3I9AA

Crystal structure of human transthyretin variant a25t - #1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPTINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone
molecule keywords Transthyretin
publication title Crystal structure of human transthyretin variant A25T - #1
rcsb
source organism Homo sapiens
total genus 25
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3i9aA00
4TQ8A 3QVAA 4HJUA 4TLTA 4TLSA 3IWUA 3GLZA 1E4HA 3I9AA 4MASA 3OZLA 5FW8A 2B16A 1BZ8A 3KGTA 3FC8A 5L4MA 3P3UA 3ESNA 2B77A 2TRYA 4ABQA 5K1JA 2QELA 3CFQA 2GPZA 4L1TA 3Q1EA 2PABA 4TQPA 5CLYA 4TNEA 1TT6A 2G4EA 2G2PA 2G3ZA 2G2NA 4TNGA 3HJ0A 1DVYA 4PVNA 5CM1A 3DJTA 2ROXA 3IMRA 3DGDA 5DWPA 3I9IA 3NEOA 4IKIA 4TL5A 1BZDA 3A4DA 3IMWA 4N85A 3DK2A 3NEEA 4YDNA 2G5UA 5CR1A 3ESPA 3TCTA 2FBRA 3CXFA 1E5AA 2G3XA 4D7BA 1DVTA 4AC2A 1GKOA 1FH2A 3DK0A 1ETA1 3DO4A 3IMSA 1TSHA 2H4EA 1KGJA 2IGLA 3BSZA 1G1OA 5L4FA 4TQIA 2FLMA 5E4AA 4IKJA 1DVUA 3CN1A 3NG5A 4ABVA 2QGDA 4QXVA 3IPBA 2H1XA 4PVLA 4TLUA 3CN2A 4QRFA 1IIIA 1TLMA 2QGEA 3CFMA 3U2IA 4HJTA 4ACTA 4KY2A 4AC4A 5BOJA 2B9AA 3BT0A 3CN4A 5AYTA 2G4GA 1SOKA 1THCA 1TTCA 2H6UA 3I9PA 4PMEA 5DEJA 4DERA 4DETA 4PWKA 1IE4A 4TQHA 3DIDA 4IKLA 4FI8A 4PWEA 4WO0A 1FHNA 3DJSA 2H0EA 5JIDA 1ZCRA 1TYRA 2QPFA 4TLKA 5AKVA 3M1OA 4L1SA 3A4EA 3CN0A 4Y9CA 5K1NA 3GRGA 1SN5A 5L4IA 2NOYA 3ESOA 1BZEA 3GPSA 4N86A 4TL4A 3GRBA 1IJNA 5AKSA 5A6IA 5L4JA 3CFTA 4I87A 1TTRA 2GABA 4Y9BA 2H0JA 4TNFA 3GS7A 3CFNA 5CN3A 3IMVA 5AL8A 1OO2A 5JIQA 2QGBA 4DEUA 3CN3A 5HJGA 3B56A 4PWFA 4FI6A 2B14A 3KGUA 3KGSA 4MRBA 4MRCA 5AL0A 3IPEA 3NESA 5FW6A 1X7TA 5EN3A 4WNJA 1BM7A 3W3BA 2H0FA 1F86A 1KGIA 1SOQA 2F8IA 2QGCA 3P3RA 3P3TA 4Y9GA 4IIZA 4I89A 3D2TA 4ANKA 4WNSA 4Y9EA 1TTAA 1DVZA 1U21A 1RLBA 1ICTA 1Z7JA 3IMTA 3OZKA 4YDMA 5E23A 5E4OA 3U2JA 4IK6A 1ETB1 1THAA 1TZ8A 1DVQA 3DJZA 3P3SA 4I85A 4Q14A 1DVXA 1GKEA 3DJRA 2B15A 3IMUA 4TM9A 1DVSA 1X7SA 4IK7A 3TFBA 4TKWA 4ABUA 1TFPA 1QABA 4IKKA 4DEWA 5FW7A 4HJSA 5CNHA 4PWHA 4ABWA 1TTBA 5IHHA 2G9KA 5EZPA 3SSGA 4PM1A 5TTRA 3GS0A 2F7IA 4FI7A 4DESA 3GS4A 2ROYA 4PMFA 1F41A 1SN2A 3A4FA 3FCBA 5JIMA 1IIKA 1QWHA 4N87A 3IWVA 4PVMA 5FO2A 2WQAA 3CBRA 4HIQA 1E3FA 5AKTA 4QYAA 5CLXA 4PWJA 1Y1DA 4HISA 5CLZA 4Y9FA 1SN0A 4PWGA 1BMZA 2TRHA 3D7PA 3NEXA 4PWIA 1ZD6A
chains in the Genus database with same CATH superfamily
4XRCA 3AROA 3VFGL 3MLXH 4IW4C 2B4CC 3MCG1 4WUUA 4OFKA 5IF0A 3FOLB 4OB5L 4IBLT 1EEUA 3U2SA 2ITFA 3X2QB 3S88L 2G2NA 4NERA 3QORC 2PTVA 2L7UA 3W2DH 4NZUL 2BPBA 1K4CB 3O0RH 3QDMD 4FNUA 1T22A 3ETBJ 3GJEB 5B1JC 2HN7A 4WHTB 1KN4H 4ODWA 1TENA 1MREH 2CIIB 4LCWA 5MEOA 4YDLB 5JOFB 4UV4L 5LHDA 3PE9A 1I3VA 1Q9OA 1M3JA 2CRMA 3MLUH 1YMHB 3MV8A 4WSKA 2XV0A 1W0WA 4GG6B 4R7DA 1QUNB 4PB0L 2EXYC 4KQ3H 4PJ7E 4Y4FA 2PR4L 4E0RA 5AQ0A 1OF0A 4G1MA 4QRRE 3WFEL 1IGCH 2GITB 4XNZC 2C7FA 3D3VE 1GR7A 4NQDD 3ROOA 1BZ7B 3U2IA 3ES6B 4BZ1H 3BT0A 1D5ZB 1FO0A 1S7TA 1FVDB 2VTFA 2JELL 5DYOB 4WDIB 2R0WH 5J13B 3EJZC 3FTZA 1K8DA 2BFGA 3FO1A 3KPRD 2ADJB 3L95B 2ZYHA 4R7LA 4YDKL 4RISL 3KBHE 1ACCA 5DMKB 1N8OE 3KPOA 1R3KB 2C8NA 3VMOA 3FQTA 3H7LA 4FRWA 1HH6A 4JRYD 4L0PB 4S11A 4C4BA 4N2LA 4F58L 3HNTH 5AVUB 3VNYA 2WN2A 1JGLL 3QI9B 4Q9CA 3M8OL 3ZGIA 1P4LB 2BS9A 1CD0A 1TJHH 2CKBL 3ZDXF 1CN4A 4JG5A 5CWSB 4KRLB 5GRUH 4Z3TA 1D5XB 2BHUA 3C6SB 1ZPLA 3EYQD 5ALBH 2WUCL 4QXTB 4PJFE 1UKTA 1UC6A 5E2UL 2OMVB 3OD3A 3VB8A 2ZYRA 1BLNB 1EHAA 4K8RC 4WSJA 5DJZA 4AJVA 3TFKD 2VXQA 3C60A 4NQTA 2VDLH 1MHPH 2XUWA 2I9LB 4LNRA 4LSRH 1QR1B 2PPDA 4UT7L 1EFXA 4PGEA 2F7QA 1XGRB 4ODSL 2KL6A 1M2OA 2AC0A 4E42B 1RJZB 5DQ9B 3MA7A 3NDYE 3ZE1F 1U8CA 2AI0H 2BVOB 5FCSH 2D3NA 2VW6A 1ADQA 3CDFA 4PJBB 4X6BA 1BBDH 4LLVB 5LWYL 3DETD 4KI5D 1GY1A 3FDWA 1MSPA 5I2IA 2OSYA 3CSGA 4PJGF 2MNJB 4ZOBA 4ADJA 4P46C 5EZIL 3KS0J 4QGTA 2IADA 3DSFL 4JVWA 3LVTA 4WGKA 3HRZB 1QAWA 4HISA 2EO1A 1DJHA 2APVA 1E2ZA 2W07B 3QNXA 1WEJH 3CVHA 4UM8A 4PRAA 3ZHLA 2PWGA 3MRGB 4GI6A 4PRPD 4FG6C 4LCVA 4LSUH 5DWUH 4NXKA 3HZKA 1YNKH 2YEQA 4AGQA 3L9EA 3TBTA 1A6ZA 1PZ3A 4OM1H 4TTGA 3TJHC 1YEWA 2ZCKH 1A65A 2E76C 3SGKA 4YMPA 1Z9MA 4UM9B 4KMTL 4R4BB 2H26B 5GIRA 5D5MF 2CGRH 4TNEA 3RL2A 3QWOB 5J7CC 4HXAH 4W6WB 1KCVL 1JHTA 5K59E 4G3YH 1WCBA 3RVUC 4DQOH 3UJJL 3PWPD 3QRLA 1BQRA 3RI5K 3QQ9D 1CVRA 4GBXB 4HHWA 2JXMA 4UTBL 2GB2A 5I9QC 1A22B 2CALA 2BY2A 4FKHA 4UDUA 4LXFA 4OD3L 3O3DA 4HEPA 3DV4A 4JY5H 4G8FA 1JNNH 2X2HA 2IO5A 2J1KA 2XU9A 2GJPA 1GL4B 1I31A 2NNFA 2Y6TE 3AY4C 3LQAH 1NCNA 1U4EA 1RZIA 3MGTB 4KRNA 2EUVA 5CEXA 2X88A 4TUJB 5CCGE 4WW1A 5DUPH 1SMAA 2YUZA 4QHUB 5DJ8B 3UIZA 1A6WH 3JZYA 4OQ1A 5EO9B 4POYA 4N22A 4I18C 1E3XA 2YQGA 1SHXA 3LRKA 1AI1H 2CPCA 4HX1A 5J57B 4BUGA 4MCZB 4K5NA 1F1DA 4KAQL 3VFNB 1TR7A 5DZPA 5JIQA 1V5JA 5CSZB 3TEUA 5JDJA 3BDYL 2Z7WA 5DGQA 5SX5H 4Q6KA 1IGIH 2Z8RA 5EN3A 4AIZA 3VMPA 1FNSH 1LWJA 5GS0H 4X83A 1OVZA 3CZGA 3S37L 3LYRA 3QQDA 2G75A 5JLZB 1MWAB 3MV9B 2VLRB 2CCLA 4YE4H 3JWNC 3TBSB 5BZDB 5BVJA 5KG9B 1ZS8B 5C07D 4PCKA 4QHKJ 2N1KA 4L4TA 1MLBA 1T1ZB 3KLAB 2DQHH 3MBWA 5IMLB 2BSTA 1A0QL 2XICA 4PY8J 3DO7B 4KQ4H 4QEGA 3NABL 5IBTL 3ULVC 2X4OA 3MO1A 1N4XH 