3I9AA

Crystal structure of human transthyretin variant a25t - #1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPTINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Crystal structure of human transthyretin variant A25T - #1
rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 25
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3i9aA00
1TT6A 4PWKA 4QYAA 3DJSA 5CLYA 4Y9GA 4ACTA 5L4JA 1Z7JA 2FLMA 2G4GA 4ABVA 4IKLA 2QGBA 3DJRA 1GKEA 1Y1DA 4IKIA 4WNJA 3GS0A 4QXVA 4PMFA 4HIQA 5CN3A 4PWGA 2F8IA 1SOKA 4FI8A 4PWHA 1IIIA 5JIDA 5K1NA 1TTCA 3DGDA 3BSZA 3M1OA 4QRFA 1OO2A 1SN5A 4FI6A 2B15A 1QABA 4WNSA 1THCA 3GRGA 1F41A 4I87A 4Y9FA 1BMZA 3DK0A 1TLMA 4YDMA 1BM7A 2FBRA 4PWIA 3BT0A 4IK6A 1SN2A 4DETA 5AL0A 4D7BA 3GLZA 2B14A 3CFMA 2GPZA 2ROXA 3CFTA 4TNEA 3HJ0A 1E3FA 4TLTA 3D2TA 1DVTA 5FO2A 4ABUA 1TSHA 2H1XA 1TYRA 4L1SA 3P3SA 3KGTA 4Q14A 3IPEA 5EN3A 1ZCRA 5EZPA 1SOQA 2H0JA 4KY2A 4DEUA 3Q1EA 4IKKA 2QGEA 5TTRA 4IKJA 4N87A 4MRCA 4PVLA 4TKWA 1ICTA 2G5UA 2IGLA 1ETB1 3DJZA 2NOYA 3NEXA 5CLXA 4YDNA 4HJUA 5K1JA 1TTBA 2B9AA 4AC2A 4TLUA 2QELA 2G3ZA 3CFNA 1BZ8A 3NESA 3DIDA 1DVUA 1GKOA 3CN1A 5AKSA 4AC4A 4N85A 3CN2A 3IMSA 3IMVA 5L4FA 4FI7A 3I9AA 2TRHA 3IMRA 4L1TA 4PVNA 3GS7A 4PWEA 4TL5A 3TFBA 4DESA 5CLZA 4TQ8A 3DJTA 3IWVA 2B77A 3SSGA 1TTRA 4TNGA 4TQHA 3IMUA 4PM1A 1IIKA 3CN4A 1BZDA 3D7PA 4PWFA 3OZLA 2GABA 5AKTA 5L4IA 4MASA 2G4EA 1DVZA 1RLBA 3B56A 2QGDA 5CM1A 3OZKA 2F7IA 2H0EA 4DERA 4HJTA 2G2NA 2ROYA 4N86A 3DO4A 3A4EA 1X7SA 1DVQA 3IWUA 3A4DA 3CFQA 4PWJA 3GPSA 3NG5A 1DVXA 4HJSA 3CN0A 4TM9A 4WO0A 5AL8A 3FCBA 5HJGA 1QWHA 3CXFA 2G3XA 4ABWA 5AKVA 5A6IA 3NEOA 1THAA 5FW8A 3TCTA 3W3BA 1G1OA 5L4MA 4TQPA 4I85A 3IMWA 4TLSA 4ABQA 1X7TA 1U21A 2PABA 1TZ8A 5CR1A 5DWPA 2G9KA 1FHNA 2H4EA 3GS4A 5E4OA 2G2PA 3A4FA 4Y9CA 3U2JA 3ESPA 1KGJA 1SN0A 1E4HA 1DVSA 3KGUA 3P3UA 5CNHA 1ETA1 1BZEA 3FC8A 1FH2A 3CBRA 1TFPA 3P3RA 4IIZA 4MRBA 4TLKA 5BOJA 4TNFA 3P3TA 4TL4A 3I9PA 3KGSA 1E5AA 3I9IA 5E23A 5FW6A 1IE4A 4ANKA 2WQAA 4HISA 1TTAA 2H0FA 2B16A 2QPFA 3GRBA 4I89A 4DEWA 4IK7A 5FW7A 1DVYA 1KGIA 3ESNA 5JIQA 3ESOA 5AYTA 1F86A 1IJNA 4PVMA 3IPBA 3QVAA 3CN3A 4Y9BA 2QGCA 2TRYA 3NEEA 5E4AA 3U2IA 5IHHA 1ZD6A 3DK2A 3IMTA 5JIMA 4Y9EA 4TQIA 2H6UA 4PMEA 5DEJA
chains in the Genus database with same CATH superfamily
1WA0X 2OMVB 3DJSA 3AY4C 3DX4A 4QDGA 1KPUB 1MAJA 1CYGA 1E4WL 3WIFB 4Y19A 4Y1AA 5JIHA 2ZJSH 4MJ6A 4UV4H 4MDIA 1KN2L 2Y5TB 3DXAB 4GKNA 3AGWA 4FF9A 3VGBA 1ZTMA 5C0GA 4OV5A 4HC1L 4I87A 2FECI 4PPTA 5BQDA 4FABL 3MUHL 3CVDA 1D5MB 1M05B 3TGXA 2L04A 2P47B 4GEIA 1KYAA 2I24N 1IO4C 1UGKA 4G7VH 3EO1B 3QH3A 1OQOA 3NA9L 3WEXA 1MHCB 1NFKA 2Z31C 1SOQA 4K3HA 1ASOA 3FRPA 1OT1A 3QQ4A 5TFSH 4LKCB 4OQTH 3ZE0F 3S5LA 1RJYA 5DHXB 5GRVL 4OF8A 4XAWL 1QACA 1N68A 3GBDA 3W1ZA 2AJXH 1PW3A 2WBXA 4W4OA 4TLUA 4OIFA 4OLZH 5AKSA 1XSIA 4YNYA 1ZVYA 2RCSH 3FDWA 2X1PA 1GL4B 5L4FA 3L5HA 1HL8A 3MRLB 4B6ZA 3JTBA 3HC4L 4LCCB 4P05A 4LHJB 5KS9B 4HX1B 1KBBA 4HLZH 3G5XA 1VKXB 3N9GH 2Y3AA 4HMDA 1KJMA 2R69A 5GJTH 4UM9D 2NZ9C 2QGDA 1N0XL 4U1MB 2XWJA 4KROD 1SEQL 2C7FA 2FJHB 3TT1L 1FGVH 5A3IC 4K7PX 5JORB 5SWQB 1KLUB 4KNTA 4P4KC 1G7PA 3FQTB 3ZE1B 1ZTXE 4HS6B 4NHCL 2PCFA 3GMNB 2QZ5A 4X98A 2EQDA 3V4PL 5K59E 4Y5VB 3QQDB 1AE6L 4UMSA 3EJUA 3FRPG 4JFTA 5EV7A 4BINA 3PXJA 3PPEA 4HC1A 2FQEA 2ATKA 2HJLA 2XFXB 2ZCLL 5HVGB 5TF1L 4WDIA 4H0HB 5AB2A 5EU4B 3WS3B 2EEFA 4BFFA 1OAZL 3FOLB 4YDZA 5B39A 4HFWA 4JFXA 4P3CL 5E8OB 4E9XA 4JFDA 2F58H 4X6FA 4ODHL 3KNBB 3SGKA 5IM7A 1NCCL 2Y7NA 1IKOP 1FNLA 1NFDA 3OKDB 3DMMD 3LRHA 3MOAH 3ZTNL 5I6KA 5E6RB 3VNZA 3REVA 5KS9F 1XO8A 1TLKA 5JDSB 1CXKA 1YQVH 4P3DA 1ERNA 1P4IL 4HIEA 4AZUA 1R47A 2NNAB 3RY5A 3SQBB 3U4KA 2FATL 4CVWA 5EZLA 2VMFA 4DGIL 1GS6X 2Y5QA 3L5WB 3OAYH 4MTMA 1IBYA 3UAFA 2MNUA 5BS0B 3MBXH 3AABA 5IMOA 1U8LB 1GKEA 1M71B 4FXLA 3ZE1F 1G9NL 4B0MB 1SLWA 4PWGA 1WGOA 5JIDA 2P48B 3BH8A 1BQHB 1IKNC 3DGDA 1F58L 2OSLA 3GIVB 4XZUB 3A23A 4KTDH 3QT2A 4G8FB 3M07A 1U8KA 4IK6A 5D1QA 4N2EA 1T1WA 5AL0A 5K9KB 1P84J 4JY5H 2RQ8A 1CK0H 1E4JA 5HDBE 1NUDA 2CHWA 4PYHA 4C58B 3QO1A 3EGXB 3NN8B 4P4RB 5MEQA 1UB6B 5FV1L 1X5LA 2DQFA 4KI5C 4ZFFA 4UV4L 4L4VB 4V2BA 2WP3O 2VDLL 3JYCA 3FQYA 3HNSL 5I6LA 2G2RA 2VDMB 3U7WH 1J0KA 1WHPA 3QAZC 4HLEA 2AABL 4TNWF 4CC1A 4Z7NE 4IBZA 3BZ4A 2GUOA 5J5EA 1BZQK 1EXHA 4PJ5E 5JPNA 4PJHA 4MBRA 4XODA 3B9VA 4AQEB 2WQRA 3D9AH 1HK6A 4HT1H 3VRJB 5F1SA 3HMWL 1DFBL 1XSKA 2YD3A 3IDJB 5C0CD 3DV6B 5D72H 1OCWH 4UNVA 2OMZB 3O2DH 4NO0A 5GZND 1LO5A 5DJXB 5DO2D 4DO6A 2AJXL 5CIPB 3SPVB 5DK0B 4R5XA 2W9EL 1KJVA 1G0YR 3GBNH 1NDGB 4QTHA 3T2LA 1WS8A 3H7LA 2YD8A 3Q2WA 3PL6A 2RCSL 1T3FA 1FO0H 4Y2DA 2PWDA 2EO7A 3E6FA 3KYKH 4PJAB 3RGVD 4PB9L 1OW0A 2OKMA 2R2EA 2ZXAA 2VDQH 4ZQKA 1EAJA 3N9GL 1KCLA 1KGJA 1E4HA 1NSNL 1RJZB 3NZSA 4J6RH 4KPHH 5GJTL 4NKOB 1QHPA 2QSTA 4DW2L 5FYJE 1S7UA 1AACA 3SE9H 3TASA 3GLDA 4BK5A 3C6EA 2Z93A 4ZXBC 3S9DB 5LBVA 1KG0A 1ZS8B 1YYML 3F7KA 5ANMA 1F4YL 3Q13A 1NIDA 4JREB 3IFLL 5JW4N 1P1VA 4RFEA 4IBYA 4O2CB 2UYLA 2X6BA 5SV3A 4TTDC 1G4MA 2A99A 4HJGA 4YBQC 3KE0A 5DSCA 5DI8A 4MXVE 1BOYA 1KXQA 1KIRA 1PX8A 