4GSUA

Structural basis for the inhibition of mycobacterium tuberculosis l,d-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
268
structure length
268
Chain Sequence
LTFQTSSPAHLTMPYVMPGDGEVVGVGEPVAIRFDENIADRGAAEKAIKITTNPPVEGAFYWLNNREVRWRPEHFWKPGTAVDVAVNTYGVDLGEGMFGEDNVQTHFTIGDEVIATADDNTKILTVRVNGEVVKSMPTSMGKDSTPTANGIYIVGSRYKHIIMDSSTYGVPVNSPNGYRTDVDWATQISYSGVFVHSAPWSVGAQGHTNTSHGCLNVSPSNAQWFYDHVKRGDIVEVVNTVGGTLPGIDGLGDWNIPWDQWRAGNAKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Probable conserved lipoprotein LPPS
publication title Structural basis for the inhibition of Mycobacterium tuberculosis L,D-transpeptidase by meropenem, a drug effective against extensively drug-resistant strains
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 74
structure length 268
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03734 YkuD L,D-transpeptidase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.440.10 Mainly Beta Beta Barrel L,D-transpeptidase catalytic domain-like L,D-transpeptidase catalytic domain-like 4gsuA02
2.60.40.3710 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4gsuA01
2HKLA 4A52A 4LPQA 1Y7MA 4QR7A 4GSRA 4K73A 5DVPA 4ZFQA 3TX4A 4A1JA 4JMXA 4A1KA 4HUCA 4QRAA 5DUJA 5DC2A 5E1GA 4HU2A 4GSQA 4QRBA 3TURA 5LB1A 3U1PA 5LBGA 3VYPA 4LZHA 5DCCA 5K69A 4Z7AA 5D7HA 4A1IA 4QTFA 4GSUA 1ZATA 4JMNA 2MTZA 3VYNA 5E51A 3ZQDA 5E1IA 3ZGPA 3VAEA 4XVOA 5DZJA 5DU7A 3U1QA 3VYOA 3ZG4A 5E5LA 5DZPA
chains in the Genus database with same CATH superfamily
3HG5A 4GKSB 4OFYA 4PREB 4Z7OE 1W91A 1CXFA 3HE7B 3QDGB 4GP8B 5IJVA 4JZJB 3EADA 1RUKH 2YMTA 2HUEA 1R4XA 4L5FH 4PJIA 5CCKL 2OAAA 1H8SA 3SE8L 2W65A 3QQ9D 3PPSA 3AITA 3MLVL 4X5PA 1DBBH 5I0ZA 4XCEB 1AGDB 4LB8A 3Q6GH 4P57A 4MMXA 3NCMA 4W68A 3TBWB 1F58L 1T1XA 2VDOL 3UTPD 3V0HA 2A9MH 4HEME 3K71B 3N40F 4PFEA 3FFDA 1JGEB 2FUQA 2XQYA 3H0TA 3STZB 3TP4A 1TDQA 1D6EB 3TA3B 4BSJA 1WP6A 5DRXA 3FAWA 3I6SA 4YS4A 2Y7OA 3H9SA 5SWZD 1N5AA 2W91A 4QOKB 1IEBA 3GM8A 3VFRA 2JWYA 1OLZA 4PJHB 5LCVH 5IFHH 1RI8A 1MAML 4Y88A 5I8EA 1UM5H 2EKSB 4L05A 1A0QL 2IWKA 2QGDA 2AJ3B 4PD4K 4S2SA 3G6JE 4RAVA 5C0EA 1VJSA 1R5WB 2BNRE 2VLME 3MLUL 1G43A 4NB7A 5IFAL 4JJ5B 1WBXB 3IMRA 5SV3A 3L5IA 1IGMH 3QXWA 5SWZB 5DHXB 4X6FA 2GJZA 4M6NL 4DKTA 2NCEA 3J27A 5DS8B 4HUXB 4PRHB 5EPMA 2V3EA 2OL3H 3DV4B 2WYHA 5GIRA 3I75B 4MA3B 1U3HB 3LDBC 3UAJC 1OVZA 1AXTH 3FU0A 4JCLA 2QGEA 1WWAX 3UYPB 4P48A 3MOQA 1SQ2N 4FQXC 1C12B 1N6UA 3CN0A 2EEDA 2PR4L 1JNHA 4Q6IB 3BRDA 2Z35B 5GGVH 3QCUL 1RPQA 1L7IL 3D0LB 3GJFK 5EO1B 5GZND 1UJ3A 5L6YH 3RL1A 4ZMXA 1EK3A 2JKNA 1IB5A 2YUZA 5MEND 1MLCA 1EJFA 1T5KA 5B3JF 2YPLB 4U1KA 5DK2B 3NPSB 2DB8A 3X12A 1UASA 1QPXA 1VFUA 1JPFB 2FT6A 1OCRB 3AS0A 1CT8B 4OIBA 3SOBH 4X7TB 5B3SB 3DX6B 1AD9B 3FUMA 1QPKA 3B2PA 5H35A 2PYEB 4FQJH 4MJ6B 1DQIA 1J48A 1E3ZA 4LCYB 3ZZLA 4M93C 2Y69B 4NLAA 1ZLUH 4NNYA 4GG6F 5CGMA 4XB3A 5CCKH 2I9LB 2VABA 2JCCF 3D39D 3LN5A 3LD8B 4TLTA 3LHPH 3MLVH 1RURL 2NSQA 3V4UL 5FAAA 5CJXA 2WNWA 3QEQB 4TQHA 1BD2A 5BRZE 3DIFA 4LFHD 1A1OA 4MCYB 3GI8L 4X8GA 3VXMB 3TIDB 1VGEL 4O4YL 1I7ZB 4GXUM 1VKXB 3EYFB 1AGBA 3GLEA 4ZOAA 1LNUB 1Z9SA 3ZOAA 4D8PB 3ISWA 1HKLL 4QHUA 1S7UA 2CAKA 4P5TD 4AM0Q 3PPEA 5F6HJ 3SO5A 1XV8A 5EU6A 3UAJA 2VN4A 3FZUC 5LLIC 1MAMH 2ZOKB 4YO0A 5C6PB 1N18A 3VTTA 4FQXA 1EAQA 1HCFX 4ISVA 4U6XB 4ZI8A 2CIKA 7FABH 1S9WB 4JM2D 7PCYA 1AZUA 1FC1A 1CICC 2YFNA 3B3BA 3MLUH 3FOLA 2Z93B 1UATA 4LO9A 3L5HA 4AQ1C 2WQVA 3PDDA 3DPBB 4JPVL 4N8CH 2DWYA 5DJDA 5CCHE 1G1CA 4OQTL 1I9RH 1UWEL 3ZTNH 3EDKA 3JWOH 5FYLH 3FS9A 1J8HD 3B2XA 2FBJL 2GSIB 1E6OH 1ZANH 3UYOD 2I85A 3VGBA 1EHXA 1SXNA 4M6OL 4JM2B 2IC2A 4BUHA 5C0DB 4M61A 5AW3B 2X1XR 1CU4L 3BUPA 4LU5L 4WHTA 1OT4A 3D12B 2JV6A 3FQRA 3NJJA 3PJSB 3IJYA 1PZ2A 3L7EB 3MTRA 4MX7B 3CV5A 3FQTA 4IRSB 5CHNA 3QG6A 4HJJL 1RUMH 2XFGB 4WI4A 1MVYA 1E4KC 4JPWL 2XWJA 1KGCE 3HMXA 4UQ9A 2EH8L 3O2VL 2CMRL 4F7KA 4PJBF 3QZLA 5FYJD 1GGTA 4E0RB 4NO2B 3SJVA 4PLJC 3RUGF 1F3RB 4AKQA 2YAOA 2BVQA 2JXMA 3O6LL 3Q43A 1EXHA 3A22A 5F44A 4KNUA 