4GSUA

Structural basis for the inhibition of mycobacterium tuberculosis l,d-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
268
structure length
268
Chain Sequence
b'LTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable conserved lipoprotein LPPS
molecule tags Transferase
source organism Mycobacterium tuberculosis
publication title Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
pubmed doi rcsb
total genus 74
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4gsuA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gsuA01
4A1KA 4QRBA 4QTFA 4A1IA 4K73A 5E1GA 5DZJA 4GSQA 1ZATA 4LZHA 5DU7A 3TX4A 4ZFQA 3ZQDA 4QR7A 5LB1A 3ZG4A 5D7HA 4LPQA 5E5LA 4GSRA 3VYNA 4A52A 3TURA 5E51A 4GSUA 4A1JA 5DUJA 4HUCA 5E1IA 3VAEA 2HKLA 5LBGA 4QRAA 5DVPA 4JMNA 5K69A 3VYOA 4Z7AA 3VYPA 1Y7MA 4JMXA 5DC2A 5DZPA 2MTZA 4HU2A 3U1PA 5DCCA 4XVOA 3U1QA 3ZGPA
chains in the Genus database with same CATH superfamily
3CLFH 5DK2B 5FECB 4GXUM 4FNLH 1WPCA 2XX0A 4Q9CA 5GGSA 2VOTA 2OFQA 3VXUE 1XGRA 4U7KA 3IU4L 3B3IA 4GRWH 4P2OA 2E7LC 2ZJSH 3MO1A 2ZT9C 3SZKC 3R4RA 2IC2A 4FXKA 5KSBA 4Z7WB 4JRFA 4YLCA 2AMUA 1JPGB 1NCCH 5D1QB 5HGDB 1X5KA 4ENEC 4JDZA 3IMSA 3IK2A 2EXSA 1H3UA 4KO5A 3LEVH 3RIKA 2X4QA 2SODB 4P3WA 4F9PC 5GRVL 1LD9A 4PB9H 2G2RA 4IRSC 2JCCF 5T3ZH 1DEEB 2YAOA 4MKTA 1JVOA 1G9EA 3FT4A 5HYIA 2PYEA 1BZQK 3A6CL 3VXRD 1DBBH 3LN5B 2LHAA 2QEJA 3TCXA 1NH6A 1Y1DA 1J8HA 1OP5H 5I1JH 3GIZH 3OSKA 5D6DA 5DA0B 1JD7A 2B77A 3QUZA 5AB2A 4WFHE 3C6LD 3N5AA 3VWJB 1A3ZA 1QD0A 1KN4L 3PL6B 1QSFD 2HT4D 4MAYB 3HN8A 1WZKA 1L7IL 3SDDB 1TFHA 3ESMA 3P2BA 4G5ZL 5CEZD 5IB1B 4L23A 5FLVA 2FECL 5I1JL 5CJ5A 2VL5A 4P4RB 1JFHA 2WVVA 3O45A 4GO8A 4Q89A 2NUPA 4HKXA 4H1LH 1UWYA 4OJAA 4OUOA 3RNKA 4F91B 5I0YA 1S7XA 4IS6B 4I3RL 3DV4B 5AYUH 4M00A 4QY8B 4QRRD 3BSZA 3RWFA 5BV7B 1MUJA 1E4WH 3KL0A 4JPSA 2JTDA 2CBQA 3E38A 1R46A 5DLLA 1OF2B 4MA7L 3ZMNA 4A6YH 1RVFH 1JPFB 1NM9A 4GRLA 4J4PD 1AE6L 4N2KA 1HL5A 2BP8B 1WAAE 1XGQB 1NUDA 4G1MA 1WC7B 2G3NA 3L95B 2EECA 3NCCB 1X5GA 2V17H 3T2NH 4AQZA 1JGUL 4OFVA 3V7MA 4FQCH 2HB0A 3ASWA 4PS3A 2WANA 4OIIH 5FO9B 1NJ9A 4E5XA 2GY7B 3HHSB 4AVHA 1M1XA 2BO0A 1BZOA 5BS0B 2H6UA 4KDTC 5IF0A 3L5WA 2V37A 3F58L 4XP4H 2E47A 5T1DL 4D0DB 4IBQA 4LHQB 1I8UA 1CFVL 1Q9OA 2PWHA 5FDYA 2B4CH 3QIBC 5T1LA 1FFTB 3TBCA 4X8XA 4ISVA 3NIDE 4G7SB 3FF7A 5CSZB 3MODL 4XO5A 3LB6D 5AQ0A 1A3QA 4YHYB 3DOSB 4BFOA 2IBZY 4DF9A 4Z78B 3TCLB 1XCTA 3F62A 2IOOA 5JW3H 4DKEH 2HN7A 2EH7H 5E5MA 4GKZB 3A6CH 4JE4B 1F4XH 1F6LL 3K4AA 4OIIL 3MODH 1RSFA 2P7TA 2WD0A 5DLML 5D7JC 1T20B 3KR3L 1EXHA 5C0FA 1ZXQA 1S7TA 2C9UA 5JDSA 1C16B 4BWTA 4QXGL 2PXYB 1KB9K 1XFPA 1N4XL 3UYRL 1OSZB 2DD8L 3T6VA 5JW5B 1VENA 2V9UA 5T1DH 3OL2A 1PLGL 2IDTA 4K5OA 5MEPB 2HPOA 3SDCB 5EZOL 3CUPA 4HLZG 1XX9C 4PJ7F 3HC0A 3GTNA 4WTZG 4UNIA 5G5DA 5DEGB 5D71L 4IRSA 5DVMA 2VN3A 2KC0A 2DWEB 1D6EB 2R4RH 4X8GA 2FUTA 2VXQL 4I89A 2VCOA 5E2UL 1INQA 3Q43A 1EZUA 1IKOP 3BD3A 1NBCA 4NC2B 4XPFH 5FOJA 1NGWB 1QTSA 2GY5A 1H3XA 5HHPB 1NCUA 2C9QA 2WO3B 3ULUF 3K1DA 5I6XB 1NLDL 2IOIA 3K6SB 2VQUA 2C7UA 3D9AH 1CGSH 1M7IB 3RFZB 2ERJC 3PWNB 2HAZA 1YJDH 5KVGE 3RP1A 4AG4H 1ZLVK 1JZ8A 3NFPB 1OD9A 4MCNA 1C12B 2IO5A 1BP3B 1IEBB 3MLXL 4DP6X 5KANG 3HE6C 3L3KA 4NCC2 3TCTA 4OD2A 4NQTA 4OF6A 5F0JB 2R2BA 43CAA 4QRBA 3TN0D 1CICB 3RIAF 1BQKA 1NFDA 2VM3A 2C8NA 1L9RA 2O6DA 3Q8EA 1TFPA 2OSWA 4JM4L 3LSOB 5E2UH 5D9SA 2WXQA 3HNTH 4AQ8C 4UOW0 3RURA 4NT6B 1EDYA 3IPEA 1RK7A 2MQCA 3LMJL 1AD9A 2CWRA 1EV2E 3ARGB 1P0SE 3BZFB 4N0FB 4UQ2B 1RZ8B 2RB8A 4LEXH 4WJ5A 5CNHA 4G6ML 5ADOL 5JNYB 5DYOA 5KANI 4M4RA 4AEHH 2ZUUA 4DGYL 4LRIA 2YMTA 5C0NC 5DQDL 3HVNA 3EFFB 4BSWA 4K23L 2O6CA 3BKMH 4X4ME 5E0QA 2VIRB 5FKAB 1ZS8A 3L45A 2FX7H 4DW2H 4UOW1 3ZKMD 2HKFH 3B2UD 3CVIL 1HNGA 3PHSA 1AQKH 3CMOL 1CQKA 4FXLA 4NKQB 3O2WH 3P1VA 3WE6A 4PS7A 2NW2A 3MRLA 5IQOA 2R56H 5BV7C 2IFFL 3RB5A 3UJIL 1KNOB 1Q94A 3T0BA 5DTFA 2BY2A 3EJTA 2X3BA 1YZZA 3GJEB 4XBGB 5GS2H 1G9NC 2G3MA 4GBXA 1NCAH 5EU7E 1G43A 5C6WH 4EN3B 1NLBL 1HKLH 2KDYA 3C60D 3MJ9H 3DRQA 4WJKB 3H53A 4XP9L 1UT1A 4TQEL 5MENE 1HNFA 5FKPA 5BZWA 2JKRM 2Z7WA 3FB7A 2D31B 5DC4B 4UDTB 1E3ZA 4FLRA 1T3FB 5E9DD 4PJEF 1RLWA 4KTEL 1N8OE 3O4LE 6PCYA 5GGTA 3OKDB 5AZ2L 3VJ6B 3VI4A 1N5YH 3W2DL 1CFQA 1U8HB 1U91B 4YGVA 5GS0D 3Q8CA 4Z7UB 4D7BA 1RI8A 4M6NL 4UQ3B 3V4PH 4HV8B 1KEGL 5HDBE 4PJEE 1H19A 5BVJA 4LPUA 1YMMB 5ETUB 3L3IB 3VWKC 4Y8AA 4ANKA 4KDTA 4XVUC 3V2AR 2G2RB 3VMNA 4AQOA 1QTPA 4NGHH 1AGCA 4PTUA 4N0CC 4J5VA 1CLYH 1TZIB 1VGKA 5IROA 4DSYA 1YDPB 1BZ7B 2UY7B 3LN5A 5ID1A 5GZNA 1QYGH 2DJMA 1EEQA 1SOKA 1C5DA 1BQHA 4UDUA 2B9AA 3MR9A 5DI8A 3VDBA 4MQ7A 4UTCA 4GRLC 2V2WB 1HQRB 1MFCH 4DOHB 3H0TB 4PVLA 4LSPH 3OKLB 1EAJA 3BDYH 3EO0B 3BWUF 4MJ4A 3ZDYE 1KZQA 3A6OA 3MXWL 2WKGA 3HE6A 4C59B 4PG9A 1BVLB 1DJSA 2I69A 4XOAA 1AR1D 4KXAA 2KZ1B 4S2SB 4FABL 4I0PC 1TVBA 2J6EL 4L1DA 2WYIA 4WWNA 4Z18A 1S5IH 1SVZA 5FW7A 1KXQE 1SLUA 3F12A 5HYJD 4H5SB 3EYUH 3CZJA 5I76A 4ZUVB 3LZRA 2GAZB 2K3TA 2OMXB 2DEWX 4KDWA 3IDYC 3UBFA 3FZUC 5CJOL 4E9TA 1E2ZA 1JHLH 3VWKB 3T0EA 1RJYA 1C7TA 1NBVH 3N85L 1ITCA 5C86A 4JS7A 3FCSA 4IW4C 4NN5B 