4RWYL 1MJUH 5GSVB 1RVFL 1RPKA 3UTQB 4LSPH 4BA0A 3ULUL 1QSFD 4P2YA 1MWAB 3L5JA 1CLOL 1MKFA 5F7WC 2X6AA 1E5UI 1NPUA 2J88L 5DQJA 3HPLB 3NJMA 3SDDC 1A4KA 1U8NA 1AIZA 4OQTA 3QZPA 2COVD 4PJAF 3BVDB 3X12A 3SQOL 4R7DA 3FQWA 1J1OH 5HYFA 2C3HA 1O7VA 1YQVL 3FB5B 3TIDB 2E7LA 4J4PC 2P8MB 1AMYA 1CDYA 2J25A 4V1DA 2DM7A 4AEHL 4PJ7A 3PV7A 4AUYA 2DLTA 1M7XA 3MOBL 4MB5A 1JZ2A 3Q2VA 4NQEA 4IGBA 2D2CC 4LVNB 4Y7MA 2YUWA 2IFFL 1OOWA 5ALCH 2N7BA 4EBQL 4YHYB 1HAWA 4GKLA 3MRBB 1JSYA 4PSRA 2FQFA 1L9OA 3CZSA 3GEFA 5GPRA 4YX2H 2VC2H 1G6VK 1ILSA 3LY6A 2WTRB 1IGYB 4OM1H 1IUZA 1EUUA 1GYUA 3CZKA 1QPKA 4FLSA 3KVPA 4PN6A 3RVTC 3W56A 3OMAB 5JOFA 1BX2A 1HYSD 4H26A 4NJAL 3IMRA 4MJ5A 2OBGA 4Y19B 3LVEA 4Y1AB 3TV3L 4MJ6B 1J0YA 4BUGA 4FMKA 1RUQL 4MDIB 3STZA 3NOIA 3FQ4A 1BQKA 2NUTB 4LOEA 4GKNB 1ZAGA 2RD0A 3LXAA 4IRSC 3BFWA 4M00A 1NBZA 5C0GB 4OV5B 2QQLH 1IAKA 4R84A 1AO7A 3JTSB 35C8H 4GEJA 4S2SB 2XA8H 5D4QA 1CFVH 3QAQA 3QH3B 1KN4H 4WK2B 5EU6A 3WEXB 2YIHA 2R7EA 2CNZA 3APNA 5GGRA 2X05A 1GGIL 4I85A 3QQ4B 4GLRI 4ABQA 3P3YA 1RJYB 5DEFA 3S5LB 5BPPA 3IT8D 4MMZC 4HT1L 1EAOA 1HIML 5EU5A 3PFQA 3UBXA 3U2JA 3IDXL 3KVQA 1E4XI 2A1WH 4GW1A 5DVLA 4P23D 1QNZL 1E3XA 1F56A 4NLHA 1BEYH 1JDAA 4YNYB 1DVFD 2GYSA 4HF5H 5DC9B 4A39A 3WTYA 4PGEA 4Q9QH 4KH2A 3WI9A 3FQXA 3UJJL 2UZYA 3GB7A 3X1BA 5GS1C 3SKNA 5C0BA 5F0MB 2WXRA 3K6SA 1JDCA 5C0AA 2L7UA 4RMUA 3GI8H 2EVFA 1LILA 4FFVD 3G5XB 2YFNA 1JZGA 3ROOB 3QXTA 1G7HA 1KJMB 1AR1C 2CUAA 2B9BA 4XOCA 2XWJB 1KC5H 5DD3L 2YD5A 1P7QD 2WAHA 2VDQL 3MRJA 3MCLL 4Q9CA 2N01B 3MRKA 4FKHA 1G7PB 1XIWD 2EO1A 1BJ1H 4G42A 3RWDA 4X98B 3NA4A 4FP8H 3K5RA 3ARDC 3KL3A 1SYSA 3UABA 3SQRA 3NQKA 4O9HL 5FIEA 3NABH 4FNUA 3TVMA 2A74C 2N1KA 3OX8A 2VRQA 5DTFB 2CJSA 4NUJA 3HB3C 2DWYA 2OSYA 3RTLA 2HJLB 1E0OB 4WDIB 2BO0A 1BW8A 3O6MH 3H9ZA 4ZDHA 3UBXG 2N0KA 1JPGB 5B39B 4ZW8A 4ZS7L 1OP5H 3QJXA 4HWBL 4PI2A 4JFDB 4X6FB 1NGWA 2O6EA 5FYKL 1MJUL 2YAEA 4AYFA 4TOYH 1NFDB 4HCGA 1X5JA 3H0TA 3CH8A 2R83A 2I9LA 2JVUA 4RX4D 2GIYA 3REVB 4AT6A 3BWUF 4P3DB 2CA4A 3HHMA 1N0LA 4DKFH 3AY4A 3UPAA 1G7JA 5EZLB 2X4RA 2CNYA 4PLJC 2NXZD 1NQBA 3O2DA 4LHUB 4MNHA 4YHIA 5DRXB 4ZMTA 1JNJA 3VXNA 2CJUH 4WGKA 5IMOB 2YAMA 3VG0L 1M7UA 1CE1H 2KZKA 4DO5A 1I4FA 4DQAA 3MNWB 2JKXA 1RIUL 1T6BX 4GI9A 4MJID 1FO0A 3ESVF 2OSLB 1BQ5A 1IRAY 2FLRT 5IJKC 1WFTA 3HRZC 5AW1B 1KCWA 4OR1A 4L1LA 1UEMA 1PZCA 1U8KB 3BWSA 3VQ2C 1OSPH 2C1PA 2W1NA 3C5ZC 2VC2L 5D1QB 2Z31A 4NHUA 2GKIA 2Z4QA 1A66A 3QO1B 3V4PB 4XP9L 2FSDA 2Q8AL 3WKQA 1QWUA 3BN3B 1TPXB 4DO4A 2ICWJ 2NY1D 5LCVL 1NFDF 1TZGH 1J8HA 2DQFB 2NNCA 4XVUD 3SYOA 4ZFFB 5CR1A 4NO5A 4YBLB 3QDGA 2YAPA 4PW9A 3VXUA 1QW8A 2G2RB 1N7ML 2Y36H 3UACA 4APQA 3K81A 2EUXA 3U83A 1QG3A 3GXPA 3BZ4B 2GUOB 1E28A 3HS0A 4V2CB 1KCRH 1UT2A 2G75A 1FI8C 5JPNB 3K4AA 4PJHB 3O0RL 1CWVA 1MHHA 2YLKA 5E23A 1ADQH 3GRBA 3O2WH 1E3ZA 1ACYL 2EE0A 5GGUB 4DAGL 1BLNA 4NO0B 2R1WA 1LO5B 4JM2A 5GGVY 3DYMA 1QATA 1Y7VA 3MOQA 1IC7L 1BDYA 3T6VA 4I3RL 3EF7A 1KJVB 3LB6D 4QTHB 1BEYL 4WO4D 3PL6B 4MA3A 4Z95L 4HF5L 3BQUD 3ZE0E 3ZE2B 1T3FB 5MEOA 4CVZA 1JPFA 2K8MA 5EU7E 1DP0A 2C3XA 3Q6FA 4Y2DB 3E6FB 5HYSG 1UD5A 3IFOA 2R2EB 3GI8L 4UQAA 4ZQKB 5GRJH 4K3JH 5DR5L 2KS0A 4D9QE 1EPFA 2L8AA 4FQ1L 3QUZD 3V9EA 3QDHA 1S7UB 1T2QL 4J28A 1WIOA 4H5SA 2P5EA 3WHXA 4PJHF 2Z93B 1GZHA 3FYIB 4TN9A 4XPHL 1KG0B 4IJ3C 4LARL 3DXAE 3QC6X 2LR4A 2AJ3A 5ANMB 1JHKH 5F7LB 3VQ1C 4K9EH 4KX7A 4QCIB 1UWEL 4RFEB 2BFGA 4FYQA 2UYLB 4X5XB 1DZ0A 5IK3A 4ZX4A 4HJGB 4G7YL 3WNNA 5DSCB 1EBAA 1FLTX 3V95A 3ARRA 1KIRB 1CBJA 3RX7A 5BZWB 3UMTA 1HH9A 4EVNA 1GOHA 3IWVA 1BECA 1IKNA 1CICA 2ZX8A 3JVGA 2BVUA 3ZE2F 1JGUL 3OKYA 5DQJB 2GIMA 4W9EC 3H1ZA 1A4KB 1U8NB 2EH8L 3TBTA 4B50A 4MQXC 4NUPA 4F80A 3X12B 2VT0A 3FQWB 1ZJAA 2R56H 3DO4A 4ZW3A 4V1DB 3NZHH 4PJ7B 3I84A 4NQVA 4HJSA 2VN5A 3D50A 4NQEB 4IGBB 3DX7A 3EGSA 2CJUL 5KS9E 1QFWI 4U2YA 1ZA6A 4RH4A 3EYSL 4I1NB 1G7MA 3E3QC 5C07A 3U0WH 4QF1A 3V55A 3RKDD 5LXGH 1DBKL 4WKZA 4XH2A 2ZYSA 2RHEA 4OH2A 5AG9A 4AEEA 3QR2A 1BX2B 3X3GL 4H26B 1OSPL 2VLJA 2LTQB 4MJ5B 3ZE1E 1IEBA 1EXUA 2MSPA 5JHDB 5IVNA 4DEWA 1IL1A 5EUKA 2BMKB 1K8DA 3O3BA 4X80L 2J1KA 4QOKD 3MV9D 1PLAA 1F3JA 1NBZB 3S0PA 1S5HB 3RJOA 4A2EA 5GZOC 1AO7B 3W11D 3BUTA 4PMEA 4PWKA 4FZ8H 1KULA 4NZ8A 3LJ3A 5EU6B 4Y4KA 1UCBH 2J5WA 4PB0L 4JN2A 4PJ7F 1NOAA 3ILDA 1GY2A 2R7EB 1KCRL 5GGRB 2WOBA 3S4SA 3IKCA 3ZY7A 5F7FA 4B3VA 5DEFB 3B34A 4XOEA 1BFVH 3NRQA 4FI6A 2XETA 5AVQB 4M6OH 1H8SA 3EH4B 3T1WA 4GW1B 4OCNC 1SN2A 2QLVB 3P4NA 4FXKA 5BS0E 3GNML 1OAYL 4KK5D 1INEH 3FQXB 2UZYB 5E9AA 3GB7B 4N3TA 3SKNB 1PZ3A 4G11A 5C0BB 4Z3TA 3K6SB 5C0AB 4FMVA 4GRLD 2XY2A 3QFJD 1E7UA 4AVHA 4ADIA 4C56A 2EIZB 4JHUA 2PW2A 1G7HB 4A6YL 2UVEA 4OGAC 4XXDA 3RIFF 1CLZH 3AREC 3UH8A 1X5IA 5F96H 4FQXA 3UAEA 2I7SA 3GO1H 2WM0A 1LGVA 4K3JL 3EYOA 3BLPX 3MRKB 1WV7T 1MCEA 5CJQL 3ULUF 3UAJC 4G42B 4NC1C 3RWDB 4LLWA 4Y1TA 1X5AA 3SDDA 1SYSB 2M83A 1D7FA 3D33A 3ZTJH 3C60D 3VB8A 2EDBA 4JMXA 5DFTA 4FNLH 3OX8B 1TQBC 1LK2A 2FHBA 3VJ6A 3T0ED 4POYA 1KBVA 3FAWA 4H2CA 5F3FA 4K9EL 2BOBA 4ZDHB 4C59B 3PJSA 4A1RA 4AG4L 2MQGA 2X41A 2XQBL 4WCYH 1CQYA 1NGWB 5DEGA 5LGKA 3FN0L 2X89A 