3I9AA

Crystal structure of human transthyretin variant a25t - #1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
b'CPLMVKVLDAVRGSPTINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Crystal structure of human transthyretin variant A25T - #1
rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 25
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3i9aA00
1Y1DA 1SOQA 4MRCA 5EN3A 5EZPA 1E5AA 3CFNA 4TLSA 4ABWA 5AKSA 4MRBA 4L1TA 4I89A 2F8IA 4PWFA 4YDMA 2H0JA 2ROYA 3IPEA 4DETA 1U21A 1SN2A 1IIIA 1BM7A 1X7TA 3CFTA 1FHNA 2B9AA 3IWVA 1TZ8A 3GS7A 4IK7A 1OO2A 1BZEA 3IMVA 4PWJA 3D7PA 4ABQA 3P3UA 1THAA 4HJUA 3CFMA 5E4OA 5JIQA 2GPZA 3DJZA 4TNGA 1ETB1 4TKWA 3NEEA 1DVSA 1SN0A 5CNHA 4DEUA 4TLTA 4DESA 1X7SA 1TTBA 4Y9FA 1BZDA 1TT6A 3DO4A 3DK2A 2G5UA 4IKJA 5AL8A 4IIZA 1ZCRA 1TLMA 3CN4A 1ICTA 3KGTA 5FW8A 2B16A 1SN5A 3P3RA 5DWPA 3NEOA 4FI6A 3CFQA 2G3ZA 3D2TA 3GPSA 4N85A 2WQAA 4QYAA 4Y9CA 1QWHA 4DERA 5BOJA 5L4MA 4FI8A 4TQPA 4FI7A 4PM1A 3ESNA 3Q1EA 4ABUA 4D7BA 5JIMA 2QELA 3IMSA 2B14A 5K1JA 5CLZA 4Y9GA 1ETA1 3SSGA 1GKOA 1BZ8A 1FH2A 4AC4A 4I87A 2FBRA 5CLYA 4TQIA 3I9AA 1TSHA 1G1OA 2F7IA 1TTAA 2H4EA 2QGCA 2QGEA 1E3FA 4HIQA 3CN1A 3A4DA 3DIDA 5IHHA 4IKKA 5AKVA 3FCBA 1RLBA 3A4EA 4ABVA 2IGLA 1Z7JA 3I9PA 1TTRA 5CN3A 1DVXA 1DVZA 3CN0A 4ANKA 1F41A 1ZD6A 1SOKA 5FW7A 3HJ0A 4DEWA 2H0FA 1IJNA 2QGBA 2TRYA 3BSZA 2FLMA 1QABA 3CN2A 3I9IA 3IMRA 1THCA 3IMWA 3P3TA 3QVAA 4TNEA 2G9KA 5AKTA 4PVMA 1GKEA 1IE4A 4PWIA 2GABA 3B56A 4IKIA 3DK0A 4AC2A 3NG5A 4PWKA 4Y9EA 3OZKA 4PWEA 4N87A 1TYRA 3DJSA 3IPBA 4HJSA 4ACTA 3IWUA 3GRBA 5FO2A 5FW6A 3KGUA 4IK6A 4WO0A 3NESA 2G3XA 1IIKA 3U2IA 1KGIA 4HISA 1E4HA 3CN3A 4KY2A 3FC8A 4MASA 2G2PA 2G2NA 4TQHA 3GS0A 3ESPA 5CM1A 4TL5A 1TTCA 4PMEA 5CR1A 3BT0A 4TNFA 3CBRA 3DJTA 2ROXA 3GS4A 4TQ8A 1KGJA 1F86A 2H1XA 2TRHA 4TLKA 3KGSA 5HJGA 4TM9A 3W3BA 3P3SA 3GRGA 3OZLA 4QRFA 5E4AA 5JIDA 5AYTA 4IKLA 4PMFA 1DVQA 2H6UA 4QXVA 2G4EA 4PWGA 4N86A 5CLXA 1DVYA 4TLUA 3ESOA 1BMZA 3IMTA 4Y9BA 5TTRA 5AL0A 4WNJA 2QPFA 3GLZA 3TCTA 4PVNA 1DVTA 5DEJA 5L4IA 4I85A 4PWHA 2B15A 2NOYA 4HJTA 3DJRA 4TL4A 2G4GA 2H0EA 4YDNA 5E23A 3U2JA 3CXFA 3IMUA 4Q14A 2QGDA 4PVLA 5L4JA 1DVUA 4WNSA 3TFBA 2B77A 1TFPA 4L1SA 5A6IA 2PABA 5K1NA 5L4FA 3NEXA 3A4FA 3DGDA 3M1OA
chains in the Genus database with same CATH superfamily
2L4OA 4HSAC 4QTIH 4OGYH 1SXCA 3HPLB 1N68A 3LN4A 1AQDB 1T89C 2VR3A 2EEAA 1MHCA 5DJDB 2NY3C 4Y2NA 3KPNA 4NZTL 5I75C 3AQDA 4QY8B 5DZ9A 2B1AH 1G0DA 4NNXA 3BGFB 4HQQH 5K9OB 2AV1A 3KHQA 1XTLA 3ZL1A 4OFYD 2FUQA 4WNQB 2QTEA 1O5DT 2YPKB 3HBZA 2OYPA 2QPSA 4KI5E 5M94B 3OAYH 3CE1A 4AKOA 2QVIA 3CSYA 3GSRB 3B9DA 3VFRA 5IB1A 1HWWA 2BRRH 4X9YA 4GO9A 5IIEB 1TLMA 1ICTA 2IWFA 4FFZL 3V7AG 3S8WA 3WI9A 1G7PA 3KLQA 4A2HA 4XO4A 2OJEA 1BSIA 1DANT 2MPVA 4J39A 2QELA 4OGYL 4E68A 3S3DB 3A6BH 4M4PA 4CSZA 5ALBH 2IPKA 4KXDA 5TE4H 5CP7B 2ZX6A 3MYJA 4KC3B 3VO0A 3RWJA 5DHYB 4MXQD 4JR9H 2FX8H 3U4KA 3DX7A 3F05A 2NY5L 5AVZB 1T20B 5HDBF 5SWSB 3EOBA 1UZ6E 1S7SA 5I1GL 3H9SB 4TUOB 2CO6B 4HLEA 1NGYB 1RZ8B 5DYOA 2WV3A 2WNXA 2K4AA 1OLLA 1XB3A 4M7LL 5DXWA 3FFCB 4MQTB 5DC9B 4AWJC 2ZUTA 3U79A 3P11H 5KAQG 2EDQA 1KJ2L 1ROCA 4J23A 3T8XA 3X14A 5DMJB 3C12A 4JO5A 5E00B 2D03H 2I9TA 4AK2A 5B3NA 1FL3A 2Q7NA 4NPJA 2ESVE 3A6BL 5DFWH 5DF0A 4IOIB 4Z7UB 3U2IA 4LCCC 1J9QA 4BZ1L 1F6LL 1U2YA 1HINL 3PWUB 2ED7A 2LR4A 4N5ED 2ZWLT 3QEGH 4H88L 1S7VB 3IFPA 3FQWA 2X1XR 5F70A 5IMOB 1Y6MR 2AS5M 1EEYA 3ARTA 4KROD 5ALCL 4LHUB 1CFNA 1CQKA 2V9TA 2DYSB 3IM1A 4KJYB 4PYHA 3W2DH 4QXVA 2AEQH 3CH8A 2GJ6E 1MHPL 1HT6A 4LSVH 3FRPG 3G5ZB 2CM5A 3U9PH 5D7JC 1E28A 5EOCL 4PU2A 2QQNH 2XZAL 4H8HA 1KTJA 2D03L 1BW8A 2R1XA 3H0TB 2KZKA 4K7FB 3QFGA 4X6CB 4MCZA 3ZDYE 1E67A 1PD0A 1UM5H 1S5HB 4PRDA 3N0PB 5EN3A 2EDBA 1T1XB 4UI2A 5TPWH 3FSWA 1XAUA 2YWYA 2VLKE 4LCIH 3IRZA 1CDJA 2QKIA 3MO1B 4ZMNA 4KV5F 2EYTA 4MA8L 1BIIB 4M43H 1RP9A 1RU9H 3UZEA 3BAKA 1KSRA 3P9MA 1VIWA 1EXGA 5ADOL 4Y19B 3ZT7A 2GPZA 3DMMB 2NSMA 3KWTA 1NGQL 1AXTL 1YY9C 4AH2B 5L2JA 2Z91A 5IR1A 3CVHB 2Y5QA 1FYTE 4BEIA 1PPIA 3DUUA 5KSUA 3K6SB 1B0IA 2Q76B 3FT3B 5FO7B 4Z76A 2PXYA 1DQIA 2B59B 2J3SA 2WBJC 2APBA 5EF0A 5L4MA 4AV0A 4RMUA 1MHEA 2GBVA 4N2FA 4QCIA 1RZIB 4WF7A 5JOEA 4FHBD 4EQ2A 5HYSG 1PEWA 2MH4A 3N2JA 1PX4A 2N59A 2ZX9A 1QFHA 1GH7A 5EOQL 2X4UA 4F3FA 3UERA 4ZT1A 5DZNA 1Q72H 1OGAE 1PU0A 4ZQKB 1TTRA 4HIHA 4KRNA 1YPZE 2XU9A 4JFVA 3K6FA 2XBDA 4LQFL 3K8MA 2DJUA 5D2LA 2BIOA 4NKOA 4X99A 1JNNL 3DRQA 1MCRA 2AGJH 5I74C 3HAEH 1A8ZA 3WO3B 2I69A 2DQTL 3TWCH 1QHOA 1AGFA 4P49A 5GSVA 2QLVB 4MNHA 5AOZA 1DBAL 1KTLB 3VXRA 3W9EA 1MCPH 4NN6C 1WWAX 1RULL 3UAFA 4OH2A 2ICEC 4AJVA 4QD2E 3KPMA 5I19H 3D12B 4P46C 5IJKC 1K5NA 1WS8A 2E9BA 1UEMA 5E1AA 3LN4B 4E5XB 4Y4KB 1J8RA 3QQDA 1HKLH 3I84A 4GKZB 1U8NA 1SY6A 5I5JA 2E6QA 2D4DA 4AYSA 3S88H 1MQ8A 2AF2A 4Q7DA 3BISA 1S7QA 4TN9A 4Y9BA 1HQRA 1MEXL 4P3CL 4WGKA 4H44C 1RUPL 4N8UA 1QD0A 3VFUA 3EYVA 3K5SA 4WHDA 5KSVB 2DMBA 4ZW5A 1V27A 4HYTB 4LSTH 4NAJA 4KI5D 4R5VA 4V2CB 5F7UA 3FK3A 2CJSA 1MCPL 1JYNA 5BJTB 4YXLH 1YEDA 3HR5B 4W9GC 3BUBA 1G7PB 3RVWD 5I19L 1M7DB 4FLRA 3UG3A 3GXMA 4L37B 