4G7VH

Crystal structure of voltage sensing domain of ci-vsp with fragment antibody (r217e, 2.5 a)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
219
structure length
215
Chain Sequence
EVQLVESGGGLVQPGGSLRLSCAASGFNVSSSSIHWVRQAPGKGLEWVASISSYYGYTSYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSYSWSYAIDYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural mechanism of voltage-dependent gating in an isolated voltage-sensing domain.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Membrane protein
molecule keywords fragment antibody heavy chain
total genus 46
structure length 215
sequence length 219
ec nomenclature
pdb deposition date 2012-07-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g7vH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4g7vH01
2J4WH 4GKNB 5E9DB 2DOCA 4ZNEA 4OSUH 2P7TA 3F5WB 5CWSB 4K7PX 2WIIA 1BQHB 4GAFB 4PJGE 4MJ5B 3MV7D 3TIDA 5TFSH 4QF1B 5KVFL 3O2VH 3GSWA 4XZUB 4HWNA 1EO8H 4XX1G 4UTAL 4P5TD 3UTSD 3C5ZD 4XC1L 3I9GL 2R0KH 4LU5H 2E7BA 3A6CH 1NSNH 2PO6C 3HNVH 3SQOL 2C1OA 3AAZB 5A43C 4Z0BL 1BM3L 5JXED 1X4XA 2FH6A 3HHRB 5IHUL 3B2VL 3UJIH 2A0LC 4O00A 1FL3B 1RZKL 1F00I 2DRUA 2C4FT 2Z91B 5F7HA 3KPQA 2Z92B 2FECL 1YEJL 1NGXA 4OAWA 4F7EA 1CU4H 3V4UH 1KEML 4OFIA 3MA9H 3QEGH 5GZNC 4WHYG 1AGEA 1RFDL 4NNXA 1RZ8B 3GIZH 3MGAA 1KB5H 3DV4A 3TYFA 1RZFH 1QTYT 4U49A 1NMAH 1ZOXA 1M4KA 4LKCB 2Y6SC 1HZHL 2VLJD 4H20L 4JHBA 1ZLUH 5JHDE 3LKNB 1OSPL 5DJ6A 4UMGA 1K4DA 2APWA 2O93L 1NCBH 4R97B 5C07E 3WL9A 2OI9C 4FFYL 4PJAB 4AT6A 3AC0A 1K4DB 2FX7L 3NTCH 5BRZA 2AABH 2DYPB 3QDHA 2B7DT 2PF6A 4KY1L 3WKML 1NLDL 2B39A 5DR5H 4C56B 1A6WL 4E42A 3QAZC 2GJ6B 4HC1A 3W0WE 1FNFA 2DKUA 2I5YH 4M7LT 4R4FH 2X9YA 3SKMB 4QXUH 2A1WL 4LSUH 5DEFA 4ZPVB 4LRIC 3VGHA 1G84A 2WP3T 1LEIB 1T89A 4GRWE 2JF1A 4HKXA 4L29A 3EYSL 4DW2H 4G8GB 4NN5B 1XR9B 3BKCL 4OLVL 3QDMB 4CGTA 1H8NA 1CLOH 4XAWH 4C59B 1ADQH 2DD8H 4F3FA 3WN5C 3OKLB 1OGAE 1IKFH 3K0WA 3QYCA 3P9MA 1P9MC 3OBAA 4G5ZH 2GSIB 1WAAF 1MCJA 5FYLE 2A9NH 1J0YA 3S5LB 5I66B 2EDDA 3D0LA 3REVA 4RFOL 2EDHA 4PRDA 4PR5B 3N1QC 2BSRB 4L4TA 1ZVYA 4J3XA 4PJ7B 2EDKA 3S7GA 3B6SA 3DGGB 4BM7A 4X9IA 1S9KC 1CS6A 2VH5L 5DK2B 1I9EA 1JN6B 3C09B 1LMKA 4EIGB 2EYRA 3AS0A 1AXTH 1MNUL 4EI6A 1INDH 5MEND 1TQBC 2NY0C 3MCKA 5I19L 4NJ9L 3RY4A 1C08B 2QHRH 3CFCH 1UZ8A 5DJ2A 3KG5A 3MPCA 5F21B 5IBLC 5FDWB 2X4QB 4WWKD 3I3DA 1RJYB 5LCVH 4LLVB 1SEQH 1EHXA 4XP6L 4C58B 1YN6B 4AENA 1KTKE 4RMUA 3HR5A 2Z31A 2GIYA 3ROLA 3D0VA 1WWBX 3H3KA 2R0LL 4XWOC 4MA1C 2Y06L 3HNSL 5HGBB 1A5FH 3MODH 4DKEL 4XCCH 4LVNB 3PP4L 1JHKL 4PJ9B 4ODXA 3W0WD 3MUGA 4NUJA 5GHWL 3MRHB 4UV4H 1NCNA 3VXPA 1HHKA 1R24B 3QWQB 3P4OB 4XNZB 5GGRB 5EZJA 1YEHH 1KN2H 3TO2B 4K7PH 3EFDH 4K94L 5DI8B 5FYJE 4F9PA 4TSCH 1AY1H 4M6ML 2AKRA 2HFGH 2APXA 2WANA 2AV1A 4R7DA 3D0LB 1MHCA 5E5MA 3REVB 5T3XD 3HLAB 3RQ3A 1SYVB 4Y4HC 2YC1B 5D1XD 3MRCA 4L8CA 3EZJB 4DFHA 5B8CC 4ENED 2JB6B 2IC2A 1C5DB 4NPYB 4PGCB 2YC1A 4KRPB 4HIEA 1U8QA 1D5XA 3VMPA 5TQ2L 2CPCA 1BBJB 3P0YH 4XMLL 3RUGA 1S7VB 5IB1B 2BCKA 2EDEA 4LPTA 3EO1B 1V7ML 4C55A 2ZUQC 2W0FA 3TCLB 3MACH 1MCOH 2AXFA 1BD2D 4YDLB 1G9MC 2F54A 2DF3A 1IKNA 3DX7B 3GHBL 3GDBA 4NC0B 3SGEH 5IB5B 4H8WH 1L6XA 5IVXE 2DLFH 3GUTA 2F54E 3MV11 3EKCA 1EH9A 1ZHLA 2XQYG 2V7HB 3E2HB 3HE7C 1YZZA 4GXUM 4OQTH 3F7VA 4IRZL 1DLHA 1MUJB 4GRLD 5C08A 5CHNB 1A5FL 4MXVF 4PGEB 1HHKB 5FYJU 3STBA 3K3QA 4Q6IA 1I9IH 3O6FD 3GJEA 4TUOB 1XCTB 1N4XL 2VLJE 1OT2A 4QOKB 4JPWL 4IS6B 1MCSA 5E2VH 4PJXE 3ARFC 1EGJH 1MFEH 1XH3A 4DEPC 1YPZE 1B2WH 5D1QD 3U9PL 3UBXI 3IU3A 4KI5D 5E03A 4A6YB 1G7PA 1OP3K 2KPNA 4UTBH 4GW1A 5FO8B 2WWKT 1MJJB 4ONOA 2CMRH 4UUJA 5EU7C 2JB6A 2HH0H 1H9VA 2BSTA 4IOIA 3WFHA 3SCMD 5FYKH 3RY6A 4M48H 1BFOB 4NN7C 5CIPH 4HC1L 5E99L 3CK0L 2HVJA 4JJ5B 5FUOL 1A3QA 1AGCB 2BOCA 3BQUA 3KPLA 2VR5A 3H0TA 3QT2A 2KUTA 3CZFA 2VIRB 4YHZL 1QSZA 3KLHC 4OLWH 3QXUA 3EYVB 4HWBL 1A6VH 2LV4A 1NL0H 2AJZA 2BK8A 3HA0A 3FT3A 2AJSL 1TVBA 4MX7A 2EEDA 3C09C 3MRQA 4NQXA 1BFSA 5C7XH 2DD8L 1S5HB 4MNHA 3PG2A 3NN8A 5EUOB 2HN7A 3LB6D 3NCFB 4HBQA 3U0WH 4NO0B 5ID0A 4BZ2H 4CNIA 4JFXA 1GGCL 1OSZB 4M4PA 1JUFA 2YA0A 3QBTB 3O4LD 1R3KA 3LEXB 4G6ML 4QYOA 3PHQA 5IB2A 3K4AA 2HFEB 4RGMB 2IWGA 1JNHA 3HTLX 1QFWI 2WQRA 1O7VA 3C87A 4UBDC 2Q8BH 3RZWA 3MLRH 3Q3GB 2DI7A 1INDL 4UNVA 4OF3A 4IS6A 3ULSA 5K9OB 5HVHC 4KRPC 4HUKB 2AJUH 2L7UA 1DE4B 2OI9B 3DGCR 1MLBB 2FSEA 3X11B 1D3CA 1OAKH 2RJMA 1T5XB 4PRPB 1WVZA 3ROOA 4FABH 5MP6L 4X5WB 4KMTH 4UUJB 1DBAH 5HGHA 4NP4L 1O7SA 4JG1L 3WLBA 1N4XH 3IAGC 3D3VA 1R5IB 3JVGA 4K55A 4YDJA 5F9AC 3PXHA 1VFBA 3ZTNL 3ARBA 1ZWIB 1U6AH 3QEGL 4JRXB 5JUEH 1J05B 1JCKA 3H0TB 1QP1A 2Y9RT 2DIAA 4M5YL 1DN0B 5JHDA 1T80A 3ARBD 3V7AE 1LP9F 1W2KT 4K9EC 3UTOA 3S98A 4WU5A 5T1LB 4QEGA 3PWVA 4ERSH 2Z93B 3RL1B 5F9WB 4GG6B 1WZKA 2NW3B 2FZ3A 5C0CB 4P0DA 4AM0A 4O2EB 2CH8A 4HGKC 4DCQB 1I7TB 1EMTH 2W07A 3OAYK 4JFXB 3KPMB 1B4RA 3EFFB 3BPCB 4RAHA 3K2MC 3HUJF 4QO1A 3NIFF 2EDRA 1RK1A 5C0JA 1QNZH 3NIDF 3H42L 3MNZA 5AUMA 3B8YA 5D7IF 2GSGA 3WSQL 1OAYH 4QRTA 1FN4A 1KSRA 2HT2D 3PP4H 4HIIA 2DQTH 2D7MA 2HG5A 4QF1A 1DQDH 4JREC 5AZ2L 3IDXL 3A67L 4NZUL 4NZRH 1X5HA 3BWAB 1BBDH 