1I82A 4AYFB 3H0TB 4AWJC 2WXGA 1ADQA 2I9LB 4AT6B 4LVOB 5F2FA 3T3PB 1SJHA 2DL2A 2O6CA 2R23A 1MZZA 2EE6A 1N0LB 2E27L 3PE9A 1L7IL 1SVCP 1G7JB 3QWRA 4FLHA 4NO3A 2O72A 1H9VA 3CQPA 4ODTL 2XRAL 3G08A 4MNHB 1PY4A 3VXNB 5DT1H 5FLVA 3W5MA 2DD8H 3NZHL 3AZUA 3CFCL 2FNBA 3OAZH 5AW8B 4ZFOL 1I4FB 1X5HA 4A7TA 3I6LE 3BESR 4PJAE 3CXDH 1CDUA 3L4WA 1VHPA 1WQVT 1FO0B 1YJDL 4YGAB 4DFHA 2RIKA 12E8H 4P2OC 4Y4FD 5DJZA 1IGFH 5E2TH 2ITDA 2C1PB 2VDQB 3U0WL 1ZSDA 2C34A 1NJ9B 1CXIA 2Z31B 4NHUB 3BYYA 5LXGL 5SX5K 2Z4QB 4CC4C 3E6HA 1IBHA 3TEXA 1TG8A 2IQAA 3HI5H 5B4MC 4OFYA 5F7EL 4FJYA 1G84A 4NIKB 1SJMA 2X1WL 4DIXA 5LNDA 4KRPD 1J8HB 4EUPH 1SMOA 3GLEA 4PTUB 5DMGD 2WBJD 3QDGB 4MDJA 3T3PF 3ZDYB 3VXUB 2F54A 2RALA 2B20A 3I6GA 4WEUD 4Q6IC 2PP9A 4ONHA 3ZYOA 4APQB 4PWIA 5GS1A 3U9UA 2XQYK 1E28B 3HS0B 1RZGA 1YC7A 2E7CA 2ROXA 2G75B 1E3FA 1GAFL 3O6FA 3Q9PA 4ZW6A 4A7SA 1IT9L 4DPBX 5KUKA 3CLFH 4FZ8L 4PJ9D 3V5DA 1RU9L 3F8UB 3PGCA 4U4IA 5GXBB 2ARJA 1I1AC 2OYLA 2BWIA 1BJ8A 5BUPA 5J9PA 5IW1A 5TF0A 5ADOH 1HCVA 1BLNB 2H6PA 2JKNA 2R1WB 3QWOA 1BFVL 1CD1A 4LP4A 4P5KA 5T3ZH 4JM2B 4TNWK 5D7JC 1PLGL 5FYLH 3HS9A 3MRGA 5M94B 1E50A 2FO4A 4MCMA 3K80A 4WK4B 1A47A 3JQOB 3PAZA 4MA3B 5MEOB 1LXMA 4CVZB 1JPFB 1UZ8A 3Q6FB 1MCPH 4PP2A 1O6SB 4UTBL 2GEQA 3T6ZA 2XACC 3GZOA 4OCWL 2YPLB 2DEXX 1NCWL 2VC2B 4PSPA 2BXYA 2EIMB 2IAMA 4YHZH 3ATAA 4XMKH 4Y19E 1KNOA 4Y1AE 3U4AA 1EEUA 4H5SB 1QFUL 2P5EB 1FNEA 4G9DA 4FTDA 4Q0XL 3WHXB 2F53A 3WUWG 3WNPA 4AVKA 2FIRT 4NBXB 3MRRB 3MRCA 2B3RA 3PP3H 1E4KA 2AJ3B 1X7TA 4UAOB 5D96C 4GUOA 3SPCA 1VFBB 4LEBA 5IBLC 5TH2B 4FNLL 4MAYD 5KYXA 5I1CH 4NZUL 2OJZL 5K9JH 3HE6C 1FFPA 1L3WA 1N5AB 1KBKA 4JM2F 4Y2LA 4UDTA 3MLVL 1IE5A 1U8CA 1HH9B 4EVNB 3BEWB 1CICB 3A3YB 1R3LA 1WD8A 2VCOA 5IJKA 5PCYA 2YSSB 4XNMA 1F86A 1A65A 4FADA 2YFOA 3TBTB 3PJLA 5CSZA 5AZEH 1QWNA 4HUXB 5LUMA 2ZX7A 2DWDA 2L7JA 1NEZG 3DTXA 4NQVB 2H47C 4LIQL 2KT6A 5I0DA 3DX7B 5LAPA 4IKIA 3EGSB 4QXVA 3CDGA 2YS4A 1ZA6B 3CX5K 1L9QA 1A7RL 3H9HA 1TTCA 4L29B 5CD5C 4K3EL 1G7MB 1ZT1A 5C07B 4QF1B 1FPTH 2B1HL 4Y9FA 4F7EB 3CXDL 4N4YB 2PPFA 4WKZB 4XH2B 4E9WA 4U6VL 1E9PA 4HCRL 3T1FA 2Q0ZX 1IGFL 5LNGA 2VLJB 2GAZB 1U2YA 1IEBB 1EXUB 4PJXA 4LEXH 4OD1L 4PYGA 1UWFA 1IL1B 4UZSA 4XP6H 4R4ND 5EUKB 2VLKA 2W07A 1CGTA 4G6FD 2X3CA 3VNYA 4IKJA 3ZDZB 3S35L 1F3JB 1VCBC 1MFMA 1L7TL 3RRQA 4FA6A 2Q7YA 4JUTA 1XGTB 4MJ4A 5AZ2H 2HRGA 4JFDE 4Y4KB 4OGYL 1FZKA 4HMEA 4JN2B 4F8NA 2AGJL 4ENEC 4KDWA 3WIIL 1NFDE 3ILQC 3S4SB 4U0RC 2CDGA 1V54B 3Q2NA 2V9QA 2Y1VA 4P9HC 1TQVA 5AKTA 3EXLA 3SJVE 3FKUS 3L9EA 5KVGE 3RJQB 1OTUD 3ARPA 4ZYKA 2W9DL 2ZSWA 1H3GA 1R3JA 4JMNA 3BZFB 3P4NB 4D9LH 3NH7L 4FXKB 2FX7H 1AXTH 5LGYA 5A2LH 2BJMH 2DN7A 4ZAKC 3SBPA 4BZYA 3V6ZA 4QRQA 1KYOJ 3LPWA 3FOMA 2IH3B 3GXIA 4N2AA 4ZPVA 2W65A 1NC4A 2ITCB 3EYUL 3MNDA 3ARUA 4NM4H 3VYNA 5GSRA 5FAAA 3ZTJG 2PW2B 3KWWB 3ZDZF 4XXDB 1BREA 1E7VA 4PLKD 1FNHA 4EN3C 4XGZA 3BZEA 4FQXB 3CFDA 5D1QE 3S6CA 1WUNT 2B7DT 2OXHA 3NCMA 2DI7A 4PP1C 4U7SA 2NY3B 3EYOB 1JRHI 5EF0A 4TNFA 4HW6A 3NUKA 2W8CA 2Z7YA 1MI5A 4LLWB 2CBTA 2AEQL 3VXQA 1VFUA 3BVTA 2XTJC 1LWRA 3VJ6B 2O5YH 4FG6D 3U2IA 2W9LA 4EUPA 4F7CA 1RZJL 4Y1SA 4X9FA 5I8CA 2BOBB 3NCJL 4QTFA 4I77L 2PPAA 1IZJA 4S1DC 4MGXA 4PJHE 2A9CA 1YEKH 4Q7DA 5J3HC 2YEVB 1QQDA 3CTTA 1MFDL 3LS4H 1JZ8A 3IVKA 4LF3B 5DEGB 3EW3B 4JFEA 4B0MM 3FUDA 1W72H 5A1AA 3PREA 3GRWH 2X0UA 5K1NA 3PNWB 9CGTA 1SN5A 4KUCF 2R23B 3SBRA 5IEKA 4XPAH 2X44D 1UA7A 3UYPA 4NO3B 4XP4H 2VW7A 4L5FE 3D8MA 2WQWA 4W6WB 5BRZD 2C9UA 3A6CH 3G08B 3GLZA 5AZEL 4DKDC 4KXZI 4XRCA 3DTDA 4HA1A 4L1SA 3ZE2E 3MNVA 3U4EA 3NK4A 4U6XA 2WN3A 3UGUA 4HGMA 5HHPA 2Z8RA 5CLTA 4F37K 3BDYL 3LZPA 3BLBA 3D3VA 4PRPB 4A6YB 3AUVA 1DJGA 3EOBA 4N87A 4OLYH 2I85A 4TKWA 2OR7A 2GJPA 3VDAA 2PMZA 1XBRA 3EH5B 3UBGA 5JHLL 2ITDB 2HB0A 4X4ZA 3TTYA 1FPTL 2VAAA 4N5ED 1X5YA 1CGUA 3DOIA 3PV6B 5L0QB 5A2AA 3VFUA 4Q9RL 2IQAB 2Q3XA 4OLXH 3KWUA 5IWLC 4N2GA 3TJEH 2JJWA 3ZKMD 5A6MA 1BXUA 5ANME 1UACL 1SEBA 1EEQA 2HVJA 4WW1A 1QBML 5BVPL 4OQ1A 4MDJB 3HFMH 2F54B 4HJJH 3L7FB 1Q1PA 4GQ9L 5D6DC 3I6GB 1JGDA 1JXGA 4ONHB 2IXQA 2EXWD 2NR6C 4M1CD 2WWKT 4JZJC 5DZOA 3U9UB 1KXQE 4JGMA 3O2VH 3O6FB 1RZGB 2ALAA 4XP1H 4Y4HC 3AQDA 2IWEA 4L3ED 3U2SA 1IZKA 4P46A 2MTAA 5MEPB 2D0HA 1KXTA 2DIEA 4IBUA 3V5DB 5IFAL 3PGCB 5E4EC 3AREA 1TDQA 2VQ1A 2ARJB 1VGKA 1X9LA 4J3UA 5GRVK 2IDSA 3EJQA 3S36H 3VXSA 2ADGA 5J9PB 3CMGA 5IW1B 3GBLA 2DQJL 1HXKA 2H6PB 3QWOB 3X11A 1CD1B 2FBOJ 4JFFD 3MXVH 3QQNA 4JX0A 4P5KB 1VADA 4V1DE 4ZBJA 3UAJA 4PJ7E 3PG2A 3MRGB 3EHBC 3DIVA 2EP6A 2DH2A 2F19L 2FO4B 2XX0A 4NQEE 3D39D 4TSBL 1JVOA 3BJLA 3IGLA 2MCMA 3P9LA 1AXTL 1B0IA 1ET7A 1UZ8B 2O30A 2V3DA 5DS2A 2X4QA 1IAIH 3MLRL 2AMUA 1KGIA 4PP2B 1RIHH 4ONFL 1UJTA 3P0VL 4R4BA 4TVSa 2NY6D 4O51B 5E2UL 2F6AA 4LEOA 4PLNC 1ZS2A 2IAMB 4KUZL 4XNQA 3K72A 4P9HH 2EDJA 3K1DA 1F97A 1KNOB 1DLFH 1G9ML 5CD3B 4XTRD 1FNEB 5JZ7D 1BAFL 5JHDE 2F53B 3KH3A 3ME0A 3C08H 4S10A 2Q6WA 2IH1B 3MRCB 4U49A 3DV4A 2AXHA 1PD0A 1Q72H 1P7BA 3B2XA 3U6RA 4FE9A 3V4VL 1WLHA 2MMXA 1J87A 5ADPH 4UBDD 3GBEA 5HI4D 5BZZA 1AO7E 2ADFH 2EEDA 2VERN 1FFPB 2XYBA 3CFKA 4MNGA 3ZR5A 5I75C 