4G7VH

Crystal structure of voltage sensing domain of ci-vsp with fragment antibody (r217e, 2.5 a)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
215
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVSSSSIHWVRQAPGKGLEWVASISSYYGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSYSWSYAIDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords fragment antibody heavy chain
publication title Structural mechanism of voltage-dependent gating in an isolated voltage-sensing domain.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g7vH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g7vH01
1TETL 2PYFB 3P4OA 2A77L 2C1OB 3B4NA 3RTQC 3BOVA 1DN0A 4NP4L 1L7TH 3QQNA 3BMVA 2FWOA 5GGTL 3R0MA 3D87B 4WI7A 5H37G 4I48B 4QRTA 2MKLC 3T2PA 5K9KB 4K7PL 4WW2C 3KYNB 2OZ4L 3RVTC 1SVCP 1NAML 3BPNB 3UYRL 5GGRB 5FGRA 1T1YA 4I2XA 1EUUA 3U30C 4P9HH 3JUYA 2XQBH 5D1ZD 5IB2B 4DUVA 1HILB 5BRZE 3F8UB 3BIKA 1DQQA 1UM4L 3QO1B 3RAJL 1D6EB 2DQIL 2YD8A 4IJ3B 3DUUA 3QCTH 3MRJB 4D0CA 1EFXD 2OX5A 4NQEE 3WFDH 4LPTA 4EZMA 5TGBA 2ARJB 1AR2A 4FXGA 4X7SH 5J12C 4G5ZL 2IBZX 2HT3C 2H2SC 3LMJH 1FZOA 4ZXBB 5C0IB 3TN0C 2IANA 4U1JA 4NZUL 2DWEA 1JPTH 1UJ3A 4JR9H 3EO1A 4XP5L 1NH6A 3HMWL 3DO7A 1MIEH 4IIQB 4HWEH 2V9QA 3TBYA 2WUCH 2XWBA 2HA1A 4ZNEA 4UUJA 4WUUE 3O4LE 4M43L 4H0HB 4G3YL 4WUUB 3L1OL 6FABH 5GGVL 4DGYH 1B90A 2AXGA 1A64A 4M8QA 2AJ3B 3B8SA 2XZQL 5AYUH 4NC1C 4L9LB 5ID0B 4EJ1C 5LQBL 3STLA 5I75C 4HUKB 4P2QA 5D7JD 3FRUB 1R5VB 1IM9B 4PGZA 4F7PB 3G5VB 2GITA 4HIIA 4PJCE 3GI9L 5ITFB 3OTTA 3VFMA 1FNFA 4JFPA 1AY1L 5LXGH 4IRSD 3ULVL 3FQNB 7CGTA 3IDUA 3P4OB 3HMXH 2X7LA 1DN0B 3MV01 1CK0H 2EC9T 1ADQH 4NNPH 3BRDA 2FWOB 1GHFL 2IJ0C 2EDBA 2ESVD 5A3IC 3LS5H 4M6AA 4QRTB 1BQLH 3TIEA 1SJVA 4HUMB 1T1YB 4I2XB 4MB3A 4EQ3A 1TCRA 2YD9A 1EVTC 1DTUA 5C0BD 1KB9J 5D7SH 3BIKB 5H37H 1DQQB 2J7LA 2EDDA 5AZ2H 4Y2DA 1DQML 5EIQA 3DUUB 4D0CB 4P0DA 3O6FD 5TE4H 4G6AD 2AK1H 3NFSL 4PLJD 5TGBB 1MCOH 4FXGB 1JP5A 1FZOB 1D3CA 3QJHA 2IANB 4U1JB 1ZLSL 2DWEB 1UJ3B 5T33H 4ZAKA 4NO0D 1REIA 4KRPD 1VPOL 3DO7B 1N4XH 1ULVA 2QLVB 3D25A 3O3EA 1TZGL 3TBYB 2XWBB 3O2DL 2ENYA 5TDNA 4UUJB 3D9AL 4GBXC 3WFBH 5EZJA 4O00A 4YHYB 2QQKH 5DMGD 3JUZA 1JIBA 1IRAY 1T7ZA 2ITCB 1T3FA 4QOKA 3RWDA 4LPVA 5T3ZL 4JKPL 2AXGB 1OAUH 3A0OA 4M8QB 3SOBL 2EZ0C 4MXVE 1MSPA 4DW2L 1WFTA 3STLB 4R90H 3MUHL 3CVHA 4P2QB 5GGVY 1CD1A 1A5FL 3Q2CA 1HHKA 1RULH 5KSVA 2GITB 1P84K 3QEQD 4HIIB 4LCUA 4M5ZH 4MD4A 1IGJA 3SE4A 3QA3A 3VFMB 1CFSA 4GH7B 1WWBX 4JFPB 5HHXH 4LCCA 2VXVH 5SWSA 3OF6D 4JO2H 2J4WH 1I9IL 4UB0H 2X7LB 4U6VH 3QDGD 1D5BA 2FB4L 4JHWH 4M00A 4PJBA 5D6DC 3OKLA 3OKOA 1SJEA 2MPAL 4MGXA 1AE6L 1KTDB 2DAVA 3D85A 3TIEB 5M94B 4HWUA 1T1XA 1TCRB 4M3JA 5F9DC 1SMOA 4JZOA 4GKOA 5CSBA 1MH5A 4M48H 4J3VA 1ZT1A 3F62A 3V6OC 1UZ6F 4Y2DB 3RHWK 4KTDH 4E41E 5C09A 2EICA 5I1CH 3TNNA 4PYGA 1MIML 1A4KA 3WD5H 2A74A 4XNYL 1A6WH 3QJHB 4DTGL 1JGLH 1F6AB 1CGWA 4OLUL 5I1HL 4ZAKB 5BVPH 1E6OH 5E2UL 4JFYB 4PJ5D 3D39D 2A6KA 3D25B 4N1EA 3O3EB 1YPZA 3SDDC 1BBJA 1KJ3H 1QFHA 5TDNB 4RAUA 4NN6B 1Z2KA 3L3IA 2PO6D 5EZJB 4MJIE 1HWHB 4LKCA 3CCHA 1RHFA 1ZHLA 3ZMRA 5C07E 5JO5A 1QLEL 1T3FB 3C08L 4QOKB 4TSBL 4JO3L 3LDBC 3RWDB 1JL8A 4JKMA 5J9PA 1LNUA 2CJUH 4Z7UE 1INDL 5F7DA 4MNGE 5KANG 1GAFL 1NC4A 2DQUL 3WMSA 2GI7A 1DBML 1S7SA 1RUMH 4EUPH 1RUAL 3CVHB 1BJ1J 1YEFH 3KPRE 4OLVL 4HKJA 4H25A 1CD1B 1O7VA 4ZPTA 3X3FH 1HHKB 4XNXL 5KSAC 3P40A 2IBBA 5JHDA 5KSVB 4RFOH 4LCUB 4MD4B 1IGJB 5SWSE 3RDTD 3AMLA 3QA3B 3V0VA 1CFSB 1MCQA 3PP4H 4LCCB 1C5BL 2OCFD 5SWSB 1A3QA 5I1IL 3TA3C 4X4ZA 5KVDL 2BNRD 1D5BB 4PJBE 5FYKU 3O6LL 5C71A 1U6AL 2V5SA 1W0WB 4PJBB 3H3KA 4JRYE 3OKOB 1EMTL 2J8UE 5IW6A 1YEIL 2J6EH 1OSPL 3D85B 1DANT 1T1XB 1C5CL 1WV7T 2P44B 1FDLL 3KLDA 5I9QC 1S78C 1MJUH 3MXVL 3GSNA 3DMMD 5CINH 4JZOB 2DI7A 3V4VH 4DN4L 1A14H 1MH5B 1UWEH 5E0QA 3ARBB 2ZCHH 1ZT1B 2R0LL 4O2EA 5C09B 2E7MA 1NEZA 4U0RB 3GSWA 2XPGA 3TNNB 3CFBA 1XR8A 4DVRL 4XPFL 1A4KB 2A74B 2C7UA 4JPKL 4YZFE 3RHWF 1ZSDA 2R15A 5JR1H 2FATH 5LJYH 3WS6A 5D5MA 3DURA 5ITBH 2Q76A 2BY2A 2A6KB 1IILE 5DMYA 2V9TA 1YPZB 1EHXA 4Y19D 1BBJB 3ZYJA 4RAUB 3GM0A 3L3IB 3KGRA 5JQ6L 1RUQL 1QA9A 3ULUD 4LKCB 3CCHB 1ZHLB 2LU3A 4OCWL 1MFAH 4PBWD 4Q9QL 2DQTL 4YPGA 1LNUB 3LQZA 5E7BA 1MVUA 2F54D 5F7DB 5CJ5A 1NC4B 4M7LT 1CDHA 5GISH 3P0VL 1ZK9A 1S7SB 1BMGA 3N9GH 4P3CH 4HKJB 5GRYA 4H25B 1U8LA 3UTZA 2CIIB 4ZPTB 3RNQA 4AENA 3BP4A 4IEFB 5JHDB 2GTZA 4S1RL 2NW3A 2BY0A 5EZLA 3MNZA 4DEPB 3PNWA 5MENA 2UZIL 3V0VB 1G7MA 5GS1A 1MFNA 2W59A 4I13B 4S1QL 4XI5D 3WIHL 3QZWG 1DLHA 3KLHC 1NANI 1EK3A 1S7VB 3MLUL 1K5NA 3B2VL 1YUHA 1XCTA 3SJVA 4WTZG 2VL5A 4PUBH 3TP4A 3T0EE 4X9HA 5IW6B 2R29H 3V7AE 1RIVH 2MCPH 1LWRA 4HK3N 4HV8A 5C7XL 2IH3A 3FL7A 1KPUA 4FQQA 3GSNB 1ZWIA 1B0WA 1DQLL 4BZ2L 3WFEL 1KEML 2FEDC 4TNVK 2P45B 3H9HA 2Y6SC 3OR7A 3MV8A 3MX0A 4KKLD 5AG8A 1NEZB 3GSWB 1NMBL 4Z7VA 1BECA 2XPGB 4DFHA 1G9NL 3MUY1 3EDDA 1T21A 2Y36H 5DT1L 3QHFL 3CFBB 1XR8B 3S98A 3IFNH 5DGRA 3FZUC 4MS8C 2C7UB 4GG6F 4LPCA 2KL6A 2PXYA 1MQKH 5D5ME 1ZSDB 3ULVF 3BFOA 5A2LH 3PXJA 5CBAA 5D5MB 3DURB 4TVPD 3NZHL 2Q76B 1OLZA 4GSDH 5KVGH 1KPRA 2I24N 3RX7A 