5DD0H 4Z7OF 2OL3H 1KB5L 1BIIA 3ZDYE 1G9ML 3X3GL 4I77L 5E8DL 4MDJA 4TRPL 4XP5H 5EOCH 5IB3A 3V0VB 1LD9B 4TTGA 2DWEA 1I1AA 3Q0HA 5IB3B 4R3SB 5INCA 3VWJB 1QFUH 4NHUA 2DQJL 4OGXL 3T09A 1WSST 1YC8A 2PYFA 3P30L 1I8MB 1T4KB 4CVWA 1D5IH 1UB6B 4U6VL 1UQSB 1HOCB 3BQUC 3KPQB 3VGAC 1UB5A 4I0PD 1CQYA 2A6KA 3CAFA 4LVHB 3DO3A 4XPAH 5GGRY 4NNPL 4XHQA 2VH5H 2X4RA 4LSVL 1UH3A 5KN5A 1W0VA 4HH9A 1U58A 1UKTA 1BECA 2MCPL 3KPPB 5KJRH 1E0OB 1XCQA 5KN5B 3GMLA 2GK0B 4OD3L 5IF0B 1F3JA 1RSFA 3IKCB 2XKUA 4PG2A 1LILA 4LSQH 5I15H 5IWLC 1QBLH 5IUSA 3AXLA 1I7ZA 1MRDL 4OGXH 1Q9KB 5GGTH 1OAXH 3HPJB 4ZUUB 3SKUD 4LLYA 3SHSA 3HZYA 4WJ5A 5DVNA 1CD1A 5D1ZD 3K80A 1WEJH 1N0LA 3OKKA 1CCZA 4NKMA 3F7PC 1JYNA 5ITFB 5C0DA 3L6FA 1KC5L 2CJUL 1VFAB 4FQCL 3VD5A 1WF5A 3IDIA 1A6TB 1FNAA 4KVCL 3MLXL 2CO7B 4HCRH 4RRPA 5DHVH 3JWDH 3L95A 1GAFH 2AGJH 2DQTL 2ICCA 4MQ7A 4XZUA 2XY2A 4EQ3A 5EIIB 4ZXBA 1ZT1A 3TH2T 4D94A 2NY3B 4XH2A 5D7JC 1GCFA 5D1ZA 3HMWH 4KUCD 4MD0A 2Y5TA 5T5NF 4ZXBB 1RUAL 2IQ9H 3L3IB 1H5BB 1PKOA 1T2QL 1SJHA 1ZHKA 3HUJE 1FVEB 3UMTA 2NY5L 3U7WL 3FRUA 3M45A 1JWUA 2O61A 1C8PA 4LCWB 3HR6A 1QHPA 1E28B 1C5BH 2AV7B 1F4XH 3VWKD 1BWWA 2FGWL 4P2QE 3N1PC 4G6MH 1Y18B 2XTJE 2FHCA 4PY7B 3MGTB 3I84A 3C5ZB 3HZVA 3O41B 4H88L 1Q9OA 3WBDA 1LEGB 3QXDB 4JCMA 5EG6C 2IH1A 5F93C 1CFTB 2CLVA 5LGHL 2GAZB 4XXDB 2P42B 1JF6A 3N85L 3BZFA 3BDBA 3ELAT 3DUUB 4LLDA 3RDTB 1F4HA 3QG6B 5KSBA 4XBPA 1NUNB 1JPFB 4FZ8H 5HGAB 3QG6A 1NL0L 3O9WA 3MJGX 2XKNA 4M7ZC 5CUSH 1NCBL 4LEOA 3VH8A 2FDBP 4YGVB 4L3ED 4KI5F 4YUEL 1PD6A 3T3ME 5I1KH 5C08D 3ZLQC 2CK0L 2IJ0C 5D2LB 3BJ91 1EO5A 2HLAA 4I3RL 3ULUD 1FBIH 4OLXL 5DC4B 2QJDA 4BFGA 5KG9A 2X4UA 5GZOC 5T5FH 2ED9A 5DD5H 3RX5A 1HYRC 1ZLWH 1NGPL 5BRZD 2X4UB 2Q8BL 2SEBA 5KOVC 1N6UA 4NKOA 4X6CB 5T1KA 4Z78A 3QDMA 5JQ6L 1H5BA 2NR6D 1KXQE 4KJYA 5E2VL 5I1EL 5L6YH 3O4LA 1HCFX 1UZ6F 1GPOL 5H8DA 1BQSA 1AR1D 4FOMA 5KVDH 1U95A 5FYLH 1VHPA 1ADQA 4YHNB 1M7XA 2VXUH 4FQHB 1U95B 2YUWA 2C4XA 2DMBA 3GM0A 4OGYL 3K8LA 1J0KA 4QOKD 1XF3B 4DN3L 5ISZE 3RU8L 1AGEB 4WWKB 4EDXA 1UT9A 1IAKA 1A6VL 3GMNB 4MQXC 1HK6A 5TFSL 2CLVB 5E2TL 4X4YA 4WI3A 3P73A 2GAZA 1TZIB 4OQTA 2V2WB 3S4SG 5ISZA 4F7CA 4X4YB 2V7NB 2GUOB 4OZIB 3FT4B 4D3CL 5SWSA 3WL9B 1JPFA 4PJBF 5HGAA 2ITDB 1K8IB 1QYGH 4YHLH 1ZT7A 5FHBL 1U0QA 2RCSH 4NJAH 5GS2D 3NCMA 2GJ6A 1CXFA 2PO6B 1IC4H 5DYOB 2CIKA 2CGRH 3BIBX 5AZEL 5IQ7L 5HYQB 1J1PH 4X6DE 4U3CA 2IGFL 5E8OB 1FZOA 2YXFA 4DGVL 1MAJA 1OTUC 2IPUK 3OHXA 3V5HA 2DICA 3FB7B 4M5ZL 3TO4A 1FZOB 1KJ3H 3QUML 4JQVC 2OJEB 2ZKHH 4TQEH 6CGTA 3RUGF 2IMNA 1UKSA 3GIZL 4M62L 4KMTL 3LD8C 3RWCB 1RJZB 1N0XL 3BIKA 1YEDA 1SQ2N 4PGBA 1Q94A 3PE9A 5KSAD 3HZKA 3O3BA 2B20A 2GT9A 2ZJSH 4JG0L 3FT2B 1Y6MR 3G5ZB 1FC1A 3B5TA 4W70A 2R2EB 3RNKB 4HG4J 4MAYC 4QY8A 4Y4KA 4UDTB 4HJ0C 4Q2ZB 2PR4H 4J1UB 1MREL 2ERJC 3L3OA 1L7IL 3RNKA 4XP4H 1T0NB 1IAOB 4OGYH 3DVNB 5FA4A 3GMNA 1BJ1H 4P4KD 5F96H 3MBXL 1RAMA 5CCKL 3NCJH 1ZEAH 5AG8A 5FA4B 4L4TD 2B8OT 4KTDH 1HXMB 2H3NB 2CIIB 1B9ZA 5JXEC 3FT4A 4QRQA 2E3VA 2IAMA 5IB1A 4EUPB 3H7BB 5LWYL 1DQQB 3EO1A 4XPTL 3S35H 3CPLA 3EOBB 4MB4A 5CIPA 1MVUA 3QHTC 3CFBA 4Y4FD 5DJCA 3G5YB 3QDGE 3SBWC 2VLME 4PLOB 2FO1A 4N0FA 4OZIE 2PO6A 4F80A 3L5HA 4OBSA 1AO7D 1AQDA 3RZCC 1YEFL 2DTMH 2F54B 5T1LD 2DQEL 4D9RD 3UTPD 3ZKXB 3MXVL 4GXVL 4WV1B 1D5BA 1W0WB 3HZMA 3QQNA 4GAYB 2NY1D 4UDUA 2Q76B 4JDZA 1N7ML 2X41A 4XBGB 3QH3A 1AXSB 4X4XA 4YQXL 4H1LG 1B0GB 1TETH 3W9EA 1S7WA 3TBSA 1R24A 4XAKE 4M1CC 1FFNB 1V3MA 4KJWD 2FD6H 5HDBF 4X5XB 3JVGC 1JFQL 4XP1L 2IFFH 1IMHC 2YHGA 3DV6A 1HINH 5A2FA 1Q9LA 2B0SL 1MY5A 2CRIA 3THML 1U8MB 4DN4H 4R7DB 2PN5A 3AMKA 3KLSA 2AK4D 4WVRA 4EN3D 5IV2A 1GC1C 1R3LB 1P2CA 2Y25A 3LQZB 1CLOL 3HE7B 3WHE0 2VDRL 1X5AA 3FFDA 4OM0L 5DRZA 3SO5A 2ORBH 3DETC 5BZWB 3CFCL 5D8JH 5I76A 5SWQA 3KLHD 5E99H 3UROR 3P3YA 1S9VA 3SEPA 4QRQB 3SDDB 2P8LB 4A2MA 3BQUB 1MCWM 1MFCH 1U93B 5KS9F 1RK0A 4W6WB 5GGQL 2QQKL 4JM4H 4BQ9A 1WIOA 1T1ZB 1FIGL 3L3KB 3PWVB 1QLFB 4C83A 3M8OH 4Z76B 5CILH 2J6EH 5J06A 4P5MA 4DGYL 1JBJA 2H32B 1R5WB 3UBXA 1QLFA 3CVHA 2Y36H 4WV1A 3GI9H 2Y07L 3JWOC 4JFOA 4XXCA 5I8KL 3VGAB 4PJDB 5ID0B 5HDOA 5BMFL 3NIDE 3BZ4A 4YDIH 4YZFF 5KVMC 1HEZA 2BXYA 3QAZB 2NY0D 4HUXB 3UDWC 5ALBH 4P23B 1H15B 4HIIB 3CUPA 3LS4H 3K8KA 3BGFB 1LDPL 3WIIL 2APFA 3DO7A 1ZHBB 4YEEA 4PJDF 5SWZD 5JW4R 1R3LA 1MPAH 3MLUH 5JZ7D 1FCCA 2FR4B 4R7NA 3IDMB 2LTQC 3KS0H 5ILTH 5IJKC 3QCTH 2DWEB 1S5IH 4WFHE 1NLDH 3TN0B 4HLZG 4UINH 5JO5A 1X5YA 5KW9L 1D6EB 5ANMB 2J4WL 1NFIA 1HOCA 1JPTL 5C0BE 3ZHKA 1E4KC 1CGSH 5SX5H 2P5EB 1QUNA 1DEEA 4XI5D 4LSSH 2COQA 1UM5H 2FO4A 1TNNA 4JPIA 5F1IA 2YSSA 1NBZA 2V17H 1MFNA 1K6QL 4JFQA 1T83A 3D3VE 1ZTXH 4LVEA 1MIEH 1W0VB 4OV5B 4GXUN 4FTVA 3KPPA 3NA9H 1SBSH 2AJYL 1BIHA 4P2QD 2NZ9D 5BS0B 4E0RB 3IJHA 3CXDH 3WUWA 2VDKH 3SE9H 3F62A 3ZT7A 4P2RA 2HKFL 1LO0H 2UY6A 12E8H 4UI2A 2M2DA 4YHOH 4U1SA 3CVHL 4E41A 5HVFB 1UACL 5CJBA 4F9LA 4PJGA 5FK9A 2ESVB 4LHUB 1RK1B 1J1XL 4NKMB 4R2GB 4J4PD 3NABL 2K3TA 4J23A 1J1OL 4JVUA 4RGMC 5DEZA 1EEZB 4G8GD 1PW3A 5DT1L 4RGOL 1FNGA 1N5AB 1JWMB 2ITCA 4F7TB 2NTSP 5L7XL 5CINL 4B50A 2WBJB 4JB9H 1IGIL 2VDKL 4Z77A 3S37H 2WWMD 1E4XH 3OWEA 3QFJB 4QLRA 3MREB 