5EU6E 3ULUE 4UDTB 3M1BA 3QJRB 3ZLQC 1U8CB 5HI5C 1NKRA 4LCVA 2WJ5A 1R3LB 3VH8G 4P2OA 2E4TA 1HXMA 4PUBH 4XNMB 2XQYG 3TNNA 2W88A 2H2PD 4Z7IA 2IGLA 5CSZB 1M3JA 2X2UA 3KR3L 4YQXH 5T1KD 2WINA 4KBPA 3OHMB 4CC4A 3IF1A 5E00A 2DWDB 3PQYD 4PS3A 2OTWA 5CD3A 1RURH 4YE4H 3BP5B 3DTXB 3AADB 1HOEA 4G8GD 3OAWA 4DGVL 5E56A 5C0BE 1UM4H 4PJCA 5C0AE 4Z8FL 4AITA 5KVMC 5J57B 3GDCA 1G7IA 1Q0YL 2YEZA 3H2WA 4N2CA 3QHZH 1MUJB 1F4XL 1WGVA 2YGPA 3CDGB 3H9HB 3PDDA 5BOPA 5JTWA 1SXAA 4XBMA 1WFIA 3L9BA 4YN3A 5AW7B 2X40A 4F33A 4N24A 1ZT1B 2E8ZA 2ZP0T 3RDJA 3N85H 5DZNA 4R90H 2I60L 4C57C 5D1XA 1RSFA 4OLYL 4DHLA 1E9PB 3T1FB 4WUUA 4YUEL 1HN1A 4WFHE 2N3JA 4CJ0A 4N1CA 5EO0A 5HJGA 4PJXB 5F1IA 2IEPA 1I1AA 2OCFD 4R83A 2BIOA 3TCTA 5KJRL 1TTUA 3I2CH 3UZQB 5F7DA 2VLKB 4PRID 4PR5A 1XGQA 3ML8A 4YHNA 2AMGA 3TWCH 4PJBB 4G9FD 4U7KA 4KHTH 4FNRA 5TE7H 2X1OA 2Q7YB 3O3EB 1OEZW 2O6DA 2R27A 2ALWA 4LSUH 4OGZA 5DYOA 1JGLH 2WKLA 2NNFA 5DO8A 2GC7C 1AGFA 1FZKB 3O2VL 3CFUA 1F6AA 2WZ5A 3PP4L 3O41A 1I85C 3I75A 2CDGB 3MODL 2VSKB 3T3PE 3V6OC 2MOVA 1NC2A 2EDTA 1W72A 4GI6A 3MUZ1 2Y72A 4AQAA 5D2NC 2F5BL 5CZKA 3GRWA 4DSYA 2XXCB 4Z7UB 2AJVH 2XKNA 4XN2A 4ZYKB 2ZSWB 1R3JB 1BBJA 4JRWA 5DMIH 1L9PA 3INUL 5D70L 3VRLF 4QXUH 1PCSA 1O6TA 1WH0A 2ICCA 3P73A 4GKZA 4ECNA 1AGBB 4HG4K 5C6WH 4JQIL 2AITA 3MXVL 3R19A 4QUOA 5C7ZA 3QHFH 1O7DE 3E1ZA 4QRQB 1BWMA 4AQ1C 3FOMB 2CO3A 3LMJL 4PJXF 4ZPVB 2W65B 1NC4B 2VTFA 5DZJA 1ZEAH 1RK1A 5GSRB 2CZNA 2ZCHH 1PEWA 2BHUA 3E8UH 4FGMA 2ZUXA 5IBTH 4HWNA 1SXCA 4PJBF 4JFWA 3OSKA 4XGZB 4JHBA 1QI5A 1DQQA 4LRNH 4YDMA 3CFDB 2NXYB 4YHKL 2DYPD 2OXHB 2QJDA 5KSBA 2V7NA 2DQTL 1EGJL 1T22A 1TYRA 2HH0H 1MI5B 1UASA 1K8IA 4ATTA 1D5XA 1SLXA 4NAQA 2MQCA 3NSDA 5MEND 3VXQB 4WV1C 1KENL 1J8HE 2ETWA 2X12A 3QDGE 3VXUE 4JKWA 4QTIH 4EUPB 3RIFK 4IOFC 1NKGA 4F7CB 5I8CB 4Z7UF 5ISZD 1SMDA 1KLFA 1FLRH 1Q72L 1AZBA 3LPFA 5I23A 4W4NA 2XOTA 5FYKE 2PO6C 4KKLC 1QQDB 4MNQA 4IBWA 3GXFA 4JDTH 4JFEB 3TL5A 3TA4D 5IBUB 4MZRA 3VXMD 4DNLA 2FO8A 1V7NL 3ZKND 3IYLW 5T5FL 4L37A 4NI3A 3N1PC 2CHXA 4DK5A 2E59A 1MJ8H 1EJOH 3MRHA 4E41A 2X38A 4R7LA 1YEEL 5IEKB 1DBBL 3UYPB 2G2NA 1JL8A 4YHPA 3B9KD 2PP7A 1MQKH 1P5VA 3CDZA 3KVDD 4XRCB 3IDYC 3MNVB 4HEPA 3U4EB 5MP6H 1RURL 2BERA 4H8VA 4JCWA 4FG0A 4U6XB 1S9XA 3VCLA 5IB3A 4G71B 1ZHLA 3MPCA 5HHPB 1RQ5A 3D3VB 3EOBB 2WLZA 3CVHL 2YPLE 3DETD 3KLHC 4MFHA 3CIQA 1QSZA 4AK1A 1JZ6A 3OR6A 1TYJA 4K55A 3NDYE 5DRNA 5LN8A 1KCUH 1TZAA 3BAIA 1R24A 1NMCB 3KHOA 2VAAB 32C2A 4DN4L 1EGJA 1H3UA 4CVUA 2NY0B 4K7PH 1TMQA 5CILL 2IWKA 3VFUB 4HOMA 2EDQA 2Q87A 4ANKA 1W15A 2JQZA 1VLXA 3TO4C 1U42A 3QULA 2XFGB 1NLBH 3E2HC 1SEBB 2EEXA 3QIBC 4TSAL 4X50A 5HD8D 3CVIL 3FJTA 2HVJB 4QO1A 1N70A 4WW1B 1BXAA 1SF3A 1TJMA 4U33A 1MFEH 2DQUH 1XXFC 1JGDB 2YWYA 2V0AA 3R7RA 1EZUA 4ZAKA 2IXQB 2HVKA 4JHWH 2WLNA 5D8JL 3MFFA 1FQ9C 1OK8A 5KVEH 3AM8A 2YD6A 3U2SB 3F00A 4UMGA 1ASPA 4P46B 3QDAA 2CRIA 1KXTB 5KBMA 1LTXA 4NZTH 1I3GH 1IVTA 3RKPA 4EN3A 3WTXA 6TAAA 3AREB 3ABZA 2VQ1B 2KPNA 1VGKB 3AWGA 4K94C 2ADGB 2CLZA 4X4XA 4ZD3L 2H0PA 5EF3A 1JFHA 4UB0L 3X11B 3WLWC 5F9OH 4BZ2L 1VADB 1TVHA 3FFOA 5F7KC 4E42B 4YH6A 5L7XH 2VDPL 4HOXA 1GPOL 3FO9A 1V3MA 1P7HL 3ML9A 5DMIL 2FEEI 3P9LB 2FR4A 5ACMA 1IBGL 5HHNA 2X4QB 2FGWL 3QHFL 5JMRA 1YUKB 4JKPL 2WZ0A 5C07E 3CVHA 4R4BB 3FQNA 1A3RH 2FK9A 5F6HJ 1ZEAL 1Z1WA 5E5RB 1N5YL 4ZMOA 2ZCHL 3E8UL 4LEOB 1J11A 3QUYC 1UH3A 4XNQB 3K72B 3PAUA 4L3FA 2VLJE 4Z3IA 4OGXL 3HC0A 1NFAA 4XC3L 4ONGL 5HJ3A 1JPSH 3LCYA 3ME0B 3RTQC 3TPUB 2P44B 1B4TA 2Q6WB 2ZF9A 1WCBB 2J71A 3P30H 5AOZA 3ET9F 3DV4B 4NUQA 3ZDZE 4DP0X 4XX5A 1DANU 4M7JH 5A6LA 1K6QL 4S1SH 3U6RB 3QNZA 3I02A 2DMKA 3TJHC 3K6IA 4DP2X 3FQUA 4BKTC 2YN3A 3CFKB 1V55B 4MNGB 4TXVB 3T0VA 1EHNA 3GIZH 5J56B 4B95C 3M1BB 1UM5H 2Y7QA 5EPMB 3QWQB 3KWTA 4LEEA 5A2JH 3ECVA 4DT2A 4P2OB 3HE7D 4K3DH 4UI2A 1HXMB 2VJ0A 1WZ1L 1ES0A 3TNNB 1PKQA 3HR5B 4HAFA 5TJWK 2WINB 4ETYA 3V79C 1BF8A 2WLLB 3IF1B 5E00B 3OWRA 4F8PA 5IWLA 3M6DA 2OTWB 2PXYC 4RGND 3DVFA 4MXQD 1QZNA 5GQBA 3RVXC 2PW1A 3FCGA 1H3XA 3TZVD 2H1PH 1MQKL 2YEZB 3SPJA 3DHMA 4N20A 4NEHB 1MW0A 1PAMA 1UD4A 3BAEL 1FBIL 4Y4HA 2CCVA 5D1XB 4DGUA 5E70A 3QYNA 4MLSA 4WUUB 1KPRA 1P5UC 4YK4C 5EO0B 5F1IB 5DRWB 4DOHB 3VMPA 1AOHA 2GEEA 1I1CA 5F7DB 4PR5B 4YHNB 1LQBC 1XGQB 4JLRA 2YO3A 4FCHA 1KELH 4DKTA 2XZAL 4G3YH 4OLVL 1QLEL 4YLQT 2K7QA 5DEZA 1HHJA 1MW3A 4WTWA 3ARBD 2WXIA 4FD0A 2HT4C 4Y8DC 2OV0A 3W9EB 1BZ7A 4GW4A 4S0SD 3VD4A 2BOCA 4WI0B 3HHSA 1AGFB 4PI0A 5H94A 5DZAA 1DJWA 2P8LB 1UXSA 4R4FH 1F6AB 4HZAA 3O41B 2H0JA 3I75B 3UXFA 1GIGH 4GQQA 3GHPA 4XWGH 3WSQH 3GHEH 5FCUH 1NC2B 1QRNA 1W72B 3SGJA 4AQAB 1ETZA 3ZHLA 3RYMA 3S37L 1TCRA 2WYZA 4OUOA 3BUYB 4AENB 1MFNA 1TTBA 2XKNB 4GAYA 1A7BA 2BSBA 4I0PD 2VR6A 2NY5L 1BBJB 1FUNA 2WJ7A 3BKCH 4JFQA 2PPDA 2FAUA 3PUUA 5FFOA 4F3FA 5BW7C 5SWZA 1IC1A 3UMNA 3P73B 4QRRA 4GKZB 2C4XA 1D7CA 1RV6X 3SDAD 3TFBA 3V0JA 1KB5L 4JO4H 5L7XL 1IAOA 5D96B 2OULB 2EKJA 1ZV2A 3JV0A 2QQKH 4GW5A 2JQMA 4GRWH 4LPXA 4PRPE 5EORH 1RK1B 2AV1B 1A6WL 1NAMH 2AFNA 4KJQD 3H53A 4N2KA 3EUUA 1IGIH 3U6XA 1XF4A 3ALWA 2FJUB 3O3AA 4LGRB 3D4CA 3MJ9H 4HSCX 3FO1B 4DZ8A 5KSBB 