3MJ6A 1F97A 5LKNA 1KN4L 1QA9B 3THML 4WV1A 4YE4H 4B7LA 4LU5H 2D03L 3NPSC 3W5MA 4NRYA 4YDJA 3K8MA 1VFUA 4KVCL 4R0LA 4PJ7E 3K80A 1NKRA 4YPGB 1YC7A 3LQZB 4PP2A 3RBGA 1FP5A 1MVUB 1KN2H 3MODL 1RIUH 1FAIL 2H6PA 3STBA 2Z8WC 1RZJL 5C2UB 1TTFA 3QG7L 4NNXA 3FO0H 1MJ7H 1AFVH 3NAAH 1U8LB 3UTZB 3RNQB 4AENB 3N0PB 3BP4B 2GTZB 2NW3B 3VFTA 5EZLB 4BFIA 3MNZB 5EO1A 2GJ6D 3PNWB 5MENB 1WSST 1G7MB 2QHRH 3OV6A 3P0YL 1N0XH 2YK1H 4YHML 1MCPH 1OAXL 1DLHB 5J57B 1N2RB 5FGBA 1MY5A 3SJVE 2IF7A 1K5NB 1KB5A 1YUHB 1HINL 1XCTB 3SJVB 2VL5B 4LRNL 4NT6A 2HKFH 2EO1A 5IWLA 1B0GA 2Z31A 4HV8B 2IH3B 4KY1H 5F1IA 1HXYA 1KPUB 4FQQB 2H3NA 1ZWIB 1VA9A 1UCBH 5F97E 3MV8E 4QWWC 2VLJE 3H9HB 1A6TA 2V5RA 3OR7B 2DLFL 3MV8B 2YEZA 3GEWB 1UA6H 1EEYA 4O2FA 3PHQA 3KPMA 3DHMA 4Z7VB 2BNUA 4TNVF 1T21B 3MLYH 4XAKE 3FQWA 1BZQK 1OPGL 1V3LA 4KI5E 5D1XA 2PXYB 4UI2A 3VFGH 3QCVL 4M6OL 4XVTL 2OR7A 1YEEH 5CBAB 2R1YA 1F4YL 5DD1L 2VLMD 5C0RL 1B2WL 1KPRB 4UDTA 4XVSH 5IHLB 1PY9A 1KCVH 3QXAA 4WRLA 1P7QD 3VMPA 1I85C 3RY5A 4D0DA 3T3ME 4WV1B 3BRFA 3N50A 4NRYB 4F9LC 4YHOH 4YDJB 3T1FA 1UXSA 4G80A 3DI2B 3UYPA 2W07A 4F15B 4R0LB 4ZFGH 4PP2B 5F9AC 4OCMC 1E0OB 5L0QB 1DVFD 5GGRY 1JI1A 1QYGL 3TBVA 2H6PB 3ROLA 1BGXH 5EU4A 3VA6A 1ZTXL 4LSDA 4O58L 2ADJA 4NNXB 5F7WC 3CU7A 3QXDA 5E24E 4FQLH 3B5HA 3VWKC 4I3RL 1BQHA 3VFTB 4BFIB 5EO1B 1UKTA 1CFNA 3RZCD 5F9WB 4BQ8A 1EJOH 4P49A 1TZHA 4OD1H 1FBIL 4XNUH 5H35A 4C56D 4ENEC 4XHJC 1G7QB 4K94L 4WCYL 2GUOA 9CGTA 1ZHKA 1BZ9A 1KB5B 2FH8A 4XPGL 5J3HC 4NT6B 4LCWA 3LSOA 2W9LA 1PLGL 2E27L 1JMZA 1B0GB 2Z31B 4GAJL 3S97C 2PR4H 5EORH 5EOQH 1HXYB 2YRZA 2H3NB 4XMPH 3GMOA 1FO0H 2VXSL 2DS4A 1T6VN 3MXWH 4FFVD 3GHBH 4L3ED 4LSUH 4NSKA 1A6TB 4K55A 4KQ4H 1WQVT 2E8YA 4JPWH 3W0WA 4Z7NF 2YEZB 3X13A 1EEYB 4O2FB 4ZFFA 3CD4A 3PHQB 4I9WE 1Z0MA 3KPMB 3L5IA 1CF8L 1L0XA 2BNUB 3ZYOA 2I07A 3FQWB 3MRKA 4U3CA 4XWOC 3WKML 4HMEA 4F7CA 5D1XB 3Q5TA 4XVJH 1OP5K 1P53A 3BDYL 4OT1H 4Z7OF 3GO1L 1L0QA 4LAJH 1TMCB 2R1YB 1KV3A 4NC2B 2D9CA 1KJMA 4UDTB 5HHOD 2BVPA 3ARGC 4KQ3H 3QXAB 3BP6A 3I3DA 2YZ1A 4D0DB 4P5TC 3CFJA 4RAVA 1H8SA 5IFHH 3T1FB 1UXSB 4G80B 1NJ9A 3Q1SL 4LLAA 2AGJH 3U48A 4OFYD 1IC5H 3TBVB 1MJ8H 3ROLB 5EU4B 4WFEE 5CJOH 2VH5H 2ADJB 3QUZC 3QXDB 4K07A 1HCFX 4RZCA 1FLRL 3LD8C 1BQHB 1OT2A 4R26L 1MJJA 1OARL 1CFNB 2JELL 3V7MA 1PX3A 1N6QL 4E9LA 3ULSA 2Y25A 1TZHB 4RDQG 1IMHC 2DQCH 4NHCL 2X42A 3BE1L 5H35B 1J1XH 1U36A 3MJ7A 3VH8A 5JDJA 3NBNA 2GUOB 3CXHJ 1ZHKB 1BZ9B 1FCCA 2HFGH 1H5BC 4LCWB 2KQMA 3WYRA 3LSOB 4PPTA 1JPST 1G9MH 4XAWH 4ZO7A 2UWEF 1JTOA 1DEEA 1KELH 4TULH 5I0DA 5KSBE 3EYUH 1SJXA 1TNMA 2OMNA 3GMOB 2IAMC 2BZDA 3EDKA 4TOYL 5J13B 1QSFE 5HDQL 1KXVC 5E8DL 3NCJL 3TESA 3X13B 3B43A 2Z4QA 3EO0A 5C2BL 4ZFFB 2AEWA 1XF5A 4OLXL 4TPRL 3SCMA 4NCC2 5GS3A 2A38A 4G8IA 2I07B 3MRKB 3QIBC 3QWOA 1A9BA 4F7CB 1CWVA 5BCAA 4NPYA 4BSJA 5HGHA 2XZAL 4OCYL 4X6DE 5FYJU 3V0AC 4UT6H 3ZYIA 5DO2D 2B4CL 3FTGA 2ARJQ 4RMUA 2AABL 2IFFL 2WWMD 1KJVA 5ETUA 5HYJE 2F5AL 4XRCA 4CMHB 1KJMB 2BVPB 1L7TL 3BP6B 5JPNA 5GXBB 2VC2H 4FZEH 3CFJB 4RAVB 1QHOA 4BQ6A 2AJXH 3K1KC 1ED3A 3FT3A 1A6VH 1NJ9B 2P5ED 1S9YA 1H3WM 1I8MA 4P9HL 5D9SA 2R8SH 4PRHA 5CWSA 1NGWA 2EIDA 3JWOH 5F7EL 1MRCL 3PL6C 1BOGA 3L5JA 1BD2E 4ZDHA 2D31A 5C0AE 4KXZI 2OQJA 3ZKMC 4Y5VA 5B4MD 3QCTL 4RZCB 1YYMH 4OLWH 1LEGA 1N6UA 4R7NA 4QHKI 1MJJB 1UWXH 4X7SL 4YDVA 5D70H 3ULSB 1ZGLA 2NXYC 3WHXA 1CR9H 1PGRB 1JPTL 5JHLH 3RVWD 3MJ7B 3VH8B 4JR9L 1I8IA 2GK2A 2E8ZA 4O4YH 1MIEL 4JO4H 3K1DA 4HWEL 5IFJA 3K74B 1NSNH 1IBGH 2R9HD 3CX2A 2WUCL 4XTRD 3CFEA 1DEEB 2N7BA 4YHLH 4NQDD 5E2VH 3P2TA 1EDQA 1K4DA 2XA8L 4L4TA 2DM3A 2VR4A 5JLZA 3B9KD 4P3WA 5CP3H 1IT9L 2N1KA 3CAFA 4DGYL 3RKDD 5D2NA 2Z4QB 3EO0B 2ERJB 1ACZA 1XF5B 3SCMB 5KTEL 4KJQC 5FHBL 4G8IB 3WXVH 2YD7A 4XX1E 5DA4A 3PP3H 3QH3A 3QWOB 1A9BB 3GK8H 1YY9D 4NPYB 1PYWA 4D3CL 5HGHB 2FGWL 3SQOH 4EQ2A 3FTGB 3W2DH 3S3SA 1KJVB 5ETUB 1T83C 2H32H 1CS6A 4XRCB 3HMXL 1JYVA 1C16A 3BYTA 1CK0L 1CGVA 5DJ0A 4J3XA 2EDRA 3OB0H 2CKNA 4NNPL 4YDLC 5JPNB 1M05A 3GSNL 3BH9A 2MNUA 1D5ZA 3QT2A 4JJHA 2YA1A 4PGDA 1BQLL 1ED3B 3FT3B 3V6BR 4PRHE 1TJGH 4KAQL 3ARPA 2EXWD 1S9YB 1I8MB 1HDMA 5F6IB 4PRHB 4MHHI 5CWSB 1NGWB 3VFRA 5TF1L 4TUOA 5D7SL 1BOGB 3QRGH 1Q1JH 1ZVYA 4ZDHB 3DYOA 2D31B 5E8NA 2OQJB 1ACYL 3GBLA 4Y5VB 5AZ2L 3WDHA 5E08H 5FKPA 3NGBC 1CICD 5I8CA 1LEGB 4PJCF 5TE4L 4R7NB 2AK1L 4APQD 4JFEA 4UT7L 2P1YA 1MCOL 5DQDH 4YDVB 2Y6SD 5IP4A 1ZGLB 3WHXB 5L2KD 1X4ZA 3TYGH 5C9KA 5T33L 3BP7A 3H7LA 1I8IB 3JTTA 2FSEA 5K9OA 4LMQE 5CD3B 5IFJB 3L3GA 1B9ZA 3DETD 4K3HA 4ZQKA 1N8ZA 1SBSH 5T3XH 3CFEB 5C3TA 1WISA 2XTJE 3IF1A 3D0VA 4HQQL 2QQKL 4L4TE 1K4DB 4M1GH 4FFYH 5I71B 1RMFL 4L4TB 1UACH 5JLZB 3NCMA 4X9IA 2FBJL 2L4OA 5D2NE 2QKIA 4KDVA 4LGRB 5CZKA 5IIEA 1JNNH 4N0UA 1OAUL 5D2NB 3DJ9A 2FEEL 2NQCA 1I8LA 4LPYA 4P3DA 1CFQA 1P69B 4R90L 4H1LH 3I9GH 4OZGA 2WAHA 2V9RA 3BRGC 5E4EB 3QH3B 3RIFK 1PW3A 3V5DA 4PLKD 5I30H 5E6IC 1RULL 4KKCC 2B20A 1PYWB 2XY2A 4M5ZL 3S35H 1E6JH 1UADC 1F90H 1RZIA 5TQ0H 5D1ZA 3MOAL 3EYQC 3Q3GA 5J7CC 1IQDA 2HT2D 2VXTH 4KC3B 5IJKC 4N1HB 1C16B 5DJ0B 5D71L 4JHWL 4QEGA 1HH9A 1MVFA 1EFXA 3BH9B 3BPOC 1D5ZB 2G5RA 4PGDB 3BN3B 1NANH 4LIQH 