3I9AA

Crystal structure of human transthyretin variant a25t - #1
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
CPLMVKVLDAVRGSPTINVAVHVFRKAADDTWEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transthyretin
publication title Crystal structure of human transthyretin variant A25T - #1
rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 25
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00576 Transthyretin HIUase/Transthyretin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.180 Mainly Beta Sandwich Immunoglobulin-like Transthyretin/hydroxyisourate hydrolase domain 3i9aA00
3DJZA 1TYRA 2G2NA 4TL5A 4PVNA 5AL0A 1SN2A 1E3FA 1TTRA 1F41A 4ACTA 4I89A 5FW6A 4MRCA 3TCTA 2G9KA 4IIZA 4TKWA 3CN1A 4TLUA 4ABWA 2QPFA 2H6UA 1SN0A 4D7BA 3CN3A 1FH2A 2GABA 4AC2A 5A6IA 3DK2A 3A4DA 1U21A 2B9AA 1SOQA 2G4EA 5DEJA 2IGLA 2G2PA 4TLTA 4L1SA 4N85A 1TZ8A 1THCA 2WQAA 1E4HA 4DERA 3IMUA 2H0EA 3CN2A 4Y9BA 3DJRA 3OZLA 5CN3A 2B15A 3NESA 5EN3A 4ABVA 3U2JA 3P3RA 5IHHA 3KGTA 2PABA 3OZKA 2FBRA 1THAA 3ESOA 1ETB1 3CXFA 3DO4A 3P3SA 4HISA 4IK7A 4IK6A 5AKVA 4I87A 4TM9A 5EZPA 3P3TA 4ANKA 1DVZA 3CN0A 1BM7A 5AL8A 4QXVA 4DEUA 3I9IA 3DK0A 3IMVA 1DVUA 1DVTA 1ICTA 2B77A 3BSZA 3TFBA 3CFQA 2QGCA 3IMTA 3NEOA 4TQHA 4MRBA 1X7TA 5CNHA 2FLMA 3DIDA 3GRBA 4YDMA 4ABQA 1SN5A 1IE4A 5E4OA 4ABUA 1Z7JA 4FI7A 3FC8A 5E4AA 4N87A 2B16A 4Q14A 4IKLA 5DWPA 1G1OA 5CLYA 5BOJA 3GPSA 1TTAA 3QVAA 4DEWA 4IKIA 5K1JA 3W3BA 1DVQA 4PMEA 4AC4A 1BZEA 2QELA 2H0JA 2ROYA 1KGIA 3CFMA 3IPBA 3DGDA 3IWUA 4HIQA 4HJSA 4IKKA 4WNSA 3CFNA 4PWFA 3IMWA 1TTCA 1IIIA 3ESPA 4KY2A 4PVMA 3A4EA 3IMRA 1DVXA 1TFPA 1RLBA 3IMSA 4PWHA 3M1OA 5JIMA 3GLZA 4WO0A 1KGJA 1SOKA 1TLMA 5JIDA 5CLXA 4FI8A 5E23A 2NOYA 3HJ0A 3CN4A 2G4GA 4MASA 1DVSA 4Y9CA 3IWVA 4PWKA 2H0FA 1E5AA 1ZD6A 3DJSA 3A4FA 4TNEA 1BZ8A 4TQPA 5L4IA 2GPZA 2TRHA 3GS4A 5FW8A 3NG5A 4I85A 4TLSA 5CM1A 4Y9GA 1GKOA 4TL4A 4TNGA 1X7SA 1IIKA 1QWHA 1TT6A 1DVYA 4TLKA 2QGEA 4DETA 5L4MA 5AKTA 4YDNA 4TNFA 1Y1DA 3ESNA 2TRYA 1ETA1 2H4EA 4HJUA 3B56A 2QGBA 4QRFA 5K1NA 2G3ZA 4N86A 1FHNA 3NEXA 3NEEA 4PWIA 4TQ8A 3IPEA 4Y9EA 5L4FA 4TQIA 5TTRA 4FI6A 3P3UA 4PMFA 1BZDA 1IJNA 2F8IA 3DJTA 3CBRA 3I9AA 5FW7A 1TSHA 2QGDA 2H1XA 3I9PA 4HJTA 1OO2A 4WNJA 1QABA 4QYAA 4PWGA 4Y9FA 3U2IA 3KGSA 4PM1A 5CLZA 5JIQA 3GS7A 5L4JA 2F7IA 3FCBA 4L1TA 4DESA 3SSGA 2B14A 4IKJA 2ROXA 1BMZA 3GRGA 5CR1A 5FO2A 3Q1EA 1GKEA 1ZCRA 3D7PA 3GS0A 5AKSA 5HJGA 5AYTA 3BT0A 1TTBA 3KGUA 2G3XA 2G5UA 1F86A 3CFTA 4PWEA 4PWJA 3D2TA 4PVLA
chains in the Genus database with same CATH superfamily
3Q3GB 4TSAL 4MJJA 3LEXA 3RI5K 5D96C 4XAWH 2Q1EA 1BZQK 2W07B 1N8ZA 5DRZA 1MFBL 3FUDA 3ARDC 4NWUH 4JCWA 3R06A 5BOPA 2Z3FA 4UAHA 4DP4X 5DLMH 3U4EB 2WBJA 4ODHL 4G7RB 2IOIA 2A83B 4ZAKC 4OCNC 3TO4C 2IBBA 1R5VA 3B9DA 4OZFH 1RHHB 5K59F 3LIZL 2DWYA 2Q8AL 3UBFA 1W72B 1WIOA 2FQDA 1LNUA 3HHSA 4EPSA 5DLLA 1HEJC 1A4JB 1IGML 1NGWB 1RSFA 2A6JB 3ECBA 3HRPA 3D3VD 3IETA 3QDJB 4GG8B 5DI8A 5FECB 2YGNA 4U1MA 5J6GB 5KVMC 3KLQA 3EFOB 2HVKA 5BS0A 2P1YA 1DSFH 2HZHA 3MACH 4G6MH 4G1MB 4AOFA 3EUUA 1AQDB 1EWHA 1E9PA 3GRBA 4HMDA 4BM7A 1KBGH 5CEYB 1FH5H 1YQVL 4HC1L 1T5KA 1D6VL 5L9DL 1HDMB 4D9QD 3ZE0E 1HESA 5DJAB 2AXFA 2CKBB 4M5SA 2QELA 5SX5H 4CRPA 5I1AA 1NFDF 2DWSA 1HN1A 3T1WA 1SQ2N 5GZOC 3WTTA 1MJUL 2QEJA 3E1F1 1AKJD 1RUML 3AJ7A 4XOEA 3GXTA 4NCDA 1HKFA 1GY2A 1I8KA 5D6CB 2FBJL 5IP4A 1CQYA 4PI2A 3TNMA 1QUNB 3FQYA 3SE6A 3FB7A 1RZFH 3MMEA 3RTQD 3RNQA 1EO7A 3KHOA 2Z35A 3GJEA 4ZFZB 6FABL 1LHZA 3TIEB 3DV4A 2UWEE 3F05A 1S7VB 1P4BL 1OM3L 3UTTA 2M83A 4S0HA 1X7SA 1EBPA 3M07A 1UWXK 2Z8RA 3N50A 4LEEA 4NC2B 5C0AA 4JMNA 5KYUA 3T2OA 4F33B 4Q9CA 5IMOB 3MLXH 3QCVL 4HT1L 3B43A 1OAKH 4F58L 3NDZE 4KKBC 5FGRA 3MNWA 5K93A 2HX9A 2VAAB 2P44B 3GLAA 2WUBL 1HCVA 3MV7D 5ID1A 4YDKH 1XX9C 1JYXA 4OZIE 2F18A 5HYSG 3ARPA 1ZPUA 1EEYA 1H19A 3VM5A 4OJDH 4FTDA 4L4VB 3T0VA 5I1CH 4I2XA 1F4WH 5B38B 1OWRM 1G4RA 1UZGA 3EYSL 4UQ3A 5AYTA 2WZPA 3WNKA 1FZKB 1F86A 4XPFH 4BD4A 4LCWB 4HIIB 4BSVA 2C9AA 1S7XA 4X0KB 3W0WE 4MA8H 2KT6A 3QZLA 3GJFH 3BLBA 2C4FT 5F3HA 1H3VA 5GJTL 1J1PH 4XPGH 3T8VA 3UX9B 1JTOA 2Z0UA 4P3WA 3AC0A 5MENE 1H3XA 2O6FA 3UYRH 1A7PH 5E2TH 3CN3A 3KXFE 1ZHNA 1A1MA 1G94A 2A77H 2BP0B 2X7LB 4N85A 3N43F 5FOJA 1DBML 1EPFA 2EUVA 3B9KC 2NUPB 4AVJA 2TAAA 3DX7A 1TPXB 1ZGLP 4MGXA 2DMHA 4LK4A 2A3TA 3QB7C 5SWZE 1G0YR 1MCHA 4OCLC 4F15C 2QSVA 1NFDB 3NIDF 3UDWA 3VRJA 5FA4B 1KNOB 4YXKL 2DQCH 3LEYL 4HKXB 1LILA 1GZHC 3QORB 1CYGA 2YIHA 1E65A 2VN6A 2OLDA 1A5FL 5AB9A 1QSVA 3T8XA 3KLHD 3KZ8A 2X4PA 3PWVB 2I25N 4HULB 2EIMB 1DQQB 1MFNA 2JKRM 3CH1A 4JCMA 2AZUA 1ES0B 1MVYA 3AADB 3KYOA 4P2RD 1RURH 2BFVH 3AXIA 1UUNA 3KGRA 3N1GC 4HK0A 3ULVE 2CUHA 2XFGB 1EGJA 3CFDB 4L8SA 1OW0C 5E8NB 4X83A 3OMZA 5GS3A 4BQBA 3L95A 4XCCL 1UT2A 3J27A 1UH3A 2PP7A 1MFCH 4CAGA 1KJ3H 3I02B 5A16A 1P53A 4CW1B 2ZOOA 4OAWB 5CLXA 5J12C 5E23A 3ULVC 4DVRL 1CU4H 1YEWA 1XF5A 5L2KE 3GYRA 5T3ZH 3BZFA 2FBOJ 1EK3A 2BWQA 3GSRA 3W9DA 3V10A 3SDXF 1UWEH 4OLVH 3PWUA 4XO8A 5HDBF 4IBSA 5DEGB 1Z2KA 1NFIB 4KRPC 3UPCA 4M61A 2ERJC 4PD4J 4IMKA 4DP8X 4RAHA 3RIAF 4HX1B 1PS3A 3EOBA 3JV6B 3L7EB 4KI5D 