5IVXA 2X5PA 2HT2C 2V7NB 2QSCL 2Y25A 1QASA 2FQDA 5DJYA 4K94H 2BOLA 5CFAA 5JXEA 1K8IB 4F2MA 4EQ2A 1D5XB 1AXIB 5C0DA 3VFWA 3ASWA 4AIZA 4XB7A 2WWMD 4JRXB 1O9WA 3AVEA 3SGDI 5FDWB 2NZ9D 3D2UD 3P30L 2F54E 3MV7A 3WIAA 3ZUNC 5KYYA 3EOTL 4QHKJ 4RCAA 2DB8A 3WN5C 4HWEH 1B0WA 2VH5H 3FNKA 2VXQL 3ULVH 2HP4A 5I17B 1MSPA 3TN0D 1I7TA 1FCCA 2QPFA 1XR9A 4MQ7A 3QXDA 3GLAA 5FPIA 4NZRL 4MHHG 3GSVA 3O81A 4L37B 3A22A 3VFOA 1R34A 1KXVC 3MRHB 3LKPA 5KSAD 4E41B 1T7XA 2V5SA 5FK9B 2PWHA 4H20H 5F9AC 2R51A 3GTVA 1RP8A 4YHPB 5DHDA 1ZT7B 1E5BA 1P5VB 3CDZB 5KSBF 2WYIA 3U48A 1RMFH 5JOEA 1I3RA 1Q0XH 3O4LD 2AXWA 3OAUL 3MLWH 2MCG1 1S9XB 3VCLB 1B9KA 3F58L 1ZHLB 4PMFA 4FQLH 1S7QA 1FE8H 3F6JA 4TUKH 3CSFA 4BWWA 4F7TB 3ECBA 4AV5A 3OR6B 5DRNB 3CX5J 3T3MB 1R24B 5CKGA 32C2B 3CQQA 3LX9A 5DZ9A 2ZXGA 5GGQH 1U30A 3V6OA 1XB6A 3QULB 3JYBA 4NX0A 4P48A 1GW0A 3UG5A 3PCYA 4P2RB 3PDOA 4QO1B 4PJDA 2CGRH 3IRZA 3IRPX 4FLOA 2CPCA 4I18C 3TBBA 43C9A 3AWEA 4ZAKB 4U3SB 1LVEA 2MKLC 3TBWA 3MFFB 4AQ1A 2EAEA 1R1CA 2IH8A 3A67L 3FUKA 2VMCA 3L3DA 4J3TA 5C0IA 3BWZA 2UV3A 4U2ZA 2C3WA 3D85B 3FU3A 2AJSH 1SUJA 2DM2A 3D4YA 5T33H 4U3CA 1J05B 2P8PA 4PBWD 4WNQA 5FV2A 1C5BL 1FH5H 1KDJA 1M9SA 4M6MH 1MIEH 2ZWKA 3QQ9C 1RY7B 4A7QA 3QUKA 4ELKA 2CLZB 4X4XB 1XGZA 2AEOA 3CQFA 5FCUL 5I19H 2WIIA 2WVSA 1KEGH 3FT2A 4JAMA 1NMBH 1TVHB 3ABKB 1HJCA 2ZOUA 5JPMC 3T3MF 4AJ0A 3FO9B 4WK0B 3PUCA 3CZFA 2R29H 3BKCL 4WV1A 3QXUA 5C08D 1F4WL 1BGXL 2XTJB 3L8QA 4P2CG 2FR4B 4FFYH 1YJDC 2CKNA 5HHNB 2Y9RT 2UZXA 1HESA 3GKZA 4KGJA 4XBEH 3FFCB 2X2IA 3CVHB 1DJSA 3FQNB 3SZ6A 5B22A 1E9QA 1A9EA 3BUPA 3VRLE 3GZPA 5GS2H 3VXRA 3C6LC 1EFXD 4N8VG 1KY6A 3HC0B 1A5FH 4PJXE 3RNKA 3ASNB 3RVWD 4DVRL 4KJPD 4LGSB 5A16A 2I25N 2VLKE 4UQBA 3WENA 4FFWD 4PJBE 5D5MA 3LD8C 4N0YH 3VGGA 1V27A 3QNZB 3I02B 5ICUA 1DANT 1PS3A 1RHHA 2QPDB 4WFFE 1TT6A 4GG8A 2E6PA 2KC0A 3VWJA 2Y7QB 3F05A 4YHOH 3KYMA 3ULVL 3BXNA 4N9GA 4POZD 3ZZLA 4Y5XA 2DRUA 2J6EH 4TUUA 3GSWA 4LOVA 3UTTA 1E9OA 1ES0B 2YA1A 3N06B 3OXRA 1PKQB 1J9SA 4QRFA 4Z7UE 2MHAB 3EYFA 3D0LA 4PJ5D 1JZJA 4LIQE 3TO4A 2YMOA 4DK3A 4H20L 3D2TA 4BE5A 1TSHA 3QIBA 4AV4A 4ZFGH 5AEAA 2PW1B 4XVOA 5EEZA 1RMFL 2X2HA 1Q0XL 4NPYA 3BSGA 1SJXA 3KYNA 3PGFH 3S97C 5I1KH 1WG3A 3KD4A 4KDTC 1FE8L 5F93C 5C0RL 4Y4HB 2QELA 2YUZA 1E5ZA 3C8KA 2NYZA 5LGJA 1KPRB 3MJ9A 3MLPA 2WWKO 1MI5E 3V6BR 4W9JC 3N41B 4YSSA 2LV4A 1UXLA 2DLHA 1YN7A 2VL4A 5GGQL 3D51A 3PJNA 4L8CA 2ZE0A 3PHAA 2HFEA 4TVPL 1UWYA 2F7IA 1HHJB 3E38A 3EHBB 4MD5A 4TVUA 2CGRL 1DEEA 3PF2A 5AW9B 4KKCD 5HHQA 2EVJA 5A2IH 1BZ7B 4AQ8C 2BOCB 2KUTA 3AW5A 3HHSB 1ODAA 5H94B 3FCBA 4JFEE 1UXSB 3GC3A 3MLTA 5GRXG 3GF8A 2ICEC 4DF9A 1AQKH 2HPOA 5CBEA 1CL7L 5LQBL 1QRNB 1ETZB 2AJSL 2UY6A 4DZBA 1TCRB 2GITA 1HQ4A 3BVNB 4KXAA 4ZRGA 2MFNA 3DGCR 4GAYB 3LEVL 5AVRB 5FUOL 1MIEL 1JYNA 5KSUA 4OJYA 1BHGA 4UT6H 4JFQB 2PR4L 4X7EC 3SO5A 3MJ7A 4F3FB 5T3ZE 3RTQA 2GFBA 4HHAB 4YHLH 4QRRB 2ZXWB 5K5YA 5K93A 4YZWA 1HZHL 1AKJA 2ED9A 2HX7A 4P2QD 4WI3A 3BAJA 4GW5B 3N41F 1WF5A 1MEXH 3OLEA 3D3VE 1USQA 3TEYA 3RZCA 4PY8J 4FFYL 2DW5A 4DH2A 3HNTH 4U7MA 1XF4B 4OB5L 2WNWA 5EZIL 2YOCA 3O3AB 4ALAL 5JIMA 1FSKC 1MCRA 2F08A 4YE0A 3WJLA 4DZ8B 5IVXB 2QKIA 4AKOA 1KPVA 3BIAX 1EZSA 5DJYB 5FM5O 4DJMA 2OP4L 2P45B 1JIBA 2V3EA 4F2MB 2FX8H 4YSCA 4GMTH 5C0DB 3VFWB 8CGTA 1A5FL 4RLDA 1Y6NR 1EZVX 2P5WA 4KROC 3MV7B 4FNPA 4TMPA 5D4IA 1YMHA 2PXYA 1RUKH 4Z0BH 5KYYB 4LPWA 2XXFA 2R0ZL 3QI9B 4Z7VA 4G5AA 3MGOA 3RE0A 2GI7A 1HHHA 2APWA 1I7TB 4LDCA 4LASH 5CZXD 5A2CA 3GFUA 2VSDA 2DBLH 4MZ3A 2W91A 3WCYA 3HBQA 3QXDB 4YHOL 4W9CC 4JG0H 1XMWA 1K3IA 2HRLA 3GSVB 2B0SH 3K1KC 3CAFA 3UO1L 4WFED 4L2YA 1JZ5A 1OAJA 4G6KH 1WT5C 3LKPB 4AC2A 2O4EA 1P5UA 2VXSL 3CN2A 4QHNB 3QEQB 1U4FA 2Z8VC 5F8QC 1KFAL 3LV3B 3WEAA 5IVXF 3ZVVA 4NRXA 1I3RB 3SDCB 3DMMC 4X4MA 2B77A 2OMWA 5IFHH 2R29A 2RACA 3QZLA 2VR3A 5DQ9A 1FIGH 1S7QB 5D71L 5AW3B 4FFYA 2K8QA 2AVFA 2K45A 1XGPB 1BVKA 5I6PA 3WO3B 4WEMB 3ECBB 4LPCA 4G7QB 5F70A 2EJ1A 5I1GL 1D5ZA 1NGYB 5E1AB 1IC4L 3ZL2A 1U58A 3FUMA 3MRIB 4UQCA 1UA6H 4E5XG 2Q7AA 1KTBA 1XQ4A 2WY3B 3SKUD 5KAQG 1QBLH 1FYTA 2CMRL 5LWYH 4M1DL 1FNGA 3PDOB 3DURA 4PJDB 4NYLA 2F1AA 2H4EA 3LH2H 2B2XL 4IEFA 1B4JH 43C9B 4MNGE 2PYEA 4NNXA 4YPGB 3TBWB 1J1PL 5FCSH 4AQ1B 5T1LA 1W0WA 3L3DB 1BEXA 3HG4A 3MJGX 4LAJH 1D6VL 4S1RH 3D07A 3SY6A 4L3CA 3HG1D 4WNQB 4N9OB 2ZUQB 4M93B 1Q1JH 3FQRA 4JANA 4PJ8A 4RISH 2R59A 3L4UA 2J6EA 1AQKL 1TQCC 1WSST 3QUKB 4FJZA 4XPGH 4ELKB 3NACL 5HHMB 3UC2A 2WIIB 4PHZA 3X13A 1B2YA 3FT2B 1F0LA 4TQIA 4JAMB 5F7HA 2DQIL 1FC1A 3DGGA 2EUWA 5IMKA 4D9RE 4M9PA 4ACTA 5GS0H 2WO2B 3EF4A 3CZFB 2G4GA 4RETB 1JZDC 2BLFA 1F4HA 2YZ1A 3C2SA 3THML 1FA4A 4ZO9A 3DNKA 1LO3H 4YHLL 3AT8A 4HKZA 4TRPL 2UZXB 3M8OH 1E43A 4WVRA 5EOQL 1MNNA 4WHDA 1KGXA 3BGAA 3K0YA 4M7LT 3RDTA 4HG4J 5GZNC 4WNSA 5DO2C 4PJDF 3HAEG 5F6IC 3UEZA 1M7DB 3ECUA 3C6SA 4X9GA 4IRJA 1E9QB 5D1XE 3WS6C 4MAUL 4EI5D 4OAWB 4WUUE 4A7UA 1AXSA 1IJ9A 3KEHA 3QNXB 1CLCA 1F3RB 3MGAA 2PN5A 2WZPD 3L5IA 4F5CA 4GP5B 4AE0A 2G60H 3RNKB 4DOHE 5IVOA 4PIRF 3IK2A 3I9GH 4Z3JA 4KITB 5D7LA 1J5OH 1KXVA 1HT6A 1JYWA 5D5MB 1NANI 1QFHA 3MMEA 1U3HD 3CJJA 1ZOXA 