3GMNA 2XACC 2ZUXA 3ARDC 3RFZC 1HDMB 1QFPA 4BH8A 1QP1A 3SGKC 4RFNB 4MXVF 2V7NA 4GAYB 3D3VD 1XF4A 4WENB 3VFRB 4TUOB 2ZUWA 1KOAA 4MXWL 4WDIA 1VGEL 5E8NB 2AJVH 5FKPB 4QHLA 3NCYS 4JFEE 4XT1C 5I1CL 3MJ8A 5F1OB 3C09C 4JFEB 1TXKA 4JG1L 3CPLA 3ZTNH 3IJSA 1JGLL 1U3ZA 4QO1A 1R3LA 2F58H 4GJTB 3BP7B 3P3YA 1E6OL 3QNXA 4KV5E 4XCCH 2XFXA 3JTTB 5K9OB 3KPQA 5FECA 3CSPA 3L3GB 1YNKH 4XXCC 4ZQKB 4C4KT 1N8ZB 5D7JA 1KJ3L 3RL1A 5SV3A 3SDCD 3WSQH 1G9NC 1EEZA 3IF1B 3JV4A 4PYHA 3WKNA 3D0VB 1N5YH 5JZ7D 4PLNC 4N0UE 4NKIH 5IB5A 2QKIB 4IRSA 3S5LA 3AB0B 4WHDA 5IIEB 4N0UB 2WWKT 5DD6A 3KG5A 4P3DB 4OZGE 3MV7D 5I1EH 4OZGB 3D6GA 1RUML 2ESVA 3BPNC 3O2WH 1YEFL 4LSTH 5FHAH 3ME0A 3V5DB 3NABL 4RQQA 3X3FL 1CIDA 2HTLD 3HG1D 3VXME 3NACH 3BQUD 1NBQA 3WE6A 4G6MH 4LSRH 1RZIB 3C5JB 5D1ZB 5C0BA 2NY7H 5E56A 4IJ3C 3Q3GB 3EZ8A 4UBDC 1IQDB 3RIFF 3HZVA 1SYSA 4DFIA 1RZJC 1HH9B 2OS7A 1RZKC 5KVEH 3O6FA 1EFXB 2VN4A 1IC7H 3ESVF 4ZXBC 4LCYA 3GMNB 2CH8A 2VDPL 4Z7UF 1RUKH 4BH8B 3SE3A 3MLZH 3V4VL 2V7NB 1A14L 4IIQC 4RISH 1UWEL 4NO0A 1HIMH 4WDIB 5JW4M 2XI9A 4ZPVA 4YDKL 3QJFA 3A6OA 5DUPH 3F7QA 4UINH 4QHLB 2O5ZH 1XGUA 2YA0A 1MCJA 2PUQT 3MJ8B 2IPUG 2FX7H 2ED8A 3CPLB 1ODAA 5JDSA 3IJSB 5JW4R 1OTSC 1R3LB 2ICWA 1FQ9C 1U42A 4PJBF 5HYSA 4L9LC 5JR1L 4PRID 2FATL 4R8WH 3QNXB 3IDIA 1VACA 2XFXB 5ITBL 2FJGA 3KPQB 1RVFH 5FECB 2J8UF 3PE9A 1KCUH 1YN7A 4Y4KD 4PJHE 5DC4B 3GSOA 5D7JB 3RL1B 3L3KA 2QQLL 1EEZB 1I8KA 3JV4B 4MB4A 4HCRH 2EDHA 4CDGC 3QEQA 4Z7WE 3WEXA 2MQ0A 5IB5B 3HAEH 4IRSB 3O9WD 3EJZC 3OF6A 4Q9BA 1YY8A 3S5LB 4G43A 5DD6B 3QDGA 3QNZA 2ESVE 1MWAA 3DXAD 1R24A 3E6FA 5GISL 2RR3A 3MFFA 3HC3H 4K9EC 5B38G 5E6ZA 2ESVB 5DD0H 4S2SA 4P3CL 1LO2L 4P2OD 3PWUA 1INQA 3KYAA 4RQQB 4WFHD 4HDIA 4HAGA 4YZFF 1NGPH 1KLFA 3KYKH 2EDXA 5C0BE 3WE6B 4KRNA 5JXED 3ULVD 3VD4A 1AGDA 3NTCL 4YHZH 5C0BB 1QRND 1B4JH 3HZVB 5HBBA 1R6VA 2Y06H 1SYSB 3NA9H 1AXTH 2J2ZA 1JBJA 1BP3B 3O6FB 4PUBL 2MCPL 1MFDH 4JFXA 4LCYB 3WNOA 1JNLH 1UJ3C 4OFVA 3B8YA 3VI4E 1U8HA 3WLBA 1PFCA 4NO0B 1W0YT 5D96B 3MPCA 4PJ5A 4JB9H 1PG7X 3D39A 4KRPB 2V7HA 5D93B 1R0AH 1CFVH 5D7KE 4D9LL 4ZPVB 3BGFB 2L7JA 3GBML 3QJFB 4YHYC 1BFVH 3MJ9A 3ZT5A 4UAOB 1XGUB 4LQFH 2AEQH 2VDNH 2PO6A 3EYVA 4KTEH 2AEIT 2B2XH 4LNRA 5JW4Q 1J5OH 2Y36L 3QPQD 3N1QC 4JN1H 4KWUA 5C6PB 3MGOA 1FFOA 4EOWH 1YQVL 2ICWB 5HYSB 3GHEH 3L5WA 3IDIB 1HKLH 2AKRA 1QNZL 1VACB 2M1KA 1JZ4A 2FJGB 2BP3A 4GSDL 1YN7B 3HR5A 5KJRH 4N68A 3GSOB 2AXJA 4BQBA 3L3KB 1NUDA 1I8KB 1JRHI 3SE8H 3EOTH 4LPUA 4MVBC 3QEQB 4YE4L 3WEXB 1A7QL 3OKMA 3RDTA 1U8NA 1EBPA 1OTUC 3VXNA 3SKUD 1EAJA 1YY8B 3OAYH 3B5TA 4G43B 3WLWC 5D2LA 1KN2L 3QDGB 3QNZB 2FD6H 2BNRA 4HIHA 1U3YA 1MWAB 3E6FB 4WEUD 3MFFB 4P59H 2FYYA 4S2SB 1QFWL 1MJ7L 4JZJA 3PWUB 1AFVL 3FB6A 3NAAL 1INQB 4G6KH 3HNVH 4AQOA 4UIKH 4HDIB 2MOVA 3C8HA 5D5MF 1OD9A 4QXTA 3ABZA 4LEOA 3DMMA 4X83A 1AGDB 2FBOJ 5H94A 1FIGH 2QHRL 1ZANL 2ID5A 2X4QA 1IQWL 4Y2DC 1N0XL 3UO1L 3QXVA 2YK1L 1MCPL 1AXSA 3IDGA 1Q38A 1C7SA 3AROA 5EBMA 1NC2D 2A9ML 4KJWC 2HKFL 2ZJSH 4JFXB 5AD0A 5I1JH 4PJ7F 3GSQA 5B3JE 4ZAKC 5KZCD 4LIQE 1U8HB 1UCBL 3WLBB 3QRFM 4NWUL 4PJ5E 1KIPA 3MRQB 3F7RA 3KDMA 4PJ5B 1RI8A 3D39B 2V7HB 5EZOH 5HPOA 4YFDB 4NN6C 1UA6L 3RJDA 2BVUA 4RGNE 1Z9OA 4Y19A 1CDYA 1BHGA 1K3ZA 3UAJC 2PO6B 4OZHE 3EYVB 4UT9L 4LNRB 1PAMA 3MLYL 3QWRD 4F8TA 3MLXH 3FFCE 4G9FD 3MGOB 4EKXA 1FFOB 4OF7A 3F7PC 2APWA 2BNQE 4PJIA 2VDLH 3L5WB 1YEEL 3S37X 2AKRB 4KGJA 2X1QA 2HMIC 4QHKJ 3ZE2E 4XVSL 3HR5B 4F8QA 1UKQA 5D7LD 4WFGE 4G42A 1A7RH 3TWCL 2R4RL 1M6OA 3RGVD 3SE4C 2W91A 4DQOL 4LCCC 3I6LE 3OKMB 4YHOL 1WITA 4MHHG 3ZSSA 3RDTB 1U8NB 3K4ZA 4P4KD 3VXNB 4ZFGL 1RV6X 5D2LE 2B4CC 2HLAA 1J8HD 4OQTA 1YNLH 2BNRE 4AK1A 2OR9H 1IL1A 4LLWA 5D2LB 4N5UA 15C8H 3S9DB 1OWWA 1T6WA 2BNRB 2DMKA 4HIHB 1IAIM 4MCYA 1D5XA 2FYYB 4X6EA 4JZJB 3FB6B 1CXKA 4FQLL 4KI5F 2ADFL 2YD3A 3BW9A 4QXTB 4DK3A 4LEOB 3ARBC 3DMMB 5I15H 4KXZH 2G5BA 1MHPH 5H94B 4RMWA 3CMOL 2HTKC 4MDIA 2X4QB 3SHSA 4HWBA 4OD1L 4Y89A 3ET9F 1AXSB 4U0RC 5FB8A 2AAVA 4U31A 3IDGB 1IGTA 1U0QA 5BOZG 5EBMB 3T3MF 3UP1A 1FORH 4I3SH 1ZLUH 3EO9L 5CBEA 2AV7A 2PR4L 5AD0B 5EORL 5EOQL 3GSQB 1T0MA 5DUMH 5JIPA 2R0KH 2DI8A 1FNGA 1FO0L 4M7JH 5HYQA 3ZE0E 1KIPB 4XP9H 3MXWL 3GHBL 4OD3H 4LSUL 3KDMB 4KQ4L 4JPWL 5FO8A 4Y19E 2A6JB 4PJFA 3GSXA 3DX7A 4JN2A 3GDBA 4Y19B 4Z8FH 2CLVA 4A2LA 4HGWA 3V8CA 2AQ2A 5HHVL 3ULUE 2ZKHL 1FNHA 3UJIH 3AS1A 4YDIH 3IS0X 3QPXL 2X1OA 2ZP0T 4BELD 3FN3A 4YK4B 4PJIE 3CNKA 1JGVH 4OT1L 4J3WA 4PJIB 1FZMA 4S10A 4WEBH 3WXWH 4KQ3L 2HFTA 4G42B 1M6OB 4CW1A 4DEPC 2K3TA 5F89A 3A67H 3DO3A 1IAIH 4FQJH 3VXPA 4LSPH 4YXHH 3TO4D 2GJ6A 1JGUH 4W6YB 2P8MB 4KJPC 5CIPH 1IL1B 4LLWB 1IC5L 2R56H 2NCMA 1QBBA 2ITDA 4J1UA 4MCYB 5DLML 5CJOL 1D5XB 2LE9A 1MCIA 3T09A 1QOKA 4X6EB 1HZHH 4PJEA 5TPWH 3JWDL 3VGAB 3BW9B 3N1MC 4Z7QE 5AG9A 2G5BB 5HGBA 2LV4A 3U4BH 1IGYA 5K93A 4MDIB 1ZHBA 2E3VA 4X6FA 4YEEA 1S3KL 3MRPA 4I0CC 4OF6A 4PS4H 1U8QA 1DBKL 5FB8B 3RGHA 4ONGL 1QLFA 1IGTB 3PWPE 3FOLA 1A1MA 3C8DA 3WN5A 2HFGL 1Q9OB 4J3UA 1G9ML 5CBEB 4PG2A 1YN6A 1ZMYA 2AV7B 1KELL 3IU4H 1X4YA 1T0MB 3EYUL 2X4OB 3KJ4B 3WS6C 1FNGB 1HEZA 2FIKA 5HYQB 5GS0H 2NNAB 4TVPE 3BKMH 1WF5A 5FO8B 4PJFB 