3SODB 4ETQA 4JFFB 5EU5A 4LMQE 4ZUWA 4UIKH 5EUOE 2W1NA 4MAYD 3LRGA 4PY7A 2WO2B 3ZKMD 4NJAL 3BVWA 5HHXH 3QNYB 4KK6D 5D96B 1P4IL 3PV6B 3AU1A 2XRAH 4XBPB 1EEZA 4BK5C 4D2NA 4DF9A 2IQAA 4F57L 1HN1A 4WU7A 3FCTA 1UD3A 5BV7H 3NZHL 3GLZA 5A2AA 2JI3A 2PYFA 1NGQH 3VD4A 3VFOB 2YXVA 5A43C 1RV6X 2NY7H 1P5UB 3AABA 3RBSA 3WD5H 2WWKO 5GGRY 1RZPA 4E9VA 3CU1A 1G7PA 1WCQA 4GKNB 1QNZH 3K0YA 3O3AB 4JZJA 4PJAB 3VFPB 3WFCH 2IMNA 1N7ML 2OCCB 1XGPB 3IU4L 2WO4A 4YOKA 4A2LA 5I1JL 2VDNB 2DDQH 3FQWA 1QFOA 2B3IA 1RVFL 4A1RA 4MNQE 2JKJA 4O2CA 2XN0A 3FUMA 3SGDI 3A47A 5GS1A 2EYTA 1O9ZA 3N1FC 4WI0B 4OGAD 2QEJA 4G80A 2ATKA 5C0JA 2P3YA 4KX7A 5HGHB 1YY8A 4GW1A 4YH6A 3ZTEA 2UZXA 4IGBA 3GXMA 5J89A 3CMOL 5DT1L 3R7QA 5HPMA 4R4FL 3B9VA 1HEZA 4XVUD 2Z31B 1R5WB 1MI5E 4JN1H 4HZLB 4NO0D 1D6EB 4L8SB 2I25N 4UOQA 3WIAA 3VWKB 1JZJA 1KDIA 4GAYB 1MAJA 3ET9F 1PL3A 1NMBH 2EDNA 5T33H 1X5GA 1M7UA 1KNOB 4NQEB 3HVDA 3GGWB 1I8UA 3L1GA 5E6IA 3C6EA 3ELAT 5JO5A 1KBBA 3OXRA 5F1IA 1IZKA 3PLYA 3HVNA 4G5AA 4IOSA 4ALAL 4AQ1A 4BSVA 3PY9A 4CW1A 1KLGB 2DYPB 4YLCA 1ZV9A 5ESQA 3LEXB 1A9BA 4Z5RA 2IOIA 5BOPA 4UV7L 3WE6B 5I1IH 5TPWH 3SDAD 5I76B 1CYWA 3OHMB 4K23L 3CFEB 2BIQA 1OCRB 4JFEE 3VACA 1Z5HA 1EJ8A 2NZIA 2EVIA 1GVIA 4AW4A 3AUVA 1AO7E 4YZFE 3O45B 3MVSA 2WKLA 4X4XB 3IVKB 4OV6F 2IPKA 1KCLA 2FBJL 2OMTA 4LLAA 1JAEA 1ZTMA 2K45A 3G6AB 5D2LF 5C0CB 3VM7A 3MI6A 3F2LA 5CEZE 2HMIC 3PWUB 2H0PA 2DIJA 2GI0A 2X41A 5L2JA 5IVZA 1KEGL 4QY8A 3DIFB 2CD0A 3QCTL 2F19L 4PVMA 3JTSA 2NXZD 2OXHB 3PL6D 2XWEA 3ARBB 4PWJA 5CP7B 3D39B 4QOKE 1MF2H 1JK9A 1BMZA 2Y06H 2DBLH 3JYBA 4YBHA 5KOVC 5FB8A 2E46A 1MJ8L 1C7TA 3LH2H 2C1OA 2QPSA 4XPGH 3U7WH 1PMYA 3VFRB 4WAFA 4YSRA 3IDJA 2VN7A 5ACMA 4JFQB 2JIXD 2G5RA 1EANA 4YGVA 2Q3XA 5JDSA 3T3ME 3TV3L 2HFGH 1Q9KA 3CUPA 3VH8B 4L3EE 4PJIE 3TS8A 3ZL4L 4D8PB 5C0ND 4XXWC 5D7JD 2M2DA 5IJDC 3BPLC 1OCZB 1YEKL 1MCSA 1GYCA 2OJZH 3HE7C 4MNGB 4MA8L 3U36A 2YD3A 3ASOB 2JLLA 2UY7A 3DX9B 3V8CA 1TUPA 1WTLA 1GS8A 5FA3B 5TDOA 1GZPB 3IPBA 2XZCH 3H2WA 2IANA 4N3UA 4I0PA 1TDQA 5T3ZL 4XBGB 4HJTA 5F9WB 4XCNB 3V7AE 2H6UA 2E6PA 4F7CB 1G6RH 4PTTB 5HYQB 3FSAA 2A9CA 2AEWA 1XFPA 1FQ9C 2UXFA 4P06A 2LABA 4PJ5E 1T03L 4QDGA 2KLTA 5F8QC 5DHVA 1LP9E 3QUZC 4ZTEA 4TUUA 5AKSA 4CVXB 5GRWA 4GRWE 1ZKAA 1CL7L 2VLKE 1PSKH 4Y4HC 5A2JH 4XNAA 2PP7A 1UGNA 3UXFA 1G9NL 1AD9A 1KT2A 3WCYA 4ZQTA 5MENB 5EZLB 2J4WL 2WIIA 5AW4B 4R5XA 4QKXB 5FPIA 5I1LA 4ORGA 3PU7A 4RSVA 5F88B 1UT9A 4V1DA 4JFUA 3LY6A 3PHSA 3V9CA 2W81C 4QRPB 2X4TA 4YL4A 1HXMB 3X3GL 3TBVA 3WKQA 3T0DA 2V7HA 1QBAA 1G9MH 3BUDA 2X38A 3WN5C 3CFKA 5T1DH 7FABL 2W65B 1ANUA 4NUPA 1QRNE 4UT9H 4XMXA 4N0FB 2NSXA 3AB0C 3BAKA 3K5RA 5FW7A 3QUHA 2DLFL 3S2AA 2PCFB 4Z7VA 3B2VH 2NY2D 1QKZL 1F3JB 3IAPA 3MNZB 3O8XA 5ID1A 3TNNB 1FYTE 4IDLA 3AT9A 1JE6A 1O9WA 1JZGA 1WVZA 3S5LB 3FCBA 2YARA 3HC2A 3VX1A 3EH4B 4K5PA 6PAZA 2WNWA 3FPXA 5TE6L 1GZHA 3NJJA 3W9EA 5CLZA 3VI4E 1AQ8A 1BBJB 1PNCA 2KQNA 5HGGS 4BD4A 4POZC 4UQIM 1DE4A 3CHXA 3OKNA 3ZN6A 1AOHA 1I9JL 5CUSH 4JW3A 4L0ZA 1MDTA 5F7MC 3U0WH 5CSBA 3GK8L 3SO3C 1BPVA 1AANA 1XGUA 2NY3C 2JF1A 1LK2A 3T77B 3F6JA 1RUQH 2DQDL 2N4IA 7TAAA 3EBIA 3OZ9L 5H94A 3EO9L 5HDBE 2KMWA 1U0QA 1NGZA 2YUVA 4KXAA 4EBQL 3U7YH 2IVFC 1MLCB 1BPLB 4D7BA 3GRWA 4MDIB 1DL7L 5IG7B 4KRPD 1OTSC 3DO4A 1PKQB 2ZXGA 1FNGA 1ADWA 4HK3J 3H9ZA 3MRBA 3NG5A 4K3DL 5E08H 5T3XE 4WEBH 1EJFA 5ALCL 3QFDA 4HC1A 1NCOA 5AWNH 3NP3A 3PF2A 1RIHL 1QSED 3QK0A 4Y1AD 4I5BA 5EIVA 1N67A 4DO5A 4N26A 1N64L 1H3PL 5F7DB 4Z7WA 1DCLA 1NC2A 4XO4A 2OYPA 2AHIA 1I8LC 3QORD 3V4PA 4C56B 3UTZA 5CAYB 8PAZA 1KG0B 1VCAA 1WHOA 1S7WB 3ECWA 4LVOB 4M9PA 1JZ4A 3AY2A 5AOJA 1HT6A 3CFDA 4Z0BL 5IB4A 3I75B 1FDLL 2ID5A 2BNRA 2B5IC 1R5IB 3KXFA 5EWIH 4LHQB 5CGMA 1XL6A 2EXYD 2X1XR 5BV7B 3MUY1 2MOGA 4HT1H 1TYEB 2GTWA 5I6XB 5ITBH 2W80C 3O6ML 1CXEA 3E6HB 2Y2TA 2QQQA 1TCMA 4LEBA 4YHOH 3SPCA 2CK0L 3E8UH 3QEQE 4HUCA 3TJPA 3MMEA 1A1OB 3EJZD 2FL5A 2E56A 1QSFD 3HE6C 5LBSH 4XVJH 2EDMA 2XA8H 4HVBA 5JYLA 5FUCE 2HRGA 5AOMA 3EW3B 1QPPA 4LLMB 5IB5B 5I73B 1S7VB 2VXTL 3HZMA 1DUZA 2LAGB 1X9LA 4B0MM 4Y2OB 5FHAL 4CN4A 1JGEA 3S96A 4PMFA 4MX7B 2X1PA 1N0XH 1HI6B 5D2NE 1MAML 4JO1H 2QPDB 4PJ7F 4ICXA 1NWOA 1Q90A 4QYAA 1TCRA 2ZXQA 1MCPH 1N6QH 2XYBA 2YR3A 5GRVK 2AK4E 4YLBA 1YPZA 3CFCL 3V6FB 5I18H 4B5ZA 4E9RA 1VGKA 4Y19D 3NZ8A 5CJOL 2WLHA 4K3EH 1RJYB 1IC7L 5K69A 2W94A 4G8GD 3SGKC 4UT6H 3OB0K 1UZGA 1CWVA 5FYKU 4JANA 4H0LC 4TF4A 5JPNB 1FLRH 3US0A 4JL1A 3IB4A 4JO3H 3I6LE 3T1WA 3WEAA 3V2AR 4HPHA 5B4MC 1ONQB 3GMRA 1I8MB 3UTQA 1NEPA 4G6FD 2OZ4L 5DRXB 4KFMA 3HMXA 4B7LA 5GJSH 4HDIB 4P46D 3FQXA 4K9EL 1N8ZB 1F6FB 4G9FB 5D2NA 5I1KH 4AZUA 5MEQA 4Q9QL 2DLHA 5E1QA 1TO5A 2EH8L 4M7LH 1CE1H 4XP6L 3V7MA 3ARPA 2RQ8A 1U8PB 5CBEA 2FIKB 4PJFF 2XFXB 5J6HA 5EU7C 5E1HB 3MFFA 3QIWB 4K5MA 2FAUA 3RGVC 4N9GB 1V27A 4Z7NF 1RJCA 1F4WH 1PNDA 4HHAB 5FYKH 3EG9B 4P57A 1TPXB 2ZX7A 3B9DA 1U3ZA 4F8NA 2PNDA 5TQ2L 4G82A 3DXAD 5FO9A 2ZXDA 3FXIC 1NKGA 3FO9A 4YPGB 3WTYA 4JLRA 1JV2B 3RVUD 3HNSH 2OJ1A 1J5HA 1GIGH 4X2UA 2WNKA 5H2BA 5AZ2H 4IMLA 2LU3A 1X5FA 4F7TA 3VD5A 3VWJD 1F4YH 1RK0B 2ZOUA 2XCMC 4AQ8C 4F9LA 1X6NA 1XIWC 