2N1TE 2AJZA 4ODTL 4OLYH 4I0KA 3B43A 3NTCL 2W0LA 4UQ2B 3RZCD 2HUEA 1ES0A 1U21A 2DLFL 4ZSOB 1BM7A 1P1ZB 4Y9EA 2IALA 1W8OA 4XVOA 3RWJB 1FC2D 3VWJA 1ZHNA 4PRHA 4N8PA 2VXQA 1F90H 3ALWA 3B2UC 3L1OH 2BZDA 4FFYA 5D71H 4BH7B 5FECB 2J21A 5JW4R 3H55A 1SN0A 2ZUYA 3O3BB 3QQ3A 5CNHA 4Y4HA 3WFBL 5DZPA 1XD1A 2KQMA 2I7SA 5I24A 4QRPA 5BRZA 2DDQL 1T1YA 1FIGH 2OFQA 1JF1B 1RJZA 3BKML 4UOW0 2D7QA 2GTZB 3OHMB 1FL3B 2XWJA 2VXSH 3ASWA 2OW7A 3E7JA 2DQCL 2CRIA 3EOYG 3PAYA 3BP6A 4PD4J 5D1ZD 1OQOA 2F7PA 3L3HA 4MMXC 4PGBA 3CN1A 3B37A 2VRAA 4A2GA 2YBRB 2AJSH 5EZLA 5T1DH 3RTQC 5AB9A 4P3WA 1KEGH 3O2VL 1FAIH 1FZKB 1WIUA 4OM0L 2ZSVA 2X38A 3QH3B 3FQWB 35C8H 4N2EA 4YE0A 1F90L 3ULUE 2Y5EA 3AB0B 3OV6A 5D71L 1EEYB 4I0PA 4IOSD 4G42A 3BPLC 1CFNB 4PVMA 3UMNA 5HBBA 4LIQE 4YPGA 2UZYA 1AGEB 4XE0A 4OLEA 1WAEA 5DJXB 2FQFA 2AK4E 4PJFA 4ZFZA 5CGBA 4EI5C 2B8OT 1MXDA 2ORBH 4WWID 5HJDA 2M2DA 2QEJA 3IWUA 3KBPA 2YA2A 3BAYA 2R1XB 6TAAA 4DNLA 5C09A 2VXSL 4LHJB 4N6RB 1KV7A 1IARB 2HRPL 4N6QA 2G3XA 2VZOA 5F1SA 4HISA 5L2KB 5BRQA 2ZYIA 4PLNC 3G6JB 5I1HH 5ICXB 3U25A 1AIFA 3TVMD 2X1OA 2AJSL 3C6SA 1ZY9A 5JDSA 4DIXA 3HC4L 2OSXA 2VLKD 1IVTA 4DZBA 2ARJQ 2EYTB 4G9FA 4D9QE 1YMME 2DLHA 3PWVA 4BKSC 1S7XB 3IFOA 4C55A 1TETL 1MLBA 5KZCD 4W9EC 3W38A 3VXMD 5EIQA 4GQZA 4Y2LA 2Q8AH 3ZHLA 1DVTA 3PQYA 3FQRB 4XR8C 4U1KB 2F74A 1C5DA 3VXUB 5IR1B 1AZUA 1CGUA 3DUUB 1U33A 1FYTD 4HWZA 2Z1KA 4F7PB 4X6DF 4YJZL 5J13B 4KUZL 4R96A 3U36B 4Q97A 1VRSA 5EC2A 1XR8A 4QCIB 5AKSA 4P2OC 3CSTA 1KT2A 1GYVA 3BEVB 4R7DA 5L8KB 1TYEB 4JHUA 1HXMA 3O2WH 1F5WA 2XQYG 1NLBH 5B8CA 5HDWA 1EXUB 4HJUA 4M1DH 4WI0A 3G04B 4HIHB 1R5VA 4MJ5A 2V17H 4JM4L 3ZL4L 4YZFE 2OSWA 4TPRH 3PHAA 4X99B 1QRNA 4OKVA 3B2PA 3M07A 1WAAE 4NHCH 3WEAA 3GSWA 4FQXC 2EE2A 2F08A 1XH2A 2XPZA 4EUPG 1PJ9A 3BQUB 1RV6X 5KN5A 1AQKH 1GZHA 2OPCA 2XRAL 2C9SA 3R4RA 3VXRB 3W9EB 1IAIL 1T1WB 1ACYH 4U6YA 5D55A 2PTTB 3UADA 4JGUA 5AAPA 1M2VB 4NQVA 1D5MB 1IB5A 2P49B 1AD0B 1CE6A 4RZCA 1MCKA 4CL7A 2BCMA 3AREC 1N19A 1CDYA 5FA3B 2EXYC 3KYNA 1ML0A 2ITCA 3SDXF 1S3RA 3NZ8B 1XGQA 3TU6A 3KWUA 1JPST 4P4KD 3I9IA 3F84A 4QKXB 2GB2A 2O6PA 3MV8E 3WHXB 1WK0A 4PRPE 1T5WB 1QTPA 3ILDA 4CNIA 4YGVA 4H8QA 2QPDB 2X6AA 4POZC 5A43C 1S3KH 2WQ8A 2APXA 1MFCH 5LBSH 4WSGA 1AVAA 1YEDB 1NAMB 1UHVA 3UAJA 5FYJU 2H3KA 1X6LA 1Z66A 3KWWA 4R7XA 4D9RE 3LQZA 1AMXA 4LP4A 4FD0A 3BCFA 3ZRCC 2QBWA 2YAEA 1DQLH 4GRLC 1GYCA 1OALA 1LGVA 5EBMA 4ZMZA 1I7TB 1ES0B 1OARH 3MRPB 3MV7E 4G59C 4L3EA 2Q7AA 3VGEA 2V9QA 3VWJB 5EF3A 4DTGH 4PRHB 4YSEA 3OGCB 1BWWA 4KQ3H 1P84K 2GIXA 3TPKA 4JVUA 2ATKB 5LQBH 5DT1H 3KXFE 3VNYA 3SGEH 3ZKXC 1QO3A 1PNDA 3MCYA 4K3HA 1S3KL 2EXSA 4Y4HB 4A7GA 4CADA 4CVXA 1T2QL 2G4GA 5F1KC 3C6LA 2F53D 2JXMA 5LBSL 5GS2H 4RAVA 5IBUG 4OZIA 1T1YB 25C8H 4KJWC 1U95B 1F42A 1RJZB 2HKFL 3WELA 1COBA 2O4EA 2YAHA 1LE5A 4NO0B 3HE6C 5EMYA 5KG9A 4OCYH 1AHWB 1QW8A 15C8L 1NGPH 1VEPA 3NDZE 1FJ1A 1LL1A 1ULVA 4ZXBA 4CSTA 2CDGA 2CO7A 5D1XC 3FAWA 4JKWA 2IDUA 2ZSVB 3IDIB 5H8DA 1NMAL 1ETB1 4KQ3L 3IYLW 3WFCL 3MA7A 3ZO9A 3R19A 4TUJB 4BGLA 1QFWM 1NCHA 3ULUD 1T7YA 3SCMB 4KO5A 3ZPDA 3SY0A 1SHMA 3QCVH 4XB3A 2DM7A 4YK4B 3SE4A 5F9JB 2BSSB 5BZXA 4K71C 3SPIA 3TESA 2FVNA 3P30L 4L8CA 1T22B 4ZFZB 3T04D 3DX8A 5B1JC 2AK4D 1RAMA 3G5YB 1KB5L 4CBPA 1L6PA 3QJVB 4MLSA 2AQQA 5I15L 1J1XH 1FA4A 2VXTL 1TSHA 3CZJA 1A7RH 4APQB 3DTDA 4FQ1H 2UWEB 3GMRB 5K93A 5C07B 5JDSB 5A7EA 3ZJAA 3T0VA 1VPOL 4DZBB 4G9FB 1I8MB 1QA9B 1VFUA 1YUHA 2VE6A 3WO4C 5AW2B 5I6PA 3FO9B 1YMMD 1MPAH 4M7KH 3WEXA 2XTLA 2J1XA 4D9QD 3GNML 1MLBB 2JELL 3PDDA 5EBWA 3QCVL 3H2WA 2VLLA 3D3VA 3AGVA 2PWDA 1P9MA 3PQYB 4D94A 4JB9H 4BFNA 4M00A 1J9SA 5L9DH 1Q94A 4JGNA 1OCCB 3APNA 4LARL 4QRQA 5I30H 4F57L 3H3PH 3II1A 3MRJA 3CFBA 3AT0A 4KDTC 4JN1H 1H3WM 1I9RH 1KCSL 1WFIA 2C9XA 2QZQA 4FQ1L 3QO1A 2HWZH 4OIFA 4ALAH 4HIJB 3NSDA 1LE9A 4GKSB 5EZJA 1AR1C 4R7DB 4BGDA 2CSPA 1T1ZA 2DD8L 2VDQB 5F1IA 3N85H 4X5WA 2AZAA 3B7SA 3MODH 2J12B 2NYYC 3O6FD 2NUTA 4F33A 2ED8A 4HXBH 3VH8B 1RZFL 4M7KL 2RQ8A 3WY3A 4WI0B 3MJ7A 3O81A 1OD9A 4MJHA 3SDDA 3QDGD 2CG9X 1UKQA 4IBQA 5MI0B 4ELMA 3MRDA 4YBLC 2LU4A 3GSWB 5E23A 3SE6A 3ULUH 5AG9A 2OMZA 4GI6A 1CTMA 4DOHB 1PKQE 4KNUA 4P05A 5I30L 2B77A 4OZFA 1ZVSB 3OPUA 3NMEA 3X11A 3AWGA 5FHBL 1Z6JT 1PX8A 4IDLA 2JH2A 2ZICA 2HWZL 2ZYRA 4U6YB 3BWAA 1UTDA 1FP5A 3D8MA 4GBXC 4WW1A 5C6TH 3ZSTA 3H7BA 5T8IA 4RZCB 2ALWA 3D25B 3HA0A 2VUYA 3KYNB 2V2WA 2ZP0T 5E4OA 4XI5C 3HNTH 1V55B 3EDKA 4L4TE 2FHBA 2VDPB 1BZOA 1FLTX 1I85C 4H20H 1IAII 4CN6A 1MAJA 1ZLSH 1LDPH 4WKZA 4BK5C 5KOMC 3ULUL 3KGTA 3MV8D 5D1ZI 3OM3B 3IDMA 4PRPD 3D2TA 4YGVB 4P4RA 1JK9B 1XF2B 4LLQA 1PZ5A 4LIQL 3VFGH 1RSFA 2NDGA 5TDPA 1KXVC 3ISYA 1U58A 1ZE3H 3SY6A 4KI5F 4KRPD 1XIWA 4ZO9A 3VXQA 3EJYC 1XHHA 1QQDA 2H4EA 2EIDA 1CGXA 1CYXA 3LQZB 5HDBB 2PP9A 1BMGA 2JCCE 2PW1B 4GXVH 4NUGH 4DK3A 5HHME 4D9RD 3PDOB 5HHOE 3ARGA 1DVXA 3JZYA 4CILA 3HTLX 2X4RA 4AIEA 1IC5L 3L3OC 3Q48A 1E6OH 5LAXA 4X4XA 1R5WB 2ZG3A 3PWJB 4S0HA 2ZXWB 5I8OL 1LDPL 4Z3TA 1G6RH 4XNXL 4J4PC 3NIFB 5E6IC 4PRBA 3LKSA 43C9B 2WZ6A 4UYQA 2VISA 1H6EA 4X7TA 2XFXA 5I66B 5DWUH 2X1WL 4EN3D 1IKNC 4XNMB 3JUZA 3KXFD 