4GSUA

Structural basis for the inhibition of mycobacterium tuberculosis l,d-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
268
structure length
268
Chain Sequence
LTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable conserved lipoprotein LPPS
publication title Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 74
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4gsuA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gsuA01
3TURA 5E1IA 5DC2A 4Z7AA 4JMXA 4A1KA 4QRBA 5E51A 4XVOA 5DZJA 5E5LA 3ZG4A 4A1IA 5LB1A 4K73A 2HKLA 3VYOA 3ZQDA 5K69A 3ZGPA 5DVPA 2MTZA 5DU7A 4A52A 4ZFQA 4QR7A 5LBGA 4A1JA 5D7HA 4QRAA 1ZATA 3VAEA 5DUJA 3U1PA 4LZHA 5E1GA 4HUCA 4GSRA 5DZPA 4LPQA 4HU2A 5DCCA 4JMNA 3U1QA 4GSQA 4GSUA 4QTFA 3TX4A 1Y7MA 3VYPA 3VYNA
chains in the Genus database with same CATH superfamily
4PJBB 1RZJC 3OKDB 1G9NL 4Z78A 1CD1B 1F41A 3QZOA 5DFTA 2FJSA 3G6DL 4Z7UE 4XMUA 4PJIE 2AVFA 2XN0A 2IGFL 5DD3H 3ULUF 2H32B 2JTYA 2VR3A 5CGBA 1IBZA 4NNXA 4QCIA 2C3XA 2EH7L 1BF5A 2HSIA 4IRZL 1RVFH 2ICWA 1TTRA 1A47A 3JBG7 1FORH 2NLJB 2QVFB 1I7ZB 3VFRA 4HUMB 2ZF8A 4FQ2H 2VDLL 3OC8A 2RBLA 5J11C 2D7PA 3LQAH 1F6FB 5D1XE 1WPCA 2MCG1 3HR6A 1UKSA 4G7RB 5J1AA 5I5RA 3MMEB 1LEGA 4GUCA 2NX5B 1DVZA 1UH3A 3CN3A 5EPMB 4DZ8B 4ZZFA 2YD5A 4FNLH 5JXEA 2CIIB 1F8TL 2BDNH 3CZUB 3L6FB 5HHXL 1DL7L 3N42B 4LOFA 3GUFA 5L9DL 2JI1A 1YA5A 4PJFE 1G9NH 2DQCL 3QNYB 1INDH 3G6DH 2NNCA 2IGFH 3D39E 2J5LC 3MV9D 4HG4K 3K6OA 2EH7H 3EBIA 2GITB 4IRZH 1JPGB 3GMMA 3O81A 4UM8B 5LN8A 2VE6B 1BZ7B 4I5BA 4P5KB 5EIVA 2V0AA 3A22A 3G6JE 2ZAIA 2R23A 4GXFA 2VDLH 4LLDB 1TEGA 2XFGB 3HNSL 4U6HA 4DP5X 2BX5A 2XQYA 5CEZD 1DP0A 2J71A 4BSWA 5ES4B 1LE5B 3F6JA 4OZGA 5A2CA 4FYSA 1ONQA 1SLWA 5DZVA 2V7NB 3KEHA 5F1NB 4AT6A 3K81A 2ZSWA 1E4HA 1R3LA 1F8TH 3X13A 4QT5A 4BKLB 5HHXH 5KSVA 4ZMZA 3DUUA 2Z7YA 4QOKD 3BAJA 1GCYA 1YN7B 5L9DH 3N50A 3OGCB 5I1CL 4J3OC 1TJMA 3OKKB 2DQCH 5ANMB 9CGTA 3W82A 1N59B 4HHAB 3UDWA 1M71B 1XGQA 4R4ND 4FXTA 2BO0A 1OD9A 2EABA 4WVRA 4Y9EA 5DDHB 1IO4C 4P23D 1T1WA 2ZONA 3ZTDC 2CLRB 1A7RL 2TRHA 5EUOB 1XSJA 5AVVB 1D2OA 1AGEB 5IB1B 1J87A 1IC1A 3H3PL 2X6UA 1SFHA 2P5EE 3MRMA 5JDSB 1T5WA 3HNSH 4MJ5B 5KBMA 2F5BL 2E86A 3T08A 2WOYA 4F8NA 2OK0L 4ODUB 3KWVA 1Q0YL 2P8LB 3BH8A 1HI6B 3VYPA 1DQKA 2A3TA 4APQD 4N0CC 2YBGA 1G9HA 3LV3B 3MPCA 1UOWA 3ZK0A 4OZHF 3I75B 3QDJD 1BBJB 1ZA6B 2DMGA 5FA3B 4N2IA 4E9QA 3KGRA 4GG8B 3SZ6A 2JJWA 1C9SA 3MLZL 3U4EB 1PW3A 2CNYA 4UDUA 12E8L 3L3OA 1JD7A 1GC1L 5C09E 5I1CH 2DQIL 2F0CA 4WUUD 4YS4A 1TKWB 3IMVA 5F3FA 3O11B 1DDHB 2DF3A 1X5MA 4OAWB 3OB0H 4WNJA 3BN3B 3PE9A 4OTXL 5HYQA 3KHQA 4PG2C 3HZ3A 4Y9CA 3S5ZA 3G5VA 3QDME 3H3PH 5ID0B 2NY3D 4YXKL 2WXRA 1JHTB 3RY4A 1A6UL 3CFEA 2OK0H 4BD4A 3WIFB 1QWHA 3MGTB 3GJFA 5DRNA 4I3SL 4AYFB 2GT9A 4F2EA 1VENA 4MAYD 4UQCA 3I85A 3QJXA 1UEMA 3FQYA 5HHMB 3K5SA 4BUHA 1JVLA 5IJCC 3ZE1E 4QHNB 1T1ZB 4EI6B 2R9HD 2DQMA 4DVRH 4Z95L 4Y5YC 4ANKA 2I7OA 3MLZH 1YNLL 1GR7A 2VMFA 5FYJD 2DMKA 4AYGA 1WGOA 5I1IH 4GG6A 5F7WC 2HVBA 2DQIH 4JRXB 2R2HB 3SD2A 5ALCH 4JE4B 1HL5A 2R2CA 3HOGA 1YQVL 1XF3B 3D85D 3H42H 3HG1A 2AHIA 4M4RA 5CP7B 3KCWA 3MUHL 2CDFA 4AOFA 4YHLH 1OCRB 2BNRD 2K3HA 1L9RA 4OTXH 1PF3A 2RMNA 4NUQA 4XN5A 4QRAA 3RA7L 3OC5A 4PJXE 4G3YL 1XF4B 4LL1A 3CN0A 4NO0D 4ELMB 5DHMC 4K9JA 2WLIB 2NQCA 4YXKH 4QXTA 1A6UH 4YDVB 4PSRA 4I3SH 5I0WA 4FLSA 4ISVB 3ULUC 1H3PL 4G9FA 5H8DA 5GZOD 2OXGA 4FYQA 3BAXA 5BVJA 1ZGLM 1H8NA 4RFEA 2Z1KA 3ZDYF 4AX3A 1TPXC 5JHLL 4EN3D 3P69A 4Z95H 1IL1A 2MHAB 5CP3A 3S98A 1DEEB 4GB9A 1YNLH 4DOHE 4R8WL 1A9EB 1ES0B 4UBDD 3ZKND 3ARFC 1DCEA 3ATEA 4HKXB 2EACA 2ZP0T 3X14A 3O3DA 1YQVH 4HH9A 4NZUL 2C9QA 3X11B 2HLAB 4YSSA 5EORL 5DMGC 4P5RA 2C3WA 4MJIE 3KCPA 4Z77B 3ZUCA 3DURB 1O5DT 1J1OL 5C6PB 3RA7H 4RH4A 1O6SB 1OT2A 1Y1UA 1P5UC 4PJ8D 2OTUA 4XN2A 2XN1A 4A2MA 1JGDA 3HA0A 3JV6B 1FO0L 3IDXH 4RZCA 1IGTA 5K39B 1CTMA 2EYTB 1QQDA 3B5GA 2H0FA 3UJTL 4RAUB 1MWAH 5HHOE 4NQDE 4YBLB 3ZE2B 4HEMA 3EJJX 4AC2A 1I1FA 1H3PH 5B7MA 3QQ3A 3LAFA 3T9WA 1NIDA 5CZRA 2W9EH 1JF5A 5JHLH 2AXGB 2N1KA 4X6BA 4R8WH 5AB9A 3T0ED 4HCFA 1T5XA 3D3VA 1HQRB 1J5DA 3T2LA 3O6FB 5IP4A 3PJSA 2I60L 2VR6A 4WK4B 4A7SA 1MCRA 2G5BB 1W2KT 5EORH 3R06B 2E7LA 3PWPB 4PVBA 4KKCD 3FUEA 1J1OH 4X6DB 1UZ6F 3LX9A 1VGKB 1MCPL 5DFVD 3VW3H 3AMKA 1NCHA 1JGVL 2YPLA 4HLZG 2F7RA 4LVNC 5AW9B 1FO0H 1FAKT 4TUKL 4HCRL 3E38A 1DHKA 3INOA 3UTPE 2ZAHA 1QP1A 1U2HA 3UJTH 1BVNP 1QKZL 4RRPA 1MCKA 2G4GA 3PG2A 3SGDI 1DO6A 4ENED 3LXCA 1R75A 4CRPA 3T8MA 5BZDA 2J1YA 5EOCJ 3CG8A 4U6XB 4X98A 4PP1D 2VZ3A 5I75B 1BMGA 1I1CA 3IDYC 1CD0A 2I60H 2XVBA 1AQDB 5J06A 3ILPB 2P1YA 5HDRA 4PJIB 1XEDA 3RHWF 5J1SC 3KBEA 3WO3B 4PUBL 3PHSA 1XSIA 4A67A 5HVWA 4YZWA 2RAMA 1NEZG 2ITCB 5BRZA 1MCPH 2BSRB 3DSFL 3EGDB 2F2HA 1DTUA 1QA9B 3MKGA 3B2MA 3C08L 4ZFZB 2GBVA 3OKDA 4PJBA 3VI3E 1CD1A 4R0LB 2WWMD 2EE3A 4TUKH 4HCRH 2LLNA 1OM3L 4APXB 4PG9B 3U2SB 1PLAA 3WXWL 1PQZB 2H32A 1HEHC 5AZUA 1QKZH 2SEBB 3ARDD 3UJJL 5D1XB 3W9EB 4LSTL 5CUSH 3PXLA 3L3DB 1E2VA 4Y5VB 2LW3A 2NLJA 1AHKA 4FERA 4BH7B 1I7ZA 3WY4A 3C5SB 1P9MC 5F7DB 4G43B 1RKRA 2K3TA 4UTAA 5C0CE 2IDFA 1EGJL 