3GSXB 4LVEA 4DVBA 2ZOKA 3BZDA 1ZLVH 3DX7B 4JN2B 5E03A 2P7TA 1OWRM 2CLVB 4HGWB 1P7QA 1C1EH 2VO5A 5GPRA 2DQGH 2QSTA 1T04A 2NY2D 1DZBA 5GGUA 4MA8H 1A6UL 1VKXA 4UT6L 3LHPH 5FEBA 1DVFA 1ZKAA 5E94A 1J0JA 1FZMB 2Y5TA 1MFCH 2I60H 1IGML 4I8DA 5EA0L 4HXAL 2HH0L 3HI5H 4CW1B 5IB4A 5KSBF 4PRPE 5F89B 3VXPB 5GS1C 4JKLA 2AJXL 3R4DA 3UBXA 1CXIA 3T1WA 5BRZD 2GJ6B 1E27A 1PKQE 3RZCA 3P73A 1AGCA 2Z93A 3IJYA 2BVTA 3UZVB 1U93A 4GAFB 1GL4B 3RVVC 3LIZH 1UT9A 3JWOL 4C56A 4AYFA 2ITDB 4J1UB 3ZKND 4NQED 3LEXA 5INDA 2YHGA 1IKNA 4A6YA 5I73B 4XB8A 3ZDYE 1OAYH 4PJEB 1YYML 5GRJH 4X6DF 5FK9A 5HGBB 1LEKA 4FNLH 1NCTA 1JZ5A 1IGYB 5D70L 1DBBH 3F12A 1HNFA 1ZHBB 4X6FB 2VISA 3FO9A 4L3EA 2GY7B 1XF2A 3EIFA 3MRPB 1CR9L 1U8QB 5JHLL 4NN7B 3LKRA 4QRRD 3GJFH 1QLFB 4O4YL 3O4LD 3FOLB 1A1MB 3WN5B 2A2QT 1GGIL 4OIAA 1IBGL 4HGMA 5HVHB 1GZPA 4HLJA 2PXYC 1YN6B 4XWGH 5FYLH 4HXBH 4LFHD 4PJ8D 3DTXA 1CLYH 1HEZB 3F58L 2FIKB 1N7MH 1VDGA 5B39G 3H2WA 4LVOB 2VLME 2NZ9C 2O61A 4WW1A 1FL5A 4OLYH 5HHOA 4DVBB 2ZOKB 4N8VA 2P7TB 4WV1C 4GXUM 4QGYA 4F15C 4Z0XA 4R0LC 3WXVL 1KTLA 3LRSA 2DLHA 5L0QC 1T04B 5IVZA 1KJ2A 2R2HA 1T7VA 3EDJA 4XPHH 5GGUB 1IEHA 3N06B 3OBAA 1VKXB 4G7YH 1DVFB 4K3DL 2YXFA 3MRLA 1L4IA 5E94B 2VR9A 1VEPA 4OFYA 3W2DL 4O5LH 1CTNA 1GC1C 2Y5TB 4LASH 2X6MA 4BQ9A 5L9DH 4N90D 3EYSL 1OW0A 3OKYA 2HVKA 5IB4B 3BP5A 4ZD3H 4HFUH 4V2BA 5F9WC 5BZDA 5AUMA 1EIBA 3UBXB 3CIQA 2L7UA 2F15A 3HE7D 1E27B 3RZCB 4IRZL 1TJGL 1AGCB 2Z93B 3DX8A 5EG6C 3IJYB 5FGBC 1OTTC 5J6GA 1U93B 4Y1AD 4C56B 3ZT7A 3QRGL 3LEXB 1Q1JL 3UPCA 5INDB 5DQ9A 5IWLC 2Z31C 3V5HA 5CD5D 3I3EA 4A6YB 5C3LD 1FHGA 3HHRB 5E08L 5CP7A 2VL4A 5I8EA 5FK9B 3MOQA 4ODVL 1LEKB 1QVOA 3TJEL 4HPOL 4JFOA 3F12B 3J8F7 4N5EC 1E4WH 2VISB 3FO9B 1RURH 4L3EB 5HHME 4LEXH 2YSSA 2E6PA 3LKRB 1WFNA 5ABDE 4X7DC 1GOGA 2J88H 3S3PA 4DGIH 1AQKL 2DI9A 3QHZH 3RIAK 5D1XC 5F8QC 1GZPB 3ZDZF 4Y8DC 5D8JH 4MB5A 4NCC1 1WCBA 3MV9D 3DTXB 4M1GL 3VCLA 1VFAA 3MBXH 5IHUL 5HHOE 2O61B 4K23H 4WW1B 1FL5B 1EVUA 2GT9A 1HQ4A 1MF2L 1RU9H 1JNNL 4NNYA 5HHOB 2CLZA 2ICES 4N8VB 1Q72H 1JGDA 4TNWK 1LD9A 5C6TL 5DVMA 1KCSH 2ZCLL 3I9GL 5GZNC 4Z0XB 1KTLB 4ZTOH 3LRSB 4UOW1 2G75A 1JHTA 5IVZB 1KJ2B 2R2HB 3BEVA 2XG5A 2P5EA 3BMWA 3S35L 3EZJB 5IT2H 3MRLB 3X12A 1NCDH 5TQ0L 4UV4H 5CJXA 1JGEA 3GMPA 3LH2H 5DMJB 3IVKB 2UY6A 3QG6A 5JIIA 3EFDL 3N85H 4CVUA 4U6YA 5BV7H 2NR6C 3H0TA 3O8XD 3BP5B 4NN5B 1HSBA 5A43C 5BZDB 1A3LL 5HDBE 5AUMB 5ADPH 3MLPA 5TFSH 1MFBH 4LIQL 3DX8B 2WIIA 1R5IA 1DQJA 4YHIA 1UM6H 5J6GB 5IGXH 4Q2ZA 4E41D 2Q3ZA 2RBLA 4CU6A 1BJ8A 5DQ9B 3V5HB 2AK4E 4JY4A 4L8SA 3VG9B 4UOJA 5CP7B 5JA9A 5I8EB 4S1SH 4ERSH 3M1BA 4NQDA 5F96H 5J13C 2WBJD 1QVOB 1QSEE 2LTQB 1IAMA 3U46A 1NMAH 4JFOB 3KPLA 3RVXD 3FONA 3ZTNL 3LB6C 3B9KA 1WC7A 2OBGA 2YSSB 4DN3H 3B6SA 2F58L 3E2HB 1X6LA 4XCCL 3RU8L 1HXMA 4MJID 2IPTL 3HNSL 4OGAD 1INEH 1YNKL 5C07D 3CDGA 5JOEA 3KPPA 1WCBB 2JCCA 2AERT 2F19L 1BVKA 4U1SA 2A9NH 1EHLH 2MTPA 3K2MC 3VCLB 4ODWB 5DXWA 4CMHC 3WL9A 1VFAB 3RIAF 3KPOA 2Z91A 5AZEL 2GT9B 1HQ4B 1JRHH 3KPRD 4NNYB 4WI5A 2CLZB 4LHUG 1UWXK 3LEVL 1FZJA 1Y18A 1JGDB 1LD9B 4YGAB 2GJZA 4ALAH 1S7QB 5EZIL 5I1EL 2UUDH 4PRNA 3O4OB 3O2WL 5FHAL 2MMXA 3BJLA 4NFBA 2G75B 1JHTB 3BEVB 1CLOH 3MCLH 3E0GA 2P5EB 1MCSA 3OWEA 1URLA 1EGJA 3PV7A 4XP1L 4TNWF 4LLQB 1J0KA 3OSKA 4G6ML 4KV5F 4F9PC 3X12B 4P57B 1RFDL 2NY7L 1JGEB 3GMPB 4JRYD 3C60D 2H8PA 4BJLA 3DSNA 3QG6B 2A0LC 1EO5A 3GFUA 2VQTA 2CD0A 4U6YB 1G7LA 3H0TB 2V2TA 4IOSD 5CEXA 4M6MH 5DS8A 1CICA 1HSBB 4GMSL 1NGYA 3ARBD 2DKMA 1TLKA 1UWGH 4APQA 3LRGA 2DM7A 1N64H 4LLDA 3BVNA 3VXOA 1R5IB 1DQJB 4YHIB 1RUKL 4OCSL 3ARSA 2RHEA 4Q2ZB 5L2KA 4OZGF 2G60H 4RISL 3PP3K 1HIML 1X7QA 1YECL 4B0MM 2ICWJ 1DL7H 3WFZA 4JY4B 3ULUL 1X4XA 4LOUD 4L8SB 4NWTH 5DUPL 4UINL 4NQDE 1LE9A 4FTVE 5HDOA 4OTXL 2ILLA 1RZFH 3M1BB 4NQDB 2A73A 4NIKB 5T5FH 3NN8A 1BWMA 3CLEH 3U46B 3KPLB 3FONB 5CEZH 3B9KB 4OCRH 2ERJC 5EU6E 1WC7B 1T7WA 1G0XA 3HI1A 5FKAA 3B6SB 3SCMC 1SM3H 3FRPA 3QUMH 4GRWH 1HXMB 2XWTA 3VRLE 1Q0XL 2NYYD 2VR5A 3CDGB 2JCCE 2Y23A 3PF2A 3KPPB 4PJDE 2JCCB 4OLZL 2AJSH 4EXKA 3SE9H 1BVKB 4HCRL 4U1SB 1HH6A 3GUTA 1GGCL 4XMKH 3WL9B 5FYLE 1NBZA 3KPOB 2Z91B 2RIKA 5F3HA 1V5JA 5C0ND 4M93B 4FQIL 1FZJB 1Y18B 2VZSA 2GJZB 3JWNC 2X1WL 4PRNB 3HC3L 5DD0L 1G7JA 1UKSA 5IBLD 4YBHA 5F6IC 5EC2A 3ECBB 3NCCB 2DKSA 5E1AA 5MEQA 3V6FA 3BUYA 4PD4K 4U1MA 4IOIA 3L3OA 3RX5A 4DUXA 2EEBA 5GZOC 2P42B 4YHZL 1UQSA 5HYEA 3VRIA 3D3VA 4Y5VC 3T0ED 2IQ9L 2H8PB 4PJHF 3T2OA 5HY9A 5J56B 3BH8A 3NA9L 4XNZB 1AXTL 1G7LB 2V2TB 5CEXB 5DS8B 3W11D 1CICB 1NGYB 4JG0H 4Z7WF 1S9XA 2XZCH 4LSVH 4RDQF 4APQB 1MFDL 4KHTH 1X3DA 4PTUA 4LLDB 3BVNB 4TVPL 3BKJH 4IBLT 2YPKA 1KENH 5SX5K 3VXOB 5L2KE 4IDLA 4WWKD 3NCEB 4UQ3A 1EZVY 4HEPG 3BPCA 5L2KB 4LRIA 4EN3D 2OM5A 1CL7I 1X7QB 5CLWA 2J1KA 2J8HA 4I5BA 1R0AL 3KLSA 4FXLA 1CFVL 2F53D 1NCWL 5IMMA 1LE9B 3QFDA 1FGNL 3SDCA 4LQFL 2AEQL 5I71C 1I1FA 2BFVL 3BGAA 2B2XL 2A73B 5HPMA 1J5OL 1V3KA 3MJGX 2AXFB 3NN8B 4ZUWA 2OL3A 4OM1H 3EOBA 1DN2A 5D2NC 4EOWL 4M7KL 4XXDA 1H3GA 3TGXA 3HI1B 5FKAB 1JUFA 4A2MA 3GHEL 4L9DA 1JTPA 1DUYA 2XWTB 1RPQA 3MV7A 4YNYA 3UTPE 5EWIH 5E4EC 1NCCH 2XN9E 1I7RA 4X7EC 2JIXD 2VE6A 