTB 3GTNA 4ZQTA 1T7YA 4IRJB 1ZHNA 5FOBA 3TYFA 5BOPA 2H1PH 1DJZA 2ZUYA 2ADJA 3MV7A 1JGVH 3FS9A 1U8NB 2X1OA 2G5BA 2Z7YA 4PJBB 3H4HA 3S34L 1G4RA 4LNVA 1BJ8A 3OLGA 3WKYA 1USQA 1RVFL 4Z76A 1FQ9C 4X8XA 4GUPB 3UTSB 4QCIB 5D4QA 3LEVH 4GKZA 3KS0H 5I8KH 2DJUA 1CE1L 4Y4FC 3GQFA 2XQ0A 3KM1A 1DQQA 3VVVA 5I23A 3CC5B 4Q9CA 4GG6A 4ZUSB 1M2VB 5HYQA 4LHUB 3CSTA 4B5ZA 3L1FA 4LLQB 2GB2A 1BVOA 1M1XA 1ZSDB 3F7KA 5DHVA 1A3RH 2WNXA 5CU5A 1UKQA 1QBAA 3B5TA 4OAWB 1P53A 2R4RH 1KGUA 4TN9A 3OKLB 3CN0A 3UJJL 5ITBH 1QLFB 4OF3A 4TUOB 1LO0H 3RDTD 3QNZA 4L3EE 3LH9A 3UL4A 3VWJC 3QJXA 4XP6L 2X4NA 5AOIA 3ECBA 2O5ZH 3NYKA 2VE6B 1QKZL 2DQDH 3SO5A 1C16A 1NCGA 1PG7L 4ZS6C 1RUMH 4NKDB 4B97A 1NUDA 4N8VG 4MRCA 1N19A 1SDAB 3UAAA 5B3JF 1A8ZA 1IGYB 3FOLA 4HYTB 3ZU8A 3D06A 1HL4A 3IKCA 5DZPA 1X3DA 2H26A 2WXOA 2P5WB 4BCYA 3DMMD 4Q52A 1RK7A 2EDOA 1C5DA 4R7DA 3D39B 1JZEA 5GGSY 1Q9KA 2QSQA 3TN0A 4PJ7B 1KY6A 4F27A 3MOQA 3CFDA 4HS6A 2XZAL 3O2DL 4KK6D 1ET5A 4KXBA 1Z9PA 2FZ3B 3F05A 3JT2A 4DW2H 4S1RL 1A6WL 2RBLA 1AGEA 2QQKH 3X12B 1A6AB 3RWEB 1QSZA 3TU6A 4XPHH 2NYZA 1A7BA 5FOBB 3TYFB 4M1DH 2YD6A 1F1AA 1LDPL 4APQA 4H1LH 3QNFA 1RJYA 2G5BB 1JGUL 1SN2A 2MTAA 5AW1B 4M3HA 1K6QL 4M7ZB 2VR3A 4XVSH 3HZ3A 1JNJA 1QUNA 1U58B 4LQ1A 4M3KB 1SF5A 2AV1A 5K9OB 1LWJA 1PEWA 4OV5A 3PL6C 4EZMA 4Z76B 4KK9C 1OY3B 4EN3B 2VLRA 4ODHH 2OMYA 1CL7I 3VJ6B 5EBWA 1NGWA 5DJ2A 1DQQB 4GG6B 5H4YA 3LHAA 4OF0A 2OTWA 2DYRB 5HYQB 3WFCH 5F72S 1BG1A 3CTTA 5KJ7E 3GJEB 3BI9X 1P2CA 5DHVB 3MA7A 3EYVA 4AYDC 2XV6B 2Z34A 2APXA 1PU0A 2EIDA 3RHWK 4QR7A 2DLEA 1DZBA 2XJLA 3E2HC 3FQ4A 3QUML 4O2FB 1M71A 1UXWA 2DF3A 3QNZB 4CILA 1EHLH 5BZXA 5JHLL 3ECBB 4J27A 4DWHA 1MFAL 3QQ3A 3RTQC 1C16B 3FB5B 3P02A 4YHZL 5I75B 4BH7A 5FYLD 4KRNA 3T71A 4N20A 3QI9D 3EDFA 3PQYB 4P5TA 4X5PA 4XO9A 2VMFA 4JRYE 4JQVC 4MTMA 4NI6A 2XTJB 3I84A 4TF4A 3IEAA 4JO5A 3NBNA 2COQA 4F57H 3QJFA 5KTEL 3FOLB 5D7KE 1CLYL 3NIDF 4L4TD 2V3EA 1SHSA 4ONGH 