4N2FA 4IRJD 2FSEA 1NMCB 2XTSA 4LXFA 4P46A 3RKDD 1AIFA 1L4IA 3QWRD 3Q13A 4PPTA 2Y6SC 3IETB 4QHMA 1T5WA 3T3PF 1UB6A 2XWTB 1KLUB 4KKZA 3IWVA 4Z7WF 1O9WA 3QIUA 1RUMH 2UXVA 4Q6IA 1MEXH 2DQTH 2O5XH 3V0EA 1XEUA 4M62L 2X1OA 1QFWM 3ARQA 4X6BB 3RPIB 3WTUA 3DX6B 4JUTA 1NWPA 2XETA 3TA4D 4V1DA 4W4NA 4ANUA 1W8OA 4QRFA 1QBBA 4MBRA 4PRIA 1DCEA 3MU3A 5HDOA 3KYOB 4D0DA 3DYOA 4LQFL 4XE5B 4E2OA 3CHQA 4YFEA 3MKKA 4KK6D 4LCUB 3MLZL 2DDQH 4MFHA 3VXPA 4XAWL 1U0QA 4DP1X 1QLRA 1G87A 5GRVK 3RYMA 3T65A 3RKDC 4UDUB 3KWVA 5KVFL 1IGYA 1D6VH 2DIEA 1KN2H 4CNIA 1YMMD 1MRFL 3BRGC 4AYEC 4PJAA 3EH5B 2O5YL 3QAQA 2YAQA 3IJ8A 5MERB 4CW1B 3II1A 5F9AC 4Y4HB 3RHWF 5FOBA 4AITA 2HVKA 2R8SH 2A6KA 2AEOA 1XGUA 5KW9H 2QADB 4LAQH 4L29B 1BEYL 1AQ8A 1AIZA 4QR7A 2C1PB 4QOKD 1K3IA 2ZWLT 4CRPA 1UJ3A 1U8JA 2VR4A 3RIFK 4TM9A 4Z77A 3IJSB 3ETSA 5G4OA 3TO4C 2D0FA 3HAEH 3HFMH 4PWEA 4TS6A 2WP3T 4BDVB 3FMGH 1MH5A 1HZHL 5IOKA 3HC0B 5CR8A 4FG4A 4R4BB 2DIAA 2VJ8A 3IDGA 4PCTA 2A83B 2YD8A 4W9FC 4AYID 1DQIA 2D4FA 2OR8A 1EIBA 3ZZLA 3KM2A 3C87A 2NCEA 3K8MA 1A22B 3H2WA 5LDUA 1DVZA 3FSWA 5E8NB 5GS0H 1INQB 1K4CB 1KXVA 1H5BC 1URZA 4KXCA 3VVVA 3LKPA 3QI9D 4TNWF 1MCCA 4WV1B 4E9YA 1CO1A 4OR1A 4N6RA 2R8SL 1ZHBB 3KJ4B 4G8IB 2VSDA 2WY3B 4PVMA 5T3XD 4YHOH 2VQ4A 1O6SB 1IGCH 1QACA 4IEFA 2QGEA 4GQ9L 5LG1A 2MTZA 3VWKD 4WDIB 5T3XE 1NOAA 1AD0A 4LHJB 4N0UA 4P5SA 1FG2A 1WFNA 1QR1B 5IB2A 5J6GB 3DUHA 2F7QA 5GS0C 3V0FA 3OAZH 3H0TA 1YAIA 4GS7C 1UVQB 1FGNL 1UXWB 2KYIA 4L48A 1KT2A 1QFOA 4Z7NF 2VZ3A 2X38A 1ZHKA 4PGZA 3FTVA 2GYSA 4GW4A 2FQEA 1QRNA 1JTTA 4LKXA 4WQOA 3KPTA 4Z7UF 5LBVA 3RVWC 5L9DL 3HA0A 2ENYA 5D6DC 3U7YL 3I2CH 1CGYA 2BJMH 1XF4B 4GQRA 4LOFA 5DRWB 4M1GL 3S3PA 4JFED 3T1FA 1OAXH 3L2MA 3QDHA 4UT6A 1UKSA 4M7JH 5KVFH 2N7BA 3G6AB 4BGLA 4Z7NE 5D4JA 4XCCH 1SLWA 4NUJB 5EZPA 2FYYA 2H0EA 4CMMA 3GPSA 2X9WA 4LMQE 4I9WE 4AZ8A 2R1WA 1F1DA 1HTYA 1ID2A 2A4CA 1XGRB 3V4VB 2BNQD 4Z7IA 3MLRL 5CMAA 4AQ1A 4Y4HD 4BQCA 2H32A 4PJ8D 4C4UA 3UAJD 4QRAA 1AGDB 2OP4L 1A7QH 4X6DA 1ZLSH 3TWYA 3EOYG 3HOGA 3NFSH 2VXTL 1WO2A 3CFBB 3H7BA 4F57L 2OJZL 1JUFB 4TNEA 1DLHB 5D8JL 1A8ZA 4X4XA 1AS6A 4ODVL 3T0WA 4PW4A 2FAUA 3MRMA 2E6PA 2XWJA 3W5NA 5I6LA 3BAXA 1PEWA 1PG7L 2FNWA 2HKFL 3A4DA 4XO9A 1E5CA 1EUTA 1GOGA 1CDIA 5CEZE 4PJXE 2YBRB 1NTDA 3VGHA 2Z65C 1XGYH 4JK0D 5BUPA 2V9QA 3SO3C 3OKOB 4FP8L 4LESA 5GQBA 2ZSVB 1I85C 5EU6D 2NLJA 1IAIM 5F8QC 3MLUH 3TN0C 5ESAB 1MHHB 3FT4B 3HPJA 1I7UB 1NAKH 5IVXE 4RZKA 4ODBD 5ICZA 4QRPE 1MJJA 3I9PA 3O2DL 4Y5YC 4N90D 3MNZB 3KBPA 3GLEA 3VI4E 1BGXL 3VG0H 1TSRA 2JIXD 1P7QB 4RBPH 4WK4B 5I1DB 4QTHB 3QDGD 2I24N 3X17A 1ERNA 4YC2B 3L5JA 4XXWC 1I9JH 1ZSHA 2BVOA 2Z35A 4NUGH 4GAAA 3SYOA 2HRGA 1WBYA 3EJCA 4MMXA 4NWUL 1MH5B 3QZNA 3R1GH 1TETL 4LCCC 1OCWL 1OT2A 1RPQA 5DHVA 1PKQB 5ALBH 2DAVA 2F53A 1TZGL 1S5HB 2VN5A 3WFEL 5ANMA 3WFDH 1G7QB 5LNEA 4KITB 1GVIA 4IRJA 3T08A 1KBVA 3O41A 2X7LB 2BPBA 2J57A 3MQIA 3SCMB 3O8XA 1FZKA 5CZXC 1RAMA 2K4AA 4FZ8L 3BQUC 3GUFA 3HG1D 4YDIL 4WUUD 1JI2A 4TSBH 3ARTA 2H3NA 4HG4J 1IFGA 3X13B 1JSYA 1OW0A 2F6AA 2X41A 4MD5A 3KPRB 5DZ9A 4U4IA 2VLKE 3GWJA 3NJIA 2DM3A 1FAIL 2ENQA 2D2CC 3GBML 4WI0B 2PABA 1D9KB 3EFDH 1BBDL 3DURA 4F24A 3MRPB 3V0VA 2UX7A 4H0HB 4R7DA 2OMVA 4YPGA 1YQ2A 3VGEA 4JM2B 4MJID 4JRXD 4MQXD 2A0LC 3RWEB 1UXWA 5D1XE 5IJBC 2ED6A 2VC2L 3VQLA 1UZ8B 3GSRA 3CX5J 3NSYA 3LB6C 5ADOH 2H1LM 5LUMA 1ETZB 2BSRB 4JFZL 3RAJH 3V5DA 4AW4A 1TOXA 3BP4B 1JK8B 4UB0H 1GR7A 5DQJB 4ZUWA 2VLJB 4ADJA 4AZUA 4Y4KB 2WXJA 3SJVA 4DGIL 5FB8A 4O2EB 1G0XA 5FM5M 3WNKA 3F6IA 2XV6B 4YXLL 1E4KC 4KK9D 4M8QB 1FLRL 4ODTL 2I25N 1GHFL 4XAKE 4XB3A 5EU6E 3V4VA 1MY5A 4BCYA 4Z7OF 2ZQKA 3BIAX 2PXYA 2XI9A 4G1MB 2XZZA 1E8XA 1EZVX 1M1SA 2HWZL 2LLNA 3HB3C 2P8MA 4XC3H 5L88L 1NCOA 1I8IB 2X2YA 1KZYA 5E1GA 1MJ7H 2Y5QA 1OE3A 3NIFF 3OR6A 3QDGB 5J9PB 4L2YA 4JFZH 2CGYA 3TBTA 3TN0A 1DR9A 1WGVA 2X4PB 3MLVL 3T2NL 3KYNB 5FOBB 3GNML 4HALA 3FU8A 2Y7NA 3Q3GB 4XPBL 1UUNA 3UGUA 1HH6A 3NFNB 4U1JA 2H3NB 2ED9A 1D3CA 3ZK0A 1ADWA 3ATBA 4KV5E 3C6LB 1A3LL 2VQ1A 3ESVF 5AFAA 5B38B 5IBTH 4ZD3H 2MOVA 1U3HB 1BF2A 3GNMH 4CVZB 4E41D 1A7NL 4Y7MA 1FGVH 2J3SA 1FV1A 2GJ6D 2NY1B 3MRPA 2P5WA 1KGUA 4J8RA 5I1CL 4G6KH 1VACB 5HGBB 4UAHA 2QVTA 2GEQA 5L4JA 2AK4E 3VFWB 4AEHL 2QQKH 4O00A 3LH2L 5EOCJ 3VD1A 3P4OA 3MMEB 5ELIA 5AB1A 4AK2A 4XPFL 2CALA 1EO8L 2GSGA 5IM7A 3BLBA 2OMBA 1C16A 1ICTA 2PMZA 4JJ5B 5MP6L 3LKPB 4OJFH 2X89A 1UA6H 5DSCB 4NUMA 2AK1H 4AH2A 1KJVB 4X7SH 2CDFB 3MREA 4IBUA 4Z7QE 2OCJA 4QTIL 1TEYA 2AV7B 1YJDL 3VXSA 1SBSH 1IBGL 2XKSA 2OMYB 4HXBH 4I4WB 1CBVH 2X4TB 3C2AL 2YAMA 4DP7X 1PKQA 4XZ4A 2GC7C 2WTRB 4E9VA 2E7DA 3O6FD 3ARGA 1A3RH 3WHXB 4HCIA 1NGYB 1VESA 4X9IA 4M7LT 1OZUA 3NN8A 5LN8A 3NRPA 4B9ZA 3ME0A 3TNMA 1CXHA 1NEZA 5EZLA 4YHKL 2V2TB 1MLCA 2IDUA 5JIIA 5IR1A 3PWPA 3VE0A 3WFCL 5IB5A 2E76C 3OKEA 5CZRA 5EIIG 3TZVB 4NAMA 4TVPL 4A6YB 5EBLA 3BIKA 3LKOB 3VD3A 3IXTB 3WS6C 1NDGB 5H37H 1B9KA 2WXLA 4FQJL 3O0RH 1U8OB 3MSPA 2X0VA 3UTQA 3O8XC 1I1AD 4URTB 4KRPC 1N5AA 2ZUQB 4WWID 5C08E 2IPUG 3FCTB 2YSSA 3QJOA 3CDGB 4X5LA 4H1LB 4Z6AT 2JE8A 3SY0B 4BFBD 1LMIA 4QHUB 5K9KA 1A3RL 2X40A 4LDOB 3LZFL 4X5PA 5EN2B 