3WN6A 3WUZA 5IFHL 1S2EA 2XN9A 3BISA 3W11C 2HT4C 1G9EA 4XGZA 2NY1B 3A67L 1IAKA 5HHNA 3UMTA 4NM4H 2E27L 3AVEA 4TQEL 3ZT6A 5DZOA 3LDBB 3KR3L 4YHIB 3V95A 2R1XA 3B6SA 4PAZA 4M56A 5A6MA 3EXLA 5HGAB 1EJ6A 1MHCB 1HL4A 1IEHA 2WQXA 5D8JL 1B0WA 4ZZKA 3GMPB 5K59F 4NQCD 1Z6JT 2WMPA 3GHPA 3N6YA 4PGBA 4PRID 4NP9A 2R0LL 3CZJA 3M07A 3O2DH 3QIUB 1D5RA 4OM0H 3OSVA 3L54A 4G2AA 4XAWH 1RIVL 2HRLA 5MEPA 2HFEA 3V5KB 1D9KA 1CXLA 3TYFB 1NINA 4XBMA 3QG6B 1NAMH 2EEFA 5DC0A 3QR2A 3IDGA 1QA9B 2VLJD 1A3RL 2QDWA 4OGYL 3CLWA 4WFED 3GSOA 2DQEH 5KSBB 4LQFH 1BEYL 3H4FA 3NA9L 5JQIB 1CFTB 1JCKA 1OIOA 4HV8B 3SCMA 3UG3A 1KF9B 1AMYA 5FIEA 3SY0B 3OKYA 3QUKB 4UQDA 4U1HA 3QUMH 3VXUE 4NKMB 4QAMB 2TAAA 3BKJL 3QNZB 4AXWA 3F3HA 2J5WA 5D1XE 3RIKA 5BZZA 2KH2B 2J12B 3TO4A 3FL7A 1UM5H 3ULVD 4M5YL 1IFHH 2XQ0A 2EIBA 5C3IA 4F3FB 1BXUA 1OZTG 3VGAC 2XBTA 2K4WA 1OZUA 1F42A 1ETA1 2AV1A 5GS1C 2NXYC 3C6LA 5HHOE 2EYSB 4HALA 4J4PA 1QMUA 1DQML 2VLMD 2IDUA 5J56B 4MJ6A 3G3LA 1GJWA 1OE1A 1RH8A 3JVGC 2AQNA 5AW1B 2IAMD 2PPCA 4PJDE 4KY2A 2M83A 4YFEA 1XEUA 3S3JA 5EU4A 1EDYA 4M61A 2B39A 2XZAL 3HPJB 1X9RA 1S5HA 4XB3A 2KPNA 3QULB 3D85A 5T1JA 2ZSVB 3H7BA 1T1WB 3GLAA 5K1NA 5IR1B 3FOMB 4TL4A 4HUVB 4WW2B 4TXVB 1PVHA 4ADGA 4OIIH 4PJHB 5EUOF 2IWEA 3KPMA 5CN3A 4PIBA 4WJG3 4APXB 1WTGT 1CD9B 1DSYA 1WBZB 2J88H 4OCRH 3FRPG 3KD4A 4PJ6A 5KANG 1T83A 4OFPA 4OFDA 1H19A 4U1JA 4PJCE 4AQ1C 2PP9A 1BVZA 1I1AA 1YN7A 1AQMA 3G5XB 3O3UN 5HYSB 4XWGH 3FU3A 4CN6A 1MWAL 4BH8B 4LVHC 3ZUCA 1CDIA 1CICD 2G5BA 1JBJA 1C8PA 3OPUA 1S9XB 1VFUA 3IMUA 1OP5K 1E4JA 3F58H 2MHAA 2Y5TA 4GY4A 3WFBH 2R2CA 4O58H 1NCCH 1S8DA 2AV7A 2WC7A 5IM7B 3WLWC 1FZMA 4DK3A 5HI4C 5AFAA 5T1KD 1XEDA 1BVKB 3FHAA 2EIZA 1OV8A 5GGUB 2DL9A 4HJ1A 5CZVL 1AMXA 3N41F 4D0CB 5DRZA 3JWOH 3HBQA 4Y2DB 2WQAA 4FFWC 2G9HA 1Q0XL 1LE5B 1CGSH 1G1KA 4AGPA 1KCRH 1QUPA 4J6RL 2JKNA 3Q9PA 3G6DL 4ZUVB 4HS6A 2CWRA 4OZIB 3OJVC 1UD6A 4HKZB 5DQDL 4NKDB 4NC1C 5IOPA 1JYVA 3PREA 5FKAA 4YSSA 2XWTB 2A9ML 3CH8A 5HJ3A 1Y0LB 1EO8H 3OSKA 4WV1C 4KK9D 1G0DA 1UCBH 2H32H 3MCYA 4YEEA 2HMID 3P4MA 5DK2A 3A6OA 2ZD0A 2VDNL 2VISB 5AALA 1HHJB 4JDVA 3EYSL 2R2BA 4S0HA 1FV1A 4Q97A 5KJRH 1Y18B 5GISH 1J8HB 1WZKA 2GFBA 2VRAA 4BRJA 4BH7B 2QPUA 4AC2A 2ED7A 2P5EB 5CINL 3RX8A 1BVOA 4PHZA 1OP9A 2AJYL 3QFJB 4BSWB 1A7PL 3DX2A 4P5MB 4Z0XA 3DHJA 3ARFA 3G5YB 1ZLDA 4WI3A 1KELH 1SY6A 4HJ0C 1IKFL 2P80D 1ODUA 4PS4L 4KNUA 1DJXA 4LARH 4I0PC 4H5SB 5ICXB 3GHBH 5TDPB 3CN4A 4YZFF 5IHLB 1IAIL 2ESVE 4JQXC 1ZHNA 1BAWA 1FUNA 3CLFH 4M7KL 2NYKA 5IMMA 2GI7A 1NIBA 2WBJC 3L3HB 3K1DA 5FUOL 1KENH 2E6QA 1LO4H 4KXBA 4E9TA 2AJSL 3SKJL 2R1WA 2XTJB 4AMXA 3F84A 4Y5VA 4CADB 5KVEH 3BGFB 3VFSA 2ZPKH 1PLGH 3HE7D 3HB3B 3UFIA 4G6KL 3TZVB 4X7SH 1PG7W 2DRUA 1Z5YD 5BW7A 2PWHA 3DOSB 3DVNB 4PR5A 1IZJA 2FJGB 4M5SA 1KSRA 3P3RA 1CE6B 3O2WL 1Q0EA 1MH5B 4J23A 2A0LD 2Q86A 1JK8A 4ZNCD 2G3MA 3IGAA 3ZPDA 5EOCH 3DX6B 2GTZA 3LPWA 3T3MF 1U8HB 4ZBJA 3O0RL 2PXYD 4PJIF 4U1MB 4YHKH 1NM9A 3QUZD 4G7YL 4DPRA 5J9PA 4I3RL 4ELDA 1KN4L 3M17A 2YS4A 2LHAA 3OXSB 1MREL 3CPLB 4Y4HD 3BP6A 3APNA 4HULB 2YAFA 3MLUL 1IC4L 3O8XC 4JFDA 3RY6A 5EEXA 5K9JH 1YA5A 1IGMH 3VFTB 4HWEH 3O6FA 4KQ3L 2CJTA 3KL5A 4Q6YA 5AUMB 2WINB 5T1LA 1IGCL 4H7VA 5I66B 5F44A 5AB1A 1M6OB 1KB9K 3VVWA 3QYNA 5IHWA 3SKMA 4MSWA 1NBZB 5I6KA 5KS9A 4AZ8A 2GAZA 5DMIH 4ZMPA 1T66C 2R0WL 5JORB 4FJZA 3Q0HA 4ZOCA 3RWFA 2WXJA 4OF3A 5T3ZE 4PRHD 4TLSA 3Q2WA 4UIMA 3VXRD 3KNBB 2Y2WA 3LNFA 5D7LE 1LP9F 3EDEA 3HNTL 3DTXB 2XV2A 4GRWF 1E4XL 2GJ6E 4ZQKA 4ZXBC 1NAKH 3QHFL 4M4RB 1TJHL 1F6LL 2I9TB 3GUTA 2DQUH 2GY7B 3BQUA 5E4EB 5DA4A 1ES0A 3GSQB 2AEQL 2A83A 4XX5A 3UBXB 3GNMH 3LB6C 2R56H 2FLMA 2O61B 4POZD 1E42A 4OLVL 4UOJA 2OMYA 4H8VA 1F45A 1AE6L 1FG2B 3LNEA 4DZBA 3OKDA 4LSRL 1KPVA 1EAPB 1ZA3A 2EDHA 3ESVF 2X6AA 1KJMB 4WUUD 1AJ7L 3PNWA 1HHGB 2X6BA 2NY3D 1R4XA 2AI0L 2M1KA 2Q20A 1ILUA 1DQDH 3T3PF 1JWMA 1BBDL 3CAFA 2FWUA 2WCSA 3I74A 4NQVA 5K9QI 4YXKH 3WTXA 3T6VA 2GSGA 3AS0A 3K4AA 1HL9A 2OA9A 1JFHA 3IF1B 1FC1A 5EB9A 3BT2H 2A9DA 3VH8G 1I7TA 1ZMYA 3QUXB 2GJJA 1R0AL 3CJJA 3MNMA 1NAMB 4EE2A 1SHSA 1KY6A 4LCWD 4B27A 1WEJL 1OTSD 2CO4A 3MV8D 4FI6A 3QDMB 5E8PB 1VLXA 4FZ8L 4LSUL 5DWUL 5FO7A 3T0EA 4P5TA 5C8JA 3BAIA 5HPOA 5AAMC 1KXQE 1X4YA 4OM1L 2ZCKL 2F5AH 5INDA 4C4KT 1WITA 4KJPC 5G4NA 1O7VA 2X09A 3TT1H 1A6UL 1FZKA 1FRGH 3ARQA 3GMNB 4U6HB 4QT5A 1JNLH 4Y5YA 3K91A 4NAQA 4G72B 4NQDB 4DQOL 2BCMA 4XOCA 1GGIH 1HH9B 1YVLA 3B9KA 3EYFA 4IQHA 1MG2C 3SDXF 3TBWA 3OL2A 2H3XC 1G5GA 3IJ9A 3V0FA 4LLYB 2JB6B 3B34A 3KPRB 1SZNA 2E7MA 4N0YH 1PD6A 3QIBA 3UROR 3NIDE 3B2MA 3KCWA 3OKOA 5CBAA 2UWEA 4DN4H 4JRYB 2LVEA 2YHGA 4KUCF 1JNNL 3IMBA 4N8VB 4OGQC 2Z8SA 2ODIA 2FJFB 3S8WA 2HCZX 1L0QA 2A9BA 4PI2A 4P2OA 4WNQA 4N8PA 3P73A 3IFNL 3TNMB 2EVGA 4GRMA 4FYQA 1A1MA 2RD0A 5DUPL 4JNXA 2P8LB 2ZUUA 3C60D 1D5MA 1BZ8A 3NDZE 3E1ZA 1EFXD 2YEZB 4NSKA 3HZVA 1NDTA 1NUNB 4NNYA 2O26U 1AI1L 4N2OA 1J48A 3KPLA 4OZGB 3VXPB 3WHE1 3HJ0A 1YAZA 3K71B 5HVWA 3DGGA 3BVXA 4FQ1H 4H26A 4AL8L 2WB1A 4U1KA 1IGIL 1OOWA 1UKQA 5IBUG 3GBNH 3REWA 2ZG1A 1FNSL 1NUDA 2UY6B 4ELME 4FQQB 4PUBH 2BSSB 2EIKB 3FTXA 3H55A 4YIQA 3CXDH 4PRDB 