2BW5A 4FLQA 4K2UH 4JRXB 1X4XA 5IROD 4I8DA 4DCQA 3SE3A 2E75C 3ETBJ 3P54A 4XN7A 4N8CH 1BQLH 3I9PA 1DCLA 3IJYB 1YNTA 1P5VA 2B4CC 2VOTA 3DROB 2HKHL 4AYFB 3NK4A 5FKPB 2APBA 3LKQA 1FZOA 3VXQA 5DZPA 5ESQA 4BKSC 4YSCA 2X6VA 3N43B 1EHAA 4W1TA 4I0PB 3AZUA 5ISZA 3FRUB 5E08L 1SUHA 1M05B 3QJQB 1AOHA 1OTSC 3MUJA 2NZ1A 3OKNA 4ZDHA 1JE6A 2EVJA 1LJMA 4PP1C 3SY0B 2OZNA 5KANG 2MWCA 4WWKB 2HMIC 2OMWB 3NIDB 3Q9PA 4X5XB 4R7DA 1MNUH 2XY2A 3GSNA 1SJXA 2Q86A 4G6JH 3REVA 4XE5B 2GABA 3BUIA 1Z0NA 3VDBA 1RU9H 4WUUA 2XX1A 1F4YH 2ED7A 3GSQB 2IPKB 3RB5A 3HHMA 3QULA 4OIBA 2PXYC 3GK8L 1Q0XH 3G5XA 4J28A 2JLLA 3WOVA 4MNQA 3HC0A 3NESA 4HWBL 3EYFB 5JIPA 4JNXA 3GM8A 3HI1A 4EF3A 4OGYH 5AD0A 4D9RE 1BBJB 4HJ1A 5AB1A 4MCNA 2ZYSA 4Y88A 3QIUB 1G6RA 2Y1VA 1L6XA 1CICC 5F7KC 4LDOB 5E00B 3RTLA 3WDHA 3O4OC 5AZ2H 1KY6A 2AK4E 4F27A 3K7UA 4L3CA 4NHUA 4M3KB 1Y6KR 3EHBC 3C2AL 5C0CB 3EH3B 1LVEA 3ZIMA 3QCTL 4Q52A 5I5MA 2CRZA 4JREC 5C07D 1F6FB 4CC0A 1L9QA 2ZE0A 4PRID 4GAJL 1IM3D 1P4IL 2BSRA 5KTEL 1AC0A 1SFHA 5HDBB 5CIPH 4AQEA 3RNKB 1X9UA 3PHQA 3VFMB 2J43A 4HWEL 4KROC 5LB1A 4FXKA 4WI7A 4IU3B 4IU2B 3KCPB 4XMUA 4PVMA 2AJUH 2YOCA 4OT1L 3IMRA 4YXLL 3ZPDA 1DCEA 5D7HA 3RYMA 4ATWA 4PHZA 3R18A 1P6AB 2C3VB 2MQ3A 3TBTB 2CM5A 4K7FB 3AAZA 2ADJB 4JFEA 4XMKH 4G9DB 2C26A 4ZFOL 3VXNA 4PJ9D 3UAJC 2TRHA 4A68A 4GP8B 1ETZB 1UURA 4GSXA 5DJ0A 2V7HA 2YRBA 5GGVL 2Y3AA 3BQUB 4PRHD 4FFVC 1N67A 1TVDA 4OCRH 1YYMH 1AGFB 2G3ZA 2CO7A 1SF3A 3VO0A 2WWKT 2KHAA 4POYA 1AQMA 4KX7A 1ASQA 3BPOC 1B0RB 1GAFL 2F19L 1IGFH 4OB5H 3ZHLA 3FRPA 4LLVA 2X28A 4NUJA 5GGTL 2D7PA 4EMZA 5KBLA 5CINL 5ICXA 5EO9A 5M95B 2KERA 1ZS8B 3SB3A 2CK2A 4P9MH 5EZLA 3BGMB 2IBGA 3I2CH 4LPYA 3O2DH 4Z23A 1IBGL 4EN3A 2JFCA 1XF3A 4JKPH 3DBXB 4QF1A 2G3XA 4NRYA 4U4BA 3ZHFA 4JZJB 3G6DL 1CTNA 3ES6B 3OR7A 5IVXB 3LH2H 3NP3A 3BESR 4OBSA 3W2DL 4KFMA 3MREA 4MRCA 4S1SH 5EUOE 1KLGB 4KJQD 1H9VA 3NBNA 3LDBB 3X17A 1KFAH 3QWRD 4AV4A 4EE2A 2N1KA 3NCCB 4X4YB 5J1AB 1SOQA 2RHEA 4YUEH 3ZDYF 1NWOA 1J8HD 3STLA 1BFOA 3OPUA 3VI4E 2ZUVA 3NN8A 2OCJA 1J1XH 1OGAA 1GVIA 4GRWB 2F74A 4PJFF 4HPOL 4C56D 3CVBA 1RK0A 2OMYA 3IBEA 4KOBA 3PGCB 4N2KA 5LCVL 2VSDA 1AKJB 1L3NA 4R3SB 4RA0C 1SBSH 1BM7A 2CDGB 2Y7LA 5E4EC 4QD2E 3BFQG 1BECA 4FQCH 1MRCH 3UTZB 3CXDL 1JXFA 1S7UA 2EEXA 4NO3B 5CWSB 3RTQB 4A7QA 3S88H 4ABQA 4YWGL 2GHZA 4LPUA 4O2EB 2GKIA 2TSBA 4YR6B 4BFRA 5BOJA 4FN0A 5E6ID 3X3FH 2ITFA 1L7IL 2ZPKH 3ZDWA 3S5LG 4ONGL 3CFMA 1HAWA 4GKZB 3CLEL 3CFNA 3DV6B 4X6DF 4YZWA 4G5ZL 4BINA 2V2TB 3IAGC 4WFED 4ACPA 3KWTA 1BQHA 1MCJA 4XB3A 1MHHA 5CILL 3QJSB 2I9LA 2B1HL 1BOYA 1F6AB 4TNWK 1LWRA 3G9AB 1FO0B 4M7KL 1I53A 1ZWIA 1NM9A 2H32H 4YGVB 4ENEC 4PTTA 4Y2OA 5C0BE 2DMKA 2J4WL 2CGRH 1Q9WA 1CL7H 4RDBA 1UOKA 2QSTA 2EUZA 3B2PA 4BK8A 4GEJA 1IEAA 2FSEB 5C7XH 1K8DB 2QSCH 1HS6A 2IANE 5JOPD 5AAMC 2K3TA 3P9MA 4KI5F 4AKQA 1IEHA 2FQFA 3VFTB 1S5HB 3BKCL 2J8HA 4LSDA 4HK3N 1U58B 2I27N 3NFNB 4WTQA 3S96A 1WUZA 1QSEE 1OO2A 1SHWA 3S3PA 1ODUA 5L4JA 1XGYH 2ICEA 4XP9H 1F3DJ 1N68A 5C97A 1MRDL 3X1GA 1BMZA 2LU7A 3ZDYB 3GZKA 3IU4L 1ZVNA 4XP1H 3NSYA 1RERA 2ZUSA 3O41B 3QZBA 3OAZH 4PJFB 2GT9A 3VD1A 1G9ML 4KKLC 4K9EC 4JJ5B 1FL3A 2NY2C 3G04B 3G5ZB 1KN2L 1OV8A 2Y06L 4Y1AA 3UADA 5TK2A 1OPOA 4BXVA 3S5YA 4BBWA 2R51A 2WQVA 1FA4A 3ALPA 4G7VH 3JYBA 3O6KH 1ILSA 5C9JA 1CG9B 3SBRA 2A9ML 3GI8H 3TURA 4TVPL 3RUGE 4KMTH 5F7NC 4FULA 1M7IB 4IMLB 3T0BA 5IHHA 4C57C 2NLJA 4QJ5B 4F7EA 4YHOH 4R96A 4QXGH 5JO5A 5I23A 4JLRA 4FC3E 2YA1A 3Q8EA 5I1EH 1XH0A 4OZHA 2JB6B 5JTWA 4HKJA 4ZZFA 2R9HD 5FHAL 3CFQA 2W0LA 2E9WA 5DMGD 5DUBA 1T04B 2A6KB 2CBQA 3O8XD 4HFUL 1I9RL 3DXAA 3NJXA 5I30L 2G2RB 4FJZA 1TPXC 2JIXA 3GNMH 4IIQB 4K94L 3P11L 4PSPA 4E5XB 1GJUA 4V11A 1KBBA 3KEHA 3OB0K 4WWOA 5B1CA 4EI5D 5SWSE 1AIFB 2BP5M 2NT1A 4BFOA 4PIBA 5GS0C 2JXMA 3BSHA 5LBVA 2E59A 1OOAA 2DAVA 3HW7A 4KK5C 3QORC 4LNRB 2DLEA 2FNWA 1LP9F 3F6JA 4LZKA 4FQJL 1T1YB 4NT6A 1L6ZA 4AG4L 1UKQA 5KSBF 1INDH 2FYYB 2Z8SA 5C09E 1P7QA 5D7IF 4XX5A 3N85H 4MD4B 5GRJH 2GTWA 4BKTC 3EJPA 4PJGA 4PUBH 4LLMA 1EEZA 4M1GL 4ZD3H 2EDNA 3OAYK 2VDQH 3AG4B 5IW6A 1M4KA 3MJ8B 5HHVL 3E80A 3KLAB 2Y5TA 3QDME 1IBBA 1CTMA 1P4UA 3QG6A 1CBVL 2IPTH 3B56A 3B5GA 3AVEA 5IVZA 2XA3A 3GMPB 4LPTA 4OF5A 1KELL 5INDA 3ZUCA 1W0WA 3S6CA 4ZMZA 5T3ZD 3I75B 3GFUA 5DDHA 3ZDZE 3QQ3A 2WWNA 2E27H 3QJHA 4ZUWA 2EUWA 3V95A 3M6DA 5DJ6A 2J73A 2BH0A 3NPSB 2DI8A 2IAMB 3BZEA 2HN7B 5DD1H 3FCTA 2QKIB 2VZTA 4HH9A 3QNYB 2O4EA 2X4TB 3S7GA 3CJJA 2DWEA 4DGIL 3US0A 5ETUA 1S7WB 4KKCC 2XQBL 4ZUUB 3CFEA 3G9VA 1O7SA 5D7KD 4PVNA 1F5WA 3JV0A 3ZTEA 4KKZA 4OF3A 5FF6A 5JHDA 2X4SB 3L3OA 2NMSA 1TJGL 5D1ZA 1YPZA 4IGBB 5EEVA 1S3KH 1RUAH 5IQ9B 4XVTL 3H9ZA 4FYSA 1OGTB 4UILL 1R47A 4I0PC 2GTZA 3SKOB 3B2VL 3GIVA 2G2PA 2CIIB 4AEHH 5C07B 1ET5A 4PPTA 1NMAH 5LBSH 3BVNB 1T4WA 4KXCA 4NKQB 3MLRL 1N7ML 4PRIB 4AGPA 1IM3B 1HHHA 3N3EA 4RIRA 2YJLA 4WWKC 2F68X 4PLOB 2CCWA 2A0LC 1P4LA 2NY5L 5ADPH 5K9QG 4G5AA 2Z4QA 1OCOB 1Q8MA 3VAEA 1M7XA 4KY1H 5F8QC 5HDQH 3I6GB 4HEPA 1V7NH 4B50A 3QUYD 2FEDC 1B2WL 1LP9B 1OF2A 1VKXB 3S8FB 4ZRGA 4Y19E 5DJ8B 2G3MA 4KO6A 4NENA 5KSBB 4ELMB 1AGBA 1KY7A 5D7IB 4HAKA 5I1JH 2RR3A 3ML9A 4MKMA 1TETH 1KIUB 