4AQ1B 3ZE0F 4Q56A 5JMOC 1D9KC 4UZGA 1KGYE 1QBMH 3R06B 2DMHA 1NUGA 3F7RA 2GJRA 2YRPA 1I1AA 3SO5A 1I31A 3D87B 2AC0A 2BNUB 2N3JA 3AACA 4HV8A 3S5LB 4NM8H 4RETB 4P2QB 1AKJA 5DJAA 3B7UX 1CG9A 4I88A 4ACPA 3QB7C 1I8AA 3VYOA 5G4MA 1DBMH 1XSKA 4RGNC 4Q97A 2JB5L 4FKHA 1ZDSA 2VABA 3ATAA 3CFJB 3KGSA 2DEYX 1R1CA 3QWOB 4G8FA 4I2XB 4LLMB 5DEFA 1FAKT 1LK3H 4YE4L 3AXIA 1FL6B 2XKNA 1E67A 3RTQB 1ZIAA 4OZFH 2ATPA 5DRXB 1F3RB 1V7NH 2HJKA 3TBWA 2D9CA 2V2TA 4C56B 1T66C 2J1ZA 3JWDH 4WENB 4UTAL 4HH9A 2NDFA 4WEBL 5E56A 3VI3E 3WEXB 5IW1A 1NSNH 2FEDD 5AW0B 2ZG2A 1OQOA 3QORC 4QGYA 4P3DA 4P23C 5CD3A 3ZDXF 3TJPA 1ORSB 5E24E 2GTZB 5DHYA 5I6XC 2OMTB 5KBPA 1JPTH 4JDTH 3PS6A 4I48A 3DVFA 4NI3A 3Q8BA 3VWJD 3UTTE 1AQDA 2DY2A 2IAMA 5HDRA 4MAYD 1VACA 3G6JF 5HBBA 2NY2B 2WNXA 1YEEL 1XAKA 1J5HA 1ZVSB 2PO6C 2EINB 1FI8C 3NIFB 2JELH 4YHZH 4N2HA 1BQSA 32C2A 3ZQ9A 3VG0L 1AY1H 5F7UA 3ARGC 5CBEA 1YYMH 2SEBA 3TS8A 2VZTA 3QUMA 3D50A 3S3DB 2GJ6E 5ABDE 5I76B 4JZNA 3AGWA 4TULH 5DC2A 1I1AB 3FNKA 4QHLB 4P5KA 4R97C 1I9JL 1Q4NX 4NUGL 4KAQL 3DECA 3L16A 1W6LA 1KGIA 3J2PA 4NM4L 2BK8A 3AGVA 4NN6C 1ES0B 2CRMA 2CXGA 3FULA 4BFIB 1BVOA 4PRIB 2XIIA 3E6FB 3HFFA 3NACH 5ID1B 1VA9A 2W60B 1JHTA 4ZODA 5DHDA 2P5EA 4LKCB 3VO0A 1IKNC 3RPKA 4GUPB 4KX7A 1CLCA 4C4BA 4TF4A 1GIGH 1NEPA 3O3EB 4PLJD 4KK8D 3GYRA 2DQGL 3B83A 3QDMD 3T65B 4XI5D 1NOLA 1AXSB 4QRTA 1WZAA 1CBJA 4KJYB 3W37A 4HKBB 4PJXA 5FM5O 5IZ7A 2EP6A 4Z0XB 5BJTA 3GSNH 1REIA 4XNQB 3KPQB 1MQKL 1LO2L 1JPSH 2Y1AA 3TF7C 2EUXA 2IADA 3UTSD 1CD0A 5HYSB 4KJPC 1N64L 4LVEA 5EBMB 1EAQA 4MNGB 4WHYH 2W0KA 2AVFA 4B95C 1HEZB 4W93A 5HI5C 4PJHA 1WIUA 3KYKL 2W38A 4ZTEA 5I6MA 3S37L 2CHDA 3MLZH 1VFBB 2G3ZA 2G5UA 3A67H 5GGVY 4BKTC 5I15L 4JY4B 1O7DE 4PJIA 1S7UB 3VWKA 4BXSV 1YY9C 3LKQA 3P3RA 4Z7QB 1HEJC 3FCBA 3H6AA 5H94A 4P57A 4BK5C 1E9PA 2X2HA 1TNNA 1YN6B 3L4WA 2NDGA 3B9EA 3BEVB 3O6LL 3OB0H 1XV8A 4PRHA 3Q8FA 2J8UF 3I74A 1NIBA 1W2KT 2H0FA 5C0AB 2X4PA 1FVEB 3U4BL 2QQNL 1ZTXE 1WA0X 2Y4SA 2P4AB 3G5YA 4R4NC 1P5VA 3VGDA 1ZGLA 1PJWA 5T3XL 1Z5LB 1WBXA 2BNRE 3UH8A 1USZA 4W6YB 1FZJB 5C9JB 1AGBA 4FFZA 3EJYD 1SEQL 4FERA 1WHPA 3BW9A 4X99A 4F58H 1E3FA 1EZVY 4K3JH 4IKNA 5CP7B 4CJ0A 4PJ5E 4WSGA 1T0MA 5JPNC 1Z0NA 5E1HB 4XOBA 4AIZA 1HHKB 4NZRH 3EOAB 2VLRB 5D5ME 3WI9A 1FFNA 4FZEL 3ZRSA 3ECWA 3PGFL 3OGCA 3OKMA 2HJKB 1XMWA 4FNLL 5CFAA 1H6TA 1OM3H 2OBGA 1XF3A 4JMXA 4KKBD 2FJSA 4DN4L 1GSKA 3AUVA 4PGBA 4GQQA 2R7EA 5EF2A 3KPQA 1NGPL 3QPKA 5IMLA 3U4BH 4N9GA 5A6IA 1ACZA 1ADQH 4P23D 2NXZC 1YEDB 4QDGA 5E4OA 4ALAH 2CO1A 4JFDA 3DSNB 2AEQH 4G6AC 4OZGF 2H6PA 4CU7A 1HHHA 1NANI 3MRJA 4FFYA 4WI5A 1AGFA 4U6XA 5E00A 3V0GA 4MSWA 5MEOA 1KN2L 4RWYL 4BRJA 2E27L 2P47B 2QLYA 3RWIB 3TEWA 4POZD 1OTSC 2FB4H 7PCYA 1IGFL 4EPSA 3VXME 3MUHL 4YVNA 4BZ2H 1Z32X 2EIZA 4WFGE 2NCMA 5INCA 1JPGA 3K2MC 5HGDA 2OYPA 1A66A 2A1WH 2E59A 3FU7B 3KYKH 3QUYB 4W9EC 1FNSH 3KXFD 5FYJE 3DOIA 4WHDA 2K6YA 5EU6A 3N1PC 2NQ3A 4B60A 4JFSA 4MDRA 4XNDA 3VFMB 2VE6B 3GD1C 2CHWA 3SKJL 5C0DB 2NPLX 4HIIB 3PWJB 3V0DA 4F7KA 4KJWD 4RFEA 5AVWB 3FL7A 1M05A 2WQSA 1V3KA 3O3BB 4KAQH 1FG2B 1NM4A 2W81C 2Y06L 2BHFA 1MCFA 5FUOH 2RALA 4JRLA 4LL9A 2BP0A 4M7KL 3PP4H 2WIIB 4X7EC 3T0XA 3WFHB 4JFQA 4F8PA 2FQDA 3MRMB 1MOEA 3QUXA 4XNZB 1M57B 5SWSD 4K2UH 2VZOA 3BVXA 4HD5A 2GK0A 5FW6A 2Z31B 3H3BC 1FA4A 1U8NA 3DX2A 4NWTH 1S5IL 5A3ID 1KPUA 4H1LG 1XF3B 1K2DB 3BHBB 4GP5B 3W56A 5I1GH 3MA9L 5TQ0L 2OMWB 5DRWA 2GBAA 5FC9A 3VXQA 1HN1A 3APNA 3O8XD 1T4KA 4PCKA 3HN5A 5C0CE 1HINL 4XPHL 4HZ1A 1T2QH 5EC1B 3HS9A 2WBWB 3GZPA 4JL1A 4TSCL 4UTBH 1SJHB 2CAKA 1BZ9B 3W11D 4KUCD 4R7LA 3V4VL 3SOBH 4Z5RB 3GSOA 3QUYC 4KXZH 4RGNE 4QAMB 2B5IC 5I1IL 4LLQA 4TTDC 4OD1H 1ASOA 5GGUB 3TYGL 3TFBA 3JWDC 2WMPB 4FI6A 3F65A 3G04B 2EE0A 3S37H 2BS8A 3S5LG 3CLWA 1CGVA 1MJ8H 3OC5A 4MMYA 2ENPA 1SUHA 4LCYB 4O58L 5FR3A 5L0QB 3N85H 2W8CA 4W9IC 1IBBA 2M1KA 3ABLB 2NZ9C 4WU7B 4KHXL 1DBML 3BWAA 4Y2OA 5F7WC 4P46C 5C71A 5ITFA 3AB0B 4YSRA 4AJ0A 1ZAGA 3LKSA 4XNZC 3TBSA 1FVDA 3QSKB 1J11A 4M61A 1AXTH 2AJUH 1L9TA 2UUDH 3QCTH 3NCXA 1OAZL 1D9KA 3PQYA 3L4CA 4HUMB 3I02A 4YNYA 1JZ2A 1OK8A 1BAFH 2Y7SA 1W0WA 4LVHB 4D0CB 3ARFA 4FQQB 1DQJA 1PL3A 3LNIA 4HWBA 3WKPA 2MKWA 2Z9TA 1VIWA 1C9SA 1W72B 2YXWA 1HOEA 2E9BA 4WUUE 3SKNA 4Z3HA 4UM9A 3ZE0B 1VJSA 4M03A 1KXQA 4HHGA 4NCDA 4ZUUB 5HI3D 4EAEA 3OJDB 3BAJA 4JFFA 3EHBC 4PP2A 4M6OL 1OL0A 3RILA 3VRIB 5C3IA 3V5HB 3KPSA 3AQDA 3AWGA 4XO4A 1CCZA 2JELL 4YHZL 3BUYB 4HUXB 1UACH 3AROA 1I75A 2P8PA 1T6WA 3MNWA 4JN2A 5E1QA 3RDTC 4HHWA 3MJ8A 3RTLA 3EFFA 3VM7A 4F2FA 2FECI 3WNMA 4FFWD 5SWZB 5EZIL 1V7MH 3UG5A 2ADIA 3LXUX 1TZAA 4MZ2A 5CJ8A 5C6PB 2W65A 1BZEA 1PZ5B 4JO5A 3LS5H 1AGEB 1XWVA 1HHIB 5HI4D 4HF5L 2Y5TA 4G70B 3QRBA 2A6JB 3WJMA 2XQYA 3ULVE 4KK9C 5HVHC 3BDBA 2BIOA 5TF0A 4NB7A 4WLCA 3G5ZA 2VLKA 2WQVA 1UB5A 3QO0B 1YEFH 2CHZA 2IADB 4Q4EA 4J3XA 2ZJSL 1A7BA 4P5RA 2VDNH 3GXNA 1I8IA 4R7XA 2PUQT 3C6EA 4NBZB 2BSED 4WI0A 3EJSA 3IDNA 1MELA 4WIQA 1CQYA 3V0HA 5T5NG 2W9DL 4U49A 1PEZA 1W9XA 3RIAK 2O5NA 2VC2B 2OL3L 4KMTH 1INEH 4TQ8A 2CSPA 1NAML 3FB5B 4PY8J 3MV8D 3TYFA 3VVWA 1RK1B 1RD6A 3C9NB 4MCZB 3B2XA 4MQXC 4N3UA 2P26A 4AYFA 3ETTA 