5A3ID 4JAMA 4M7ZB 3W5NA 5B39G 3F7YA 3TN0A 1XGUB 2R9HD 4ZXBD 3V0VA 1ZLVK 5SWZE 1AXTL 3QG7L 5I1DA 3CFEB 3CX5J 8FABB 4OZFA 1NANH 3VD3A 5EUOE 1DBBL 3AFLA 5BVPL 3MLTA 5LAXA 1YUHA 1GOFA 3GMRA 5KW9H 4QRPB 3P11H 3MRBA 4XP1H 3DARA 1AC0A 1FP5A 1S5IL 1PQZA 3W39A 3W2DL 3MRBB 1BQLL 3QDGD 2JB5L 1CLZL 1XGRB 4KJQC 4OI9A 4B41A 1TETL 5TDNA 4AY0A 5IMMA 1A7PL 4IBLT 5FV2A 2EKJA 3BYYA 2HTLC 3QDME 4YHYC 3QWRD 2HKHH 2ENYA 4DZ8B 3BOVA 4ZOEA 4TN9A 5JMRA 5JXEA 3V6OA 4R90H 4LRNH 4G8FB 3LEYH 3N50A 2K1MA 4PJCA 2VQ1A 4PP2B 4OF7A 5B22A 1KEGL 4LP5A 1NPUA 4X6DB 2DQUL 3U0WL 4LCYB 1M71A 4U1HB 3VFPA 4LDEB 4BFBD 3VCLA 5GRUH 3U36A 3IDIB 2IANB 2I26N 5DD1H 4OCYL 2OL3L 1EXUA 3RWJA 2YWYA 1T1WA 2N1KA 4KVNL 4HGWA 3IXTB 4F15C 2RFXA 5CGYD 3F7YB 1PYWB 5D1ZB 3S36H 4UILL 2ZZUT 2Y5TB 5GGQH 3IXTA 4YAQA 1J0ZA 3MBEA 2ICES 4OD2B 2V9TA 4FHBD 2DJSA 5IVXB 3F7QA 1T5WB 4PLKD 4XNQB 1UADC 3BRDA 3ZSSA 2BNUB 3TO4C 4Z7WF 5FM5O 2K7QA 4M43L 2G9HA 2H41A 2P5WB 3DWTA 1LDPH 3EYUH 1FGVH 3OGCB 4PV8A 1QA9B 1YNKL 4HS8L 3KYMB 3CSBA 1U58B 2YPVH 1D9KD 4EUPG 1RZ8A 4HWBA 2IH1B 3OKOA 1GGUA 4TPRH 4ZOCA 1IQDA 2A74B 4UIKH 5DQ9A 1LO2H 4MXQD 4M5ZH 4OZIA 4GRMA 4OCWL 4UU9B 1WCBA 2VLKE 4DGVH 3HI5L 4BA8A 2O5YL 5KSBB 5F3HA 4YHIA 3HAEA 4KJPC 1GZPA 3PL6C 2P4AB 2W0KA 3QI9A 4QHLA 1QR1B 1KBGL 3BE1L 2R0WH 3ZE1F 1KTLB 4LPVA 4PRIB 4XB7A 4X6EB 3EOAB 5C09D 3J8F7 1IARB 1PEWA 5ABDE 4WEUD 4LVNC 3OHXB 2ZNXA 4MS8D 4N8CH 5I1JH 2YMXH 1AI1H 1LO4H 3FAXA 3ZE2F 1UH4A 5EZIH 2HTKD 3IFNL 3IFOB 1A3LH 5DURD 1FC2D 1ES0A 3QNXA 5MENE 1YN7B 4PGBB 3MROB 4XNZC 1Q94B 3IFOA 2E6QA 1ZHKB 2XPGB 4KHTL 4WFEE 3O8XC 3AY4C 4ZG1A 4LOUC 3NCYP 1JRHI 3OR7A 5D1QB 1ZANL 3KDMA 4HWUA 4PG9B 1K3IA 4XNQA 4ODVH 4YHYB 4Y4KB 4Q2ZA 3GRWA 2DBLL 1J7VR 1Y0LB 4YBQC 3MFFB 1YEKH 1WBZB 3LKPA 3T0EB 1EFXA 2VZVA 4MNGE 3VXRA 4HKZB 2EEBA 2E9WA 3IDGA 1TENA 3SDCC 1S7TA 2Z31C 4HKZA 4U7KA 4P2CG 2BY0A 1XGYL 1DDHB 4WCYL 1P4LA 3DYMA 4MNQD 5E08L 3AY4A 1DQQA 4I3RH 1BVKB 3VH8G 3NA9L 1FAKT 2AJXH 2YD8A 1FZJA 4X99B 4LAQL 3FOMB 1TZGL 4RFEA 3UTTB 2XOTA 1WGOA 2LU7A 5ADOL 1H3GA 5EBWA 5GGSA 5CD3B 4MXWL 1G6RA 4RGND 1BD2A 5HI3D 1FVCA 2GCYA 3HC3H 1FGNH 2B1HH 1TJHL 1LK2B 1OP3H 2OK0H 3CIQA 3LIZL 4JFDE 1UM4H 4PJ5A 5JMOC 5HYJB 5HGBA 3QDGA 4LLUA 1VGKB 4N0YH 4HUUA 5HYIA 1P4IH 4ZFGL 3N85H 4LNRB 2AEQH 5DXWA 2W65B 5TF1H 2VYRE 5IVZB 3KHOA 3GGWB 2XPGA 1ZLSH 2F53B 3BVNB 2D4FA 1U41A 5D1ZC 4PTUB 4PLNC 5KTEH 3VXOA 5BOZG 1T6WA 4YX2L 4XNUH 1XGTA 2XTLA 1YECH 4K3DH 4UB0L 2AKRB 1RIUH 4OIIL 3VFSA 5A2JH 2F5AL 2MQ3A 4HFUL 1SJEA 1S8DB 4QY8B 5C6WH 2ZSWA 5C0IA 3RZCD 3DYOA 3IDJB 4R2GC 5BZWA 4U0RB 3KLAA 1U8NA 4JY4B 4RFOH 3TPUB 4KZEL 2VABB 5HGDA 2AERT 5HHPA 4S1QH 4R4BB 4FTVD 4XNXL 1CICD 3ZT6A 2EDLA 3D85D 3QHZL 4FTVE 1JI2A 5KANG 3ZTJG 3BD4A 2ZCLL 3EO0A 3PWPE 5CZXD 2EXWC 4GAJL 2R29L 3BH8B 2I9TA 3DSFL 4J2XA 3HCVA 1YMMA 2AI0L 1JYVA 3OR6B 2AEPH 2BVEA 4NUGL 4OF6A 2VXTL 3LKSA 1OD7A 1NEUA 5C9JA 4GRWF 3L3DB 2XN9D 4C83B 5FM8A 2LTQB 4Y19D 1EAPA 4HJJH 3TT1H 2BNRE 3L3DA 4BSWB 4DEPB 5ACZA 1VACB 5JOEA 2EDYA 5E24E 1N3NA 2VLRB 3I75B 1C16B 1IGTA 5DMYA 3LEVH 3GSQB 3QFDB 3ES6B 1PFCA 2C7UA 4AEHL 3K1DA 4N0CD 5GS1C 1XZ0B 3L7FB 4JFEE 5I8EA 3VDBA 3RWCA 4GQ9H 3V6OC 3T3PE 5DO2D 4QHKI 4XVJL 5DQDH 1H15A 2NY0B 3T0VA 1T03H 3ARPA 3CUPB 4MMXC 1FFNA 1DANU 2W9DL 4G9DB 4ZUVA 2PW2A 4JFFA 3RU8H 3WFZA 3MV9D 4PGDA 4HKJA 2R2EA 3QIBC 5DMJB 1ZHNB 5T1MA 1AGDB 1JFQH 3DVIA 1U8MA 3MLPA 5E9DE 3M1BA 1HINL 4IJ3B 4P2RD 3JV6A 4G8GE 3RGVB 4P2RE 4XCNA 3PABA 3CXDL 4CVZA 5J8OA 4GG6F 3V6BR 2DQFB 43CAA 2XZQH 4U33A 4J3OC 3VE0A 4IDJL 5CJOH 1KNOB 3GMOA 5HHVL 5I74B 1CDBA 3OAYH 5EO1B 3QQ4A 4RWYH 4ZFFB 5DGQA 3W11C 1U2CA 5JW3L 2KQMA 3V5DA 3KPLB 5E6IB 2DDQH 3BH8A 2BNQA 4G8EA 3O6ML 3CZFB 4KHXH 3OR6A 1H3UA 1IFHL 4X7TA 3K4DA 1NGYA 2P5ED 4PRPE 4PRPD 4QXGH 3RBSA 3EAKA 1RUQH 3N1FC 4YDKH 2LQRA 4XMKL 5FGRA 5C6PB 1IL1B 2BMKA 1YNTB 2VSDA 3O6LH 3PWPB 4X83A 3QIUA 3VDCA 3NFSL 1JHLL 1JWSB 5GGUA 3TF7C 4XBGA 1FV1B 4IMKC 5J12C 1XZ0A 4QHMA 3ULUF 4ZO7A 3U46B 2V9QA 3BKYH 4UT6L 3KPSA 3GJFB 5GGVH 4J3UA 4X5XA 4RNRB 3QUMA 35C8H 3WD5H 4UQ3B 1I9JL 1LK3H 2NZIA 3GI9L 4ZAKC 3I3BA 2FGWH 3VXME 4ENEC 3V6ZA 1I85C 2J3SA 4Y7MA 4Y8DC 1BPVA 4X7FC 3I02A 3B9KA 4X4ME 3SGKC 1UEYA 4RGNE 3PV7A 1WK0A 4R7NB 2YD4A 1A3RH 1DQLH 1VFOA 3BGMB 4OZHB 3C5JB 4LLAA 4CU8A 3QEUA 1RU9H 1I7RA 1NC2B 3GNMH 1U8KA 3UX9B 1VFBB 5IT2H 4JZNB 3ZKXC 2ZWLT 2JCCB 1R5VA 1U8OB 4FP8H 4XX1E 4N1HB 1XIWC 2NXZB 3KPSD 2YA1A 3P4NA 4YE4L 5FYJL 2XFXB 2QHLA 1T1ZA 5J1SC 3VFGL 1IQWL 2XY1A 3T04D 5F8RC 4Z76A 3VFOA 5HHMD 2Z31D 2X89A 5HHME 2X4OB 3X3FL 5JOFA 5EOQH 1YMMD 2MPAH 3T1FB 5K9JL 4NQDA 1Q72L 3LY6A 4JY5L 4B7IA 4LEXH 4YC2C 4MAYD 1MIMH 4AM0B 1KFAL 4DCQA 1BREA 4JKMA 1I7TA 3BSZH 4V2CB 4L5FL 3SOBL 1G7IB 1CXKA 4TVSa 1PKQB 3FQXA 1UXWA 3N1MC 3CU1A 4M7KH 3L5WA 4MNGB 3ESVF 2WM0A 4HUXA 3GJFH 2BNQD 1HSBA 4UT7H 1OOAA 1PGRB 1UXWB 2UZXB 4RNRA 5AUMB 1G7QB 4HKXB 3ARTA 1F6LL 5C0EA 1NSNL 2YD6A 3U36B 4LCUB 3VXRD 1OD9A 3OZ9H 3GMMA 1EO8L 2VITA 4GXVH 1S7QB 4UTAH 1SEQL 2WBJA 5HHXH 3H8NA 2VE6A 4G6KH 2E8YA 2O26U 2YOCA 4PYGA 1PSKH 4XTRC 5E00A 3WEXB 4LF3A 5DURB 5DSCB 5DHVA 3HFML 4P46C 2UZIH 4NHCL 3KPRD 1KTDB 1YNLL 3FCTB 4M6NL 4G7YL 5JIHA 