4GO9A 3T65B 1XTMA 4G43B 3MV8D 1UYWL 3MRRB 3L4VA 3MLSL 4W4OC 4Q7DA 1XH3B 3VD7A 4BRJA 2ETWA 4K7PH 2JNZA 5HI3C 4RNRB 3SDXE 1JVOA 4PRHB 4NI6A 1SJHB 5L7XL 3VA6A 3VXSE 1NGZA 4NEHB 1MQKH 3KNBB 1A6UH 3CHPA 1H15A 5FCUL 3UBGA 3MRPA 1A0QL 3VD3A 4Y16A 1YUHA 4AZUA 5J06A 4XBEL 2DDQH 4P4KB 4H2AA 3T4YB 4ZUSA 1YJDH 1GKOA 3TFKC 4YBLC 3ZT7A 3X1BA 1CWVA 2I69A 5MERA 5JR1L 2PP9A 2EIZB 4QJ3B 1MAML 1O9VA 2YWZA 1YMMA 1ZE3C 4BSJA 4PGEA 3HG4A 3M1CA 3IXAB 2Y7OA 2IWGA 4N2NA 4XRCB 5K1NA 4YQXL 4WW2A 1NCCL 2C3XA 5LNGA 3SOBL 3P4NA 4L9LB 4B7LA 2XPGA 1X3DA 4GW5A 1CLOH 4Z7VF 1AZCA 4WSJA 3F65A 2BVOA 4HGWB 1FFPA 1MREL 1J8HB 1T4KA 4H8WC 5DK0A 4AMKL 3ZL2A 1MEXL 3EGXA 4V1DD 1CGUA 1XCTA 1NGYB 3QEQE 4HS8H 1KBWA 1S7QB 4D3CH 4N2BA 4C56B 4BH7B 1IM9D 1QASA 4J3TA 1SQMA 1UT9A 3HMWL 4YEFA 2Z4TA 3LN5A 3G5VA 2PPFA 4LLQA 4XGZB 1MHPH 3PIQB 2EACA 2QHRH 4O02A 3V4PB 4J3OD 3BZ5A 4TKWA 1FVDA 1S7TB 4QAWA 5TQ2L 3V5HB 3BKYH 5FYKE 4UM8A 5ID0A 1NCWL 1LEGA 4GMSL 2AQSA 4OZFB 1AD0B 1WAAA 4ZUTA 4UT9L 2A73B 3BGAA 1J0HA 1OOWA 4JFUA 5E6IB 1S9YB 1KXVC 2YD2A 4J4PA 4WY7L 2PN5A 3W38A 2UZIL 3D0VA 3MNVA 3FB6A 2K7PA 4D9QE 1DUZB 1A22B 2EXWC 4F7PA 2YD9A 1JGEB 4IRZL 3MLYH 3VSQA 4NUGH 3RI5F 5AL8A 3HC4H 3NACL 3IMVA 3BSZA 1SHMA 1WT5C 1ZJBA 4MJHA 4M6ML 4KO9A 2DQIL 3U30B 1N0LB 1P1VA 1GGCH 1HL5A 4Q0XH 4UQDA 2R29L 1H0DB 3U4BH 1U8MB 3FO9B 1FZJA 1BMGA 3ZT5A 3O45A 4QIRA 4B9CA 1N0XH 4FA6A 2OTWA 4QO1A 4AXWA 2HG5A 2O6EA 5DFTA 4BWTA 3WMQA 3V0EA 3O81A 2A4EA 2WLZA 1ZV5A 3QDGA 1A3RL 5C9KA 1K4DB 3RTQC 4HZLA 5CO1A 4LCCC 1VDGA 1J9SA 1NIAA 4JEGB 4F7KA 3Q6FB 3A6BH 3IJEA 5JXED 2AQQA 1INQB 5EBWB 3VFPA 4UINH 2JKXA 4PJIA 3EF7A 1UXWA 2AQNA 4M7ZC 5DURD 3MV7E 4Z7VB 2P8MA 3WFHB 3V0DA 4YSAA 2AF2A 1Z66A 2HLAB 4P5MB 3NG5A 3M88A 1QUPA 3OJVC 2X70B 3LNDA 1B88A 2AW2A 4FQ2H 1TMQA 4DGUA 3NRPA 1KSRA 4GQ9H 3LXBA 1JN6A 4U49A 4HEPG 4CKVX 5KS9A 3H6AA 1RUPH 4XVSH 5EF3A 4OGXH 3WAJA 2W60A 3ARXA 5IESH 1QACA 5IMKB 4ADJA 4K3JH 1K5WA 3MCLL 3GZQA 1QFWI 1HHGB 5KJRL 2GJ6A 2XWTA 2XZQH 4HJGB 2NW2B 4C83B 3IFOB 4P2QD 2V9QA 4LSTH 2ZCLL 3T6VA 3RX7A 2DWDB 2IXQA 4J12A 1WTLA 4MJIE 3EH5B 4RX4A 5BMFH 2ESVB 4UOZA 4UOW0 2X87A 3LIZA 4LKXB 5FK9A 4M43L 3DO7A 2XZAL 4F24A 4YSOA 3RL1B 1JWUB 3HRZA 1VJSA 4ZW6A 1YEEH 2V7NB 4XBMA 4XMZA 2E7MA 5E8EB 3QH3A 4FTVD 1ZLDA 1R24A 2R2EB 4OGZA 2VABA 3NZHH 1DFBH 1WQVT 1LEKB 2Y1AA 3O8XB 4HDIB 2YK1L 3KYNA 4N4YB 2DQUH 1ODAA 3D50A 5MI0B 1BEYH 2WB7A 4MDIB 3SD2A 4UYPA 5F6HJ 4ZO6A 5ESVA 2XWBB 4J8QA 4L5FE 4HC1A 5JQ6L 2YQBA 3HA0A 4EI5B 3F7VB 1TJMA 5AW5B 3RWEB 5IEHA 4NGHL 1EO8L 4IYKA 5AZEL 1HYSD 4P2RE 2DL9A 4NIYE 5K5YA 5E9AA 3QWQB 3K8KA 4NP9A 1CIDA 5T1LD 2XN2A 1RJZB 1NWPA 4P48A 2QQLH 3GMMA 2CUMA 4WSKA 9CGTA 3KLHC 2H2SD 4TOYH 4IDJL 4JPKL 3X14A 1U8PA 5G4OA 1TQCC 3ECQA 2PTVA 1E4XH 3CVHB 3FT1A 3RVXD 4UNVA 3QHZL 2XV3A 3FC8A 1AFVH 5B7MA 4AGNA 3M46A 4X50A 5DWPA 5ANME 4KZDL 4XTRD 4XNYH 4ZXBD 4NQSA 1XMEB 3HPLB 1JVKA 4JE0A 1SM3H 4JDTH 3CFCL 1T5WA 2V5MA 3LZLA 1S5IL 4PV1C 1N3NB 1XSIA 3C8KA 4UUJB 2FATH 3SPVB 1Y07A 3V6OC 3WXWL 2ADFH 1H6FA 2IOMA 1IVTA 4MJ4A 4XXWC 4QHKJ 3TBVA 4KI1A 3FQNB 1F11B 2E3VA 2YQ3A 2Z91A 3FBKA 4HUXA 5DC4B 2VLKD 5EFIA 1PAZA 1OAQL 1MY7A 1O75A 5FB8A 2AERT 5CP3H 1JHLH 4I1PA 1CVSC 4U1HA 1R3IH 1E9OB 2BMKA 4LRIC 5HGAB 4ZQTA 4X99A 5ABAA 2NW3B 4WHCA 3CC5A 4YSPA 5GISL 4KI5C 4B3VA 4F92B 2J1XA 1YEKL 2NX5D 4CN6A 3TH2T 2ZAIA 5IROC 4D0CB 3V5DB 1MZYA 4BA0A 1DN2A 1DEDA 1U4EA 3G6JB 1I7TB 5HYQA 2NY6C 5LO7A 2Z7ZA 4E9XA 1XGZA 4NN7B 3MROA 1DQJB 2DYPB 4R6UA 3L2LA 3TN0A 5LWYH 4U1SB 1PD0A 2ZUYA 5C0EB 4WIQA 2X42A 1G9EA 3ARFD 2OULB 2A6IB 4H20H 4AIZB 2WM0A 2HT3D 2YSSA 3OXSB 1S8DB 2BSCA 3FMGL 1TEYA 2WYZA 1QEWB 1QPXA 3VNYA 3D6GA 3QXAA 4EVNA 3KYKH 2VSCA 3V4VL 1TNNA 1QWUA 3NPSC 4J3OF 1N70A 4OLZL 3GB7B 2FSDA 4FABL 3Q8AA 1AVAA 2P5ED 3EYOA 3QUYB 4FQXD 1JPTH 3QEGL 1AS7A 2VDNL 1FAKT 3OHMB 2EYRB 4YFDB 3CHRA 5EC2B 3NRFA 1FYHB 1AGCA 1PDKA 1EJOH 3GKZA 3ULVL 2EDOA 3MV8B 3VFGL 3I9GL 5CD3B 3O3BA 4ISVB 2XN0A 1LMIA 1MI5A 4HK3J 4Z7UE 1XGPA 4X7TA 1TNMA 5IUCA 4G3YH 3S34L 1C1EL 3BWUF 3D2UA 5CHNA 4WDIA 1P5UA 3U9PH 5GGUA 4PJ7F 3L5WB 4MSWB 2AAVA 5DWUH 4R7NA 2MNJB 1MVUA 2ENJA 3DURA 3MRJB 3I85A 4X4XB 2DQEH 1JPFA 3VB9A 2WO2B 1NCAL 2N1TE 1EFXD 3ZRFC 4YSUA 3AQYA 3V5KB 1CLZL 4OD2B 3VD2A 5JORA 1J9RA 1TTAA 2OPCA 3QQ4B 4C4KT 5IK3B 1CT8B 2B4CL 2HG0A 1K8IB 1BIHA 4LB8A 2HA1A 4PJCE 3DX9A 4PRNA 4XH2A 2XTJD 4PJHA 2RIKA 2E74C 2D2OA 3FQTA 4N2DA 4PSRA 5FDWB 1MHEB 4FRWA 4A7GF 5MEOB 3QRBA 1DQDL 5BZXA 4I88A 3PWNB 4GUPB 2EO1A 3M17A 3QUZA 4PJ9C 4QTHA 3X12B 3ZKQD 2XWDA 4GAFB 3HG1A 1WK0A 5CN1A 2FGWL 4PJXA 3U0PA 1OF0A 4MAYD 4NZRH 4AYMC 3UTSE 1G5GA 1KPVB 2PCFB 4FNQA 3BPLB 4V1DB 5A3ID 3HE7D 2J21A 3BCDA 4HJIA 1CZ8L 3OMIB 4X7DC 5EF0A 3QIBB 5DS8B 1IM9B 4UCFA 1A9VA 1YEFL 5BQ7A 3NEXA 1EDHA 3NEEA 2APFA 1U6AL 1VGEL 5IFJA 3OKEB 1SYVB 1YEJH 5K1VA 3LRGA 1JWMA 3I6LE 5JHAA 1DJXA 1YHPA 4FKHA 1BM3L 3IDXL 3EF4A 1RZ7H 1JHKL 2MIZA 3O6FA 3FCGA 4F7CA 2ZOKA 4H88H 12E8L 1IFHH 4N0CD 1ESOA 2V5YA 4XCEA 4AQAA 3HS0A 3N06B 5DHXB 5IV2A 4Z3JA 5CSBA 4L9LC 2E6PA 3Q2NA 2G2NA 4KJQC 3N1PC 4MJ6B 1OP4A 2OSLA 1F41A 1UA6L 4FYTA 4HWBA 2X2JA 4N2MA 4HPHA 3DX6B 1OCWL 3TWCH 1T0NB 