5DJ8A 4IRSA 4R83A 1C7TA 1DL7L 3JWDC 1D5XA 3MJWA 2LHAA 1CXFA 2YZ1A 3GK8L 4RAVB 1FFOA 1OSPH 3FCSB 3ZDZE 3NFSH 1NEZA 5EWIL 2BPBA 1NC4D 4TNVF 4Q9BA 5DJAA 2BS71 1E9PB 2XVKA 5KG9B 2ITFA 3BVVA 3V4UH 5EU5A 1F86A 2X3BA 4TLKA 4DPAX 1DUYB 1FJ1B 4ZXBB 1SMOA 1K9TA 1NDGA 2CO7B 4HH8A 4W9FC 1MFEH 3Q2CA 3NSFA 3HLKA 4EF3A 3BLPX 4Q4EA 5I0ZA 1GW6A 4K9EC 3RWDB 1YEEL 3MOBH 2H8PB 3MBEC 1NCNA 1BG9A 3QWRA 43CAA 3VXSB 5JA8B 3BKCH 5A3IC 2C3GA 5T1KB 4NJ9H 4JDVA 2AJVH 4PW9A 2NZ9C 1CFVL 2FIKA 3D2UD 4HUMB 3TA3D 4PP2B 3B3IA 1YAZA 3GM0A 1CICA 4R2GC 4L8CB 4P57A 4XVUC 3L16A 3QULA 1FNEA 3ATEA 3LRHA 3FTGA 5BRPA 2DQHH 1J8KA 3LS4L 2JB5H 2VZVA 4M1CC 2JB6A 5J0BA 3QIUD 4MXVE 4WEEA 3FU5A 4AT6B 4NN5B 4UM9A 1U3HB 2E8YA 3Q3GB 3KYMA 4FTVA 5IMKA 4B50A 4HLZH 1FNHA 2H32B 1I75A 1MCFA 3LEYH 5ESVA 1YUHB 4UQ3A 3QDJE 1Z3GL 3I02A 2BIPA 3WEXB 1KZQA 1ZHLA 2YXFA 3BYTA 3BIKA 4IGBC 4JM0A 4P2YA 4X6DA 5J3HC 3TN0D 2AJVL 4W6XB 2VLLB 4QYAA 2XTJC 5H37A 3T6WA 3WXWH 4OZGA 3UZQA 1Q94B 3V6FA 3F6IA 4ODUB 1UGKA 5IW3A 2QR0A 4U1SA 3D85B 3MRJB 3DX3A 4TSCH 4QPEA 4PJBA 3NZHH 3VXPA 3CK0L 1IGML 3FB8B 1X5GA 2MCPH 4MB5A 5EZJB 1A02N 3CNKA 1F11A 3BP5B 1T1ZB 1H6UA 2ZXCA 1B3IA 3DHMA 4JRYD 5F1IB 2JIXD 5FV1L 3PGCB 3BGMB 3SPJA 4F33B 1WA1X 3ROOA 4GLRI 4A2EA 4DAGL 4Z5RA 1ETZA 3SDDB 1RFDL 1X7QB 2OTWB 2ZWKA 1B0RB 4YLBA 1YPZF 1GTNA 3AXIA 3WXWL 5FLVA 4OFVA 2DQIH 2UZIH 1MJJA 2XT1B 3B7TA 3O9WD 3T2NL 4OZFB 1TEGA 2PR9A 3QHZH 2DYPA 5ANHA 3X11B 1JJUA 5CM1A 3NZHL 3Q0HA 4RFOL 1QI4A 2UX7A 3BWAB 3HFFA 1UB5B 2AJYH 3LB6C 4U1NA 5D2NB 2MCPL 3CDCA 3TYGL 4WWKC 5EOTA 3H7BB 4XXCA 4B27A 4CDGC 3D06A 1MW2A 4J3UA 1NFDA 4PYGA 2ZJSL 4WK2B 2A6JA 4DGVH 3CSFA 5D5MA 3N41F 2OYLA 1AE6H 1QEXA 3MACL 2R4SH 4RRPG 3LHAA 3S4SA 3TNNB 3VFTA 4L4TD 3ML8A 4XVJH 1WBYA 3M1CA 4Z3JA 1ZRUA 4FMFA 1KIQA 3QAZB 4JFTA 4NNPH 5D6DA 2IBZY 1J18A 2UZIL 3IK2A 4P4RB 2FAUA 2PABA 3OR7A 4RGOL 4TS6A 4GG6A 4LLQB 3BKYH 1W2KT 1RP8A 1B4RA 5T3XE 1FNLA 1U58B 4NWTH 2LW3A 4MRBA 1QNZH 4D9LH 5CN2A 1SHSA 1ZA3A 2ZYSA 1I9JH 5D7IA 3D4ZA 2AJYL 3CZUB 4HCRH 2X4TA 3G9VA 3H6AA 4I77H 1K8IA 2KS0A 1EVUA 3ISWA 5AEAA 2RBLA 5SV4A 4HK0B 4BE6A 3HMWH 4JRLA 5J1TC 3HNVL 4NZUH 4YHNA 4Q74A 4Y8DC 5HHMD 5HHOD 1GW0A 4NOFA 4LHUG 3KDMB 4DGVL 1GGUA 5HI3C 2R4SL 3R7QA 2DI9A 4CW1A 5PAZA 4J6RH 4IIZA 1AKJA 2PPCA 2A74B 2ADIB 4ZAKC 4ELKB 3CXHK 3LEVH 2OBGA 3HC3H 2DS4A 4I48A 5F1OB 4X7TB 4D7BA 1QASA 3H7LA 1FNFA 4LKXA 1OT1A 3WDJA 4OUOA 2FBJL 1XFPA 2DKUA 1A1NB 1A4BA 1QNZL 4NQCE 4NXKA 5HGDB 3DVNA 2VKWA 3M17A 4MD0A 2VJ8A 2X2JA 3THML 3GO1H 1X5IA 3NJFA 4NO3A 3ZMRA 4ABVA 4F7EB 1F41A 4NZUL 3HE7C 3NCJL 5EU5B 1YNTF 4XC1L 4HG4J 1NDGB 1SVBA 3HI1A 3VFMB 2OP4L 1JZ6A 2J88H 4C56A 4J6RL 1YDPA 4BV1A 4XX1G 2MKWA 4K3EH 2F6AA 1QVOB 3LEVL 1YA5A 5DO2C 5CU5A 4MNGA 2VAJA 5IZ7A 43CAB 1TOXA 2CD0A 3WY4A 5C0JA 2WXIA 2B4CC 2DF3A 3GI9L 1KGIA 1JS4A 2FIKB 4TXVB 1RMFL 1CB4A 3GS0A 1S8DA 5KWYC 3GO1L 1CXLA 3FTGB 5JW5A 1NCGA 3C8DA 1AI1H 3I2CH 2W38A 5AVQB 4CC4C 4Y5YC 2EEDA 5ESAB 5FM8A 3WMQA 1KXTB 2Y3NA 1UD2A 2PO6C 5E4IA 4Z7IA 3JWOC 1PYWA 4JMXA 3V52H 3P0GB 3JYCA 1QZNA 2HLAB 4CJ0A 1AIZA 5D4IA 5SX5K 3B7UX 3O4LB 2BXYA 3QG6A 4NZRH 4HJEA 4XNZC 3E6FB 4X6DB 3MX0B 3BIKB 2C4XA 3BGFC 1NCAL 4QXTA 1JRHL 1ZANL 3N9GH 3FPYA 1CDIA 2FNWA 5IK3A 2CIKA 4HJJH 3L5IA 2J8UF 3DOIA 1H19A 5J9PB 1TSRA 1GOHA 3RL2B 4Y1AA 4B9JA 1PY9A 2CJ3A 3Q2NA 4U1SB 4G9DA 5C8JB 4XWGH 5HSFA 4NSKA 2D7TH 5EN2A 4E5XG 4PLJD 4Z0BH 3VXPB 1UXSB 4FNTA 2VAAA 5DQ9B 3UBFA 4A2MA 1F11B 5DUBB 3CC1A 4JDEB 5FO8B 1OD7A 3TONA 4NZRL 4WDIA 4DGWC 1AZVA 1QACA 4OFKA 1SDDA 3SQOH 3N9GL 4Q0XL 1OWWA 3QEQA 4FI7A 4AIOA 4L48A 1TYJA 4JK0D 3EOTH 4YZFF 2VLME 1ZPLA 4O2CA 3H2QA 2VR6A 3I6LD 2FBRA 3WL9B 2WUBH 1BYPA 1MJJB 1WAAF 1XCQB 2UY6B 1IGTA 3D48R 1JPEA 4GOSA 3SDXB 5GHWH 3QUMH 3I50H 3T4AA 1LO3L 1NBYA 1G0YR 4IDJL 4UMSA 4KO7A 4S0TD 3U0TA 3W82A 4AKQA 2NMSA 2J6WA 3IMRA 2E7DA 2D0HA 3D69A 5EOTB 3GMLB 3EO0A 5FUOH 1JE6A 1AAJA 1MI5B 2ZKHH 1IE4A 1MQKL 3F04A 4PJIE 3LHPH 1NFDB 1T6BX 3WAJA 3TZVC 2A6JB 2A3TA 1CF1A 4KAQH 3SQOL 3VFTB 4UT9H 3UEZA 5AD0B 1WBYB 3WOVA 1EQWA 4MA7L 3DBXA 4U6VH 3EOTL 2DMCA 3LPGA 1P0SE 1MCNA 4I18A 1YEWA 2WUBL 4DKAA 5EH1A 3FT4B 1C1EH 1PY4A 3FC8A 4O02B 3VUAA 3L5XH 1HS6A 3D0VB 3QUML 5IQ7H 4NZFA 2DI8A 3ECUA 4F7CA 1OT2A 1ZA3B 2CMRH 4NKDA 5T3XD 4LSSH 3H3BC 2ZCLL 1KGJA 4KGLA 4UINL 2X05A 4CKQA 5HHNA 1Q0XL 1K8IB 5FUOL 3VQLA 1JMXA 1OP4A 5FF6A 4LEOB 5GRZA 5F0MB 3QDHA 3WDIA 3LHPL 3OSKA 4UNIA 4FGMA 1Y18A 2R15A 2VQUA 4KAQL 4A66A 5F93C 4DQAA 1LHZA 4U6VL 3S37X 1N8ZA 2A83A 4PVLA 4JZOA 5DRWA 1P4IL 3C5JA 5A6IA 4I48B 5C7XH 1AJ7H 3DMMC 4ETQA 2Z8SA 1JVLA 5B39A 1U3JA 3TGXA 4ODBD 1AANA 1HEZA 1U8PA 2NSQA 4O9HH 1MWAH 2H26A 3O6KL 4L1TA 1J48A 3FRUA 4ZTPL 3ZR6A 1N2RB 4J8RA 1U8MA 3JTTB 2HKHH 4AY0A 3C08L 4HGKC 1GA2A 3M17B 1JZ7A 4ONGL 2X40A 4AQ1C 3O6LL 3FSVA 4NO3B 2RQEA 4PH8A 2K3TA 4AOFA 4OY9A 4BQBA 3CMOL 2Z8VC 4JUSA 3IXTA 4OGXL 4XT1C 4TSAH 5F7BA 1TQTA 3HI1B 3LXCA 1E4WL 1KLGB 1OP3K 4BZ2A 4C56B 4E9XA 2MFNA 3WFHB 2ZOTA 1TLKA 3KBEA 4QAWA 1A7OL 1QWHA 1A0QH 1AJ7L 2CHNA 4G70B 3IAGC 3NCXA 5EU4B 3RDTA 3RFZB 3S36X 3WEMA 5IEHA 1GJWA 3QJHB 4XMKL 2HKHL 4P2AA 