2NXYC 3IXAB 2N7SA 3LDBC 3MMEA 3QAZB 1Q0XL 4PJFB 4KKBD 4A7GF 2NX5A 4QJ4B 4GINA 5EPMA 4DZ8A 1DJSA 3AG1B 5INCB 3WGVB 1K2DB 3D39B 5FYLD 5SX4I 2I24N 4PUBH 2CIIA 1U8JB 2XG4B 4LDOB 3L6FA 4JHVA 4MAZA 1BCIA 3BSHA 5JTWA 1Y6MR 3C08H 2HX7A 4JKLA 4P99A 4U3CA 4BJLA 4QAWA 3MTXA 3QNYA 2JJTC 4M43L 3JWOC 4U1SB 1OM3H 3WXWH 2WO4A 4HZLB 2GITA 5E8PB 1JPGA 2NR6A 4IU2B 4UM8A 4X6CB 3TBTB 2VE6A 1BZ7A 3IKCB 4P5KA 5I74B 4FA8A 2VAJA 5C08D 3HZMB 2BP8B 1OTUD 2AERT 1SN5A 3IN2A 4OIIL 4LLDA 1BPVA 3S5LG 2DQFB 2DIJA 1EGJH 2NY0D 5T1DL 1RZKC 1WAPA 2O26U 1LE5A 3KLQA 4N0UE 3QZMA 4QXGL 3VXUB 2W0FB 4CN1A 1PAZA 1Q0XH 2EIEA 1ACZA 1SPDA 5D5ME 2V7NA 3RVVD 5F1NA 1GRWA 1OT4A 2ZX6A 1A65A 1W80A 4BKLA 4XVOA 3OLEA 1IC0A 1D9KB 2QPEB 1PLCA 2ZWNA 2Y1YA 3QWRD 2BNQD 1YN7A 3O6KL 3OGCA 3LZOA 3MV8D 3OKKA 4CC4C 1EEQA 5ANMA 3WMPA 2DV6A 4BXSV 3STZB 2RCSL 2P5EB 3CZJA 3L1OL 1CZ8L 3FUJA 1N59A 4HHAA 4QRPD 5FB8B 1M71A 3DX6B 2HT2D 5L4IA 4GAJH 1TZOA 5DDHA 3MUGB 5F7NC 5AAWC 5I1EL 1CURA 2Q76B 4KZCA 1CE1L 3IDNB 1N3NB 3PS6A 2CLRA 2UVFA 4UV7L 3DJTA 2WWOA 5EUOA 3VWKB 1AGEA 5HYIA 5IB1A 2W60B 5IJBC 1AACA 1UB5B 4YNYB 5JDSA 1PY4A 5FXCH 4MJ5A 2A4CA 2Y9RT 1Q1PA 1SDDB 4HWZB 4ODUA 5T1DH 2P8LA 5EEWA 1HI6A 3MBED 4NHUB 4QXGH 5C09B 3DROB 4C4KT 4R7XA 3LV3A 4UIMB 2NMSA 4I1RA 1RERA 3UZVB 4LLWB 3I75A 1FSKB 2XIDA 3D2TA 1BBJA 1ZA6A 2DIEA 3FZUD 4XP9L 5FA3A 4GBXC 4GG8A 4PYGA 4LARH 5D7LB 1FNEB 5GISL 1OAZL 3U4EA 3BE1H 1KXQA 3L5XL 2HWZH 4LSQL 3VXPB 3ELQA 3O6KH 3NRFA 3JYCA 1TKWA 5C70A 1KTKE 3QDMB 3O11A 4LDCA 1DDHA 1TF4A 2RCSH 1KSRA 3L1OH 1CZ8H 1R47A 4OAWA 1AZCA 5I1EH 1AS7A 3V6ZB 1U8KB 1WF5A 5FHAL 1KIRB 1CE1H 4UV7H 2F1AA 4JFUA 4M3KB 3BRDA 4JQVC 3ZE1B 5B39G 5ID0A 5EBGA 3CZKA 1JHTA 1NDTA 5MENB 5IB5B 3HE7D 4KK6C 3ETBF 3N40P 2NY5L 3FB8B 3MGTA 3WIFA 1KB5B 4AYFA 3MDJA 2E6PA 3GZKA 1T5KA 3S36H 5KYYB 1LHZA 3FSWA 4GXVL 3VRJB 5F9WB 5SV3A 4BK4A 1HCVA 4H20L 4QHNA 4ZQKB 1T1ZA 2G3ZA 2ITFA 4G70B 3VFMB 4EI6A 4XP9H 4QRBA 5BUPA 1CICD 3HRZB 2V17L 4BZ1L 4YHML 5GISH 3X1NA 1OAZH 3L5XH 4PRID 4RISH 5J6SA 1COBA 1JD9A 1SHMA 4LSQH 3PP4L 4P2OD 1FNLA 2O1AA 3FRPB 4PJXB 4OGAC 5JIIA 4JRXA 2R2HA 1LL1A 4X99B 1XF3A 3EJYC 5AW0B 1O9WA 3P30H 3MOBL 1C1EL 5CP7A 4ZNEE 3QB7C 3U83A 3AITA 3FYEB 1IU1A 1OGAD 1HXMB 3GIZL 2Z0BA 5JXAL 4NOBA 3KWXA 1XF4A 4ELMA 4KGLA 1F58L 2WLIA 3VRLE 4YDVA 1Z5LB 2NY5H 4DOHB 4WWOA 1FL6B 2Q8BL 4UT6A 4ISVA 5CZXC 4JRWA 2C26A 1JTPA 2X4RB 1UZGA 1LEKB 6FABL 4GXVH 3WKQA 1MCWM 3IU4L 1PZAA 4Q9CA 1NEPA 4B9CA 4Y2OB 2V17H 4YHMH 2MHAA 3KLAB 4MJIB 5F6HI 1DEEA 1A9EA 1ES0A 2ZUWA 3PP4H 4Y9FA 3CFTA 4HKXA 1MCBA 3P0YL 1PEWA 4JJHA 4XN1A 2J8UE 2IOOA 3X11A 2HLAA 3LHPL 3O4LB 3MOBH 1C1EH 4LMQI 5AG8A 4Z77A 2AXFB 4DERA 3DURA 4O51B 2B20A 4BXVA 5HHOB 2C9AA 5DWPA 3GIZH 4EIZC 1O6SA 1JXFA 5JXAH 5TF0A 2PTVA 1PCXA 2IANE 1F4YL 1RV6X 5HSFA 1F58H 3JV6A 3ZO0A 3I9PA 5K39A 3RWDB 3VSTA 2EYTA 1OW0A 2Q8BH 4RAUA 2WXJA 3UL4A 5IFHH 1CK0H 1M2OA 5F9DC 1JZ7A 1G7IB 2FEJA 5LXVA 6FABH 5JOFB 2JF1A 1AO7D 3DX8B 2W91A 2WQVA 3FOMB 2AXGA 5GS2D 2EXYD 3LPFA 5E9DD 2EINB 1NICA 1UOKA 1HQRA 3C60C 3O6FA 5GJSH 5F7MC 3E9TA 5LBGA 4HLJA 3RKDC 1G0XA 3P0YH 3KW7A 2G5BA 3LHPH 4LE8A 3R06A 1BBDL 5DVKA 3PWPA 2G3MA 2X1QA 3B7YA 3KH3A 1JF6A 4KX7A 3RPIB 5DFWH 3MXWL 3WN5B 5T3ZL 3ZDZF 4X6DA 1MJUL 1U9KA 1VGKA 4QWWC 1E4XI 2IH1B 4P9MH 3QQDB 1SBSL 1BG9A 1TR7A 1JJUA 1HHIB 3KWWB 3IGUA 4RMSA 5CGYD 3MLPA 1A25A 4HHGA 4HC1L 5ISZD 1NM9A 1BECA 5E99L 1P6FA 1JTTA 4WFGE 1IM3D 4RMRA 1T66C 3FN3A 2CUMA 4WI4A 4ABWA 4J3OH 4PJDF 3QUML 4OM0L 3BUQA 2Z35B 4U6XA 2DQGL 1MI5B 4UAOC 4OQTA 1O6TA 1SVZA 5C0FB 1AQDA 3ILPA 1DQJB 4X0KB 3MFGB 3VI3B 3ZR5A 4F93B 2VERN 3DMMC 3RTQD 3LRGA 4UZUA 5K5YA 1BBDH 4PJIA 1JMZA 3MXWH 4WSGA 2PR9A 5C0AB 1NGQL 5T3ZH 4F7CB 1AP2B 1MJUH 1R5WB 2ITCA 4AK1A 3DRQB 1B6DA 2BSRA 2ZKMX 3EGDA 1KJ3L 1QA9A 1Z5HA 3CFIC 3VG9B 4ZFZA 5C0BE 2AC0A 4HUUB 1LJMA 3B9KB 4R0LA 2WGXA 3RUGE 5I23A 1SBSH 2JE8A 3K91A 4LMQE 1TYEB 2Y5QA 2Y36L 4P5SA 4P2RD 4PG9A 5C0CB 1PQZA 4HC1H 3U2SA 4APXA 5B3JF 5IM7B 2SEBA 5D1XA 3W9EA 5C0NC 3Q3GB 4XTRD 2YD7A 4LBAA 4RWYL 3L3DA 4Y5VA 3NIDE 1KB9J 5AYQA 2Y7NA 4BH7A 4RDQG 3T3PF 3C5SA 3N42F 5F7DA 1NBVH 4F5CE 3QUMH 4OM0H 4G43A 3GHEL 2DQGH 3MLSL 4LP4A 3IXAA 3EZJB 4PJFA 4A68A 1TU2B 5F7HA 4JFDB 4R5XA 2A9NL 2WMPB 3VMOA 4TQIA 2WUCL 4V1DD 5INCA 5T1KB 3BPOC 3N41F 1T4WA 1K2DA 3D39A 1SMAA 3ABKB 3BYTA 1NGQH 1R3HB 1U8JA 2XG4A 3L3HB 3FU3A 1KCUL 3DX3A 4BCYA 1TYJA 2QV2A 1KJ3H 2V8MA 1AR1B 2O93L 3QSKB 1IEHA 3ULUL 4AE0A 1UWFA 1OQXA 1WIOA 4U1SA 3VWJB 2Y36H 1BFVL 4I3RH 4MS8C 2KDGA 4HXBL 4JDTH 2HT3D 4HZLA 5E8PA 4IU2A 4X6CA 3TBTA 4N0UB 2B9AA 5D93C 4P2CG 3IKCA 3BP5B 3F5WB 3NCWA 3HZMA 2BP8A 2P80D 1K9TA 1ULVA 2VDQL 5D5MB 3Q13A 5DJ8B 3BT0A 3ZDXE 4ZS6D 1MVFA 1UH2A 3GHEH 3LN9A 2DQFA 3MLSH 2A9CA 4GP5B 1A3LL 3P3YA 4NKDB 3VXUA 2JQAA 2W0FA 1SXCA 1NCJA 4NXKA 3T0WA 2A9NH 5MHSD 2F53E 5DEFB 2WUCH 4F33B 1CO1A 4G42B 2Y23A 4HOMA 3D48R 1D9KA 3T2NL 1KCUH 4HMDA 3HNTH 4QEGA 2ZAGA 4XVSL 2C9RA 2WW8A 1JWSB 1H3UA 1MH5B 2GBAA 3I9IA 3ULUH 1K8DB 3STZA 5A3IC 4PLJC 3D51A 2NZ9D 2P5EA 1QEWB 3RIFF 3V9CA 3HAEH 4GSUA 4MMYB 5FB8A 3DX6A 2XWZA 3NJXA 4FTVB 4HXBH 2VDRB 3MUGA 