1DN0A 1K2DA 1EJOL 5IHZB 2MFNA 1CTOA 1KDJA 4Z7UA 1BXVA 5JHDA 1OPGL 1H3PL 1MLBA 1KIQA 4ZUUA 5I2IB 1ZLDA 4D7PA 5IJDC 4K8RD 1MIML 4A7UA 4ZO7A 5L7XH 4X6DE 3UJJL 1U3YA 4OZHA 4WW2B 4LNRB 5BQDA 1CI3M 1T80A 4MKMA 1NCHA 1H3PH 1JN6B 3JQOB 1CURA 4WY7L 2WLMA 2X4TA 3OM3B 5E2TL 2BMKB 3HZVB 2YD6A 3GKWL 2IH1A 5GJSL 2Y7QA 4DERA 2CRIA 3IDIB 5AVTB 5HDBB 2V3EA 4P5TD 4F27A 1OKEA 2BM3A 1DQDL 2FWOA 3IDXH 3DX6A 3P11L 3ZGPA 1GMEA 5IG7B 4CKVX 3KPRD 4PS4L 2J1XA 4RAVB 4TVPD 2DD8H 3UEQA 4PRAA 4Y2OB 5JIDA 4AIOA 5F1IA 3QHFL 4O51B 3ULUL 1C5DB 1KCRL 2X6BA 3KWTA 4ECNA 5IMLB 1WISA 3NN8B 4N2AA 5J3HC 3VB8A 1GC1H 3DYMA 4OB5L 5D7LA 4JM2D 4MJIB 4JRXB 3C8KA 4OIAA 4Z9KB 3VE0B 3DMMD 3CVHL 1NDMB 1GZPA 2R0KH 4MSWB 4ZPVB 3ZSSA 5MEOB 4LIQL 5IVNA 2B4CC 5LXVA 2FIRT 1IAMA 2CNZA 1J5DA 3BIBX 2JNZA 1W72A 2YC1A 3SSGA 4V11A 1ANUA 3FB5A 5KVDL 3ULVD 4DEPB 1QO3B 1A9VA 4PJ6A 3T0EE 3W38A 4Y19A 1UJ3B 5INDA 3A0OA 1DN0B 2P80A 3GLDA 3IETA 1F56A 1NUNB 4OT1H 4OSUH 5IHZA 5LAXA 1GMIA 3FUKA 3GO1L 4JFEB 3ISWA 2H4EA 5D5MF 4AH2B 3HBZA 4QHKJ 1IM9A 2HT3C 2AQPA 1Z3GL 4KZEL 1RIHL 3VXUB 3T0EB 2F08A 4KROC 4ABVA 5BXFB 1DDHA 3AWFA 1UWXK 4L8SC 3B9KC 3GXDA 4XPGL 2VW7A 3WLWD 2QSCH 4JBSA 4OFQA 2FCBA 2L4OA 3GB7B 4N9OB 1CU4H 3HLAB 4N2DA 3BI9X 1OW0C 4NENA 5B39G 1P4UA 4PJ8B 4NUPA 2VWEE 3UJTH 2AQTA 3ZL4H 2P80D 4JPQA 4BFGA 3IDIA 3N0PB 3OB0K 5ERWB 1PZ5A 1FG9C 5PAZA 1NGQL 4L4TD 2AERT 1T2JA 2I07A 3V6OA 4R84A 3UJJH 4FQXA 4J3VA 2CDEA 5HY9A 4UI2A 2DQCH 2CO2A 1UA7A 3GIZL 4ZTPH 1J5OL 1D5BA 2QSTA 4HH9B 1BM3L 3PREA 5LNGA 4HAFA 4X6CB 5IGXL 1YY8A 2NYYC 2A6KB 1RH8A 4ODSL 4ZSOE 1T4KB 2ICES 4ICXA 1CE6B 1BX2A 1YCSA 4GIOA 2BIMA 1KN4H 3VU1A 4LLQB 3GI9H 3CFTA 3BN9D 3GBMH 4D94A 1D7FA 1A7OH 2HTLC 4KPHH 1MFBL 2AK4D 4XX1E 5LLIC 4FD0A 4NQEB 3MYJB 4IOFD 1NKOA 5D1QD 5FDWB 5FGBA 1ONQA 2P52A 4YVUA 3F7LA 4YSDA 4RFNB 3DETD 3ZUNC 1YQVH 4XGZA 4Z0BH 3CFDA 4TQPA 2XN2A 4X5WA 4IHOB 4JVWA 3TEUA 2NSQA 4H88H 3S5LA 2R0KL 3S3CB 3AG2B 4LLUB 4JQXA 1HHJA 2VDLB 1QFWL 4R4BA 4X8CA 3RX9A 1JG9A 4D0BA 3Q48A 2BY3A 2HT2D 4XMTA 2WWMC 1D5RA 4IGBA 5F0MB 3GSQB 5AZEH 1QFUL 1RUPH 3TJEL 3ZU8A 3BWSA 5JYMA 3FTYA 2BINA 1BYOA 3ARBA 3QUMB 1Q0YL 3V52H 4GUQA 1X5HA 3HNVL 1Y7MA 4WV1A 5IJVA 3DK2A 1NMBH 3KPNA 5ALCH 1HIML 5F8RC 3VD5A 4ANXA 1CGWA 1L9QA 2ADYA 1UT9A 1FLRH 2ZXEB 4NHUB 3WDIA 1QWNA 3MV9A 4ZAKD 1QSEA 4JFVA 1L9MA 4YDKH 3LNDA 4KO7A 4QXTA 3ZLQC 3M17A 4LDCA 3K6DA 3GRBA 5DD5H 3TURA 1Z6JT 4FFYH 5D7LE 2K4WA 2OJEA 1D7BA 1E42A 4JFFB 4PP2B 3CN3A 2BY0A 1KB5B 2DQHL 3T77A 2DN7A 4X0NA 3NOIA 1XL6A 4RGOL 2YKKA 4Z78A 4A66A 1BXAA 5IWLA 4Z7VB 1PX3A 3DYPA 4WI3A 2WZ5A 3GMNA 3WNOA 2DJSA 2VUYA 3DKHA 2A83A 1MFUA 5ESQB 5IQ7H 4R26H 1UD6A 3PHOB 4QRQB 5CCKH 4YHYC 5J8OA 4GQ9H 4Y4FC 2MMXA 3QS2A 4X98A 4MB4A 2CJ3A 4Q8BA 3G6JA 4X6EB 5HYEA 1KIUA 4WHCA 2MCG1 3UACA 3CFDB 4AZ8B 5EEXA 5BS0D 2C3GA 2Z8VC 4RX4D 4E5XB 4Y88A 2VN4A 1WRFA 4XN7A 5KYUA 2CR6A 2J5LC 4Y4KD 5FYKD 1T03H 4A2FA 4IMKC 4WO4C 3VFGH 4HEME 2FIKA 4QUOA 1Z5LA 4RSVA 4DPBX 4PN6A 2P5EE 3FOMB 2ESVA 2Y22A 3DDGA 4OFYA 1D6EA 4F9LA 3LAFA 1NMCC 3QNYA 4OGAD 1UM6L 5EO0A 3L9RA 2F5AL 5E03A 1A6UH 1JOIA 1JCKA 5HHVH 1AQHA 4Z76A 2C3VB 1J0ZA 2A4ZA 2PTTB 5K1JA 2EKSB 1Z9MA 3ZOAA 3SE4A 5I16A 1MEXL 2DQTL 5KJ4A 2Y07H 1KC5L 1X7TA 3CSPA 4L4VE 5FX3A 2G9KA 3SDDC 5A16A 5C92A 5KBKA 3VQMA 1MKFA 4U6VL 3TA3C 1N6UA 1OSPH 1RJZA 4R8WH 3UG3A 5GIRA 4GI8A 4M43H 5HYSA 5CO1A 3QEHA 2EDFA 5CZVL 3V0VB 5I24A 5I71B 3QAZB 3F2LA 2UX6A 3GXMA 1AOHA 4JCLA 1U3HD 4CADA 2XWCA 5A2LH 2NX5B 4YEFA 4I0PD 1FZOB 4XNBA 1GIGL 3UTOA 2NY2D 5LKNA 1W6WA 2H32H 2HJFB 2XN9D 3IRPX 2J7LA 4KO6A 4MAUH 1AR1C 2R39A 1SHXA 1MJUH 4ZTOH 3MA7B 2IF7A 2GJ6B 2NY1D 3LSOA 4LB8A 5ENWB 2RCSL 3UZQA 1B0GB 2MPAH 3MRIA 2HRPH 4AEIL 4FZEH 4QLRA 2F5AH 1LXMA 3QJVB 2O5YH 4FNSA 3MRFB 3PL6C 4HHAB 2FLMA 4NEHB 4WGVB 5KYXB 4QRQA 2AI0H 4PV9A 3EAKA 2X4UA 3LHAA 4Y4KA 5EORH 3QUYA 3N44B 5IQLA 2DQEL 3MDJA 3CH1A 1HHJB 3NJNA 3DIFB 3PABA 4WI6A 2H2SD 4U1LA 2EDXA 2WZPA 4R3SA 1WA2X 1S5HA 4QKTA 5J11B 2WN3A 2CJUH 5HHPA 3QQ9D 1OK0A 4OU3A 5EF3A 4EI6A 3HFML 5DUJA 1GS7A 3L1FA 4RFEB 2DI7A 4M62H 3P0GB 3QBTB 1DE4B 4JKWA 3VM5A 3C09C 3ISYA 3MRLB 5IHUL 3SGDI 1G9MC 4F3FA 5FAAA 2DQJH 3BFWA 5J13C 3ALPA 3GMQA 3L1OL 3IDJB 1IAIL 5E95B 4HJIA 3QNXB 5TFSL 3D39E 1EFXD 2DDQL 3I84A 4C56E 1F6AB 1IGIL 4Z76B 2QLVB 4Q6YA 4HFWA 2XBZA 2C5DC 2VRQA 2Y7OA 1OB1A 1XZWA 3TV3L 5C08A 4KTDL 2Q6WA 4WEMB 2E9JA 3LRKA 4Y1AA 3WIIL 4NZ8A 2FT6A 1A25A 1T4WA 2WLLB 1E28A 3DHPA 1J05B 3QJFA 4BK4A 3EBGA 3W9EB 1UOKA 1I7TB 3C60C 3I85A 5AZ2H 3DSNA 3RWEA 5L4FA 3PWUA 4FQIH 1HOCB 4D9LH 5BRZB 1ZANH 3GSRB 1C08A 1IC5H 2BNRD 2QMJA 3QFDA 1RCYA 5IROC 4PY7B 4CAGA 4N0YL 4E42A 1XAUA 4F7EB 3ZHNA 4YX2H 5K5YA 1Y6KR 2MRYA 5JTWA 5MHSE 4NENB 2YOAA 1I8MB 4EZKA 1VKXB 3BEWA 1WWCA 3NJJA 1AYRA 1PZCA 3P77B 3BKCH 1BFOB 5EOQL 5CD5D 2Y1VA 2P8MB 5FYJU 5EBGA 5EPMA 2K9UA 2XPYA 2XU9A 2F8VA 1CL7L 3AT0A 5FO8B 2JTYA 5DZLA 3K2IA 1XCQB 1C5BH 4X4MA 1BMZA 4MVBD 4JGJA 1HC1A 1MFEH 1VZGA 1QYGL 3HEIB 4ABWA 3G7TA 1XF2A 4R2GC 1RULH 4J8QA 1L9PA 1CYWA 2WUBL 1KGWA 4RMVA 4S0SD 3S36X 2A73B 5B3JF 1G9NL 4ES8A 4LSVL 3HLKA 4EJ1C 3ZKSD 2IBBA 1BIIB 1SY6L 4Q9RH 4IBZA 