3MJ9H 3HG1A 2XTLA 3QI9D 1HH6B 4NOFA 3BQUA 5A16A 3GUTB 3VI4F 3MYJA 4P48A 4Q0XH 3CDYA 3VGGA 1NBZB 5CKGA 3UTQA 5F3HB 4KK9D 3U7WH 5IROA 2FD6L 2P8LA 4JM2D 2YPVL 5IR1A 4K8RH 4OI7A 4P59L 2W0FA 2OZ4A 5FYKH 5I0ZA 5I8OH 1NAMA 5DHVA 1G7JB 4G6KL 3RY6A 1K6QL 4WUKL 3HNVL 1NBVH 3IKCA 2EYSA 4UIKL 4NQTA 4MX7A 5EC2B 4RFNC 2X41A 5E1AB 1G84A 5E2WH 5HTSA 3V6FB 3BUYB 3ETBF 4HG4K 2ZUQB 4U1MB 4IOIB 3T0AA 3L3OB 1FIGL 1V3JA 4XZUA 1UQSB 3BPLB 5I74B 4P23D 3VRIB 3D3VB 3MUZ1 3O3BA 3IDJA 4FQ2H 1Q9LA 5HY9B 3DVNA 3P9LA 3R1GL 4MCZA 4IS6A 4AL8H 1S9XB 1X6NA 4F57L 2ZJSL 5HI4C 1NLDL 1KFAL 3JWDC 2VLJD 4PTUB 4X5LA 1W72A 3BDBA 3QR2A 2YPKB 5D4QA 4XC3L 5ANMA 4UQ3B 3BPCB 4PRIA 1QFUL 1UH3A 3HPLA 4I5BB 1AR1D 2Z8SA 4Y4KA 3RUGE 3PABA 3G6DH 4KI5D 5IMKA 3LN5A 3QFDB 3SDCB 1PQZA 4NUJA 1VFMA 4KK6C 1BFTA 1L9MA 5HPMB 2W92A 2B0SH 3MLXL 4ZUWB 2OL3B 3S34L 3AB0C 4L8DA 5IBTH 3EOBB 3HNTH 3I2CL 5IUSA 1I8LC 4XXDB 3FO2A 1BEYL 3O9WA 1JUFB 1CDGA 5J0BA 2VDLL 1DUYB 5DEGA 3E6HA 3MV7B 3DXAA 4ZUUA 4YNYB 1U2CA 3TPUA 2VE6B 4P2OA 3SQBA 2OJZL 3HG1B 4WI3A 1PD6A 4UILL 4GG6A 3KNBA 5D1ZC 3BQUB 5AWNH 5A16B 3MYJB 3DYPA 4H8WH 5JXEA 4NQSA 1FNSH 1WBYA 1CGSH 4OV6F 3UTQB 1LP9A 1QRNA 1YNLL 2OR9L 5KVFH 3IFLH 15C8L 2P8LB 1R3IH 3V52L 5IR1B 1B6DA 1NAMB 5DHVB 3DPBA 5A2IH 2FX8L 3IKCB 2EYSB 4MX7B 4LARL 5D7IA 3BZEA 1MHPL 3LY6A 2N56A 3ZE2F 3L3DA 3OAUL 3O3BB 3IDJB 4J4PD 5E5MA 1G6VK 3ARZA 2F5BH 4JFFE 2CRIA 4I4WA 1Q9LB 5C0CE 3F6IA 3DVNB 3TLRA 3P9LB 2CRYA 3U9PL 4ZS7H 3O41A 4FQCL 1MCEA 4MCZB 3MLVH 5FUCE 4IS6B 4XP4H 4I3SL 2I9TA 4HS8H 3DV4A 4X8JA 1XF1A 5ANME 2V5MA 3OL2A 3PUCA 1W72B 1T03L 5D2LF 2I25N 4S1DD 5ANMB 2R0KL 2XYCA 1LMKA 4Y7MA 4PRIB 4XP9L 1I3UA 4OD3L 1ZT7A 2QQNH 3HPLB 3U82B 3OAZH 5D7JC 4ORGA 4RGOH 3O2DA 4Y4KB 5IMLA 1X44A 4Z8FL 1KJ2L 3PABB 4NKMA 5IMKB 3LOWA 3LN5B 3MCG1 2EDTA 4LGSB 1PQZB 4NUJB 3UJIL 3FQUA 1IFHH 1MCHA 1WZKA 1A7PL 1V3MA 3U7AA 4IRSC 2UZXB 4J12A 2EDLA 3MRHA 1JGVL 3FO2B 2D7PA 3O9WB 4PP1D 4JDVA 5TE6L 5DEGB 1NCBH 3E6HB 2WLZA 3DXAB 4ZUUB 1OOAA 4HC1A 4GRWE 1KT2A 3EHBD 5DFVD 5F71A 3WXWL 4WFHE 3RY4A 3TPUB 4P2OB 4MA3A 3WV0A 3LEYL 1QHPA 1ROWA 4GG6B 1LP9E 3H42H 4LSPL 4YXHL 3ZE0F 1QRNE 4NQSB 5CKAA 2VDRH 1WBYB 4WFED 1LP9B 5JUEH 1QRNB 1L9NA 3GNML 3L7EA 5DZOA 1UB5A 3O6FC 3D48R 4PV9A 4FRWA 4FG6D 4I77L 3S7GA 3ULUF 4G6AC 4PLJC 5EU7C 4G7VH 4R7DA 1IM3A 1NC2A 2H2PD 4OCNC 3EJYD 4WHTA 4KRLB 3KYOA 5D7IE 1FVCA 4P2RD 4PJIF 3BWUC 2WIMA 5D7IB 4LCIH 5BS0D 2IPUK 4YQXH 3BZEB 5D96C 4WO4D 3RQ3A 4AMKL 1KPVA 1OCWH 4KRPC 5D93C 2B1AH 3MACH 35C8H 5I66A 5E5MB 3BGFC 1EA9C 4I4WB 3ZKXB 4UAOC 4PS4L 2Y07H 5I8KH 1NEUA 1X5LA 4J7RA 1YYLH 2MWCA 3DYMA 3O41B 3BYYA 4LAQL 2VLKE 5DMGC 1G6RH 3CFKA 3IRZA 5IKCA 2I9TB 3DV4B 4X8JB 2VLKB 3MNVA 1XR9A 3QWRA 1QSFD 3LB6D 4G9FA 3H9YA 4PJ9D 3UC0H 2VZUA 3VXRD 4ELME 1WFUA 1VEOA 3VGFA 2NY3D 3BKML 2K9UA 1ZT7B 4RWHA 1UGNA 3CLFH 4ORGB 4NM8H 4ZTPL 4XCYA 5IMLB 4XCEA 3T77A 5D7LA 4NKMB 4FFZL 5DSCA 1C1EL 3RGVA 4ZMAT 4Z7QF 1MEXL 1E4XL 3FQUB 5E8EA 2DQGL 4K2UH 2Z9TA 1FZKA 2UV3A 1HQRA 5HYJD 4Z95H 3DVIA 2C3XA 3NFNB 4P4KA 3MRHB 1FFQA 3DOSA 2C4FT 1J8HA 4RRPG 3LHPL 2JB5H 2VWEE 4JDVB 4AZ8A 4TSAL 2MKWA 5E99L 3RWJA 4QRUA 4I18B 1J7VR 1MCNA 1KT2B 2I60L 4D94A 2BOBA 1QPXA 4MA3B 2IPKA 5E2JA 3X17A 3AXLA 4IHOA 2W38A 5H8DA 3JVGA 1D6VL 1UXWA 1XIWD 2EH7H 1BD2D 1EHNA 3HTLX 5IFAH 5C0AD 3TV3H 1MCKA 3L7EB 1HHIB 3UTSD 2CGRL 1UB5B 4JRWA 4XBEH 4Z6AT 2DLIA 4R7DB 1IM3B 1MREH 1NC2B 3QQ9D 4WHTB 3QEUA 3KYOB 1J05A 5J06A 1FVCB 4JFDD 1OAYL 5FYKE 4JHZA 5DFTA 5KZCB 4W6XB 1Y0LA 2Q86A 1MI5E 1KPVB 3KHOA 5I66B 4EBQH 1CXHA 5J8OA 1LE5A 3VU2A 1EAPA 4ODSH 2IBGA 1U92A 4OZFG 2PO6C 1R3HA 4HIEA 3QEGL 3CFKB 4XPAL 5MP6H 5IKCB 4OSUH 2C5DC 4Z77A 3MNVB 1XR9B 5CJBA 5IMOA 2WZPD 1T89A 4XWGL 4G9FB 5FYLL 4IOFD 1HI6A 1S9VA 1T2QH 1X5XA 5TQ2H 5EULV 3MZTA 4FQPA 4LPWA 4XBGA 3NA4A 4XCYB 4XCEB 3T77B 4Y4HD 5D7LB 3ZDYF 1U8OA 2UWEA 1CDBA 2WLYA 5DSCB 2DM4A 3RGVB 3RDTC 1TTUA 1PG7H 2WV3A 3EKCA 5EIIA 3HFMH 1FZKB 2XKSA 1MPAH 4GKSA 1HQRB 3TO4A 1MUJA 1J8HE 1MCWM 4LF3A 3UZQA 4P4KB 1WCQA 3U1SH 4XPHL 4FQHA 3NZ8B 5KBNC 1J8HB 5IVOA 1ZLUK 3MOBH 1NGZA 2DWDA 4O5LL 3RWJB 4QRUB 4JZJC 4HBCL 1M7DA 1U8IB 3MUGA 4LASL 1JK8A 7FABH 4HKXA 5L9DL 2BOBB 5E8OA 4B50A 3DMMC 4HX1A 2IPKB 4ZD3L 1SMAA 3AXLB 4BQCA 4IHOB 1JWUA 4HFUL 1G1CA 3G6JE 1YEGL 3DIFA 4BFEA 1FCGA 1Z9SA 1YEHH 1UXWB 3EDEA 3K4AA 3EYOA 4HBQA 1JYXA 1ZEAH 4C58B 2ZUVA 32C2A 2E6QA 3QEUB 1J05B 1KTRL 3TH3T 1TFHA 4P2YA 2BHUA 1BLNA 3P4NA 2BSTB 1QR4A 4MQXC 2P8PA 1Y0LB 2Q86B 3OHXA 4KKBD 1LE5B 2FECI 2X4SA 4LEXL 1EAPB 5F1NB 5L7XH 4M02A 1U92B 3L5XH 1WT5A 1R3HB 2XTJD 3UJTH 3ULUC 4XP6H 3QUYD 4HIEB 4YBQD 4XVUD 2J88L 4DGIL 3QHZL 4ZYKA 4YK4C 4JKWA 4Z77B 2AV1A 5D8JL 5DMKA 5IMOB 3KYMA 1S7UA 3GZKA 2DYPD 1U3JA 4M1CD 3DLQR 4OZFH 1S9VB 5LGHH 4GW1A 5FYJH 4K23L 2X70A 3O81A 6CGTA 1GJIA 4XBGB 1I9EA 1NCNA 1Q72L 2UWEB 1U8OB 1I4FA 1OHQA 3DRQA 1KCSL 3Q0HA 43C9A 2NY0D 5E6YA 4H5SA 2B7DT 1WTGT 4U33A 5EIIB 4GKSB 2E7LA 3TO4B 5BRZA 1MUJB 2K7QA 2R2CA 4LF3B 4XI5C 4FQHB 1CE1H 2FL5A 1NGZB 2PW2A 4WGVB 2DWDB 2VQUA 4EDXA 1CBVL 4ZOBA 1SEQH 3GKZA 3EW3B 3LH2L 4NQEA 5KAQF 1M7DB 3MUGB 4UV7H 1JK8B 4HKXB 3VGAC 4LPXA 3N85L 3CFDA 