5DJYA 5DEGA 2CCWA 2Z8WC 5ESQA 1HE7A 2QFPA 2W81C 1SDAB 3TJPA 4HXAH 3TXAA 2PP7A 3FSWA 5I5IA 1G9EA 3NMEA 4ZW6A 5IQ7L 3QJHA 3IU3B 3OKMA 1RURH 4L4JA 4W9HC 5BXFB 4Y5YC 1BIHA 2NSXA 2F58H 2DN7A 1ETZA 1MFBH 4OD2A 4RGNB 3HIZA 1C16A 4NKIL 1CICA 3KCWA 4YDVA 3U0TA 1E5YA 5H37G 4CADA 3BKCH 4AQ1A 2FR4B 1KLFA 1PL3A 2JQZA 2MIZA 4Z7UE 5T33L 4O4YH 4P06A 3DVGA 2UUDK 3NZSA 2O6PA 5JLZA 1NGPL 2AJUL 4PJ5B 4RFEB 1YEKH 1IZJA 5FA3B 2R0WL 3CNKA 3FB6A 3A0OA 4MA8H 4X80L 2IXQB 2Q7AA 5CMAA 1U33A 1BIIA 1JZ8A 2X1QA 4H8WL 1OGTA 1WC7A 4YPGB 3MODL 5DS2A 2MRYA 4KXZH 4N87A 1VRSA 3QEHB 2OXGA 3MR9A 4WKZB 2EYTB 4RWHA 3Q01A 4P2RD 5EDXA 2MOVA 3U7AA 1ZJBA 1DSWA 4YZFE 4MAYD 4ENZA 2XHNA 3O4OB 1E4KA 1JV5A 4MXVE 3HFFA 5ABDE 1FI8C 2Y25A 4FQQA 4QAMB 4O51B 1OALA 5D5MB 2A74B 1FNGB 1ZXKA 2FBJH 3L2LA 1DBJH 2XWBA 3D09A 3FUJA 4ELMF 5BVJB 2NNAA 1WBYA 4JVPA 1LK2B 1XXDC 4F7EA 3UJIH 1CU4H 2ZKXA 4QHKJ 1IE4A 2A6KB 2X4TA 4OLZH 3DGCR 4Y1AA 12E8H 1XF5B 4PB0H 4YXLL 2WLIA 4JFEA 2GIYA 1TEYA 2BHYA 1N0LA 3RNQB 1KV7A 2ZOLA 3GGWA 4YFDB 1J0HA 5DD3H 2I24N 2OA9A 5IBTL 4PR5A 5ICZB 4Y5YA 5T5NF 4N8VB 3HHSB 3LYRA 4ZX4A 1F11A 2FEDC 3O2VH 1X44A 4H4NA 4RRPM 4WO4B 4N8UA 3RWGA 3ARYA 4X6DA 1A7PL 3QE5A 2NNXA 4PTTB 2Z4TA 2WINA 2RACA 4OJCA 3O3EB 3VXOB 3MCKA 2APVA 4BFRA 4JRXA 1FRGH 4LL1A 4D9QE 2ZXCA 1ZSDA 3HCVB 3I6KB 4O00A 3R4RA 5MEPA 1YA5A 2GJJA 4NFCA 4ZFZB 4JY4A 4IU3B 4N25A 1GMEA 4X5LA 3PWJB 4OV5B 1NDGB 4XCCH 1UZ8A 1MH5B 3QFJE 2A4EA 5F9OL 1DVFC 1Z0MA 4MA7H 3ULVD 4PIBA 3GM0A 3I6LD 4JL1A 3HE6C 4JKLA 4S1SH 5AZ2L 5AOZA 5AB1A 1M7DB 1KCBA 5GGRA 4JDEA 2IANA 3ZDYF 3C5ZA 4MXWL 1DLFH 4C4BA 4A52A 1RZFL 1L5GB 3RX9A 3UZQA 3QIUD 2I07B 2X1WL 3EYQD 2VLKD 5LXGH 2ZOTA 4JFFB 1Q94B 3F7KA 5DRZA 2YBGA 4UMSA 1P2CB 4LCWD 1ZHNB 3UTSD 1XT5A 1RFDH 5B22A 4KITB 4G9FE 4CKVX 4H8WH 4WI0A 5DYOA 2WUBH 3CFNA 3O9WD 1B3IA 3IBEA 5I1HL 3U82B 5KYWA 4NRYB 1SN5A 1OCOB 2ZXAA 4U1LA 1TJGH 2GJ6A 2VLKB 3GBNH 1NBZB 3NIFB 2DYPA 5K1VA 2CDFA 5C7XH 3T6WA 4OQTA 2F1BA 5FYKD 4AQEA 4H20L 5L88H 1CS6A 1F0LA 3O3AA 4I4WA 3VUAA 5D72H 1P4IL 4FN0A 4GW4B 5DMJB 5MEOA 3IPEA 2VXQH 3N3EA 4CNIB 2DAVA 2AITA 4WI5A 2RCSL 2HKHH 3ZTDC 3CSFA 3OKYA 3D85D 2ICEA 3EHBB 3S34L 3HUJB 4L4TE 4H8WC 5CZXD 4FKKA 5IVXF 4Y9EA 1U8OA 3PDOB 2MCMA 3U6RB 1HVXA 3KJ6L 1BXVA 1NWOA 2RIKA 4JFDD 4ZUUB 2PWEA 1HK6A 1JWMA 3V0GA 1P5UC 3L4WA 3QZWA 4GINA 5J6HB 1MNUL 1WF5A 1DN0A 2BC4B 3M7FB 4OAWB 1YCSA 4P23C 3HN8A 5I17A 1JMXA 4AK1A 4L3EA 1NKRA 1CYXA 4E9XA 3HE6A 1VADB 4FZ8L 4Z7UA 1FVCB 5IQ9A 5CJOH 3QUHA 4YHMH 4YLCA 1H19A 5AVZB 4P4KB 2X0VA 3W56A 4N0FA 4NQCE 4PGDA 1JPST 1AS7A 4KKLC 4DGIL 1MFEL 4IIQB 1E2WA 4BD4A 3IFOA 4KDVA 2R1YB 4X9GA 4FFWD 1AAJA 3N44B 1ZS8B 2HYMA 3RJOA 4PHZA 5EEYA 5B7EA 5SV4A 5JA8B 2AKRB 5CILL 1NCJA 4AUJA 3CPUA 4FA7B 4NBYB 5EORH 1HL9A 1UFGA 3UTTA 4PQXA 5I26A 1BZEA 3OX8A 1M42A 1NQBA 4FLQA 4YSOA 32C2A 1TTBA 5K9OB 1E30A 3UBFA 1QLRB 4ODSH 2MHAB 5F7BA 1IBDA 4D2NA 2F08A 5E8OB 1NCUA 2ZP0T 3KW7A 5ITFB 1GRWA 2E59A 5JHDD 1XCWA 5GISH 5IBLC 3X14B 3BMWA 3Q6FB 1JGDB 3WFHB 3PJNA 4LLQA 3V4VH 1U36A 1FP5A 3QR2A 4KK6C 1A9VA 1HZKA 3HLAA 3HNVH 5BZWA 2NW3A 5EBWB 5ID0A 5I1HH 3D4GA 1E8YA 3BAXA 3C5JA 4KK8C 5D6CB 5AD0A 1GJIA 3NA4A 4Z0XA 3SBPA 3B2UD 4JDVA 4YHKL 4LLUB 1HCYA 4CVXA 4PRAB 3UBHA 1DFXA 1A1NA 4OF8A 3TCXA 1P5UA 2OMWB 3AFLA 3IS1X 1G7QB 4P23A 1IGYA 2XOTA 3CDZB 2D4FA 3SBWC 1SUJA 3II3A 3CN2A 1A22B 4RCAA 5EU4A 4QI3A 3QO0A 4KXAA 4POUB 5ECGA 5AAWC 4JFPA 3WN5B 1UD3A 1QLFB 3EGXA 5TE4H 1DUYA 2JKXA 1E9OB 1TITA 4BEIA 3QFJA 4AH2A 1H8NA 3MHZA 5IB3A 4Y2DC 4MHHG 2W80C 4QO1A 2HT3D 5KSUB 4X2UA 1PX8A 1G94A 1P5VB 2VLJB 1OCWH 3KWTA 1Z5LB 4JFOA 4KRPB 2G0LA 1EVTC 3UGXA 3I9GL 4HWBL 2YKLL 1YN7A 1JFQH 4JX0A 4MQ7A 4TPRL 3CPLA 3UO1L 1QFWL 3V0EA 1EPFA 2DS4A 3QG7H 4F8LA 4MD5B 3ARFB 1ZVYA 4AYFA 1A3RH 5GRUL 5TE7H 4DGIH 2BIOA 3G6DH 4UTBH 1SY6L 1HX0A 1KGIA 3CX5J 1M1XB 3GLZA 4GLRI 4PU2A 1QNIA 5HHVH 1N8ZA 4EUPG 5HHOD 1TTAA 4EQ3A 2LLGA 5CILH 3UROR 5DFVC 3VWKC 1AMXA 1T0MB 2V5SA 1XQ4A 4J8RA 5BO0D 1F6LL 2UWEA 4FNRA 3IWVA 5DQJB 2EDBA 4L4VA 2WUCL 3AG2B 1Q9LA 2EDYA 3Q1SH 4NDMA 3FTUA 