3NABH 4LARH 3UMNA 2OR9L 5KSBB 4I87A 1XH0A 4JNXA 3D3VE 3EZ8A 1CT8A 2BSBA 1JYWA 1GYCA 5D5MA 1LP9A 2FRGP 3BGFB 3WKML 1K8IA 3ZR6A 1DJZA 3UMTA 4WO4B 3OMNB 2HKLA 4UOZA 1OLLA 5I1DA 3EYQC 4J2QA 5JR1L 3M8OL 4U1JB 1LD9B 3VD2A 3PGDB 3DX9A 3HKFA 5HVFB 1J18A 3GXFA 4AGQA 1M7UA 4X4ZA 1BFSA 1ZLUK 4QCIB 1CL7H 2H5UA 1S7QA 1H9DA 4B7LA 1G0DA 3HE6D 1N8ZA 3MGOB 1N5AB 1SJEB 3CG8A 4LOEA 3F84A 1RULL 2Q10A 2XN9E 4NC0B 4XNXH 5EU4B 5SX5H 2EO9A 3QEQD 3FUMA 3GSNL 3ILQD 2WWNA 4MD0A 4HIHA 1FLTX 4PWIA 2F7RA 4IGBB 3ARXA 3EYFA 5IB1A 3SDDA 4LLWA 2KERA 3BCFA 5HDWA 3GPEA 4F7CA 2UZIH 1U8LB 3RWJA 1VGKB 4HUXA 4UQ3A 3SGJA 3QNZA 2BRQA 1MHEA 4LFHG 4J2XA 1SYSB 1UWEL 3WIIH 1BWMA 4JDVA 3L4TA 1T6BX 3DV4A 4YSQA 3ARDA 1BFOA 2CLRB 1QEWB 1R5IA 2GFBA 4G6MH 4D9LL 3QWRA 4MZIA 2UY6B 2J4WH 3D5OF 2X88A 3P9WB 2A74A 4XB8A 4LPXA 5BRZD 4G1EB 2M8XA 1AR1B 2F15A 1MCOH 3QR0A 4JHUA 4XVJL 2BOCB 4YXKH 4YSOA 1OOAA 1SXZA 1NGZB 3E6HA 1ZGLM 4NKOB 2XHNA 3T8MA 2ADIB 1Y6NR 4KOBA 4UQEA 5E08L 5I71C 1WF5A 2NY3C 3MRCA 4LU5H 1YA5A 3P3SA 1HWWA 2KBGA 5KVDH 3V8OA 5F7HA 2X0UA 1MCNA 5T1KA 3FYEB 1I4FA 5GRUL 5F9DC 4H44C 3L7FB 1M2VB 1CFTB 4LRNH 4HFUH 2IGFH 2UXGA 1QUPA 3AUWB 1EWHA 2PW1A 3O9WB 1HL8A 3N1QC 1HKLL 4PIBA 1TVBB 5EOCH 4DK5A 5HD8D 1SBSL 4CSPA 4QRUA 3ZDZF 3KCPB 2F1EA 3FUJA 4XCNA 5D2LA 3H1ZA 3KHQA 3GEFA 4QF1A 1PG7X 2E86A 2HXAA 4R7NA 5AKSA 3E8UL 1FNAA 4U4BA 3LDBB 1E6OH 1FC2D 3UTSB 3OAYK 1F58H 3DVNA 4NERA 3QIBD 1DBAL 5JA8B 3U7WH 5AZUA 5BNXD 2B1AL 4NQEE 4HIEA 2Q3ZA 4XP1H 4LSQL 5DMKA 4ZS6D 3WFCH 4L9LC 4WW2A 4FA6A 1RZJC 4E42B 3OAWA 3MRDA 5DLMH 1H0DA 2QFPA 4ZDHB 3IJEB 1SOXA 4PI0A 3X3FH 5G4NA 4HEMA 3L9RB 5I2IA 1IIIA 4Z95H 3T0EC 1NPNA 1LEKB 2GI7A 2XKNB 3T4YA 2JI3A 2ZUWA 5FGCB 3VNYA 4UBDC 4ELKA 1ZVNA 4J4PC 3MRRA 3QUXC 1XF2B 2YLHA 25C8H 3RVXC 3C5JA 1A2YB 5FHAH 5DFVC 2RHEA 4KKRA 5K9QG 1UM6H 3ESUF 4NKOA 2VZSA 1MAML 2CD0A 1HL4A 3HZKA 1IC4L 3GT6A 2AJSH 3V7AE 1X44A 2PKDA 4L3FA 1EA9C 2C26A 5DHMC 5KEZA 2EDOA 3L1GA 4O02H 1U95B 1M2VA 5GHWH 3MV7D 1D5ZB 1JNLH 1O75A 1GL4B 4ZXBA 1KLGB 3DK0A 4Y9BA 1CICC 1VFMA 4FF9A 2D7TL 4I18C 3DTXA 2VJ0A 2K8QA 2BS71 3C6LC 4XP4L 2VDNL 4MX7B 4YE0A 3EO9H 1NFDE 5K9JH 5DHXB 2W9EH 1AS7A 4ADGA 3CFKA 5IMKA 2OTUA 2VDKB 3HIZA 3V52L 3BZEB 2NZIA 2IAMB 2YS4A 4PJ9B 1C8QA 5D7IB 5F7AA 1DQQB 4OLYL 2R2BB 3AS3A 4B5ZA 5FGBC 5CMAB 1RUPL 4IRSD 1YC7A 3MGAA 12E8L 4FHJA 4P99A 1E9QA 2IWKA 4S1SH 4UB0L 1IFHH 4KFMA 4U3SA 2ZWSA 4RISL 2WCPA 3QO1B 5AOLA 3GDBA 1GY1A 3BYYA 2IBZX 3CMOH 3F01A 4Y16A 3HRZA 2YPKA 1H15A 1R9FA 2A7BA 1S7VA 1HSBB 1MFNA 4DO4A 3FQYA 3NCBB 1XGTA 2FH6A 4G8IA 1OP5K 3G5YB 3TPUB 5GSRA 3U25A 1N4XH 3DVIA 4XO3A 5DRXA 2KL6A 2PCXA 2J2ZA 5L2JB 1WQVT 2J71A 3LHPL 4RIRB 1YEHL 3WU1A 3EOBA 2P5EB 4LKCA 4UNVA 3WEXA 4HU8A 2YA0A 3BOVA 1EXGA 3NAAL 2WQUA 2KLRA 3BYTA 3CQFA 2JVUA 1FCGA 3UL4A 1SPDA 3LMJH 4EUPG 5KYWB 2ZX6A 2HPTA 3NJFA 3LIUA 4XPBH 3HMXA 3BP6B 5AENA 1CU4L 1UFGA 4OZGA 3SKOA 1LK2A 1WGOA 2VITA 5CEXA 2VXVH 3PWPD 3EJJX 4GXFA 1KPRA 4GJTB 1P5UC 2B3RA 4FEMA 2IG2L 4G72B 4OJCA 3SYPA 5ITBL 4F5CA 1VKXA 5IV2A 3SE4C 2L7QA 1T5KA 2J8UE 4N9GB 3VTTA 3WTXA 2ZONA 2PWDA 3ZQXA 3ERXA 2AJXH 4LHUA 4HIPA 3AU0A 5D7KE 4QOKE 3RHWK 4MB3A 1JZDC 4HKZA 4NKDA 3ELQA 4FNQA 5LCVL 2B08A 2D3VA 4LFHD 3UEZA 2P5PA 3H55A 3VI4F 1WC7A 3FUFA 1DBKL 1UTDA 1CLOL 5AUMB 2EH7L 2JQMA 3GSXA 3QJSB 5B4MD 2AABH 4JO4H 1CXKA 3M1CA 5JUEH 1KYOK 1P7KA 3NSJA 3WFDL 4OJDH 3WL9A 1ACYH 4P04A 2DYRB 4I77H 1NCCL 1SNRA 3IJYA 3H42L 5GZND 3VFSA 3ASOB 1FFQA 1MDTA 4I3SH 4KY1L 3D3VB 4LEOB 1S7SA 1CJYA 4QRPD 3CQPA 5EMYA 3S8FB 1TKWA 4ZSOB 2VISB 5DZNA 4IBTA 3S88H 1M7IA 4M1CD 4HJUA 4FI7A 3WUWB 5CR1A 3M17B 4QYOA 3MLTB 5AVUB 4J3TA 5T1JA 5FGSA 1FGNH 2OMVB 4U6HB 4NLHA 5LAPA 5T1LD 4HIHB 1TQWA 1FFOB 3MV9B 3E0GA 4OI9A 1JXDA 3N9GH 1IB5A 2JI2A 3N06B 4ODUA 2D7NA 4JFOB 1R3HA 4PY8I 1FIEA 4G5ZH 1AANA 3IE9A 5AYQA 2PR4H 2PXYC 3FUEA 3ZE2B 1A1OB 2YPLA 4UAOB 1ZV5A 1LEGB 5C0RL 3J7HA 5IBUG 4XHQA 2UV3A 2DJUA 4PJXF 3WD5L 4UQ2A 5FA3A 3B43A 1WFTA 3HG1B 4I3RH 5CWSA 5AOIA 2F74B 3ATEA 4XNAA 2VW4A 3UDWA 1TTRA 4XPTL 3G6JE 1MZZA 4Y2DC 3VXNB 2W5PA 5DEGA 2VSKB 3D0VA 3FPYA 3MTXA 4I3GA 3RVVD 4X7CC 4LCCB 1QP1A 1YEIL 2FD6L 3GTVA 3E1F1 4PIRF 2O4EA 3WKQA 4RWHA 4JFTA 4PJAF 4DN4H 1PIGA 4FFZH 5T1KB 3VYNA 4OLYH 2AW2A 1P7KB 4MRBA 4Z7OE 1YNTF 3NQIA 3CSGA 1A9BA 1ZLVH 1QSEE 5A6MA 1OGAB 4PP1D 4ZMAT 2X4QB 2VQTA 3WJLC 1JZFA 1H6EA 2AEWA 5L2JA 2HLAA 1DJWA 4PJIF 5E08H 1NCTA 4HPOL 5D1XD 4AE0A 3D4ZA 4Z7VE 1ZVHA 2QQLH 4U0RC 4WI7A 2OJEB 1EFQA 2VDRB 2HLFD 1D6VL 2IGFL 3D33A 4YDZA 1SXNA 2EKSA 4KKAC 1LGVA 1DEDA 4YLQT 5DJ0A 2HMIC 2V5YA 2FX9L 4NQDB 3QJTB 1GC1L 1MCDA 2WXIA 1U6AH 4AQAB 4MCYA 3LOWA 4W81A 3FCGA 3QGVA 5F71A 5GIRB 4H8WL 2AK1L 4YSPA 4ZXBD 1LEIA 4U7SA 3GI8L 2BLFA 2EUZA 4XCFH 1O6TA 1UXMA 1G6RB 2XICA 3EG9A 1JNNH 1NC4B 3L13A 4LT7A 4WI2A 2ZF9A 1BQRA 5K9QI 1PMYA 3KH4A 5DEZA 5FUOL 2O5ZL 3BP5A 4W9KC 3KGUA 2V2XB 2ZX8A 4LNVA 2WP3O 5TFSH 3D25A 2X89D 3QFJA 4DCQA 4WV1C 1F2XK 2CU9A 3ESOA 1Q0XL 3TT3L 2UVEA 1TVDA 2WLNA 1FO0H 2NR6C 4PI2A 4MLSA 4Z8FL 5CJOH 1NCIA 3O3AB 2XVBA 3EDEA 1HQRA 1SY6A 1BQLH 3FQRB 4AL8L 1HHGB 2XZQL 3JWNE 2L7JA 1FORH 4L3EB 4JFDD 3VXTB 3WEOA 