2VC2H 3KPRA 1HCZA 3FCBA 2YZ8A 4MXWH 2ICWB 3FN3A 3WFZA 1Q38A 1YG9A 4HIIA 1FHGA 5H2BA 2QSQA 2X2YA 1CTOA 1NBVL 1ZHKA 2O26U 2VH5H 3NRFA 1BGXL 4PRNA 2V2XA 4UTAH 3GM8A 1ZSDB 4FLOA 3NYKA 1DQML 2FH8A 3L17A 4JQIL 4YNYA 3BX7C 5BZDA 5C0DB 4JO3L 2IC2A 4ZUTB 2B2XH 3I85A 5CJBA 1HYSC 5E5MA 4LZKA 1A0QL 4KK6D 4Y4KC 5C0BA 3QG6B 3V4VH 3VM7A 1NCBL 5CIPH 1AYOA 4LLDA 1YY8A 2NZ1A 1TQBB 2X2UA 3R0NA 2Y6TE 5IK3B 3TF7C 4RGNB 3NVQA 4JEGB 3B34A 2VC2L 2DQJH 1IGCH 4JDTH 3TX4A 1HH6B 3ZXAC 4C83A 1SBBA 1W8NA 4FA7B 2QADD 4Y1AB 2V9UA 1SRDA 2NXZD 4TM9A 5T3XL 1JRHI 2R39A 5EN2B 2W8CA 4UTAL 4XNQB 5KVMC 1DZBA 1B4LA 1HAWA 5SX5H 4OI8A 1NOAA 5BMFH 4YE4L 3F7YB 1CIUA 3QZWB 2E7CA 4PJ9A 4MCMA 4IBVA 1KWGA 2X4PA 3BE1L 1UT9A 4WDIB 3VCLA 4MSWA 3S5LA 4JLRA 3SQRA 3DC0A 3QZPA 4GP8B 2AQTA 4ZG1A 1MCJA 4KK5C 3DGDA 3QEQB 2OZ4H 4MJJA 1E5AA 4PD4K 4ABWA 1IQWH 2ICCA 3HZMA 4JRXB 2M1KA 4O2CB 1EERB 2NQ3A 5JHBA 2R9HC 1QFUH 3DVGA 4ZUWA 2GBTA 2VLMD 2WZAA 4JFFA 5KBMA 3T4YA 4DETA 2CLZA 4NRXA 3SOBH 2ZUQB 2B9AA 1BZEA 3OZ9H 4BDVB 1H3TA 3FU9A 1KN2L 1FVCA 1NBYB 4DCQA 2ZPKL 4XXWA 1IBYA 4G80A 4WI9A 3N6YA 4NQDA 4PJGE 5BCAA 1FFNB 2Z4TA 4UZGA 2OMNA 3FQUA 2DL2A 2BHZA 2VDOB 5IROC 1C5CH 1DFXA 5D72L 4GO6B 4HOXA 2XQ0A 2IH1A 2AKRA 1K72A 3PWPE 1D9KD 5GRUH 3KLKA 1BAWA 4NBYB 2FEJA 4Y9GA 4ZD3L 4UNUA 3KYKH 2Z3FA 1XGZA 3OVUB 4I18B 3WTXA 3L9EA 5CD3B 2IV9A 1F8TL 1A25A 1HL9A 1T21A 4IKKA 5I8EA 3H4HA 3OZ9L 4LU5H 5HVGB 1J0JA 5CN3A 2H6PB 1JF6A 1I1CA 3OQ3B 2CO1A 2R1YB 2WXOA 4Y16D 1MDAA 1TNNA 1TQUA 3P3TA 5K1VA 3V6ZA 1JGLL 4FQ2L 2R0KH 1G9NC 2GABA 2X6UA 2QMKA 4N2HA 4AYID 1W72H 2NY3D 2JCCF 3K81A 4HWEH 1T4KB 4HJ1A 1OSZB 1Y18B 4BQ8A 1FYHB 4HD9A 3T0BA 5ANMA 4KHTL 4LNVA 4YZWA 3C5ZB 2BSEA 1KIUA 1N8ZB 3NESA 4JZOB 2PYEA 4JFEA 4LVNB 3RY6A 2PCPB 2R2BB 2DZEA 1I1AA 3WJJA 1WCBA 4ETQB 1ROWA 3HRZA 1EGJH 1TJGH 3KM2A 4M7LT 2EEXA 5B39B 5EU7C 1U8PB 1A8JH 2ESVB 3B9EA 2H26B 4H8UA 4K73A 3FRUB 5BO1L 2J20A 4J8RB 2P45B 3MLXH 3QBTB 4NQXB 5DMYA 1YVLA 4AQEA 4DFHA 1OANA 3ZDZF 2EO9A 5FDWA 1G4RA 5J13C 4PUBL 4UQCA 3B9KB 1W72L 2BS8A 3IXTB 1RIVL 4ZFGL 1U2CA 3N44B 4MQXC 2YAMA 5KYXA 1U6AH 2E7LC 2GJ6B 4XMXA 4QRRE 5SWQA 1I7ZB 4TYUA 3WKMH 2BNRE 2DQEL 4HIXL 1J0IA 2BP8A 3RDTB 3PXLA 4LSUH 3KPSA 4L5FH 1NGZA 2P8MB 1UD5A 5IEHB 3UBGA 3OKKB 2ADJB 3BQUC 4HUWA 4G7RB 1HHIA 2VLKB 1O9ZA 2GYSA 4P5KB 1NCJA 4Q8BA 3WNMA 3EJPA 4R0LA 2WTOA 3EYFB 3W5NA 1ZHKB 3MGTB 3VH8G 1SEQH 4FQQA 4JUTA 1B0WA 5I17A 3M1BA 5TDNB 3P4OA 4AZUA 2B20A 1QFWH 1U6AL 1UM4H 2J8UA 2YSTA 3FT2A 4HEME 4MXVF 5DVNA 3VI4E 2CXKA 2Q86A 3BUYA 3L6FA 5E5MB 1N5YH 1HI6B 2FIRT 4GG8B 5I1DA 4S1RL 1FYTB 2I07A 3ARSA 4UTCA 4LLYA 2SEBA 2CGZA 2IAMA 4LLDB 3QI9B 4GH7B 5DMGC 5D7JD 2XCMC 4DH2A 2RFXA 4DVRH 4EAEA 3WSQH 1IC4L 1SPDA 1ZHBA 2VXVL 2IADB 1Q0YL 3ES6A 3QRLA 5KBNC 1AHMA 2IXQA 2GC7C 2JKIS 4DKDC 3VW3H 3OKYA 2Y1VA 3INUH 1SEQL 4F9PA 1LMKA 2HX7A 1OGAB 3DK0A 4UIMA 4AGMA 2WB7A 1YPZB 1MAML 4X9FA 2H47C 2N0KA 5DC4B 4CN1A 4KKZA 5GISH 4FNSA 3SE8L 1N5YL 5E8DL 5LCVL 3VCLB 3KL3A 4MSWB 5DJCB 3S5LB 1N0LB 3VWJC 2RAMA 1YY9D 4D0CB 5IEKA 1RIHL 2VW6A 4G6MH 3FO1A 2ZKMX 2EYRA 2XVLA 3KJ6L 3DVGB 4PRIE 4Y4HC 3T4YB 5KS9E 1J7VR 3DOSA 3LNHA 2H1XA 2B7DT 2CLZB 1V3KA 4XHQA 3CVBA 3WFEL 2EABA 4HOMA 3MJ8B 2WBJD 3NSCA 3BDBA 3C75A 1NJ9B 3U7WH 1KY7A 3INUL 3AUVA 2EDDA 1NCCL 4WUUE 4P4KB 5H94B 3IU4H 4G80B 3UBXI 3FU3A 3F8UB 5LG1A 4YC2B 3FO0L 3INOA 1AHWC 5GISL 3PHQA 3V5HA 2HFGL 4AXWA 4N28A 1IKFL 4ZK8A 3MLSL 1IBDA 2AXGB 3FN9A 4GY4A 5EU3A 3LIZH 3UFIA 4MJIA 4AK1A 1I9IH 2F7RA 1TIUA 3ZRSA 3K6OA 1KPVA 4OAWB 4MYWB 1CFQA 1VJSA 2J5WA 4EZLA 3PWPD 4OI9A 4G6ML 3RE0A 3APFA 1CYGA 1HSBA 3MNMA 3ZQXA 4GW5A 3E38A 1T03L 3NFPB 4GAAA 2R2EA 3RILA 1KIPA 3NFNB 2ZWSA 4W1TA 3FOLA 5I8EB 2J43A 5DZJA 5E1IA 1N26A 1SYVB 3CDYA 3CH1A 5E5LA 3V0JA 2I5YL 1NL0H 2FJFA 4P46D 3SPVB 1A6AB 4TLTA 5IV2A 2DI7A 1G5AA 3R18A 3ZSSA 3UJJL 5BW7A 5JHLA 3QRGL 12E8L 1BVNP 5LBVA 4APQC 1M7IA 1L9RA 1VGEL 4U3HA 4X7FC 3X2QB 3WMSA 1ORQA 3BWUC 4FFVC 4XNUL 1BM3H 4TQPA 5ITBH 4JO4H 5ANMB 3ZE1B 3KMDA 4KVNL 4MA3A 4I87A 1DJZA 1BZQK 2PYEB 3BC9A 3ZT6A 3RLSA 4B6ZA 4ANWA 1ZT4A 5JHMA 2WLYA 5GGTH 5FWQA 1B6DA 3P54A 4HHGA 4EDWH 5DYFA 3MJ6A 5EZIL 4RSYA 2W9DL 4ZTOL 1PS3A 2WHVA 4GRWH 1DQJA 4LXFA 3LCYA 4U3SA 4ZFQA 5LWYL 1JZGA 5I6XC 1CXEA 4AQEB 4F15B 5AOIA 2G9HA 2UXGA 1CCZA 5KVEE 1UXLA 1OAYL 2OI9C 1U2HA 3B7RL 1G7LB 5E9DA 1INEH 3RZWA 5D7LE 1YYLH 3V4PH 4HUUA 4KFZC 1OHQA 3B2UD 3FH7A 4TSBH 3UO1L 5HDQL 4JRFA 3S9DB 2AK4B 4QRRD 1IEBA 2X9YA 5JIPA 2JI1A 3BAEH 2BSBA 1UVQA 1WE5A 2BNRD 5GGTL 2HLEB 2BP8B 5MI0C 3PNWA 3Q44A 3DSFH 1BZ9A 2E8ZA 1NGZB 3KPSB 1Q1JH 4OVUA 1RURH 1YQ2A 1MFNA 3QZLA 5GZND 1D7BA 4JG1H 1DQTA 4HUWB 4LEXH 4B5ZA 1HHIB 3VD9A 4P2RB 4N86A 3VRIA 5HI5C 1V54B 3QXVA 1SXSA 3GLZA 5GRVK 3L1GA 3RAJH 1RZ7H 3EBAA 3G5XB 5D1XE 4FQQB 5F0JB 3RTQD 3CDGA 4XP1H 3NCMA 5KJ4A 4JX0A 4YDIL 4M7JL 4XMPH 1YYLL 2E7BA 2J8UB 3AW5A 1A2YB 2RD0A 2WKOF 2YPVA 3D33A 3FT2B 5I76B 3QFJA 4C57C 1WIOA 1T3FB 3WEOA 3DXAE 2DWDA 1MZZA 3MV9E 1N10A 1V7MH 4IRZL 4FQJL 3JV5A 1LNUB 4UQEA 3GSUB 3VFVA 5F97E 1QUNA 3IFNL 4M93C 1CR9H 2DQUL 1Q1JL 4H1LG 2P7TB 1MWOA 5EA0L 4EI5D 1PFCA 4HHAB 4JO1L 