3GDBA 1E7UA 3ZTJG 1MI5D 1S5HB 2XVKA 3PAZA 4MB3A 1F4WL 5DMKB 5EZJB 2B59A 4Z9KB 2DQCL 1TOXA 1IM3B 4QXGH 1IVLA 3QR1A 3SBWA 4JS7A 4HOXA 3QNZA 3CZGA 3HAEB 1OW0C 5FHAH 1RP8A 4JHAL 3L3KA 3RX7A 1O7SA 3N0AA 4PYHA 5CEYB 5SX4H 4ABVA 2HAZA 5AAWA 3NEOA 1K2DB 4KO5A 1FCCA 2EDRA 2IAMC 2NY4D 1WA1X 3Q7JA 2ISDA 1JNLL 3ALWA 4S0SD 3B9EA 4XPAL 4XP4H 1FNLA 4CU8A 2IPKA 4G5ZH 3IM1A 1H6FA 2O6FA 2X87A 4OD3H 1IM9A 4HD9A 1Q1JL 5EOTB 1A6TA 3D06A 1A66A 3IE9A 4KK9D 4KVCH 1Z5YD 3KLAA 2HMIC 3BYYA 1Q9WB 2VWEE 1CTMA 1NDMA 3L3JB 4NYLB 2I7SA 2BVYA 2NY6C 4RZCA 2OYLA 3V7AE 5KVDL 5EFIA 1FNAA 1TXKA 3WIHH 3K8KA 3BZ5A 4J3OD 3DIVA 3MRQA 3FCTA 4GKNB 1YUKB 3MOBH 2P5WD 1BGXL 4RX4D 5F70A 3EBGA 4G6JH 3NP3A 3ZYIA 4RRPG 5ICYA 1Z9MA 3RDTC 4L29B 1FL3A 2GT9B 1MWAL 3L2MA 3UC0L 4IQHA 5ID1B 2MCPL 4PRBB 1KJVB 4GMSL 1U8HB 4ZXBC 3PAYA 3QWOB 3VB8A 2G2RA 4CMHC 3VQMA 5GSVA 3WFZA 5LVEA 1BZOA 1ZHLA 3HG3A 4HPYH 4PJDE 3VWKA 2H1PH 1GY1A 2P5WB 3SYOA 3NK4A 4ATTA 3C87A 4TPRH 1E9PA 3N06B 4PIRF 1P7KA 2W8CA 4LARL 3M88A 3F7YA 1I3VA 5DC4B 5KVDE 1ZTMA 5D7EA 3V95A 1NC4B 1OE2A 1KN4L 1I85C 3A6OA 2G3ZA 1MSPA 3MCG1 4ZTEA 4DAGL 2EO9A 1H5BA 2WNXA 1NCAH 1SY6H 3TZVC 1OW0A 2VB5A 3FHQA 3PAUA 4PRIE 2J4WH 4JREB 1S78D 1KB3A 5A7EA 4L1BA 5AVWB 2IAMA 1ZS2A 3VXUB 2YXVA 4BFBD 5IJVB 3WKML 2WO4A 3E9UA 5FW8A 1F4WH 2GI7A 4MQXC 4PJIB 1P84K 3RL2A 4N2BA 2DQCH 2W65B 4Y16D 3W9DA 2I9TA 5JIDA 2YEZB 2XIDA 1S46A 3KLHD 4P57B 4N2EA 2AXWA 2JJSC 2JQAA 4MMXB 2H0JA 1T1XB 1O7DC 4NZJA 4KKNA 2FEEL 3FCGA 3WKPA 5FF6A 2JLPA 1F41A 2Y7LA 2ZYHA 5E9DA 5JW4R 3FFDB 2WVUA 3H0TB 3TLRA 5IEHB 3KH3A 1JWUA 4Z7NE 2G2PA 4HQQH 5DU7A 3OBAA 2DLHA 3H9SB 5FM8A 5FGSA 1N5AB 4QGYA 2BP3A 3AUVA 1IEBB 4OF6A 3QS3A 2DLTA 4JPIB 5I8EB 4FCHA 1TJHL 4MWFA 2Q3AA 1KN2L 3CLWA 3OR6B 4NM8H 1L0XA 5LB1A 4PLKC 4RAVB 4XODA 5AW6B 3G04A 1HEZA 4MNGE 3BD4A 1DVTA 2JB6A 1FUNA 3GRGA 3T0WA 4IBLT 2EQDA 3OC5A 3UAEA 2AJXH 4JPQA 4CDHA 1I85A 4X6FB 2DH3A 1HYRC 2GJZB 3WIIH 4J27A 1MWAH 3B1TA 3UC0H 5EPMB 4BFKA 3BVDB 5GIRB 4GMSH 1KPUA 1FE8H 1BM3H 1C08A 3UDWC 1ZCRA 4YGVA 4BWUA 4LEOA 4P5TA 4HUCA 4BH8A 4HUKB 4Z1PA 3GBMH 4ODVH 3BP5A 3B34A 3P3SA 2VDQB 3QZNA 1OHZA 1K85A 1JNHB 4QRQA 4PJ8A 4P5MA 3LXCA 1AGCA 3VE0A 4HWBA 2XKNA 4ZNCD 3RWHA 2WTOA 1X4YA 4PS8A 5D9SA 2K9FB 4MJIA 3ROOB 3I6GB 3BPNB 4IRJC 3GKZA 2NY3C 1UB5A 2A6JA 2LQRA 3PNWA 4JO2L 1JYNA 2QR0A 5C6WH 5B1JC 4JFUA 3KLLA 5B4MD 1F8TH 1ACZA 2Z0BA 4U1KB 3WAJA 3X12B 2CCVA 1OP5K 2JJSA 2QQQA 3AMKA 5FO7A 5CEXA 2B20A 2QSQA 5T3ZL 4WGWB 1WCQA 1TZGL 3FQ1A 2WPGA 3VFMA 4MB1A 3HZMA 5H35B 1MCRA 1SVZA 1OM9A 1ZLEA 2YMOA 1N6QL 1PLGL 3M17A 1YNKL 2WVSA 2UX7A 4CILA 3K2MC 4NNYB 2X6CA 1XAUA 2VABB 2EUWA 5B1KA 5BQDA 3ZZ1A 4FTVD 3IXAA 1P7HL 4KROB 4HIIA 1T7XA 2Z8SA 3KYNA 3V9EA 3WIFA 3RVVC 5IKCA 1BD2B 3ZY7A 3KNBA 1XDTT 3DIFB 2R59A 1HXYA 3CZNA 2P8MA 3OC8A 1ROWA 2EIBA 4OJYA 3VX0A 4ZUTA 2VZSA 1A1OB 5I8KH 1QBLL 1U21A 3S36L 4YEFA 5A6IA 5HJBA 3RB7A 1V55B 1AGBB 1T66C 5T3ZE 1JMZA 3ASNB 1Z9SB 5DI8A 5DR5L 4QHUB 5CU9A 1S7UB 4B9YA 2QV4A 3UDWA 1NUDA 3QZMA 1YY9C 2J1YA 3LDBB 5EU6B 4YSUA 5EF0A 3P9LA 4FQXB 4HFUH 3F2LA 1KN2H 4ISVB 5J13B 2CIKB 1BZQK 1B9ZA 4B95C 3WTUA 4BQ8A 3QPQD 3SEPA 4XAWL 3QZOA 3RU8H 3E8VA 3FOLB 4Q9QL 2RD0A 1DQJA 2BFVH 2NY2D 5DJDB 1I7TA 5B1JA 4HMEA 4XCFH 1XZ0A 4XHQA 1CFMA 2XI9A 2WV3A 5IBUB 2Z0UA 3T0ED 5E99L 2OCCB 5FK9A 4MXQD 4GRLC 2WLNA 4M61B 2AVGA 4Z7OB 2C3VA 2DBJA 4WHTB 4C55A 3FQRB 3V2AR 4DEUA 3IJYB 1X5FA 5DT1L 4KTEH 4NQEE 2EDOA 3FQTB 2VITA 4M93B 1T2QL 1PZSA 1ZMYA 3EF4A 3BKMH 5LGYA 4ZUSA 5CHNB 4LLMA 3QG6B 4EI5D 2FTAA 2HXAA 5KBNC 1WAAF 4NIYE 5GS1C 2XWJB 1Y18A 3S4SG 5JMRA 2ZXQA 5I19L 4KKZA 1KACB 2ATKA 2QADC 4MAUH 5IJCC 3SJVB 4FKEA 4HBCH 4W4OC 2BNRD 2VLMD 3FDWA 4OB5H 3COOA 2BVQB 1R0AH 2SODB 1MCJA 4JRWA 4N3UA 1N7ML 5DJYB 3ESOA 5ESQB 4U49A 5IP4A 1N6QH 3V10A 4PI0A 3V4PL 5AOMA 1IFRA 3ZRFC 3QAZC 3QJHB 3G6JB 2NR6C 3OKMB 3S2AA 3DX2A 1EDHA 1PS3A 5KSVA 2PCPA 4XP6L 3OKOA 4KXZI 4LVHC 3QQ3A 1YNTF 1CICB 4M7JH 2A6DA 2VDOB 4YDVB 3U0TB 2DD8L 4CADB 4AQ1B 4AJYV 3GFUA 1QBLH 3OSVA 1J0KA 3WELA 1IX2A 4WWKC 2X4PB 1YEFL 4FFVD 4HWEL 2NY7H 