5F0MB 3DO7B 4PJ7B 2BY2A 4XNQB 5T1MA 2HRLA 4ZTPH 1U8KB 3FCSA 3EOAB 1AXSB 2PW1A 3ZKMC 5BZDB 4HWZA 1I7RB 1I8IA 4ZI8A 4ZW3A 4FQIL 2IQ9H 2AGJH 4CL7A 1AZUA 2WVVA 1MH5A 3EYVB 5I8CA 1B4JL 3W5MA 1USQA 4KBPA 2OK0L 1DFXA 1WDAA 3F85A 1KGCD 3GM0A 5GS1C 3RPIA 1BD2D 2C9UA 2QQKH 3SEPA 32C2B 1Z5LB 2IH8A 3HBGA 1WG3A 2ZP0T 4EXKA 1QLFB 3W37A 1LGVA 1E7UA 1ORQA 2HJFB 2PCYA 1DEEA 3MCYA 3CFBA 4HIPA 4XMLH 5E6IC 4H7VA 4HLEA 5DURB 1JZ8A 5EIIG 5JYMA 1TTGA 3V0IA 2B16A 3V6FB 4WO4A 4HV8A 1VHPA 4TRPH 3TC9A 5CSZB 3L3JA 4R0LA 4ZFOA 4XC3H 1II4E 5B7FA 4DP1X 4RCAA 5IB2A 4NHCH 1CLCA 4OLWL 2FLRT 3CU7A 3U30C 4B5EA 1VSCA 2DM3A 2OL3L 1QQDB 3QNZB 5A2FA 3WFBH 4OTXL 4XB8A 4XNXL 5DT1H 2MCAA 1YNLL 5E2JA 4FQHA 4DN3H 4P46A 1EHXA 1AQKH 3FUHA 4MASA 4JFFD 1CN4A 2H32B 4J6RH 4DP5X 3N42F 4NQUA 4JO1L 4LU5L 1T1ZB 4MAUL 4U0RB 4P2QB 5IOPB 1KCWA 2B0SL 5GGTA 3HN5A 1T7VA 4KXBA 3ETBF 5AOLA 1XL4A 2PW2B 3QFJD 4XCFL 4ETQB 3BLPX 2CKNA 2FIRT 2V4LA 1UM4L 4G7QB 3NK3A 4GBXC 4MWFB 4W9GC 5DMKB 5AG8A 2W88A 4FTVB 1NBCA 1XCXA 3KR3H 1IC5H 5DHYB 4KC3B 4KAQL 1U36A 1FNEB 2P24B 3FSZA 4TNWF 3RWGB 1ZDSA 3MRIB 1D6EA 5BJTB 5IM7B 3SJVD 3BVVA 2IF7A 2EKSB 5IQ7L 5I2IB 5CEZH 2IDFA 3AY2A 4I7ZC 5LXGL 4KTYA 2F5AH 1MQ8A 2BVYA 4X98A 3QI9A 1JK8A 2KQMA 1NUNB 4LHUA 1YEHL 5KVEL 2JQAA 3DPBA 3MXVH 5T1LB 3AREA 1ZMYA 1WFMA 2DJMA 4U1LB 5LCVA 1OE2A 5DA0B 1UCBL 1HQ4B 1DSWA 5DF0A 4FNLH 2GVYA 1UD2A 4H25A 4P23D 2DWTA 3HI5L 1A21A 2H0EA 4EZLA 3TF7C 1T5XB 4ANVA 4RZCB 4EUPB 4FFYL 4HOZA 2RFXB 3UABA 2BP8A 3NQKA 4Q6IA 2R9HC 2K6ZA 1CCZA 4O02H 4KQ0A 1ETB1 5DMGC 2ADIB 3O8XC 5B21A 3L45A 5I6NA 1VIWA 2XWRA 5AVVB 2ARJA 1L5GA 4JS7A 5LQBL 3RY4A 3NZ8B 2G75B 5IF0B 5DJ2A 3WMPA 4PJBE 4GSRA 1X5MA 1KGYE 1NCDH 1E3ZA 1WP6A 5ALBH 3DVGA 3I6KB 4EI5C 2A9AA 3NA9H 1D9KA 1F13A 4JFOA 1VGKB 2VLKB 1I3VA 5BUAA 3N42B 1E4WL 3IDIA 2K8QA 4G8GA 5E03A 5KW9H 2ZOUA 3FS9A 2ZOLB 2NNXA 4KKQA 4MCZB 3U7WH 3BMWA 4G8IA 5BXFB 1ZT1B 4HIHB 5D4IA 2BP3A 4H44C 4A7VA 1BVZA 2NX5B 1TQVA 1ZT7A 5DZ9A 4UM9D 3SGJA 3GUTB 4JO3L 2HLEB 4R4ND 5D7LD 4DN4L 5DZOA 5B8CB 3EG9A 2H9GA 5CUSH 1KT2B 2DS4A 3ZW3A 4TUKH 4WEBL 2B2XH 2W92A 4IBQA 1JOIA 2J20A 3RBSA 4CSZA 5SX4I 2OP4H 3KW7A 2ZSVB 3S35L 4R5TA 4BFBD 1DUYB 3A21A 1NL0L 4JPWL 1SY6L 4K9EL 4NPJA 1KPUA 3CLFH 2VDQB 2ITDA 5IJKC 1PIFA 1X6NA 1T89C 3ARFB 5DD0L 3V0HA 5BO1H 1FFRA 2O5ZH 5D1QE 1AXIB 4Y5XB 1M7UA 2X05A 1AYOA 4NXKA 1LXMA 2IV9A 3IMBA 1F2XK 5K9KA 4X6CA 3O3DA 5F9JB 4MNHA 1HSBA 3RY5A 4GOSA 4PREB 3K6IA 5H37A 2DLTA 5J0BA 3GO1H 3PWLB 3NSXA 5D1QC 1ET8A 2P5EB 4PGBA 2GK2A 3DUUA 5PCYA 3VQ1C 1DE4B 2GAZB 2H7WA 3E8UL 3C6LA 4OUUB 3K2UH 1ZDQA 3WUWB 3QFDA 1NIBA 3L4UA 5I18H 1J1OH 4KH2A 2AABH 4G42B 4YHZL 1IB5A 1D7BA 4Q2ZA 4JKKA 5FO9B 1SJVA 3EADA 3MFFA 1E5ZA 4ZUVB 1M53A 3CQFA 3QRFM 1DVFD 5IG7A 3PJNA 3V55A 2CO6B 4JRYD 1JFQL 3GMLA 1V3MA 3DTXB 1QATA 2AJSL 3O9WA 4WJKB 5CZVH 3L7FA 4CMHB 1L9RA 1DANU 1YRKA 1BEXA 1TO4A 3RBGA 5GS0L 3LS5H 2H6UA 4RMRA 1UATA 1MFBH 3ISWA 4KOCA 1RK1B 1WJ3A 3GUFA 4ONOA 1TCRB 5C0BB 1KV7A 1EFXB 4NZFA 4IHOB 5KVDH 3PNWA 3C6EA 3L4CA 3V4UH 2BNRD 3NVQA 4HKBA 4MXQC 3E6FB 1CGVA 3LIZH 5ES4B 4J3VA 2FR4A 1KEML 2A9NL 4OLXH 3A47A 1VZHA 5CM1A 2XN9D 3M8OL 2XTJB 5CJ8A 4YZFE 5IUSA 5LN8A 4YDVA 1KCVH 2OMTB 3ZTNH 1IGMH 5IJCC 3FQ2A 3RGHA 3FTGA 4MQXD 5GRWA 1LQSR 1KBKA 4OD3L 3QXDB 1U93B 1KJ2B 5D93C 4M5ZL 3WGUB 1GHFL 1U42A 1DBAL 1QSFD 1YQVH 1G0DA 1HXYB 4HC1H 4A67A 5L9DH 3VJ6A 1AG0A 3ESUF 4WFHD 2PYED 4OFIA 1ONQB 2RCSH 2VXUH 3BAYA 1IGCL 4LHUG 4KDWA 1J8RA 3B9VA 4ZMYA 5DC0A 1HTYA 5ABDE 4GG6F 2VZVA 5F7EH 4BDVA 5LNEA 5J89A 1NDGB 4ZW5A 1LO4H 4KRNA 2A5UA 3KDMB 4GO8A 5F1NA 2J5LB 4R2GB 5FUCC 1XXDC 2VDMB 3TONA 1TZGL 1BZ9A 2BSSA 1DBKH 4LMQE 4HHAA 3V0JA 1HL8A 3HBZA 3E3QE 4P07A 2WBWB 3IWVA 5D72H 2NUTA 1BA9A 1UXMA 3WKML 5J1SC 2V2XA 3OX8A 4FE9A 3VXUA 3KPLB 5T3XE 4TLSA 3KPRB 4PCKA 3HZKA 2G60H 3UO1H 2EXYD 2RA1A 5E2VH 5CMAB 4GMTL 3E3QC 5DJYB 4ETYA 1U2HA 2NY4B 1Y1DA 1ETA1 1J0YA 5EULV 1Z5YD 2BVPA 4HT1H 4BIKA 2XOTA 1CE6A 2O5XL 3MRLA 1TJIL 3QJTB 1HX0A 3ILDA 3CSPA 1ZHBA 5ADOH 1M9SA 2Q8BH 2WGXA 3SZKC 5JUEL 2WUBH 5IEKA 3CBRA 4GQRA 3C6SB 1UZ8A 5E56A 1QFPA 1YAIA 2VC2L 2APWA 3BPLC 3PGDB 1UACL 3M7FB 1S7SB 3SDYH 4AGOA 4DZ8A 1UZ6E 3OWRA 4OBRA 2CNZA 4PN6A 5CF3A 5F1IB 4I18C 5DS2A 2MOQA 2ZQKA 4Z76B 2RQ8A 3OKMA 1T3FB 2VL5A 4Q4IA 1KJVB 1ECZA 3CFTA 4XAKD 1OAZL 4WI8A 3RFZC 1NMBH 2D4FA 3EYUH 4G8AC 4BCZA 1TKWA 4MA3B 1ZTXL 2BSED 3GHBL 2DEXX 4YSDA 2XBDA 4HZAA 1BD2B 4EI0A 2OW7A 2QPFA 3ZJAA 5AZUA 4NNYA 1TVBB 4J3UA 1N4XL 4M8QB 2EDXA 4YHNB 4Y4FD 1PSKH 4KTDH 3JV5A 4XCNB 3UAFA 1MPAH 1J5CA 1A4CA 3IMUA 4M1DL 5EU6B 1DBMH 4QGTA 3GSVB 1U9KA 3QDMB 3U2JA 2FGZA 2CDEB 2ID5A 3GRWH 4Y4KD 4UIMA 1PG7W 4FCHA 1M1XB 3NCWA 2EIJB 3PP4H 3FSVA 3NABL 4Y8DC 5DHVA 2PPDA 5AKVA 5HYEA 2HRHA 3JWNC 5D1XA 1IAOA 5DJDB 3UPRA 2F53B 3BVUA 1AHWB 5EN2A 3LEYH 4WU7A 1OKEA 3TCLA 5L0QC 3PFUA 3I84A 4LLDB 4HQQL 3F12A 2X1PA 4UB0L 1NLDL 5EU3A 2OAAA 1A6TB 1H5BA 4Q14A 1FNGA 1NSNL 2C1OA 3FB8A 1A25A 1IU1A 5GJSH 4BFEA 2JCCA 1E4JA 3CK0H 2WIIB 2G5RA 3HLAA 4H8WL 1IL1B 4G9FD 3MODL 4I9WE 5JXEC 1RH8A 3FN0H 5C0IB 2N01B 4F57H 2YXFA 2WLLA 1J0IA 4ZS6D 3APFA 1JPGB 1PPIA 3E6HB 4WWNA 5BVJB 4NP4L 