4HUUA 1YG9A 1CCZA 2FSDA 1UACH 1M71B 2B1AL 3N43B 4DKDC 2W60B 1UUSA 2VRQA 4J39A 1DQLH 1U8JA 3WGVB 1KYUA 2KYIA 2J1XA 5J1AA 2X70A 4N5EC 4KQ4L 4JGMA 4PRPB 5E6SB 3VW3L 4K2UH 4LSVL 3EHBC 3KM2A 4X5PA 1A4CA 3QXTA 1AHWB 1XR8B 2QR0B 1SBSH 1VFBA 4OZ4B 4Q6IC 2VAAA 4JRXE 1ZT4B 2OL3H 2HXAA 4OGXH 4UIKL 4CBZA 1G84A 4JFHE 3HJEA 4CAGA 5EOTA 2J43A 4TNFA 3MRNB 5EULV 4PV9A 1DDHB 5HHXL 4G1EB 8FABB 3MJ9A 3IFOA 1BQUA 3LPOA 1YEDA 3PWPB 5BV7L 5DFVC 3EYVB 3ZSSA 4JM2A 1NGQL 4MVBD 4A37A 3BWZA 3V9EA 3HHRB 4LRNH 1QNZL 1QQDB 1KJ2H 2H32B 4Z95H 3U4BL 1DEEA 1QBLH 2VKXA 4RAVB 4WEMB 5BS0A 1AH1A 2MQCA 2CBMA 1KTBA 3L3JB 4NQSA 4QMEA 2VIRB 5LDSA 1I4FB 2YPLD 1S7XA 3CFBA 4W4OC 4M29A 4IEFB 1XGYL 2H2SC 3DYOA 4PBDA 4Y1SA 3UAEA 1P7QA 3EO1A 4AGLA 3FZUC 3BOVA 4H20L 3HG2A 4JUTA 5I5JA 4B95C 4C83A 1IIKA 5C0BA 5SWZA 4KZDL 3HLKA 3C8HA 3Q3GB 4UOW0 4H8QA 4HJGA 3FU8A 4J3OC 2HT4D 3UYPA 4IRSA 2VCOA 1QFWL 5L2KA 1HXKA 4GG6E 1F1GA 2YMOA 5ANMA 3ZQXA 1PFCA 4LSPH 4EI6B 5LXGH 5KVGH 4MJ4A 4HF5H 1GPOL 3QVAA 2C7UB 4IU2B 1J1PL 3OKLA 5MP6L 1E0OB 3C5ZA 4JN1L 3SCMC 3MREB 4HK0A 4K4KA 5I82A 5IMOB 4HSAC 5EA0H 5K1JA 5HHQB 1O7DC 2EDTA 5EU6D 2JCCB 1NMBL 5T33L 5B39B 2B4CH 1MZYA 3CC1A 1KBPA 5C07B 3GJEA 3IDXL 5ICZB 4EZKA 1PLCA 4NZRH 4WHTA 4KKAD 2ZOOA 5AW2B 2H9GA 1A9EB 4ZW6A 4HD5A 4MNHB 3AQYA 4WI6A 1F4AA 2JV6A 5TPWL 4AV4A 5MHSE 3GSWA 1A8ZA 1CUOA 3L1FA 4J4PC 1BQHG 1ZLUH 4MAYB 3BN3B 4YJZL 4B9ZA 4H1LB 2A6JA 2BRRL 5KVFH 1EPFA 4GLRH 1HL8A 3QO0A 2IDQA 2NY0D 3ILQD 4GIAA 5JA9A 5EIIB 3GSVA 4JG1H 2WNXA 5IQMA 4ONGL 5FV1L 1MRDH 5ICUA 5DMKA 3KM1A 5G55A 4XCCH 4PJBE 1LK3H 2WAHA 1VFOA 2ZJSH 3MRPA 2D03L 1EFQA 5F1NB 3RDTC 3IJEB 1FYHB 4MJ5B 4S0TD 2J71A 2X2JA 3DX8A 3KYAA 4BBWA 5AOIA 1CU4H 1MHEB 2NXYD 2DBLL 5GSRB 4OLEA 1ZWIA 5CWSA 4HUWA 5DJCB 2QLVB 2H3KA 2C9RA 3IRCA 2MKWA 5HD8C 4XPGL 5C08E 3U7WL 1F86A 3MJ6A 4IGBD 2P28B 2VR6A 4QXUH 4EDWH 1T7ZA 4IIZA 1ZANH 2Z6FA 1KLFB 1BFTA 1RZ8B 2VC2H 1TTAA 2Y7SA 5DJ0A 1NGYA 5E23A 3VGBA 2MQ3A 4OCNC 4I8DA 5JTWA 5DZ9A 4E9LA 2HFGL 1ZDSA 3LKNB 4G71B 2F8VA 5HDLA 1VEOA 3MACL 5I75C 1QR1A 3IJYA 5FX3A 4E42A 5AENA 1ETZA 4HJEA 3FN3A 1A25A 5BZWB 2G9KA 2Q3ZA 1LD9B 3E80A 4K8RH 5ADOL 3ME0A 4FJYA 5JPMA 4IBWA 5DK0A 2Q8AH 4NO0B 4W9KC 3CZEA 1TYJA 3CDCA 3I84A 5E6ID 3E2HB 4G5ZH 2XZCL 1R3IH 2YGQA 1KPUB 4ZTOH 4IHOB 4MA7H 1NSNH 3MKKA 4JY4B 3D07A 4PJDF 3DKHA 1CQYA 3CX5K 3MRGA 5JYMA 1LVEA 1IMHC 5EEZA 2V3FA 4PFEA 5D4JA 1R3LA 5KYUB 2XPYA 3CDGA 4FNRA 1IB5A 5J3HD 4YNYB 4UNIA 4UM9A 4FCAA 5E1AA 3F6IA 2B2XL 3GMMB 1MNUH 3ESNA 3MUHL 3F5WB 4WFFD 3SDAB 2R39A 4Y5XC 1WPCA 4OLZL 4E9WA 4EVNB 4QRTA 1UH3A 4TNGA 1VEPA 1JZHA 1UA6H 5DJ6B 3FQRB 2R15A 5HI4D 4G43A 4ZD3H 4ZMWA 4QO1B 3S97C 1MY7A 3VXOA 2J6EA 1C16A 3GTNA 4KX9A 2CLZB 4D9RD 3FF8A 1OEZW 4FFWD 1A4KA 2AJXH 3P0GB 4PJCF 1EEQA 4BFJA 5EBWB 1G9ML 2MH4A 3UYOD 3FQ1A 3IFPA 4JFPB 1JYWA 5EO1A 1MOEA 2AF2A 2Y5QA 4HKBB 5T1DL 5E8OA 1KCSH 4XB7A 3AFLA 2GIYA 4P3WA 2P5WD 3RWIB 2NXZB 5DD1H 1DBKH 3PL6B 4G7QB 3WUWA 4UT9L 3MV9E 2VLRE 2ZX8A 4W9DC 2KZKA 1GS7A 4I4WB 3GBDA 4F7PB 5IROA 2NDFA 2V7NB 3BDBA 2Q8BH 4RAUA 4L1SA 4QHUA 4ZYKA 4Q89A 3NYKA 2DMKA 2WKOF 3O4OB 4P4KC 1QP1A 2JIXB 5AW7B 3FT2B 4JFFE 4DKFL 1JHKH 4PJ9C 4QGYA 1KBGL 2BVQB 3V0AC 1ED3A 2FLBT 4XR8C 4A2FA 3FT3A 5D7JB 5CR8A 4B9JA 3L48A 4HJ0D 3U0WL 3QDJA 3H9SB 6PCYA 4I0PD 4JEGB 4PQXA 1TZAA 1WH0A 2NTFB 2Z93B 4OLWH 1OQXA 1QYGL 1UZ8B 2HJKA 1CJYA 5EF3A 5I1CL 2FATL 1TKWB 4FN0A 4U05A 3S0PA 3TBSA 3UAJA 3VO0A 3WIIH 5BZDA 3DJRA 5KG9A 1LO0H 4PJAE 3M1BA 3VFMA 2HA1A 3KLAA 4RGMB 3U7YL 1PYWA 2QSVA 1M7IB 3BFWA 2GBVA 1XDTT 3NA4A 1RUMH 3B4NA 2J8UB 2K3TA 3IDNA 5H37A 3JWNH 2Z4QB 4JFFA 4OQTA 4QHLB 2WJ5A 4N87A 1X5YA 4L3CB 1O6SA 4L37B 2AJZB 2BFVH 4JG0H 4V1DD 4Q9RH 3IK2A 1WBXB 2EKSB 1KIPB 1WP6A 4XT1C 3PV6A 1AGFB 2YLHA 3ULVH 1EAJA 1OXYA 5HYSG 3CH1B 4NT6A 3I9AA 3ARYA 4NNPH 3VFOA 3RX9A 2LTQB 1P5UA 2OL3B 4K71C 4Z76A 3C8DA 4PN6A 4CU7A 4O4YH 5TDNA 5CKAA 3VFPA 2EILB 1U9KA 4WQOA 3D0LA 4JPIB 3O8XD 3ILPB 3IMWA 4GXVH 1MVUB 1NCDH 5E8EB 1UVQA 1S3KL 3BEVB 4GUOA 1S78C 4JPKL 2NY2B 5ITBL 2WLNA 2YIHA 3EOBB 4FERA 4DO4A 3DHMA 1KJ2B 1T66D 5FLUA 1U8LB 2ADGB 3N1GC 1HKLH 4QRFA 2HRHA 5IKCB 2WTRA 5LBSL 4XVJL 2XA8L 1V7NH 1EDHA 1T4WA 1J0KA 2Q76A 3WNLA 43C9B 1JFQH 1M05A 3MOAH 4ZXBD 1KMGA 1XV8A 4LBEB 2ORBH 4AK2A 5I74C 4L8SA 5FFGA 4ATTA 4FP8L 3EJYC 5C0CE 1IJNA 1D5IH 1ZHKB 4JO1L 4UQCA 4ENZA 1IM9D 2E59A 1RY7B 5C9JB 5ICYB 5DEZA 3VTMA 2ZNWA 2SEBB 4ONOA 2W0PA 4XMKH 4NQEA 1N6QL 2CGYA 4B9CA 4EN3A 5I18L 2WYTA 1KWGA 3LB6D 3VGHA 2XG4A 5AD0B 3LAFA 3T0EC 1SEBA 2DYPA 1IGFH 2WP3T 3OKEB 2YBRA 3D39E 4K3EL 3LEXA 4PJ8C 4ZSOB 2XT1B 5I6OA 1B4LA 1GHFH 3VX0A 4KRPB 2AITA 5I76A 1R46A 5FDWB 1FLRL 1EBPA 4G9DA 3CG8A 3CZUB 4MA3A 5D6DC 4ZTPH 1JPFB 3DVGB 2DKUA 3OKKB 2EE9A 5DZJA 4LVNB 1BJ1H 3AQXA 1NC2D 1MJ7H 8CGTA 1QSEB 4NPYB 5DI8A 4HJSA 4Y1AB 2ZE0A 5I1KL 3PIQB 2H6PA 1CPUA 3BKMH 3LD8B 1OOAA 1CE1L 1IE5A 2E86A 2BNRD 4GAGH 4M6AA 3S5YA 5JOPD 3A23A 4K7PY 4U4BA 1JRHI 3OF6A 1V54B 3RYMA 3F7QA 1BZ9B 2J44A 2OXHA 3CC5A 3KBFA 4MNGE 3MX0B 4LHUG 4BZ1A 4J27A 1ZHBB 3CZNA 5CIPH 2VZOA 2YRZA 1F4WL 4J3VA 2YC1B 4GXUN 5FYKL 3I6SA 4OCLC 4N90D 1AG0A 