4PJCA 2YD0A 1DSFH 5L8LB 3WENA 4F2EA 1L9PA 4R2GD 3KYOB 4XVJL 4JFHE 3ZKQD 2ZWYA 4AQOA 4GRLA 5IHBA 1BIIB 1BYOA 5FYLD 1OGTB 1WC7B 1RIHL 3TEZA 4QTHA 2NDFA 3LEXA 2AZUA 4HJTA 3MR9B 3SE9L 4W4NA 3NJKA 1AHWA 4U1IA 5IVZA 5IHZB 2H26B 2AAVA 1IBHA 5ESAA 4GKZA 1GMIA 4L1TA 1TSRA 1JV5B 3NTCL 4FGMA 4C54A 5GS1A 4S1RH 4Y7OC 4NC1E 4YSTA 3QIUA 2BK8A 5M94B 3HC4L 4IYKA 1ZXQA 5F7YC 5D5MF 1YHPA 1YO4A 5BRZD 2XWBB 4MLIA 5IB2A 4Q97A 4W4OA 2NNAB 2R0ZL 4PVNA 1WBYB 4LCWA 3C12A 3UPRB 4F7EB 2AXFA 2NRDA 2X4TB 3ENEA 3QPXL 4Y1AB 5TPWH 1WITA 4WSKA 5DT1H 1R6VA 4UBDD 4A7TA 5IGXH 4HWUA 4B9GA 1N0LB 1H3TA 4KQ0A 3S3DB 4NPKA 2ZOLB 1QHQA 4L0YA 2OS7A 4XTRC 4PR5B 3MRBA 3NACL 4Y5YB 3F7PC 1F11B 1Z32X 2VR5A 4AIZA 5B7FA 2R29H 5I28A 4X6DB 3H54A 1AYRA 2D7TH 1O6SA 2MPVA 5C3LD 2HSIA 3TV3L 3ULAB 1FO0L 2WINB 3B5TA 3MCKB 3W3BA 4JRXB 3GS0A 3VTMA 1AG6A 4WWKA 4XVTH 2DTML 2RA1A 4AY0A 4G8GA 1YYMH 5ADOL 3SD5A 1GS8A 1X6LA 4FMFA 4QKTA 3A5VA 4UQIM 3VGHA 5EN3A 2LHAA 1ROCA 1X5LA 1MIMH 3N42F 2KLSA 1UZ8B 4JHBA 5DURD 3CFJB 1AXIB 1JZ4A 4N22A 2VDRL 3DPDA 5I5RA 4O02A 1R75A 4WTWA 5TDOB 4RQQA 1J10A 2DICA 1V27A 5GGTA 2AQNA 4J3VA 4XNAA 5E2UH 5GGRB 3ABLB 4JDEB 2DD8H 2IANB 4TS6A 3C5ZB 3RURA 5B38A 3CWGA 2ITFA 1HZHH 1KIUA 3O41A 5JOPD 3UZQB 1ZVNA 4FC3E 5CZKA 3K7UA 1KGCD 5DRZB 5AW9B 2X05A 1CZ8L 3Q2WA 2WM0A 5EO9A 2KUTA 5LHDA 4KGJA 1HC1A 4P49A 2JKTM 4ZUWB 4AWJC 4WI0B 5DYOB 1KTRL 3WFCH 1IGIH 2FJFA 1NIDA 4JFVA 4D8OA 1JDDA 3ECUA 2V2WB 5KYWB 2VMEA 5PCYA 1DHKA 3SE9H 1KDJA 1ED3A 4KGLA 4U1LB 2GJ6B 5BNXD 4PJ9C 4PAZA 3S88L 2CDFB 2WZAA 3DROA 4GAAA 4NJ9H 1A7RH 4F2FA 4R90L 2UY7A 3NTCH 4UNIA 1TMCB 2GVYA 4HC1L 3O3AB 4I4WB 4X6EB 5F93C 5MEOB 4HK3N 4OW6A 5E2VH 1DVFD 5CGYD 2R0ZH 2DIBA 1MJ7H 3O6KH 1AS8A 3MV8A 5LNDA 2HP4A 2X6AA 4P3DA 2H6OA 4LDLB 2IV9A 1S7RA 3DNKA 3KWVA 2DKMA 1KSRA 4FZEL 4WDIA 1M4KA 1U8OB 3BP7A 3BCFA 3FTYA 3CLFH 2MJWA 4W9IC 4JDZA 1JWMB 3WUWA 2BSCA 4DZ8A 4ZMQA 1DVFB 3NACH 2DQUL 5I17B 2ORBL 4LSSH 3AGVA 1AACA 3UFIA 2WXMA 1U8KA 3UBXA 3HE6B 3NCYP 2VGLM 4Z7UB 2PETA 3L4TA 4H0IA 5GS0H 2HFFA 2E3VA 2YK1L 3FK3A 4AIEA 3NSXA 4HISA 5IQMA 4N0FB 4PGDB 4XX5A 1I9JH 2WAHA 3MO1B 4IS6A 4AENA 1XCTA 1LK3L 2UZIL 3IFOB 1AJ7H 4QYOB 4ACPA 1WGVA 2QTVA 4HP5A 2AF2A 3F85A 3MCLH 3V4PA 4DTGL 5E4OA 5E1IA 1UZ6F 1SMAA 2GBUA 1G0XA 3JTSA 2VDRH 1INEL 5GRVK 2WKLA 2VM3A 2NXZD 3INUH 4QNPF 2R23A 4XP9L 2CUHA 4KY1L 3WEMA 3OX8B 5SWQB 3GTNA 2E8YA 2IQAA 4PJ9A 4PRPE 3TEXA 4Z3JA 32C2B 5F7LB 5IY5B 4UF7C 2LVEA 4ZPTB 4Y2OA 4EIZC 3KPSA 2DI8A 5I75C 4YWGL 1QUPA 2Q86A 4Y1TA 5FUCC 1L3NA 2YLHA 4N6QA 4LLQB 3RY6C 2Q76A 3GDCA 2ESVD 3FFCA 3W0WE 2XN9A 2JK5A 1LEKA 1KIPA 3HLAB 1MAJA 5DVNA 3VRIA 5BZWB 2NW3B 5ID0B 3IJEA 4ZFQA 3JWDH 3C5JB 5CJ8A 3I9PA 5HHMB 3S3CB 4D9QD 5AD0B 1QI5A 2P43B 4OJFH 1QRNE 4Z0XB 2WWKO 5GGUA 1MCPH 1QACA 2OSYA 4JDVB 1U0QA 3MC0A 1OAZL 4GS7C 3ZE0E 4CVXB 1MI5A 4U4IA 3KEDA 3S88H 1A1NB 4K7FB 1P5UB 4XAKD 4R90H 4RISL 1DBAH 4LLWA 1IGYB 4P23B 3BT2H 5BRQA 2IMNA 1FF5A 1MHCA 2X3BA 1GOGA 1YEWA 4LHUA 5AEAA 5EU4B 5EULV 1KCRL 3MJ8A 1PKQE 4M4RA 2EH7H 1OAKL 3GTTA 2VYRE 4N8VG 1GW0A 3TBYA 4JFPB 1AS6A 1J87A 1R5IA 3EGXB 1DUYB 3ES6A 1PG7H 3A6CL 4XMZA 3JWDC 4U1HB 2VMCA 3WNMA 1FFQA 1UXMA 3D1MC 4YDIL 1E0OB 4PP2A 3OKNA 3QFJB 4AH2B 5IB3B 5DGRA 3WS6C 4G6MH 4QO1B 4WKXA 4M9PA 3BPCB 5ACMA 5I1JL 4X99A 4Z7VF 3EOBB 4G9FD 4JFOB 1EFXA 5FCUH 3TVMD 3NBNA 5T1LD 3IJSA 4MQ7B 1QI3A 4Z0BL 3BI9X 3CPLB 3TPKA 2BPBA 1A2YA 2DQIL 4LL9A 3P3YA 1FO0A 2DWEA 4KK8D 5LBSH 2GPZA 5DUPL 4AEIL 4W6XB 1C7SA 3WL9A 4AYFB 4JN2A 2APTA 3MJ9L 3TM6A 4BE6A 1J0IA 2Y7QA 1OTTC 4XN9A 5A7BA 4G70B 1HTYA 2B39A 3ATDA 4WTZA 4Y4HC 1X7QA 1IKFL 4G9FB 5I15L 3VYPA 4KHTH 2J88L 2KLTA 2ZAIA 1N8ZB 4CUCA 5LQBH 1N64L 1H3GA 2DYSB 5SX4I 3VGDA 1INQB 2H9GA 4J8RB 2UWEB 2ERJC 3MRPA 4L4TD 4WEUD 2AHIA 4L4VB 1INEH 2GY5A 5JXED 1Q9LB 1ZV5A 4NDMB 1K8IA 3DRQA 1KLGA 1NM9A 2CDEA 2YD6A 3GXIA 3MUZ1 5H4YA 3X3FH 2A2QT 5F72S 4JG1H 2Q10A 3ZKSD 1A9EB 2FLBT 5I8OL 3DV6A 2CO1A 3GKWH 3QFGA 4OZIA 4NWTH 3AT9A 1KXQE 1TZHA 4F1ZA 1OD7A 1XH0A 1OY3B 4Y2DD 3QNZB 1QW9A 4GQQA 1E67A 1X5XA 1YMME 4NUGH 3KYMB 4A7QA 