4JG1L 2RFXB 5EC1A 4LEXL 1WEJH 1CGVA 5KVGE 3AG1B 4QIRA 4MVBD 1NPUA 4YDVA 1DSYA 2ZKXA 5EIIA 2IQAA 4KUCD 6FABH 4PJHF 4GPVA 1YEJH 4XP1L 2ISDA 1CBVH 4GMSL 4XMPL 4OIAA 2IOMA 3T77A 3US1A 5EDSA 4AGOA 2WAQA 3FHQA 3SKJH 2D7PA 5AW8B 1K2DA 3UEQA 4J1UA 4WI7A 1DEEB 2CKBA 3FUDA 1DJHA 3X3GH 1ERNA 3ZKSD 5DC2A 5CLZA 2J25A 5BS0E 2YKLH 4HDIA 4DUXA 1P1VA 1WC7B 3HB3B 4ADIA 1KB3A 1I1YB 4Z78B 1O7SA 1VKXA 3FB5A 2F58H 1JI1A 3FO1B 4GNKB 2EYRB 4UTBH 1G7QB 5DCCA 4ZO7A 1EAPA 1E6JH 3VD3A 4LESA 1DBJH 3H9HB 3K7UA 3V95A 2Z0BA 1L4IA 4PRID 3X1BA 4A6YH 1CO1A 4K55A 1L3NA 2XA8H 5JLZA 3N1PC 2KLTA 4P2OD 4UOZA 3GMNA 1VLXA 1XGRA 4N90E 3T2QA 5ICYB 2WUCL 2FQGA 3SKJL 3LNIA 2YARA 5DD6B 5ENWA 4AXWB 1C8PA 4ZXBC 3KGUA 1VFBA 2IQ9L 4PRPB 3SGJA 2R0LL 5GS0D 2DLTA 4ODXB 5EU3B 4LPUA 3VB8A 4G8EA 3TYFA 5DZOA 1KPVB 3D18B 4NDMB 3U0PB 3W57A 3N5AA 4G8GE 4A7TA 1JXFA 5FUCC 4FQXD 1E8YA 5E2WL 3GDCA 3V0DA 2FO1A 1IAKA 1YUKB 4GW5B 1DBJL 2DPKA 5EUKA 5IB3B 1NFIA 1GY2A 1CT8A 5CGMA 1HXKA 4PLKC 3VRLE 4G6KH 4Y2DA 5FYKE 5HJ3A 3TBBA 4ISVA 4U1MA 2IPTL 2WY3B 1J5IA 2BC4A 3MV7B 5IV2B 1FGVL 1ID2A 4R26L 4ANUA 3ARED 3C8KA 5I2IA 2K7PA 2EXYD 1ILSA 1PW3A 3CLFL 1E5BA 4R5XA 4NN5C 5D70H 1WTGT 3MLZH 3WKNA 1XH0A 4HX1B 4BZYA 1ORQB 5J5EA 1S5IH 4FLHA 1OY3B 2XWTA 1QSEE 2HFFA 1PX3A 4BHUI 3NJIA 2O5XH 4L1BA 4HKJA 5CGYC 2HPOA 5JUEH 5I9QC 1O6TA 1S7RA 5EORL 1YZZA 1KN4L 4H0HB 3NABH 1ESOA 5B4MC 4P2QE 1H3PH 4LSDA 4BH8B 4ABQA 3LZNA 3AU1B 4PJAE 5L6YH 1T0MA 1P9MC 4K4KA 2IBZX 5DJ2A 5IQMA 4FEIA 1P6FA 4FNPA 5F7EH 1DQJB 3FFDB 3NCYS 4L8BB 2GIMA 1PNCA 1BBDL 4GRLD 2DEXX 5DWPA 5FAAA 3GPSA 3MLZL 1P53A 3HS8A 1T66C 4H0GA 1C8QA 2WLIA 3NJGA 4IMLB 1TQVA 3RJDA 3UX9B 3HG1A 2O5XL 3K2MC 3KPPA 3QW9A 3LY6A 5D7LD 4YHPA 4Y5XA 5GS0H 3S8GB 4J3BA 2ILLA 5IHZB 3EO1A 4OZHA 2WLMA 1BJ1J 2DBLH 2OMYA 3BAJA 4KHXL 3SDDC 4V11A 2BVPB 1FG2A 3X12B 5L6YL 3KEDA 1BZ9B 2YLHA 5KTEH 2R7EB 1JIBA 4WO4A 5DTFA 4KJWD 5EULV 1UA3A 5HVWA 4ZW3A 1S9KC 4XO5A 5C0CA 4OD1L 5EO9A 3GBEA 5FCUL 3FFOA 3FBKA 2VSCA 3HE6D 3ULAB 1TKWB 2CLVA 5AB1A 2Z8RA 4DEPB 3R1GL 1FH5L 2GK0A 4ZQTA 3D07A 2EJ1A 2E75C 1KG0A 3X1FA 1ZWIB 3RWGB 5I76A 3GUTB 2J1KA 5D1XD 4P9HC 1QKZH 1UD6A 4EEEA 2UXTA 3BZEB 3UPCA 2DH3A 3V0HA 4ANXA 5GZOC 4XH2A 3SKOB 3QFJB 3WGVB 5GS0L 3BRGC 2L7UA 2AXFB 2DM4A 2F54E 2DBLL 4LRNH 4OLXH 3LRSB 3DXAD 4PMEA 5T1JA 1CGSH 3BT0A 3WAKA 5HGHA 3JXAA 3MV9D 4OF7A 2K8QA 3QAZC 1JTPA 3IFLL 3I3EA 3QO0B 4G1EB 2K6WA 5IFAL 5A40E 1FZMB 2V5MA 1MLCB 4WV1B 2DN7A 3BAWA 4TULL 4YFDB 1LP9F 4TRPL 1B6UA 2IIJA 3IEAA 2XKUA 1IMHC 1B2WH 1JZ5A 5EIIB 2IQAB 1FG9C 2CRMA 3QZBA 5B38G 4PTUB 1T6WA 3Q43A 3GYRA 3GZPA 2N4IA 1HIML 4NYLA 1LWHA 1FL6A 3RWIA 3WIHA 5I26A 2WIMA 3MPCA 2FGWH 3ISRA 2NXYB 3ARGC 5EEVA 4NQEB 4F92B 3BSHA 4XOEA 1GZPB 1DQKA 2CKBB 3D52A 4QYOA 3QJZA 4XO3A 1U8HB 5JDJA 2UY7B 2XZCH 2XX0A 3OMZA 4H0LC 4XN8A 3QNFA 2XTJE 1PKQB 1OQXA 1HDMA 5FGRA 5BS0D 1MREH 3AU0A 3GS7A 2K70A 1UH3A 4TF4A 3SD2A 5T1LD 4E9WA 3DROA 1KDJA 3S5ZA 5E6UB 4DVBB 4GW4B 4AV5A 4IIQA 4J5VA 5K9KA 1C16A 4M56A 1KCUH 5G5DA 2AAVA 3UTQB 3HG4A 4KFMA 3ARBA 1SGKA 2CRYA 3SDCB 1A6ZB 4OJEH 3IGFA 4L4VA 3QDME 1E42A 1IBGL 1O75A 1WBZA 1E3XA 1TJHL 4IS6A 3MR9A 4N90D 3FSAA 1SXBA 2CE6A 2NYYD 1UCBL 2WQWA 3CHQA 5D8JL 4RA3A 4HGWA 2WYZA 1XO8A 4LDCA 4TQIA 5T5NG 4AGPA 5KVEL 3ET9F 3EJRA 1GR7A 3F7RA 3QGVA 4G8GD 2XVGA 1CTNA 4V1DB 2P48B 3TBWB 2Z93A 4HV8A 5CMAB 4JO2H 5EU6A 5EUKB 3LN9A 4PN6A 1KCUL 2BOCB 2NYZA 4BQ6A 2JCCB 3QA3A 4JFOA 2PCFB 3B56A 3MUHL 4NCC1 1CICC 1OGSA 4QRAA 3S98A 5HJ3B 2HRHA 1PAZA 3DSNB 3BN3B 4GBXD 4U1MB 5FYKD 3QCUH 1U8QA 4AJWA 5KVGH 4I1NB 3NJXA 5I2IB 2DYRB 2R29A 1JVKA 4IK6A 1GYUA 4DW2H 3MCKA 4XI5D 1J1OL 4FG0A 2HFEB 2XIDA 4B3VA 3NP3A 2HFFB 3IXAA 1QSED 1XVSA 3EGXA 4DN4H 4S2SA 1S7RB 4NJAH 2JI3A 4P5TA 5DMKA 3MXVH 5FGCE 3ZDZB 4Z3IA 2ADGA 5F1NA 1X4ZA 4QRFA 1MCEA 2HP4A 2XI9A 4MS8C 5LDUA 3LDBB 4P2QD 1JZHA 1WT5A 1Z5LA 3EJYD 5DJ2B 4W9KC 3V6OA 1MJUL 3QCUL 4LSQH 5KVGL 3JT0A 5BVPH 5GXBB 4YDJB 1EDHA 4DW2L 4EUPH 3MRGA 3ARDA 1G7HB 1YRKA 1NICA 2Y06H 1DDTA 2X0WA 3CIQA 4KQ4L 1EXHA 1FZOA 1DJXA 4ZMVA 4KNSA 2EH7H 4DN4L 1UADC 4YDMA 4J4PD 1LMIA 3TPUA 5E6ID 4YHPB 4BUGA 4X6EA 2VDML 3EO1B 2DEYX 2R0ZH 4IRJA 2OMYB 5F21B 1WFTA 1UWXK 3QORB 3E6HA 2ZAHA 2JSFA 4F1SA 1M05A 3GJFA 4HKZB 4XWOC 4KZDH 5DTFB 3L54A 3LZFH 1XSIA 3G6AB 3VB9A 5C0NC 3DPBA 5HYJB 3DO4A 4I3RH 3RKDC 4A2DA 4P5RA 5C9KA 4M8RA 2YOCA 1SBSL 4CAGA 3QZWG 2WZPA 4FYQA 5JQ6H 1K8DA 2OL3H 1YMHA 4G43A 2Y06L 1R47A 3QT2A 2WLKA 4KJPC 3QDJB 3V8CA 3IMSA 4MYPA 5C97A 1GYWA 2WTRA 1QSFA 3NPSB 4Z7NE 4XXCC 5HHPA 5T33H 3CTTA 4XH2B 5CZVH 5J6GA 4WFHE 2JKTM 1T6VN 3MBED 3OF6D 2FR4A 1CMOA 3ZE0F 3QCTH 1D5RA 3LS5H 3VI4F 2X4NB 4HIPA 3SPHA 4AYFA 5A3ID 1KGYE 4DP4X 4XBPB 3BWSA 5HGHB 2F54D 3HJ0A 4DEWA 1VESA 3CN2A 5D6DC 3LEXA 2GBUA 5K1NA 4KY1H 1IEHA 1YJDC 4R2GD 3H9YA 4AJ0A 5F7MC 4ZX3A 4TVSa 1VERA 4YFLI 4W6YB 3QXAB 5HGAA 4YHZL 2FRGP 2NR6D 5I1IL 2XPGA 3P9WB 2CLRA 5C6PB 4XVTH 2XNAA 4NGHL 1HJBC 1F4HA 1UA6H 1GS7A 2Q5BA 3ULVH 4KUCF 2LTQB 2WCGA 2WWOA 3OKEB 5FYKL 3IJYB 2VR7A 4MB1A 1G1CA 2Z6FA 1UQSB 1E4HA 1EFXD 2FL5A 3KYAA 3VXOA 4GUQA 3F64A 3FDWA 4R4NC 5CZVL 1IGJB 2FHCA 4HVBA 