3N41B 4LXFA 1C5DB 2K4AA 5SV4A 4M1CC 5CEZH 2DQHL 5D55A 3FB6A 2DI8A 3PJNA 5IB4A 1VKXB 3TN0B 2PLTA 3Q6GH 1EERB 4HUMB 1E2ZA 1FNEA 1HX0A 4KK8D 4A55A 4PLJD 3CFDB 5LN8A 4MJID 4K9EH 4PY7A 4DQOH 1T7WA 4FMFA 3WAKA 4X80L 1NMBH 2DLFH 4TVUA 2AQSA 3QO1A 1FHGA 3BQUC 5CUSH 1E4XI 4V1DE 1AGEB 3T0DA 3QNYA 5E0FA 1P7BA 3MJWA 4IRSD 4W6WB 5KOVC 3ZMRA 2BHUA 2QTEA 2KPWA 3B2VH 4YSTA 1QZ1A 2WN2A 2CO1A 5DQJA 2EDHA 3PNRB 2WZPA 3VXRD 1NH6A 3FUEA 5DFVD 1RJYB 5I6PA 4RGND 1Z9OA 4Y16C 2BP5M 1OP3H 1W0WB 1FPTL 5DD3H 2XYCA 3NEXA 3SYOA 5L2JB 4TVPD 2W9DL 2W0FB 3KPSB 1TQBB 1WAAE 4NERA 3WNMA 4PV8B 4YGVA 3Q9QA 3DXAA 1KBWA 2ID5A 1XB3A 5EBWB 1X5YA 4BZ2A 1NGWB 4OZFH 5DJ2B 4G6ML 1ZEAL 1QSEE 2OTWB 1RXLA 5I1AA 2V17L 4GG8A 2Y07L 3VD0A 2EUXA 4IJ3B 2FD6H 2Q7AA 1E30A 1FP5A 3O3UN 3F58H 4KJPC 5DLML 3K1KC 4Z0BH 4TOYH 3MA7B 5IGXL 1VADA 3EYVB 1KB9K 1FNAA 5CR8A 4TSBH 2XZCH 2R59A 3LPFA 1CICC 4WJ5A 1U92A 4UT9H 2NUTA 2FT7A 3LPGA 1M71B 1UXWB 4UTBA 1KLGA 3K6FA 6TAAA 1OB1A 3KG5A 4OCYH 5EO9A 3KMDA 1KGXA 4FXGB 3QQ3B 4HS8L 3OAYH 3SDXA 3UACA 5B4MC 2NDFA 2F54B 1NEZG 4FABL 3VD2A 4MXQD 4OF8A 4P2QA 3HBQA 3WEOA 4MMZC 4CVXB 5L7XL 1SXZA 1QR4A 3EH3B 3KCWA 4PY8I 1LNUA 2ZWKA 1ZTXL 4NM4L 1BEYH 4Y8AA 1Z9SA 3V4PL 5CILH 3TWYA 1C7SA 2YA2A 4XNAA 4E9WA 4Z6AT 3VNZA 3ULUC 3ULUL 1QHOA 2J5LB 4YC2B 3GTVA 4B3EA 4M3JA 5IB4B 3VXOA 5T33L 3WO4B 2HJKA 1FYTE 2ATAA 1FNEB 3GBML 2FJFB 2I60L 1AGFA 1JF1A 2P5PA 4W9FC 3SY0A 2JQZA 5CKGA 2BVUA 1MI5D 1J18A 2IH1B 4WVRA 3V0JA 2F5BH 5DK3A 3WN5A 3L5HA 1T83C 5EPMB 3TTSA 4WNJA 5AKSA 2A6JA 1MHHB 3OXSB 4JANA 3QIBA 1TT6A 3HJ0A 2AQQA 1A0QH 2YC1A 3P0VL 3G6JE 1BG9A 3KH4A 3QQDA 5DQJB 2PPEA 3GEFA 2FATH 4UAOB 2BINA 4URKA 1KT2A 4FXKB 5DFAA 5FUOH 3RGBA 1RKRA 2BDNH 4FTVE 4MYPA 1TKWA 2VLJA 35C8H 3EOBA 5DZNA 1CCZA 3QXTA 2HWZL 3Q1SH 2PYEE 4YGVB 1L5GB 3DXAB 5AW9B 1MJJA 3RDTC 3MBEA 2WO2B 4LLDA 1QTSA 2O26U 3RFZA 4C83A 4KHXL 5F6IC 3S34H 3FQNB 5I1AB 2VLKE 4KMLB 3KPMB 3MLUH 