3L3KB 1JXGA 1Q0XH 5LN4A 3G08A 1KBVA 3D0AA 2EYRB 4NQCD 3G5WA 5DSCB 3T3MF 3BEWA 2Y1AA 3PFUA 4NSKA 1ADQL 2C26A 4H1LH 1IM9B 3WS6A 2X6BA 4DP7X 4Y2DB 4N2IA 3NFNA 4FQHA 4TTDD 3KLAB 1BOYA 1MELA 1N4XL 1NDMB 4KHXH 3NCEB 2E7DA 4JN1L 4HC1A 1ZLUK 1OSYA 3JWNG 3ZUNC 1U8MA 2W1NA 3ZYOA 4YBHA 1OAKH 4UT6L 2IDFA 4U3SA 4N1CA 2VSMB 1CFVL 1JK9A 1IC5H 5DD6A 3LXAA 2NYYC 3CSPA 3A6CH 5ALCL 1FL3B 2CO3A 4ZPVA 5CN3A 1X5ZA 4Y4HA 5EUOA 4DGVL 4HKZA 2HJKA 5C6TH 1MZZA 1RK1A 4FADA 4QHKI 3J8F7 5GSVB 4LSUL 1ZHLB 4WIQA 5EOCH 2Z91A 1ANUA 2Y1ZA 3VWKB 3VI3A 1FNFA 3EFOA 2KH2B 4EDXA 4NN6C 5IHWA 4PRPA 2ZNWA 2WCPA 4Z0BH 5M95B 3PUUA 1Q90A 3SCMC 3VD7A 1P7KB 3RFZC 3F7YB 3ERXA 1J7VR 4B6ZA 1MWOA 3PV7A 5BPPA 2WZPD 5KANG 2IFFL 3PAVA 4POZC 3OAYK 3OXRA 2Y4SA 2O5ZL 2IF7A 4U1MA 4DJMA 1FSKC 3N04A 4PGZA 5FGRA 4BXSV 3ZSTA 2DKSA 2XTJC 2DKUA 2NY6D 4C4KT 4OF3A 4Z3HA 5L0QC 3DBXA 5DJZB 4ONGH 3R7RA 5DFTA 3TBCA 3C8KA 3UEQA 2IAMB 5E6IA 2ALAA 1I9IL 3VFUA 3V0IA 1GS7A 5C3IA 1NH6A 1WDAA 1T5XA 3DC0A 2KZKA 3QXDA 2Y06L 4BZYA 3MRKB 4X9BA 3RDTD 4HCRH 4PJIF 3RL2B 3W9DB 2I9TB 4NT6A 4ZFGH 1NEPA 1QWUA 2A0LD 3JXAA 4KI5F 1QVOA 2JFCA 3UPAA 2NY6B 4APQC 4YIQA 2YJLA 1PKQA 3EXJA 3WN6A 5F9DC 3HVDA 2CIIA 5FF6B 4PB9H 2FD6L 2V7HA 5E9DB 3OTTA 3WHXA 3A67H 2XZAL 5D1XE 3DK0A 1QBML 1MFAL 2VJ8A 4ILDA 1JWUB 3RDTB 1XL4A 4AGNA 5DWUH 4JO5A 5JXAH 2AJZA 1ADQH 3KPLA 1BZ7A 1YECH 3FW6A 4ZXBB 2BSED 2W07A 3HI1A 5F0MB 4CMHB 5IB5A 35C8L 5F2FA 1N4XH 3BHBB 5JR1L 5F7UA 2DLIA 1BVOA 3TJEL 3RP1A 3G04B 3SY0A 4DKFL 1M2VA 5JHBA 1SJMA 3HG2A 4NZDA 5FHBL 5E95B 4ALAL 5BOZG 1S3RA 2WP3O 4G5AA 5A2LH 1PQZA 3TZVB 1KPUB 2HFEA 1C08B 3V6OE 2WGXA 4AIXA 1C8QA 1M71A 3GTVA 3HBZA 4LEOB 4BH8B 5ERWA 2WYZA 5HD8D 4YXKL 5D7LD 3BP5B 3PWPE 4QRQB 1V5JA 3SGEI 4LP4A 3G5ZB 4P5MB 1IVTA 3PNRB 1AGCB 3VE0B 2XKNB 3G5VA 3RWHB 3S96A 3VRLF 1N68A 5D9SB 5FECA 1G7MA 4MJIB 3CXFA 2WB1A 4B0MB 3PNWB 4RDBA 1UB5B 2A6JB 4M62L 5I1DA 5JYLA 2QR0B 2J5LC 4R7XA 4FJ6A 2EVJA 1AI1L 5I5JA 1YEGH 1YMMA 3QHFH 3H6AA 3MJ9A 2KERA 4DO5A 2O5ZH 1BEYL 4JCWA 1ERNA 3HOGA 1MW3A 5K59F 4AL8H 2CJTA 2FEEI 3HW7A 4UM9A 4OBSA 4PLKD 4AKOA 3VFMB 4PVBA 3ULUL 3HZMB 1CR9H 1ILSA 4G59C 3HAEG 5AKRA 2F8VA 3ZKND 4V2BA 3M17B 4JHVA 5JQIB 1P6AB 1I53A 2Z8VC 3SD2A 2VZVA 2Y06H 4N2AA 2GBAA 3OLDA 4CRPA 2NY1C 3DHPA 1G0DA 2HVJA 3Q5TA 2DWDA 4NHCL 2PN5A 3I3DA 4NKDB 5GXBB 4XVSH 1K6QH 2PF6A 3KYNB 3VH8G 1AKPA 3F8UB 5IKCB 4GAYA 2KBGA 4L8CB 4GH7B 5I74C 3PREA 5D1XC 4ZUTB 2ZCKL 3KPOA 2FD6H 3LIZH 5AVVB 4PWKA 4OCNC 1D6VH 2VQ1A 2XZAH 4JQXC 2E46A 1LO2L 2B5IC 3EO9H 1FFTB 3ESMA 4FFZL 4P2OC 4P9HL 5A2CA 3ULUE 4LF3A 5HYSA 1ASQA 3GLAA 1WD9A 2P24A 4TUJA 1HSAA 2L7JA 1OOWA 3AW5A 3P2TA 2VW4A 3F84A 4GSXA 3V0FA 5C2BL 2EYSA 4PRID 1N6VA 2RB8A 5B1CA 2YC1A 2J8OA 3ECBA 3N1GC 3TJEH 4DZBA 4CW1A 4QJ4B 3BAIA 2XWCA 1I7UA 3V0WH 1RAMA 1H15A 4MAZA 1W72H 1DQJB 4UT6A 5DLMH 5JA9A 5HDLA 4IRJB 4ALAH 1I7TB 2NY3B 2WJ7A 3B2VH 1G6RH 4DN3L 4ZW8A 4HS8L 4DNLA 1XZ0B 1MWAB 2HUHA 4QRPA 4AE0A 3LZQA 1OB0A 1NOLA 1BECA 1JP5A 1QD0A 5FK9B 2VN3A 4XVUD 3UC2A 1FLRL 4YXKH 2C3VB 3VJ6A 3WNOA 4I89A 1W6WA 3G6AA 1K72A 4Q0XH 1NEZA 3GIZH 4FQIH 3HNTL 4LEBA 3BGFC 5T1DH 3T65A 5IROD 1U3JA 1CDIA 2VITB 2O5XH 1CGSL 3CUPA 4EOWH 4PS4L 2NQ3A 4ZUSB 2WB7A 5EU7E 1BQHG 5G55A 4KMTH 4ZO8A 1FH5L 4ALAC 2BNQA 1Y18B 1LP9E 3K91A 2ATKB 4M43L 2P9RA 4KMLB 5J11C 1BEYH 3Q8AA 4NFBA 5F7EL 5D1XA 3SGKC 4PG2C 2IBZX 1I1AA 5E6UB 4AKPA 2BOCA 4JQXA 1JS4A 4GOSA 2P5EE 3ULUH 3KPRA 1YSOA 5I8CA 4NO5A 4QKXB 1P53A 1RQ5A 4U3XA 5F1NA 1U30A 4L3AA 2JIXA 2GKIA 3QZPA 3SDXF 5C08E 2XQYG 4AVHA 4GRMA 1LO3H 4NC2B 4NHCH 3QA3A 2ITDA 4RBPH 3ZGIA 1S7XA 3ML9A 4BQ6A 3LZRA 5KSVB 3RTLA 2PCPB 1WG3A 2PCFA 3FQWA 4BE5A 2C9AA 2I27N 1P4UA 5IK3A 3GF8A 5JPMC 4R84A 4HFWA 2ZG1A 1YQVH 2A6DB 2DTSA 1N0XH 5CUSH 5T3XD 3FTSA 2P3YA 2LOEA 3EYSH 3MMEA 5IW6A 2R9HD 1RK0A 2ZWNA 4PEEA 4PJEF 3ULUC 4XN4A 4MRCA 4PJCB 1JGUL 3ZKXB 2HVBA 3D4YA 4W9EC 3FRUA 1LO2H 4P9HH 4BKSC 2DMCA 1AR1B 1PG7X 1QBBA 1UXWA 1PSKH 4NZ8A 1HH6A 3ZE1E 1DZ0A 2VXSL 4GRLB 1OD9A 2ZWLT 3PWPA 5DJ8A 4E41E 1UA6H 5C2BH 1JSYA 5TK4A 2AQSA 2V8LA 4OFKA 