1HNGA 3FCTA 2IGFH 4QYOB 1E4JA 3LS5L 5AYUH 1FNAA 3QIWD 3QR1A 4KH9A 5J3HD 4IGBD 1FLRL 2AAAA 1CD1A 3KWVA 1A9EA 1HDMB 2P8PB 2XTJD 2AV7B 1GC1C 4KY1L 4L3AA 4BCZA 1RZKC 4NWUH 1XEDA 5J11B 4KPHH 4PV8B 4M48L 3SGKA 5BV7C 4YHKH 3PAUA 3K80A 5DGRA 3U4BL 1C16B 2FUTA 4XVTL 4ENEC 1J0KA 4OSUH 1HXYB 1UA6L 1GGYA 3UJTH 4X4YB 3ARBB 3UP6A 5HVFB 5KS9F 2VYRE 2BNUA 1EO8L 3HZYA 3QHFH 4IBTA 1PG7W 7CGTA 3KPLA 3KW8A 2ZKWA 4UAOC 4F5CE 3QDMD 2Q10A 3VFPA 5DRZA 2GBAA 3MRQA 3VXNB 5ACLA 1NC2D 3B9AA 2P52A 4JFXA 4DPBX 2WTPA 1WFOA 3AY4A 4FNRA 1R19A 3I9GH 2X89D 3DNKA 4OBRA 3OB0H 3BDYL 4B95C 3H9SE 5GGQH 2VCOA 2JKSA 3EJSA 4J3VA 5C3LD 4NWUL 2B08A 3FFCE 3CFIC 1MCQA 4KPHL 3CXDL 2X3AA 1CLYH 3O45B 4X7SL 3ATAA 3DUSA 5CZXD 3QNZA 3RFZC 3G6DH 5EU6B 2BNQA 3CZLA 3LKQB 3JWDL 5B22A 2BVQA 2P5WE 3HN8A 4KZCA 4OSUL 3QWOA 3UJTL 2ZUUA 3TCXA 3FB6B 5CD5C 1OF2A 4Y7MA 3SODB 4FI6A 3LB6D 4FZEH 3DYOA 3Q1SL 5CHNA 4Z7UE 1WA2X 5IW1A 2Z31A 2E74C 3OKDA 3PY9A 4S1SL 4WWKD 3ECBB 1NFAA 4NQUA 4YAQB 5IW6B 4JS7A 1B3JA 4K9JA 4A1RA 3MCKB 1CFTA 5BPPA 1A1MA 1TTAA 2IANB 4G72B 5B38A 2AQSA 5IHHA 2VDNH 5GGQL 3IXAB 4ZFFB 1PIFA 1JD9A 1D5IL 1PZAA 2IFFH 3HS0A 4S2SB 5FW7A 3GB7A 1G9EA 1CLYL 4NQCB 2HVKA 4PG2C 4P5TB 5DMKB 4H8WC 1TFHA 3G6DL 5C7ZA 5F1NB 1F02I 3PP3H 2OJZH 2LAGB 3L2LA 2RTTA 4P06A 4NLHA 5ISZA 1R9FA 4G3YH 3QJFB 4MGXA 4MNQA 2A38A 3LH2L 4RFNB 4X6CE 3GSOA 4M61B 3PUUA 4PBXA 4WFFE 1ZGLP 5I0YA 1I3UA 1MFVA 3C2SA 3TBTA 5EOCJ 3TH4T 3AG4B 3CN3A 4B9KC 3ARDB 1X5MA 3TJEL 5HI3D 1EBAA 3HI5L 5DJZA 1WGOA 2BERA 4ZDHB 1CZ8L 1KCKA 2K45A 1FZOB 4NUMA 4UYPA 4XP4H 1HJCA 5F9OH 4QRBA 4ZAKD 4X6EB 2I9LA 4XX1E 2YGPA 1TITA 4PV1C 1E0OB 4QLRA 4F24A 3E6HB 1U8KB 3ESOA 5GJTH 4TV3A 1JWSA 4X7DC 2FLBT 3ESUF 3CU1A 2KZWA 3MCLH 3ARYA 2IF7A 3QDAA 3UTSB 3X3FL 5JR1L 5SWZE 4Z77A 4MD5A 3KLHC 4M8VA 3UZVB 2X09A 3EFFB 2WVVB 3ROLB 3T4AC 3L3GB 3HE7D 3HAEA 2LV4A 4N0UA 2OJ1A 4MA1B 4XGZA 4NI3A 4EIBA 3OLDA 5CU9A 4G43B 2BHUA 3VVVA 4UWQB 2ZOWA 4W9HC 1QSFB 4UBDC 4XP4L 2F8IA 5F9OL 2FWLB 1PZ3A 4KXBA 2F8XC 5J6GB 3DTXA 5DO2D 2YC1A 2FR4B 1PLBA 3P3UA 1KXQA 5IB5B 1S9VB 4G7YL 2VN5A 4IKNA 3WUWA 2XTSA 4UNVA 1BHGA 2ZXGA 2XQBH 4PJHB 5FKAA 4B7LA 1KJMB 4X6BB 3T0WA 4I18C 2JK5A 3GIZL 3RY5A 3TT1H 1ZIAA 3HHMA 1BVLA 3JT2A 1A3RH 3AZUA 3L7EA 4MAUH 5EPMB 3U46A 4UT7H 1AACA 2BSDA 4H25B 3L3KB 2CLRB 1INQB 3RVTC 1JDAA 1PJWA 2PO6D 4DT2A 5CJXA 3FZUC 2XG4A 3FU6A 1AZBA 1GGCH 4C4BA 1QFPA 2WQXA 1NM9A 4GAFB 4EPSA 4UDTA 1FO0H 4XVSL 2K6YA 1DFBH 3OXRB 5IQ9A 4XPGL 3FCTB 2ZCKH 2DEWX 1IC0A 5CJQH 1OAKL 1QHPA 2XQBL 2Z7ZA 3BZFB 4Y5VA 4WI8A 3WD5H 2YBGA 2ZWYA 3FO2A 4ZMAT 1U8OA 4LVNC 5IQNA 3ETBJ 4NKMA 3VYNA 2HN7A 2WYIA 4YBQC 3LQAH 5EF2A 1EDYA 1XGUB 1YYCA 4UT7L 2W9LA 2C1PB 3IRPX 4Z7OF 2AITA 1WZMA 5GSRB 3I75A 2YHGA 4N2CA 1IGYA 4Q6KA 1R75A 5HHVH 2BSRA 1JGEA 5DLML 4BWWA 4A7SA 1FO0L 5DRZB 1DQDL 3KPOA 3MRQB 4ZSOE 3H85A 5JQHC 1TPXB 4J6IA 1DR9A 5HI4D 2F5AH 4MHHG 4N20A 5B21A 1A47A 5E03A 3V0IA 3D4GA 5E9NA 4IHBA 5E8PB 3WD5L 1SQ2N 4GUPA 3MHZA 1DVQA 3H9SD 3BZDA 1HHGA 1IC7H 2NPLX 4M6MH 3KLLA 4IOFC 3FFCD 3RDTC 1P6AB 3L95B 3V0VB 5JOFB 1P7KB 2HG5B 4OB5L 1FRGL 5J4MA 1HQ4B 4L9LA 1IL1A 5CEYA 3QWOB 5I73C 2VLJA 4LBAA 1UKTA 4N8VA 3D0AA 2F61A 3HBGA 1ZS2A 9PCYA 4P9MH 2Z31B 4H13C 3TO2A 3VRLF 2QVFB 3CDZB 4O5LH 2CR0A 4PJ8B 1ADQH 3PWLA 4QXWA 3GMOA 3MUUA 1R3LA 4EO5A 1XGPA 2MCMA 3U82B 4ZMQA 3MBWA 3EH3B 2VL5B 1MFAH 2ARJB 4AMWA 1DLHA 5AALA 3K2UL 2VQ4A 3JV6B 4N3TA 1GHFH 2Y36L 3GXPA 3HEIB 4LHUD 4CVWA 1WRFA 2J7LA 5CFAA 2ZSWA 2B4CL 1AY1L 3ERXA 3B5TA 1OP5H 1ZCRA 1X5LA 2ZF8A 2FATL 5ISZB 2B16A 4XPTH 4MNQB 2W5PA 3QJSB 4YQXL 4O58H 2G3MA 2K3HA 1ZLDA 4PEEA 2WN3A 4LOEA 4PJAF 3GSOB 5L2KE 4WI6A 4EXKA 3T0EB 1RUAH 5BZWA 2GJZB 3DO7A 5DVMA 4YXKH 4OF0A 1KELH 3MV11 1KCBA 2D3JA 4WFFD 2V5TA 5GRJL 3ZTEA 4UILL 4JZJB 4N9GA 3EYQC 3JWOL 3LKPB 4OQ1A 4RMRA 2D2OA 1TZIA 1WD9A 2D0GA 4WU5A 1IGFH 4ORGB 4PJ9C 1J11A 2RB8A 4WUKH 2VLRB 3QHTC 1OZUA 1GHFL 3EJQA 2P26A 4ZX6A 2C9UA 3N42F 1KCRH 4Y19D 5EU7E 2I9LB 3DMMD 4JJHA 3VXUE 2J6EH 2OXHB 5D1ZA 4LCCB 3QG7H 4X0NA 1OAQH 4GSDL 3NACH 2C3WA 3WG7B 4I4WA 4OLWH 3ZDXB 3A0OA 3KLAA 1CGYA 4LDLB 4FQHB 4X80L 4TUKL 5DEFA 4N26A 4UB0L 4Z77B 2MOQA 3V79C 2VN4A 5SWZD 2WVTA 3HAEB 4A2FA 4IOSA 4UAHA 4XXWC 2W60B 5JZ7C 2G2NA 1JV5A 2QT6A 1V7NH 3ARRA 5F7DB 4YC2C 2FHFA 1RZGA 1KUMA 4A55A 1BYOA 4WUKL 5LGYA 2VT0A 3RP1A 3UDWA 4FADA 2YEQA 3EDEA 2XZZA 4HWBH 3ZZLA 2H3NA 3DTXB 3DX9B 4M7ZC 3PJSA 1LP9B 1B9KA 2YC1B 2B0SH 2DBJA 1XF4A 4IKLA 5A2FA 2XWDA 5FKAB 4M8UA 4N2KA 5D9SB 4X4KA 2WC7A 3BVNA 1XCWA 2HJFA 5IHUH 4IU2B 1KLUA 1IGIH 4HPHA 1ND0A 1D7CA 3VXRE 3L7EB 3WN6A 4CN4A 2CIIA 4ODWA 1VGKB 2BOBA 4AIZB 1TFPA 3LV3B 2WIIA 2AJ3B 1GGBL 3DX2A 3MUGA 1JPSL 1G9MH 4LPVA 2ZNWA 4G7SB 4ZFOL 2MEJB 4KK9D 3OAUL 5C0EB 5I8KL 1MNNA 4K7PX 4YX2H 2VDLH 3VXMA 5EUOF 2XWBA 1ITBB 4LE8A 3SBRA 3N91A 1IU1A 1NH6A 1A6PA 1OGTB 1NSNH 5LBSA 2EKSA 1ZLUK 2TSAA 3BH9A 4Y4KD 5C08A 3STBA 5B7EA 3U48A 3PF2A 5IG7A 1Q9WA 2YMXL 4JPWL 4KZ0A 4RFEB 3D1MC 5AZUA 3S35H 4MDJA 4HWUA 4RBPH 2WBJB 5D7EA 2NTFA 5HVHC 5E56A 3RL1A 1KPRB 3FO2B 1U8OB 1D6EB 4NKIL 2ZUSA 3MLTB 4K8RH 3S97C 3E8UH 4ENZA 2PPEA 4NC0B 3WJJC 1E9QB 