4ZZKA 4Y2OA 5DMGD 4JG0L 5DEZA 2XJKA 4YLQT 4HAGA 1RVFH 4WEUD 5L4JA 4KDVA 2EYRA 2VIRB 4X83A 3P54A 2X87A 2YD7A 1IJNA 5CSGA 2GJ6E 2YZ1A 5FYKU 2JK5B 1U92B 2NUTB 2UXFA 3T2QA 1KLUA 1CE1H 4JN2A 1KLGB 5EN3A 1ZLWK 5EO9B 4PLOB 1VGKA 1QLEL 1SVZA 1MWAA 4TUKL 4M6NL 3SDXB 3RY6C 1JI2A 3U0TB 3HMXA 1UH3A 3FF7A 2BSBA 3D4ZA 5CZVL 4XNQB 3UJJH 3ET9F 3KHOA 2CHDA 1KXQE 3IU3B 2B1OA 3E80A 1P4LA 1NBQA 4QY8B 3H2WA 3IAQA 4HGWA 2DQTL 3HVDA 4IEFA 4WO4D 4XP6H 4A68A 2FUQA 3VFRA 2CIIB 3HW7A 2OLDA 2CLVB 2F5AL 3CDGB 2WY3B 1PG7H 1VPOL 4OLWH 3GINA 1FO0B 3F3HA 5I1EL 2YRBA 3MNVA 4HZ1A 3SGDI 4OCXL 2BH0A 4TL5A 3VXOB 5A2CA 1XCTA 1ETA1 2C1OA 4OF5A 4C47A 3PXHA 1TXKA 4U3SB 4UQ3A 2OX5A 4D3CL 5EZJB 1J7VR 2KC0A 3WXVL 2PWHA 2CK2A 3D33A 4HP5A 4J4PC 1OTUC 1CGSL 4NKIL 1UT9A 4XPGL 1OARL 3N1FC 4JE0A 5CINL 2A6JB 4JANB 4IOFD 3NIFB 3QIBB 3SDAD 5GHWL 2YC1B 3IDUA 2NY1B 1T5WA 4QRPD 3SOBL 5HI5C 3EOYG 5G2NA 5EU4B 5I6XC 4OJAA 2XZAH 3O2DH 1YJDC 3TX4A 1KJ2L 2JI3A 1YJDL 2FCBA 3MJ9L 3ZE0B 1H3TA 4S1RH 5D7SL 5KJRL 1Y0LA 2VLJB 1A6WH 3EOBB 5HJ3A 4C8XA 4HWBA 3L54A 1AG6A 5D7JD 3FONB 1A6VL 1MFEL 5ID1B 1HJCA 1VZIA 2C3VB 2ED6A 1PYWA 4GO6B 5IROD 1S5HB 4IIQA 4U6VL 3MBEB 4PFEA 1LDPH 2WUBL 4YHNA 1S78C 5E5RB 2NR6D 5E4IA 4C83B 5EU5A 3C12A 1JGUH 3LEXA 4RA0C 5J06A 1BFSA 4XN4A 1K6QH 4K3HA 4HJSA 4S2SA 5E24E 3L4CA 1A4JA 4FXLA 4LLYA 5E6RB 2BO0A 3V0VA 1D2PA 2EYRB 4E9YA 3TVMA 4RMQA 5FECA 3DVNB 4QWWC 5EG6C 3ZKQD 1KLUB 5F7LB 2XTJE 2QVFB 3BZDA 2Y7QA 4RMSA 1IT9L 5JPMC 1ET8A 1WFTA 3MLYL 3CZLA 3QNXB 2DEXX 2ZCKL 1VGKB 2XKUA 2YEQA 4FLOA 5AUMA 1YC8A 1NCJA 2NY4B 4PTUA 1EXUB 2CGYA 2W8CA 4CMHC 2SODB 2P45B 1PX3A 1BMWA 5FYKD 2DN7A 3E1ZA 2R29L 2VR6A 5JTWA 2WJ7A 3W0WD 3P77B 1BXUA 2E7CA 2GCYA 3C5JA 3L4TA 3ARFA 3QUMH 4XC3L 4Y4HB 4EI5A 3PIQA 1P4LB 4AGLA 3WIFB 4DFIA 1JYXA 1IBFA 3L9YA 1FORL 3L3IA 3LS4L 4HGWB 4IEFB 4E41A 1R5VA 5JHLH 1MFAH 1T1YB 3VFRB 4N3UA 4JM0A 5D7EA 4LVHC 3MNMA 4IRSC 4IBVA 2CO6A 5A2KH 