1M3JA 4QTHB 1AR2A 3O6ML 5TFSH 3LEXB 1DQDH 1MQKH 5FYJU 5I1LA 3TWCL 4BFIA 3EBIA 5AALA 1K5WA 2WQUA 1AHWB 4U1IB 5IVZB 3BN9C 1DVZA 1HU8A 2C1OA 4QF1A 3T9WA 3IKKA 5ESAB 4GKZB 1A6PA 5GS1B 4EN3D 4DN3H 2PYFB 1JZFA 4K4KA 4XNMA 2QADB 4HS8H 5MERA 4M7KH 3UBXI 4LESA 4P9HC 5AYUH 2DJ4A 2NR6D 3U7YL 4TKWA 1GJUA 5IB2B 3SGKA 1VFOA 1WUNT 1IGTA 4PG2A 3MNZA 1JUFA 4H0GA 3OHXA 3RVWC 2AXFB 4R5TA 3UP1A 4N9OB 3F01A 3UEZA 3BFOA 3KL0A 5JHAA 5EU7C 3LRLA 1YEDA 4Z18A 1DL7H 4NQXB 4YHOH 4PS4H 4M7LH 3ETBF 3FH8A 1IBZA 2FVNA 3JV4A 2CHDA 4GMTH 4H8HA 4Q56A 3AY2A 4U0RC 2CO7A 4HIJA 4LVHB 3D7PA 3LKOA 1HOEA 2HRLA 1XIWA 4M43H 3DMMC 5FGCB 4AIZB 5C0AA 1ZY9A 1EZLA 5TF1L 4KZCA 1O6SB 2WXHA 4FJZA 4X6DF 2YQBA 3X11A 3T2QA 3ZKMD 1VCBC 2PW1B 1IMHC 3RKDD 4K55A 4WWKB 1HH9A 2A9NH 3SDCA 3E80A 4G8GB 1WS8A 4XR8C 2Y22A 1PLCA 3C5XA 4RAUA 1U8IA 4ODWA 4JGJA 4GKLA 5C0BA 2NX5E 4ZMLA 3WEAA 1ZT1A 4QGTA 1IT9L 5E2TL 3I02A 5F1IA 4TTGA 5CEZE 3EFDL 4IW4C 1ULVA 5DHYB 2QLYA 3IMUA 1K8DA 1T1WA 4RQQB 4O58H 4NQED 3LNHA 1CQYA 5B38B 2BSDA 1KIUB 1GC1L 2F61A 1TJIL 4J3UA 1JGUH 2BP0B 2HT2D 3LZFL 4FHJA 1JG9A 5CGTA 3VI4A 4FFZA 1Q38A 2DM4A 1N8OE 5EO9B 3OWEA 2OMYA 1E5BA 4JY6A 4EBQH 3PWVA 3PQYD 4OU3A 1GOHA 4WU5A 3LEYH 3OM3B 3S7GA 3UIYA 2FJFB 3AS1A 4ANWA 3DIDA 3L4VA 4NOBA 4LSQL 3UCRA 1ED3B 4K94L 3T2OA 5EOQL 4PV8B 2FX7L 5F88A 3Q8EA 3LAFA 1FNEA 3DROB 1RHFA 2UY7B 1EZSA 1RUQH 5B3JE 1ZD6A 1AE6L 4XMXA 3DMMA 2FSEA 3NCBB 4TNWF 4OIAA 2H1XA 2P5EA 4MZIA 3WFDH 1JHTB 3MV8B 3NIGB 1PW3A 4P3DB 4PMFA 4HGKC 1S7RB 5C08A 3EYUL 4NHUA 2E76C 4N4YB 3AREC 2WMPA 4TXVB 3BP7B 2UVFA 5E1QA 4GG6E 3DJZA 3QJVB 4JM4H 5CEZH 2IPUK 2JCCE 1HN1A 2EEAA 2Y1YA 3O81A 4JDZB 4JFHD 1BZDA 3WUWB 3FBQA 4DZ8B 1I8MA 3AWEA 4X9YA 1RJZA 2FDBP 4HKXA 1BF8A 1CF1A 1U8KB 3UBXB 3CFIC 3SKMA 3I3EA 2HFFB 3Q8CA 3WOVA 4UQCA 4Y4KD 2ZUSA 5E94A 3MRGA 2B0SH 9PCYA 1YPZA 2H0FA 1IGJA 4IS6B 2DBLL 2FZ3A 3FKUS 5ENWA 4XB7A 4AENB 4ZW3A 3LEVH 2UZYA 4V2CB 4F3FB 1K5NA 3V4PB 3GYRA 1U8CA 4FMVA 1UWXK 4KBPA 5E9AA 4YHNA 4HT1H 1IT9H 5E2TH 3RKPA 1TETL 4MZ3A 3B56A 3CC5A 3GXPA 2HJLA 4UYPA 2JJWA 3FFOA 5AVTB 4H13C 5F3HB 4ERSL 2CXGA 4EI6A 4AEEA 2R23B 3PP3H 3WO4C 3DO3A 3DVFA 4MCZB 4PJ9B 1XCXA 3BH4A 3HMWL 3EG9B 4JW3A 4JKMA 5KBPA 4YH6A 2NXYD 4BRJA 1GC1H 2WXPA 4Y2OB 3SDDA 2F8XC 3LZFH 2XV3A 2Q86B 3VD2A 3QI9C 1QFUH 4F80A 1KBGL 1LYQA 1GIGH 2Q76B 3GHEL 3G9AB 1YNLH 3FFCB 2XN9B 3T0XA 3NCJH 1SM3H 2JK5B 1PFCA 1LEKB 1KIPB 1SXSA 1UOKA 3VRIB 4N0UE 4XCYA 3IJEB 5LNGA 1U3ZA 2XQBH 3MOAH 3DXAE 3H9HA 4K94H 4FNTA 2DM2A 5EOQH 3QORD 2YPVH 3ZT5A 5TQ0H 3MV9E 5FA4B 1IFHH 4BINA 2IQ9H 2XWXA 4QRAA 4OZ4A 1DP0A 1GC1C 4LLWB 4PJBE 4NX0A 1A6VH 1MHCB 1WFNA 3RUGE 4LHUB 4TVUA 4ZZFA 1AZRA 2AV1A 3MJ8B 4M4RB 4MTMA 4YX2H 4LPVA 1LQBC 4RGOL 1JGVL 1R5IB 1VACA 5JZ7D 3TU6A 5GS0D 2NTSP 2YOCA 3K1DA 1AGEA 4KXBA 1A4JB 4CA4A 1TYEB 3OKNB 4K94C 5AOLA 5H37A 3TN0C 4ZAKC 5I1KH 5EA0L 3T1FA 3CXHK 4X99B 1AGFA 1EFXB 1RMFH 4XC3H 2ITEA 3IJSB 4PJ7A 2DMKA 5IIEB 2AMUA 1WK0A 4YUEL 4XWOC 1A2YB 4MMYA 2X89D 1FO0B 2DWEB 4UM8A 2QQLL 2J7LA 3ZN6A 4F57H 5ANMA 3TONA 5T5FH 2D7MA 2BY1A 1SVCP 4HZ1A 3WL9B 4JN2B 5I75B 1KXHA 2IOIA 3QNXA 4BUQA 2BSRA 1MREH 1W6LA 3QI9A 4NUPA 1CLVA 1KB5L 4JR9H 4MZ2A 5LKNA 2YWZA 3U9PH 2HLEB 2AS5M 2FK9A 2Q8AL 3PHOA 2LAAA 1TETH 3VFWA 3C2AL 4I9WE 3MRPB 2GYSA 2UWEF 4WI7A 2VDRB 1KWKA 4ERSH 1CD9B 1DEEA 1K8IB 2WYIA 4HAFA 3DRQB 4A2GA 1FHGA 1SYSB 2CDEB 4GS7B 3PABA 3BSGA 5BS0A 3TA4D 4F9PC 2V7NB 1JVLA 4PHXA 3DV6B 4OZIB 2PXYC 1JXDA 4G6FD 1TZHB 4CJ1A 4U6YA 4UIKH 3UYRH 3ARVA 5JYMA 4ONFH 5IZ7A 1QW8A 4ELME 3GHEH 2CRYA 3X1GA 4NPYA 3DDGA 3WAKA 5ESVB 4XPHL 3G08B 1S2EA 1ZDQA 3BWAA 4JY5L 2CHWA 2B1OA 3BEWB 2ZX9A 4NSKB 3WHE1 2VLRE 2ED8A 1S7VA 4LAQL 3TN0A 3U0WH 1HYSD 4ZAKA 3H8NA 2I60H 1MNNA 1A25A 4V11A 1XGRA 3DK2A 1WPCA 1WV7T 1YEHH 3E6HA 1DQLL 3S8WA 4MNHA 1GYAA 1U8MB 4R96B 5FS5A 1UKSA 2LU5A 4OCYH 1ZK9A 3QZWG 3E1ZA 3W2DL 1BG1A 3U4AA 1A14H 2OZ4A 4OVUA 2XICA 1MF2L 3W81A 4ECNA 5IW1A 2YS4A 5I24A 4ZPVB 2E9BA 4Y4HB 2VR7A 5EUOB 2HJKB 1QSFE 4YDMA 4A37A 1RK1B 3D2UA 3NZ8B 2DIAA 1X5MA 4AEHL 5EG6C 3W0WD 3IMVA 2Z91B 1OSEA 