3O2WL 5FCUL 4Z7WA 1CR9L 3OB0H 4WFED 4DAGH 1FBIL 2BVUA 2YSSB 2ZUUA 5GISH 4OZHE 2EYRB 2BY2A 5J56B 4EI6B 4NP4H 1P6FA 4QRRA 1NCWL 2R9HC 4PRAB 5DDHA 5A3IC 3FTGA 2ZG1A 5F7NC 1ZLVH 4JE4B 1PQZB 3W39B 2D7TH 4XNYL 4CAGA 1OGTA 1N5YL 2VO5A 2NX5E 1RPQA 4NQTA 3U6RB 4HX1B 4E41E 4NM4H 1JK8B 1E6OL 1JGUL 3OSKA 1EZVY 1NKOA 4YHIB 5LGHH 4XRCB 2L7JA 2CSPA 2ZJSL 4U6XA 5E2JA 2R1YB 1BZ9A 3WMSA 2PTUA 4OLVH 1FZKA 3QJHA 1N0XH 1J8HA 1M7DA 3GIVB 3OKEA 3PQYE 3LEYL 4PJHF 1J10A 1VDGA 1J8HB 5DO2C 4YHKL 4QXUL 3BP5B 3VFWA 2VXQL 1RUMH 2HKHL 1Q8MA 4JDVA 3GMMB 4HJGA 5D1XB 5C2BH 1JGVL 4HJGB 1IGJB 5C0GB 5FB8B 3O3AB 4BK5A 4CVXA 1QPXA 3I50L 5TE6H 3BP4A 3T77B 4NJAL 3L3IA 1LP9E 2W9EL 2H2SC 5BCAA 3VXSB 5LKNA 3CSGA 5MHSE 2D03H 6FABH 2IG2L 3U4AA 1EZVX 2NW2A 1CZ8H 3VWJC 4DUXA 5I73B 3SKOA 1JTTA 3WS3B 5LAXB 1KPVB 4P5TA 3UTSA 4EBQH 1CL7I 1R3IL 3BKJH 2ADJA 4OJFH 3FB6A 1U8QB 1I3GH 2H8PA 5J13C 3BEVA 3UPRA 1I9JH 5IJVB 3DMMB 3NFNB 1BZ7B 1XGRA 4RISL 1J0HA 3BEVB 1CYGA 1CFTA 3DMMA 1T1XB 1PVHA 1KJMB 2UVEA 4I3SH 2JKXA 4K23L 2AXGA 3GO1H 2B1AL 4PJIF 3HS0B 3VXMD 3IJYA 4JPWH 3R06A 3D0VB 3PWJB 1PLGL 3WHXA 3PQYA 3HS0A 2WUBH 3EDEA 4WFFE 1G9NL 4K7PY 2VDLH 4ZS7H 3AU1B 1GOHA 4OM1L 3ZMRA 3QI9B 4QHLB 1QSFE 2GCYB 3FOLB 5DWUH 1QR1A 5FYKD 2ZUWA 3KNBA 1FLTX 4JPKL 4FXKA 1QFHA 3DHMA 3KPRA 5B4MD 3CVHH 4P4KC 5C08B 5FDYA 4KRPD 1FPTH 3KWWA 1EFXD 3LRGA 3ORJA 1XMWA 5JZ7C 4M7LL 2X1WL 3G6AA 3EYQD 2OL3B 3T77A 1YEGL 4X6CA 4ODSH 1Q9WB 4J3TA 3MRCB 4L8CB 4EN3B 2FJFA 4N0RA 5HY9A 2LAAA 4JHAL 5I8OH 4XPFH 5F7EL 3ZYIA 5IIEA 1NLBH 5LQBL 1W8NA 4PRBB 5JHDD 3I50H 5D2NE 1EJOL 2ZSWB 3LQMA 1TJIL 1JGVH 5HHOB 1I3VA 1AR2A 3VFUB 4XPGL 1MH5A 1ADQL 2O5ZL 1IAKB 4JLRB 3OKOB 2DKSA 2NZ9C 4L1HA 5M7QA 5F72S 4JFEA 3RVWD 3TBYA 5DA4A 4HPYH 1WIPA 2AXFB 5I1AB 1MI5B 1JV5A 4YFLI 1FH5L 1CFQB 3Q1SL 4AEIH 2Q8AH 5IG7A 1FSKC 1JTPA 1ONQB 1JV5B 4K3EH 4K94H 5J89A 2YPLB 4QHKJ 5FEBA 3PJSB 3MJ8B 4RWHA 4APQA 3GB7A 4H8WL 2VJXA 3B5HA 3HAEH 3PP3H 3G04B 4Z7NF 2R69L 3C2AL 3STLA 3MGOB 1EEYB 2W0LA 4HT1L 5C0BB 2A6JA 3QA3A 3C5ZC 4Q9QH 2A6JB 4ZODA 3TO4B 5E56A 4G8IB 5JDSA 5I16A 3AB0C 5EB9A 4G80A 2E27H 4Z7UE 1WTGT 2DQUH 4Y19E 3PNWB 1QRKA 3SE3C 1CT8B 1ZVSB 4JN2B 4KDTC 4HXAL 4KC3B 5L0QC 5SWZB 4PRPA 2CR3A 3ROOB 4Y1AB 4NWTL 5F7YC 3ZE2E 4Y5XB 3U0TA 4Y1AA 2X2YA 2Y72A 4X6BB 5E2UL 4YPJA 1IEAA 1WC7A 1R5IA 5EU4B 2HRPH 2F8XC 1GVIA 1A1MA 3DVNA 3QUZA 1LEKA 3DUHA 4KK6D 1PZ5B 4L9LC 5EU6D 2WMPA 2BVPB 5EA0L 3BUYB 4FQIL 4XC1H 4CW1A 2QQLL 2P8MA 1INQA 2EE2A 2IPKB 2CIIA 3P2TA 1RJLA 2Z8SA 5EUOA 1U8IB 5C2UB 1FO0H 5K9KA 5GRVK 2BZDA 4O4YH 5D5ME 1BD2B 4MNQE 2NY2B 3G5YA 1Z9LA 2ZUTA 4YBLC 4P5KA 3KPMA 4LEXL 1AH1A 5I18L 4POZC 4J3SA 3G5XB 4KKBC 3HE6C 1FG9C 4XTRD 4JB9L 1IVLA 2HFTA 1D5BB 1MOEA 3TBWA 2OLDA 1FN4B 4K71C 4IMKA 3IXAA 4X80H 5GS0C 4CU6A 4X9BA 2FJHA 1FL5A 1GH7A 3MRPA 5B3JE 5IT2L 3QUMB 3WKMH 1JPGA 4PJ8C 1CFSA 1DQLL 4JFDB 5CEXA 4FFYH 4MSWA 4C4KO 1URLA 1EVTC 1IAIM 2R1WB 3MV8A 3WUZA 4XGZB 2OM5A 2E27L 3PL6D 1AHWC 1OSPH 3FN9A 4N0UE 1B90A 1AJ7L 3VFSB 4PGJA 3IFLH 4ZDHB 5IW1B 2AK1H 1PLGH 4KPHL 3DNKA 4XHJC 3BUTA 3MRDB 4F57H 3T65A 1F6FB 1T4KA 4JREB 3EGSB 1BZQK 2X1XR 2BVQA 3KVQA 4OZHA 3QJFA 2P5WE 3IU4H 43CAB 4RMWA 4JZJC 5DJYA 4BQ6A 5GXBB 5BRZE 3DX9B 1KJ2B 4R6UA 2VLLA 3DI3B 4GS7B 4Y5YB 4PB9L 4S2SB 5D93B 2DS4A 4PBXA 1RJLB 4XXCC 1R5VB 1U8OA 1UM5L 1T7ZA 1GGIL 3MSPA 4JG0H 1UH2A 4PREB 2R23A 3SDCB 5ID1A 1H3WM 1ITBB 4EZMA 5ECJE 1E4XI 1F3JB 1HQRB 1VB9A 2V5TA 4Y4FB 1QLEL 2CKBL 2NY2C 3MACL 5F7DA 1RY7B 2VOTA 4L4VE 5JXAH 4Y4FA 1JNNH 1QACA 3PGCA 1IM9D 5TF1L 3VG0L 3HZYB 4WJ5B 4XPGH 3W82A 1CBVH 5DUBB 3BZEA 5TJWK 3GI8H 2DB8A 2C7UB 3RKPA 4ZUWA 2CDEB 3OTTA 3ULUC 1EJOH 4GLRH 2DQIL 5F1NB 5GS1B 1HDMB 2A77L 1FZMB 4OSUL 1YNLH 3GMQA 4P4KB 3MV8E 3VW3H 3CMGA 2VDPL 3STZB 3L5XL 2VLMD 4LKXA 2KZ1B 1QVOA 1TVHA 4JO3H 2Q20A 4LLWA 3RL2A 5B4MC 1GIGH 1QVOB 5C0CE 1C1EH 1MFAH 1E6JL 1XGQA 2DQGH 1AGDA 3EYUL 1KT2A 1L9MA 3GFUA 4K3JH 5C86A 3DO7B 4AJ0A 3M1BB 1ZHBA 1U92A 4D0CA 4O02L 3KS0J 4WW2A 3LH2H 1KIQA 1WZ1H 3UJIL 1KPRA 5E2TH 4LF3B 3WV0A 5I1GL 5DSCA 2LU3A 1VESA 5HVWA 4QRPD 4MD5A 5JO5B 2QQNL 3RIAK 4MVBD 2H1PH 3D39A 1NDGA 2V2TB 3CC5B 5JHLL 4JQIH 2VB5A 4NNXB 4WHCA 3U4EB 3GSXB 3IJSB 3BH9B 5TE7H 3S6CA 5K9QG 2VZUA 1DEEB 2X40A 3BQUD 4N9GA 4M93C 4N68A 1WICA 3O4LE 3QEQB 5DJXB 1JMZA 3B3IB 3WHE1 3HPLA 4WI2A 1P7QD 3B3IA 1FNHA 4LHQB 2B4CH 2EDFA 4OCMC 2L4OA 2XKNB 1KCVL 3NAAH 5F44A 5I74C 5FYLD 2W1NA 5I1JL 3ZE0E 2R29H 2I60H 3VG0H 5CEYB 1JNNL 1A7PH 3L1OL 1S3KH 5ITBH 2D03L 3MNWA 4GMSH 6FABL 1AKJB 3AS3A 4PJCF 3OKEB 3ARDB 5A2IH 5AD0A 2NXYC 2VNCA 3U9UB 5JA8B 1IGMH 5IK3B 5IVXF 2V5YA 3H6JA 5C08E 4YBLB 3ARDA 4UT7L 1P5UA 2DL9A 2HJFB 5CJ8A 4P5TC 1KT2B 4IRSB 4ZOAA 1G1YA 4ZMAT 3ULUE 4LCUA 2EIEA 4UQ2A 5C0AD 2JJTC 3PUCA 3C6SB 4R96A 3EJZC 3RPKA 4JFZH 4J3WA 2OP4L 5E5UB 4FFZL 3JBG7 2VDQL 4Y5VC 2F54D 1WAAA 1XGUA 3WEXA 2YPLD 2XQBL 5F89B 1XF5B 3Q6GL 4WI5A 4M43H 3WE6A 4N9GB 5DJ6B 3V9FA 3FO2A 3DTXA 4YO0B 3MUHL 3TYFB 5DVKA 4Y16C 2VLKA 2A9MH 3QPQD 5DR5L 4MJID 5LGKA 1MLCA 1OLZA 2PCPA 3Q5TA 1HSAA 2AQ1A 2EDXA 4PJIB 5CEZE 4E42B 1NGQH 1S7XA 5CEZD 3ZYJA 4JM2A 5EN2B 2BNRB 2G2RB 3I3EA 2LVEA 5DA0B 5GISL 2WNGA 5LBSL 4TTDD 