3VFWB 3HRZC 3QWNA 1H6TA 3TBYA 4JRWA 3CVHH 5IMMB 1UT1A 2OR9L 1CD0A 1MVUB 1Q9LA 5C0AA 1IGYB 1G9ML 2ZX7A 4N0FB 1NUDA 2GCYA 3CX5J 1BCIA 2BVOA 2BRQA 2WINA 2CHWA 2F8VA 1ILUA 3L7FA 1IQDB 1AGBB 5I74B 2CM6A 4F2MA 3W1ZA 3NBNA 1SLWA 3S3SA 1NSNL 2XYCA 3A4EA 4OI7A 1FIEA 2DTMH 3TCLA 3RWFA 4PRHE 4U1LA 3S35L 1IBFA 2YA0A 5ICZA 2EQDA 1W0VB 4XB8A 3FTSA 1RK1B 3AS3A 3QJRB 4KK5D 4QO1A 1AQMA 2WBXA 1A4JA 4GUPB 4HBQA 1HHGB 2J56A 3RWHA 3DV6B 2R9HD 3ZDWA 4U1JB 5E8NB 1QLEH 4HKXA 3ASOB 4ODHL 3K1KC 2EC8A 2WXQA 3CVHL 1IL1B 1PQZA 3LZLA 5IQLA 1SDYA 3MJ9H 2VLJB 3TJPA 3O41B 3SDYH 3GSNH 4F9LA 4N8VB 3NZUA 4L8SA 5FB8A 4JFUA 3O6ML 4NM4L 3NA9L 2AI0L 4D8PB 3FB7B 2MSPA 4R0LC 1EWHA 4XCFL 4UT6H 1WBXA 4Q9CA 5IROD 3DV4B 3GMOB 1R3LB 2ZUVA 3UYRL 3EYOB 5HJGA 2ODHA 1M57B 1SEBA 3VD0A 2YEVB 4PMFA 4FZ8H 1Z2KA 2X0VA 5LLIC 1CF8L 2DWXA 2P24B 1F58H 3KJ4B 4UF7C 3CPUA 2A9CA 3TASA 2IAMC 3HPJA 3OKMA 3BFWA 2YFOA 4FMKA 3KGRA 1NCOA 2EDKA 2P46B 2ZX8A 3O8XB 2PPAA 1NCDH 2F1BA 2KDGA 5C09E 3QUZA 4TMPA 1KTCA 3TT3H 2VTFA 2JKNA 4Y89A 3K72B 1VDGA 4NQSB 3VM5A 3V0AC 5IBTL 5L2KD 1ZSHA 1NEPA 2UWEE 2YO3A 2N7BA 5C07E 5DS1A 2EH8L 3MLRL 3FQ2A 4F9PC 2RCSL 3L2NA 2DIJA 2GI7A 3V4LA 1DQVA 1XEUA 2X4OA 2E0PA 3CSPA 3IKCB 4G9FE 1TZIB 4X8JA 1JN6A 4JN2B 1PZ2A 5GIRA 4FZ8L 5HDRA 1EAOA 2ENPA 2F53A 4N8CL 2YKKA 4QLWA 4XCYA 4WZ9A 1CLOH 3T1FB 4JQVA 3LNGA 2Z35B 3PQYE 1J0HA 4IEFA 1IM3A 3CN4A 3HB3C 4HCIA 3VXUD 4PQXA 5I1JH 4YHOH 5BOJA 3BVXA 2XWEA 2YAFA 3QSKB 5FO9A 4WIQA 1JFHA 5DEFB 4E9LA 1HK6A 2O1AA 3VI4B 4AQAB 3NCWA 2AJXH 1FVEA 3BPLB 1BF5A 1MHHB 1G7IA 4JNXA 1F0LA 4M1GL 2DAVA 4JM2A 3TO4B 4MQXD 3WNLA 3WIAA 1QBLL 4PB0L 5MEQA 1J05B 4APXA 2VSDA 2ZXDA 6CGTA 2H3NB 4Z7NF 1HH9B 3MUJA 4YEEA 1QRNE 3K6IA 4GFXA 5C2BH 5DQDH 3HLAA 2XN0A 1S4IA 3KH4A 1Q8MA 3Q6FA 3IPFA 1A6TB 5CFHA 3LD8C 3BVNB 2HJFB 5FYJE 3BQUD 1SYSA 4RMVA 5FLUA 4GAYA 1E9OA 7FABH 1DJGA 3UMTA 2BOBB 4FG6C 3VXRD 3BPOB 2WIIB 1MJ8L 2Y9RT 1VZGA 3TWYA 1RLWA 3MUGB 3EOAA 1PDKA 1YMMA 2QSCH 4H7VA 4UDUA 4YL9A 5ID1A 4XAWL 5CR1A 1PTZA 1ONQB 3QJTB 4FQIH 3GS4A 4OIBA 1WCQA 3P77A 2RA1A 3FQXA 2YD0A 4XCNA 5DRXA 4NUPA 2MWCA 3BH9B 1JD7A 3QB7C 2APFA 1UD8A 2BS9A 2GSGB 2A9MH 5C08B 1Q9WB 3WDHA 4PGJA 3ZZQA 1JK8A 4YWGH 2A1WH 1OW0C 3TC9A 1M53A 2HXAA 3QPXH 1Y0LB 4Z7QF 4J12A 4E9YA 5DMGD 5KS9B 2NTFB 3P4MA 2W91A 2W07B 4HJTA 2AK1H 4R90H 4U3CA 1IM9A 4NHUB 5JHAA 5DJ6A 4ICXA 3NJNA 1L7IH 1KMGA 3BN9D 5K39A 4WUUB 1UWGL 7FABL 4G83A 2EUZA 1IFHH 1OE2A 1HNYA 4EIGB 1TQCC 3O6FA 1G6RA 3BZ4A 1Q9LB 1IRAY 5C0AB 3GMMA 4BD4A 3O2DH 3BT2L 3UTZA 1V10A 1JHKH 2A6IB 1DSWA 3T8VA 2WINB 3QDGA 1G9NL 3W0WA 2BVEA 5F89A 1BQ5A 1ZLUH 5IGXH 2F0CA 2ZAGA 3CQQA 3GHBH 4MMZB 4UM8B 1T5XA 1THAA 4ZO8A 3TCLB 4KU1A 4U1HA 2HTLC 3MRLA 2OMTB 4O51B 4JY6B 3RWFB 4E42A 4U1LB 4BBWA 5ICZB 1H15B 4NIYE 3VWJD 1BFVL 3NIFE 1BQRA 4PRHD 4ERSH 1I8IA 5E08H 5E70A 3BP4B 4WU7B 1LK3H 1A4JB 5JW4Q 4RSVA 5DHXB 4M6OL 4JHAL 4Y4HD 4HJ0C 2YQBA 4O2EA 3BHBA 2A9NL 4HKXB 1GVIA 3EKCA 3IU3B 1IBZA 4N0YH 1UUSA 1EHKB 1PQZB 3GXFA 1PF3A 4G1MA 4AC4A 1H3UA 3PPEA 1JHKL 4NO0D 4L8SB 4DEPC 3T3MF 4JPSA 5AKVA 4L0PB 5KYUB 2NX5A 2FD6L 4MBOA 2E27L 4A7UA 2ERJB 4AEIH 4FYTA 4P2CG 1M3IA 5DVKA 4GQRA 1IJNA 3VGHA 1X5XA 2KL6A 1JGUL 5FUCE 4NC1C 4ELDA 5E08L 1YNLH 3VXSE 2GFBB 3VI3F 4OCSH 3SIKA 4AL8H 4LMQE 4F8TA 2YEZA 1JNHA 4XMLL 4GIOA 5IFHH 3UOAB 1PG7X 3OKMB 1GJUA 4QHKJ 5DEGB 4L0ZA 4AYDC 4ACTA 4BFIA 5HY9B 4PLOB 4LCWB 4DKEH 4F8NA 2BY3A 3FTXA 4FHJA 3REVA 3ZYOA 4B0MB 4KV5E 2CXGA 4LK4A 5DD1H 1Z9PA 3QUZB 4MCNA 2BY0A 5H4YA 1IAIM 2FX7H 2XY1A 1UWEH 4HAFA 3LKRA 1AFVH 4AVHA 4NP4H 2R4RH 8FABB 3F7VA 3GKWL 2ITDB 4P5SA 1KNOA 3EGSA 1NAMH 4APQD 4RETB 1FE8H 3DJTA 4OCWH 5C07D 3AJ7A 1WITA 4X98A 3ZKXB 5BQ7A 4M62H 4EZKA 4FFVD 2ZIDA 3ZKNC 4EN3A 1XH3A 3KXFA 4X8JB 1GAFH 2NXYC 3MLWL 1FCCA 1JG9A 4P59H 4G9FD 4WTZG 1YNLL 1RI8A 5M95B 2VZ3A 1K4CA 3IMTA 3WFDL 2OCCB 4XCYB 1BVKB 3VXTA 3FUKA 2BK8A 4HIEB 5AAMA 3S3PA 3HE6B 1KF9B 1P84J 2WGNB 1F1AA 4DKEL 5ES4B 5TE6L 4X7CC 1CGTA 1XTMA 3L08A 3PQYD 5ID0B 1N67A 4K94C 5CBEA 4J2QA 4AI7A 1BEXA 2CPCA 3M1OA 2FX7L 1BA9A 2XKNA 3JWNC 3FJTA 1KDIA 1SFDA 5FO9B 5E1GA 3F5WA 3REWA 1NAML 1FE8L 1OEZW 3KNBA 2KDYA 4ZX4A 5IMLA 1FV1A 3AQXA 3H8NA 5JYLA 4M62L 3L48A 1JGVL 3Q8CA 5HHXL 3MV9B 1D6VL 4CSPA 4JM2B 4ORZC 4KZEH 4UZSA 1S9WA 3ABKB 5HHQA 1TMCB 3D2UA 4K71B 4G6JH 4JFHE 1IAOA 3VU2A 1CFSB 4XBGB 2PMZA 4NCDA 4M02A 3B83A 3P3RA 4OF8A 4FFYL 1A6VH 5FS5A 5I6KA 3QIUA 2BCKA 2RGSA 1YQVH 3WMPA 1JFQH 1SYSB 2KZ1B 3F3HA 5FYJD 5EO1A 4L8DB 3CVIH 3QIBA 3R8QA 5AENA 1E9OB 5ESQB 2DQDH 2BX5A 3DETC 5HI5D 3KR3H 4EZJA 5BXFA 2Q2EB 5GGRA 4Y2DC 4ONHA 4E41A 3O0RL 4XRCA 1PDKB 2VDMB 4FFWC 2NNAB 3BVDB 3TN0A 1OAXH 3EZ8A 3TFKC 1A1OA 1J1PH 3P77B 1UB6B 3TF4A 5D96B 4P07A 4OD2A 3LKOB 5DRXB 1MW1A 1TR7A 4Q9QH 1G7MB 3A47A 4Z7OB 5I1AA 5ADPH 5JXAL 4G8IB 4ZMWA 5K69A 4WSKA 2HYMA 4FXLA 1KEMH 1UACL 3A5VA 3P4MB 5HPOA 3V5DA 1IM9B 4DZ8A 3SBQA 5DJ6B 1AR1B 3MRIA 1XCTB 5IJBC 3LDBC 4JRYA 4MASA 1P4UA 2H6OA 2YJLA 1CL7H 5IOPA 4I0CC 2OTPA 2LLNA 3UBXG 3BZ4B 1F4YH 2B1OA 1H3GA 2PP8A 3UTZB 4B9IA 1J8HA 2NCEA 4NFBA 4BKLA 1BQSA 4JY5L 1KY6A 3W0WB 1CK0H 3I74A 3T6ZA 1YYMH 1KYOJ 