1RHHB 2R39A 5J1TC 3ZSTA 7TAAA 5C8JA 4GG8B 1RUKL 3VWJB 5IB2B 3KYMB 4FKEA 2BIHA 4EE2A 2DJSA 4PIBA 3BXNB 4N9GB 3UO8B 2FYYA 4XCCH 4Y5XB 3H3PH 3GSWB 2FO1A 3VUAA 1O6VA 3UTTB 3WELA 4YL4A 3OXRB 2CM5A 4MB4A 4PAZA 4JG0L 1R33A 2CH8A 1CXHA 3EYFB 3UTSA 1ITCA 2VSCA 3ZQXA 3D0LB 4E9SA 4XOAA 1LYQA 1SDDA 4G6KL 3TO4B 4B9GA 5ABAA 5AALA 4UT6A 2IMMA 4ZX3A 2YK1L 1UJ3A 3QIBB 4X6DA 5GHWL 2AK4D 4JFYA 1T7YA 4MD0A 3TLRA 1D2OA 2C7UA 4NPYB 2PABA 3KYNB 4TSCH 4GRWB 5D5MF 4KTGA 5JW3H 1FIGL 1LJMA 4R96A 5KSBE 2BNQA 3ATFA 1AI1H 3C8KB 5DWUL 1V3KA 3U36A 5LGJB 2Z92A 3BPCA 3H9SA 1G7LA 1T6WA 2VSMB 2XN9E 4Y7OC 1CGXA 1UA6L 3LN9A 3IEAA 2O5ZH 5FA3B 4JRXE 3TYFA 1YN7B 3FU7A 3HVNA 5I6XC 1QBLL 4D9QD 2HFEB 4P5MB 4MD5B 1HYSC 2JTYA 3Q7JA 1DEEB 1EHXA 2NRDA 5HHQB 2HUEA 1DN2A 3H2PA 1WJ3A 3NYKA 1TU2A 1Z5YD 3G3LA 4NP9A 3FH8A 2YGNA 3DXAD 1UVQA 4QHKI 3MLTB 4JNXA 5EO9B 5CBEB 4DP5X 4MQTB 4S1RL 4W9ZA 2UY6B 4MA7H 4DZBB 4HAGA 4TPRH 4E41E 2GITB 3C6LA 4GRWF 1HQ4B 2Y2WA 4XCNA 4AM0A 4RISL 2BVEA 1YMMA 4UILL 5KSUB 2HWZH 4ODWA 5HHOD 1L9MA 2W60B 2AJYL 3ULAB 1BF2A 3MJ7B 4LVHB 1R17A 2GFBB 3FT9A 3MBEA 2OMBA 1JWMB 3BPOC 1FC2D 3U9PL 2AHIA 4FTVA 1UOLA 1AKJB 5CMAA 1KTCA 5J12C 5GS0L 4GAAA 3ISWA 5BVJA 1OE2A 3BRGC 5DF0A 4ZMXA 3RZCB 3LQMA 1RZKL 2NY2B 4YEFA 3RBSA 2GB2A 2JKIS 1D5IL 4P23C 3L9YA 1DVFC 3ZHKA 3A4AA 5HTSA 3T3ME 1WBZA 3HBGA 5D93C 3VWKB 4IMLA 4PV9A 2IPUG 2QKIB 1KPVB 2QVIA 3R1GL 1SRDA 4X6BA 4GAFB 2FL5A 2GQHA 5HYJA 4FFVC 3ULVF 4OKVA 1U3ZA 3FCSA 4YGVA 3RWCA 3ZYZA 4P2RE 4DP4X 1J86A 2P5WB 1MFCL 3GKWL 3GMQB 1EK3A 2W94A 4P5SA 2UXVA 1YMHB 2PXYB 5KBDA 4OVUA 1XIWC 1E6OL 2EIBA 4K5NA 1XMEB 3MGOB 1HE7A 2F7QA 3IS1X 2WSPA 3BAWA 4AGNA 2EVGA 1PSKH 4HU2A 4XVJH 3WD5H 5EF1A 4KDTA 3ECWA 4CA4A 4GMSL 1CGVA 5I1EH 4A2DA 2LABA 3JV5A 5I66A 5DJ0A 1P5UB 4P49A 1HL9A 4NRZA 1NBYA 3QO0A 2OPCA 4AZ8A 5HVHC 4NRXB 5E03A 5LBSL 4LCWB 1F11A 2XTJE 5GGRY 3I9IA 1A1NA 1WTLA 4TNVF 2BY3A 5TD4A 3H8NA 2UUDH 1T83A 1MG3C 5DQ9B 3EXJA 5JIQA 3FFCE 5I1HH 3H3KA 2YBRA 4G1MA 1XH2A 1BVKB 2FB4H 2NXZC 1U3NA 5DZVA 3HZMA 3WFBH 2BCKA 4TSCL 5BS0D 1SM3H 2APVA 3N42B 5J13C 3V0IA 1JE6A 4ZX6A 5DS1A 2VXTH 3RL1A 4KAQL 3MXWH 4HHGA 3R7QA 2CIKA 3FU5A 4W1TA 1FNGB 2DLEA 4XMLH 3DURB 1R3KA 4NYLB 2Y06H 2Z64C 4PCYA 4IEFB 1XZWA 1QZ1A 2PYEB 1MHPH 3MQIA 4NNXB 4ES9A 1NM4A 4QXGL 3SCMA 1S3RA 3IPFA 5LDSA 2A9MH 3H54A 5T1LB 5I26A 4AXWA 2FBJL 1TCMA 4P59H 5AVZB 2NY1C 4XVUC 4L3CB 1EFQA 4G5ZH 4H8WC 1BOGA 2VQUA 5HDQH 2JLPA 3FQRB 4RA0C 4JANB 1PKQE 1U6AH 2FH6A 4PJ8B 4PVLA 1GGYA 4DGYH 4YFLI 1Q38A 2B4CH 2VJ8A 2Z0UA 3ARQA 3HEIB 2CU9A 4HS3B 4MA7L 3FTVA 3X13B 3QYMA 3DGGB 3N42F 4DCQA 2VR9A 5IMKB 1J8SA 4FQJH 3V0WH 5LBSA 2HWZL 3P2TA 1FFOA 2CD0A 3TNMB 5T1DL 4BFIA 1TTRA 2WUCH 1KXHA 3D5OF 4HKZB 1J5CA 1JF1A 1AC0A 3MO1A 4JFHE 3RDTB 4PRHA 4ZO8A 5C92A 4ZNCD 3C6SB 3OF6D 4IRJB 4TUOA 5CM1A 1EJ6A 2YPVH 4WUKH 3ZYJA 4NT6A 4AIEA 3LB6C 4NN7C 5M95B 1H15A 1AXSB 4WO4C 4FQIL 2APBA 3AROA 1H3VA 1ECYA 3BQUC 2MPAH 3L1EA 3D34A 1WVZA 3M1CA 3H56A 3I6LD 5AZUA 1JXDA 2OW7A 5D7LB 4PG2A 3P4MA 2G0LA 3AS3A 1KV3A 3FN9A 5DD5L 3WKMH 2V5TA 1TMCB 1WBYA 2G9KA 2KLRA 3MMEB 5DC0A 1WWWX 1X4XA 3QUZC 1DUYA 1NGQL 2FCBA 2WBKA 2B3IA 3L1OH 5B38G 1XR8A 5C8JB 1BJ1J 1WZLA 3DMMA 1PPIA 3B5HA 3G5WA 3W38A 3F64A 2ZG1A 1LHZA 3KPQA 1LMIA 3ZHDA 1TJIH 4NP4L 2QVMA 4RESB 2C1OA 5DUJA 4YPJA 4F9PA 1H8NA 1ID5I 2B16A 2VO8A 4HZLA 4LESA 5IW6B 4OCRL 3I3EA 2FYYB 2JB5L 5ALBL 1ZLWK 1CIDA 3ARVA 1QRNE 3BHBB 2JB6A 1WWCA 1Z2KA 3B2MA 5EZOL 4XNUL 3WD5L 4H7VA 1J88A 4AGPA 3UTSB 4BH7A 3HG3A 1KB9K 4HPOL 1A4JA 4N2OA 4NFDA 1MFUA 1NWOA 3L4TA 4EO5A 1SDDB 4NQUA 1I8MA 5BO1H 4QRRE 2IALA 1UJ3B 2NY7L 2Q1EA 4X6DB 1U95A 1H3TA 1KCVH 2MH4A 3T0WA 4ZNEA 4MD0B 3CBJB 4PY7A 4R2GB 2C7UB 2QDWA 3K2UH 4LAQH 3PU7A 1Y18A 2VOTA 3UC0H 4GINA 2BNQB 5IVXE 2GBUA 4PY8I 3U36B 2GPZA 3L3JB 4PTTA 3JT0A 1SJEA 2Z92B 3BPCB 2CRZA 1SM3L 3DHJA 1G7LB 1MCOH 3H9SB 2JK5A 4M43H 4F2ME 5DK2A 1HU8A 3EGDA 2CKBL 1ASQA 15C8H 2QVFB 4KY2A 5D7SH 3TYFB 2FX9H 2VXTL 4AQOA 3FU7B 3RKDC 3GSNL 5KYUA 2OS7A 5DA4A 4K23H 3MV7E 1ZK5A 2ZOLB 4JVPA 5K9QI 3L4YA 5IQ9B 3K6NA 4Y19D 4Y1AD 4NQDD 4N85A 1H9DA 4WI5A 3BC9A 1TU2B 3WFDL 4UOJA 5KVEE 4Z7QB 3GSXA 2FEDD 3QG7L 3GBMH 4L1HA 1T5KA 4X6DF 3U7AA 2B5IC 4TNGA 1K5NA 4P59L 5I6MA 2X10A 3VFPA 1DDTA 5EIVA 1IAMA 3Q8FA 4ESKA 3W11C 1CDJA 4XCNB 4AM0B 2OZ4L 3ZZQA 1YMMB 3M7FB 2APSA 4ODWB 4DGYL 3QEQE 4ZOCA 1S7WA 4KY1L 2B4CL 5IHWA 3MBEB 1ID2A 4J8RA 4E68A 3RGVA 3GMLA 2Y22A 2V2XA 4FTVB 1ZLSH 3CCHA 3P4OA 3LD8B 4X5WA 3IFPA 5CMAB 4FQJL 4WFGD 5JIKA 4PS8A 4OLWL 2Q2EB 5BVJB 2R0WL 1WAEA 1A3QA 1KGCE 3UYRH 4KVCL 3PWLB 3N1MC 3SDYL 1A9BA 4K71C 3O3DA 1XTLA 3CH1A 1WEJL 5AWNH 4KK5C 1WBZB 5GIRA 4H0GA 4H8WH 4IMLB 3DWTA 4X6BB 1W0YT 3ZKXC 1HHGA 1QP1A 2FL5B 3GINA 3L4VA 4GRLC 4J3OF 2XVBA 1NPJA 5HYJB 2P28B 4Z7QF 3BDBA 4UAHA 1FNSH 4Q52A 1R6VA 2MPAL 2Y5EA 2BDNH 1JOIA 1Y6MR 3F7YA 3FCSB 4YGVB 5B7EA 3RWCB 4ZODA 4PJDE 4BGLA 1DFXA 3W57A 5CGYD 4GLRH 4FLRA 4HAKA 1J12A 4NUGH 1QSFA 4HKBA 4CILA 4WEBH 2YOAA 3WKML 4F58L 2ENPA 3UZVA 3G5VA 1JNLH 3S5YA 3K6OA 1E4XH 2E9GA 3RFZB 3SKOA 2GJ6A 3WFEL 3C60C 1RUPL 3WV0A 5I71C 1PF3A 3T0EC 2E7BA 2CK0H 