3LN5B 4KK8C 2ZYIA 4G8AC 5SWZE 2Q76A 3BGFB 3L13A 4YDLC 3IDNA 1N3NA 1NCOA 1VSCA 2HX8A 3BVNB 3EOTL 4N1CA 4N8VG 4O58H 5DC0A 3VWKA 1NSNL 3KL3A 4RMBA 4A63A 3QJFB 2W60A 4QRSB 1UB5A 1ML0A 4YNYA 4QDGA 4ZUSB 4Z7WF 4H13C 3ZIYA 1SDDA 4HWZA 5B1CA 1RLBA 2NZ1A 1A3LH 4NHUA 3N44B 3EHBC 1RLWA 4M48H 5C09A 3DROA 1G5GA 2G75B 3H54A 4UIMA 4F2ME 1X9QA 1GZHA 3C6LD 5J13B 2ALWA 2E7LC 3UZVA 4LLWA 2JCCF 3AUWB 3HE6D 1VIWA 5D7LA 1FNEA 3KYAA 3MCLL 3LKNB 2D2OA 5LXGL 4QIRA 1R33A 1M57B 3VXPA 3ML9A 2JKNA 5AAMA 4F8QA 3B2UC 3QDMA 4MGXA 3OBAA 4X50A 4X4YB 4HBCL 1CXEA 3DC0A 1F13A 4KK5C 4XBEL 5GGSB 4WU5B 4CJ0A 4FNQA 3N1QC 3V6ZA 4DF9A 1YUHB 1U8KA 2OL3L 2P4AB 2QBWA 1KIRA 3RHWK 4B9IA 3EOTH 3IXTB 1NSNH 2B2XH 1CYWA 1GGIH 2FEDC 3OF6A 3RX9A 4R2GC 2N0KA 5MENA 5IB5A 3NUKA 1DVFC 3CV5A 3FB8A 1IZKA 1KB5A 2YIHA 3K8LA 2VIRB 5HDLA 4AGPA 2Y3NA 5KYYA 2HUEA 1SDAB 3VRJA 1Z32X 4CSPA 4ZQKA 4YSTA 3VFMA 4BWWA 4DJMA 3HRZA 2J8HA 2CR0A 3MCLH 5LXGH 4XVTL 3ZHLA 4BHUI 4ELMF 4AZ8B 3FRPA 4PJXA 1JZ5A 2R59A 4OD3L 1QHOA 4X99A 2X2YA 1TQCB 4LL4A 4HBCH 1BSIA 3DV6B 4XBEH 1KGJA 1OL0A 5GGRB 5IMOB 3NCJL 3Q7JA 1PFCA 3VFTB 3MR9B 1HXMA 4UCFA 3Q9PA 1KDJA 1QNIA 1AG0A 1CL7L 1THAA 4ZO9A 5LBSA 2AANA 5B22A 2WAHA 4ODTH 1WLHA 1PDKB 3FT0A 3DOHA 8FABB 1HEZB 1Z5LA 3GHBL 4Y16D 4Z3JA 2D7QA 1X5IA 4LAJH 2EDKA 1FL6A 5DVNA 1MFMA 4MX7B 1I75A 1FWXA 4UUJB 1GY1A 4PVLA 4TSBH 2KI6A 4AQ1B 4D9RE 3QHFH 3VQLA 2VLKD 2X4RA 1LEKA 1KFAL 1JS4A 1JZDC 2BINA 4Y2OA 4MJIA 3D07A 3KLAA 5EU6D 2CKBB 4XVTH 3JWOL 2A6IB 4Y4KB 3IETB 4QHKJ 2ZUVA 1AS8A 3N85L 4GRLD 4NWTL 4OD3H 5SWSE 3IMBA 5EWIL 3TWYA 4W81A 3RVUC 3ZE2F 3O4LA 5BZZA 4HSQA 3WY1A 2AXFA 4K5MA 4O51A 4X9FA 2NR6C 1JG9A 4IHOB 5HHOA 5FHBL 1M6UA 2J57A 5CKAA 4UQ2B 5KJ7E 3RY5A 1CL7H 1AE6L 1NDMB 1RZKL 5ANHA 2GW5A 4JB9L 4PCSA 1KCLA 4EI5D 4JBSA 3PV7A 3LPGA 1UT1A 5TQ0L 4DO5A 3GHBH 3RWDA 1IGYB 4N68A 3NIFF 1K3IA 4RX4D 3IFNL 5EOCL 1D5RA 2GJZB 1T89A 3C5ZB 4JLRB 2DTML 1G7IA 4F15C 3C5XA 4Y4HD 1KFAH 5IBUG 5JOFA 4FFZA 4A38A 3ZTNL 3DX8A 4X6DF 1LMKA 3OG4B 3FOMA 4K3HA 1E4KC 2AV7B 3JWOH 4EZJA 4PRDB 4IBLT 3S97C 1IUZA 1CFVL 3N85H 4KTDL 4NWTH 3WV0A 1PVHA 3VMNA 4URKA 1ROWA 4Y1AB 4PHZA 1I9IL 1M3IA 1EFXB 5FLUA 5GJTH 3WN5A 1RQ5A 3RPIA 4FFWD 4I88A 1ESOA 5FHBH 1BREA 5EEXA 2EICA 4LBEB 1AE6H 4KKZA 1RZKH 1BG1A 4JB9H 2IH1A 3ESUF 3QQDA 3S88L 1EJ8A 1KELL 4L37B 3UERA 5J57B 5TQ0H 1HHIA 3KWWA 4KROD 2XOTA 4NZRL 3IFNH 5EOCH 5K1JA 2R0WL 2BFVL 1D6EB 2DTMH 4Z7UF 3UIZA 1P5VB 1JNLL 1XR9B 4XN7A 3ZTNH 5C0RH 2APBA 3T0BA 3SB3A 3NJFA 3ORJA 2Z35A 3P2TA 3UYRL 2X2IA 1MI5A 1LEIB 3GMPB 1NGWB 4IJ3B 4Z5RB 4XAKD 4PM1A 4KTDH 4G8GB 4TUUA 5C0BB 5C0FA 1DQJA 3ABLB 4X0KA 3VI3A 3U0PB 2G60L 1GHFL 5EF0A 2QPDB 1I9IH 1YN6B 4HGMA 4K7PL 2X4NB 1S9XB 5C0AA 4DTGL 4F7CA 3FULA 3TF7C 1AP2A 1R5WA 3HPLB 4GSDL 5CN1A 3DRQA 1AR2A 4A2HA 3IGKA 4HUUA 3NIDB 3B9KA 1K4CB 3S88H 4XMLH 1KELH 3QEQB 1F18A 1XSOA 5C0CA 3IM1A 3KYKH 4U0QB 2ZJSL 2V37A 3NJVA 4NZRH 4PJFF 5IM7A 1I3RB 2D9QB 2BFVH 2HLFD 2WBJD 4KJQD 5JW4R 3VB8A 3Q3GA 3ZRFC 3QJZA 3QPXL 1U36A 2WANA 5I71B 4YGVB 2DI7A 4FAAB 2EIBA 3WENA 3UYRH 1U93B 3KPQB 5FO9B 2NY1B 1WH0A 1PZUB 2MRYA 3G6JF 2XZZA 1Y18B 5I1LB 1CI5A 3MO1B 5C92A 1TU2A 1UH4A 3IMRA 3LPPA 2GK0B 2QV4A 2WMPA 2G60H 1GHFH 4JFDA 4LXFA 3FCGA 5T1KA 2BWIA 5I0DA 3ARGD 3NBNA 4DTGH 2IBGA 3L3HA 1R3HA 1M6OB 3T2QA 3A47A 4GSDH 2Q87A 2DD8L 1TLKA 3FU5A 3I9AA 3EIFA 4LSDA 4DO4A 5KVFL 2MOQA 4YDJB 4CDGC 4MB3A 1ZV5A 1HOEA 2P5WB 5D7HA 1HVXA 2BJML 1Z9MA 2ZOUA 4HXAL 3VWJA 2EP6A 3GHPA 2ZJSH 1XVSA 3ECUA 4N0UA 3TFKD 3BP5A 3F5WA 3QPXH 1B2WL 2F53B 3QNFA 5D5MA 5DJ8A 3KLDA 3VA6A 1CGUA 1FYTD 3L9YA 4BCZA 1KLUB 4NO2B 1G0YR 4NKDA 4A55A 5F7EH 2OMWB 1KB9K 4QY8B 5HY9B 4P46D 5AVRB 3FL7A 3AB0B 2V5RA 4OLUL 4M9PA 5DEFA 4F33A 3M1BB 4G42A 2R51A 3G9VA 5JHDE 1HHGB 1O7DC 2GIMA 4JKKA 5GHWL 2YWYA 4UOJA 1X9LA 1DJIA 2G9KA 1JWSA 1MH5A 3Q6GL 3W1ZA 3SE4A 1AYOA 4NUPA 1XGUB 1VEOA 4ZXBB 2DYPB 2BJMH 1K8DA 2O6EA 1QEWA 1OW0C 1TQVA 4N90D 4MMYA 4XMPL 3CSTA 4FTVA 2PNDA 2E6QA 2X2JA 3F7YB 1F5WA 4J1UB 4YBLC 3LN5A 1RZPA 4XNXL 1TIUA 4XMVA 1AI1L 3ES6B 3U79A 2NUTB 4X5RA 4LGPB 3BVNA 4HCGA 4F2MB 1E4JA 3QJFA 4HIIB 4QRSA 4YSQA 2XY1A 4HSAC 2EO1A 2J21A 2C1PB 2VWEC 1ZLSL 2ARJB 4ZUSA 4UQ9A 3O6FC 2YKLL 3JVGA 5JYLA 2NDGA 4NKOB 2G75A 3QBTB 4OLUH 4DP9X 1DBKL 5HPOA 4NQCE 5GHWH 2HJKB 3LKNA 3ZE1F 2L3BA 4MDRA 4G11A 1U8HB 2ZP9A 4ZFQA 1NPNA 2RJMA 1YPZE 3N5AA 3Q6GH 3VM7A 4IRSB 4QLRA 1OPGH 4X4YA 4XMPH 3UTOA 5IQMA 2EE9A 5GGSA 4WU5A 4GSQA 1YUHA 3MC0A 1QSEE 4PJAF 3P1VA 4XNXH 5EH1A 1AI1H 3RPBA 2B9BA 2YJQA 3IXTA 1ZLUK 1JNNL 4TVPL 2ALAA 5B38G 4PJXF 3D6GA 2WVTA 3FKUS 3TCLB 2VIRA 1M3JA 2YKLH 5FF6B 3LRHA 3GKWH 1HNYA 4G2AA 4HJUA 1VEMA 1J5HA 1P7QB 5KUKA 1DBKH 4ZNEA 2NSXA 3ZT6A 4KVCL 3Q8CA 1OARL 1PEZA 2NRDA 3QR1A 4AZ8A 3K46A 4NBYB 2CXGA 1T3FB 2QVKA 4F91B 1Y0LB 3MA9L 1ZSHA 1Z0NA 1A6VL 1NGPL 1OZUA 2IH9A 1CDGA 4TLKA 1LM8V 3DV6A 3GC3A 3WJLC 5CFAA 4V2BA 5D1XC 5GGRA 5IMOA 2NSQA 3VFTA 4WF7A 5I5IA 3S5LB 5IQLA 1G9EA 3MR9A 3LPWA 1A5FH 1AHWB 1BQHG 2SODB 2ZCKL 3NJHA 1BVLB 4Y5VC 3GXNA 3NABL 3SQRA 2MOGA 1JNNH 2WBWB 2YO3A 4IOFC 5I8CB 2R1YB 1MNUH 1J0KA 1ACCA 5EZLB 4TVPH 1PDKA 1TQTA 4NAMA 