5L2KA 1UC6A 2FTAA 3O6FA 2CLVA 4UQ9A 1NKRA 1UOWA 2DH2A 2AXWA 3DUSB 3FMGL 2G0LA 1WFIA 3LYRA 3NIGE 4NQSA 4A7GF 1IL1A 2VWEC 2FH8A 3UP1A 4W68A 4EQ3A 1XBRA 5CGYC 1DJYA 4HWUA 5B38A 3U83A 4DQOL 4YS4A 1AO7A 4IBYA 1ZDQA 2I9TB 2X1WL 4UOQA 2PP8A 4FFTA 1LE9B 1KTCA 4BE6A 1E5UI 3GMMA 2C7FA 1D5MA 4UV7H 4KMTL 4XN2A 4K8RL 1MFCL 1K5NB 2NX5A 3X12B 3DOSA 1EGJA 2FHCA 3EH1A 1S9VB 3FOLB 3FCSB 1XCTB 3RVUC 3PDGA 4GW4B 5CU5A 5D7SH 3ABZA 4HW6A 4X80L 2E56A 1ZRUA 3MNWB 3IGUA 1I8KB 2ZAGA 1P4LA 1A1OA 2C9AA 5PCYA 3WS3A 3QIWA 1YAZA 3FQXB 5CSBA 1HSBA 2H9GB 1I7TA 2RJMA 3C08L 2Z8WC 3L9YA 1OAUH 4KXZI 5F7EH 3WTWA 2Q2LA 4OCNC 3DUUB 1MFAL 1TZIA 3F05A 1ZT7A 4PRHE 4TLTA 5FYLD 1VGEH 5K59E 5IB5B 3CZLA 3BP5B 4GEJA 3ELAT 2R0ZH 4K73A 3DIVA 4NN6B 3VXNA 4DEUA 4MDIB 4PRIE 5KSVB 5C0EA 5I15H 4AV4A 2K6WA 1NDGA 3L4YA 1KWKA 3DROB 2Y7MA 1KCSL 2PCFB 1BDYA 2AJUL 3IRZA 3MRBB 2JCCB 3MRNB 4YHIA 5DURB 4N0YH 3KPOB 4DOHE 3D2TA 1P9MC 2AF2A 2P43B 1LK2B 4BJLA 4C56A 3VSUA 5GGQL 4XWOC 3APMA 3VXMD 3SQBB 4BUGA 4A2MA 3BC9A 4G7QB 4ZJ9A 4B27A 3PY9A 1KGCE 4DETA 3IDMA 5CJBA 4PRDB 1H6UA 2YSSB 4PWJA 3VG9B 1M4KA 3U1SL 2VW6A 3ZTJH 1KBPA 1IGIH 3SYQA 3U2SB 3IT8D 1A4JB 3MX0B 3FJTA 3FQNA 3NT0A 2I26N 4AE1A 2Q2EB 1ZIBA 4BCZA 3R1GL 1MHHA 3GSWB 3L17A 1OALA 1NFDB 3JSSA 5LBSL 2EYRB 4LSSL 4AYFB 3MUGA 4XH2A 5DYFA 2O61B 1OAJA 1B0WA 4AQEA 5K1VA 2DQ6A 1NFDF 4JB9H 4JZOA 1UGKA 4PJBB 4YUEL 1P4LB 1BZDA 3O11B 3SQOL 5A40E 1CMOA 4ZFQA 1QNIA 3UAFA 3OLGA 1N6QH 3KYMB 5I30L 4MYPA 2ADFH 3LRLA 1NAKL 5EOQH 3OLIA 3BGAA 2F58L 1XGPA 3RDTA 4PD4J 1C8PA 3P4NA 2Y7QB 3ZTJG 3HZMA 4UZSA 1IILE 3F5WA 4UUJA 2JK5A 2XVKA 4BIKA 1EDQA 2VNCA 3MVSA 4CC1A 1HI6A 5CJQL 3JVGA 4HSQA 5D5MB 2YUXA 2MOQA 1YJDC 4NIKB 2KS0A 2Y69B 3EADA 1TTBA 3HJ0A 2OXGA 2Q8BH 3LZFH 1EO7A 2IPUK 2DBLH 3HNTL 4MMZA 3K2UL 2HFFB 3BH9B 2ZCHH 4HKJB 3QZBA 4MBOA 4YUEH 5SX4H 3SD5A 4MRCA 1J1PH 2PW1B 1G9HA 2WLKA 3DI2B 4ZAKB 3SDAC 1LO0L 4L4VB 1S9XB 5KG9B 2HH0H 3WNIA 5MEQB 5AL8A 4WVRA 4NQDE 3LPPA 2CCWA 1Y6MR 3W0WA 4APXA 3NABL 4XR8C 4FABH 1IEBA 2NT1A 3AXHA 2RGSA 1BVNP 4MMXC 2FUQA 3U2SA 5LAXB 4LOVA 3RY6A 2LW3A 2FATH 1TQBB 3QIUC 3ZHKA 4G9FD 3G5VB 3O3DB 1AAJA 3DBXB 2ESVD 5J4MA 4PRID 3R7QA 1UM4L 4GS7B 4LCVA 4BFIA 3TTSA 4Y89A 2VN7A 4R7NB 2DYSB 3VXMB 1G7JB 5LJYH 1A9EB 3OXRA 3MRDB 1LO3L 4I5BB 1HCFX 1YEKH 1Z9PA 1J9QA 2XT1B 1OZTG 2XA8L 4S1QL 4I0KA 4L0PB 1KY6A 4DW2L 1JV5A 2DWDB 1YMMA 2JKIS 5ETUA 4PSPA 5KS9E 1CGSL 4O2EA 1W72L 3LV3A 2WINB 3KS0J 4JDEA 2KZKA 4BD4A 4PD4K 1A6TB 1U42A 1P1ZA 4G8GB 3HHMA 3L5HA 5I5JA 3H9SB 4O51A 4FN0A 3KYAA 5MEND 3L3DA 3B2DC 2IDQA 2WBJB 1RJLB 1XF5A 1AXIB 2DWXA 3LKNA 4EVNA 2ICEA 1HS6A 2JCCA 2Q7YA 3T4YB 4F58L 2Z91B 4ZMXA 3IRCA 4OLUH 2J8OA 2R83A 3L4UA 2DWTA 3TBTB 1QLEB 4JQIA 3CZFB 1RUQL 5KBDA 2V8MA 4NRZB 4E41A 5C0CB 2R7EB 3BSHA 2HFFA 3SE9L 1M7XA 3N91A 3RRQA 5T33L 2V5RA 3AREA 3W5MA 2ATKA 3VGAB 3RGVB 5IBTL 1HEZA 5CEYA 5JA9A 3WMSA 2IGTA 2NY6C 2VXUH 2EDJA 3I6GB 2XN1A 4MGXA 3ZO0A 3UO1L 1N10A 3GK8L 4V2BA 2F54B 2PWGA 1X6LA 3FB7B 5D72L 3QRLA 2R0WL 3D30A 5IESL 3B5GA 4HJSA 4HMEA 4NZJA 5H8DA 4CSTA 3SD2A 2NX5D 4AYBA 1PQZA 2NNAA 3C2AH 4TUOB 1WBXB 3GQFA 1E9PB 2NY0C 2VO8A 3ZN6A 1X4YA 3HRZC 3GJFH 3FTZA 2G5BB 1H8NA 2G75B 5I82A 4KK5C 2GT9B 2VXQH 1R33A 2DQUL 3H85A 4WFFD 5KBLA 1CXLA 3B8SA 5DJ2B 5F1NB 1UA6L 3WO4C 1ED3B 1MCIA 3O11A 4WU5A 4DIXA 2BSDA 3DX8B 4OAWA 2C34A 4NO0A 1RPKA 1RP8A 3A3YB 3ZKNC 1FJ1A 3FC8A 1IL1B 1JAEA 4KQ4L 2FIKB 4XMXA 4A68A 1MG2C 1XGZA 3ARBB 5F3FA 1U33A 4ICWA 2XG5A 3BKYL 4MNQD 3PWVB 3TNNB 1R17A 2X3CA 3WN5B 1U41A 2WBJC 1FFNB 1HWHB 1JYVA 4CSSA 1XQ4A 3WO4B 5IT2L 5DVLA 4IIZA 1WBZA 4PU2A 5C0JB 4BUHA 2QZQA 3CBRA 1XF1A 1U8CB 2QL1A 2ZG3A 2OTPA 5CUSL 3NJHA 4H0LC 4DH2A 2A3TA 1DBKH 2NX5E 1ACCA 1RZQA 1YRKA 2VGLM 4KI5F 4NDMA 2WTPA 4QRRA 3QDJD 5IFJA 3MLVH 2WSPA 3KVDD 1QFUH 3K6FA 2V6HA 2MNJB 4AX3A 3BWZA 4CL7A 4RMQA 1HQ4B 2AABL 1UM5H 3M45A 3UZEA 4XGZB 1YNLL 2ADJB 5DJZB 3RGHA 1PZUB 5AYUL 1ACYL 1KIUB 1TYRA 4JO1H 3PWLA 3SPVB 5F9JB 4U31A 4HDIB 3KL5A 4TNWK 5C07B 4JHWL 2DRUA 1CGUA 4HAKA 3PHOA 1YNLH 3S2AA 3QWQB 2V5SA 4X5QA 1B4RA 1JNLL 1QKZL 2Y1ZA 4H8VA 4WWKC 4F15B 2ZNXA 3FU7A 4LHUB 4ZO8A 1CUOA 2V17L 1MCQA 5F2FA 5EO9B 1XSJA 2NMSA 3ROOA 3S7GA 5EO0B 3UJIH 1Z9SB 2IV8A 3VGBA 5FFLA 3FTUA 5GGTL 1XGTB 3WN5C 1HU8A 4BHUI 1MPAH 4A7GA 3PDOA 4XHJC 4OUUB 3TGXA 2A6IB 3IPFA 1WWWX 5CIPH 5I8KH 4JN1H 1KG0B 4QXTB 4G8GA 2IPKA 3ARBC 4RGMB 3TVMD 3S8GB 4LCUA 4PP1C 3ARDC 2LFEA 2WLIB 1CFVH 4IJTA 1MNNA 2XUWA 1JFQL 2VDMB 1FV1B 4HMCA 1R0AH 2BHUA 2P44B 3AS0A 5CN2A 5L0QC 1BFVH 2CM5A 2DF3A 4JR9L 1RKRA 2GUOB 5G2NA 5CU9A 3T9WA 3QXDA 4FG2A 3QRFM 2UXFA 3Q01A 3CZNA 3ZGHA 3F7YA 2BHYA 3FFCD 3POHA 2B1HL 5IEHB 1KCRH 4R96B 2DQCL 2B4CL 4JFDE 2IAMD 4PJ9D 4XMLL 3BQUB 3VRLE 5F9OL 1SXAA 2XFXA 2ZWYA 1BEXA 1CXIA 2VL5B 3Q1EA 4JFOA 4FHBD 2D0HA 1NIDA 1G5GA 2FDBP 3U82B 4NJ9L 4PJHF 3I9GL 2L8AA 4Y5XC 2Y0SA 2F53E 4UTAA 1G0YR 2RBLA 3BQVA 2QV4A 3QDJB 1EBPA 1JWSB 5IMOB 1NCWL 4EN2A 3KDPB 3Q5TA 3WNLA 4KRPB 2YA1A 4W9ZA 3GO1H 3ZYOA 43C9A 2P5ED 1NIEA 2WJ5A 4LCCA 2OA9A 3QO0A 3L95A 3MXVL 3E8VA 4YHKH 4NO2A 5EU5A 1YEGL 2HFEA 4EUPH 3E6FA 1DVSA 4HS3A 4EIBA 4I1PA 4GRWB 1DANT 4A1RA 