2Z31D 4RMSA 1X5GA 4DIXA 5ITFB 4DVRH 4ADGA 4N2AA 4P2OA 1XR8B 5CCKH 2Z92A 1D2OA 2NXZD 4NXSA 5AVZB 1UWGL 4JDZB 4WI9A 5IHUH 3HG0A 3IXTA 1M71B 1Q4NX 3QO1A 4HKZB 4YGAB 5MP6H 3VXRD 2F8VA 4A2HA 4WI0B 3STBA 4U6XB 4MX7A 3LN4A 2IGFH 2M2DA 2R7EB 3ARYA 4GSUA 4JY6A 4RH4A 4D8OA 2XIIA 4U0RC 4OCXL 2BSTB 3RZCA 3NPZB 4APQA 2VDPB 2CBOA 5EO1B 1U3HA 1G0XA 1K4CA 1KIQA 1QABA 1BIIB 4M1CD 5ACLA 4W9JC 3OMNB 3WNOA 5J9PB 5TF0A 1EAPB 2ORBH 5E5LA 2MNUA 4Y2LA 4X8XA 4ODXA 4U6YA 4DUXA 3OZ9L 4GUCA 2P43B 7CGTA 1E67A 2VLJD 4QUOA 4UT9A 5KG9A 3LEVH 4RLDA 1NDMA 3BT2H 4RZKA 3WFCL 2DYSB 4JFZL 3VXSB 3NJIA 4KO5A 1LD9B 5G5DB 3VYPA 1BBDL 1UG9A 4IRZA 4B53A 4NQDD 1FDLL 4X6EA 5F7BA 4NWTH 1RMFH 2I85A 3C9NA 2B9BA 4AC2A 3OHXB 5CEZD 2FIKA 4L4JA 3Q1SL 2R29A 4QYOB 1HYSC 3GK8H 2ZAHA 2YGQA 5GRVL 4HD5A 3CLWA 3H3PH 3N04A 1AE6H 5I1GH 3VWKA 4P5KB 2H2SC 3GBNL 1RZIA 2VZUA 1EJ6A 3CXHK 5HI4D 3VW3H 3FUEA 4B27A 3BJ91 2K9FB 15C8L 3IAQA 2VIRB 1JFHA 4CADA 3D69B 2WWMD 5C0RH 3F01A 1ZGLM 4WHYG 2OCCB 4XTRC 3JSSA 4ZXBC 4NAQA 1F4HA 4PTUA 5E4IA 2Z8VC 3C60D 1B4TA 4DFHA 1FO0L 4UYQA 5BRZD 3GBMH 1FHGA 3KPSD 4LSSH 5TQ0L 3ROOA 5JW5B 2HJLB 1PD1A 4N3TA 2XICA 3DOSA 3VFNA 4ZX3A 5BZWA 4LSUH 3ARDA 2D7TL 1VB9A 3HBPA 3VWKD 3QEQA 43C9A 3MPCA 1FVEB 3C09B 3DSFL 4DZBB 3V6ZA 3F7PC 1Q38A 2NZ9D 3ZE2F 1I7ZB 3AACA 4YXLH 2C5DC 4ZAKA 3WKQA 4K71B 3TO4A 5K39B 5FO7B 1PLBA 5TGBA 1FFNA 2MCPL 2X12A 1TEGA 3MZTA 4QRTA 3TZVB 5SV4A 1ZIBA 2RQEA 4NSKA 3TL5A 5T1JA 1G7QB 1XEDA 3LH9A 3FFCA 2D31B 3K72A 2DTML 5INCA 1RPUA 3NGBC 3V0FA 4P2YA 3SCMD 3IU3A 4JRYB 1B4RA 3QIWD 4GI9A 2JMRA 2GSGB 2P3YA 2XQ0A 1D5BA 5DRXB 1FBIL 4Y5YC 3LKOB 3ARFC 2F19H 2W65B 5J56B 5EWIL 1ADQH 1KB9J 2HT3C 2VE6A 4MJ5A 4PD4K 3QJRB 3VCLA 5GZOA 4L5FL 4OCWL 1T20B 2ZWKA 5D9SB 4CVXB 3QSKB 2BNRB 1ZCRA 2JJTC 3ATEA 1IBGH 3CHXA 3IDMA 3JTSB 4WV1C 5FO8A 3BVWA 1Z3RA 1MJJB 1SJEB 4AUJA 3BVDB 4FQXC 4M8RA 1HZHL 4QI3A 3K6FA 1CFTA 1EVTC 4GXUN 1HCZA 2PWHA 4W6XB 5TD4A 3ZMEA 5H35A 4RWYL 1N5YH 4UZSA 4MTMA 1C5CL 3BYTA 1R5IA 3HJEA 4L3EA 2WP3O 1MFAL 2BOLA 2D3VA 1WEJH 4KZEL 4FJYA 4I2XE 1NC4A 2XIDA 3EO9L 2ED8A 3BX7C 1QSFB 1PG7H 1U8JA 2X89A 1R5WA 3ZO9A 4KRLB 2BSDA 1S7RA 1VFBB 4JX0A 4NO5A 2PYEB 4J27A 4U1GC 2BS71 1I8LC 1SEQH 1UA7A 1EHKB 4B9KC 2XZCH 3H9SD 5LCVH 4B41A 2OX5B 4AJWA 4BSWA 2BZ7A 2Z9TA 4R4BA 1UASA 3DHPA 4CSTA 4UT7H 5L88L 4Q9QH 3TX4A 3ZE2B 1E28B 1WD8A 1XIWD 3VD9A 1SEBA 4LAQH 3MJWA 2BC4A 2JKIS 3CPLA 4YBHA 4YWGH 5HHPA 5HVWA 4JW3A 1VFUA 1ZSHA 2A1WH 2XTJC 2D0FA 4ZFGL 4MA1B 1TDQA 3OF6D 3QQ9D 4WRLA 4PJDA 1Z9SB 2YBRB 2WCGA 4NC0B 1JGVH 5CCHE 2OXGB 3U1SH 3GLZA 4BE5A 1X7QA 1UM6H 2FRGP 4MAYC 4EI6B 3B9KA 4O5LL 1EZSA 3ZOAA 5MENA 4GRLD 4M7LH 1YYCA 2VDLH 2JELL 2NY7L 3DI2B 3WJMB 5C08A 3KXFA 5A3IC 1GXEA 3GSXB 3HE7C 1OD9A 3K80A 2H1PH 3FTSA 4ANXA 2YAOA 2WP3T 4LEOB 2J5LC 5JHLH 4N1HB 1GZHA 5SWZA 4UQ2A 3ZR5A 3IGAB 5DQDL 2R8SL 2P28B 3P4OB 2ZZUT 1HHIB 4PU2A 3IDGB 1YJDC 2WKLA 4E42B 2B5IC 4CC4C 1CR9L 1RJYA 3V4VA 3U1QA 2YPLA 3BWAB 2H1XA 2KUTA 4N0CC 4FLRA 1WFTA 4O2CA 3VXMA 3V7AG 2AJVH 1OW0A 4Y4FB 1XZ0A 4OFQA 1N19A 1SLXA 2DQTH 5IJVA 1QBMH 2EP6A 3T04D 2CK0L 1FGNL 1CIUA 5GSVA 2OJZH 1YN7B 1D3CA 4PY8J 4Y89A 5T5FH 3UTQB 2BIOA 2KZBA 1DTUA 3QQDB 2BNUA 2IH3B 2V37A 3R4DA 3QZWB 5FYLH 1JNHB 1XF4A 4N9GA 2BVQB 2R4SH 1ZT4B 4JR9L 3IJHA 2OXHA 1LQBC 1JZ3A 1U8NB 4QRPA 2Q10A 3DGGB 1J5HA 5B39A 5AVRB 2CGYA 1IC7H 4NCC2 1T22B 3PWPD 4KPHH 3PV7A 2ZCHH 5ISZE 4LSPH 1Q1JH 2HH0H 4ABVA 4J8RA 4D8PA 4JK0D 3Q5YA 1L6PA 4QHNA 2UXTA 3IN0A 2H3NB 3H2QA 4UQBA 1P84J 1OEZW 3G5YA 2DI9A 3QJFB 5A40E 5AW3B 5LN4A 3BVXA 4NC1E 4F7MA 1XF1A 1VEPA 1BVOA 4OI8A 3Q5TA 5F44A 1X7TA 4WUUE 3TT3H 2Z31B 3AQXA 1PZCA 1I9RH 1RPKA 3DYOA 4HFUH 5CBEB 2J1YA 4KQ3L 1JGIA 4UMGA 3P11H 1KENL 3MNZB 1Y0LA 4JFFE 2YOAA 5JQIB 3GIZL 3TJHD 4BUQA 1T0OA 5H2BA 4OM0H 1UTDA 3R7RA 2PLTA 3KG5A 4PGJA 2BIQA 3VQ2C 4LCYA 3MOBH 1IT9L 5DUJA 3VXRB 4D9LH 3C08L 4OUOA 1JUFA 3RDTD 3FO2A 4KVNL 1XH2A 3QFJE 4NIKB 1HEZA 3BIKB 2I07B 2PXYA 2HJKA 2DQHH 1HT6A 1G1YA 3NAAL 1GR7A 2X9ZA 3WNPA 1LK3H 4J3SA 3TNNB 1I3GH 3BISA 4F93B 2IADB 4PGCA 1G7PA 2EH7L 3F64A 4WHTA 5LAXB 1CICA 2CLVB 4QXTB 3MKKA 1BZ7B 1C16B 4HCRL 4NZTL 3IGUA 2YPVH 1LO5B 3MRKA 4QPEA 1QO3A 2E9JA 3MU3A 4ZQKA 3SJVE 5KN5A 4GH7B 3ZKND 1DJZA 4DPAX 1NAKH 2XVBA 4P04A 1CBVH 1XB8A 4XAWL 3B9EA 3QUGA 4G1EB 5DJCB 1JXGA 2X3BA 2FJSA 3L9RB 4CVZB 1NTDA 4NWUL 3V4PL 2AK4A 3GGWB 4HIJA 3O11B 4CU8A 4NQDB 5DQJB 5BRPA 5DLML 4JFEE 5GGRA 1AQHA 5JIQA 3U7YH 4DESA 4U6VH 4NB7A 1IAKA 2MKLC 2PCPA 3ARTA 1KG0A 5DUPH 4XE0A 4PJEF 4WTWA 4YEEA 3TTSA 2VLLA 2YKKA 1KTDA 3PREA 2YAQA 4U6HB 2FWOA 4Z3FA 1QNZH 2UVEA 3BIAX 1DSFL 4OCSH 1FNSH 1TR7A 3MACL 4G6ML 3VGDA 4H26A 3UAJA 3VFOA 1ZRUA 4PRPA 2LU5A 2W9DH 4P23C 4FHBD 1A4KB 1KBGL 1FH5L 1FJ1B 1IAII 4NO0A 5C86A 2QR0A 5DRWB 1S9XA 4QY8B 2PKDA 2Y5EA 2GUOB 1B0GB 2FJHA 3B2VH 3C60B 5DRNB 2FNBA 1M6OA 4LPCA 4WEMB 5I76A 3E7JA 5IHBA 3JVFC 4P57A 2VXSH 4PLKD 3HC3H 1D5MA 4FNTA 4U05A 4QRRD 5IBUG 5DVPA 3UBXA 1WLHA 5E1AA 2F5BH 5CLWA 3QR1A 3OHXC 2A99A 2DV6A 2J71A 4DEUA 1RZFL 5EU4B 5FA3A 3RVVD 1BX2B 1CUOA 5D7LE 1Y18A 2A6DB 3CHQA 2DBJA 2EIKB 2GBAA 2MEJB 2KZ1B 1PJWA 2OL3A 4F2MB 1NMCB 3N5AA 4AEIL 5GPRA 