8FABA 1HEZA 2V7HB 3I6SA 1T20B 1MCWW 3CFDB 2ZD0A 3JWNH 4MX7A 1OAYL 2WLMA 4UUJA 3QAZC 5DRWB 4AQ1A 3M1CA 4PLNC 4UOW0 3Q8AA 2XRAL 2EC9U 4KMLB 2JB5H 2FNWA 2LGNA 4QRRD 2AQSA 2ESVD 3QHZL 4KAQL 4KVCH 2CKBA 5T5FL 4AGQA 4JRYE 1OARH 4MA8L 3ZT7A 3GJFH 2A6IA 4Y4KA 3RTLA 3IETA 3NSYA 5E5UB 3VD4A 1TTAA 2JQZA 5K1NA 3MYJB 2AVGA 4ACTA 2R83A 1A6VH 1NGPH 3HMXL 3RI5F 4FX5A 4XXDB 2OMTB 5D7KD 1T1YB 2MQCA 4IHOA 3GWJA 1LO4H 4K0OA 3S4SG 2ZCKH 3AS3A 4N1HB 1W6WA 5I74C 3X3GL 4UQ2A 3NABH 3POHA 1NDMA 4GSXA 2EH8L 2AJVL 1N5AB 4HUXB 5MP6L 1MW2A 1IGYA 1QLEB 2B0SL 3WHXB 4G7SB 2R0ZL 5D1ZC 1OAYH 4F7TB 2GJZA 3C5ZA 4JLRA 4MCMA 3RIFK 4EOWL 3RGBA 3WBDA 3Q5TA 1CLZL 2XRAH 5F7UA 1I8AA 2F5AL 3TL5A 1HK6A 1FIGL 1DANT 2AV7A 5T1MB 3QHZH 1D9KC 4HEPG 4KAQH 5T5FH 3SJVD 4FMVA 4MA8H 3IDJB 4PRDA 4BFIB 3DHMA 1YDPB 4X2UA 3SODB 1BEXA 5CD3B 4IEFB 1HYRC 3HMXH 1J9TA 4PJCE 3CU1A 2MSPA 4JCMA 4GKLA 1EFXA 4Y1AA 5EULV 2HRGA 4F8TA 4DUVA 2WBXA 4GKSB 2CRMA 2R0LL 2PCFB 4U6YB 4F37F 3GS0A 2AF2A 3NCCB 3X3GH 3MJWA 4WTXA 4LBEA 5E95B 4FFYA 1YEFL 2DJ4A 3QORB 3ZXAC 2AJVH 4LIQE 4L37A 1UWGL 2EXWC 5MP6H 5ALBL 3R0MA 1J05B 5DMGD 2B0SH 4OFIA 3HUJE 4DQAA 2R0ZH 3VI3F 1T04B 1D6EA 1EJ6A 3BVWA 1P5VA 3VXMD 1BIIB 1A6AB 1GZHC 1XR9A 4JM2B 1CLZH 3M8OL 4KRPB 3UBXI 2F5AH 3CMOL 4W4OA 1FIGH 2E9GA 2DKMA 1PZBA 1SF5A 2FJHB 1N19A 1LEIA 3GMPA 1NGWA 2H5UA 4Z5RA 5AAMC 1GGCL 4G8GA 5C0BA 3PAYA 1OWWA 3U0PA 4OCSH 3ULAB 5I9QB 1YN6A 1NBZB 3G3LA 2X4NA 3U46B 2B3IA 1S9XA 2QGBA 2JKJA 4BQBA 3QUXB 3HPLA 2Z7WA 3QW9A 3TTYA 1URZA 5LGHL 2RB8A 2YMTA 2GY7B 3MLWL 1K4CA 4N20A 3QEQA 3EO9H 2LU3A 5ALBH 2H6PB 5KSVB 4K7PX 2P52A 4LSSL 2EKSB 3HI6L 4NQUA 3CXHJ 3T04D 4JKPL 1I3RA 5KVEL 4KO6A 4XP4L 4Q4IA 1IVTA 1O0VA 1OP3H 1MCEA 1TENA 5F9WC 3VSVA 3N04A 3M8OH 4YGVA 4OF3A 3WLBB 3CMOH 2KUTA 2IFGA 3OZLA 1U93A 3D50A 3KPQA 3II1A 5FO9A 1MIML 1RUAL 4ORGB 4X7EC 5KOVC 2NQ3A 3SGEI 1GGCH 1D7BA 1Y18A 4ZS7L 5GGTL 2VDOB 3MO1A 4XPTL 5I1LA 4Q9RL 4NLHA 2GK0A 2HRPL 1BVKB 4HJSA 4L1SA 4PGBB 3X17A 1HSBB 3PABB 3KEDA 5LCVL 5AYUL 1L7IL 5CD5C 3EZ8A 1M6OA 4ZFOB 4UTAL 3O2VL 1PYWB 2D3VA 4PYHA 5I1DB 4NPKA 1WDAA 4XP6L 1HZHL 3MLWH 4YDJA 5A2JH 1S8DB 2X4SB 4JEGB 2P5WA 5TK2A 2WZPD 1JXJA 4LSSH 4N4YB 5DRXB 1U8PB 2ZXDA 4I0KA 3ZYIA 5KVEH 1KY7A 1T2XA 4XP4H 1F2QA 5FYKL 3GNML 3H3BC 4IS6B 2VXTL 3GXDA 1MY5A 2ZYHA 3FN0L 4PJHE 5I1JH 1CFMA 2IBBA 5HVGB 3PHAA 5GGUB 2F53A 3I9GL 3MU3A 3Q8EA 4NJAL 1GJUA 1LP9F 4AYDC 2R7EB 5AL8A 4W9CC 1TLMA 5IUCA 4E5XB 5JHDB 1XDTT 3G9AB 1RUAH 3QJRB 3RFZB 1KLUA 2OI9B 4NO2A 4BFEA 1L9TA 4ZS7H 5GGTH 5F0LB 4XPTH 2OMWA 4QY8A 5DJXB 4Q9RH 5HY9A 2HRPH 1W15A 4JZJB 1NBQA 1B4RA 4YEEA 5LCVH 3M1BA 5AYUH 1ET5A 1RK1B 1HHGA 3LZLA 2W0PA 2VDNB 4UTAH 1WTLA 1CCZA 2NXYD 3IMUA 1TZGL 2ID5A 3F65A 3O2VH 4NPJA 3I3EA 3JT0A 4WAFA 2E4TA 3NG5A 4XP6H 3AADB 1YJDH 1XGUA 4NFDA 1MW1A 4ZXBA 2DYPA 4RA3A 1YY9D 3N44F 4WZ9A 1W8EA 4J1UA 1HC1A 2KQMA 3F7YA 1T89C 2VKWA 1QSZA 3ARED 5FYKH 3GNMH 4S1DC 5IW1B 2AXJA 2VXTH 3ES6A 3FN0H 5D1QE 2NUTA 1LE9B 1I8KB 1EERB 3QIUC 5EMYA 4LHUD 4F2MA 4X5PA 2Y22A 4HIIA 1WFOA 1Z3RA 2K4WA 4NJAH 4OCYL 3RWJB 3VXTB 4B5EA 2C1PA 2ARJA 4NQCB 3F00A 4B0MB 1WAEA 1JYWA 4QHLB 5I1KL 4KQ4L 4KRMB 4NKOA 4G7VL 3MRRB 3UEQA 2H6OA 4FCHA 3WN5C 4U0RB 5AKRA 2HRLA 4RBPK 2K9FB 2XX0A 1HQ4B 3N9GL 2YAEA 2HJKA 1TZGH 2FX9L 4P4RB 3QCUL 1QSEB 2X5PA 4HZ1A 1U8HA 2DQJH 5BS0D 1TJGH 1R19A 2DJUA 4IRSA 1KGCD 2QGCA 5CSZB 5FM4A 5TD4A 2VR5A 1UKTA 3CJJA 3HN8A 4WHYG 4ES8A 1MEXL 1BOGB 1KGYE 3QRLA 5IQOA 4LAQL 4YO0B 3R0NA 5ITFB 5DA4A 5AZ2L 3BI9X 2O5XL 2X9ZA 1IILE 2YHGA 3TCLA 4G8IB 1PG7L 1T2QL 2TAAA 5DUPL 1DQMH 3VRLF 4KQ4H 4X4KA 5FF6A 5I1KH 3KWTA 1YEKL 3NJNA 1P7QA 4M5TA 2ZUUA 1EEYB 4EXPX 5DJCB 2HVJB 2OQJB 3AQZA 2R1XB 1UZ8B 4YSRA 4BWUA 3GJEB 4ES9A 1J5IA 4Q74A 3BVUA 2RQ8A 2QMJA 3QCUH 3SPVB 3UTSE 3VG9C 1TO5A 3BQUB 1T3FA 3TFBA 3B9KC 3AWFA 3EBHA 4JS7A 1Y0LA 4FQCL 2X09A 2B39A 3DPDA 4Z3TA 2NY6B 5HJBA 3QG7L 1DUYB 4Q8BA 5MEOB 2ATKB 4XO8A 5T3XH 1UM6L 2J8UF 1W91A 1MEXH 5HGDB 5KJ4A 3S5LA 1GL4B 4FNUA 4TLTA 1AHWA 4UT7L 1AYRA 1BVLA 2EDYA 4LAQH 3UOAB 1D7DA 2VMEA 3GINA 5I8CA 2R1YA 4NZ8A 3EYSL 5AZ2H 5EZLA 2YD2A 3E3QE 2O5XH 1NC4D 1DVXA 2V7HA 3EFOB 1T20A 4JRYB 1RPKA 2R4SL 3CFDA 4ABQA 1TMQA 1T2QH 5DUPH 5DRWA 2FT8A 1F4XL 1YEKH 3CLEL 4CBZA 3RDTB 4Y1SA 5I26A 4EZMA 5DI8B 4IIQB 4KK6D 3P4MB 2Q2EB 4K9EH 2X40A 2AQ3A 2DQTL 2FWSA 1MCCA 4M6OL 1YNKL 1X7TA 3MYJA 4C47A 2KMWA 2DWTA 5E8NB 3ULSB 3VWJC 1V54B 2O30A 2FWLB 3QG7H 4XXDA 2OMTA 2WVSA 1T1YA 1UM6H 2CKNA 2UZPA 5J7CC 1FNFA 2KLTA 3BKYH 5KVMC 3P3SA 1JV2B 3MUZ1 4OGAD 3BC9A 3AS2A 4M7ZB 3EYSH 1N5AA 4HUXA 2PXYB 2NT1A 1ZMYA 3C2AH 1CDBA 2H1LM 3WHXA 3LN4B 4NERA 3R4DA 2R4SH 4D9QE 2XWXA 4F7TA 1Z66A 3H53A 3FUNA 1F4XH 1KBPA 4Q56A 5D6DA 3CLEH 1DZBA 4KBPA 3QAQA 5T1MA 3OWEA 3M1OA 4MRBA 5ECGA 2WJ5A 1L7TL 2MNUA 4XOEA 2VC2L 5D4IA 3IDJA 4E2OA 1TQBB 2DQTH 2XZAH 4BFIA 3P4OB 1YDPA 4M6OH 3L4VA 1YNKH 3SE4C 5ID1B 3OJMB 3EDEA 5CD3A 4R9HA 4Y2DD 1J8KA 4IEFA 3QS3A 3D12B 4PWJA 3TM6A 1BD2E 5CU5A 5KN5B 3IAGC 3MV01 1FH5L 5JXED 3Q2NA 1SQMA 3HUJB 4GKSA 3LZPA 2PCFA 2WXQA 4U6YA 4WSJA 2JJVA 4UAHA 3WEXB 6PAZA 5FFLA 4AEIL 3QORA 2D7TH 1MHEB 2X2UA 1B6UA 