4GAJL 1AKJD 4AEHL 1JZ6A 4BM7A 3NJXA 5H8DA 3MSPA 4H0GA 1F11B 1T2QL 4KUZH 4J12A 3FC8A 2BSRA 1GIGL 3Q6FB 1CFMA 2MOQA 3P0YH 4JFQA 1WK0A 5AZ2L 4TS6A 4H8WC 1A6VL 3FCGA 3SKNA 2ZUQC 1F4YL 1H3GA 3KPPB 3PGDB 3RJDA 3UTTD 1QSFB 4KK5C 1M4KA 3HC3L 3VD2A 1OK0A 2A9NH 2E74C 4TUKH 2KC0A 1Q9WB 5MENE 4GKLA 1G7JB 2OMWA 1RLWA 5EU3B 2Q7YB 5KW9H 5LNDA 2W59A 5LVEA 4WTZA 4XPHL 4NM4L 5KTEL 1FNFA 4JREB 1R47A 1SGKA 1Y07A 4QRPE 4L29B 4A7GF 1KB9J 4Z9KB 2A2QT 4KPHH 3FN9A 3I6GA 4XBGA 3KYOB 3QDGA 2MPVA 2W95A 4M9OA 2DTML 1QATA 3FSOA 3V4VH 4F7CA 3TIDB 3PCYA 2OK0L 3O2DL 4Y19B 4NQXA 3DPBB 1UZ6E 1MHHB 2Y7QA 1TTFA 3O9WB 4OD1L 4XAWL 5IP4A 4M6OL 1B90A 1N6VA 1DSFH 3I02A 2DMCA 4G8GB 4WGVB 3ZKSD 1Z9LA 3NIDF 3F7YB 4N86A 5JXAH 1XR9A 2YSTA 4CGTA 3PFQA 2CCVA 4ESKA 5I0VA 1HHKB 4KO9A 5DJDB 3B37A 5E56A 1MPAH 4G6FB 3MA9H 2VR9A 4LQFL 3VSTA 3B7RL 4P46B 5CMAB 3UBXG 3EGSB 2NZ9C 1KTCA 2DQTH 4JM2C 5E6UB 2RQEA 2NX5A 5DEGB 3NOIA 2EIDA 1NPNA 3S37X 5FEBA 4H40A 4I2XA 5FOJA 4FNPA 5KBPA 1FVCB 3QJOA 1XF5A 3EHBD 2QDVA 1UM5L 3PUUA 4P2CG 3WNNA 1TZIB 3SN6N 4H13C 1TEGA 4V11A 2CMRH 4Y4KC 3ULSB 3WIFB 1GCYA 3DXAB 3FFCA 4ELMF 1B6UA 4DGVL 1FN4A 3AADB 4XXCC 5DSCA 5FA4B 2WBWB 2V33A 4IKNA 1XSOA 5J5EA 1B4TA 2J8HA 2EDQA 3O4LA 3LVEA 4QRSA 4FTVB 4CSZA 2NCMA 4NM8H 5DFVD 1LE9B 2XN9D 5I5MA 2QZQA 3EUDA 1PKQE 3HR5B 1HHIA 4IRSC 3VWJB 4U0RB 4U6VH 2IPUG 1ZE3H 2FSEA 4B41A 4AM0B 4NLHA 1BA9A 3U7AA 3MCKB 5KBDA 2HLAA 4FXKC 1NOAA 3PHOA 1IU1A 2L4OA 2WVVA 5JW3H 2DMGA 4LKXB 2YGVA 3QCVL 1V7MH 4C56E 4NZTH 4QAWA 3APCA 3VI3A 5I1GH 5IMKB 1S7QA 4B96A 2J88L 3FZUD 1PQZB 3KJ4C 5IVXE 1NKOA 2E47A 3EDKA 3L5HA 4NQCB 4GPVA 4PRIB 4ODHH 5DRNA 1D9KD 3INUH 5DJYA 2B59A 4MDIA 2R4SH 4R90H 1J1OH 1UT2A 4RX4A 2IC2A 1M6UA 1PKQA 1RZFH 2B08A 3HG1D 5CILH 3DBXB 5TFSH 4PLKC 1JN6B 3BUYB 4IIQC 2JJWA 2IGFH 2PMZA 2Q0ZX 3EJCA 3LMJL 1IC1A 3QZWA 4E41D 4AIEA 3SCMD 2DWXA 4OCXL 1QD0A 3EH1A 2QSCH 4UILH 3WFBL 1L9TA 3FK3A 2VLJB 4O58L 4ZMAT 1NCCL 2PYEA 4BZ2H 2WWMC 2ZKXA 3CZSA 1L9MA 4PG2A 4WENB 2XQYA 3R0NA 2IH3B 5LGJA 3QPKA 1FHNA 1KLUA 1I7ZB 4U1IB 2AMGA 5FV2A 3TO4D 3RWGA 2X42A 3WKMH 2JQZA 1KG0A 4KTYA 4BFKA 3LZPA 4ONFH 5B1AB 4NHCL 3APFA 5E95B 9CGTA 5HHPA 4RA3A 4S1QH 1FO0H 2XG5A 5T5FH 4PCYA 4HYTB 3MLYH 1G5AA 2ICEA 4MMZB 1KCRL 1KJVB 5D71L 4RDBA 4GG6F 3NCEB 3SPVA 3C6LD 3HIZA 5MI0C 5F7BA 1T5KA 3W38A 4J4PD 3NGBC 5FW6A 3NESA 3UP6A 3AAZB 3IPFA 1WFOA 3LZFH 4Z7UA 2VO8A 4ZUUA 5C70A 1H5BB 3WXWH 1SOSA 1EO8L 3WJMB 3BH8B 1MCDA 4PSPA 1JCVA 1P84K 4PS7A 4XNBA 1RCYA 4GW5B 2W0FB 5D4HA 5AOZA 2IAMB 4A55A 3VDBA 3D85D 2Z91B 3SZ6A 3F7PC 4IKKA 5KJRL 5EFIB 1T5WB 4LLMA 3RURA 3IJHA 3P9MA 5IB5A 4RMVA 5FYLD 5JPMC 2VXQH 4G9FE 3PQYA 2EDBA 4ZS6C 2DICA 4A63A 4ZX6A 2ZSWA 4S1SH 4UB0L 1I1AD 3GHBL 1PKOA 4FQJH 4K07A 4NX0A 3ARVA 4OFIA 3VMNA 5IGXH 1L6PA 3ZJAA 1G4MA 4O2EB 3H9HB 5DU7A 3CLFL 1HE7A 2H2PC 2YD1A 4EXKA 4F8OA 2IALB 5FW8A 1XGTB 4KDWA 5LDUA 1UEYA 4B9YA 2BCKB 3QUYC 5E2VH 4AV0A 2X6MA 4PJBF 3CVHH 4DPBX 1CICB 4XN4A 4H88H 2LGNA 3IGUA 5KVEL 5BQDA 2ADFH 2CUHA 1PLGL 3S4SB 2XWRA 3I6KB 4YC2B 1FL5B 5AAWC 4A6YB 3MLZH 2CM5A 4LQ1A 3BGMB 5E6RB 5E9DE 2QMJA 1A6AB 2K7PA 2X44D 5T1KB 2FEDC 4XWOC 5B8CB 3SDDA 2XFXA 2FB4L 2X40A 4FG4A 3HUJB 4Y2LA 3FTYA 4G6AC 4QRQA 3L9BA 3IU3A 4PVLA 1U8IB 1L7IH 3QIWA 1UCTA 3BAJA 4YHKL 2A7BA 2WY3B 1VACB 2O1AA 2ZOKB 1WZ1H 4F9PA 1S9VB 2QKIA 1BXXA 4QJ4B 2EE3A 2H3NA 2HX9A 4YPGA 1Y1UA 1GGYA 1TQBC 1IGML 3OB8A 3AM8A 4OF6A 4DHLA 3MROB 3AMLA 1EZSA 3AQDA 2F7RA 1DSWA 4AQAA 5D1ZC 3KYNB 1LLAA 4JO2H 5CIPB 4NP4L 1RK0A 3EJPA 1LEGB 3UEZA 5IQ9A 1RZKL 1TQWA 1JXFA 3TESA 1U8QA 3QHZH 1E9QA 1MFDH 3B5HA 5F0MB 4OCYH 2ICWB 3OJ2C 1CFVL 5CS7A 5F93C 3HBZA 5EZJB 3VXQB 1U8OA 4MJJA 2VDMB 5KSBE 3WY3A 1EGJH 1MCEA 3ZYJA 4AENA 4BEIA 4H1LG 2NW2B 4PIRF 2OPCA 2PCPB 3ECBB 4JM0A 3C5SB 3SIKA 5BOZG 1NAKL 5EIIG 2BZDA 1ORQA 2YD9A 2FHBA 1MHCA 1JSYA 1BD2A 1GAFH 4KKLC 4ODXB 4YX2H 1ZGLA 2DQUL 4KQ0A 2VXUL 4I9WD 4JMNA 1NCIA 3IDIB 4HFWA 4YBLC 3GNML 3LKRA 2JJUA 3EYOB 3AQZA 2O5ZL 2V3EA 4X0KA 2OW6A 3QG6A 5LG6A 3BPLB 5GSVA 2E9JA 2OSWA 43CAA 4L0YA 2RB8A 4U1LA 3V4VB 4XAKE 1G6RA 3HE7B 1IBGL 5EO0A 4F2MB 3V6OE 1DQDL 3P4OA 4FNQA 4LFHD 2G0LA 3TJEL 3SY0A 1MCQA 1FPTL 2CRZA 1T4KB 2RH0A 3BT2L 1VF5C 3WTTA 3QNZA 3BZ4B 2P8PB 3GSXA 4DCQB 1GOHA 1U6AH 1EEYB 2VZ3A 4PVNA 4TMPA 3WOVA 2ZUTA 5F3HB 3I85A 2PXYB 1MAKA 4UAHA 3L2NA 2D4FA 4IU3B 4XCFL 3QUZB 1ECZA 4PJEE 2VDKH 4RSYA 3O6FD 2R1YB 2XACC 3AJ7A 5T1LD 4Y4HB 3TGXA 3ZE2B 1T2JA 3E9TA 3SE4A 4AH2B 4FJ6A 4OV5A 3TT1L 2CUMA 3WMSA 1FAKT 1F8TL 2DMBA 3F12B 1FRGL 2P47B 3DVFA 5BVPH 1BSIA 4PLNC 2FRGP 2F08A 1T0PB 5BO1H 4X6EA 1GGIL 3CX5J 3F62A 3HPJA 2HT3C 3BKCL 3H0TB 4TNVF 2UVEA 3WN5B 3QJTB 1UWYA 2V17H 4L3AA 3X14A 4PRHB 3QULA 4N0YL 5JIDA 3D18B 1ULVA 1X5ZA 3VXRB 4DN4L 3UZQA 2QVFB 4OVUA 2PF6A 3AB0B 4PJHA 1NGWB 1UQSB 2JJTA 4NI6A 3BQUD 4FLHA 3X11B 4APXA 4CC0A 3UZVA 4X6DF 4Z77A 4YDVA 1I3GL 3QC6X 4P9MH 1ID2A 4MMXA 3IM1A 4LCYA 1DBAH 2Q7NA 2R27A 4BWTA 3FQ4A 3QWRA 3AREC 1HSBB 1LILA 3G5XA 4OAWB 4OZIE 4PB9L 2P7TA 1OAZH 1S9WB 1SJHB 1EZVX 4NZFA 4X8JA 1SDDA 4XRCB 1GA2A 3D51A 2DIEA 4HPOH 4WUUB 5E8DH 5EORH 2NY6B 3EJYD 5IF0B 3SO3B 2NY3B 