4QNPF 5EN2A 5T1DL 2P7TB 2XZAH 4ZPVA 5DEFB 2H26A 1SY6L 4LHUG 2YD9A 1LEIA 4XRCA 2EO9A 4X5LA 4OLZH 2M8XA 2X05A 2GTZB 4U7SA 2CUHA 3SKMA 2IAMD 3QI9D 1G7QA 1RJCA 4LL9A 4V1DE 2OJEA 4G3YL 1A7QL 1EA9C 5C0NC 1XR8A 3FQNB 4GKZB 1ZA6B 1B6UA 1RULL 3QEQE 1OGAD 2B2XL 3O4LB 4W6XB 1BM3H 3VXUB 1X5FA 2H2SD 3QEQD 4ETQA 3QR2A 2GITA 3AGVA 5DI8A 5H94B 1VGEL 4YXKH 5IM7B 3FO0L 1GC1H 3MJ6A 3W9DA 3D2UB 3EOTL 2FLBT 3I9GH 4HAGA 1K9TA 4M8VA 4MS8C 4GKOA 1I3RA 2FJFB 4WWKA 2JIXB 3KR3L 4YZFE 4UNUA 4XP9L 3HE6D 4XPAL 5HYSG 5DJ0B 4FRWA 1Q1JL 3MRGA 1QLEH 4M1GL 1ORQA 3P40A 5I19H 2BNUA 3BPNC 2NW2B 1HXYA 4TULH 3IVKA 4NRYB 4U1GB 1ORQB 4Y16D 4L8BB 3GSRB 2OCFD 1ULVA 3FTGB 2X7LA 3MRMB 2X4QA 1HSAB 3OAUL 1Z9MA 2QSQA 1AQKH 4WUUA 3RVVC 3BEWA 1FRGH 2AP2A 4LPYA 4F15B 4C56A 1WCBB 5JLZB 1RZJC 1YEEH 1T2JA 4LNVA 3BYTA 3IJYB 2GQHA 1S7UA 1CQKA 2IMMA 2Y23A 3OKDB 4ZAKD 1Z0MA 5AAMA 4PJ5E 5D2LF 1DL7H 2D7OA 4GO6B 1IGFH 4MYWB 4P2OB 2FB4L 1L7TH 3TZVD 3SGJC 1ROWA 5I6XC 5TE4L 4L8SB 3GBML 4NRZB 3PHOB 4JDZB 3WXWL 2C9AA 2MQCA 3OAZH 4PGEA 1OY3B 2YD2A 2XWJB 3C6LA 4Z5RA 1OARL 3P9MB 3RI5F 1HHGA 1CICC 4R4FL 1OTUD 4G9FD 3K4ZA 4JN2A 1RIHH 2DIBA 3ZKMD 5J9PA 5T3XE 1YJDL 2OJZH 1C5DA 1L0XA 1ACZA 3W81A 1QKZL 3DBXB 5JOPD 4Z8FH 5D7JA 4HIHB 4NQVB 3HLAA 4FQLL 3O2DL 4YXKL 1BJ8A 1IC7L 2FBJL 5IHZA 4OZ4B 5F1OB 4O4YL 4GG8B 2ADJB 3QUXB 4IHOA 4XB8A 1CLYL 5I8OL 1MEXL 3MCLH 3MUJA 5GRUL 2NY6D 5E4IA 1M05B 3BKMH 5M95B 5IMKB 1HI6A 4MA7L 2W0FB 4ODSL 4XT1C 1MH5B 4S0TD 5EC1B 5T3ZD 5ADOH 5CIPB 2HTLD 1PZ5A 1D6VH 1MVUB 3KPOA 5EULV 3OX8B 1CDUA 1UXSB 3MLSH 3QFJD 3B9KC 3MLWH 3LHPH 3M07A 3C60A 4PUBH 3MJ9L 4KK6C 5IB5A 4RDQF 5IG7B 1NAKH 5LGJB 1I1RA 1MNUH 3C60B 3N06B 3FQRB 2BFVH 4M1DH 1MVFA 4M8QA 3R1GH 1DR9A 5CBAB 3NFPB 1NFDB 5EBWB 2I9LA 2JELL 1MUJA 3MUY1 4GRWB 4L8SA 5HI4D 1MQKL 3VXQA 3LCYA 2VDOL 3TVMB 4UOW0 4D0DB 4JO4H 3WJJA 1N59B 3GSUB 3NZ8A 3OMZA 5GGRA 1SVZA 3RAJL 2G60L 4C56D 2VC2H 3HNTH 5ERWB 4HIXL 4TUOA 2NPLX 4QGTA 4PB0H 2NTFA 4JANB 5E8NB 5I17A 3Q2CA 4HJ0D 4U1JA 1Q9WA 4L8SC 3TC9A 4WI7A 1CDYA 3GGWA 5D2NB 3C9NA 3FJTA 2YD1A 5EU6B 2GJZB 2DJ4A 3RKDD 5D2NA 1G7PB 2F53D 4GW1B 5TH2A 2MKLC 4Z8FL 4ZDHA 2A1WH 3G08B 3QIWC 2ZOLB 1FFOB 1T20B 1UWGH 4NBYB 4GG8A 4LSQL 4U3XA 5KS9A 4XPBL 2EXWD 3SDDA 3BGFC 1G7HB 5L0QB 5DT1H 4JRXA 1A6WH 1F13A 4H25B 3B9VA 3WIHL 1CGWA 5KANI 5TF0A 1U8NB 3KPOB 3MV9A 2W92A 1JGEB 3T08A 3FT3B 4PJIE 4JVPA 4Q0XH 4JFQB 4BQ8A 4M02A 5D70L 4AH2A 1BWMA 3IB4A 2R1XB 2V5RA 2VDML 5F9OL 3NACL 3HCVB 3QRGH 4P2RB 2UWEA 3LQAL 3CGTA 3C2SA 2PYEB 1NFDA 1Z3GH 5F7DB 1A7NH 1SM3L 3VFNB 5LQBH 3T2NL 3UYRL 2NY7L 3BPCA 4GG6E 1AD0A 3BZ4B 2XT1B 4HFWB 3DROA 2FATL 3TESA 1NCDL 5BJTB 4PJGB 4ORGB 4JRYA 1MAKA 2IBGA 4RAUB 4U1MA 3WO3B 4KAQL 1HDMA 2DLFL 3GSUA 4R0LC 2YRLA 1NCCH 3S88H 3QDAA 1KIPA 4CDGC 1GSMA 3GHBH 1CD9B 4M7JL 1G0DA 3S36L 4U1JB 5EC2B 3HE6B 4NKQB 4LP4A 4ZTOL 1FL5B 5E6ZA 4UINL 2QQNH 5EOTA 4X9GA 3IS1X 3X11A 5EIQA 1HH9A 1MCKA 3D2UD 4R26L 4NQUA 2AEQL 3MREA 5JPMA 1S9XA 3C60D 4HG4K 4O9HH 2QL1A 5L2KB 4AEEA 3RAJH 1CIUA 5IW1A 5HGHB 1F4YH 3D9AL 1LNUA 3NPSC 4KHXL 1MFBH 1MHHB 1LEKB 2WWKO 5IROA 5GZOD 3KGRA 3VE0B 3GMRB 2YWZA 1PJ9A 4PRNB 1A7RL 3Q5OA 4FTVB 2ESVD 5CEZH 1ND0A 4IOSD 4XPHL 5HYEA 2YUZA 3JTTA 3L7EB 1L6ZA 3V6FA 2HMIC 3V5DB 4NQED 4XCEB 1I3UA 5E6IA 1RZGA 3IU4L 5I2IA 5DD5L 5J1AA 1OAZH 4LARL 5E08H 1XF1A 3U0PA 5EORL 4IIQA 4R8WH 4Y5XC 2V5SA 3IKCA 1F8TH 5D7KE 2GJJA 1QQDA 3NACH 2OR9H 4Y5VB 2P43B 4IRJD 3SJVA 3O6KH 5IB2B 4OZFG 5MENA 4W4NA 4N0UB 3TZVB 3ZE0F 3OKKB 1J11A 2H6PB 3RWGB 5B39A 5GGUB 2APTA 5BO1L 4G6AC 4X6DA 1Q72H 2FBJH 1I4FA 3LKRA 4JFYA 3QQ3A 5B8CA 5IK3A 5D9SA 3MR9A 4HK3J 3SGJA 3REWB 5FO9B 1U2HA 1YQ2A 4NQSB 2R15A 3DVFA 3FQUA 5FHBH 4GS7C 3E0GA 3MLVL 1MWAH 4G6FD 3G6DL 3UYPA 1ZLUK 1NDMA 4EXKA 2KL6A 2BY3A 3RA7H 2FEEL 2UWEE 3C6SA 2GTWB 1OARH 4WUUD 3W5MA 2A6KB 5IVXA 3ARBB 2WUCL 4UAOB 1F3RB 4OFYD 2ARJB 2BVOB 1BVLB 3D69B 2D7QA 5L8JB 1YYMH 2OQJA 3TT3H 2JB5H 3TYGL 2CLRA 5C07A 1Q9OB 3D69A 3QXDA 5I1IH 4M93B 4J12A 3ULVL 4O58L 4QCIB 4JZNA 2OTWB 1J9CT 1XEDA 4F2MA 4XPHH 4YIQB 3CLEH 1YQVL 5DK0A 4UU9A 2HLFD 1VENA 1CR9H 2FH8A 4QGYA 5BRZB 4PJCB 4QXTA 3T3PF 3DRQB 2VQ1B 4HQQH 4QXWA 2B4CL 4L8DB 4U0QB 5IOPA 5GJTH 5JW5B 3TA3B 4ZUUA 4YGVA 4PB0L 1YJDC 2CDEA 4X98A 4OCSH 5DHXB 5F1NA 5FHAL 1FO0L 3NCBB 1A6TA 4L4VD 4OT1H 4Q9BA 2YD7A 2IH3A 1RVFL 1WBXA 5KVGH 5L2JA 3L6FB 3I2CH 4LIQE 4I2XE 4LKXB 1R0AH 1AD9A 1LQSR 1WCQA 3WIFA 4K7FA 3QUXD 4MDJB 3V7AG 4H1LB 1J5OL 4MQ7B 4GKZA 4KJWC 2EIBA 1C7TA 5BV7L 3UJJL 1UACH 2PXYC 4LCWA 3GBNL 3RNQB 1I8MA 5HDBE 5I66A 4I0CC 3DLQR 4PG9A 2NX5A 12E8L 3RVTC 4HIJB 1WZ1L 5LXGH 2HWZH 1R3JA 4Q9RL 1I3RB 1RZJL 2HRLA 1K2DB 3T0ED 1RZ7H 3C08H 3K2UL 4JKLA 3AREB 5CJ5A 1FH5H 5AYQA 2N7AA 1WBZA 3LQAH 3RZCB 5EO0B 2JIXD 1NCTA 3IVKB 4FXGB 1HQ4B 5JORB 3ULUH 4KGLA 3GBMH 1CL7H 4RIRA 4OFYA 1NC4D 1L7TL 2AQ2A 4LSSL 4EJ1C 3B2VH 2HLFC 3IDNB 3MRRA 4KU1A 4K07A 5E8PB 3HPLB 3BI9X 3H9HB 3VFVB 4K3GA 2OTUA 5FKAA 1MSPA 3ARGC 1A6UH 4TOYL 4EI5C 2FHBA 3EJJX 3C2AH 1TITA 2OTUB 5FKAB 1V8HA 3EDJA 3O0RH 3VWJD 1JYWA 5I30L 1UENA 3C8KA 4RFEB 3VU2A 2DYPA 2XN9A 4L3EE 1I1AC 1FAIL 3DMMC 2G2RA 1OW0A 4PJXF 5ALCL 1BQHA 3U30B 3OGOE 3TIDB 5HYJD 5FUZH 