2R29L 3E6HB 4Q9QL 5KBPA 1BXUA 1J05A 4HIJB 1B88A 1G7HB 5JPNB 2ATPB 5DGQA 5LBVA 2HTLC 4J6IA 4AQ8C 3RRQA 3W37A 3JVGC 1XR8B 1T04A 3RUGF 4NBXB 3NT0A 1BIIA 1Q9WB 2NY4B 1A6AA 4JM2A 5J13C 1VFMA 3VFGL 4LK4A 4E9XA 5JMRA 4M62L 5ENWB 2OZNA 3FUFA 1A4CA 1EZVX 1L7TH 2VC2H 3NIDF 3S0PA 2FJHA 2C1OB 1F2XK 5ACLA 2DH3A 2EDLA 2XXCB 1KJ2L 2AI0H 2D7OA 4WHDA 1FH5H 1NBZA 5KS9E 1CGYA 3K4DA 3EH2A 3U46A 3UTTB 5LO7A 3OKYA 3QO1B 3E8UL 4LSVL 1YEEL 2YD1A 3QUXA 2EC8A 4N6QA 4O2CB 3VXSB 1DJHA 3VI4E 1N0XL 3RKDD 2HT4C 4K4KA 3D87B 4U7SA 1CTNA 2JV6A 2R29H 4Q9QH 1X7QB 5LAXB 1CFSB 2H6PA 3ABZA 2P26A 2EKSA 3BFQG 3ERXA 2XWCA 3EJUA 3KVDD 1NAML 4PGDB 4UQEA 4P06A 1TTFA 2Y0SA 4QWWD 3VFGH 4MKMA 4X5XB 5ICZB 2FYYB 4M62H 3WLBA 5I30L 4LDEB 1S2EA 2BLFA 5DHVH 1GJWA 3FC8A 3X1GA 2YXVA 2COVD 1UA3A 4ORGA 1F1AA 5FW7A 3ZDXF 1YHPA 1ODUA 2FT7A 1KJ2H 1TQCC 4HETA 5HHPB 4B41A 2A6JB 2ISDA 3UG5A 1T66D 1BVKA 4PGBA 1HSBA 3PABA 1KIPB 2I5YL 2N56A 3E8UH 4LSVH 3F83A 1ACYL 4ZFOA 1NCCL 2QADD 1PYWA 4OF6A 2CGRL 2H2PC 3RL2B 3VDAA 4PJHB 5E6IC 1FDLL 5I1DA 4KUCF 4Q6KA 1S8DA 2J1WA 2X4SA 2V2XB 1J48A 5I8KL 3WLWC 4ANUA 4D8PB 3FTGB 4RFNB 5DRXA 1U8PA 4MJ2A 4MB1A 3ARBB 5CILL 4AQ1C 1MCLA 1NAMH 4IS6A 4ZAKC 3JZ7A 2FH8A 1UT2A 3INUH 5GGUA 2AQNA 1KIQB 1UKQA 3HAEG 4TQEL 3OJVC 3OX8B 4X0NA 1ZANL 1BMWA 4U1NB 1IBDA 4GJTB 3CXHK 2WB1A 2R7EA 3EJSA 5JHDA 1N70A 4E5XA 4Y4KC 2J1XA 4PMEA 3RFZA 4WFED 2G2PA 2OCCB 3SBRA 2X1XR 1T0PB 5DJXA 3ASWA 3WKNA 4DP2X 4CW1B 4X8CA 3KPLB 4JZJA 5CS7A 4A7QA 2JKSA 3HKZA 1EJFA 4MAUH 3AFLA 4G1EB 1RK1A 2FK9A 1TZ8A 5JOEA 1ACYH 4RMWA 1NCCH 1SXNA 3U25A 4GOSA 3RWGB 4JHZA 3E6FB 4WNSA 5D1QB 1HDMB 4M1CC 4KQ0A 3HG1D 3ZYOA 3C6SB 5I8KH 5CILH 2X7LB 3C5ZC 4E9WA 4S1SL 3ZSSA 3ZLQC 4NT6B 5IW1A 3CH8A 1T80A 3TA4D 5TK4A 1LE9A 4N5ED 5E6UB 1I8KA 4F37K 5JOPD 1X3DA 4TQEH 3RWJA 4BFGA 3VXTA 3D09A 2B8OT 1RY7B 1ZANH 4GY4A 4OBSA 1CGTA 5C6TH 4NQCA 1KIUB 2KZBA 1HYSC 4G9FD 3EGXB 4QHLA 3GDBA 1DJWA 3MRRA 1LK2B 4LPVA 5DC4B 3QR0A 2DICA 5IIEB 1OAUL 2L7JA 2GI0A 3MROB 1HQ4A 4CDHA 4P4RA 1AIFB 3I74A 1QSEA 3HC0B 1FVCB 1MRFL 5ESAB 3DI2B 1OP5H 4LVHB 1NIBA 4HP5A 4L9DA 5CINL 5CSZA 3ROLB 1MY7A 4S2SB 2VXUL 1G7JB 3CE1A 2O5NA 4A52A 3DRTB 1HE7A 4S1SH 1BOGA 1QZNA 4EXKA 4BUGA 4G1MB 4D2NA 3CX2A 4W4OC 4YO0A 1LWJA 1NMCB 4OFVA 5ITFA 3R8QA 5TDOB 4RGNE 5A3ID 5HI5C 2VDLB 4PLJD 4R83A 4KNQA 4LNVA 2WB7A 4EKXA 1LWRA 3KLLA 4IJ3C 2J1ZA 5HJGA 4G8IA 2XHNA 3BAEL 3CX5J 2XX1A 3UTSB 2K4AA 3CDGB 4IGBB 1EEYA 1OAUH 5DJCA 2OQJA 2HVJA 3O2WL 1RZ7L 1UZ8A 2R1XA 1T4KB 1X5GA 3GJEA 3D3VD 4PFEA 1PG7X 5FGBA 3SPVA 4DKFL 3BQUA 2WN2A 2Q2LA 1MRFH 1W0VB 5TE7L 3UPRB 2V3DA 5CINH 1DUYA 5MEOA 2ATKA 3QI9B 2VXUH 4TNEA 1WWAX 2CUHA 3PIQB 4QYAA 5HGDA 4C55A 1SVBA 1FI8C 1FC1A 3H1ZA 5I71C 5JO5B 2YPLD 2ZUQB 4XCEB 5DQ9B 2ZXGA 4BKTC 1ZS8B 4YHZL 1WP6A 2NY1C 3EFOA 4KK5D 4JRYA 4TYUA 3BAEH 3E9UA 4KC3B 4V2CB 2GYSA 2FJFB 4XPGL 3RU8H 2FB4L 4WJG3 3SDXE 2FEDD 4N5UA 3RDTA 4DKTA 4K3DL 2IGLA 4DN3L 1L6ZA 3BVTA 3K8MA 3O2WH 1LO3H 5DI8A 4IIQA 4Q6YA 1KLFB 1OHQA 3P4MA 2YAHA 4QRUB 4DKFH 3QRFM 2MH4A 3WEAA 3IS1X 3BW9B 4I9WD 2C7FA 1D3CA 4UIKL 4BFBD 3FFCE 1IC7L 5E8NA 5GRVL 5TE7H 3ULSA 4MXQD 4OLXL 3AQXA 2X70B 4IBZA 3PRZA 3DBXB 3FYIB 5BRZD 3M46A 3SDDB 5BVPH 1JV2A 2PTTB 2B3RA 3OWRA 2GC4C 4YR6B 2QFPA 3CZSA 2YQGA 1CIDA 2CUAA 2PXYA 3EJRA 4RDBA 1FPTL 4GNKB 2X4PB 4YHZH 3WFZA 4PRBB 2BY2A 3H9ZA 1FG2B 1S78C 3GYRA 3LN4A 2APFA 3DHPA 3ILEA 2ATAA 1P1ZB 4HK3J 1VJSA 2HG0A 1MFUA 1GS6X 3AB0C 2X1PA 1GGYA 2OR8A 2C4FT 4ADIA 2MTPA 4YDKL 5EU3B 3I6KB 4PY8I 4DN3H 1A64A 3FUHA 4OQ1A 1JDAA 1OEZW 1CF1A 25C8L 4XXCA 1PD0A 5G4OA 3P4OA 4W93A 3K0YA 1FC2D 2YD8A 5ID1A 2NX5D 4L3FA 4UIKH 1IC7H 4ZXBC 1E6OH 4S0SD 4OLXH 1P84J 2WWNA 2PABA 4FFZL 4G8EB 5KN5A 4Q52A 1L0XA 1E5CA 3JTTB 5F21B 2RGSA 3HUJA 4JM2F 2G0LA 2PLTA 1TCMA 1OCWH 4FQXD 1Y7VA 3WEXA 1QFPA 5DK3A 3IDGB 4AZUA 1MHEA 1QVOB 4LNRB 4RESB 3E6HA 3KLKA 3WJJA 2HA1A 3RVUD 1F86A 1FPTH 1UADC 3AVEA 3SKMB 4AM0Q 4WSKA 4HIJA 1G7HA 4POZC 5JPNA 3IBOA 1FHGA 1NAKL 2ATPA 4IBSA 2YBRB 3QISA 2NR6D 2XTSA 3SQOL 5IQ9B 1AD0B 1XR8A 2X6VA 2VZ1A 2FSDA 2DMHA 2GBUA 5IFAL 1Q9WA 5I19L 1HKLL 4YDKH 1RZFL 4WU7B 4IBYA 2HKHL 5ENWA 3HFMH 1BXAA 4YMPA 5KS9B 1QW8A 3WY2A 25C8H 2IOMA 2C1OA 4LHQB 4WTQA 3FFDB 3JYBA 4I7ZC 4NPYB 4IRSC 1DN2A 1BQHB 4IW4C 3LIZL 1D5MB 3EFFB 3WNJA 3BZDA 3TVMB 3UTTA 3BP7B 3QO1A 3FS9A 4G9DB 1F6LL 1EJOL 4O2CA 3HI1B 1EWHA 3VXSA 2FO4B 2XACC 4PJGE 4MVBC 5E2UL 2J56A 1X7QA 3ETTA 2BCKB 4P3WA 3QIBB 1CFSA 5LAXA 3RVXC 3VXQB 4AXWB 1NAKH 4MQ7B 1MWAB 4WNQB 3SQOH 1AGDB 4GUOA 4PGDA 5I19H 4O5LL 1AQMA 3EADA 1HKLH 4X5XA 5ICZA 2FYYA 2HLEB 1RZFH 4L3AA 2HKHH 4K3GA 4H8HA 4OZFG 4OJYA 4EUPH 3ZZQA 1EZSA 3MOAL 3MLVH 4L4TD 3A4DA 3BMWA 5E2TH 4XB8A 1UWEH 3OTTA 5JA9A 2C9SA 3VU1A 5HHPA 2A6JA 1CIUA 2PW2B 3LIZH 1XCTB 4PHXA 2LAGB 4WFFE 4Y4FB 1JXGA 4XNAA 2H47C 4A1IA 1AHWC 3SGKA 1EJOH 4XH2B 4PS3A 8PAZA 3L1EA 3PYCA 4PJHA 1UURA 5ERWB 2OSYA 3RL2A 1HE8A 1OV8A 2K7QA 2YWZA 3DK2A 4U1IB 2WUBL 1FO0B 2OSLB 2V2XA 3RJOA 1MFNA 2YS4A 5SV4A 4D8PA 3FTGA 4YZFF 2L4OA 2VR8A 1KPRB 4I8DA 3ARBA 2VR7A 3BH4A 2ZYSA 4O5LH 5IHHA 1IAII 1O9ZA 3MRNB 2AQ1A 2EADA 1KIQA 5I5MA 1XHHA 3QDGE 3IJYB 