1NGPH 1ZSHA 2HG0A 3SE3C 5SWSA 2MOVA 1W91A 3U2SB 3A0OA 5EMYA 3STLA 3CXDL 3FFOA 3Q2CA 3B3IB 1A4AA 2DLIA 1FA4A 1J8HE 1OW0C 3A4FA 4L18A 1U41A 4L4VD 4D0CA 1E8WA 1T22B 2JQMA 2P5EE 4NCC2 2HN7B 3T0ED 1DQLL 4P5TD 3TO2A 3CHPA 5C0GA 4PJ8D 3QFJE 4ODWB 5JMRA 5I19H 4I0CC 4G7RB 4LCWB 5MEOB 1SJVA 3DV6A 3L13A 3MV8B 4HUMB 1SFDA 1W0WB 4CDHA 4R7DB 2VSCA 3T08A 4E0RB 4G1MB 4TNVK 2P1YA 4EDXA 3ROOB 4OR1A 2OL3L 4OGXL 2ARJQ 3B9KD 2ZQKA 3ATAA 1INDH 1FO0B 1S7TB 2R0ZH 4U6XA 5C92A 4UAOC 2G2PA 1IBYA 2JJSA 2O5NA 1K8DB 3FO1B 1HHJA 3TH2T 1JYNA 3GSNH 3QIBD 2XTJE 4GRLC 3FQTB 2N0KA 1HH6B 1IJ9A 3RL1A 2JB5H 3K6SA 2Z1KA 3QBTB 4LRNL 5IJBC 5KSVA 4P2OD 1ZDQA 1KJ2L 4P5MA 4Z95L 1BAFH 5DMGC 5C2UB 4F2FA 3BW9A 4OZHB 4XNXH 3DJ9A 4H5SA 5BOJA 1P6FA 4LNVA 3I3EA 2UXGA 1P7KA 4FKKA 3ARXA 2A74C 1B4JL 2GHZA 3NSYA 5DJZB 1LQSR 4F15B 4WHYH 2D3VA 4KJQC 3C60B 3L3HA 4J3OG 4LNRB 5TGBA 4EF3A 5AW8B 1KCKA 2ZP8A 1EFXB 1UEMA 3OHXC 1I3UA 2Y1YA 3MA7B 4A68A 1TQSA 1U8CB 4RETB 2XIDA 4X6BB 3ARSA 5FR3A 4LSPL 5I2IB 5G4OA 2I27N 3MZGB 3AXHA 1KN2L 4QLRA 4L9LA 2X4UA 3TZVA 5KVGL 4ODBD 1AXIB 1FFOA 2DKSA 2PLTA 3RX7A 3ZO0A 5FYKE 3EF4A 1TF4A 2IADB 1P9MC 3EBHA 1UWXH 3L1OH 4UT6A 3Q8FA 4P5KA 3D2TA 1XMWA 5E2WH 3TURA 4HEME 1X5AA 4UM8B 4QJ5B 3QNXB 1KEMH 3WIHL 3CVHB 4PRAB 3D34A 2WKOA 4FG2A 4O5LH 4I85A 1DZBA 2B4CL 1YEJH 4LOEA 2FO1A 3HZKB 4KX8A 1FFQA 2VXSL 4ONHB 4XC1H 1HE8A 1A6ZB 3TBTB 5LB1A 3K6DA 4NZRL 1L9PA 1OAUL 1E5CA 4J3WA 1HYRC 1AZUA 1MWOA 2Q2EB 1OSZA 3TPUA 5GIRB 5CJXA 2P45B 1TTUA 3RL2B 4KGLA 3ISYA 1JHTB 1KBVA 1YJDL 1WCBB 1QPKA 3LQZA 2BMKA 4PBVC 1PD0A 2YD8A 4JM2D 1GSMA 1SVBA 1I1YA 5JIKA 2WPGA 4YBQC 4JG1L 5KZCD 4UDUB 3O3DB 3DV4B 3VFVA 4G8FB 1UZ6F 3HC0A 5BS0D 4KV5F 1YY9D 1F2QA 4XCCL 3GI9H 1KIUB 3X1GA 5AW5B 4Q4IA 4AG4H 5I26A 1ZA6B 3TH3T 3UMNA 3GYRA 3ETSA 2NY5L 3FU7B 1CU4L 2GVYA 4KKPA 4R2GD 1P7QD 3QEHA 1U8NA 4AQEA 5BUGA 2PO6C 1AP2A 1XO8A 4EXPX 3BWUF 5B1BB 5C0BD 2YPLB 5SWZD 1GMIA 2I24N 5E70A 2WN3A 4CC1A 3A6CL 4ZFOA 4EDWL 3QDME 4MXQD 1DLFH 1Z3GH 3OMZA 4IRSD 5L2KD 3SDCA 1B2WH 3LJ3A 3BLKA 2O61A 1OB0A 3ZZ1A 1RURH 3E7JA 4QXVA 2ENQA 2Z7UA 5C6WH 2B8OT 3C5ZD 4BYHA 1COBA 3BHBA 5IJVA 1AZCA 1QO3B 4AIZB 1HHGA 3GRWH 3QQDB 2G75B 5SWQA 4MQ7A 4NQDE 2HPTA 2F68X 25C8H 2XKUA 3TA3A 4JQVA 3KCPA 5BVJB 3OLEA 4G5ZL 4B0MB 3KPRE 1MLBB 1TTRA 1JZIA 1R3IL 3DVIA 1NAMA 2NNRA 3ARGA 3MBWB 4HBQA 4RQQA 2XLLA 3TM6A 2BSTB 3KL3A 1NSNL 2YKLH 1ZLSL 2ICEC 4JRYE 4CJ1A 4MHHG 2X4OB 2BHZA 5EZOL 3MO1B 3V4PH 4H8UA 5EU5B 4PLKD 1QASA 1X7TA 4NDMB 2DQJL 1XSKA 1B4RA 1YDPB 3FUKA 4ODVH 2P24A 4PY7B 3QUMA 3OJDB 1D5BB 4FNTA 2ENJA 1MNUL 4L8BB 5I15H 3WTWA 4EUPH 1Z7JA 2WVUA 1A02N 4X5WA 3AU1B 1EEZB 2IQAB 4JUSA 4WU7B 3QEGH 4ZD3L 3FCTB 4X8GA 2IV9A 5LGHH 1I8KA 2PYFB 4OZGE 2NY0B 4JJOA 4P23C 2VDKB 5CP3A 1T6VN 2VH5L 5IVXF 2F53A 2JB6A 2ICCA 1BFOB 4JQIA 1IUZA 4JKNA 1MG3C 4MMYA 3LIUA 4DT2A 5IREA 3HG0A 4JBSA 1ZGLM 2F15A 2JTYA 1KCSL 3FQWB 4N8VA 5FDYA 2XBDA 4BFBD 4KI5E 1CTOA 2IBBA 5JW4N 1T7YA 1DBKL 3EO0B 3LEYH 5GS1B 1UWEH 2EYTB 2NXYB 12E8L 3MZTA 3UJTL 2P4AB 3S7GA 2BVTA 4RMUA 2ATKB 5LGKA 4HWZB 5C0JB 1YY8B 4GW1B 2UZXB 2K4AA 4IGBB 4PRPE 1PZ2A 4DP0X 1LTXA 2D3LA 5SX5K 2BOBA 5GHWH 5C09A 4AYBA 5HPMB 1JHKL 3VD3A 5DWPA 3VU1A 3ARTA 3B83A 3ZTCC 2BNQA 3P9LA 4DN3H 2F58H 3TWYA 2NT0A 4ZS6D 2Y69B 3TT3H 1O5DT 3MR9A 5TQ0L 4ODTH 4TSAH 2BSSA 3FH7A 4OLWL 3RUGB 3QRFM 4NNXA 3GUFA 4YHNA 1L9RA 2CGZA 3SDDC 3ULAB 5E6IB 1A7QL 5JO5B 1MXGA 1ZV5A 3HMXH 3OXRB 5F1IB 3WIIL 4BSVB 1Z66A 3CFMA 2AEOA 4AQ1B 4OUOA 1LO0L 4CW1B 4NUQA 1E27B 5DFAA 3BCDA 1GGBH 2J8OA 1K2DA 5ESQB 1A9BB 4DEPC 2BX5A 1OGAA 4Z5RB 1C5CH 1F4XL 3NCYP 3QUYD 1A47A 1IT9H 4LVHB 3O3EA 1AHWA 4BCZA 4K3JH 4LDEB 5TE7H 1Q94B 3N2JA 4HIXH 4JG0L 4AE0A 2OMTB 3HS8A 2IOMA 2JFCA 5DRWA 1VEMA 2VLLA 2FEDD 2DWEA 1F6AA 4DOHB 4K3HA 4RZCA 2KERA 3IPEA 3PWPA 2DW5A 5L2JB 4G6AD 3EYVA 1R5VA 5IVZB 3WI9A 4QY8B 4ZO7A 4LIQL 5A40E 1XXDC 4NNPL 5FUCC 5L6YL 3GMOA 3JTSB 2OI9B 3ZTNL 2X4PA 4N0UB 4MDRA 1MCWW 1QQDA 1U92A 1JK9B 1YYMH 4LCCA 5IQOA 5FB8B 2HLFC 2P5WB 4HIHB 2L7EA 4TM9A 2BVYA 4B97A 3CSYA 4ANWA 2C1OB 2JH2A 4GXVL 1R6VA 3MXWH 1NCDL 2JCCE 2VQ4A 4WV1B 2HX7A 3PAYA 5D7SH 5KVEE 5DVLA 4UQ9A 5DFTA 3IDJB 5D1ZD 4YGVB 1LMIA 3L8QA 1Q9KB 2ZOTA 3CUPB 3H6AA 1QHOA 4HXBH 5GZNA 4XVOA 1JUFA 1KFGA 1HKLL 1VB9A 3L9RA 5E1IA 3V55A 3QDJD 4OLXH 4WJKB 4WTQA 4ZAKA 4N0CD 3NN8A 2LOEA 3NFPA 3VTAA 5DZLA 3WKPA 1JFQL 2UY7B 3MOAL 2X6UA 2XYCA 5KBLA 3RAJH 4MASA 2ORBL 3MREA 3P3YA 4M1GL 1I8IA 4N5UA 4XNYH 5TDOB 3UAJD 5IQ7H 4I0PB 5E6ZA 1VIWA 3SBQA 1ZJBA 2R69H 1D5IL 2TRYA 1P84J 2IFGA 4KOCA 3B43A 2XVLA 3PAVA 5B39A 1REIA 4QCIA 4K73A 1M2VA 4BZYA 2ZONA 5C07A 3BPCB 5ICZA 2VZSA 3PV7A 2AEPH 2VM4A 4HZAA 2HTLD 5DHVB 2WW8A 4MQTB 4A6YL 1IGFL 3NIFB 5IQNA 1HOCA 4FNSA 4IHBA 4FOMA 2Z92A 4ODUB 4O02A 2XKSA 1AD9B 1KT2B 3GEWB 4JO8A 5EDSA 5KSBF 1JNJA 2BIHA 4YUEH 2WIIB 1C12A 4ZTPL 1MIEH 1A64A 2OM5A 3ISWA 5I1LB 1FSKC 3KGRA 4V1DB 3K0WA 1OPOA 2O6DA 1MJ7L 2X4TB 4F27A 4N1CA 3TBVB 3KDMA 5DMYA 4FQIH 3IYLW 3BKML 4JS7A 3CFKB 3FBQA 4NUJB 4AT6A 1YUHA 1DLHA 2ETWA 4HS3A 4GAGL 1FBIH 2PUQT 1PX3A 3S4SG 2AKRA 3M7OA 1BYNA 4EKXA 1Q0YH 1CGXA 4MJ5A 4Z7VB 1TJMA 3SKUD 