3A6CH 5FFGA 2YIHA 1PCSA 5DVOA 2Y24A 1A7PL 3CMGA 1T5XB 3AT8A 5T5FH 3IJ9A 5TGBB 1CDBA 4U05A 3IDXL 3KCPA 3MRLB 1DVYA 5ADPL 2YJQA 4ZOBA 1JZ3A 3BXNA 4HU8A 1TXKA 1IBHA 1ED3B 1BZ7A 3U0WH 5JPMA 4NO5A 4UV4L 1NMBH 4P3DA 2JLPA 1JWUB 5I8CA 2JJVA 3TBSA 2PW2A 1UWFA 1E30A 3BHBB 2F18A 5SX4H 3CPLA 2CBOA 4NT6B 4YUEL 1CL7L 1NGWB 5C9JA 1OK0A 3E1ZA 1F4YL 3EG9A 4Z0XA 4Z8FL 4XPFL 3GMPB 1ZK9A 3VGFA 1N6QH 1ANUA 4HSCX 1WZ1H 3LQMA 5GGVL 4ZOEA 5INDA 2NY6B 4N1EA 5F8QC 3S0PA 1RHFA 2HH0H 1C08A 2NX5B 2OR7A 3BESR 4X2UA 3F58L 1ZTXH 2W9EH 4ZXBD 3WS6A 5GPRA 2GITA 1DDHA 3QR0A 2VDQL 4GSUA 4DEUA 3QRFM 3U0WL 4MKMA 1M6OA 3WTYA 1NMBL 3FT0A 4PJAB 3QZNA 5LN8A 3VXSD 1F97A 3IF1A 2YEZB 2VO8A 5T1KD 2DQ6A 1BX2A 3KVPA 3IGKA 1R3IL 2EIEA 3HBQA 1I3RA 3QXDB 4TVPE 4GJTB 3REVB 3D4CA 1XBRA 5CLYA 4PLKD 2L7EA 3L3OB 5HHOA 3KPQA 4QNPF 4DJMA 4NNYA 1UH4A 1X9QA 5FYJL 2FB4H 1N6QL 3ZMNA 5HYQA 3KCWA 3LKRB 3M86A 1HHHB 3L3JA 3N42B 3U1SH 2I32A 3F7VB 3TNMA 1JSYA 5L8LB 2HH0L 3EGSB 1GZQA 4QXGH 3RQ3A 1EUTA 1U3HD 3ATFA 4X98B 3ZIYA 1NDTA 4HF5L 4U49A 4BA0A 4PJ7A 5F6IB 2C7UA 1SJHB 3IETB 1YECH 5J1AB 4OGQC 4S11A 5CGYD 3L3IA 3AAZA 4X6DE 4HUVA 3FN0H 2VDPL 3OKOB 3V55A 1T0NB 3PCYA 1A7QH 1R1CA 4FLQA 4L1HA 3ZE0E 3K0WA 1Z0MA 4LLAA 2NNXA 4OZGE 2F19H 2IMMA 5I23A 3ZOAA 3K8KA 5F7YC 5CBEB 5CZRA 1MW3A 2XKNB 3GSQA 1MCBA 2BSCA 3GF8A 3NDYE 4PJBE 4XX5A 1X9LA 3VGAB 2AABL 3ARBC 3CGTA 3E3QC 1A21A 1VA9A 3MAWA 4IHOB 4GSRA 4YXHH 3CHXA 5F9DC 1FV1B 3BMVA 2VR4A 5KJRL 3N1QC 1ASOA 2F54B 1KBWA 1YECL 5DEZA 4AUYA 1WZLA 1HILA 2OMVA 3QUMA 4BFRA 1IT9H 2ADFH 4XHJC 2VWEC 5C70A 4ZW7A 1MNUH 4BE5A 1IAOB 3TBVA 4JFHD 3L5WB 5MP6L 1YN6A 3SDDD 2EVGA 5D7SL 2IWKA 3OAYK 1DLFH 3FQYA 5D2LF 1BOGA 3CWGA 4JBSA 1EZSA 1BOYA 1G7JA 5G2NA 2ENYA 2BCKB 3B3BA 5IB2A 3BSZH 5EUOB 4UQAA 1U30A 1H0DB 5I28A 1JGDB 3QIBB 3NJHA 3IJEA 4LGRB 3CBJB 4UT9A 3Q6GL 1F6AA 1X5HA 4PB9H 4XNYH 4PGEA 2ADYA 4YXHL 5T3ZE 3E0GA 1X7TA 4DP9X 3FUFA 5FFOA 4ONHB 3LRLA 2H9GA 1S7TB 1PCXA 2A6KA 1ZT7B 1MN4A 2ZKYA 1URZA 1DUZB 1ZV9A 4YSRA 4UQ9A 3EF4A 1CE1L 4AENB 1NFDE 4EQ3A 3MROA 5KVFH 2MTPA 5FK9B 3U2SA 5GZOD 2ADFL 2X4SB 4KTGA 5D5ME 2Z65C 2I60H 1TT6A 3G7TA 1KJ3H 3FUHA 5I1AB 2E47A 1BV8A 1LD9B 2UZXB 2H32H 1VFAA 1OCWH 4M3KB 1KFAL 3KBHE 1JHTB 4WTZA 3NPZB 3MGAA 5FOBA 5JW3H 3FUEA 2Z92B 4GG6E 4P5TC 3BSZL 5CJOH 3V5DB 1ACCA 4D0DB 2YN5A 3U9UB 4JKKA 2VNCA 5BZZA 1QG3A 5IOKA 3FSZA 3SJVA 4RFNC 1WT5C 1QI3A 2GI0A 3DI3B 2VIRB 5ETUB 5DK0A 3V6OC 2XZQL 1N64H 3RNQA 1J8HB 4NKQB 3OC8A 3OD3A 5DD0H 3EFOA 2IG2H 3ARGD 4HS3A 1MWAA 1A4KA 2OQJB 3ARDC 1JPFA 3GI8L 1BQUA 2I60L 4IKIA 1PZCA 4L05A 1BREA 1NUFA 3V2AR 5I6LA 2VDKH 1USQA 3ZLQC 4MWFA 4LLWA 1RJLA 4O2FA 4OUUA 1BZ7B 3OKNA 1A3LH 4TUUA 5KUMA 2EDEA 4GYBA 4JQXA 1EK3A 2YD2A 2KQNA 4M4RB 3VMNA 4UU9B 2PW2B 4IRJC 3TBSB 4ZZKA 3NIGF 3MGOA 1S78C 4ZPVB 3GMQB 2V2TA 5C9JB 4HGMA 3IE9A 3FQ4A 4JFYB 1OIOA 4ODVH 3EG9B 1JDDA 2Q7YA 3OPZL 5JHDA 3N0AA 3IMBA 1KCVL 2DWEA 5DD0L 4WFEE 4WK4B 2IG2L 4H1LH 2EIMB 1FNGA 4MA1C 4E0RA 5I18H 1C08B 2A4EA 3PV6B 3QS2A 4LOVA 3U4EA 3X1GA 4C56E 1CL7I 5LAPA 4G11A 1DDHB 1N59B 3IJ7A 5FGCB 4XMZA 2R29H 4PWHA 1DBKH 3SQBA 4XAKE 1QBAA 1LILA 3ZHNA 1AXSB 4Q14A 5B1AB 2Y7OA 3QXWA 3NJKA 1Y6KR 4ZW6A 1ZXQA 4N22A 4UTAA 3P2BA 3MNVB 2BSTB 4MRCA 5I5MA 5MEPB 2KPWA 4FYRA 3RB5A 1I3RB 2Q8BL 2E46A 2JCWA 2V5RA 3RBSA 3GBNL 4PJFF 3V4VA 3FCUB 3O3DB 3RI5K 5CIPA 5D4JA 1WSST 5FFLA 2Y07H 4WGVB 5I1EH 3U6RA 1T04B 5AOMA 2B1HL 5I18L 1GZQB 2YD8A 1R5IB 1DBBH 3C60B 3UBXA 1N5AA 2NY7H 5CSBA 4P9HL 5DHVH 5GQBA 3NQIA 4RQQA 4FXKB 4PJ7B 4XZUB 1LEIA 1DBKL 3BWUF 5CCGE 4B9YA 1NAKH 3FH8A 3CFEA 3O4LD 4YSSA 3LYRA 2HJLB 3BPCB 4HUVB 1N3NB 1UD4A 2Q2LA 1T0OA 1KYDA 4HH9A 1ZEAH 3PWNA 1N12A 5CF3A 4RGNE 3NCBB 4MS8D 1FFRA 1ORSA 3HE7B 3SKMA 5E2TL 4EXPX 2OW6A 1T5KA 4TTDC 4Y1AE 5TFSH 4G7QB 3SGKC 3L4VA 5CR8A 1GGIL 3ILPA 3FQTA 1DVZA 4Z7NB 5IREA 1SOKA 3PE9A 1S6NA 3EDDA 2OZ4A 4NZTH 1I8LA 2NY7L 3GSVA 5DVLA 5AYQA 3CZNA 2FT8A 2XWCA 4LF3A 3WE1A 3AY2A 2DJSA 4WK0B 2A73A 1HILB 3KYOB 4J3SA 4W9DC 4KRMB 3HKFA 4PJ5A 3P73A 1OLZA 4RVBA 5AVTB 2HG0A 3QEQE 2EXWC 3T5WA 1AGDA 2W65B 2EIKB 3NRQA 1JUFB 4JRXE 4FFZH 2K9FB 4XNDA 1E43A 3ZR5A 2PO6B 4CDHA 3UJIL 4UIKH 5C0ND 1VEMA 5TFSL 3X13A 3RKDD 3MLPA 3CBRA 2XIIA 3VRJA 3IJEB 4AE1A 1F6AB 3WXVL 2Y0SA 3OLIA 4HXAL 4WWPA 2Y7QB 1QEWA 5LGHL 3QR2A 1K3IA 4XNZB 4L18A 5T3ZD 1CWVA 4KBPA 4KJPD 4Z7QB 1RZJH 2Z31C 1XF3A 2NY5H 1BVZA 1SF5A 1MI5D 2R0WH 3F6JA 3LRMA 3MROB 1FVDA 3IDNA 4PJ8C 3QPKA 3LMJL 5I1GH 1MXGA 4ZPTB 4JVWA 3CFDA 4M7LH 5E1HB 1E65A 4JPIA 2BFVL 1WWBX 1QUPA 2YWZA 3JSSA 1HWGB 1KJ2H 2C4FT 3UTOA 5FOBB 3VTMA 5LUMA 3ECQA 3FBQA 3ZYJA 2CHXA 1W72A 4UIKL 5GS1B 1P4BL 4RX4D 3K6NA 1GSKA 4HZLB 2GTQA 4Q4IA 2V5YA 3AXHA 4BZ1H 2ENQA 2XHNA 5DUML 3SJVB 5JXEA 3KBFA 1HINH 4Q2ZB 3RJQB 4MDRA 5DK0B 3MKGA 4HSQA 1RZJL 4FFTA 4H88H 3T0EC 3UXFA 1EGJA 1P7QB 2R0WL 3EFOB 4LMQI 4PJEA 3OHXA 1M7XA 4HS3B 4R4ND 5ALCH 4JZJC 5LG6A 3FPXA 4LAQH 1MHPH 3CFQA 4YHIA 5FKPA 3LVTA 4EMZA 1H8NA 4G8FB 2HJKA 5JQIB 5EOCH 3NUKA 4JG0L 3OKNB 2ZXEB 4XP6L 1TTFA 2P5WB 3S96A 2XZAH 3ATBA 2YRZA 3NIFF 3T3MB 5AFAA 4QDGA 3OKLA 4ZFOB 3MGOB 1R3HB 4GRMB 4HIQA 3V0EA 2R2H