3OX8A 2ADJB 4U1NA 3E1ZA 1S7QB 3MOAH 4LVEA 4YUEH 3BRGC 1NUNB 4QGTA 3H85A 1P2CB 3K7UA 5KZCB 2DI8A 4CW1A 3E8VA 3KPLA 4A1JA 2YXFA 1ZY9A 4G1EA 2CR3A 4A7VA 1JAEA 2BHYA 3UAJA 3RWGA 4JRXD 3E6FA 5D1QA 1AJ7L 1HDMA 1WO2A 5JIDA 2XG5B 3WNNA 3P2DA 1QFWI 5FAAA 2YD6A 3C6SA 1V3LA 2C9PA 2XTJE 1HL9A 4N8UA 3SO3B 1NFDB 2N1TE 3LCYA 1YPZF 3OV6A 4B50A 2X7LA 4KI5D 1ITCA 1JE6A 4NT6A 3FHQA 5D7SL 3VDBA 4CKQA 3U7AA 5DVPA 4V11A 2GKIA 1IRAY 5C0DB 3SE6A 1BM7A 4KNTA 3NFSL 4NKMB 1KIUA 4FNTA 3GKZA 3MZTA 3KVPA 3EGXA 4XNMB 4WENB 4RDQF 3VE0B 5I1GL 5FYJU 1LK2A 3KS0H 4L1LA 3U2IA 3SKUD 4JFZL 1C5DB 3A6OA 4OJAA 5IIEA 4HUVB 2EVIA 4Q6IB 3KPSD 3MROA 1MJ7L 2P43B 1O7VA 1P0SE 5A6MA 1AIFA 5CAYB 4KWUA 3HC0A 4UDTB 1AJ7H 3QORC 1FVCA 5FK9B 1E5AA 1HCFX 4PTUB 3H2PA 1RU9L 5ESAA 3NSCA 2ICEB 4RGNB 3ROLA 3WNKA 3FU7B 2LABA 4MLIA 4S2SA 1BZDA 4G8FB 4IRZA 3GSXB 4H1LH 3DRTA 4PJ5B 5BCAA 4UWQB 5D7SH 4WO4B 5JLZB 4JM2C 1QUPA 1OZTG 4G1MA 4HQQL 4KRPC 4M1GL 3HG4A 4OGXL 1UYWL 4BFRA 1QD0A 5JZ7C 2BHUA 3P0VL 1BWMA 5TDOA 4U31A 3NFSH 2ZICA 4GXUN 3EJCA 3GPSA 3K2UL 3UTSA 1CD8A 3ZPDA 3QYMA 4FE9A 5I1GH 4UNIA 1W16A 3D18B 3CDGA 4IGBA 4PPTA 5I9QC 4JFZH 3ZQXA 4XZUB 5B1BB 1ZHNB 1T4KA 3QUXC 4DGWC 5HYFA 3CFMA 1BA9A 2JKTM 2YD4A 2A9BA 3QCVL 1JGEB 3D4YA 3UMTA 4DGUA 1W0VA 1RU9H 1RZ8B 3CVHL 4L0ZA 3UPRA 1GS8A 3KXFE 3PWPD 3GMOB 1PZ5B 3QI9A 3PAUA 1L6XA 3L5WB 4NM8H 2QZQA 3PIQA 4RAHA 5AW4B 4HU8A 5BJTB 2CBQA 1G7PB 2NNFA 4OGZA 4HQQH 4M1GH 5JO5A 5EC2B 3LQZB 4OGXH 4XCEA 3MBWB 5DQ9A 3EH1A 3P0VH 3SDXB 1U3HB 2DAVA 5IOKA 3U6XS 5E1GA 1ZS8A 1MW0A 1X7SA 1ZIBA 2FGWH 2P47B 4R4FH 3K2UH 3G6AB 2E7BA 1KEMH 5GZNA 2FJFA 2AEPL 2CCWA 1KYFA 1VF5C 2ZWYA 2GTZB 2I32A 3FFCB 4FS0A 1U2CA 3BOVA 1SM3L 4L1TA 3ZG4A 5LUMA 5H4YA 2AJYL 2W81C 1ZLWK 3V95A 5I6OA 2F58H 1KLFA 3CX5K 4XNZB 4LQ1A 4NB7A 4QRUA 5IVXE 3QCVH 3NZHL 1NKGA 3BW9A 3JTBA 4XC1L 1BLIA 2A73B 5M7QA 3CVHH 3QNZB 3FO2B 1QOKA 3K71B 2X70A 3W56A 1XF2B 2G30A 3HS9A 1PY9A 4WCYL 1AZZC 3DBXA 4BK5A 5I0XA 3J07A 2XU9A 3OHMB 1YCSA 2CKBL 5GQBA 3SDDA 2WTPA 4NUJB 4PJCF 5F9AC 5CEZE 2PTTA 1B0RB 4YR6A 2FZ3B 2VR4A 4A39A 2X4PA 1KCKA 3A24A 1WGVA 4EQ2A 4PRBA 2JKRM 1FG2A 3RFZC 2OI9C 5D1XD 2CPCA 5H35B 1P1ZA 4HK0B 2XV0A 2AEPH 2V3FA 2Y72A 2WYZA 2ZOOA 2W9DL 4JZJC 5BRPA 2BRQA 3HUJF 1GS7A 4UQ3B 5EU3A 3I6KA 1SM3H 4OZIB 2AJYH 4U1MB 3JV4B 4ZO8A 5F3BB 2TSBA 3CVDA 4RCAA 1A7QL 4RWHA 1K85A 3NZHH 3B7UX 2LOEA 4YSAA 4XC1H 5GRYA 2Y6SC 5KAQG 1OOWA 4J2XA 3DDFA 4P4KB 1YYLL 4G8EA 1WWWX 3JTTA 1RURL 2YXMA 4I0PB 4WCYH 3IN0A 4GT7A 1YAZA 2CKBH 3O0RL 4PV9B 1RH8A 4M1DL 3IDGA 2XIBA 1QABA 1QVOA 3CHRA 3IYLW 4LNRA 5DS2A 5GS0C 5KWYC 1E28B 3HZVB 5IKCB 3SKMA 5FPIA 3L5JA 3U0WL 1EHLL 1KG0B 4DGVL 4RAVB 3QDJE 5FO8B 1T1XB 2YBRA 2HH0L 5IQ9A 1AD0A 3CGTA 2QLYA 2V3EA 1NMAL 4WI8A 4IIZA 1QHPA 1PSKL 1MREH 3OKEB 4FFYL 4WU7A 1FUNA 4WUUE 5FM8A 3MZGB 3QIWB 3Q0HA 2LU5A 3ZMEA 1U41A 4XNBA 3OJDB 4U2ZA 4H40A 5KS9A 3X12B 3ZGPA 1A7QH 3GSNL 4FRWA 4OZHE 1YSOA 3ZSTA 3VXUD 5KBLA 1I7RB 3FFDA 2JQMA 4NPYA 4NN6B 1BQHA 4PJGB 1D5IL 2EDXA 1JK9B 4HHWA 4JKWA 1YYLH 1D5MA 3EFFA 5DO2D 1IVLA 2RTTA 3CHPA 1MCOL 3BP7A 1D9KD 3TVMA 3ZR6A 5JW5B 3KBFA 4G9DA 2CA4A 2K1MA 3HI1A 4JDEB 4M1DH 5ICUA 2FO4A 5JHMA 2FVNA 3RQ3A 2E27H 1P84K 1JDCA 2BCKA 2JMRA 3QIBA 3VXQA 3U0WH 1EHLH 2IAMC 1I9RL 4DGVH 3PREA 4AXWA 2Q3XA 4MQ7A 1MWAA 2HH0H 4WNQA 4PB0L 1GYVA 3BRFA 1AGDA 1H6EA 1NMAH 2BSBA 3BWZA 3VWKD 2DYSB 4DGYL 3B2XA 4TN9A 1WAAA 4FFYH 1KJMB 5JHLA 3EXJA 2EXWD 2F54E 3VU2A 5FGBC 3JSSA 3GSNH 5DD0L 2BIHA 3BQUC 4KJWD 2AQPA 5C09D 2BNRE 2J5LB 2BXYA 3EJTA 5CLTA 1D5IH 1T7WA 2PW2A 2GUOB 2QQKL 2J6EL 1MZYA 1XCTA 4Y4FA 1MCOH 5D7LD 5J89A 1N8ZB 4XH2A 1LO2H 1EVUA 3GBEA 1J8HB 3CSBA 5ERWA 5DUJA 3QDMD 2Y25A 1KYOJ 4EF3A 1E4WL 4U1IA 1FO0A 4WI2A 2OSLA 3UMNA 1I9RH 4EN2A 4YWGL 1KPRA 4PB0H 4HEPA 3BPLB 3BESR 1GTNA 1NL0L 4HIPA 4DGYH 1EAOA 2VGLM 3MRNA 3OF6D 5H37H 3RDTC 3IJYA 1E4XL 4AMWA 2ADJA 4IIQC 5MEND 3HC3L 1S7QA 1S9YB 2ZKYA 5IW3A 5DD0H 4CN4A 4OSUL 3PWVB 1MAML 1KCBA 1NUDA 1P2CA 1MQ8A 2QPUA 4DESA 4WEBL 2A0LD 4LRIA 2Y1ZA 5DZAA 2QQKH 2J6EH 3BJLA 5F8RC 4K94H 4J28A 4EIBA 2C9UA 3PL6B 2Y5EA 2B1AL 2PWFA 4XMZA 5BXFB 2DEYX 5HGAB 5IR1B 4LOEA 4ZTEA 4YSDA 4BCXA 2AV1B 4M7ZC 3GO1L 1M7DB 2XG5A 2PXYC 1E4WH 2QGEA 3AQDA 2UWEE 4HCRA 5FWRA 1SXZA 3IDIB 2GSGB 4YWGH 1NFDA 5CD5D 3FB7B 2LV4A 4NZDA 2VYRE 3T0EE 2DBJA 3Q44A 1ZPLA 2B16A 2GCYB 3VG0L 1SYVB 4H7VA 5BOJA 3BGMB 1E4XH 5C0DA 1MRDL 1NA8A 4CSSA 3QUMB 3HC3H 1R0AL 2DEWX 4OJDH 4XXCC 2OSWA 4NKMA 1J88A 1FCCA 4IOIB 5DLML 4WWID 1MAMH 4XNMA 5E6RB 3RAJL 4POYA 3QUZC 4Z0XB 2MMXA 3EBGA 4FQLL 3VE0A 4JG5A 3OR7B 4WEBH 4K71B 3CFCL 1QI3A 3H4HA 2IVFC 2UUDK 4KI1A 5IK3B 3UGXA 1C5DA 2F7PA 4MJID 4HUVA 1W8NA 4NBZB 4Q6IA 2B1AH 2WHVA 3US9A 1PU0A 1LD9B 4UDTA 5FK9A 5IVXB 3GO1H 3FTVA 4AL8C 4PTUA 4TXVB 1EHXA 3O4LD 1XB8A 5JPNC 2RALA 4H26B 2ICEA 4Z3EA 2QHRH 3FU7A 4HLZH 5HHOD 4HGKC 4UILL 4G8FA 2EZ0C 3GSXA 2VRAA 4MQXD 4PJ5A 4L4VB 4Y5YB 1XF5B 5JLZA 2NY4C 4WO4A 2RA1A 1K5WA 3VG0H 2DIBA 4LL9A 2H7WA 1UWXK 4WTZA 4KOCA 2ERJC 5DHDA 1MRDH 4JY5H 5DRZB 3IMSA 2YJLA 5CIPB 1EGJA 1TJHL 1AG6A 1V05A 5DLMH 4S1DD 3RAJH 1VPOL 1GY2A 1KTBA 4FQLH 5DFAA 3NIGE 