3FFDA 4TVPH 3CDGA 2WLIA 3K81A 1INEL 2ZOLA 3EDJA 3FUHA 5DO2C 4JG1H 2E6JA 4CUCA 3GXTA 2OMUB 2WXRA 3DX0A 5BZDA 4ORZC 3OR7B 3X1EA 1I85A 4QRSB 5L8JB 5SWZD 2GQHA 3OJDA 2LU4A 3VX1A 1SOQA 5AG8A 4ODVH 1IT9L 1A6ZA 2DTSA 4JKKA 4L8SA 4OIBA 5ACZB 3WTSA 1DQKA 3K8LA 3QYMA 4Y16C 2I60L 3KLAA 3IS1X 3HI6H 3NFSL 2GSIB 3T04D 4EI5D 1EGJH 1QW8A 3KYOA 4KRLB 4FCHA 2DM2A 2R1WB 3SKMA 2CCLA 2CG9X 4HK0A 4HSAC 4R90H 4KKPA 3UTPD 5KS9A 5DHVB 3MBWA 2ZCLH 4GG8A 4GKOA 5B3JE 1N3NB 5D7KD 1VZIA 2P24B 1DQDH 3IDXL 3I50L 2MH4A 2OZ4L 4JDVB 5TH2A 1TQCB 1ODUA 1DFBH 4P59H 1SOSA 2Y5TB 3RZCB 3D3VD 2VLRE 5GJSH 1EEUA 3P73A 4E68A 4OF3A 3QH3B 2CLVB 4TUJB 3V6OE 4P5TA 5IJKC 3MV8B 2GBTA 5F1IB 3S34H 3BD4A 1F6AA 3PDOB 1TJGH 3IAQA 2DWEA 3ZR5A 5C9JA 3BGMA 3VI3A 4KQ4H 3RBGA 2QFRA 2TSBA 1T0PB 3AG1B 1PLBA 4B9PA 3ULVF 2QSVA 4K5NA 2G30A 2ZXQA 2XQBL 1DQLH 5CHNA 3C8HA 1PPIA 4ZOCA 4O4YH 4DP4X 2ZOLB 4ATWA 2E6QA 3AG4B 3PU7A 1FL5A 2W07B 3MRHA 5ALBL 3Q05A 4R97B 5EOCL 1K5NA 3OGCB 4ZMWA 2J12B 4N90E 2PYFB 3F83A 1V54B 1EERB 2QMKA 4F7MA 1LO5B 1AFVH 2J1YA 2SEBB 4XBPB 2I9TA 1BQ5A 1OOWA 2IDFA 2J1WA 2Y5EA 5BOJA 3WGUB 2YQBA 3GRWH 3ZYIA 3T8XA 1L0YA 4X6FB 4MS8C 3BH4A 2LGNA 2QVKA 3U6RB 1JGLH 1SMOA 2UY6A 4ZFOL 5I30H 3P9LB 3VXSE 3TEZA 4B9KC 3CC5B 4PMEA 4QD2E 1CICD 2CKBL 2WUBH 3DXAA 4FTDA 4P07A 1CD1A 4PRAB 1R34A 3M8OH 3E3QC 2CIIA 3B5HA 4Z95L 5C0EB 1FHNA 4PGJA 1K6QH 1A14H 1ZE3H 3DMMB 3FO2B 3QJHA 4H8UA 4JO3H 3V7AG 5M95B 1AXSA 4QRTB 4GH7B 3DUUA 1KYAA 3Q2LA 4YFLF 2D3NA 4PJFA 1CFTA 4ZOEA 2WQ8A 4EI5B 2JMRA 3BSGA 1NCGA 4XBEL 5DFVD 4J3OG 3S4SG 4B53A 3Q3GA 3SDXA 1YY8B 5JQ6H 5JQHC 3QUXD 3MLYL 1C7SA 3WUZA 2B16A 5LQBH 4GO6B 5DVKA 4HOXA 4G6FD 1MG3C 3F85A 5IB4B 1GGBH 4HAGA 3T0ED 4HCFA 3WFEH 1GJWA 2GJJA 1IM3A 5C07A 5L2KD 3EZJB 43CAB 1JRHH 4L1BA 1PG7H 4HMDA 5FYKL 3EO1A 2Q9OA 4NQEA 5C6TL 1M71B 2AHIA 4LPCA 2XACC 1ZLWH 1QTYT 4DFIA 1UWEH 4YFDB 3GB7A 3FSAA 1IEAA 3MA9H 1IGML 4CVUA 2VMCA 1OAXL 4N24A 4QOKA 5EO9A 3BRFA 2XZCH 5BZZA 5C08D 3NP3A 4HGWA 2V9RA 3DXAD 2CBPA 4LLDA 4ZNEA 1PDKB 2G60L 3V6ZB 4P2OD 2KQMA 1DBJH 3DLQR 4XMWA 3TL5A 1DVFA 2VR8A 3MJ9A 4K8RH 1U91A 4YGVB 3CVDA 3INUH 5KSAB 1IBDA 1WTGT 1ZPLA 2BNRA 1JWMB 1OAUL 5E8EA 3QORB 5IOPB 4LDEB 3GJFK 4U1IB 4IDLA 3B7SA 4PJ7A 4Q0XL 4X6CA 3O3UN 4OV5A 1RUKH 2VLRA 2X9YA 3QVAA 4LSSH 3RVTC 3D2UD 3TPUA 1WD8A 1GCYA 1WD9A 2MTAA 5EF1A 4PLKC 1T2QL 4WNSA 1L9SA 3ARFC 3H56A 1FH2A 2NY3D 1U4EA 1T7XA 2RACA 3TFKC 2VUKA 2R56L 3RL1B 1D7CA 1SM3L 2AQ1A 4OCWH 5ICZB 4I85A 4MMZB 3PXHA 1YEWA 2VYRE 2FYVA 2VKXA 4JQIL 5D2NA 4TQEH 1ODAA 3VYPA 2XXMB 1MFEL 3IMRA 1WV7T 5EIVA 5KG9A 4G9DB 2BDNL 4TMPA 4HOZA 1ZXKA 2H26A 1AC6A 1JMZA 3H8NA 4M48H 1JGVH 1Y1UA 1V27A 4XODA 1JPST 3CIQA 4KKLD 5IB4A 4JY4A 1L7TH 1W91A 1KEMH 4XXCA 5K9OB 3SY0A 5I8CA 1JPTL 1F45A 3DHMA 1WUNT 2V5TA 3CU1A 2YUVA 2R0LH 2VRKA 3RUGE 4YFLI 1WZMA 4OGYH 4ZDHA 4X98B 4EUPA 1NIFA 3CCHA 1T5WB 4HZAA 4A1KA 1MFDH 3ULUC 3CVBA 4JQIH 3X11A 3FFOA 3VRIA 2HKHL 2BNQE 2AXGA 2GTWB 3SPIA 3FAWA 4LLDB 4L18A 1AFVL 2G2NA 4FQIL 3FU0A 1WAAA 3DDFA 1O0VA 2B8OT 1WCBB 3CLEL 5E1AB 3STLA 4X9FA 4Z3IA 2R4SL 1RIVL 1ZTXH 3C2SA 2WIIA 4EI0A 1JV5B 3CXDL 1JXFA 4NOBA 4GLRH 3IJYB 3L9BA 3ARFD 3CC1A 3OLEA 4UIKH 4CSZA 2QZ5A 4Z1PA 4OI8A 2Y07L 1XH3B 3D3VA 2R2EB 4KKNA 4TXVB 4NPYB 1IJNA 3CMGA 1VADB 2YD1A 3CV5A 1U58A 2IQAB 5I0XA 5KSAD 9PCYA 4AL8H 4KVPA 4XCYB 1AC0A 1RPUA 1PZ3A 1J86A 1MF2L 3QQXA 3FO1A 2E7BA 3U7YH 3F00A 5IVOA 5B1CA 1G1YA 1J1XL 2Z91A 1DANU 1QPXA 4AKPA 2Q7AA 5I66B 4WTZA 1GTFA 4ALAC 2H26B 2H3KA 3MLWL 5CEXB 1A0QH 3ULSB 2APBA 2JLLA 4DO5A 3G5VA 4HXAL 3BZDA 4P0DA 5BOZG 5AWNH 2E3VA 2M2DA 3GUTA 3E2HC 1MJUL 4MCZA 3BPCB 2I9LA 4DEWA 4ODXB 1KB9J 1N59B 2ZP9A 2YUZA 1KXHA 3ZG4A 3IDUA 3QIWD 4YOKA 4OZHE 3SE8L 3TC9A 1EFXA 4QOKB 4UQAA 4HUWB 5DJDA 3ZZSA 4OZFB 4P59L 4Q6IB 5KYUB 2DWDA 3E9UA 1RZGB 1AQKL 3IJHB 3I6SA 2VLKD 4X80H 4GRLB 1Z9NA 3P2DA 1I3UA 3FRUB 4OZHB 2X09A 1FQ9C 3JV4A 4LIQE 1GHFH 1JWMA 2ZUSA 3EOBB 4KMQA 1KJ2H 5FYJH 1BBJA 4OZHF 5E6YA 4YBQC 3RPBA 2RFXB 3VQ1C 4HK3N 3N2JA 2CPCA 1NEZG 4K9EL 3GRWA 1A6AB 4POUB 1PD6A 1FL5B 4FQQA 4CNIB 3MRGB 4Z3JA 1UVQA 2KH2B 1GH7A 3IVKB 1HXKA 2VAAA 3PGCA 2LE9A 1XBDA 4Y4HA 5GISH 4FQCL 5FWQA 1VADA 5IM7B 4YSSA 5M94B 2HVKB 3A5VA 5K1NA 2H2SC 3AW5A 2DQHH 1ASQA 1XF4A 3LXCA 3OC8A 1E43A 5KYXA 4JVPA 5CLTA 5AVYB 1DVTA 2JKJA 2YJQA 3VCLA 1UD8A 3F58H 1U92B 2QJDA 3MUZ1 3V0WL 5LBSH 1RFDH 3MBEC 4KQ3H 1PF3A 4G6KL 4TULL 4HC1L 4QLWA 1YYLL 5CKAA 1DUZA 4UYQA 1LK3L 3HCVB 1JPFA 5F7NC 3E3QE 1CVRA 3MGTB 5I8KL 5CKGA 2EE9A 4Q14A 5HVHB 2AANA 5FA4A 4DGUA 3BVNB 4JO4L 5AW9B 4GSDH 1WP6A 4K7FA 2H2PC 3P3YA 3CH1B 5E4IA 4MLIA 3QDAA 4GG6F 3H42H 1EFXB 2BSSA 4F8LA 3LIZH 2UUDK 2C9RA 3BIKB 2ENJA 2XJLA 3KR3H 5C0IA 2FT7A 3NDYE 2PTUA 5JIHA 1BIIA 3O0RL 4U3XA 4HWZA 2IG2H 4JFUA 1JZIA 3Q1SL 3WMQA 1KTLA 5TE4H 1RFDL 3LPWA 1R3JB 2KZBA 1UEMA 3CDYA 3HHSA 5FYLE 1ZLEA 3LZOA 3HS0C 4N8CL 1M6OA 4XVSH 3EOAA 1QWHA 2GIXA 3LRGA 2AJYH 4N22A 4PJAE 4YSAA 3EO1B 3EYUL 4HFWB 3ULVL 4E9QA 1BECA 1D7DA 4QCIA 4LGRB 1FL3B 2BERA 2EIDA 2VKWA 3RZCC 5E8PB 1HCVA 4WUKH 3WAJA 4K0OA 4PR5A 5IIEA 3HC3L 3NCJL 4Q58C 3WEAA 5KBNC 4ODSH 1XIWC 3REWB 2N01B 2ODIA 1NC4A 