1S2EA 2H0PA 3MA9H 1OGAE 4TPRH 5EU7C 1Z9PA 5DO2D 3N41B 5D2LA 3MLXL 1OAKL 1EZVY 3EGDB 1CF1A 2BOCA 2XXCB 4K3EH 4JFQB 2XFXA 4TSCH 3QDAA 2BNQD 4MZIA 4XWOD 3CVIL 4LSVH 5DHEA 3WEXB 3WNNA 4NUQA 4L9DA 4AQ1B 1ZAGA 4YDKL 3QIWB 3Q3GA 1JDCA 2OKMA 4BFIB 3ARBB 3KPMB 5EUKB 3U46A 5B39G 3CDCA 4LL4A 1JF1B 4CN4A 5I1CL 4JUTA 3AXHA 4W9CC 3U25A 2JKWA 5HYJD 3NZSA 4QNPF 4XPFL 4QOKD 3VI4A 2WHVA 2DM7A 2YSTA 3C09C 4H0HB 5D7EA 3MR9B 1PVHA 4PJEB 2C9XA 5IB5B 3EOTH 3L1GA 5JR1H 2A83A 4MA8L 1ZHLB 4FFWD 2EEBA 3US1A 1RHHA 3U2SB 1J1PL 1PQZA 2LV4A 4XPGL 3QZPA 2XU9A 4MB4A 1LEIB 1W9XA 4KMLB 1A7PL 2P46B 4JPVH 4IS6A 1MUJB 1A4JA 2JWYA 1YO4A 8FABB 3HAEA 5FECA 5J6GA 2A77L 5DJZB 3WEMA 1CFSB 1T0MB 3PNRB 1S78D 1VEMA 3GBEA 3U4AA 3BUBA 4G1MA 4AM0B 1JV2B 2JKNA 2X6MA 1F1AA 1DVFC 1A6VH 4YSRA 2XRAH 5CEYA 4KX8A 2ODHA 4W9FC 1CVRA 2Q3AA 2YEVB 1HDMA 4JQVC 2VDOH 4TYUA 2LOEA 3BLKA 3LHPH 3ZL1A 2DQCL 2VH5H 4FFYA 5EF1A 2LAAA 3FUIA 4MA7H 1TEFA 3KAAA 1SXBA 3MAWA 3L5XH 2PTTB 4FP8H 4KJYA 1XGTB 1DQLH 2WXFA 3MV01 4GMSH 4WJ5B 1Q1PA 1IEBB 4RRPA 5AAMA 1RURL 5EZJA 1MFDH 2BFVL 2WK2A 3HR5B 4E41D 2EYTA 1HSAA 3TIEA 3IPFA 2Q2LA 3Q2VA 2P5WD 4OM1H 2YXMA 2XG4B 4MQXC 3SGDI 1S7VA 5AW7B 1MFCL 4IK7A 4Y1AE 2IANA 1D5ZB 4IRZH 3RFRA 3RPBA 2R15A 5IMOA 3DK0A 1AGDB 1YN6A 3PG2A 4YNYB 3GHPA 1CU4L 3MRNA 4YPGA 1L3WA 3TFBA 2GBUA 5T3ZL 3TO2B 4NERA 4OZ4B 4FAAB 1NCNA 3ME0A 4MD5B 5ICYB 4O2FB 3IVKB 3DECA 1XR9A 3ZO0A 1UWEL 4OLVL 2AZAA 4KNTA 5AAPA 4YAQB 1SY6A 3CCHB 3LS4H 2ZUXA 2Y6SD 5JA8B 5KYYA 3UYOD 4AY0A 4W70A 2J3SA 4OZHE 1PJ9A 4K2UL 3UROR 4BELD 3C87A 1DJWA 2QVTA 3QZNA 1HXMB 5D2NB 4U2YA 4N2HA 4RA3A 3VXOB 2R69H 4N8CL 1BQLL 1ORSB 4BCYA 5CGTA 3DXAE 3PJSA 4ELDA 3MRQA 2DYRB 1T2XA 5IVNA 3BZDA 4MA1C 3WSQL 5E5UB 4P5SA 2H26B 2EXYC 2K3HA 4QEGA 4WI3A 5EHFA 4TNEA 4TQPA 3P0GB 4XN9A 3H3BC 4JPSA 5G4MA 1HXKA 2BP0A 1N59B 2WINB 2X7LA 3FU8A 4IKNA 9PCYA 4J1UB 1IKNC 3BIBX 4TVSa 3UBXG 3OGOE 2BK8A 4CNIA 1JZ2A 1KOAA 1EQWA 2QT6A 4DP9X 1MNUL 2AJYH 2DPKA 1EHNA 3FTZA 4G6JL 1YQ2A 3EYQD 1NFDA 1KFGA 4PJBB 4XXCC 3WN5B 5KBKA 2R1YB 3HOGA 1F0LA 1RU9L 1UXSB 3H42H 1CGTA 3OLDA 4PJGE 1F4YL 3HVDA 5D71H 2W0KA 1Q0XL 1UKTA 1ZVSB 3QORA 3KS0J 3PWPB 4PBWD 4OGYL 1MLBB 2W0FB 3BT0A 5SWSA 4PRBB 5C8JB 3RA7H 1BCIA 1AAJA 4ICXA 3K6SA 3RWIB 1ES0A 1H3TA 1Q0YH 4FFTA 5GGSB 3WU1A 2XZAH 4LVOB 3P30H 1S9WA 3CFDA 5GZND 2IDUA 1DO6A 4HF5H 4Y4FC 3VGAB 4UTAL 5IHZB 3UTOA 5E1QA 2EXTA 5E5MA 5C09A 1CYWA 2HTKD 4YHYB 1VFAA 1RULH 4QGYA 2HP4A 2OJ1A 4Y4KC 4CW1A 4OAWA 3K2MC 4QRUB 2C7FA 2HX8A 5FX3A 3D39D 3JTBA 3HI6H 1JGDA 3P1VA 4F7TA 4X5PA 5EBLB 1TITA 1BXAA 5JHDE 4NGHH 5DEGA 3DTDA 1NFIA 1WHOA 3H6JA 3P3TA 4TM9A 3RDTB 2WTOA 3ZYIA 2WXNA 3K91A 5J57B 2C3GA 1TQUA 3VWJB 4G9FE 4HX1A 3L2MA 1BVLB 1D7CA 2OBGA 4XMKL 3M45A 4XN5A 2JE8A 2AXGB 2AEPH 1IGJB 2C4XA 2DJSA 2YD5A 3ISRA 1OT1A 3IDYB 5D1ZC 1LYQA 2VDKH 3IJYA 1AZVA 3DROA 2WPGA 5FKPA 4YMPA 1KGIA 2VJ8A 2WNWA 4OCRL 1E9QB 1YYML 5F6IB 2BHUA 3VI3F 4GAYB 2CDFA 4ZS6C 4OV5B 3QUXD 2Z31C 1S5IH 3FXIC 4I0PA 3WXWH 5JDSB 2JSFA 4OB5L 4DP6X 1IGFL 1HL4A 3M86A 3C12A 1BJMA 4OVVA 2NXZC 1IQDA 4AV0A 4WWKA 2BIPA 2OMWA 4X5XA 5DS1A 4TUUA 4RRPG 4P9ML 5C0AD 1CYXA 3I2CL 1BZ8A 3HCVB 3PV6A 5IMLB 4JKPL 1MCEA 5HGHA 3EDEA 3II1A 5DEFB 1Q94B 3LH2L 2UZPA 2ALWA 1QFWH 3GMNB 4JM2B 3BMVA 2Q6WB 5KWYC 2VLJE 2X3AA 4AGMA 2DEYX 5ALCH 2YD7A 4M1CC 3EH1A 1BBJA 4LHJB 1KFAL 1MCWW 3QK0A 4W4OA 4YUEL 2CU9A 4JY4B 4UNIA 2WZPD 4DPRA 1EAJA 4AQOA 3K2KA 4YE4H 2ICWB 1J1XL 4LCUA 5C0CA 1C08B 3PHAA 5E9DD 5CEZE 3GS0A 1YMME 4F91B 5B38G 3P0VH 1NEUA 3GD1C 4HUUB 3DWTA 2HKAA 3CSTA 4H13C 5J6HB 1SBSL 2H2PD 1NM4A 2B08A 4QRRB 4L8BB 3SDXA 2Q3ZA 1FZMB 3L6FA 3UMTA 1EXUA 5D70H 3BH9A 3RNKA 4AUUA 1Y1UA 3VFMA 1MRCL 2G9KA 2WXPA 1PCXA 4IU2A 3KCPA 5I73B 3S88L 4KXZI 2RTTA 4DNLA 3II3A 3RWHB 4Z77B 1A1NB 2VN3A 3MCKA 2FUQA 1A6ZB 2CXGA 2ZPKL 3X3FL 4DUWA 1A4AA 3TBTA 2XBZA 2BIHA 5EORH 2ADJA 5I8KH 3I9GH 5KSUA 3EUDA 3WHE0 2AMUA 4LFHG 4RWHA 2N0KA 3KPSE 1ETZA 4RAVB 1F1GA 3X11B 5CSGA 3Q0HA 3CFJA 2BNQB 4KK8D 3AUVA 3S34H 3BH8B 1BHGA 3CVCA 1MCLA 1AGFA 2BHZA 2MNWA 2Y23A 5E7BA 3PHOA 4JAMA 1L0PA 1WAAE 2WLMA 3SYAA 4MQSB 3H7BB 3IJ9A 2CGRL 3GKWH 5LBGA 2ZWSA 3TEZA 2ZONA 3EAKA 1ZLEA 3GPSA 4NQED 2WLIB 3EGSB 3VWKC 1HIMH 5F1OB 1IGIH 4XVUD 3DX8B 2QSCL 4QOKB 4ES9A 3VYOA 1ZS8A 2NZ9C 2PO6D 4HU2A 3BGMA 2EE9A 1FGVH 4LRNH 3LAFA 5F71A 4B6ZA 3GSOA 2VR5A 5A43C 2WJ7A 5E6SB 4HUCA 1RVFL 2N3JA 3N40P 5CJOH 4XZ4A 1XGYL 4MDJB 1KXVA 3MZGB 4XP9L 3D3VA 1CJYA 4JFDD 4YIQB 4ONFH 1CDGA 4XP1L 4IJTA 1I1AD 2P5PA 4X4YA 5J1AA 4XN1A 3SCMC 1DVYA 1WT5A 4AQ1C 3QIWC 1J11A 1L9SA 4JFXB 3MX0A 3QDGE 4H1LB 1IO4C 2H4EA 1CF8H 3DPDA 4JG5A 3L48A 2OR8A 1I8MA 3W56A 1YEFH 3LNIA 4Y2NA 4UDTB 2ZXDA 1BOGA 4G7VL 3O6KL 4PJIE 1NEZB 1AKJA 4R3SA 3FUJA 1OE3A 1SLVA 2R2HB 2WLHA 4HBCH 2CDGA 1WFUA 5AYQA 4FYQA 3GI8L 2LU3A 4ODWB 3S3SA 1I31A 4KMTL 4NO3A 4TMPA 2N7SA 1XEUA 3RTQA 4LCCA 3RGVB 1M56B 4MB1A 4R7VA 1I1FB 1XF2A 4FLOA 1EO5A 5I1EL 4LPXA 4HOXA 4NYLB 2P5WB 2HFFB 4PFEA 3WHE1 3CE1A 4GKZA 3AWEA 4K07A 4BH8B 3NTCH 1KCSH 2XIBA 4DO6A 3GBDA 3UGXA 3WTUA 2GJ6E 2J8UF 5DFWH 2V2TA 4TS6A 3H9SE 2AQRA 4I5BB 3GNML 1VFMA 1NC2D 4MNQD 4E9VA 1U8OB 3MV7A 3JWOH 2WQAA 