3D18A 3CFCH 1GH7A 2RACA 2EVFA 1KYDA 1XD1A 3KXFB 4JKMA 3UYPB 3B7TA 4XZUA 1J5OL 2HVKB 1ZHNA 5AVZB 4WEEA 4WV1B 1G6VK 1ZLVK 1T6WA 1JGEA 3DX1A 4OB5L 3VYOA 2XPYA 1RZ8A 1QHQA 2CH8A 3TU6A 1XMEB 2WGNB 3GMOA 1PZ5A 3HAEB 1OCOB 4UILH 3L5WA 3N0AA 3PGDB 4KTYA 5EFIB 1C12B 3WSQL 2X3CA 4JPQA 2OJEB 5E8DL 3TN0D 4JO2L 4HISA 5BJTA 2N4IA 1G7PA 5EC2A 3LQZA 2JK5B 3MBWA 1S7WB 2DM2A 1HL8A 3RX5A 3H3KA 1U3HA 3SDXA 3CHSA 3ISRA 1F02I 1ZTMA 2O5ZL 3BAYA 1FLRL 5FYLE 4JRLA 3G6AA 4ZW6A 4WFHE 1VPOH 1RZIB 3T0AA 2GTZA 3FFCA 4NQQA 5F3HB 1FAIL 1TTCA 1DVYA 3B3BA 4F1ZA 1P5UB 4R7VA 4BIKA 4ZMQA 5F71A 2VN6A 3NSDA 3ATDA 1MI5D 1TQSA 4HFUL 3SGKC 4OCWL 2I25N 3ZZ1A 2OMVB 4OB5H 4Z3GA 3CSFA 2Y2TA 3ASNB 2A73A 4GAGL 3QNZA 4B5ZA 3BH9B 3FO2A 4RFNC 3K71A 1OB0A 3V10A 5C0AD 1XF2A 3ARBC 4R26H 2ZXAA 1U0QA 3WSQH 5E8DH 4JO2H 4LOUC 1IFRA 4NUJA 1U2YA 5FX3A 1B0RA 3B9KD 4ZMXA 3BAIA 5SWQB 2FZ3A 1U21A 2VM9A 4IM8A 3ZL2A 1IFHL 5ACZB 4UU9B 2O5ZH 4F7KA 4E41B 1IV8A 5FW8A 1FLRH 1VADB 4KTGA 2J43A 5H35A 4HK0A 2VITB 3NZ8B 1A3RL 3U4AA 5DCCA 3V0GA 2BNQE 2J44A 2L8AA 1YMHB 1FAIH 3FPXA 1J9QA 2H3KA 4UQ3A 2Z8VC 5MERB 4OZIA 3J8F7 4HFUH 3JV4A 4U1MA 5F3BA 4LVNB 3ZVVA 4OCWH 1RD6A 3UAJC 1MDTA 4QRPE 1QLEL 5J6GB 5D1QC 3V5DB 1FF5A 4JFDD 3ZT5A 2F18A 4GAGH 4LCYB 2JKWA 4H25B 5T1KD 4P4KA 1BZ8A 4OBRA 5AL0A 4I0PA 3QDJB 1GZPB 3S96B 3TASA 1AR1D 2VN7A 4L0YA 1QYGL 2MQGA 3FO1B 3PHQB 4PV9A 1AKPA 1JPSL 5KS9F 3UAAA 4M7KL 5I2IB 2N7AA 1IFHH 1V8HA 4ZW5A 4WUUB 1E28A 3HZVA 3L5IA 3VWJD 5IKCA 1KG0A 3LQAC 1RUPL 4RAVA 3VI4F 3CIAA 5FO8A 1T1XA 4UNVA 2EVJA 4OZHB 5LN4A 1MCHA 3X1EA 1XZ0B 1A3RH 2QFRA 3W0WB 2W07B 5EO9B 1E8WA 2XFXB 2XUWA 3OKEA 4N2EA 2HYMA 3QIWA 2YSTA 5KVGE 5K9JL 2VERA 3KZ8A 1T03L 3OJDA 4LCWE 3UAEA 4NC1E 2CHZA 5E4OA 3X12A 3JWNE 5F1SA 2XXGA 2WXLA 1I7RA 3F84A 3AROA 3ESOA 4KKAC 3TS8A 3AG2B 4NM4L 4PJGA 4MNQE 3GRWL 1L9QA 1A66A 2X42A 5M95B 1JK9A 3MNDA 5DVLA 1LYQA 1Z9LA 5I66B 4J3TA 2PP9A 5JW5A 4P9HL 1W72L 4JHUA 2XWJB 1QYGH 3UTQB 4HD9A 4JDEA 1JPSH 1NWOA 4FXLA 3NMEA 1NMCC 4O2FB 4M7KH 4MMZB 2YARA 4M29A 5DJAB 2F54B 1RUPH 5IWLC 4FTVD 3EYQC 1QASA 5CJQL 3WFBH 4PCYA 5SX5H 2Z4QB 1KN4L 1KJMA 5K9JH 1T03H 1AC0A 2AQTA 2HRHA 4B27A 1NIAA 3BQVA 3OAWA 4KTEL 4FYTA 3O45B 4LPUA 3V7AE 4UTCA 2WNWA 3MN8A 3EAKA 2X12A 4NM4H 3GRWH 4KXDA 5EV7A 1UCTA 4PJ9B 3E3QC 4WLCA 2GUOA 3ARZA 3QI9C 4ILDA 3ULVF 5FM5O 4P48A 3A67L 2KYIA 1E3ZA 3IPBA 4P9HH 1W72H 1N8ZA 2QEJA 2OMBA 1J8HA 2ZUQC 4JANB 4M8RA 3VD2A 4N24A 1CF8L 2XT1B 2VDOL 5C86A 3DX0A 2DQUL 2PWEA 2C3VB 2UUDH 2WLZA 5BV7H 1YNTB 1JHLL 1GOGA 5FGRA 4PJ7F 3P9LB 3FN9A 3NESA 1V10A 2ZUSA 1FP5A 2XJKA 3T1FB 2XWRA 2YGQA 1A7PL 5GSVB 2LLLA 1DLFL 1GOFA 1S9YA 1VLXA 2CHDA 3QEHB 3RBGA 4DP7X 1IM9B 3QS2A 4KTEH 5DC9B 1NKOA 3F05A 3PUCA 2YZ1A 1IIKA 2Z31D 3PWVA 3OZ9L 5EF3A 1JPST 1CQKA 1YMME 4EDXB 5ADOL 4M7JL 2UWEB 3P0GB 1UWXH 1SHSA 1Y1DA 1ZLEA 3A67H 4BK5C 4P2YA 3PL6A 2A38A 3SDDC 2NYZA 4KPHL 5BXFA 2V9QA 5HGAA 5IR1A 2AV1A 4K5OA 1EXGA 1CXIA 1M7DA 3FU8A 3L81A 5EZOH 1CF8H 3NSFA 2VDOH 3S34L 3MJ6A 4AJWA 4U1LB 5F96L 3IDIA 3OZKA 2GSGA 4HC1A 3FB7A 1JHLH 2ADFH 1NCDL 4GBXB 1FBIL 3ZL4L 1KXTB 2VDNL 3ESNA 4PI0A 3LRSB 4TSCL 1KYOK 2GCYA 2VDKL 1SYVA 1ZLDA 3BGMA 4FABH 5CR8A 4L8SB 4M6NH 3QUMA 4OLYL 4MJHA 4CSTA 4FKHA 4H8WC 4HX1B 4IOIA 5E2VL 1FQ9C 4GUPB 2VW4A 3CUPB 2X1WL 4Z0XA 5CZVL 3W11C 3OR7A 1DSYA 4LP8A 5CEYB 4PG2A 1KBBA 1E8YA 4M7JH 5IK3A 8CGTA 3IB4A 1C08B 5ADOH 3CN2A 1SJEB 1P1VA 4YLBA 2MPVA 5GS0L 3KYOB 2GJRA 4KPHH 5E03A 1JYVA 5FW6A 4Y4KD 2WWKT 5ISZE 5F1OB 1LD9A 4MKTA 4UM9B 1N7ML 3S34H 3UP1A 4BFNA 1X5AA 5JMOC 2MKWA 3OMAB 2FBOJ 3ZDZE 2W59A 4H26A 2JJUA 1SY6L 1RIHL 3L9EA 2CO7B 3C12A 3NCXA 4XMTA 2VZTA 4OZFB 3WU1A 4L4VA 4Y5YA 1FBIH 1XF5A 3N2JA 3ZL4H 1I4FB 3OB8A 4U3HA 3TESA 4WEUD 4HALA 4RGOH 4TSCH 4TOYL 3NIGB 4XP1L 3FUKA 5L2KB 2VDKH 4R4BB 5FV2A 3VB9A 2ILLA 4OLYH 2X6CA 4DHLA 5DRZA 4IK7A 5CIPA 1JDDA 3D4GA 4WWPA 3C5ZD 1UD5A 4FA6A 5CZVH 2K6YA 1MCDA 3KXFA 3IWVA 3UYPA 3ECVA 2HVKA 5GS0H 1JZ4A 4WV1A 4P2RE 3SDXF 1HYSD 1M56B 3FB6B 3SGJC 2BS71 1N7MH 1S6NA 3WIHH 4DT2A 4Y1AD 1TVHB 1ZTXE 1X9RA 2AFNA 3HAEA 1SY6H 1RIHH 2X9XA 2DN7A 3ETSA 1BFSA 3PGDA 5EFIA 1C12A 3BLPX 2OJEA 5IQ7L 4ZFGH 4R7DB 2V2WB 4XP1H 4TOYH 2AAAA 2JK5A 2VZVA 1S7WA 2YUVA 3WEMA 5B3JE 4O4YL 1S3RA 4J23A 4YHYC 3D0VB 1BHGA 5IJDC 4ECNA 4JN1L 1AY1L 4RA0C 3T3PE 1ZE3C 1N2RB 4YLCA 1RPQA 1UA7A 1RZIA 1PKQE 1SGKA 5F3HA 4GP8B 1EHKB 1PIGA 1V27A 1P5UA 1E3FA 1L9PA 3QJOA 4GMTL 3QR2A 1OP9A 3OAZK 3RVWC 4XODA 3U2JA 4PGJA 3V79C 4JN2B 2OMVA 4FD0A 4G8GD 1JN6B 3H7BB 2H6UA 4M93B 5CJ8A 2P42B 3L4YA 4JL2A 2NYKA 3A0OA 3BH9A 3LRMA 3BYYA 3Q5YA 4YXHL 2VCOA 4FL4B 3OPZL 1B3IA 3B34A 3NCEB 4GUQA 1ECYA 5EB9A 4Z8FL 2OS7A 3HIZA 3QEQD 5SWQA 1IAMA 3C60B 4O4YH 3ESVF 5ACZA 4UU9A 2BSDA 5MHSE 2UY6B 3PNWB 3L45A 4Q7DA 4E41A 4UTBA 1VADA 2XZQL 1OSYA 2X44D 1AY1H 3CXDL 3D06A 4FG2A 4BFOA 1IQWL 2VITA 3NZ8A 5AVWB 4LRIC 3D0LB 1ZOXA 2MQ0A 2X0VA 5ECJE 1YMHA 1Z9SB 3U4BL 3V4LA 3T3ME 2IMNA 1PGRB 5MERA 4GMTH 1PY0A 1I8LA 1JWUB 3I2CL 1MWOA 1UJ3B 5KEZA 1AXTL 5J6GA 3V5DA 2NYYC 4LCYA 4J6RH 3QWNA 3RE0A 4H25A 3SY0B 1TXKA 3VX0A 3SO3C 2V8LA 4YXHH 2EE2A 3OPZH 1E5UI 3QDJA 1MQKL 