1SEBB 5K93A 1JGEA 4PGEA 2X70A 3SGEI 1E3XA 1GZHC 1U3HD 2GHZA 3MNVB 1AGDB 1MFMA 5EUOB 3QPQD 3UC2A 4EIZC 1XCTB 4X7EC 5E9DA 5FAAA 4CC1A 4H13C 4UQ3B 4XB7A 3EDDA 2QADD 5KTEH 2H4EA 1JTOA 1CLYH 4ALAC 3DWTA 4QAMB 1M9WA 5DHEA 3SBQA 3BFWA 5E6IB 4HLZH 3EGXB 4RFNC 4BFGA 3ULAB 2D7QA 3OHMB 5TDNA 3P69A 2OTPA 5E99L 2JELL 3D12B 2DQHH 3GHBL 5JUEL 5ISZE 3KPSE 3ILPA 3VGBA 1LE5A 3LV3B 3JT0A 3RG1C 5AVXB 1RSFA 2FRGP 4CC4C 1O6SB 4PRPD 1ZVNA 4FERA 4X80H 1VGEL 2PCYA 4JFZH 2FAUA 1Y0LB 32C2A 3MC0A 3QJVB 1T66D 5F88A 5FS5A 5HJ3B 5D2LB 2IJ0C 3V7AG 5IBLD 2BNQD 3VCLB 4IIQB 4M6ML 1ZT7B 4POYA 5E6ZA 5JZ7D 2Y7NA 2E9JA 4FX5A 4KAQL 3LEXB 4PG9B 3DTXB 1CWVA 2XX1A 4S2SB 1YY9D 2ADFL 1FPTH 4PJDF 3QCVL 2WWKT 4FQIL 4LLYB 4O2CB 3TNMA 2A73A 4M6AA 5BXFA 3M1BB 4QI3A 4D2NA 2NQCA 2F54E 2W9DH 4NNPL 2A99A 3TVMB 4F1ZA 1VACA 4KJWC 4BUHA 2ADIA 1KIRA 2CGRL 1UEMA 4G6MH 1ZEAH 4U4IA 4Q6KA 1B2YA 4YIQA 4RAUA 5AUMB 2V17H 2Y07H 4UQ2A 5DLMH 1J5CA 2BSSA 4GFTB 5IGXH 2IGFL 4Z7WF 3VSVA 5KAQF 2ERJC 5BUPA 2VXQA 2VITA 1DE4B 1ONQA 4EI5B 1SJVA 3ARFB 5EC1A 7TAAA 1LE9A 2XY2A 3POHA 2EXSA 2NNXA 2ICWA 1R5VB 5DK2B 4O58L 4P99A 1DLHA 4HS8H 4NLAA 4E9XA 4JO1L 3IFPA 4FABH 4YL9A 2X0UA 3D09A 1QOKA 4YUEH 4PGEB 4YLCA 2X70B 5DEGA 3DVGA 3UIZA 3BFQG 2ZWNA 5L7XH 2W60A 4I18A 3GRBA 3I9GL 3BMVA 2Y1AA 2EACA 3AG2B 4NM4H 1ZTXH 3A3YB 3AG3B 4YBHA 1EEUA 3V4PH 1VFMA 3B5GA 4GQ9L 7CGTA 1EUUA 4JFYA 3IMBA 3MRGA 2Y6SC 3MVSA 1J05A 5J6GA 1OAXL 3VB9A 3ULUH 1JF5A 1PKOA 3SZ6A 4HU2A 2DY2A 1ADQL 2OJEA 1BQHG 5T33H 3ILPB 1KIUB 2PO6B 4R96B 5JNYA 1IX2A 2G9HA 3GBMH 2Y2TA 1P5VB 2I60H 4NUMA 2X4UA 2X12A 4FHBD 4PRAA 2PWDA 2HUEA 3WJMA 4K7FB 3BAJA 5D2NA 4TVSa 4GW4A 3MPCA 3LKNA 5L8KB 1S3RA 5F88B 1TTGA 3HR5B 3BZFA 3N55A 1NOLA 4PGBB 2AS5M 2VQTA 3P0VH 2H7WA 4F9PA 2GITA 3IF1A 2KZKA 5LAXA 3VU1A 5GZOA 3US9A 2YSSA 2P47B 4DGWC 1DO6A 4WWKB 2JQMA 2K4WA 5AOLA 4LEOA 1NJ9A 5BXFB 3ETBJ 5A2JH 1KLFB 4EUPA 5CNHA 2HWZH 4K7PX 2BCMA 4QGYA 