3S37H 5E8OB 4HX1B 5DD3H 2BJMH 3KJ6L 1JWUB 1S5IL 3DIFB 1YMHA 1RZ7H 1UM6L 3EYOB 4KKLC 1T5WA 4HW6A 1F11B 2NY1D 5DWUH 4QRRA 5DQJA 32C2B 2UY7A 3O4LA 1WJ3A 1QKZH 1K4CA 5DJCA 2OL3L 3WO3B 3O6KL 1BLNB 3KJ4C 3P4NB 3CFCL 1P4IH 1NLBL 3LQAL 3BWAA 2AJ3A 3HZYA 5I1KH 3OGCA 4S1SL 4U2YA 4QTIH 4ERSL 4PJ8A 2P8PB 5F96L 5DK0A 1IGIL 3OHXB 4PJAA 4QXGL 4FABL 4JY6A 4G9DB 5ESVA 1IGFH 2X4SB 4MSWA 1Z5LB 1OT1A 3DNKA 2BY3A 3D2UD 4PJCA 5HDBF 1INEL 2JJUA 4ZYKB 1MHEA 2AV1B 3VFOA 5DMKB 3KYMB 1S7UB 1KG0A 4KROD 2NY2B 2A9NL 3QUXD 4G8EA 1EHLL 3AGVA 4GW1B 2Z0BA 3IDYB 3VFVA 4G6JH 1XGYH 4X98A 4PR5A 5KS9A 5DRWA 2NMSA 2X70B 1JRHL 4JM4H 2DJSA 4OM0H 2YZ8A 4MNQD 5L8LB 3VXMD 1I4FB 3PG2A 5ELIA 3DRQB 1YEKL 3QP3A 43C9B 4H5SB 2AXHA 3K8LA 5DRNA 3T4AA 4OJFH 2PTUA 3GJFK 5BRZB 1CLOL 3HE7A 3MCLL 4YHPB 3H8NA 2HT4D 2FL5B 4Y1AA 2CMRH 5GHWH 2PW2B 4UOW0 4EDXB 1JZ2A 4N8CL 5I73C 3MLSH 2YMXH 3HC0A 4NQEB 4TRPH 4R6UA 2HYMA 2PW1A 1W72L 3CFDB 1F3DJ 3MREA 4M6ML 5HVGB 4LBEA 3MROB 4P9ML 1HYRC 1Q94A 1UWGL 4KUZH 2O5YH 2JKXA 2EEDA 3ORJA 1YMHB 2EIEA 1PG7W 4NN7C 2V5YA 4LLUA 4QRRE 1AJ7H 2GCYA 3NCBB 3Q6GL 2AQ1A 5DJ8A 5KN5A 1T5WB 2G60L 1N26A 3WN5C 4QRRB 1LDPH 2ZPKH 1BZ7A 3CC5A 5DQJB 5HVHC 3O4LB 4PG2C 3IAGC 1K4CB 5DJCB 1QO3A 5MEPB 2ITCA 3T0XA 4L8BA 2AJUL 3TNMA 3BWAB 2NY5C 3HZYB 3MV9A 4LVOC 3OGCB 4PJAE 1RZFL 4PJ8B 5DK0B 4PREA 5T5FL 3TC9A 4PJAB 3CLEL 5C0GA 5I17A 4JY6B 5ESVB 3PHOA 3AY4A 2ZG3A 4JY5L 4MSWB 1FVDA 1SM3L 1E28A 1F6FB 5F7YC 4ZODA 5KVMC 4PJCB 1F3DH 3V4UH 1MHEB 3VFOB 4HH9A 2XY1A 3MNWA 1MFEH 2R4SL 2VTFA 1DVFC 4PGJA 1KG0B 4XPBL 5CZXD 4L4VE 4G8EB 3VGBA 5KS9E 4GG8A 4OGYH 4XMKL 4QXUH 3VFVB 2CSPA 2W9DH 3LCYA 4X98B 4PR5B 5KS9B 5DRWB 5INCA 1KTDA 3PIQA 4N90E 1JFQH 4IRJD 4MQTB 2NXZD 2DIBA 3R0NA 3MGTA 3MA7A 4MLSA 3O8XA 4MD5A 2AP2A 5DRNB 4FQXD 4CADA 3GGWA 3RZCC 5DVKA 4GW4A 3T4AB 4H20L 4K7PY 2LQRA 1JPGA 2VLLB 3HE7B 3VW3L 4Y1AE 1QBAA 3DROA 4NUGH 3PQYD 4Y1AB 1VCAA 2IALA 1IKNC 3VRLF 1JF1A 4E41A 3HC0B 1E4KA 4ETYA 5F72S 2JCCF 2PW1B 1P84J 4PJDF 5F1KC 3FQXA 3V6ZA 1F6AA 1SBBA 1MCWW 3MREB 2GYSA 4LBEB 4JG0L 5IHZA 2XZCL 1Q94B 4JFYA 2DJ4A 3CSBA 4LSVL 4FFVC 4P46D 4U2ZA 2VXUH 5TE7H 4KHTL 2WBJA 2CKBH 2FZ3A 3BKJL 4MZ2A 1KENL 4LLUB 5D7KD 2GCYB 1IARB 5DJ8B 1PKOA 3VI3E 5KN5B 2ZSWA 4YPJA 5JTWA 1BZ7B 3CC5B 4EUPG 4MJIA 4U7KA 3P30H 1QO3B 5C07A 3RJQB 1TQBB 3MV9E 2I9LA 1V7NL 3WDIA 4L8BB 3TNMB 1Q0YL 3MV9B 3NIDE 4H26A 4Z7UA 5J11B 4Z0BH 3SKJH 1UM5H 4PREB 1A1OA 4MNGA 5C0GB 2FRGP 3GRWH 5I17B 4OM1L 4LDOB 3PHOB 4HC1L 3KPRA 1FVDB 4GKNA 4JLRA 1E28B 3BD5A 1ONQA 4JFQA 4MAUL 4M5YH 4FMKA 3V6OE 3FAXA 5T3XD 1OVZA 3KPTA 4HSQA 1K2DA 4UTAH 4HH9B 3I75A 1F8TL 3MNWB 2VSDA 4WI8A 3ZKQD 5I2IA 4LDEB 2KPNA 3MLTA 4KUCF 5EOCL 3VG0L 1W0WA 1JI2A 4GG8B 4Q0XL 4O9HH 1K8IA 5H2BA 5CGMA 4YX2H 5INCB 1UJTA 4JRYA 1OW0C 1V7MH 3PIQB 3U7WL 1JYWA 3DBXA 2J8UA 1D9KD 3C60A 4NN5C 2B1HL 5FYJE 3MGTB 1IZKA 3MA7B 3O8XB 4MD5B 1BPVA 5FYKL 4NO5A 4CADB 3GGWB 5I8OL 3ARBA 4HJ0D 4GW4B 4JPVH 2VXQH 5CILH 4YWGH 1NBVL 1JPGB 1GGUA 5HVWA 5JW5A 3IJHA 4FZ8H 3CXDH 3DROB 2JJVA 2IALB 4ZOCA 1JF1B 3QEHA 4E41B 1TETH 2A77H 4FQ2L 1F13A 3VG9C 1X5GA 1Z9LA 3GJEA 4NP4H 3FQXB 5JMRA 5JIHA 3V6ZB 2EE3A 5GGTH 3O3AA 1MNUL 2VDQH 2LTQC 4MQSB 4AL8L 5IHZB 5HGDA 4CJ1A 4MJ5A 2NY6D 3UYRH 2WBJB 4HPYL 2FZ3B 5FF6A 3E2HC 5DUBA 4OB5H 5KSAB 4RGND 4OBSA 5FXCH 2ZSWB 2P48B 2ZG2A 4MJIB 1CXEA 3TBWA 3RAJH 5ISZD 1C8PA 5C07B 3FFCD 3NIGE 2I9LB 1N59A 3IAPA 5DO2C 1NL0L 3TO2A 2HVJA 4H26B 4DKAA 4Z7UB 2BNQD 1WBZA 2IWGA 1A1OB 2WWMC 4G5ZH 2B0SL 4MNGB 3FMGL 4DAGH 3IDNA 4NZUH 2CIIA 4PBVC 1GIGH 3KPRB 1QG3A 4GKNB 4WFGD 4JLRB 3O4OC 4ZUVA 4XH2A 1ZVHA 5B3NA 3ZSTA 1ONQB 1C08A 3HMWH 3JTSA 4JFQB 4OF3A 3I6LD 2GFBA 1K2DB 1J1PH 3I75B 5T1DL 3R06A 4LSQL 4M43H 5I2IB 4G3YH 5JIKA 5CJXC 3MLTB 1S7VA 1BFSA 1F4XH 2IH1A 3AS2A 2RJMA 5DVLA 5GGVH 3HMXA 1K8IB 4KH2A 5H2BB 4JRYB 3VD7A 5B4MC 3T0EA 3DBXB 2J8UB 3C60B 3IFLL 3RUGF 1ADQA 3TVMD 1CE6A 3WO4B 1R3IL 3LKSA 1BBDL 2VMFA 3IDXH 5LQBH 1W0VA 4PFEA 3T2QA 2IC2A 4NO5B 4NRZA 4KDTA 3KHQA 1BAFL 5JW5B 3IJHB 3RVWC 3GI9H 5GGSA 1BJ1H 4WWKA 3CK0L 1YJDC 5EBWA 4XB7A 3F7VA 3QEHB 4EN3A 12E8L 4L8SC 2R9HC 2F5BL 3Q5YA 3GJEB 4XTRC 5A2FA 2BVQA 2OTUA 2F53A 5KOVC 1MELA 4KMQA 4ZS7L 1DEDA 3O3AB 4I0PD 4GRLD 3MLVL 4MQXD 3VXSD 4XP4L 1WZLA 1FYHB 5K59E 1F3JA 5HGDB 4Y5YA 4HS8L 4MJ5B 1SEBA 1RJLA 3B9KC 4ODHL 5SWQA 5FF6B 3PDDA 2B5IB 3SO3B 4R9HA 3RKDC 5CAYB 5DUBB 1BX2A 1RIHH 1HSAA 5FA4A 3V5KA 1GYAA 4HUUA 5DRZA 1GZQA 1J1OL 2QQNL 3TBWB 3PWLA 4QTHA 1YY9C 3KR3L 3QFJE 1HOCA 1N59B 2JIXA 3TF7C 4PJ7A 3TO2B 2HVJB 3QFJB 1IFHL 3NFSH 1WBZB 3QI9A 3IRPX 1OY3B 5CJ8A 4M1DL 4M93C 3IDNB 1BIHA 1IKFH 5T5NG 3I3BA 1LK3H 2A1WH 1P1ZA 3C8KA 4ZUVB 1OGAE 4XH2B 1NCBL 4JM2A 2VDMH 5DR5L 1C08B 1VPOH 3JTSB 4CKVX 4Y0GA 2EC9U 3O0RH 4L5FL 4JQXA 1TZGH 2GFBB 1B6UA 2EXWC 3R06B 3D9AH 1UENA 4BZYA 1N2RA 1RZGA 4RBPH 4XCNA 3H42L 2IH1B 2VDRL 2DN7A 5DJ6A 3VFNA 4HMDA 1ZLWH 5T3ZH 2Q7YA 4P23A 4BUHA 4L29A 4XNZC 3T0EB 3FKUS 3SOBH 1JHKL 1CE6B 1I3GL 1CICC 1CZ8L 3LKSB 5DZNA 4R2GD 1W0VB 4APQC 4G7VL 2EYTA 1HNGA 4NRZB 3L3HA 2VLJA 5GGSB 5I19L 5F70A 4WWKB 3FFDA 5EBWB 3KPSD 1OCWL 2YS4A 1ZT4A 3PWPD 4N0FA 3F7VB 4EN3B 3MACL 35C8L 