5E8OA 2R2BA 4XHJD 5DUPH 4K7PL 3QJHB 2ORBL 3U9UA 3OV6A 4HV8B 1TQCB 4BKLA 3V0AC 4NKOB 1EUUA 1YN7A 5E70A 2ADIB 3KHQA 4PJFF 3IS0X 3TO4D 2E5EA 1U3HB 5L2KD 4HIXH 2DJUA 1JGLH 4UQ2B 1TTFA 5DWUL 2F19L 5D1XA 1L0YA 4ISVB 1ZA6A 3VXUA 1MQ8A 2JCCE 3RIAF 2QSCH 4KJYB 4QHNB 4KQ3L 3FQTA 4LSDA 4EDXB 1JZ8A 2RR3A 2B2XH 2J6EL 4PRDB 3O41A 3WS6C 2OZ4A 1IZKA 1NJ9B 2YK1L 5ISZD 5F1SA 5J11B 2EO1A 3EYFB 1WV7T 3CH1B 2Z4QB 4M9OA 1FHGA 3QUXA 3VXRE 1LO3L 5EWIH 3ZDZE 5IGXL 5MEQB 2I60L 3T2OA 2FX8L 5HHPB 3RDTA 1S7VA 2DL2A 4O5LL 4NRYA 1KGCD 2BCKB 2FCBA 4L1DA 1S78D 1X7QA 4I0KA 2CUMA 3H9HA 1QEWB 5EFIB 3TZVC 2V7NA 3QZWG 3CDGA 4Y89A 1CVSC 2YXMA 2ADGA 1QEWA 1S7XB 3LDBC 5EFIA 2YK1H 4WNQA 1OL0A 2E7CA 1UZ8B 1OP5K 1U3HD 3QIUC 4UIMA 4WU7B 5IMLB 5LGJA 1NMCB 3NCYS 4KKNA 3PHSA 2OK0L 3NIGE 1DLFH 3CDFA 3V5HB 5ACZB 1N3NB 2IF7A 3I75A 3KYKH 5TE7L 1HHJA 4WFGD 5KBNC 1FFQA 4WFGE 4BKLB 4LNRA 4OFDA 3O3EA 5MI0C 4WO4A 1AXSA 5IVZA 4XAWL 3DOSA 5CKGA 3OJDB 4WY7H 3SE4C 5D7LA 4JQXA 4FQIH 3D18B 5TDPA 4QTIL 1KYOJ 2FEDD 3FT2A 4P46A 4AIXA 4E5XB 4MD4A 1EMTL 1IM9A 3DV6B 15C8H 1Q9LB 5J7CC 4WI8A 4JO2L 3PWNA 4YDVA 3S5LA 1KCUL 4TNVF 1TQCC 3QUKA 2BHZA 2BVYA 4WW1B 5GZND 3RHWF 2OL3A 5LVEA 2WAHA 3LN5B 5J9PB 3LS5L 3EYOA 4J1UA 1I8IA 5EZOL 4U6TA 1T83C 2V2XB 3PGDA 4NN5C 1HXYB 5KSAC 1F4YL 4PJFE 2GYSA 5I1HL 2HVJB 4JJ5A 5EO1A 3DRTA 1AGCA 2BOCB 5ESAA 1YEEL 4N1CA 2AEPL 3MCKB 1A64A 3ESUF 1DSFH 4L9LA 5HJ3B 5CKAA 2CJUH 2VXQH 3QCUL 3QULB 3HB3C 5B38B 1EUTA 3CFBB 5CILL 4ZFOL 2GFBA 3E6HA 1KC5H 5T3ZH 3SDXB 2HT3D 3HC0A 3UXFA 1FYTB 4HT1H 5F3BB 2R39A 2R1XA 4Y1AD 4ODUA 4H5SB 2Z31B 3O11A 2X4NB 4D8PB 3JV4B 4GMTH 3NGBC 4G6KL 3LN4B 3MRNA 3QWOB 3VFNA 4BH7B 1RIVL 4S1RH 5H2BB 4NRZA 3SE3A 1AD0B 1Q1JH 3PHOA 1BJ1J 2VWEC 3DVGB 4NM8L 3G04A 2ZCHH 3F8UB 5KJRL 4I3GA 4OM0H 5D72H 3QIWD 1HHGB 1JVKA 2D4DA 5D71H 2PTTA 1QSVA 3FO9B 3S9DB 4WV1C 3KYAA 2ICWI 5E2WH 1XCTA 1R6VA 1DE4A 2AK4B 4FQ1L 4K23H 4P2QB 5K93A 1F97A 4LSTL 4G80B 3ZT5A 2HP4A 1A7QH 3ULUL 1A6AA 4JANA 5E8NA 1OVZA 5EOTB 3K74B 2UVFA 4S1SH 1IJ9A 1JI1A 4G3YH 1H8OA 4JY5H 5IHBA 2B4CC 1S9VB 4WO4D 1IC5L 3FFCD 1INEH 2Q3AA 4XPBH 4YDJB 3N9GL 1MJUH 3EHBD 1I9RH 5HHMB 4AMKH 1NFIB 2H3NA 1IGYB 2AEIT 5JA9A 1A22B 3GBNH 2Z0BA 3QULA 3MMEA 3GRWL 4H25A 3H9SD 4BSVA 2MKWA 4WO4C 3TCLA 3MMEB 1TLKA 2HT4C 1QNZL 3E6FA 4OV5A 5DLML 2FL5A 5JPNA 2KH2B 2IPKA 4KKLC 5DD1L 3CMOL 2ERJB 1V3LA 4P9HC 2UV3A 1SYSA 1BEYH 3U0PB 1XFPA 3LMJL 3QXWA 1SY6A 4UBDD 5GSRA 1R5WA 3H3PH 4MMZC 4Y4HB 4DK3A 1H3TA 2GEEA 4JFPA 5FHAH 2VL5B 5GSRB 4UAOC 3SBWA 1MWAL 1GGIH 3QH3B 1HEZB 3QIBD 1JUFB 1R3KB 3LEXA 1FLRL 1MCWW 3LOWA 3P4LA 4WWID 3M17B 4IM8A 4JFZL 3P0VL 4HBCH 2H6PA 2IAMC 3DXAB 3CNKA 2PTTB 2HJLB 3MOAH 5DRNA 3S34H 4G43A 3FFCB 4AIZA 3RVXC 3BWAA 32C2A 3BMWA 2FX8H 4FZEL 4Z95L 2V9RA 2HAZA 1LO3H 5EWIL 3WS6A 1MI5D 4O58H 4Z77B 5T3XL 1UJ3C 5CEXB 3QIBA 1DP0A 1T5XA 2VE6B 1A4KB 2DM2A 4MA7H 1MF2H 1P1ZB 4N8PA 4RQQB 1EHLL 5KS9B 5IMOA 2R4SL 4PPTA 3D39D 1HKLL 3QG7H 4Q9QL 5I75B 4FZEH 4Z95H 4DZBA 4DVRL 1TJGL 4DTGH 1A6UL 4TOYH 1E27B 1T0MB 4NFDA 1QKZH 4S0SD 3S34L 4W6YB 4KI5E 1R3HB 5BV7B 2XACC 3OKNB 3BP6B 2VLLB 1EDQA 2EH8L 2YZ1A 4U1GC 3ARZA 1KJ2H 3JTTB 3BP6A 5CJXC 3NN8B 4FA8A 4JO2H 1OTSC 3U6RA 4LSUL 1GGCH 2R0ZH 4HX1A 4GG6A 4JQIL 2HT2C 2FZ3B 2EKSA 5C0CA 5SX5K 1PG7H 5GRVL 2VL5A 4YXHH 3TVMD 3DRQA 4HF5L 2HFEA 1QQDB 1JNHB 1NBVL 1G7LA 1EEUA 3RTQC 1AKJD 5FOBA 4O2FB 3HMWL 5ESQA 1MWAA 4JCLA 1IILE 3S4SA 1SMOA 3BSZL 4MAUL 1JWMA 4OLUL 1MCBA 4R8WL 2PYEE 5K9OA 4WEBH 1G0XA 3CH8A 1F6AA 2DQGL 5FGBA 5CSGA 4ZYKA 2E9IA 2NXYB 2EIDA 1LE9A 3CX2A 4NGHH 3VJ6A 5F7WC 2W60A 5FGCE 3TN0D 3G5VB 5B8CB 4YWGH 2DTML 5CP3H 3L9RB 3PL6B 2VLRD 1KB5A 4M6NH 2EDOA 2VLRE 3U7YL 1B0RA 5HI3C 4F58L 4LSPL 1U92B 1MFEL 3NIFE 3JWNC 3GHEL 4O5LH 4NHUB 3BO8B 3C6LD 1KULA 4FN0A 1ZV5A 5D7IE 2M1KA 1K2DA 3MO1A 4OTXH 5JHDB 2P8PA 5C09B 2XXCB 2G9HB 1X6NA 4U1NA 5D5MF 3V8OA 2XG4A 3U83A 4Q58C 1RURL 5CUSL 4Y16B 3HNVL 1TNMA 1OB1A 4FXGA 3RJQB 3PIQA 3T0EC 3I6LD 3ZDYF 4RIRB 3ULVF 4RAVB 1KJ2L 4BFIA 1FJ1A 2BNRD 3BISA 1WZMA 4GBXC 3GMLB 2YPKA 4XVTL 3DURB 1LO5B 1WBYA 4LSPH 5DK0B 1T22A 4K3DL 4UB0H 5CLWA 3VA6A 2OR8A 4ZFZB 4YEFA 5HI5D 5B38G 1IBGL 3V7MA 3VDAA 1OF2B 4OZHF 3BKYL 5KSBF 5J6HA 1BOGB 4HULB 2BRRL 4LQFL 3TA3A 3B83A 1D9KB 3MLVH 2NY1B 4QRSB 4TYUA 3VFWB 4X7SL 1BOGA 4OF0A 1CE1L 1EXUB 4I18A 2ITCB 4F7TA 5I0DA 5F1KC 4KWUA 2XZCL 5EU5B 1MELA 1FIGH 1PZUB 5C0GA 4FP8L 2SEBB 2A77H 3ZDXF 5IW6A 3QNXB 1LD9A 4J7RA 5TE6L 1JTOA 3F12A 1CBVL 4R0LA 2GK2A 2EE6A 3KYOA 4RCAA 2QR0B 4WEMB 1FORH 4X8JB 1UQSA 4KVCH 3MLRL 3SKOB 2BFVL 3VGDA 3P0VH 2C3GA 5IIEB 1ZSDA 4Y2DC 1BVLA 1X5IA 2OQJB 2BX5A 3MO1B 3O6FB 4PV8B 4RRPG 5KSUA 4PUBL 4K2UH 3UTZB 1R3JB 3FHAA 1OM3L 3LKPB 3T0EA 5GRWA 1F2QA 1KELH 1Z2KA 4QT5A 4WCYH 4KROB 5IB4B 3CH1A 3H3PL 2MOVA 2OTWA 2BY1A 1UWEL 1HQ4A 2N56A 2VUOA 1TTGA 1O5DT 5FCSH 4KKAC 2NNAA 3P9WB 3LKNA 3X12B 4ZSOE 4Z18A 2R4SH 4OZGB 4QXTB 2VRAA 1MLCB 2PCPB 1OWRM 4JQXC 2HYMA 2EDQA 4ZUSA 1GGTA 3LMJH 3EUUA 2W38A 3GSVA 5F7FA 5D6CA 3MXWH 1H3PH 4PG2C 5DLMH 3GSVB 4P3WA 4LVOC 3STLB 1M71B 4U1HA 2X1QA 2HTKC 3MGOA 5C0BA 1XF4A 2RAMA 2XWTA 4FQ2H 5J3HD 2BOBB 1F45A 1EAJA 1KCVH 2K7PA 4WO4B 1BHGA 3WDHA 5DFVD 