3OMNB 4YHZH 4XO9A 2QGBA 2IV8A 5CZRA 2EH7H 3O8XB 4N24A 5ID1B 5DUMH 1NZRA 2FEEI 3FB6A 3E8VA 2X4SA 1KGIA 2VDML 2AJUH 5FYLH 2NRDA 3AGVA 1AG6A 2Y7MA 3P0YL 3W9EB 3PJNA 3L6FA 4YDMA 1HZHH 1BW8A 1THAA 3VSQA 2XVGA 1X5HA 3GMLA 3OKNB 1R3HA 1ZVSA 3AW5A 2JKIS 4P9HL 1GW0A 4TUKL 4WW2F 3G5WA 5FOBA 3N44B 3VA6A 1T3FB 2C9XA 4KZEH 3LIZA 3OGCB 4PJEF 5ANHA 3SSGA 1LD9A 4XPBH 5KW9L 1LK2B 1NTDA 4ZXBB 4Q9BA 3BLPX 1NGXA 1SQ2N 1G94A 4EN3D 4Z7AA 5HHMD 1ILSA 3QO1A 3KLHD 1NGZB 1DHKA 1IM9B 4KPHL 4ES9A 4FXGC 2WGXA 2XSKA 4IHOA 1DFBH 2K1MA 4PS8A 1NANH 3LNIA 1J88A 1IKOP 3M7FB 3V4VL 5D1XC 4KO7A 2D7MA 4MKMA 2YA2A 4RFNB 2YRLA 4OFQA 1NEUA 1FNGB 4L23A 4GFXA 3MRBB 3EUUA 3K2UH 4KXZH 3GTVA 4CVZA 3AS3A 3AUWB 5JXAL 2J1WA 3KYKL 3QFDB 3SDAA 3BRFA 3V4LA 1RUKH 2PABA 1EJOH 4XVSH 4I5BB 2AVFA 2VM9A 2Y36H 3FQRA 3NCWA 2OMZA 3FH8A 2XI9A 1MPAL 4Z7WB 3MA9L 1NC2B 1MFCH 3BVUA 3V4PB 1ZTXL 3UTZB 4LO9A 5DJ2B 2CLZA 3BAEL 3KE0A 5FM5M 2DQTL 3RVWD 4XMTA 3OF6D 5A1AA 5DC9B 1KBWA 2BW5A 3CFDB 3BSZA 1B6DA 4FZEH 5IB4B 4OZIF 2O30A 4EUPB 5L0QB 2BNRB 3EFDH 2AJVH 2E7HA 4IKJA 5TF0A 3H9SE 3F7VA 2L7JA 4E9SA 1WV7T 1YMMA 1I1FA 1FIEA 5JR1H 5F97E 2Z0BA 1C1EH 1R24B 4X6CA 1AKJB 5CO1A 3MMEB 5I8EA 4IM8A 2HH0H 2FL5B 3D48R 4YVNA 1OT1A 4X7TB 2Y7NA 1QFPA 1CD1A 2MRYA 1TITA 4N8UA 2Q2LA 3FHEA 2J8UE 3CFTA 1EERB 2E75C 4JPQA 1BQSA 3CFNA 3H42H 4WHCA 3EJJX 4GSDL 3HZMB 4IJTA 4QHNA 5EEWA 3UTTB 2YD4A 4V33A 4Y16C 3SE6A 4LDLB 1JGEB 1F3DJ 3S96B 1JZ3A 3DA0A 1MI5D 3GM8A 2VZTA 4WK0B 3HI5H 2YPVH 2X5PA 3SPIA 4CN1A 1S3RA 3QDGD 2NTFA 2RBLA 1TCRB 1BMWA 2I60L 4J8QA 1YPZB 1V7ML 1G4RA 1TKWA 4NZTL 1VGKB 1OB1A 3NZ8B 5I1GL 4FEIA 4F2EA 2IIJA 3CVIH 5ESVB 1CDUA 1E6JH 2KBGA 1M7IA 3FRPA 3UO8B 1MQ8A 1MCCA 4ODHL 1UH4A 3QZNA 1NMAL 2R4SL 4JANB 5I1HL 3D12B 1AGEA 5EN2B 2X0VA 1RZFL 1L9NA 1I82A 5DUBB 1UG9A 3TBBA 2VW7A 5IFAH 3ZKNC 3POCA 3UTQB 5J4MA 1P7BA 2EDYA 2EIJB 3FQXB 2RCSH 4OBSA 3RRQA 3BEWA 1WBXA 4UILL 3KW7A 5MEQB 2NX5D 2HUHA 4RZKA 5CEZD 1IFRA 4IBYA 4LPVA 2ZKMX 4AE1A 5CBEB 1A7OH 3QC5X 3TTYA 2MNUA 5AEAA 3WTUA 4E5XA 4RWYH 3WKML 3MFFB 4G11A 3PHQA 4N2IA 4ONFL 4A2DA 3HMWL 1WAEA 2F18A 1FO0L 4S1QL 1WA0X 1Z9NA 4P57B 3NFSL 4YHLH 1NBYA 3MLYL 3GBMH 3KH3A 3CBKB 3EHBB 3GO1H 3U4AA 5FO9B 4MCNA 2PCYA 3FO9B 3UPRA 1QTPA 1KFAH 3O4LD 1FL3A 3HOGA 4HUXB 2J6WA 3B5TA 3MFGB 5KVDL 3APMA 2E4TA 2XNAA 4XPFH 1FH2A 5KVGE 5H2BB 4F7TB 4CL7A 4LAQL 3Q43A 3SDCC 4YBQD 1EMTH 2VGLM 5B1KA 4ZSOE 2P52A 2ADGA 3LKSA 5HTSA 4MJ2A 1PZAA 4L3ED 3TC9A 3MUGB 4A7QA 4R0LA 2XN9B 1KUMA 1AD0B 4LKCA 5AVTB 1E9OB 4XGZB 5F0LB 1IE4A 3V0DA 4XN1A 1IAKB 1G1CA 5HHNB 5H4YA 4N2KA 1OAKL 43C9A 2QPFA 1KB5A 1SBBA 4LBEA 3TA3C 4M7ZB 4K7PL 3ZKQD 4JQVC 2VXQL 2R1XB 3B6SB 3ESOA 3NJGA 3NFNA 5TJWK 3SOBH 3GRBA 1IBDA 3W0WA 3JBG7 2OMNA 4G8IA 4S1SL 5C9JA 2AQQA 3DBSA 3RVXC 2WMPB 2SEBA 4IJ3C 5C0FA 4GW4A 4QTFA 2DI9A 1ADQL 1BWWA 3E3QE 1WS7A 5GS0D 3MJ8B 4RX4D 4EIGB 5F7HA 5D7IE 3KGUA 4N0RA 4LRIA 3DGCR 3IDUA 3OKEA 3P0VL 4PJ5D 5MEPB 1D9KB 3TL5A 1K5NB 4G7VL 2C9SA 3BIKA 3WS3A 4Q8BA 5E2VL 3HG1B 5K9OA 3POHA 2PYED 3GDCA 3CVHL 1J05A 1AGBA 3GSOB 1IFGA 3OX8B 1J10A 1J1XL 3S36H 4E41B 2NUTA 1TQUA 3SCMB 2D0HA 4YE0A 3EJQA 3VDAA 3EDDA 5ADPH 2CIKA 3FNKA 1QSEA 1RJLA 4U1HB 5L9DH 1T1XA 4Y1AA 3MLZL 4X6DA 3VQ2C 1BFVH 1QSFE 4AXWB 4OJFH 1JV5A 3QPQC 2BRQA 5BXFA 4DK6A 3QORA 3TO4B 3ATDA 4M6NH 2WBXA 3EZ8A 5B1JA 5DD5L 5HVGB 4P48A 3MV7A 2X2UA 4OI9A 4FABL 1YN6A 3V0WL 3WNMA 4XMVA 1ZHBA 5DFWH 2UZPA 2FECI 4GMSH 4OF5A 1WZ1L 2AV1B 3C6LB 1JL8A 3N06B 3F00A 3HKZA 3TYGL 3T8XA 4HCRH 3WKNA 4EJ1C 4P59H 4MJ6B 1CK0H 4U4IA 2I5YH 3M45A 1G9NC 2MIZA 4Y19E 1DBML 2NNAA 3Q6FA 1FORH 2BNUA 4L8DA 4P23D 3VUAA 5EU4B 4M61B 4KHXH 1JGUL 2D7OA 1S5HB 3O6LH 2QSTA 3APDA 2FQFA 3D85B 3QHZL 3H7BB 4N68A 1PZUB 4NO5A 4OCYL 4RMWA 4OSUH 1PU0A 4YSEA 2VABA 5H35A 1NPUA 1SYVA 1EXHA 3F04A 4H8WH 4OLUH 4PV8A 1A7RH 2W91A 1DQKA 3GMQA 4CVWA 2CBPA 4MD0A 3K4ZA 4MAUH 1W72H 4HQQH 3WXVH 1OAXH 1VPOL 5HYJA 1ESOA 3O41B 1ZVHA 4U1JB 4IBVA 3VGEA 1I1AB 1EIBA 4H0HB 1YN7B 2HFTA 1XT5A 1NCWH 2DS4A 5HHVH 3GF8A 2DF3A 3DPBA 1TNNA 1YSOA 3ZQ9A 2G5BB 2F1AA 4M6MH 5I75B 3C87A 1GGCH 3CN0A 4G8GA 3LOWA 5JW4Q 1KC5L 2GTQA 4I1PA 4YHPA 2Y5TB 3ZRCC 2JWYA 2APFA 5E2JA 2AV7B 1FZMB 2AQTA 3KLQA 4FTVE 4XBEH 2J5LC 3D0AA 4OF0A 2OCFD 3N43F 3SDDD 2EIZB 2NY4D 5CMAA 3RPBA 2OCJA 2XQBH 1MIMH 3EYUL 4HIIA 5DRZB 4LT7A 3ZLQC 2D8KA 2HVBA 2WB7A 1NDMB 2G9HB 1PAMA 3ESMA 3C5JA 2WCGA 3MJ9H 3ZE0F 4ADIA 5C97A 3WTVA 4ZT1A 3RA7H 4KZ0A 4N20A 3ZE1B 2G60H 3GC3A 3X3FH 5A2BA 5IOPB 2VDKL 5HJ3B 3WHE0 3QJQB 3P2DA 2HKHH 2FK9A 4AI7A 2ZUWA 3DXAA 3MRFA 3MUUA 2IEPA 2AK1H 2R29H 4HGWA 2IH9A 4NHUA 4QYOA 4RGOL 1MRFH 4NQCE 3VJ6A 1MFAH 4PRIE 2FX9L 4JDVB 4ZO9A 2YD5A 4ELKB 5GZNC 1FV1B 4XTRC 1D7CA 3B2UD 3V0VA 4N2BA 5CLXA 2GFBB 1AR1C 2CUAA 2VXVH 3WDJA 2RFXA 2VERN 2ZXBA 1XGZA 3FRUA 2ZCHL 3MBEA 1FCCA 2O5YH 4MQXD 4TQ8A 4YR6A 3X17A 2V17L 4FLOA 4AM0A 1EQWA 4Z0XB 5CCKH 2VLJE 5IHUH 4JPSA 4IRZH 2HLFD 3MCKA 4WFEE 3VTTA 2C9PA 4U1NA 3LKPA 3H3PH 3RIFF 2XTSA 5JHLH 1BD2D 3CVCA 2KZBA 3JWNE 4GLRI 4P2QA 4XC3H 1TT6A 3BMWA 4PGCA 4LEXH 3JUZA 2EDDA 1WWCA 1MFEH 1ZHNB 4YFLI 5AVRB 5JNYB 2CO7A 3M1CA 4ZMTA 1BG9A 