1VACB 2P9RA 1KIRB 5E8PA 1LP9F 1P4IL 4KHXH 4HV8A 2UZIL 1R3KA 3IETA 5JXAL 5D6CB 4RAUB 5J1SC 4JFDD 5LBGA 4JG0H 4JFWA 1J86A 3VXNA 2BSSB 2ZTBA 3QRBA 1QUPA 1XL6A 2PP9A 3GXFA 1QFUL 1TENA 3JTTA 2J1XA 3WTWA 4HG4K 5H2BA 2D3JA 3MN8A 3NEEA 2QKIC 1NICA 2FWLB 2VITB 1OLLA 4FQHB 4GEJA 3ROLB 2IBGA 2RALA 3WMQA 5DZLA 4ZX3A 3EJYD 1XR8A 2BLFA 2VDLL 2WP3T 3P40A 4B41A 4KQ3L 2ICWB 3VXSD 1QLEH 2I25N 1UT2A 4G1MA 4TUKH 1DLHB 2XBDA 4M6NH 2EDJA 4O02A 2EIKB 1TR7A 1SMDA 4P23A 4PHZA 1A4AA 5IB5A 5DEGB 4UMGA 3DVGB 1SYSA 5CZVH 3DUUB 4NQCE 2W60B 4I18B 1T6VN 3R19A 1EDQA 1KENL 4AENA 2ZSVA 2HFGL 2QELA 2R1YA 3K2UL 4W68A 4LCWE 5F8QC 25C8L 4LLWB 1UENA 1IILE 4AQ8A 1BQUA 2DQTH 5EIQA 4JFYB 3JV4B 3REWB 4APXA 3MV8B 1J05B 4OFKA 2F5AH 5J6GB 1VPOH 5J12B 5F9OL 5IROC 5I1EH 4RAVA 4IBLT 4DCQA 4LHQB 4QRQA 3RWFA 1DANT 4OCXH 4C57C 5JNYB 4U6XB 2YRPA 2G9HB 4OZHB 4YDIL 4LMQE 3O45A 3CN3A 4D3CH 5SX4H 3LQZA 2X4UB 2P1YA 3CMGA 3WXVH 5LO7A 3FYEB 4GW4B 4HZLA 1A1MA 4WENB 2WXKA 4NKIH 4XPGH 4E2OA 3AT8A 4F15B 1OARH 3BZFB 4M62L 5CINH 4E0RA 3OKOA 2GI7A 5GHWH 1DYZA 3ZR5A 4F9LC 2GITB 2KYIA 2X2IA 3IF1B 3CHSA 3SOBH 2GC4C 2RAMA 4IQHA 3NCEB 2GT9B 2F15A 5CIPH 1JMXA 1CQKA 1KJ2H 5EIVA 1YJDH 4LEOB 3MJ9H 3NZ8B 4GRLA 1NJ9B 1BREA 4TQHA 5D7SH 5KJRH 5KVFL 4IHOA 1OHZA 4EUPB 5HI3D 1JS4A 1S7TB 4XOEA 1A6VH 1MFEH 4L4VB 4AIZA 2X6CA 4U6VH 4QOKA 1B2WL 3QT2A 2WUBH 3FSZA 1XIWD 5E94A 1LEGA 5E8PB 3EBGA 4KX8A 3ZIYA 1NKRA 4B7IA 3IETB 4N2MA 1BAGA 2LAAA 1XL4A 4LRIC 1BFOB 3VXNB 4PI2A 1AIFA 2CBTA 3JTTB 2YWYA 3H53A 1BBDH 3ZT5A 1RZGA 4HEPA 3E3QC 4HALA 5C08B 1XR8B 3OAUL 4R3SB 1V54B 1A7RL 1WHPA 1UHVA 1IT9H 1MUJA 1E40A 3CJJA 3MLYH 2J1ZA 3KDMA 2ZCKH 3F64A 3TZVD 3UEZA 1VA9A 3UAFA 1RPQA 1MCJA 1GCYA 4O02B 2AJSL 3BUTA 4CJ0A 3IGLA 2V9UA 4UWQB 2WIIB 2EH8L 2F8OA 4G6FD 4H7VA 5IG7A 2B77A 5L2KA 2R29H 4WFFE 3V6FA 3ME0A 5ERWB 5E5UB 4F33B 3FULA 1EO5A 3K8MA 4FFWC 4JHBA 2QQLL 4MQSB 4XC3H 3ZDXE 4ENZA 3EW3B 3LNGA 4F8OA