4DKFH 1OP5H 3WEOA 5B3NA 3T4AC 1F6AA 1ZHKA 1FO0A 1TTUA 4ZMAT 2IVFC 3S97C 3GXFA 2JI1A 2EDTA 4ALAH 3Q8CA 1D5IH 3FT2B 4WEEA 1XIWC 3UJTH 2FSEA 1DANT 1INDL 5A2BA 3T3ME 3VGEA 3U4KA 3NEOA 1YDPB 5GRJL 3WFZA 5T1DH 1IILE 3PUCA 4I3GA 1ZVYA 4PUBL 4N1EA 3MNMA 4ZD3L 1WCBA 5DD5H 1XV8A 4FLHA 3NFNA 2A7BA 2VDQL 3FJTA 3QQ9C 4LP4A 3FULA 4NQQA 5HPMB 1AHMA 1BJ1H 4FCAA 4H5SA 4MJIA 5C6TH 1C7SA 4U7KA 1NFAA 2V6HA 3RP1A 3Q2LA 1F00I 2H45A 1O6SA 3GBLA 5JMRA 4GRLC 4AIXA 3WIAA 2ATAA 3O41A 2E27L 6TAAA 4GKSB 3UZVA 4MAZA 4UI2A 3G5ZA 2K9UA 3DI3B 2P8LA 3KS0H 5DD1L 4QRSB 5JNYB 3DRQA 1W16A 1DBBH 2A74B 2H6OA 3CBKB 1P7KA 1IIKA 2OV0A 1CG9A 3BAJA 3D1MC 1OT4A 1X9LA 1JI2A 2YO3A 3EW3B 5DRZB 3JT2A 2K6YA 4P2RA 2VO5A 3KDPB 1M7IA 4IMLA 3R06B 1S3KL 2DQDH 2GFBB 1PKQE 1TU2B 1V8HA 4PJ6A 4PY7A 1ZJAA 4X6DA 1WS8A 4XMVA 3IS1X 3KPOB 4WNJA 2J8UB 4OIFA 4E9RA 3FH8A 4AEHL 3PFQA 1NMAL 5LBSL 2FT7A 4ICWA 3SKNB 1T04A 2A6KA 1LNUB 3V6OA 3HHSB 1X5HA 2G2RA 5LXGH 2WN2A 3IETB 3ECBB 3QE5A 4E5XA 1PNDA 2DQGH 2FAUA 2WVUA 4U1MB 4XXWA 3VSVA 1W72H 3WN5C 5BS0B 5HDQL 1KYUA 1BXUA 1G43A 1V7NL 4E36A 1XD0A 4YHPB 4LVHB 4BRVA 4HSAC 1JCKA 3H9HA 5F9DC 1KZQA 3IE4A 4NBXB 3LRSA 2X44D 4LRIA 4E9LA 2XC8A 5I1JL 2WC7A 1YSOA 4ZMWA 1ADWA 1J0JA 1TETL 2YN3A 1L4IA 1QFWM 3BXNA 2AXFB 1KWKA 5IROA 4L1SA 4U1IB 3R0NA 4HJ0C 2Q7AA 5I1AB 3APDA 5A6LA 2VMCA 3LNGA 1V5JA 2CBMA 4K7PL 2QZ5A 3KYMA 2CKBH 5I0ZA 3HFMH 3NSJA 2E0PA 4MCMA 3S4SA 3TNMB 5FM5O 3FB7B 3MJ8A 3MMEB 3QUXB 1MQKL 3RNQB 1A6UL 1F18A 3A23A 2Z35B 1J88A 1A7QH 3GJEB 3NJVA 3ZDXF 2VDML 4E9TA 5LQBH 3SKUD 1WBYB 1KF9B 3HIZA 3GMPA 3D87B 3D08A 2FQEA 2VR3A 2DDQL 3DTUB 3MLWL 1EZVX 3UTTB 5AOMA 1P6FA 3TJHC 4HCGA 1C5BH 1YJDL 5C0AB 4QRAA 5KYUB 3IFLH 1CDHA 3D34A 3A0OA 4OLUH 3RDTC 1G9NL 3T3PE 3S35X 3MNWB 1I9JL 4AEEA 1V55B 1D2PA 2NTFB 3EZ8A 4HXBH 2JB5H 5ID1B 2Z1PA 5DA4A 4L0PB 1I85C 2F61A 4MMXC 2QQQA 3VFWB 3GINA 3WEBA 1CLOL 1EEYB 3PPSA 3ZTCC 3H55A 3TPUB 1JERA 3OJDB 4NQXB 2NDFA 2X4SA 1NCGA 4GYBA 1E5AA 4HMCA 2Q0ZX 2ZUWA 3CFKA 3ZKNC 1KV3A 2X4UA 4F9LC 3L1OH 2XACC 2XG5B 1S7XB 4HS8L 2CIIA 1DL7H 1ZLUK 1ULVA 5F3HB 5C07A 1G7MA 1Q9KA 5GRUH 3F6LA 4D0BB 2XQYA 4DEPC 4Z7UA 4PRIA 1MHPL 3T0ED 5KBNC 1XTLA 2QHRL 2WZ0A 2V2WA 4Z7NF 1ZHNB 1O7VA 2LFGA 3BKYL 1OLZA 3SE8L 4HJTA 1EEQA 4A1RA 3I6GA 1OB1A 1OE1A 2BHFA 3I3EA 1CI3M 4Y9FA 3E8UH 1LP9A 1FN4B 4NQCD 3FCBA 1VKXA 3DX7B 2V8MA 5I66A 5DJ8A 3BGFB 5I5IA 3SDAD 5I17B 5KSBA 5D7IA 1HINH 2CA4A 5JHMA 3BDYH 1KIUA 2QFRA 2MKWA 3IDUA 2ENQA 4PJ9A 3T65A 3DO3A 3U82B 3D0AA 2F54D 4F20A 1Z9NA 4GS7C 1XH3A 1TYJA 4BZ2H 1F90H 1M9WA 2AJSH 3GMRB 5C0JB 2MTAA 3D18A 4RNRA 3ZHNA 3NT0A 5A2KH 1X9RA 1GGCL 4Q0XL 4ILDA 1U2YA 1DO5A 3AS3A 3FU6A 3U4BL 3ZDXB 4ZX6A 2CO3A 3CH1B 3D25B 4DQAA 1BP3B 2FO8A 3LKRA 4TUOA 1E4KC 2X1XR 4PLKC 2CUIA 3N0AA 4HK0B 4Z3HA 4LDCA 3VXTB 3NIGE 4NLAA 4NQEB 3UTSA 1OSPH 4X9YA 1XMWA 3L95B 4I77H 3WXVH 3ZHKA 2COVD 3T4YA 5AVUB 3AGWA 1ZKAA 2PO6B 3RVVC 5A2CA 5I73C 1JZGA 2EIZA 1CE1H 1E0OB 2GBTA 3A6BL 2EEAA 4FFZH 3B3IA 4XRCA 4UINL 2RALA 5BO0D 4M9PA 3QO0A 2ISDA 2V3FA 4RFNB 3EO1A 2BSBA 2IH1B 5DO2C 3INUH 4L9LA 1MHCA 1KEGH 1FYTD 4M5ZH 1DJHA 4AW4A 4DP0X 2Y24A 1W8NA 2CHNA 3D4GA 3QWRA 4HS3B 2QSQA 4P5TD 3UAAA 4FQ2L 5AW2B 4XWOC 4N0UA 4E5XG 4GQ9L 1BZEA 3P77B 4WI2A 1KJMA 3EOBB 4HJSA 4BFFA 1XGRB 1J8HA 2CSPA 4XVSL 5SX4H 3FSWA 4HCRA 5EU5A 4DCQB 4FHKA 5B3JF 5IESL 5JPNC 2YMOA 2LR4A 1T6VN 4OIAA 1NGYA 2ZAGA 2EC8A 4K3JL 3BRDA 1S7QA 3GQFA 4Z7NB 4C56A 4E9QA 5LDSA 4RQQA 1TZGH 2VDPL 4XGZA 4LSTL 3VXQB 1UWYA 2IDCA 3PIQA 3V4PA 3MNDA 1PIGA 3MUUA 4HD9A 1S7TA 1ZS2A 4H40A 3WKMH 4MS8D 5BMFL 3D8MA 4FFWC 5GS1A 2GK0B 3OKNB 3Q01A 4OZFA 5L4MA 3H56A 3S4SG 2VL4A 2DQJH 5E6IA 1S9YA 1YEEL 3GSNB 1P0SE 5HHOD 1TJIH 3REVB 2GSIB 1E5YA 3B83A 1PFOA 2VLRD 3NZHL 4UTCA 1DFBL 2GJRA 1S78C 3H53A 4PG9B 4QMEA 4K23H 4GFXA 1MCNA 2DQUL 1BEYL 1NC2B 4MNQB 2OYKA 3HI1B 3D33A 5ILTH 1G6RB 2OMUB 2VDOB 1AR2A 4NZ8A 3FO9A 5KVGE 3RAJH 4RMVA 4Y5VC 2YRLA 3P4LA 4L3CB 1O5PA 2H47C 2QQLL 4N22A 4BZYA 3VG9B 3GHBH 4TOYL 3OR6A 5EH1A 2GJJA 4OKVA 1E4XL 2ZXCA 4MQ7B 3SD5A 1K4DA 1BVNT 1AFVL 2KMWA 4C47A 3VGGA 3MLUH 3Q6FA 4XNYL 1MCWM 4NBZB 1JGUH 4AQEB 2MHAA 3IKCB 1MXGA 3HBQA 4OLEA 4FXKB 4JDTL 4GBXA 1AO7D 4Z7VA 2IG2H 2XQYG 2J44A 2HLAA 3FZUD 2BRRH 4QKXB 2FATL 2P48B 4OIIL 1PZDA 2ADFL 2X70A 4DH2A 1RI8A 2AJ3B 5ICZA 2XX0A 1PGRB 3HN3A 4YXHH 3QI9C 4E68A 3A67H 3AAZB 3IMTA 4LQ1A 2Y3NA 2Y7MA 4BZ1H 4KX9A 1KTBA 2EO7A 1EEUA 1LO3H 1PL3A 1YY8B 2Y6SC 3O6LH 5DJ0B 1NBZB 5IMKA 5J13B 5I74B 4P59H 1HHGA 1ND0B 4LE8A 1PF3A 3NCJH 3VVVA 4C83A 4JE4B 5TH2A 4B3EA 4L8DA 3B1TA 4NKMB 2F58H 2GY5A 1MF2L 3FRPB 4HUMB 1D5XA 2FEEI 3C2SA 4LLVB 2A9DA 3L9EA 3GJFA 4WFFE 5ABZA 3TA4D 2E6QA 3NJKA 4BQ6A 5EO9B 5KVFH 2Q5BA 1BG1A 5LWYL 3RL1A 5EZLB 1JWUA 1VRSA 4G72B 4Y4HD 1KB5H 4EN3B 2PNDA 4OJEH 4G8GE 4NFCA 5D7JD 5AW9B 2R2EA 5C1MB 1QBLH 4H20L 4NRYB 1ZA6A 2D4DA 3O8XA 3OR7B 4HDIA 5DVMA 5F7LB 1LEKA 1UWGH 2X1QA 1R0AH 2WWOA 1ZLWK 4AL8H 5AOJA 3KYKL 4TSBH 5TE6H 3EYQC 1VENA 4RRPM 4CA4A 1WBZA 4EZJA 4EI5A 2VKXA 3F7VA 4F8LA 1JPTL 2X4RA 5I6PA 3N1MC 1AANA 35C8H 3RWEA 2J72A 3DX1A 2Q2EB 2A74C 5IQLA 3ZZ1A 4LBEA 3SBPA 1RJZA 3CSYB 3EOYG 3NN8B 4IOFC 4K5NA 