5IW3A 3DETC 4KHXH 1B88A 1SYVA 2F53E 3S4SG 3WUWG 1Y6MR 3WNPA 5I8KL 2Y07L 2FB4H 2BVQB 2OTUB 3LV3A 2F53B 4BFBD 4HD9A 3MTRA 1F3JB 1G6RL 4Y5YB 1LP9F 1AE6H 1SEBB 1RJLB 2FX9L 3QDMD 1CFTA 5SWQB 4N0YL 4AEFA 2R0WL 1BX2B 1HSAB 5FA4B 3G6AA 3V5KB 2E9WA 4HUUB 5DRZB 4F7MA 4D9QE 1GZQB 4QGTA 1DQDL 3X14A 5FM8A 2D4FA 3PWLB 4NM8L 3TEUA 1AKJD 2J8OA 4QTHB 4CBPA 1LQSR 4PLKC 3GBNL 5D7IF 3MLRH 3I02A 1WAAE 1HOCB 2EDQA 2JIXB 3SDYH 4NBZB 4PJ7B 5MEOA 2QSCL 3G5YA 1CGUA 3QI9B 4K2UL 5LCVH 1MIMH 2M26A 4XNYH 4K71B 2HT2C 4P99A 5IOPA 1OP3K 4OLUH 2JB5L 1KCRH 5E2UH 1P1ZB 3C8KB 2VERN 4WJ5A 4JM2B 4YFLI 4PRPD 4UMGA 4EUPA 4FMFA 5A2JH 2APVA 3W9EB 5FV2A 1XT5A 5E4IA 1G0YR 3HC4H 2ZUQC 2R0ZH 2DQFA 5DGQA 1G7QA 1RZGB 4XCNB 3BPLC 5I74C 4ZUTB 3Q5OA 4JFZH 5DJ6B 3VFNB 4JO3H 3DI3B 2EH7L 2Q7YB 4P23B 4J4PA 2DM2A 3O11A 4L29B 2EH8L 2R69L 2AJYH 3PHSA 2GJJA 2DQUH 2DLGA 5J6HA 4X4YA 2JLLA 1J0ZA 2EYTB 2J6EA 1MREL 4OLVH 1Z3GH 2BHYA 3GM8A 5IQ9A 3L3HB 2VLRD 2VLJB 1B0RA 5FM4A 4LRIC 3FFDB 4FFWD 1CD8A 4ISVA 1J87A 1C5BH 1ZT4B 5F9OH 4N0FB 3U7YH 5GJTH 2DTSA 1I9RH 1XGQA 1SYVB 1WICA 1RK0A 5KVDH 5F1SA 3A6CL 5DD5H 4BKLA 5GS2H 3SDCC 3LV3B 3O6LH 3RBSA 4M9PA 2ZZUT 3V79C 5IBUG 1GGBL 1YA5A 3WBDA 5JZ7C 5B8CA 2VZ1A 1FC1A 3LQAC 3WDJA 1CFTB 3EBAA 3V0WL 2FHFA 5K9QG 4H0GA 3G6AB 4U3XA 4WY7L 5TQ2L 4F7MB 3HUJA 1C12A 5HHNA 5BO1H 5C86A 3X14B 2Q8BL 2R0LH 1UH4A 3QIWD 3BJ91 1H3UA 2HTLC 2MSPA 3I02B 1A21A 3OXSA 3BQUC 5MEOB 4M3KB 4XCFH 4L3AA 4HF5L 3W82A 3G5YB 4OGXL 1IAOA 3GIVA 4AM0A 1MPAL 2D0FA 1CLZH 5IROC 1IEBA 2V2WB 3BZFA 3U1SL 3T2NL 4P2CG 4JCLA 5IOPB 4TTDD 4BUGA 5M7QA 4WJ5B 5D72H 4CNIB 4EUPB 4W68A 4MA1B 3RY6C 4YUEL 3J7HA 4AEIH 3JV5A 3JBG7 4P2RA 1DANU 4TQEH 2HAZA 2DQFB 5JW3H 5BS0A 3BD4A 1WEJH 4OCWH 4C55A 3TFKD 1T5XA 4WO4A 1YEHL 4Q9QH 4YGVA 5HGGS 2DL9A 3O11B 5HXMA 3H9SD 4X4XA 2CK0H 4M03A 2VYRE 5J6HB 3P0VH 4X4YB 4NFCA 5KSBA 1BWWA 1KLGA 2FGZA 5IQ9B 5FIEA 4CGTA 4GXVH 5HHMD 3VFWA 1B0RB 1QSFA 4HJGA 1F4HA 2Z92A 4BYHA 4PJ9A 3VXRA 4EIGB 4ISVB 5DVOA 3BXNA 4Y4KC 1XGQB 4GQ9H 1RK0B 4M62L 3WIHH 4JHAL 4BKLB 5L7XL 3L5XL 5CGTA 1WZ1H 3MLUH 3D18A 4RAHA 3UJTL 1OP5H 1EV2E 2CO7B 3ARXA 5B8CB 4X6DA 3G6JF 5GRZA 2DQDL 4G6FD 2J5LB 5E95B 2WANA 3O9WC 5HYJA 2OYPA 3HUJE 1WGOA 3G08A 3CH1A 1DQLH 2QADD 2QL1A 4TN9A 3WFEH 3HUJB 1C12B 2ZCKL 2MFNA 5HHNB 2N7AA 5FYJL 3GSRA 3B2UD 2BMKA 2W60A 4P2OC 5MHSD 4K3JH 3QIUD 2VAJA 3ISWA 3OXSB 1NMBH 4FS0A 5EB9A 3ZHKA 5JXEC 3ULVC 1G9NH 4F7TA 4X0KA 1IAOB 3QHFH 5LAXA 3GIVB 4ONFH 4AM0B 1UZ8A 4F9PA 5EO0A 1IEBB 4GUPB 3QCUH 3BZFB 4DKFH 3E1F1 1XIWA 4IDJH 1BD2A 1CE1L 1KBGL 1WWAX 3N1FC 5C0AA 4PJXE 3D0LA 3UTSA 5FM5M 3GMQA 3NZHH 1SEQL 5TDPA 2XT1B 3BSZL 4YIQA 4UV7L 1SQ2N 4P2RE 1A0QH 2PYED 3MBEA 4K7FA 2XZZA 1KN4H 3S37L 4P2RB 4QLRA 5BS0E 4JFDA 2ED7A 2Y7QA 5BS0B 5I18H 1YZZA 1CD0A 1T5XB 1U8PA 4WO4B 2E5EA 4EEEA 3ZKXC 2BRRL 4YGVB 2VKWA 1RZ7L 2AK4D 4DGVL 3UYOD 1H3VA 3MODH 4PY8J 4MAYD 4X4XB 5A1AA 5IVXA 1RZJH 5KSBB 1RZKH 1KLGB 3QPQC 1QKZL 1I1AD 2E6JA 1QSED 4JVPA 3TZVD 2D0HA 4X9FA 1TJHL 2VNCA 1ZGLP 4UTBH 3EAKA 3TJHD 1CL7L 1P4IL 5FGCE 3VFWB 3VXRE 3QZWA 1QSFB 4HJGB 2Z92B 1S7XA 4QTIL 4PJ9B 1U41A 2BOCA 3VXRB 4WTZA 3X11A 3BXNB 2HJFA 2NY3B 3SKNA 4V1DE 1T2JA 1IGFL 4OKDA 2EDYA 4YHMH 3MZGB 3C5SA 4Y4HA 3D18B 5CCKH 4YXKH 5IEHA 4LRNH 4X6DB 1UEYA 1PZUB 4FOMA 1OAZH 3QQ4A 5HYJB 5SWZD 5GS0D 2YUWA 4B7IA 1ES0A 3G08B 3CH1B 3PWJA 3ARFD 1SJHA 4I18C 4RNRA 3HLAA 3GSRB 2V5TA 2BMKB 2W60B 2YUZA 1WIOA 3BKCH 1TDQA 3C87A 2XQBL 3H3BC 2CO6B 4F7TB 2HP4A 4X0KB 1SY6H 5LAXB 4OJFL 1UZ8B 4WHCA 5EO0B 1OF2A 4HS6A 5GRXG 5FM5O 3EYFA 1XIWB 3QCVH 2DTMH 4M6OH 3UTSE 1BD2B 5FUOH 5C0AB 1F4YH 3D0LB 3UTSB 3GMQB 4X8XA 5F7HA 3LS4H 3WFDL 2UYLA 4N0CD 3MLSL 5TDPB 3RPKA 5I76A 2YMXL 5LGJB 4YIQB 4K9EH 1KYOK 4JFDE 3LMJL 4X4MA 4OZ4A 3MBEB 4K7FB 4BFGA 3BX7C 4Y4FD 4JFDB 5J1SC 4KU1A 3HPJA 2Y7QB 4PRDA 4KUZL 2O5YL 3VD3A 1U8PB 3BO8A 2ZUUA 2DL2A 5CD3A 1NAKH 4HWNA 5DEZA 2O26U 3MRGA 2IMNA 1AJ7L 5IVXE 4AY0A 1QYGH 1T80A 2X10A 5GGQH 1LDPL 4FTVD 1PEZA 4FA8A 2HRLA 1ZTXH 4H1LG 5IVXB 3FN0H 4HWZA 6FABL 3QUYA 4GW5A 2CPCA 3K4DA 1M7XA 3QZWB 4KZEH 1FO0A 2RQ8A 5EU6D 3BISA 4I3RH 5AYUL 4YDLB 1J8KA 1PBYA 1S7XB 4ZFOL 1UCTA 2BOCB 2DYPA 3O6MH 3X11B 2HJFB 3MGAA 3SKNB 4AQ1B 1BVZA 5DJ2A 3ARUA 3HE6D 3GKWH 2YBRA 3C5SB 2QR0A 3RGVC 4Y4HB 3RWFA 3N1PC 4X6CE 4XPGH 1CVSC 3SDXA 5IEHB 4KKNA 4XPTH 4NBYB 2DMCA 4X6CB 5LXGL 1PLGH 2E27H 4P4KC 5FYLD 1IAII 2NTSP 3QQ4B 4URTB 1MFEL 1ZAGA 1BVLA 2VITA 4AEHH 1QZ1A 1ES0B 3PWJB 1ADQL 3PGFH 1SJHB 2WSKA 2HLFD 3AC0A 4RNRB 4QXWA 5EPMA 3LS5L 3HLAB 5IK3A 1JFQL 2V17H 4RIRA 4J3SA 4PJAF 2YXMA 2AI0H 2OTPA 3JVGC 5KG9A 4GAYA 3CDFA 4AEEA 3WKMH 3OJDB 1OF2B 4HS6B 1DQTA 5CEYA 3EYFB 2ZUTA 1EZVX 4YHKH 3HA0A 1RJYA 4Y8AA 2UYLB 5I76B 1KTKE 4F37K 4X4ME 4MWFA 5D1QD 1P9MA 4OZ4B 4EI5D 2UZYB 1TVHA 4WWID 3WNMA 3HPJB 4KUCD 4PRDB 5KS9F 5GRUH 1XMWA 1N4XL 3BO8B 1WVZA 2CKBL 1GCFA 2VDOH 3MRGB 1QFWI 4Y88A 1JV5A 3WFBL 1A8JH 1A7NH 1O7SA 2XTJB 3V8OA 4AG4H 1A47A 4HWZB 3BT2H 3D2UA 1KIRA 3QUYB 4WI6A 4YR6A 3P30L 1T89C 5DEFA 4GW5B 4HFWA 2D7MA 1CXLA 1EFQA 1FLRH 5DTFA 1FO0B 4R26H 4Z0BL 1ORSA 2JELH 3SKJL 2DYPB 5E5RB 3QUXA 3MRDA 1H3XA 5CSZA 4HH8A 1OGTA 3GRWL 