2ICWA 1MUJB 3NP4A 4GMSL 4QTHA 3HPJB 3W1ZA 4P48A 2GUOA 2H6PB 4LNRA 1S9VA 4OZIB 3S2CA 4F7TA 5I6KA 4KGJA 4NNYB 3SPHA 2CRYA 1F4WL 3P0VL 3ZXAC 1EHXA 1MIEH 3AY2A 3VD9A 5GRWA 5I8EA 3RWIA 1CK0H 4EZMA 3S88L 4HX1A 3EG9B 1GGYA 1OHQA 2BP5M 2OI9B 3UGXA 1HZLA 3KVQA 3I6LE 4BFFA 4GW5A 4AC2A 1UYWH 3IDYB 1BREA 1G7MA 1ITBB 4NKMA 3T4AC 1UQSB 4G42B 3MPCA 3SDXF 3MRQB 4NQXB 2W9EL 3T0DA 4QJ4B 4OKDA 3T2OA 3IMTA 2EIBA 2XTJD 3HG4A 3L6FA 4UTBA 1Z3GH 2ITCA 4GQPH 1FVCB 2YD2A 1QEXA 4KGLA 1IFHL 2LABA 3PWPE 4JKPH 5D7LB 2ZKXA 5DC9B 1S8DA 2CMRL 5SV4A 3K71A 1Q8MA 1LE9A 4K4KA 3RWGA 1T0MB 3L9EA 4FG6D 3KNBA 5E5UB 3SCMD 2EVHA 5K93A 4E41E 1C5CL 1BYPA 3N1MC 3NZHL 4JFXB 4MD0B 5HJ3A 1V3LA 1QNZH 1ZTMA 4LLYA 5JW4Q 1UCTA 1WYJA 1PNCA 1FFPB 1WHOA 2NW3B 2XV3A 5KVEH 2VSMB 2WTOA 2OMUA 4ZMOA 1SJEA 4I3SL 1MJJB 1WUZA 4KY1H 5T5NF 4Y1AE 3OWRA 2QKSA 1XDTT 4BBWA 2X2UA 5ISZA 5EZJA 1S4IA 4F5CE 1X4ZA 3Q9PA 4Z7QF 4R9HA 4YDJB 4PV8B 3MV11 3VFOA 4YSUA 2GJZB 4XRCB 2YRBA 2JF1A 3KBEA 4PJ9C 4RAUB 2PNDA 5IW6A 3AREC 4KJQD 3P4LA 4J4PA 2OZNA 4LLAA 5FKAA 1NGZA 2JI1A 1ZOXA 3HUJE 3EYOB 5SV3A 2HG5B 4RX4A 3WCYA 2WMPA 2X70B 5E9NA 3TH3T 2CR0A 1I53A 4AENA 1MFDL 4ACTA 3MKGA 1MHPH 5I1LA 5KJRL 2QSCL 3QUZC 4GIAA 2VLJD 3R19A 2R2EA 5DD3H 4YBLC 3O9WD 4OCSL 4HS6A 1N19A 3MRQA 3BO8A 1BZ8A 5D96B 1HAWA 3KYNA 1H8SA 3MV8A 4XCYA 4XPAH 3SQBA 3MRBA 4YHIB 2PPAA 1A4KA 1GZHA 1PCSA 4FQHA 4AI7A 3OVUB 3NVQA 3CDZB 3RZCA 4P4KD 4JRXE 2YEQA 1ILUA 2IJ0C 2APSA 5DO8A 2WQAA 5CHNB 1W16A 2WVSA 4XPAL 4X2UA 4OD2B 1LE5A 2J8UB 2NSMA 4N5UA 3HI1B 4QRRE 1QR4A 2OYLA 4F9PA 3KNBB 1G7PA 2LAAA 3H2QA 2ZOOA 3FFCB 1TQTA 4ORGA 5A43C 4C57C 1Y18B 2WCSA 5FHBH 1N59A 5K39B 1OPOA 4H26B 1FN4A 1COBA 1ZT4B 1WT5A 3BSZL 1MIMH 1UWXH 2P8LA 2V0AA 2XN9A 4U1KB 5C0CD 2X6UA 4A2GA 4FG6C 3BP4A 4GP4B 2J4WL 5CILH 1FUNA 1OANA 3GZKA 1RZFH 1DUYB 4KROB 2CE6A 3CZGA 3B56A 1G6VK 5B1JC 1RZ8A 1FZOA 4XC1L 4NP4H 1E4XL 4PJEA 3BUPA 1IE5A 2K70A 1T83C 5JOPD 3TBVB 3JVGC 3NA9H 4MWFB 1AHMA 5L88H 1S9YB 3DSFH 4KDVA 4MA7H 2NYKA 3U9PL 3QO1A 3FO9B 5A2AA 2A9CA 5T1MA 1JBJA 4HX1B 3MJ8B 4ODTH 4N2IA 3G04A 3NPZB 1S7VB 4K3EH 3WELA 5HHOE 5J13B 4PS4H 3WXVL 3SDAA 3MLUL 3UBXA 1RUML 5AAMA 5FCUL 3H4FA 4S10A 3QDGE 3S48A 1LMKA 2G5RA 4K9EH 4OLXL 5D1QE 3EO0A 2WINA 4AVIA 3OF6A 5J3HD 4TUJA 5DVOA 3PHAA 5HHOB 3T0AA 5F72S 2F19H 2H7WA 5FYKH 1BAFL 3V0JA 5HYJA 5HPOA 1MAJA 4EI6B 2IVFC 3UZEC 1FGVL 3WMPA 4KNTA 3TESA 2ZKWA 1CFBA 3Q6GH 3NIDB 3CQQA 1CFSB 1HXYB 4M61B 2FBJH 4OGYL 2AVGA 4OD3L 2NTFA 1A3LH 4GMTL 4MX7A 4P3CL 4JRYA 2DKUA 4JB9L 4Q9QL 1OGSA 4FULA 5JZ7C 1Q9KA 2HJLA 3DGDA 3THMH 3IKCB 1BF5A 1KEML 3BH8A 3EYSH 1ZSDB 1F4AA 1QSED 4AM0Q 2XWXA 4N87A 4HJEA 2J88H 1IGFH 4APQC 5KSUB 3HG1E 5F21B 4PJHE 3TYFB 5JPMC 1JPEA 2VXUL 3NSCA 1VPOH 3W0WB 1BG9A 4NWUH 1H5BB 2W94A 4RNRB 5DRZB 4F33B 4ZS7L 3MROA 4JJOA 2FR4A 2EEAA 2ORBH 4P4KB 5DJCA 2OULB 4U33A 4YDIH 5EZJB 3U48A 2ZX7A 2PTVA 2R1XA 4QHUA 3WNPA 1XH2A 4A1JA 3MREB 2WZPD 1MHCB 3VFNB 4HIIA 1LWJA 3APDA 4E9RA 3O0LA 3QQNA 1CZ8L 2XXFA 4LCIH 4WKXA 1CLZL 4GBXD 3ABKB 3I2CL 1OCZB 2TRYA 3UIYA 3BPOB 4JPKH 1LNUB 3SZ6A 2L7EA 1NL0L 2XVGA 2EO7A 4PJCA 1A6WH 4LASH 5B1BB 3DX8A 1RURL 4W9CC 1DBBL 2ZCKH 1KFAL 3OKLA 3HBGA 2XIDA 2ZYHA 2EXWD 3PWPB 3BRDA 2VR7A 2XJKA 2GSMB 2DLEA 2WAQA 4G6JH 3HG5A 1TQCC 4WDIA 3D06A 4WSKA 5TE7L 2XY1A 2N1TE 3AM8A 4UNTA 5FYJD 1MF2H 2XY2A 3PPSA 3AT9A 3QWOA 4G8FB 5DEFB 4LCWA 1MCSA 5J5EA 4PGCB 3C60A 4HH8A 3OZ9H 4N5EC 4P3DB 4XBEH 2LU5A 2E4FA 3RE0A 2LU3A 2HJFA 5D96C 1F8TL 1RIUL 1KCUL 1VRSA 2OMXA 5IVXF 3LQAC 1IC7L 1C5BL 1EBAA 4OZIA 2Y3NA 5IHUH 4HJTA 5J6SA 1KB3A 5I1IH 1A7PL 2EZ0C 2UZXA 5E23A 4L1SA 4K94L 3WE1A 1MI5A 1KTJA 1F00I 1Z1WA 3D4CA 2BJML 1AXTL 4NC1E 5AW2B 2WXGA 3G6AA 5JQ6L 4HIJA 2BOBB 4LPWA 4JDZB 1WK0A 5C9KA 4NQXA 1BW8A 3QXVA 5LGKA 2PP7A 1PTZA 2LT9A 1E5ZA 3IDGB 4YBQD 2C3WA 1T5XB 1OTTC 4RMSA 5B7EA 2EDKA 5CGBA 1KENL 2VR5A 5EOTB 3LS4L 1P1ZB 1MI5D 3QC5X 2YKLL 2J44A 5I0WA 5C09B 2QDWA 4I2XE 3KPPA 4TYUA 4EIGB 1QLRB 1ED3A 3GLAA 1DLHA 1QATA 3DTUB 5EU7C 4N6RB 3KH3A 1RU9L 2K8MA 1GJIA 4KRMB 5L8LB 3H4HA 3W9DA 3QQ3B 1S7SB 3KLSA 2WUCL 4FHKA 1K9TA 2YKLH 5EORL 1VEOA 4Y2DB 4Q0XH 2EE6A 3PGFH 3BAEH 3VFTB 4H20H 3PJLA 4M56A 3V10A 4UM9B 2QADC 5T33H 5AVRB 5HYJB 1MWAB 4LSRL 1BOGB 1K4DB 4PGDB 1XD1A 4IM8A 4UIMB 4WKZA 4K3JL 1SM3H 1CFSA 1HXYA 2WXHA 5EH1A 1SDDB 5BVPH 5TDNB 1X9RA 1H8OA 5I74B 1J5CA 4DQAA 4NQCA 1RZ7L 4IBWA 4J28A 2VH5L 5AW1B 3UC0L 3VTMA 2EE2A 4KTDH 3KMDA 1IAIH 3PWLB 3BUQA 3R0MA 2FGWL 1G5AA 3HJEA 4P49A 4TTDD 3BD5A 4WNQA 1EEYB 1P6AB 4JREC 4U6YA 5E99H 2J72A 1Y0LA 3BMVA 2VDOH 4PV9B 1KIPA 1L0QA 5GRJL 4HISA 4KI5D 1U8IB 2AKRA 4ODXA 3E8UH 2WK2A 2VZUA 3BEVA 4AJYV 7FABL 2FGWH 1JZ7A 4UQIM 4DP2X 1J8KA 4HS8H 1WJ3A 1UKTA 3C5ZA 4XCFL 1QABA 2FBRA 2R4RL 1EJ6A 1M1XB 3NACL 4APQA 5C8JB 4ZMPA 3DIDA 1FO0L 4QI3A 1XVSA 1EK3A 2AAVA 2X4SA 4ZFFB 3II3A 2YPVA 5C0BA 1O6SA 2AQ2A 3NJGA 4NM4H 5C0GA 4BINA 4NJAL 2Y6TE 4HT1L 4NN5C 3TJHC 3Q44A 4PEEA 5EIIA 2YN3A 4PJCB 2DQDH 4UYPA 5F7DA 4J3OC 1O5PA 2C1OB 3I75B 4Q74A 4TVSa 2KDGA 2X44D 3DHJA 2DYPA 2CKNA 2ZSVA 4MS6A 4NQDD 3B6SA 1BD2D 2WXOA 1Q1JL 4IRZA 5F7YC 3V4PB 4AMWA 4NO2B 4GAYA 3EYVA 4GKNB 3OD3A