4WKZB 3LQMA 1EJOL 5K69A 1PYWA 5CR1A 4Q56A 3JVGC 3D5OF 1AXTH 5ITBH 5JW4M 3OZ9H 4HAGA 4X6CE 2YRPA 2EDBA 2V8LA 4GRWH 4TLKA 5GZNC 3H9YA 4G3YL 2ZT9C 4XN2A 3HPLA 3U9PL 3ZMNA 2HTKC 1S7UB 5FYLE 5DWUL 1VLXA 2D2CC 3UFIA 5IJKA 3ABMB 3RILA 1B90A 1T89A 2DQEL 1PCSA 3CDZA 1N3NA 4UUJA 2AMGA 3SPVA 4AT6A 1E2VA 1OZUA 2R4RH 1HKLH 2WV3A 3DSNB 3NIFE 1AJ7L 4FL4C 4NQTA 1AKPA 4Z7IA 2X6CA 3S3CB 1HVXA 1H3UA 1U4FA 1U8IA 3NCEB 1F11A 3FHEA 4OZFG 2G0KA 3X3GL 5D1QA 1BQHB 1NQBA 5JIIA 5IBLD 3SYCA 4AJVA 5IGXH 1FNLA 2L4OA 4HEME 5F9OH 3T2PA 3NCYP 2I9LB 1WVZA 2BHYA 3L3KB 4WW1B 3R7QA 3G7TA 2VR4A 3FU5A 4JVWA 4M3JA 3T2NH 1ANUA 1ZWIB 4PLJD 3C5ZD 4N68A 4NZRL 3S36X 1A4BA 1OLLA 4X7SL 4M6AA 2OYPA 2YAEA 2KPWA 2O5YH 4S10A 4CGUB 4PB0H 3TOPA 1IEAB 4IQHA 3VTAA 1DQJA 2F1BA 1KXTA 3QUXC 4X4MA 3WG7B 4XVJH 4N1CA 5C0EA 4LSRH 4XX1G 4C54A 1GZQB 4FLSA 2O61B 2HFGH 3PAVA 4BK5C 1TCMA 2A6IA 4UDUB 3T0EB 4MCYA 3OXSA 2CLRB 4PJ8C 5F7UA 2CJUH 3DSFH 1YEJL 2BJMH 3AITA 2ICEB 5TF1L 4JZOB 2CBTA 1BXVA 3T8MA 3S0PA 2VSMB 1RZ7L 4NI3A 3GB7A 2MCPH 4WWPA 1KYFA 5CD5D 1GGBH 4H88L 4NQCB 2B39A 5J11C 4U1KB 4GSDH 1WZ1L 2YFNA 4AYSA 2EVGA 2EYRA 1WZKA 2OYMA 2R0LH 5EC2A 1DJIA 1VZIA 4TNFA 2D9CA 4AJYV 3BW9A 3R4RA 3QP3A 5CD3A 1XB6A 3TWCL 2CR3A 2C3WA 3AXLB 4OJCA 4WNQB 1MCOH 2DBLH 4DGYH 4F3FB 1BWMA 5C9JB 5BOZG 4ZTPL 1AMYA 5HHMD 1JRHI 1SOSA 4QHUA 3VXUE 4NKOA 4UTAA 2IQ9L 2AGJL 2G5BB 2UV3A 4X4XA 4F7EB 4AMWA 1SXCA 5JO5B 4DW2H 4JLRB 4LCWD 3TBSB 4XO9A 3T6XA 2NCMA 3AT8A 5LLIC 4OZHB 4OD2A 4N0FB 5LNDA 2BLFA 4GW4B 4HKJB 1ZEAH 5CIPA 3WTYA 2GCYA 2QQKL 1I9EA 5DUBB 1UB6A 1CT8A 4WFGE 4GJTB 1RZJH 3QR2A 3RY6C 1OSZB 2J6EH 4JG1H 4OF6A 5FDWA 2I5YH 4XMLL 1BGXH 1MHEA 5PAZA 2V5RA 5EEUA 3NCBB 3PWNA 5AVXB 4GUPA 4URTB 2XA8L 5DJXB 2JXMB 1OIOA 3RIKA 4NHCL 1GH7A 2GITA 2KH2B 4KK8C 1J8KA 3MA7A 4NT6B 3T77A 3FPYA 2FBRA 2UUDK 2PCFA 5EZPA 3HS9A 4V1DA 2UYLA 3WFBL 1EDQA 1P7QB 5DT1L 2D7QA 3JWDH 4DOHB 1VF5C 4DN3L 3GZPA 2FQGA 1AQKL 2GTWB 4GAGH 3UP6A 4YX2H 4PJGB 4KZ0A 4J6RL 1NBVH 1IM9A 1JNNH 4LLMB 2NY3B 5E70A 1PZ5A 1UH4A 3QEHA 2QDWA 5C0DA 1ZLSH 5EOTA 2RACA 5BV7B 1C5DA 3H2PA 5IW6B 3RFZA 4XVUC 1MCPH 3D4ZA 3OKEA 1NOFA 4M48L 4A2LA 4D0DB 4Z9KB 2PO6C 2WUCL 3BP5B 3HZVB 3PP3H 3QG6B 4JFDE 3P9LB 4ZFGH 5IVZB 2LLLA 5DVKA 4PBVC 4UT6H 5D1XE 5DDHB 4RFNC 4FJ6A 5JXAL 4ZMTA 1TFPA 4M6OH 5HHOB 4JJOA 5DJ6B 2VMJA 2NY1C 1MIMH 1MRFH 3KR3L 1OTTD 3OQ3B 1IC5L 2VLRB 4MJ6A 3SKMB 5IBTH 1NINA 4UOJA 4O5LH 4YDJA 1BFVH 1I1AC 3DX6A 1T0NA 1P9MC 2EDRA 1T21B 5ETUB 4ZMXA 1KPRA 3DDFA 3FFOA 5CEZL 5J7CC 3CFEB 3OSVA 4PJ7A 2JJSC 2F5AL 4XNQA 5H4YA 1FG2B 2JCCE 1TLKA 4ZSOA 4OCYH 1B3IA 3EOAA 2K7QA 3TS8A 1SXNA 3KCWA 1I7RA 3L3OB 1A2YA 1H5BC 1YPZB 2B8OT 3DOIA 1KZYA 3M7OA 4Z7QE 4HCIA 4JRXD 3DETD 5DQDH 1B9KA 4FZEH 5D5MF 1Q72H 3P3UA 3TN0D 4BXSV 4M4RB 3GIVB 3C5JA 4FNLL 1BAFH 2K1MA 4A7GA 3LB6D 32C2A 3BZ4B 4LSQL 3CD4A 2DZEA 3VRLF 1Z5LA 4RIRB 1TVHA 1P4LB 1QLFA 1NIFA 4PW3A 5JXEA 2Z4QB 1L9MA 1ZANH 3RPKA 1AO7B 1K6QH 3AQZA 4O02L 2Q7YB 2FLBT 3FF8A 3V6FA 1OF2B 5CSZA 3UJIH 1GL4B 2DIBA 2EC9U 4NENB 4GIPD 2ZCZA 1MVFA 1NCDL 5FC9A 5ALBL 5HYSA 2CIKB 2BM3A 3BAWA 4MBRA 4ZNCD 3RWJA 4OCMC 5KW9L 3SBQA 1CFNA 1E4HA 2ARJQ 3U7WL 5M7QA 2H32A 1T1ZA 3IF1A 3VG9C 4G6AD 4P2QA 3QIUD 5IOPA 4E9SA 5KJ7E 1NGZB 2OSXA 3QUMB 5CUSL 2EECA 4TUKL 3CIQA 5E1GA 1JJUA 3A22A 5D4JA 2B2XL 2YAHA 2PW2A 4Z8FL 1YEGL 4ETQA 1YUHB 5FUOL 4JKWA 2WLKA 5ACZA 2HPOA 4OI9A 4Y4HB 1TXKA 1JZFA 5FFGA 5CP7B 2HT4D 3P2TA 4FTVA 5D7JB 5BO1L 2O5ZL 2J56A 2VUOA 2W95A 1ZLVH 2MH4A 4PGEB 1T1WA 4RBPK 1HNFA 1FNEA 1SXAA 2JV6A 4P3CH 3MRIA 5IM7A 2EKSA 1BFTA 4ODUA 5I2IA 5DZVA 2R0WH 2Q3XA 5KSAD 3GO1L 4DF9A 1IT9H 2X6BA 5CCGE 5D5MB 1E6JH 5J13C 2LHAA 5I74C 2BVOB 2XDHA 1FFPB 4I48A 3K2UL 4JPIA 4BUHA 5HP5A 1EHLH 1FP5A 5T1LA 1NGXA 2WXJA 3V7AE 2AABL 2MQCA 4FNUA 1OP3K 3LD8C 1XCTB 5FW8A 2EH7H 1U91B 2GQHA 1FPTH 1OAUH 3QEUA 1HQ4A 3BQUD 4CBZA 2H3XC 2JTYA 2OMXB 2XYBA 3LN5B 3B7RL 4JB9L 4L1BA 3WMSA 2X2UA 2VO8A 4MNGA 1EBAA 1P2CB 2E86A 2E46A 4OW6A 3VQLA 5CZVL 4WAFA 4U0QB 2ZWYA 4A37A 1FVDB 4ZXBA 1QRND 3DARA 3K6DA 3LS5L 2CLZB 2RFXA 3O2VH 2ED9A 1BZDA 1X5FA 4UM8B 3MRGB 5ID0B 3V4PH 4WZ9A 4DO4A 3DRTA 4BFGA 2LTQC 4J3OG 5F9WB 1BJ8A 5KVDL 3V4UL 2B14A 2E9IA 2Y0SA 2Z7YA 4EBQH 2G75A 3UTPE 4HXAH 3D0VB 3MNVB 2IDQA 3FFCE 3RVUC 1GKEA 4F7PB 7PCYA 2VR6A 1VGKA 2VLKA 3HZYB 3MV9E 4OLXL 4M7JH 3IS0X 4NZDA 3QJVB 4L8CB 4MVBD 1KCVL 3ZTNL 5AL0A 1A47A 5MHSD 3QHFH 3VFVA 2ALAA 4MCZA 3U36B 5AVWB 4A2MA 3CUPB 1ZT1A 4HIHA 4KKNA 4U31A 3MRMA 4YHLH 3LKPB 2NX5A 4X5WB 1JHTA 1LO0H 3GWJA 3WJLC 3GUTA 2WQUA 1FZJB 1U41A 5I1DA 2QMJA 3O45B 3C5ZB 1OHZA 5C3LD 1XH1A 2OTWB 4ELKB 2HG5B 4ZMNA 1WFOA 3JWNG 4K7PY 4Z18A 4NRXB 2RCSL 1DUYA 2VXUL 3EXJA 1HJCA 2UZXB 1DLHA 1C12B 1RUKH 2NCEA 4U6TA 4Y5YA 5F7EL 3T2QA 2XZZA 3ARFA 2X4OB 2X4NA 1LO4L 3Q13A 2H5UA 3S98A 3IJEB 5EEXA 3QNXB 1JPST 1KN4H 1DQVA 4PJIB 1DBKL 5HTSA 1PNCA 4OJYA 5D72L 4L3EE 4JHBA 1R3JA 2JJTA 3KE0A 4WV1A 2RGSA 5F93C 3UC0H 2W38A 3ASWA 3ZR6A 2P5EA 3MLVH 4FQXA 4AEIH 5C70A 2G60L 3UO1L 1SPDA 5AFAA 3KJ4B 5E2VL 3WUWA 4PJAF 4KV5E 4YC2C 5KS9B 3RHWF 1CGXA 4PAZA 1PFCA 4HGMA 3RVWD 3UZQB 2W60B 2CHWA 3UL4A 1S9VB 1VERA 2E8YA 4MQTB 1A14L 1UOLA</