3VI3B 1MJUL 3EFOB 2BOLA 3QC5X 2ERJB 1AYOA 2FATH 2VJ0A 3EGSB 2G75A 4PRPB 2OM5A 4TSBH 4WJG3 1QFWM 1QRND 4H8PA 3ZDYE 1D5IH 1TTUA 1XTMA 1BQ5A 4UT7H 1FORL 4F9PA 5BRPA 2WWOA 2HPOA 3HC0A 4Q74A 3DSFL 5K9QG 4ZBJA 4A7SA 4J39A 2VL5B 2VISA 4U1MB 4C56E 2P45B 1HEHC 1KB5H 3ULSA 4YQXL 3QULB 1GSMA 3MRNA 1ORSB 2C9QA 3GRBA 2Q8AH 4CU6A 1I4FB 4B9KC 3VFTA 3C8KB 3AVEA 2OR9L 1L9MA 4J5VA 1FVEA 3VFUB 2EE0A 3MXVH 1T5XB 2DMHA 2LV4A 3MV9A 4IOIA 4QEGA 3ZE2F 3QXDB 4LSTL 1MCNA 2EXWC 2BW4A 1B0WA 1FAKT 4BHUA 4J6RL 4Z7QF 4XO5A 3V8OA 4OTXL 4NT6B 4QRRE 1U91A 2QSCL 4CSTA 2ROXA 2V17L 4K0OA 3V79C 2Q2LA 1T3FA 3EYVB 3QRGL 4DK6A 3EH4B 3MUUA 4YIQB 5JHLH 4X7SL 1PKQB 4JZNA 1I31A 5J5EA 5FWRA 2WZ5A 3GMNB 1MCHA 2K7PA 3VG0L 2VKXA 3KVPA 3T71A 3MBWA 4F5CE 1ZHKA 4JGMA 1TIUA 1DCLA 1WWCA 4HJSA 4I2XE 4NKOA 1OP4A 3WHXB 1QSZA 4ZS6C 5D7KE 2LU3A 3SCMD 4LQFH 2YAMA 3CSYA 5IVXE 2C3GA 4M48L 1ORQA 2MQGA 3QUXC 2A99A 2AJZB 3KPLB 4X5QA 2GITA 5LBGA 1F1GA 1OTSD 2W07B 3HI1B 4H1LB 1GYUA 1R3HA 4W6WB 5IB5B 2CH8A 4JO4L 4LHJB 1HDMA 4NN6B 1PCSA 2JTYA 4L2YA 4WK2B 4A67A 1OV8A 1M2VB 2WW8A 4NZUH 4M1DL 4LRNL 3WKQA 1M7IA 5FLVA 2VQ4A 3LNGA 2Y5TA 2Q6WA 2K6YA 1P9MC 5ICUA 3VGGA 4BQBA 4ZMVA 4AC4A 4AVIA 1PQZB 3BP6A 1FSKB 3B9KC 2HFEB 3DUUB 4RA0C 1QX1A 2XETA 3QK0A 2XTJB 1M71B 4APQD 5L0QB 3GMLA 5JPNC 2WTRB 2J6EL 1KLUA 3BQUC 4M5YL 1MJUH 1N19A 2L04A 4CVZA 1GTFA 5EIQA 1CGWA 2FQGA 4UNUA 5D8JH 1QR1A 1CLOL 2ZKWA 3G5VB 4HBQA 5FWQA 1E5AA 3S96B 4ZW7A 5DJ6A 1PZBA 1C1EL 2DQHL 4GIPD 1G7MB 5FECB 4GSDL 5JW4N 4OM1H 3L3OC 1QWNA 3ZJAA 3RZWA 3GNMH 4XNXL 1FORH 5I1DB 3OLEA 3BD3A 3BH9A 2K4WA 2G60L 4APQB 1HWHB 4ELMA 3VW3L 2QSTA 4WUKL 1YMMB 4CC1A 1A6AB 2YBRA 2JH2A 4LZHA 3U36A 4YQXH 5LWYL 3QR0A 4ZSOE 3S37L 4K3HA 4UM9B 1GKOA 3ILPA 3FB8A 1TQCC 1LDSA 2QKIC 2OR9H 4KQ3L 4G7VH 2EDNA 4G80A 3BIKB 3QUXA 2OBGA 4MDIA 2UZPA 4LSTH 4PCTA 2L7UA 4N90D 1QQDA 3WDHA 4HCFA 3BWUF 2F0CA 4A38A 2DWDB 1ZOXA 1JWSA 1YUHA 4AJVA 5AKVA 3MGTA 2EAEA 1SGKA 3MBEC 1RJCA 1PLBA 1UCBL 4GAYB 3DGGB 5EIIG 4JQIL 5IQNA 2HG5A 2AGJH 5TQ2L 4YHPA 3VG0H 3KPOB 4NP9A 1P7QA 2GSMB 2J1XA 2VMDA 4A7GF 2YJQA 2Z34A 2VQ1B 3LPFA 3WDJA 1BVNT 4ZO7A 3ZX1A 3S6CA 1P9MA 1JRHH 2ENYA 2JMRA 4OUUA 3B9KA 4H26A 4WTXA 5HYSB 5E1AA 4TUJB 2P24B 3OKEA 2X4UA 4GFTB 3FSZA 1XBRA 2EYSB 3FPXA 2DQDL 3BUDA 4JO4H 5GGQL 2ED9A 3S8GB 1O6TA 2YC1B 4XOBA 3ECBB 5D1QA 4DZBB 4CW1B 1NGYA 4WQOA 1DQML 1I7UB 4EUPA 1H15B 1SYVA 2WWMC 3AABA 4XZUA 4K8RH 1F42A 3L3OA 4F92B 5EF3A 4LRNH 2E27L 2Z64C 2B3RA 3EOAA 3NZHH 5F7HA 2JVUA 1E40A 4PV1C 5C0CE 3IKCA 2J5LB 4Z77A 5EOCJ 4LNRA 1ZLSH 2QVTA 1CE1L 2TRYA 4WW1A 3T4AC 1E2VA 1NUNB 3IDMA 4QRPB 1QO3A 2B1AL 2ZCHL 1T7YA 3Q06A 2ITCA 5IVNA 2WQSA 4R0LC 2J6EH 2XIBA 4M5YH 4W9GC 3G6AB 3ARBC 2PMZA 2QKIA 3BEVA 4WGKA 1F4YL 1CL7L 4LCIH 3QUZC 2A77H 4KRNA 3CUPB 4R26H 3FB5A 2BS9A 1OF0A 1C1EH 2RBLA 4TRPH 4JMNA 4DN4H 1NUGA 2NY1B 4QUOA 2XX1A 4XNXH 2WBJA 4P2OD 1ZLWH 4CC4C 2BNQB 3FYEB 3ABMB 3IFNL 3MBEA 4JFSA 1SBSH 3MFFA 1A7NL 4EN3A 4F5CA 5I74B 4I2XA 4JJHA 1RL1A 5D1XB 1I3UA 3DSNB 4K2UH 3HR5A 5LWYH 3S37H 1FQ9C 3FUKA 3L3IB 1TVHB 2BOCB 5J1AA 1BFVL 2X1PA 3MNWA 3EOTL 3KPRB 4Q14A 5I8CB 4MCMA 4NO5B 5CCGE 5K1NA 2B5IB 3B8YA 4D0DB 4P2OB 2JIXB 3KJ4C 3OKDB 4E9VA 2W92A 4R8WL 4QJ5B 1L6XA 1XH3A 2FHFA 3RWFA 4ZODA 2UUDH 4GRMB 2H5UA 4BK5C 2X4SA 3IPFA 4G3YL 5GSRA 1NBQA 4RRPA 1MEXL 4UOZA 3QIBC 3FQWB 2PCFB 3QYNA 3H42L 3GD1C 5IK3B 5DVPA 4JQIH 2ZG2A 2P8PA 5EEWA 4TSCL 5IW6B 1DQKA 1LO5A 2R4RL 1RK0B 2NLJA 4KKCC 4HH9A 3RHWK 3RIAK 3UGEA 5FUZL 1J86A 4PJCF 4L3CA 3FRUB 1MW0A 2H8PA 4IBQA 4OSUL 4YE4H 3WI9A 1PAZA 4B7IA 1KG0A 4ABWA 1UXWB 4Y2LA 1J1PL 4R0LA 2DMGA 3PWPB 4NAQA 4RMRA 1BX2A 1UACL 3F58H 3PGFH 5GGQH 3ARBA 4FRWA 3ZDWA 2B4CH 5I1LB 2QHRL 3BGFB 4BFIB 1TF4A 3V0AC 4FFTA 2ADJA 3TOPA 3F83A 2C1OB 2VN5A 1EO8H 4QHLA 4PUBL 2COVD 4CC4A 4LVNC 1A3ZA 5IOKA 1BXAA 4A7UA 5KZCB 5MERB 4ZSOA 3BESR 5D7IA 1W0VB 1IGTB 3MNZB 4MS8C 1AHMA 1WCBA 2KKQA 3OHXB 4WLCA 3WS3A 3FNKA 4HUVA 3ALXA 1SXAA 1MCFA 1F4YH 5HPMA 3QJOA 4UTAL 2D2CC 1YEDB 1B0IA 3MA9L 5IV2A 1J8KA 2F5BL 2N0KA 5J9PB 1HS6A 3JV4B 3RI5K 4BK5A 1IC4H 