3UTPD 5DJ2B 3LN4A 2XN9D 3DARA 2X89D 2YBRB 2QR0B 3SDXE 4MNQA 3U4EA 3RWFB 3VXMA 4M5YL 3SDXB 1D5MA 1F3RB 2NY0B 4D9RD 5HHXL 3SDAD 3TO4C 4G8FA 3C5JA 2VXVL 1CYGA 4UTAL 4JO2L 2J4WL 4UB0L 2KDGA 4U6VL 1CDJA 1BVLB 2NTFA 2VITB 5EU5A 4POZD 3VI3F 5IESH 4OV5A 5EPMB 4QRQA 1AO7D 5IK3B 3CVHH 4YX2L 4JQVA 1V7ML 3LZFH 3NCJH 5C2BH 5E9DE 4RIRB 4X9GA 5EN2A 2GSIB 4HK3J 1CN4A 3NIDF 5KG9B 4HJJH 3KXFE 3WIIH 1XCQA 4JPIB 2JB6A 2JJTA 4JPVL 4M48L 4CMMA 2OXHA 3O2VH 4ZG1A 2CUIA 5CEYB 4OCYH 2E9BA 2QHLA 1T7XA 3CXDL 4Q97A 2B4CH 3QXUA 4Z18A 4KTDL 1RJYB 2F5AH 5GGSY 2NY1B 5IJVA 4FP8H 2F8XC 4MWFB 3P0GB 4PRBA 3V9FA 3WD5L 3WFCH 2DLTA 3PGDA 1BM3H 1A6WL 1NEZG 1TVHB 3M8OH 3KLAA 2VDQL 2ZOLA 1PVHA 5BVPL 4U4BA 4F37F 3HAEG 2BVEA 3E3QC 1YEDA 1WT5C 2G9HA 4OB5L 1G7HA 1LK2A 4PJHA 1JV5B 5F7EH 3TIDA 1MRCH 2M2DA 1RJZA 4L8CA 3D2UB 4YR6B 1EEUA 1KIRB 4YHNA 5DEFB 3CDCA 4JDZA 4Z7WA 1U3HD 4HFWB 1JHLH 5FA3A 2IGFH 2NY2C 1EX0A 2CJUL 4ZS6D 5KW9H 5DTFB 4G8GD 3WHE1 2NY4D 1MAKA 1P5UA 5E5UB 3IDYC 4ZOAA 4LMQI 4KROB 5IV2A 1OL0A 1ORSB 3QUXB 3MRDB 5CSZB 1OGTB 5CP3A 1JMXA 4Y16A 4DAGL 3LN4B 2APTA 4MNQE 4F33A 1GIGL 1H9VA 3O45A 4IRJA 2LAAA 4OD2A 4MNQB 4NM4H 3U4EB 4RFOL 4E42A 3VXMB 2X4PA 3IS1X 1D5MB 5SX4H 1S9WA 2E7LC 1MCCA 4MNHA 3PP4L 4G8FB 4FQXA 3RRQA 3SGEI 2Y1VA 1J1PL 4Q58C 2NTFB 5EU5B 4L1DA 2ORBH 3AU1A 5MERB 5JOPE 1F4XL 2P24A 4LSSH 3ZKNC 2XA8H 5EU3A 4OV5B 1RHHA 4FHBD 2H32A 3PQYA 4QRQB 1IT9H 5C6WH 3BGMA 4PIRF 4WNQB 2J6EL 1V8HA 3NIGF 1MJUL 5EN2B 5KTEH 3IDXL 5CINL 3SPVA 2VSCA 5FHBH 1AQDA 1XCQB 2JB6B 4CMMB 2ZCHL 3VDCA 4P46A 4MMXC 1HYSD 1JNJA 4JFFD 4D3CH 2JJSA 2VUYA 3BZ4B 5C0FA 2FGWH 4I3GA 5C0CD 3SY0A 2Q8AH 3ARED 5JOFA 3SKOA 1TQCB 4M6NH 1FNLA 1P6FA 5IJVB 4GMTH 1ZA6A 2D2OA 2DBLH 4PRBB 3C2AH 3PGDB 5EH1A 5F8RC 4PJ8C 4RSVA 3GSNH 5IQ7H 3KLAB 2ZOLB 4I2XE 3NH7H 4NZTH 3T0WA 2YD1A 4KAQH 1FH5H 1YEDB 2G9HB 1RIHL 4M4RA 1G7HB 1LK2B 4PJHB 5DYOA 4X99A 3TIDB 4CN1A 4KK5D 4OGZA 5TF1H 2CIKA 1RJZB 3ZO0A 4L8CB 1I7UA 1QBLH 2Q7NA 1JJUA 4YHNB 1XEDA 1MFAL 5DVNA 4JDZB 1ACYH 4R97B 4Z7WB 2DQJH 5FA3B 1VFOA 3X3GH 2EE9A 4JRXD 5L2JA 1Y6NR 5IV2B 4UT7H 3EOYG 8CGTA 3TCLA 5CEZD 2IANE 2W0KA 3C5ZD 3N9GL 4Y16B 1NPUA 1IKFL 4F33B 1LK3L 3O45B 2A1WL 3L7FA 4IRJB 3EO1B 1D9KA 1MCDA 4OD2B 2NXZB 4E42B 2VDML 4H1LA 2X4PB 4GO6B 3O0RL 2X2YA 1S9WB 5C0EA 5K59F 1ORQA 4ZNEE 1ZV5A 4MNHB 5IEKA 4FQXB 3HE7C 1HCVA 1FYTD 1CDUA 3U9UA 2WNGA 2I5YH 4HQQH 3FB5A 2B39A 3AU1B 3PQYE 2P24B 1RMFH 4QNPE 5EU3B 1RHHB 1L6XA 1KLUA 2H32B 3PQYB 2FBJH 4WFFE 3BGMB 3DV6A 4C54A 4ELKA 2R29L 5DJAA 5CD5C 1RIVL 1KB9K 4P2QE 5L8JB 3SPVB 1RAMA 4EIZC 3BN9D 3MRQA 1AQDB 3MO1A 4RX4D 2AQ3A 5LBSH 4P46B 4QYOA 4LHUD 4H0IA 2APXA 4K94C 3IYLW 5C0FB 5E8PA 3R8BB 3SY0B 4OKVA 4IM8A 4OCXH 4KZDH 1NGQH 5JOFB 3MOAH 3IT8D 3SKOB 3UDWA 2VLKD 2MHAA 4KHXL 4KJYA 1TQBC 4BZ1H 1ZA6B 4OZHA 1QBMH 3IFNL 4BH7A 5ISZA 4U49A 3VDBA 5D71H 2A83A 3FFCA 4NBXB 5CHNA 5J11C 4U6TA 1MQKL 3PWNA 5K9JH 4W4OA 4J23A 2FECL 1EO7A 1OD7A 2BNQA 3AY4C 5KVGL 5T1LD 4HUVA 2RB8A 1J86A 5LVEA 5DYOB 4X99B 3ARTA 5IVNA 3HR6A 2CIKB 4LVHB 1I7UB 5T3XE 4LU5L 4TYUA 4MXWH 2PTTA 1VGEH 1S9KC 3MLRL 3D69A 2GQHA 4O2CA 3SDYL 5L2JB 5L8KB 1RIUL 3VWJD 4R4BA 3TCLB 3CVIH 3ZLQC 5LCVL 4JG1H 2D9QB 3FO0L 3L7FB 1KCRL 3O8XC 1D9KB 1X5IA 3TVMA 3O3UN 4H1LB 4IMLA 4D0BA 5C0EB 4XGZA 1ORQB 5IEKB 3MLWH 1C7TA 4HHAA 3ILPA 4QCIA 3HC4L 3U9UB 1U91A 4F2MA 3BIBX 5IW1A 2R0ZL 1BQHG 3S88H 3FB5B 4QOKE 1AGFA 4FXKA 4JFZL 4K3EH 1KLUB 1E4KC 3DV6B 4D2NA 5DJAB 4ELKB 5E7FA 3NFPA 2VZ3A 1GC1H 1OQXA 5E1HB 2AJYL 5HD8D 5DK2A 2VKXA 4K8RD 3REVA 3KWWA 4KY1L 1WAAF 2J3SA 5FYKD 1F4WH 2WUBH 3ILQD 3VFUA 5I6XB 4I0PA 2WBJC 4GRLA 1UC6A 4TVSa 2Z35A 1Q8MA 1Z3GL 3MO1B 1MI5D 3VXSA 3RVXC 3VXTA 5ACZA 3PV6A 3NABH 2NY6B 4QYOB 1ZXQA 2A6JA 3U0TA 5E8PB 4AIXA 1J0HA 4CVXA 4JM2F 4OKVB 1A2YA 4RGNB 3H3PH 1JZ6A 4KPHH 5F9OL 1KB5H 3U7YL 5GJTL 2MHAB 1I9RL 4OGAC 5ISZE 4KJYB 5DRXA 1F58H 1S5HA 4OZHB 4QHMA 5DD5L 4BH7B 5ISZB 3VMNA 2A83B 3FFCB 4FQ1H 4KKAD 5CHNB 3VFGL 3PWNB 1TZIA 3S36X 1NDMA 3OKLB 1P2CA 1SJEB 2BNQB 1E4JA 1DSFH 4OLEA 2UVFA 2VDPH 4HUVB 1KCVL 3C9NA 1R3KA 1FFRA 5F7NC 1VENA 2CR6A 3ESUF 3P9MA 5BO1L 1EUTA 5HHQA 1FIEA 3MSPA 2ICWI 2NX5D 2PTTB 5C0JA 2WP3O 5C09E 4LVNB 5FCUH 4MXQD 4YDKH 4UNVA 2P8MA 2AJZA 5ESQA 3D69B 5CGYD 2FO4A 4O2CB 4MLIA 4HCRA 2H26A 3OG4B 4XCFL 1YEJH 2NZIA 4M7ZB 4YO0A 4R4BB 5GRWA 2AS5M 5I1GH 1BGXL 3CGTA 3HAEA 3HZMA 4POYA 1CLZL 2XQYG 5F7FA 1RUPH 3C60C 1MRDH 3WO4C 1R5WA 2X1PA 1FGVH 3SBWA 2O93L 3P77A 3TVMB 4S0SD 2D3VA 5D72L 4IMLB 1YPZE 4D0BB 2X4RA 4RA0C 3I6GA 4XGZB 4RA3A 4P9HC 3RL2A 1EJOL 4HHAB 1FL6A 3ILPB 4AEIL 2QQLH 4QCIB 4Q74A 4XNUL 1U91B 4NCDA 4TQEL 4F2MB 5IW1B 2W9EH 5JW3L 5BJTA 1BREA 4CDHA 5JO5B 1AGFB 4FXKB 1WEJL 4RMTA 4QRPD 4NO2A 3KPSA 5HI5D 2FLRT 1OAQH 2GHWB 5J9PB 2C3HA 3PWPA 1Q9OA 4LOUC 3NFPB 5DK2B 3FQTA 3REVB 3VH8G 3KWWB 2X4OA 2CK0L 3QXTA 4XMPL 3VFUB 3VXSE 5ACLA 1DLFH 4I0PB 2NNAA 3INUH 4GRLB 1FLTX 2Z35B 3VXSB 1DFBH 3VXTB 1LO2H 5ACZB 2B5IC 3PV6B 5JHDE 3SO3C 1XZ0A 3C6LD 4KK8D 4GXVL 3QDMA 3U0TB 4CVXB 1QEWA 1A2YB 2J12B 3FB7A 3NTCH 2BX5A 3MRFA 2NYYC 1QFWM 4GQ9L 4N9OB 4OAWA 3VE0A 5DRXB 1S5HB 2P43B 4QHMB 5HDLA 1FFPA 2ZNWA 3EGSA 1OQOA