2VERA 5EHFA 1T7ZA 3UG4A 4KKAD 2B1AL 5HHME 2VLLA 4OKDA 1IQWH 1WK0A 5DJ0B 4QHUA 5F9WB 5AVXB 1X5GA 4JFDD 3B7UX 4NRZB 4F2FA 1IB5A 2BNRE 4JO1H 1WISA 4LCIL 1ZTXL 1NBYB 7PAZA 3QO0B 3U7YL 4AZ8B 2JCWA 1J5HA 2F7OA 1LK3H 1F11B 1MY5A 3MGTA 5CWSA 2NT0A 3N91A 2H45A 1A1NB 4HGWA 3OG6B 1AHWA 5I24A 3GK8H 3SJVD 1YEJH 3GI9L 1D5BB 2YBRB 1KCVL 4G1MB 1DCLA 1MCIA 4J7RA 3VI3A 1AGDA 1A6AA 2VRAA 1OANA 1FFNB 2VDRH 4LHUD 3T0XA 3HZMB 1SPDA 2BCKB 1A6TB 3WFCL 4LAQL 5CJXA 2Q8BH 2CUHA 2YPVA 4GAJL 1LP9A 3MX0B 5E6SB 3U6XS 2GK0A 3RL1B 1JK9B 4L1DA 3AU0A 5F72S 4OFIA 4HSQA 3BP4A 2CIKB 5L2KB 5D5ME 1I8UA 2P1YA 2R0KL 4G6AD 4Y4FC 2V33A 4IS6A 1NCAL 1R3KB 2EC9U 3RWGA 3F3HA 2FX9L 2DDQH 3Q1SH 4GFTB 1EMTL 4FQQB 3TA3C 2J2ZA 2R15A 3I3DA 4GKSA 4K23L 5C0EA 1UCTA 2O1AA 1EAPA 4FNTA 2NY4B 3CHPA 3SCMB 4ADJA 1EERB 2JFCA 5B7FA 4AXWB 4ONOA 2H32H 1I1YA 2ZT9C 3O6KL 3MN8A 2AZUA 2OMTA 3FS9A 4ANUA 4KRPC 4HUUA 3UDWC 3OHXC 5DMGC 1HEJC 2WBJC 2YKKA 3UTTE 1OPOA 3TH3T 4NFBA 4K3GA 2C8NA 1TZ8A 4M4RA 2WLKA 1IBBA 1UUSA 5FGSA 2FWOA 3O45A 5L9DH 3HOGA 3MA9H 4MVBD 1INDH 4BFOA 1BVNP 2CHDA 4BWTA 4DCQB 1MN4A 4ES8A 2VDOH 4PJ9C 2AQSA 4BFIB 2VABA 3TT3H 2QL1A 2X7LA 4W81A 1ZLUH 1P7QA 1PDKA 1E8ZA 4AYID 5ID0A 4GRWE 1JF1B 2YD9A 3MO1B 2OM5A 4F57H 4PRHB 4G6JH 1XIWA 4UWQB 3DK2A 4EN2A 4TUOB 3KM2A 1SDAB 1S5IH 4NT6B 3FO0H 4JW3A 5C2BL 1H15B 4N2FA 5FKAA 1SBBA 2Y4SA 5LKNA 4O58L 4B41A 1NWPA 3MTXA 4Y2DD 5E1IA 1NOFA 4BH8A 1FDLL 2GBTA 2I5YH 3LDBB 3P4MB 1ZV5A 1Q0EA 1C7SA 1E6JH 3OJ2C 2BDNL 1C5CH 1DUYB 2YRLA 2D03H 2MPVA 1AZUA 1DZBA 1H3WM 1XR8B 3LZFH 3DMMB 4BSJA 4NWUL 4RX4A 5ENWA 4QD2E 4WEBL 2EDKA 3ULVE 1DCEA 2C1OB 3TS8A 1JNLL 1DSFL 3P3SA 2HT3D 4AX3A 4JFPB 4HZLB 3GT6A 2IG2L 2YGVA 1OGAA 2CUMA 2WAQA 2JTDA 5T8IA 1OHQA 1ICTA 2CRMA 2JB6B 2Q3AA 4AYDC 1GS7A 2XUWA 3QARA 5H2BA 3Q8AA 3P0YL 5FYJL 3NESA 1A4JB 1VPOH 4M7ZB 3D4ZA 2MNWA 4YIQA 2V9TA 4DQOH 4F15C 1VJSA 4JHAL 2P43B 1UWGL 3VGAC 2XZQH 1L0XA 2IALB 2Y7OA 5DLMH 1JTPA 2DF3A 4RBPH 4JO1L 4UQ3B 1FYHB 4MX7A 3NJKA 4PY7B 1LK3L 3QDJD 4HPYL 1HINH 1M57B 1HEZA 1RIVH 2ENYA 3BZ5A 3U0TA 4QLWA 1QYGH 3IDMA 2COQA 1YEJL 3B3IA 5AW0B 1GGBH 1Y18B 4V1DD 1IM3D 1X6LA 2QKSA 4XPTH 1YEIH 4UT7H 4NQED 4WW2A 2IDFA 9PCYA 1CLYH 1ED3A 2JNZA 2X4PA 4PTTB 1SJEB 2ORBL 4OM0H 2JK5B 4RFOH 3WMPA 3CDYA 4NN6C 4WU7A 2P5WE 3MACL 2QADB 4TVPE 1IGCL 1MCCA 3SE8H 1MRDH 1MCWM 3UTOA 3BD4A 4PRBA 5CINH 1RZ7H 2J1XA 4R7VA 2GC4C 1JZ7A 3FC8A 3RZWA 3Q1SL 3ZL4H 4BXVA 5JHDD 3MUGA 1OM9A 2UZIH 3CZGA 3ZMNA 1Y07A 3GSXB 4R4NC 3VXPA 3KMDA 4I89A 3OXSA 1I53A 1T0PB 1XZ0A 1K5NB 2DWXA 5FW7A 5F6IB 1WC7B 1QFWH 2XKUA 4X9BA 2J57A 1AO7D 2AK1H 3NEEA 3CC5A 3CHRA 3QW9A 2ATPA 5K9OA 4OJFH 3T04D 1IBZA 5LGHH 3S88H 5DS8A 3BH4A 5EU6D 3ULUD 4UUJA 4J8RB 3RGVB 3GMLB 4L8DB 2V2XB 4LCWE 1EANA 4X4ME 4YLBA 3ZGIA 4CUCA 3JV4B 3BX7C 3CCHB 3P4OB 4OCLC 4X7CC 3IFPB 4X5WB 2J44A 3GS0A 2DLFH 1NDMA 1BYNA 5C0ND 1OTUC 3ALPA 1H6EA 4N8UA 4RRPA 1A9BB 1J5IA 4QRSA 1GHFH 3O3DB 4FNSA 4F57L 1C16A 3S5ZA 4DUXA 1OB1A 1T66D 5GIRB 3TEUA 1CFQB 3U30B 2X4OA 4LXFA 2CGZA 1PJ9A 1GSKA 2E7DA 4LLVA 1HHGB 1UHVA 5JW4M 4HK3N 3BSZH 3FRUA 2DJMA 3F7YB 4PLKC 5C6TH 4HU8A 2D3VA 3QR1A 4CW1A 1XH3A 2NOYA 1XAKA 1QSFB 2K78A 4HKBB 1FV1A 4LQFL 4GXVH 2H26A 5I73C 4JGNA 2QSQA 2PYEE 1QAWA 5K1VA 1QVOA 2HRPH 3L6FA 3G5VB 4WFHD 3UZVB 2HFFA 2WN2A 5CCJA 5KVDH 3MYJA 1DQIA 2Z4TA 3D09A 3SKOB 2GJ6B 4FHBD 3HNVL 1DDHB 2AERT 2HX8A 4AUUA 1W6LA 2H32A 3K6DA 3BPLC 1QI4A 2HFGH 3F7VA 4FG6C 3QEGH 2WBWB 3WNLA 4UNTA 4QJ3B 1A1MA 5JLZB 3OJDB 2VLLB 3AG1B 5HXMA 1IKFH 1KIUA 3LHAA 1TIUA 4QHUB 3MHZA 3SPHA 4EXKA 4JO2H 4AV0A 4YJZL 1T03L 4IU3A 3VGFA 3R8QA 5CWSB 3M86A 5KTEH 2ZCKL 3GSOA 4XCFH 4HGWB 5DD1H 1AHWB 4KQ3H 5I6XB 5EDXA 2PCYA 4EQ3A 5DVKA 4L3AA 1PIFA 1AGDB 1A6AB 4EJ1C 1NCOA 1YVLA 1IEHA 1DO6A 1FL6A 3X3FH 1Q9OA 2IH9A 4AIXA 1QYGL 1SN0A 2Y7MA 3P3UA 5CUSL 4HUNB 2OTUB 3REWA 4YXHH 3VFGL 4HQQL 4OT1H 4QMEA 4GT0A 2GK0B 3ARZA 4XPTL 4UT7L 3TBCA 1G0DA 1AVAA 1CLYL 5D7LE 5I1DB 4TNVK 2ZPKH 3BP4B 1XCQA 2Q7NA 2HTLC 2XVKA 3GSRA 4IS6B 2CO6A 3CX2A 3QNFA 3CN3A 3RWGB 1BWWA 2EC9T 4XNYL 1XL6A 3H7BA 1KEML 2J2ZB 3IB4A 4GKSB 4N5EC 5C0EB 4XN7A 3SE8L 1EAPB 5KG9A 4X6CA 1NTDA 2HRHA 4NPKA 1I1YB 2AAAA 5CINL 3ZKMC 1CU4H 2OMTB 4JPIA 1J8HD 1MIMH 3BKJL 4HUUB 1MF2L 4O5LL 3QDGD 3VXUD 1J7VR 4JFOA 4YC2C 3WY4A 4NB7A 3M1OA 4M4RB 2X28A 4APQD 3MV8D 3MVSA 4M1CC 5D93B 3O45B 1HILB 3UTSE 4QT5A 1F2QA 4NGHL 4M48L 1A3LH 5HHVH 4GRLA 5TPWL 4DETA 3QFJA 5FYKD 4OJFL 5LGHL 4GSDH 2ZUYA 4NC2B 2XX1A 4I1PA 4RMQA 1M6OA 3FBQA 4X6DE 3UIYA 3QSKB 5EIIA 1FVCA 2VABB 3CHQA 5I30L 2X7LB 3UCQA 4FS0A 4MYPA 1PDKB 1PL3A 3BFQG 2VM9A 2DLFL 4AL8L 3F6IA 4JM2D 4FA7B 5BV7C 1O5PA 3ABGA 2BNQE 3L3OA 1DVUA 1GKOA 5D2LA 2LQRA 4WZ9A 3BJ91 1PVHA 2E3VA 3BT2H 3H9SE 5IQNA 4Q58C 3T0EA 1L6XA 2M26A 2DKSA 4BKLB 5KVFH 1N12A 4BH8B 2NY6C 4XE5B 4WI6A 4FZEH 4UTAL 2Q10A 1OAKH 2YPLD 3EFFA 3VACA 1EZLA 3R4RA 5DJAB 1YECH 4B97A 3DX0A 5C6TL 4W6YB 1F90H 3MLZH 4R97C 3EOAA 4XTRC 5B8CC 4JKNA 5JZ7C 5ENWB 1K2DA 3CFQA 1MRCL 1BAWA 4JJ5A 4Z7QE 4Z6AT 1IILE 2JCCA 3F2LA 2X70A 4NUMA 2ZOOA 4QI3A 1Q90A 2YD7A 1OGAB 2NXZB 2NSQA 5HI4C 4HUVA 2J4WH 2PR9A 5J13B 4LL9A 2XWBB 