1GZPA 3S96A 3B8SA 1A0QL 4M4PA 3PHQA 3FO1A 5IB2B 3TH2T 4KY1L 4Z8FH 1FHNA 2P5WD 5I2IA 1EEUA 3DIVA 4OFPA 4WUUA 2IBZY 3DLQR 4LCWB 3TH3T 4LIQL 5T3XE 3DMMB 1KMGA 2P49B 2XZQH 4LASL 4OZHA 3CXDH 4DP6X 2VQTA 1IQWH 1XZ0A 1PMYA 1Y6KR 3W0WA 3V0HA 2W07A 2WC7A 2CNZA 4JRFA 2GHWB 4KQ3L 5EO9A 2XFXA 2F53D 4MNQB 3U4BH 4P2QB 4Z7WE 2KZ1B 1UHVA 2YKKA 1NCWL 4OCLC 4AL8L 4ZOBA 4AGLA 2X3AA 1S78D 5CLXA 5CBEB 1AXTH 2X4UB 2VDPH 4RGNC 2ICEC 4YC2B 2ZUYA 5I66A 2BW5A 1IARB 1AZRA 5F0MB 1MQKH 3CC1A 4OLVL 4WO4C 3MBXL 2Q3ZA 1A0QH 2GVYA 3CPLB 2XWJA 2QDVA 3UTQA 4KY1H 4PRPE 4O2FA 3W2DL 3TP4A 2BW4A 2Z92B 3PAZA 3T8XB 2FQDA 4J4PA 4MMZA 3SE3A 1EVTC 1ZCRA 2F54A 5DJAA 3F62A 4LIQH 2AP2A 1EXHA 4LASH 3R8BB 5KTEL 5BQDA 4TL5A 2YGVA 3RWIB 4AQZA 2X87A 1KDIA 2Z4QA 3QPKA 4KQ3H 5AKVA 5F7LB 1NCWH 1A9BB 2XN9E 4AL8H 1JWMB 1D5ZB 1FGVL 4W9ZA 4A04A 1FFQA 4AY0A 4PS8A 1H3WM 3K3QA 3MCG1 3O45A 4J3WA 3MOQA 1P4LB 1E6JL 3L4UA 4XXWA 4HOWA 5GGQL 2DJMA 2OTWB 5D93B 1N26A 4PJ9A 1A2YB 4YJZL 1PG7W 3FHAA 4KXAA 5E56A 1G9MC 4WWKD 5AYTA 4OLVH 3MBXH 4JFYB 4MA7L 5HYSG 4HMCA 3DXAB 1VACB 2JIXB 4H5SB 4JANA 4L1BA 5CSGA 3W2DH 4D8OA 1JFQL 2ENSA 1J86A 2VLKE 5B7FA 4TNVK 5CLWA 2WKOF 1CTOA 2VQ4A 2C3VA 4M56A 1EANA 4FJYA 4QYOB 3T4AB 1YNTA 4U6TA 3VUAA 1G7LB 5KTEH 3P3TA 3KJ4B 3P9LA 1ILSA 1IGCL 2N7BA 4ZTPL 1AH1A 1YMMB 3MUUA 4ONOA 3T1FA 1BQLH 2XA8H 5GSVA 3LEVL 3VA2C 3QEHA 2QPSA 3ASOB 3HS0B 4K8RL 1IM9A 3HTLX 4XNZC 5H4ZA 4PRAB 4LPCA 4X9GA 2EIMB 2OJZL 5AAWA 1NCBL 5GGQH 2H3XC 3GXUB 1P7QD 1NWPA 4EDXA 1MLBB 2UWEA 3KGTA 3F7QA 1OSZB 5H94B 3T71A 1E0OB 3WAKA 3LS5H 2WKLA 4MA7H 5F7YC 1AQ8A 4FG4A 1XAKA 3QHTC 2CA3A 3NOIA 4U1LA 5FR3A 1I1AB 1U3ZA 2D2CC 4D9RD 1IGML 4W68A 4GBXA 2HB0A 1CI3M 1KXTA 2WLKA 2Y7MA 4G59C 3LRSA 2E56A 4ZTPH 3SKOB 1KCWA 5D4JA 1N6QH 2OYLA 3ROOB 3MRPB 4L8SA 3WYRA 3LEVH 4ZX6A 4HX1A 4K8RH 3QK0A 2H2SD 4JPIB 3LKOB 2D3LA 1TFPA 4GUPA 4BDVB 3N91A 2OJZH 3CUPA 1NCBH 4P4KC 5CEYA 5AG9A 3ZDZB 1C08A 3TH4T 1SJEA 4I1NB 4I0PC 4JFHE 1Z3GH 4JQVA 4OFKA 2DQDL 3LZFL 3WTUA 4JO5A 3KYOA 3FF7A 3LOWA 4R2GB 5A1AA 3HBZA 1KTRL 3SCMB 1OY3B 3KNBB 3LQAL 1DVFB 2D7NA 4UM9A 4NN7B 5K69A 1MUJB 5AW1B 3FOLB 1SUHA 4LHUG 2PPCA 3GLDA 4ZI8A 3ZHDA 5IFJB 2ZOWA 1X6LA 2CO7A 3O6LL 4FNLL 4OZFA 4LEXL 3SKNB 1IGMH 1VERA 1G5AA 1I4FA 2AK4B 2EIZB 4KMQA 4A2LA 4P49A 1ED3B 3CIQA 4PJDB 5L2KA 4R4BA 4XAKE 1R9FA 1MFBL 1U6AL 3QIWC 2ZWLT 2Z34A 1G1CA 2PKDA 2DB8A 1INDL 5FOBB 3R4RA 5ESVB 3GRBA 3NFNB 4XNDA 2WINB 4NN6C 3S3DB 2VQUA 3PDGA 2F61A 3DGGB 3QJUB 1J18A 3D05A 4XCNB 3RL1B 2Q7NA 4JY6B 4YL4A 3IJEB 2DQDH 3LZFH 2HG5B 2DL2A 4PREB 2YMOA 1OLLA 4EI0A 4IKIA 5DHEA 2EDNA 3FB6A 2ETWA 3SYPA 3SGEH 2Y7OA 3NP4A 4JQXA 1F3JB 1TVHA 2CDEB 2Z7UA 5IVXF 5C97A 3O6LH 4LEXH 4BINA 4LLMB 3E2HC 3UC0L 5D7JB 2A2QT 3MNMA 3T3PB 4R7DA 5AQ0A 4BQ6A 4ZX3A 2V2WA 3QORD 1PKQB 2XBZA 4NEHB 1MFBH 1U6AH 4CBPA 3VD5A 4L1DA 2HTKD 3D0VA 5F7FA 3WJMB 4A7GA 1FL5B 2IPKB 1A1MB 2WYHA 3FO9B 5LQBL 5BPPA 4XP5L 3K6FA 3LH2L 3IAQA 1N2RA 2FHFA 4CVXB 3N41B 1YLBB 1EX0A 1USQA 1A22B 4DVBB 1OAKL 1BZEA 2CR6A 3JWDC 5JHAA 2G9HB 3TGXA 3FH7A 2ZCHL 5DGRA 5KYNA 3AQYA 2BM3A 4JN2A 1KTDB 2VMJA 1Z9PA 1FL3B 1JN6A 3H7BA 4RSVA 4WI0B 1NCAL 2WTRB 1UFUA 4F15B 1D6VL 2DWYA 2MOVA 2EC9T 3KHOA 4FNSA 1F4WH 3J2PA 1UGNA 2N59A 4KK9C 1IKNA 1FYTE 1NFIB 3BPLC 3UC0H 1B2YA 4MNGE 5JW4N 2C4XA 2H0PA 1CT8B 2VRKA 1SEBB 4W6WB 4RVBA 4B9ZA 4WY7L 4ATTA 3C60A 5EU7E 1AZBA 3QJTB 1WZ1L 2UY6A 3PNWA 2H1PH 2VXQL 2UX6A 3QARA 4NUMA 5LQBH 1MJJB 1ZWIB 4XP5H 3LH2H 4AIOA 3VQMA 4MB5A 3D0LA 3AU0A 1Z9SA 3MUJA 3TZVC 1ID2A 6CGTA 1OAKH 2XTJC 3PL6C 1NQBA 1JWUA 4JZNB 3RB5A 1UJ3A 2WP3O 2ZCHH 2AQQA 2WXHA 4FNPA 5AALA 5KANI 1OT1A 4X5LA 1NCAH 4L5FE 4RGMC 2E8YA 43CAB 2VLRD 1OIOA 1XX9C 1D6VH 3SY0A 3T0XA 3C6LB 3TIEB 4DVRL 4MD4B 4GLRI 4LPTA 3DETC 2ZSVB 3OVUB 3Q5OA 4H8WL 5GIRB 5IB2A 4WDIB 5I1IL 4WY7H 4Z7WB 2NUPB 4H0GA 5ALCL 1BX2B 1JGIA 1WBYB 1WZ1H 3H42L 3D0AA 2XLLA 4LCWA 2VXQH 3DMMA 3ILQC 4PH8A 4YHLL 4OCNC 5TFSL 1GAFL 2OPCA 2JCCB 1MF2L 4K71C 1T2JA 4PMFA 4MNQA 5DMIL 4KDVA 2I85A 3P9MB 4P2QA 4BE5A 2YAQA 1OGSA 2OBGA 3NSXA 1ZVSB 3MCYA 1P69B 1P7BA 3I6LE 5CBEA 2G5RA 1B4LA 4J27A 2VH5L 3GFUA 2X4UA 3H8NA 4P8QA 4PRPB 1AZNA 1S9KC 5CU9A 4N2KA 2B15A 3DX4A 2APSA 1L6PA 3B37A 2KS0A 3FT2B 4JPWL 1WQVT 3CPLA 4H8WH 4DUWA 4BRVA 4ZMAT 3W5NA 1AZVA 5HD8C 3AAZB 4FKKA 2Z92A 3T8XA 3UAFA 2YFNA 4E9YA 2XN9B 3EYOB 4PJAE 5HDBF 3NVQA 3KM1A 4EKJA 2XQYG 4LCUB 4OZ4B 5DZNA 4KNUA 2PPEA 4QXVA 5TFSH 1GAFH 3FQXB 4OY9A 2Y7LA 2Y2YA 3RWIA 1MF2H 4ZFFB 1ZAGA 1NEUA 2DEXX 3NZUA 5DMIH 5DQDL 4CC0A 3SE8L 4BV1A 4Q89A 1A9BA 4UZGA 3MREB 1JWMA 1D5ZA 4KNSA 5T5FA 4WV1C 4N9OB 5C2UB 3IDXL 2VSDA 2VH5H 4OI7A 1XCXA 2DPKA 1MWAL 1P4LA 5H37G 3WFCL 4BEIA 3TURA 4XCYB 5K9QG 2OTWA 1YNTF 3HMXA 2VLKB 5FUCE 1A2YA 2W9EL 4UF7C 4O02H 1NCGA 1KV7A 1JCVA 2B1HL 3ARRA 4JPWH 2B4CC 4JFYA 1ERNA 1S5IL 3FUMA 4J3XA 3DXAA 1VACA 2A4ZA 2JIXA 3QQNA 4H5SA 1YY8B 2H8PB 4N3TA 4GRLB 4QYOA 3T4AA 4QRRE 1G7LA 2ESVE 2BH0A 2UWEF 1KTLB 3MRHB 1ZPUA 1CYXA 3GDCA 4B7IA 1YMMA 2NZIA 5DQDH 3VVVA 3VW3L 3SE8H 5ICYB 1QFUL 3ATAA 4YHKL 4YVUA 3P4NB 2RIKA 2XV2A 3NP3A 1DEDA 2VC2B 3HS0A 4PRAA 4UMGA 2GIYA 4FDWA 3FQRB 3K80A