2EC9T 1BFVL 1MJ7L 4L29B 2JJWA 1OAUH 1L0QA 3L3JA 4BYHA 5JDSB 5I8CA 2E7LC 4YUEH 5DJ8B 4IRJC 5GGTA 1K85A 2P48B 1AE6H 3DECA 3K7UA 4DUVA 2LFGA 4JFED 1BBDL 1LHZA 5DD0L 3VXOB 1JWUB 1J86A 2O61B 4KTDL 2GSIA 3UAJD 1HCVA 1GGYA 4WTZG 4PJ9C 4LHJB 4AIOA 4G5ZL 3RHWK 2JK5B 3EYQC 3LN5A 1T0NA 5I1LB 1B88A 1QHOA 2F19H 3B6SB 3DGGA 2H2PC 2X42A 1UA6L 1YYLL 3CSYB 3MRGB 4GMTL 3RVUD 1NBVH 2WUCH 5ESAB 1S7RB 2Z4QA 5MEQA 2DI9A 2O5XH 3BN9D 1S7TB 4Y5YC 3TJEL 3EO0B 3CLFH 3VI4E 2Q1EA 1RIVH 1B6DA 1EX0A 4S1RL 5FUZL 2X7LB 1LVEA 1OWWA 5DMKA 3EOBA 1BVKA 2HH0L 1A7OL 3WXWH 3B9EA 4YFEA 3VW3L 1HHIA 2YD3A 3QNZA 2J8UE 4NKIL 3H9SE 2DLIA 1ZXQA 3QA3B 4WTZA 1NCAH 3PWLA 1JRHH 2EE9A 1WITA 1NMAL 1Y6NR 5JNYB 4PJ9A 1BP3B 5DJAB 1CL7L 4HLZH 5I0ZA 2A6IB 3ARXA 4HUUB 4Z78B 2NY4C 5H37G 2EDNA 3TIEA 4PJBE 4PRHE 1OAQH 1B4JL 3GK8L 4Z5RB 3ME0A 5T3XH 1UFUA 5EZJB 3TIEB 1OTTC 1CE6B 2R1WA 5GGTL 2RB8A 3TCXA 5ENWB 4PTUA 4Z7VA 4P99A 5LBSH 5T1DH 3X17A 1A2YA 3QPXH 2VR9A 5EPMA 1S9YA 3JV6B 1PX4A 1A7RH 4L3CA 5CBEB 3VXRB 2EXYD 4MVBC 4OM1H 1YEKL 5J4MA 1NAMH 1JL8A 4NSKB 3C5SA 5SWQB 3CFDA 3NOIA 4GRLB 4K71B 1CICB 4FQJL 2A2QT 4HUNB 4LHUD 3LSOB 3OXRB 1P4LB 5IFAH 5HSFA 4M7KL 4KTEH 4PJFB 1T66D 3P0YL 4NZJA 1QSFD 3R0MA 4BSVB 3DX8B 2GW5A 2GJ6D 4UT9H 5BVPH 2R56L 4PJFA 2I9TB 4IRSD 1NLBL 2E7HA 5GGSB 5CD3A 5DQJB 3BDYH 4XWGH 1D5MA 5C8JA 1C16A 1IGTB 2QTEA 4I48A 2LAGB 4H5SA 4RX4A 1CXHA 2AJXL 3QIUB 4KKLD 1NGWB 5D1QC 1VKXB 2XICA 4OFPA 1YDPB 1PEZA 4JN1H 3OXSA 2I9LB 4BH7A 2A6DA 2X70B 4OLUH 1FPTL 1A0QL 4TSAL 5ACMA 4TUKL 4RGOH 4CN4A 1RJZA 5CHNA 3GSOB 5TDPB 3GKWL 3QSKB 1WLHA 5EZLB 4MD4B 3F58H 2B5IB 4M61A 4NNYB 4NO2B 3ARGD 1N59A 3SKJL 3G6JF 3TT3L 3JWOH 3NZ8B 1ODAA 4LLWB 4JDTL 1NKRA 1NFDF 2F58H 2Y6SD 1WWCA 4JFFB 1LO2L 4LLQA 1B0WA 5D71L 1J88A 2WLYA 4NZTH 1IGFL 3VFMA 3PDOA 4Z6AT 1T7VA 3IU3B 3A0OA 3FAWA 3C9NB 1X5JA 1CN4A 3WFCL 2FR4A 1FYTD 3MZGB 2EH8H 1A6PA 4HWZA 4CDHA 4JGUA 2G5BB 4QRRE 5FKPA 1LP9A 5IMOB 5FGCB 3TA3C 2R2CA 3BGAA 1JPSL 3DRTB 1CICA 1QYGL 3QDJB 1UCBH 2BNQB 1QRNA 4JKWA 5ADPL 3T0BA 2P5EA 3CFIC 2AXJA 4NDMA 3VA2C 1EBPA 2CUIA 3LD8B 1KJVA 4NKDB 2P5EE 1P5VA 5JTWA 2PETA 1ORSA 1ACYL 2XTJC 3WO4C 3T0AA 2J88L 2HMID 1C5CH 3TJHD 3EIFA 1KIRA 1DBKL 4JKPL 4TTDC 4NQXB 1RUKL 5K9QI 4XMLH 4U1SB 1V7NL 1QRND 2YD5A 3OPZH 5TPWH 3CVIH 3MYZA 5ICZA 3S96B 4L4JA 3SY0A 1YPZB 4CU7A 3W9EB 4F58H 3V4UL 4MNGA 4EOWH 2HWZL 4HZLB 4F7MA 3ALPA 4RAUA 3T4AB 2P5WD 5IR1A 3GJFA 3M17A 2VDPH 1RUPL 2DQHL 1MRCH 1EEZA 5E5RB 3DXAA 3MZTA 3C08L 4ORZC 5IVOA 2MFNA 3HRPA 5IFHH 3EFDL 5T1MB 1YPZF 1NMCC 4O9HL 1DANT 3VXNB 5EC2A 4L3EB 1IKNC 2YEZB 3QFJA 4HS6B 2O5XL 1FQ9C 4KDWA 1BQLH 5EU6E 3MFGB 4QTIH 5JQHC 3N0PB 3P11L 2DWDA 4AEFA 1CG9A 4P2YA 4FQPA 3LZFH 1AR1C 3U4EA 3DXAD 2NYYD 3UAJC 5FOJA 5E1HB 4L5FH 3SOBH 3LIZH 3NPSB 1KXTB 3G6JE 4MHHI 3ZE1E 1CK0L 3TVMC 5DZOA 4PJHB 1QBMH 4ONHB 4JPIB 5F1IB 3PQYD 3B2UC 5K9JH 4M48L 2PTVA 1MHPL 3FB5A 2QQQA 3P4NB 3QXVA 2F53E 3X14B 1KEGH 1YMHA 5HYFA 2N7BA 1SYSB 4I4WA 2CRYA 4XCEA 2ZCKH 2EDJA 5J1AB 1V3KA 2Y07H 4N1EA 1UCTA 2XNAA 1E4WH 1KXVC 3T1FA 4G6AD 4NWUH 1WBYB 3ULVH 1K4CA 4NYLB 5F9JB 1KACB 3LPFA 5HHXL 4GW4B 1ERNA 1FE8L 2WLZA 1HSBB 4MJIE 4Y5VA 5KSBE 4M4RA 3WNMA 2Y1VA 1H3PL 5AD0B 1PG7L 1DEDA 4PTTB 1HN1A 3FQXB 3O4OC 1X4ZA 1M7IA 1QRNE 5CJXA 5ICYA 1MWAB 2NY6B 3TBVB 1EHAA 3FFCA 4AIZB 5E4EB 4F33B 1M7IB 1E4WL 1HWHB 1S7QA 4UQ3A 5KVGL 2WV3A 5GS0L 4KQ3H 4ZUTA 1BLNA 2LABA 4GSDL 3I6KB 5DUML 3QIBB 3MNVA 3VXUE 4HJJL 1I7UA 3MR9B 5DHVB 4G9FB 1SBBA 3RFZC 2CD0A 2FIRT 5MEPA 4OAWB 4F7EB 4ZSOA 2DWDB 2QR0A 3NAAL 4XBEL 4ZSOB 4KK5D 1N6QL 4N5UA 1QBBA 1UB6A 4GSDH 8FABA 1CFNA 3BD3A 3IFLL 5FECA 4R9HA 1BEYL 1MHEA 1OPGL 3MLZH 2QQLH 3L3GA 2ZUYA 3BE1H 1GHFH 1QA9A 2APVA 3ISWA 2X4RB 4ZAKB 3VRLF 1QSEA 1IGML 3SDDD 2EYTA 3GSNB 3P4MA 1NAML 1MFDH 3RWFA 1JK8A 2O5YH 2ZUXA 1QFPA 4HBCL 1RUML 1KCUH 3FO1A 3LS4L 4GW4A 1FZKB 3N9GH 3ZL4L 4M6MH 5CAYB 4MCYB 5HHVH 5I75C 1YMME 3JSSA 3T4YB 2BXZA 4HK0B 5TGBB 4LGSB 3DYPA 1MFBL 1CU4L 4MWFA 2JJSA 1OAQL 5DJZB 1N8ZB 5DRXA 1EV2E 2XZQL 5HDQH 1KLUA 1JNLL 4U0RC 5CGYC 1TQBB 1D6VL 4JDVB 1JE6A 4QRSA 3V2AR 4EKXA 1U8PA 4Z7OE 3BKML 2BNQE 3GMPA 5BV7H 4LIQH 3VXMB 2FJGA 4QRPE 3SPVB 3RUGE 3I85A 4ONGH 3TBTA 5EA0H 1MCCA 2ATKA 4F7PB 1RQ5A 3MOBH 1VSCA 2X89D 2ZG2A 5L8LB 3CFEA 2WSKA 4YXHL 4YDKL 3WS3A 3QPQC 2X4SA 3VXUD 2Y5EA 4X8JA 1LDSA 4HIHA 5D7LD 5FUCC 1OT1A 1FO0A 5HDQL 5I1LA 2ATPB 4L8BA 3U4BL 2UZIL 5GS0D 1V05A 3ZKSD 5IMKA 1A6ZA 1U8JB 5A40E 5IJVA 1RUPH 2YR3A 3VG9C 4FNLH 1E4KA 2MWCA 3I6GB 3DUUA 2VXTH 3F6IA 1EK3A 2HT4D 1CFQA 4WRLA 1UXSA 5DZNA 2EC8A 4Y2DD 2AJ3B 4EOWL 1I9IL 4J3VA 3HR5B 1QFWH 3FN0L 3UYRH 2R2HB 5L2KE 3R0NA 5D72L 1MFDL 3HMXH 2AXGB 3VWKC 3X12A 2X9WA 3FOMA 3UTTA 3HI5H 4P2OA 4G6FB 5FM4A 3PWJA 4PP2A 5BZDB 4OCWH 2Z35A 3L5JA 5FO7A 4TPRL 4GMSL 1NC4B 5D6CB 1DVFC 5EIVA 5JQ6H 3PWLB 1AC6A 4WI4A 5E94B 3CZJA 5CP3A 4PBWD 1NC4A 3UJTL 4I1NB 3FZUC 3S5LG 3LKOB 2WWMC 7FABL 1IM3A 2H2PD 4MA1B 1A1NA 4HV8A 3SPVA 1T0PB 4NQEE 3QIUD 1KBGH 4JM2F 4NQEB 25C8H 1PYWA 5FAAA 1DN2A 1T1YA 2MCG1 5ICXA 5L88H 2J8OA 4NQEA 1HH6B 3RWIA 1MHPH 2FYYB 5KSAA 2VDLL 4ZS7L 5DC9B 5D1QA 5TQ2H 4FQXB 4LLMB 1I85A 4PP1D 1UWXH 3BWUC 4LIQL 3UTZA 1ZKAA 