5H2BB 1K5WA 1UATA 1YMME 2XBZA 1H8OA 3KGUA 4YIQB 1ACCA 1S9YA 4EI6A 1S2EA 2QSVA 4MRBA 1CICD 3V4UL 4FTVE 4E9LA 3X1FA 5JQIB 3AT0A 3VD1A 4Y4FA 5BRQA 5I0XA 2X4UA 2CR6A 1EVTC 4MX7B 2H2PC 1I8KA 1LO2L 3CWGA 3JV6A 5KTEL 1HEZB 1N8ZA 3BAYA 4K2UL 4ZTOH 4XCFL 4ANVA 2VXVL 5AFAA 1AP2B 5LLIC 3IN2A 3IDMB 3B3IB 1JUFA 1AJ7H 2LLGA 4GXFA 4JVUA 2AI0H 2Z0BA 4NWTH 4YZFF 4WW2B 1TKWA 1YRKA 5DJCA 1ED3B 2X4PB 3X3FL 3UDWA 5HYJE 5EEVA 2BP8A 4YXHL 3AJ7A 2YMXL 2KHAA 2EYTA 2C9SA 4AE1A 4OT1L 4YDKL 1J1XH 5C07D 5FUCE 2ADIA 4WU7B 4X7SL 5FGRA 3BSZA 3IGAA 4NENA 3FT4A 4I0KA 1YNTB 4OIIH 2D31A 1TZIA 1TJHL 2EDNA 5HY9A 1TLMA 4OFDA 2VLJD 4PRBB 3TEZA 1R3IL 4LSRH 3GJFK 4G7SB 2HAZA 4GBXA 1GRWA 4U1HA 1BQLH 1Z5LA 3MUGB 5AYUH 4U1IA 5GGVH 4FX5A 4LOUD 5JOPD 3OXSB 4KTYA 3DRTA 1XZ0B 5E2WL 1A14H 4LPYA 4UOW1 5DGQA 3VSTA 1AGEA 2E9WA 1MIML 1PNCA 4RQQA 5AAPA 4YR6A 4NN7B 3CC5B 2ATPB 5K9OB 2ZYRA 1P4LB 5DS8B 1BMWA 1PEZA 2A9BA 4Y4KD 3P0GB 2CO4A 1X44A 4HUKB 5HBBA 3UCRA 4UUJB 4WW2F 1ZA3B 3LH8A 4K7FA 1YZZA 1CGSH 4EZMA 3T2PA 4L4TD 1YNKH 3FHAA 5L4IA 3T65A 3Q05A 3L2MA 3CDCA 5KYWA 4QRSB 1YNTF 1R0AH 2VYRE 1C16B 2EDRA 3QXAA 1OB1B 4CGUB 4P2AA 2WXMA 4ZJ9A 3S34H 3IDUA 2X4OB 3LEXA 5I9QC 2P4AB 2B59A 3B6SA 4LLVB 3F01A 1UQSA 1ZSHA 3ZU8A 4PGCA 1GYAA 4MAYA 1BLIA 3BT2L 2XIDA 3FRUB 4YSQA 5JA9A 1CC3A 5L2KE 2WGNB 3TM6A 4M8QA 2YXMA 4GYBA 2A9NH 4FQXD 4TQEH 4CW1B 4F92B 1XH3B 1YO4A 4RDBA 3IDNA 2WNGA 2J55A 1FV1B 1VZHA 3KW8A 2H26B 3N5AA 2NY3D 1SOSA 1AYRA 1A7PL 1QVOB 3L6FB 1DVSA 4XBGA 2HFFB 3JWOH 4P9MH 3US1A 1YECL 2YXVA 3EAKA 3LHPL 2ILLA 4M7LH 4MSWA 3MLSL 5I74C 5BV7H 2F8XC 1RFDH 1RSYA 2XJLA 4GIAA 1OQXA 3OC8A 5DFVD 4A38A 4BFBD 3KDMA 5JHAA 5ECJE 2D9QB 2L4OA 4QNPF 4U6TA 3ZSSA 4HIXL 1CR9H 1BM3H 1JVLA 1AIFA 3NFSH 1A1MB 5BMFH 5KZCD 4KKRA 4U31A 1D6EA 3PHQA 1L6ZA 2BVQA 1MAML 1S7TA 1KIUB 3UJTL 1MREH 4PS4H 1F6LL 1ZLDA 2RAMA 2XTSA 4IU3B 1I9RH 7FABH 2Y07H 1JRHH 3ZKNC 4EZJA 2WO3B 2QR0A 1KB9J 3GSOB 1VSCA 2R8SH 3OZ9L 2KH2B 5E99L 4KKZA 3CSGA 1U8IA 4PRHE 1OO2A 3FB6A 5C86A 1M1XB 1JDDA 5JA8B 2FD6H 1E40A 1FL6B 2QEJA 3B9KC 1Q9OB 3CE1A 3REWB 5I5IA 1AJ7L 1YEGH 1EXGA 2AI0L 3QUMH 1JP5A 1NL0H 3DX6A 3E1F1 4PRPD 5EN3A 7PCYA 1XCQB 4K8RL 1WBXA 2YUVA 4P5TA 4XXWC 3FHQA 3HZ3A 3A47A 3DETC 3NJGA 4LMQE 3GSRB 3TO2A 5K39A 4AQZA 4AYMC 2CO6B 2OK0H 3QCUH 4QR7A 1J1XL 4Q74A 3H7BB 4R7NA 1JNNL 4JG1L 1JTTA 1FNFA 2C9VA 1IGMH 5KG9B 4X6CB 5ILTH 1R46A 4OFYD 4BHUI 1RAMA 1MCWW 3NCFB 4KXZH 4DESA 5C7XH 4LSRL 4JPIB 5HD8C 4RDQF 2J21A 2WW8A 4P57A 3T2NL 1OCCB 4KVNL 4TQHA 2H9GA 2Z1KA 4JFOB 2F54D 4XXCC 4JO8A 2R4SH 1CFBA 4AEIL 4PGDA 3OKOA 4HIPA 3EJSA 4QT5B 3O6FD 5FM8A 3ZKXB 3VA6A 4HOWA 4W68A 4P07A 3EFOA 3OVUB 2V5YA 1CI5A 2EDEA 1M6OB 4XX1E 5EIIB 1FVCB 2NCEA 2XJKA 2EDOA 1ZVHA 4F91B 3L2LA 1I9JH 1XH1A 4PEEA 5DD0H 2FH8A 4URKA 4GP4B 5CJOH 3C09C 4OTXL 4I2XA 3L3OB 1AG6A 2VKXA 5D2LB 1MWAL 2FSEB 4R0LC 3NGBC 1AHMA 5JXAL 4X6CF 1R0AL 5DK3A 1JF5A 3T0EB 5JIIA 4FQHA 1LEIA 2MIZA 2YQGA 4YBHA 2BWQA 3FU8A 2Y0SA 4RNRA 3EFFB 5I82A 4DTGH 1JGVH 4LLMA 4ELDA 2IAMD 3RI5F 1FFQA 6CGTA 4OLUH 2A9NL 1DBAH 3EOAB 4QXTA 3M17A 1K2DB 1KCBA 4JJ5B 1LLAA 4M5ZH 4NKIH 4B9IA 4EMZA 1ZANH 2N0MA 4JPWL 2JCCB 3JWOL 1A4BA 1N4XH 2ESVA 2YPKA 4JGUA 4AH2A 2PNDA 3FPXA 4PREA 1YPZA 4UZGA 3TFKD 4FERA 5IQOA 5KUMA 5HHXH 1Y1UA 3LYRA 4HUVB 3F7LA 2BIPA 3LZNA 4ZOAA 1GZPA 3PWPA 1THCA 2UXGA 4ZUUA 4HBCH 4WI9A 3CVBA 2LW3A 2TSBA 4NNPL 2XBTA 1HC1A 1S9YB 3HTLX 5D2LF 4EI6B 3L1GA 3U9WA 4J1UA 2IANE 3MR9A 2LT9A 2BRRH 3OC5A 4B9CA 3HE7C 4Y4FB 2EINB 3LNHA 2AEPH 2X4UB 5EZPA 2WQSA 4EKXA 2K3TA 1R4XA 1I8KB 2FLBT 3JV6B 3JZYA 3IKKA 1N8ZB 3OPZH 4NQTA 5AOLA 2JWYA 3IETB 5E6IA 1F4AA 4KXCA 4OCSL 2DQGH 1WDAA 1JUFB 2J56A 4HJUA 4G72B 2XU9A 2Q76A 3WEOA 4RGNC 3GTNA 4MXQC 4FKKA 1RK0B 1TKWB 5DJCB 4PJGA 2DQDL 4XMTA 1XF5A 3W0WA 4AOFA 3TZVC 3SKMA 1KCSH 2BP8B 1GGUA 2EYTB 3FXIC 2JCCF 3F84A 4X8XA 1YEGL 2WC7A 5DUMH 3U4BL 2DWSA 3DDFA 2ADIB 1C1EH 2D0FA 2EDDA 1Y0LA 3KLLA 4DEPC 3IGAB 4NENB 3FT4B 5I1IH 5CXPA 5BUAA 4L3EA 1QSFE 3GQFA 2QQNH 3FSZA 3VVVA 4BQBA 2D31B 1TZIB 1KT2A 4CSSA 3QCUL 3UJIH 3MUJA 4GBXB 3IFNH 1EUTA 4U1HB 1KTJA 1SXBA 4YSUA 2GJ6E 3BCDA 3BN9D 4V11A 1ROWA 1Z5LB 4H13C 4ICXA 4HXBH 1PFCA 3VX0A 5CBAA 1KWGA 3QIWD 1KLGA 4U1IB 4ABWA 4EOWH 1IGML 2VLKD 2HSIA 2ZNWA 4XNZC 3VG9B 3DRTB 2D8KA 1NUNB 2Z35A 4HEME 1CF8L 1HS6A 1N10A 1AGEB 4RQQB 1AZRA 4HBQA 1VGEL 3N2JA 2R2HA 1ZY9A 5EBWA 5KW9H 4YR6B 5EEYA 2J72A 3ARBC 2PCPB 3T77A 4ATWA 3D39A 3FSWA 3L2NA 4LP8A 5IB5A 2XG5A 2R4SL 3CZNA 4KTEL 3ROLA 3O8XA 3D05A 3P9MA 4RAVA 5BXFA 2ZWLT 1D9KA 3D25A 3FZUD 5FLUA 4HWUA 2BSRA 4XI5D 4K7FB 5GISH 3BKYL 5AAMC 3HW7A 5HGGS 1HE8A 8FABA 4M62L 5F88A 4LSTH 4I0PC 5TGBA 3NCBB 3T65B 4C4UA 2WSKA 5AUMA 1OAUL 4M8RA 2EEAA 3A6BL 3DHPA 3T8XA 5KYWB 2OI9C 3WJJC 1AQ8A 1IC0A 4PHXA 4WY7L 3QXAB 1S7RB 2BCMA 3SDAC 3DX2A 2YRBA 3NRPA 1NEUA 3X14A 3QCTL 5C3IA 1Z7JA 1NC4D 2B59B 3B6SB 4HFUH 3V0EA 1UOKA 4P0DA 1AD9A 4MAYB 3QUMA 4KJQC 5KVGL 4M8QB 1K4CA 4NOBA 2A9AA 5AAWC 2OTPA 1HHIA 3JXAA 4IOSA 4LRIC 1RK7A 2NXYD 2XZCL 3FU0A 3IDNB 4NM8H 5E24E 3OGCA 1U2CA 4F15B 5C0FA 3KW7A 3LPGA 2ZZUT 4M5YH 4XBGB 1HNGA 2HTKD 1XGUA 4D2NA</