3CCHA 5IMMB 5CZKA 3UGEA 4NENB 4I88A 5FFOA 4I18A 4NQCA 1DZ0A 1DBAL 4XPTL 2WLMA 4FQ2H 2A6IA 4PJXA 1MVYA 2BK8A 2R1WB 4Y5VB 4U31A 1J5OL 4C4KO 2X1WL 3BUYA 3I6LD 4JJ5A 2BSBA 4LPTA 2DWSA 4HPOL 3B9AA 5DD6A 1WICA 1INEL 5E8DL 4TSBH 4PR5B 2VLME 4HJJH 2XV3A 5FK9B 5C0EB 3V0IA 2E7BA 1GZQA 2JCCF 4Q7DA 2WXNA 4U1IA 3RU8L 2Q86B 4PRNB 4OZFH 1OY3B 3IGAB 1PCXA 4L2LA 5TF1H 1XCTA 2F54E 2GTZB 2EVJA 5KSAC 5HYIA 5J9PB 5IWLA 5GRJH 5HDQH 3M17B 5CU9A 5I19L 2HAZA 3KWXA 4M1DH 5IOKA 3ROLA 3G5VA 2VDPH 1I1RA 2Z8VC 3BP6B 4RFOL 4P3CH 2FTAA 2D3JA 5DD3H 5EOQH 1ZY9A 1N12A 3O6FB 3QHTC 5I30L 5FUZH 3AG1B 2NMSA 5E5LA 1SOQA 5T1LB 3VQMA 3P3TA 3WJMA 2NUPA 1JZ8A 1U2CA 3SKMB 4MSWB 2K8MA 1INDL 2R0ZL 3EGXA 4BK5A 5KS9B 4X9BA 2GAZB 3QJHB 1S5IL 3U1SH 1HCYA 3RIFK 5ISZA 4JGNA 4K9EC 3RWFB 4DFHA 1GMEA 1DQJA 2Z91A 3VXTA 1XGQA 1PZ5A 4UIMB 2DPKA 5EF2A 4YDLC 2DI8A 1AY1L 4K71B 1K3IA 3OB0H 4NXSA 4NKIH 2JB5L 1PG7H 1K5WA 2RGSA 1NBVH 1NKRA 1LXMA 1YEFH 2AQ1A 3R7RA 1XBRA 5B22A 1WWBX 1AQKH 2BINA 3IJSB 2YEVB 1BAFL 3CV5A 3ZMNA 1ZLEA 3GUTB 1RPQA 4XNXL 2YMXH 1SN0A 4OLYL 3BQUB 3HUJE 3QWRD 5INCB 1ES0B 1AIFA 4RMRA 4KY1L 1KXVC 1JI1A 3N04A 2FX7L 2HJLA 4HS8H 2I07A 3BESR 2OMYB 5AB9A 3RZCA 3GXIA 4DZBB 1TLKA 3OKDB 1KPVB 1ZA3B 3QI9C 3P3UA 2X89A 3D8MA 3UTSE 3PXLA 2WZPA 5I8CB 2G4EA 5SWSD 5KN5A 1EA9C 2LAAA 3D6GA 1JWMB 4NQVB 4XCYA 1N6UA 3SD2A 2BY1A 1HKFA 2C34A 3GTTA 3NAAH 5HDWA 2MPAH 3FTGB 5CJQH 1H9VA 2Z64C 4QUOA 4M93C 2VWEE 4FFVC 2AS5M 3ZZLA 4Z3IA 3SYCA 5J8OA 2Q10A 1G7IA 1IGJA 4YSAA 1RK1A 4L4VB 4KTEH 5FO7B 3T0EB 4M7JH 1YEJL 4P5TB 5C8JB 5DVKA 1K6QH 4NN5C 4DUVA 4XP4L 4PJ8B 3BVNA 3L3IA 3S3CB 4M02A 1VACA 2ZOKA 3B8SA 5INDB 2LV4A 1VKXA 4ZMNA 1T0NB 1WA1X 2AABL 3GLEA 1AAJA 1FZKB 1TQTA 1MFNA 5EDXA 4MYWB 4QT5B 4X9GA 1W6LA 2DWDA 3CU7A 3HRZC 5DJXA 4DW2H 2BIPA 1IEAB 3B9KB 3EYFB 3N55A 4NFCA 5KSUA 3TBWB 3VGDA 3DLQR 2H47C 1J5CA 3UGXA 2N7BA 3QIBB 5I8OH 3OKOB 2P9RA 1JPSH 2UWEB 4HIJA 3PG2A 5DHDA 2HT2C 2ZXAA 5EZJA 3VXQA 4F2ME 3GI9L 2X12A 3KPNB 4WNQB 3BVVA 4P2OB 3UYRH 5FHBH 4AG4L 3ECBA 3P73B 1TNMA 3QEUB 1YNTF 1XMEB 2B20A 4HA1A 4GRMB 1A1MB 2EE2A 4GKOA 1U33A 3GXUB 3V7AG 2VDRH 5K1VA 4DEWA 3QQXA 4GBXC 4ODXA 5D2LB 4E9YA 2H1LM 1KULA 2I7SA 3MRLA 1KCUL 2YD0A 4NSKB 5J1TC 2VDOH 3K80A 3HZVB 2DN7A 4NNYB 1WLHA 2FD6H 3WGUB 1MUJB 1BOGA 3OLGA 3IDIA 1ZTXE 2F8XC 4ECNA 1NICA 1B2WL 1CDCA 4FL4B 1JRHH 3UACA 1W72B 2CR3A 4Q74A 1RURL 4XXWA 3ZE2E 4H26B 1NEZA 4U1KB 5DZVA 5E5RB 4L2YA 1IRAY 4WKXA 1AR2A 2CDEB 4WZ9A 4OD2A 3REWB 3GRWL 4PWGA 3CZLA 3RVVD 5BQ7A 1SJEA 1NFAA 4F2MA 4FYTA 4HUUB 1WC7B 3DUUB 4OJEH 3U9UA 4C54A 4OQTH 4EAEA 25C8L 3JTTA 1QACA 3UO1H 4L1HA 1U8JB 3EH5B 2AQ3A 4HC1L 2ENSA 4PRHE 4XNQA 2GPZA 1QBMH 2WUBL 3X1FA 2VKWA 4FA6A 4HIEA 5KYWB 5J1AB 2J8UF 3IXAA 3SKOA 2X70B 5D7KD 3UADA 2FDBP 3MRIA 2APTA 2HFFA 1FG9C 3Q44A 1MNNA 3US1A 4BKLB 4EI5A 3V4PL 1VFBB 2O6FA 2VAAB 3S9DB 1H8SA 3D33A 2QQLL 4A66A 4DKEL 5EPMB 1KIQA 1M42A 4Y4HA 4PTUA 4I3GA 5EOTB 1KGJA 4PV9B 5I15L 2FHFA 1HILA 1L0XA 2Q3AA 1Q1JH 3TIEA 1J86A 1IC5L 2QGDA 5C0DA 3LHAA 4YDJA 5I5RA 3QEGL 4S1DC 1YEDB 3SPHA 3HZYA 4R0LC 4JM2B 2B9AA 2OSXA 2Z3FA 3IFLL 1S9YB 1ZPUA 2DJ4A 4GI8A 4AMKH 4DETA 5BMFH 3REVA 3WN5A 5AVVB 4WUUE 2Y4SA 2ED9A 2I32A 2K8QA 5KZCB 1BOYA 3RFZC 3IN2A 3VXRA 1NCJA 1DEEB 4TVPD 4MS6A 5DLML 4AOFA 5SX4I 5BS0B 1OP5H 1ZIAA 1XCQA 2V9TA 5L4IA 2KHAA 4LCIL 1XF2A 2GUOA 5D96C 4KH9A 1OKEA 3BKYH 3I50H 1B3IA 2R9HC 3X1BA 1CYGA 1RK7A 4F91B 2AERT 3CFBB 1S7XB 4JDEB 5I17B 1OGTA 1L6ZA 3LEYL 3SD5A 3X11A 1E30A 2EDWA 1UWEL 2AGJL 3C75A 1P7QB 1Q38A 4R2GB 5BRQA 3SDCD 1EX0A 3W56A 4C83B 4LRIC 5HJDA 4AKOA 5C0BB 5SWZB 3T1FA 1BM7A 4LCWE 3W3BA 4OJAA 3TOPA 3MV8E 4HJGB 3UC0H 1YYLL 3UYPB 4IRSB 3MODH 5L2KB 2AXHA 5DLLA 4M48H 2IG2L 1UOLA 4LSSL 4C57C 5HI3C 4WEEA 1J87A 3T2LA 5GGTH 3DIVA 3OKLB 4PREA 3TA3D 3C5ZB 4FXKB 2ICWI 4XCEA 3B7YA 4DN3L 2F58L 1IQWH 4HK0B 3K7UA 1KGUA 4WFGD 3D69A 4ERSH 3TT3L 5IB2A 4A67A 4TSAL 3RVXD 3X1NA 1UFUA 3ARGD 3B3IA 1T6BX 5JIHA 5AW6B 1KIRB 3OJMB 2LQRA 4U7MA 5KVDE 2CNZA 1VGEH 3HMXL 4QRUB 4JFWA 2BHYA 2CXGA 2F5BH 2Z31C 5CEYA 1Y1DA 3WFDL 2H9GB 4AJ0A 5AZEH 4P8QA 1XD1A 4BZ2A 3CVDA 4MB1A 1KGYE 1C5CL 1YEHH 2WYHA 2XXFA 3CFUA 1IT9L 4NIKB 3GSWB 1L9OA 4IIQB 4PLJC 3VWKC 2D7PA 2UV3A 4XP1H 4K3JL 1EAOA 4YXHH 3BUBA 3EOAA 3MV11 2A77H 2MWCA 1QW8A 2A6JB 3QO0B 3CFQA 5T5FA 3F65A 4J8RA 2W9DH 3QW9A 2F53D 3GSVB 4ZOEA 3HCVB 2EVHA 1JMXA 4I48A 1I8LA 4LOUC 5T3ZD 5D7IF 5JUEH 3GI8H 2VN3A 2Y6SC 4H44C 1WE5A 3MRPB 1BX2A 1FHGA 2E5EA 3KHQA 3IMSA 4YFLF 3DX8B 3DC0A 5D93C 3RI5F 2D2OA 5MI0B 3VXSA 3T71A 1ZWIB 2CLRA 3NGBB 4X5XA 3OMIB 4HUWB 4OZHA 1H6UA 2V4LA 5B38A 3ZTDC 3Q5TA 1S7SA 4KROD 3MXWL 2LFEA 3TXAA 2WXMA 1CIDA 2CH8A 4BHUI 3D5OF 4FA7B 2Y07L 4ISVB 5DJ0B 1W2KT 1NGYB 5AYUL 1Z5LA 5FM4A 5C09D 2JI2A 3BP7A 1HJCA 1JTOA 3HE6A 4UWQB 4HXBL 4WTXA 2Y7LA 3ARBC 2XBZA 3IJYB 4JE4B 4N2AA 4YWGH 3W5NA 1WT5C 4WK2B 5JQ6L 2BNQD 1ETZB 3GJFA 3QRGH 5BUPA 2WAQA 2XPZA 4OLXL 3ME0B 3WENA 2G3NA 5JPMB 5DK0B 1CG9A 3MHZA 4RNRB 1TOXA 1BFSA 3S35L 4XNYL 5LQBH 1DR9A 3BZFB 1IC0A 1HCZA 1SYSA 3SBRA 4J6IA 5EU7E 4UINL 1QFUH 2O6EA 1OGAD 4JPVH 1J9TA 4AM0Q 3QG7H 1R3LB 4X8CA 4ONHA 3CDG