3FQTB 4APQC 1K5NA 4NC1C 4FG6D 3KLAB 3QO0B 3RI5K 1B3JA 4KXZI 3PV6B 3VXSE 4GRLA 1F8TL 4Z7UA 2PR4L 5HVHB 3QZWA 4MLSA 5DQ9B 3WLWC 1C12A 4L4VB 1RZ7L 2VWEE 5D93C 1UZ6E 1NAKL 3KYNB 3ECBB 1I3GL 4TUKH 1P7QA 4LBEB 5IBUG 5LXGL 1P4BH 4PJBA 4PRHA 2DM4A 1FIEA 3BXNA 3MLYL 4LBEA 5KS9E 3LKQA 4Q97A 3AU1A 4NQCB 4MJ2A 4X99A 5CMAA 5FA3B 1VACA 3VXTB 1CLZH 1D5ZA 3RVUC 2JJUA 3WCYA 3ARQA 4FZ8L 5FA3A 1FNSH 2IGFH 4QTHB 1CTNA 2BOBA 3GJEB 4P2OD 4KXZH 4PJ5B 3PWUB 3DX6A 3P9LB 4QOKA 4P9HL 4CRPA 4LGRB 3V52H 1TIUA 3L3JB 2JJVA 1A7OH 3HG1E 2A0LD 4HHAA 5LJYH 8CGTA 25C8L 1CGXA 1H3VA 1TJHH 1HH6A 2EYSA 3OAUH 3HC3L 4PGDB 2DLTA 3O6MH 5TH2B 5IFHL 4RX4D 4KI1A 5E2UH 1AO7B 1U91A 4DK6A 1YQVH 5JPMB 3QUKB 5AYUH 1MREH 5EPMB 4XCNB 1RZIB 4TULL 1S9YB 2LVCA 4G42A 2DQFA 3ARFA 4NN6B 1IAOA 4OD3H 1H0DB 1JGDA 4JLRA 5I71C 1JHTB 1OW0C 4MJ6A 1X5ZA 4GUPA 1S7RA 4R4ND 2HA1A 1S3KL 1J87A 1C12B 2VZ3A 4L4VA 3ARFD 5ITBL 3OPZL 5A16A 3CFDB 4WGVB 4AH2B 1WFOA 1KJ2A 1GPOH 4IRJB 4Y5YA 4TSBL 3L1OH 4NFBA 1TFHA 4GBXA 1AGBB 5BW7A 3RX7A 3RX8A 2ZOKA 4EDWH 3GB7B 2GFBB 3BD5A 3E6HB 4Q0XL 2YS4A 4ZPTB 4OZFH 2VDNH 1U8IA 2BSED 5HHQA 3GZKA 1J0JA 3FQWB 2NY1C 1MCFA 5F8QC 3EHBC 4ZNCD 3TEUA 1KIRB 2VL4A 4Y2OA 2OYPA 1VEPA 1LK2A 4NKIH 1MFCL 3O11B 2WK2A 3MV01 4NQDE 3HG1A 4I48B 4PY8J 1YY8A 3QDGB 3FB8B 1BX2A 1TCRB 4HXBL 5ICZB 1J12A 1NGWA 3NVQA 4YHML 2Q86A 3DVGA 2P49B 5IEHA 5CGMA 1JPGB 1QFWM 1HE7A 5I8EB 2DN7A 1N5YH 2EDWA 4LSVH 3G6JA 4X0KB 3IXAB 1QPPA 4UV4L 4YPGB 5TE4H 4YHPB 4ZTPL 1ITCA 4YPGA 3ZDZF 5I73C 5IP4A 4D9QE 5IFJB 2HVKA 1AFVL 4HKJB 3JWOL 4LRIA 3V0WH 1S7SB 4HEPG 5IEKA 1OHQA 2LE9A 4L3CB 5CBEA 1QFWL 3IDJA 2MPAL 3QUZD 3SDXE 1A1MB 4NSKA 1DN0A 1F4WH 3RTQA 2VKWA 1RI8A 2Q7YB 1IQWH 1MQKH 4QRUB 1SY6H 1IAMA 1KUMA 1RZKH 3CJJA 1AO7E 1NDGB 1TCMA 2I07A 2Q7YA 1INQB 4DKAA 4X8XA 5HD8C 5DD6A 3IDYB 3DX8A 4DGIL 3SDAD 4H26B 1D7FA 4NWTH 4DVBB 4JY6B 2YPLE 4NDMB 4U6YB 2ZOKB 3UTSE 1RUAH 1KJVB 4C57C 4JJHA 2RBLA 5DJXA 2X10A 3SKNB 4PJHE 5ILTL 5C6TH 3TLRA 5C8JB 3NH7H 3MRIA 1RD6A 3MLSL 1HILA 2DAVA 5ETUA 1IT9H 2GJ6E 5JW4M 2GI7A 1DCLA 4C56E 1VGEH 4KRMB 1OCWH 2A6DB 1H5BC 2X70A 1T7YA 5DD3H 3VGFA 4Z0XB 3QDMD 2Q86B 2Y4SA 2VR4A 3S96A 3SY0B 2Q7NA 2P46B 3BPOC 3QQ3B 3C6LC 4BQCA 4NO5A 1XF2B 4N8VB 4HGMA 1AKJA 4KZDH 1F3DH 3GMQB 4EVNA 1EHNA 3MLYH 4RMQA 2PW2B 4TUJA 4K2UL 5DRNB 1KELL 1KOAA 3VRIA 5D6DA 5C0CD 4R3SA 5INCB 5FF6A 3SGEI 1Z5LB 3HE7D 4NZTL 2KKQA 4LCCA 5FF6B 3RNQA 3UYOD 1CIDA 4MD5B 5E00B 4JR9H 1U8HB 4JZJA 3OF6A 2Z92A 5D7IA 4OF8A 1J1XH 2LU4A 3O6KL 4NM4L 1NGXB 4OIBA 4PJGF 4JZJB 3PF2A 4KFZC 1QSFB 2PXYA 2D7TL 4BK4A 2D7PA 1DL7L 3AM8C 4H26A 2IQAA 5H35A 3L3GB 5AZEH 1SBSL 1RZFL 4YO0A 2IQAB 5H35B 3MRRB 1HQRA 1MIEL 4RBPH 5E8PA 3IRPX 1Q9KA 2RCSL 4OKVB 5CGTA 5CSBA 1RFDH 4I9WE 1I1FA 4AT6B 1CK0H 1MAML 2DLHA 1CGTA 4PFEA 2ZUQB 3ZKND 4X98B 3OKMA 4YLQT 5DUBA 2R56H 4ZUWB 3S35L 1A8JH 1VFAA 2RHEA 3ULVD 1T7XA 1MRDH 1K4CB 5I15L 1W72H 4LGPB 1AD9B 1ZS8B 2GTZA 2IBZX 1PG7X 3KLDA 4L3AA 2ESVA 5H37H 1MCHA 1J5OH 4Z0BH 3S36X 2ID5A 3S3JA 4DN3H 5T3ZE 1NC2D 3TBVA 2FX9L 4HS3B 3QFJE 3AVEA 1FNGB 1N5AA 3HMXA 2IADA 4L3EA 4M7JH 3R1GL 2VISB 4NT6B 4U2YA 3RPIB 3WLWD 4MDIA 2QADB 3S88L 3LEVL 4LCCB 3IT8D 4MB5A 3G5VA 5ALBL 4ISVA 4TNWK 4WHDA 1XGPB 3WNLA 3BP4B 3ET9F 3W9DB 2CDFA 2J6EA 3D2UA 4R96B 3D85B 3KJ6H 1CG9B 2BP3A 4K3JL 4JVWA 4WHTB 3CSPA 4JO1H 3MC0A 1B0RB 3LPWA 3O9WC 4LPCA 5TPWL 1W0YT 1YY9D 2PXYB 4I77H 1OQXA 5EOQL 5JORA 1CGUA 5DK2A 3WJLA 3BZFB 4TRPH 2ATPA 2X9XA 3A67H 2J12B 2Z9TA 1MF2L 2P8PB 5C09A 4M1CD 1PBYA 1JRHL 3QEQA 3ABZA 1NGQL 1X7QB 5BVJA 2FLRT 1X4YA 2JLLA 3EJYC 3KXFB 3OJMB 3MRMA 4D2NA 4PJ8D 3I6GA 3OKMB 4HMDA 3LS5H 3WYRA 3R06B 3WDJA 1YN6A 2MJWA 4POUB 5GRJL 4PJ7F 4HDIB 1NCDH 1PKQA 4GAGL 2R2BB 1S9WB 3KJ4C 4X6DF 1TVDA 1F58L 3L5WB 5KTEL 4OKDA 5FGSA 4G8GA 1BZ9B 3MNWB 3FOLA 1HHJB 2BVTA 2D31B 4KROD 3ARDC 4XNMB 4PB9H 1UA6H 1YYLH 2VAAB 3KPRB 4PLJC 4W81A 4AL8L 4GRWH 4XNMA 2VDMH 4IMLA 2HJFA 4JRXD 4YE4H 3VFPB 4FS0A 4WUUE 4RA0C 3WO4B 5D7LB 3OG4B 4IRSA 5D70H 4AQOA 5HYSB 2C3VA 5GIRB 5ESVB 3FQNA 4JHZA 4XCCL 1JF1B 1HNGA 4KK8C 5ESVA 4P57B 3VFTA 1QFOA 1ZAGA 4LMQE 4MA3A 1AGFA 2RFXB 3JTSA 4OLWL 1GHFL 5F6IB 4R0LB 1GZQA 3RWDA 1A4JB 1AQKL 2UYLA 4XMPH 1YYML 4OZGE 1YC7A 2OX5A 1AHWB 2VN7A 5C6TL 1AY1L 1MHEB 5JR1L 4OQ1A 2GUOA 1TTUA 2AXHA 1CTOA 4ZFOB 1FO0B 4P9ML 4ZFOA 3MLWL 1OTSD 3KJ6L 4OUUA 3NZHL 1X5LA 4N0CC 3LRSA 3U7YH 5B38A 3ZHLA 3RWFB 1FG2A 3AROA 1AIFA 3R4DA 3UP1A 1J18A 5JLZA 2B5IC 2F8VA 5C0RL 4UIMB 4NO0D 4WU7A 4YWGL 5IMLA 3BW9A 4WUUB 3EOTH 4X6FB 2BC4B 4JRYE 5MI0B 1NAMB 4XCYB 4MCYA 2R1YA 4U1IB 2OMNA 3GO1L 1A21A 2BJML 3WFEL 1BGXL 1MCQA 4XVSL 5F9DC 4ODTH 2CRMA 2H1PL 4D8PA 3BJLA 1RHHB 1ZHLB 2B0SH 5JHLH 4P3CH 3EDFA 4XI5C 3SKJH 1D5ZB 2DMCA 2HJKB 4LFHG 3X13A 5EU7E 4NCC2 1XR9A 4ZTPH 1UG9A 2XWJA 3C6LB 4OD1H 4X80L 4FXLA 1XR8B 4WI6A 5I1CH 5BW7C 5DS8B 5F6HJ 2GT9B 3QCVH 1MIML 4LCWD 1IM3B 3KPTA 2HRPL 4HK3N 3ZKMC 3ZYZA 3VWKB 4DKDC 3EDDA 3BHBA 3MRJA 4KH2A 4NQDD 2XZAL 3O3AA 2A83A 4CVXB 1MAMH 1A14L 4NOBA 1YEIH 4P57A 1ES0B 1BVZA 4JRXE 4ETYA 1P84K 3NIGF 5EBMB 4A6YA 3RVXD 5IKCA 2D7NA 4JGMA 4Y4FC 5ICXB 5FO8A 3BDYL 3SO3B 2GJZA 4M6OH 3S3SA 5I30H 3OAZK 5DJ0A 3HB3D 1BBJA 1JPTH