4B9IA 3QIBA 1GHFH 5I2IA 4PV9A 4HIJB 3KR3H 4EIUA 1A7NH 2XJKA 3LKOB 1MN4A 3TO4D 1XIWB 4WVRA 1PGRB 1UWYA 1WYJA 5DD0H 5C0AB 2YWYA 1C5DA 4V1DE 1CIDA 5JPMB 2EUXA 5F1KC 1XCQB 3X11B 4DP8X 1FIGL 3GBDA 4HJIA 3L45A 1BFVH 1KFAH 4DGYH 1HH9B 2HB0A 2V5YA 3D6GA 4BCZA 2K3TA 3KS0H 3BN9D 5IHLB 2R4SH 1U8IB 1B6DA 5EWIH 4ODWB 4R7NA 5C0BB 4QOKE 3OLGA 5EU5A 3X1EA 1ZT1B 2NOYA 3QEGL 5A2AA 2FX9L 4G3YH 4WENB 3DLQR 5F1IB 3QB7C 4HHWA 4UANA 5T1JA 3H42H 3FQXA 3VWJD 1K8DB 1T1WB 5B39A 3M1OA 3M45A 3RVWD 1CLZL 4OUOA 1KGWA 1OZTG 3IDXL 3BAYA 2NY0D 4U1GC 4IGBC 3GZPA 4Y4KA 5FUZH 1NGQH 3VTAA 2BXYA 3LH9A 3CLEL 2P5PA 3H7LA 4ZNEE 2J8UF 3VI4B 1DE4B 4PRHE 1FZJB 4GQZA 1OF2A 3A21A 3UZVA 3DO7A 4MFHA 2OMYB 4XN1A 2Z7UA 4JY6B 3PWVB 5KVFH 1DJYA 2I5YL 2LLNA 1UACH 2ICCA 4I0PA 4L3FA 4WU5B 1UFUA 4A66A 1BOGA 1AD0A 1CWVA 4KNSA 1RPUA 5D7SL 4OCWH 3WLWD 3L5WB 1AQHA 1VAHA 1DBML 1UXLA 1FIEA 3GSQA 3OJDA 4S1DD 5F88B 4X4ME 1LP9B 1FNEB 1OT2A 3O4LD 4PUBH 5T1KD 5EZIH 1CJYA 1OAUL 2WJ5A 2Z1PA 3RGVD 4HSAC 1NCBL 3U7WH 4YSAA 4ZMYA 2YR3A 1M6UA 2YPLE 3RJQB 3TH4T 4X7DC 3DMMB 2OJZL 2FSEB 3O3UN 4OZHF 3P3RA 2P5EB 3BYTA 3O2DA 5CJQL 5FKAA 3U0PA 3LZOA 2W59A 2I69A 4YDZA 1I1CA 3K8MA 3NIGF 3QUYD 4KK5C 2PTUA 4J6IA 4P04A 2B9AA 2X9ZA 4MJJA 4P05A 5C08B 4NHUB 5FLUA 1YVLA 2WMPB 5FW7A 2E75C 3OF6A 2DI9A 3EGDA 1IGFL 2DM3A 4WWPA 4L9DA 3CZSA 1KGJA 3LVEA 3VA6A 5CFAA 5DVOA 4FNQA 1SF3A 3ILEA 1I8MB 3RWDA 3VXQA 1BLIA 1DYZA 4E41D 1CUOA 3QEQE 1U8LA 2X6VA 5CKAA 1RJZB 5MI0C 3ECVA 1NBCA 1NICA 4HKXB 2XBDA 3TV8A 3K0WA 3SKMB 2KS0A 3C60D 3NJIA 3V55A 1FIGH 4OQ1A 3RWJA 3HFML 3VXME 5E94B 4IGBA 3MRGB 4MA1C 5BVPH 5SWSA 4LEEA 1WZLA 1TPXB 4FQLL 4IBZA 2E56A 1YPZB 3TNNA 3WGUB 1IGJB 1U8QA 2OTWA 5ENWB 2VR8A 3ZE1B 2UZYB 3I74A 4E41B 5ITBL 1MJ8H 1L9NA 1K5NB 3D51A 1U8CB 1J0JA 3L9BA 3MCYA 4KAQL 1J9RA 5D6DC 3ROLA 3TGXA 3THMH 2RGSA 1KJ2L 2R2EA 1NC2A 4J3WA 5BW7C 2HKAA 4OFVA 4JG0H 1KPVB 2JELL 3U9WA 2WXNA 1Q0YL 1WISA 5EEZA 4EI6B 5HI4C 4Z3FA 4KDWA 2EIDA 2K78A 3OMNB 4ADJA 3QJSB 2MMXA 4B97A 3WFBL 1QYGH 5J1SC 4BA8A 1FFPA 1RXLA 2NUPA 2Y2WA 1T04A 3ARED 1RIVL 3CXDL 5C9KA 1WFMA 5JDSB 2WNKA 3SPCA 3CLEH 5AWNH 3MV7E 4LKXA 1OGAD 3GUFA 2O5YH 2VXTL 1Y1UA 4W9DC 1I1FA 3VFVA 1BP3B 2J6WA 1KB9K 2OTPA 3S4SA 4XCYB 5D7SH 2UXVA 4F8TA 1ZLDA 2EP6A 3W11C 3AREB 2Y9RT 4PCSA 3H9HB 4FP8H 3BVXA 4J1UB 3SPHA 1D3CA 3NP4A 4OLVH 4TQEH 1KYFA 3GRWL 2QT6A 2NX5D 4HVBA 1Q72L 3ZMNA 4OZ4B 4AW7A 4F37F 4ATWA 2FJSA 3E38A 1HXMA 3CHOA 3K1KC 2IOMA 2YPKA 2YUVA 3NIDB 4PTUA 4ZMTA 3FT0A 5CEZD 1INDH 2XFXB 4N2GA 4L0ZA 4KJWC 1DFBL 4TLUA 2AV1B 1L9QA 3VFNA 2NZ9C 3CN4A 1HQRA 3RWCB 3IJ7A 4TVPH 1FYTD 2R2HA 2FWLB 4UTAA 1F45A 3VD4A 4XI5D 5D6DA 2ZPKH 1JZGA 3FSAA 1VLXA 1B0RA 2R8SH 4WCYH 1CC3A 5HHNA 5JUEL 1AGFB 3HC2A 4NM4H 4XE5B 4G9DB 1T4KA 4FS0A 5CP3A 3PIQA 1RU9L 4PJ7B 4G8EB 3WO4B 4AZ8A 2I25N 3KL3A 2AJVH 3MUHL 4M1CC 4MMYB 3VM7A 1N5YH 3N85L 4UM8B 5KVGL 3AY4C 4JE4B 4J3OF 5ANMB 1IEAA 5ABAA 3CC1A 4JHWH 1XGQB 5JIHA 4F1SA 1YEEH 4XH2A 3QNXB 3LIUA 3LVTA 4PJ5E 3NEXA 5HHXH 2BSRB 2W9LA 3QI9B 5ITBH 2CBTA 3CDGA 2ODHA 4LGRB 1KENL 3QW9A 1F90L 5FEBA 1KEGH 3PHOB 3VFWB 4NQDA 2QVIA 1OAJA 3LXBA 3D08A 1VESA 3DX4A 3GMQB 1A3LH 2D0FA 4BFEA 1DEEB 5F7DA 4EN2A 4N5ED 5DRWA 3ML8A 5E2JA 4E42A 1RIUH 4XN7A 1J05A 3ETTA 2ZKHH 4UAOC 5C07A 4AYEC 1AKJA 1L9TA 1R3JA 5BS0B 1W2KT 4BDVA 4A2DA 5I0XA 2QHLA 1RIVH 1OGPA 4OZIF 3CVIL 4U6YB 3VM5A 5KVGE 3V6FA 1NOAA 3P4LA 1R3LA 4K23H 4LASL 1RUAH 5F97E 1YMHA 2XN0A 2G0KA 4ZS7L 4HULB 5KN5A 1OB1A 3IRZA 2AW2A 4NPYB 3WY3A 1J0YA 2FB4H 1RJYA 4S0HA 4KY2A 4GEJA 3D3VD 3P0VL 2WXOA 4IMLA 3BWAB 1ZWIA 5DEZA 5L4IA 4G7YL 1AHKA 1S7VB 5AW7B 2EIKB 3TN0B 5H4ZA 3QIWD 3JVFC 3PXHA 4ZAKB 3GRWH 3CFBA 4KNQA 1AQ8A 4AQ8A 1XGRB 3LKNA 3E6HB 4IRZH 4MNHB 4B5ZA 3ABKB 4M1GH 4WK0B 5HDOA 3Q8FA 5CR8A 2NNFA 1JD7A 1W80A 3KBFA 3EZ8A 4B5EA 3SSGA 2FO8A 1B4LA 3AY4A 3S37X 2V2TA 1L0QA 1PLAA 2ADFH 5A2KH 3GMPA 4URKA 4QXTB 5IW1B 1JXFA 1GVIA 3CSGA 1CFQA 5EUOF 4QRSA 4MS6A 1NCDL 3D2UB 3M1CA 5E8DH 2D03L 1SJEB 2PXYD 4XBMA 1K3IA 2AK4E 4BZ2L 1HL4A 1J5OL 5IESH 2OSWA 3V9CA 3VI3F 1ZEAL 4AYID 3WKYA 3KPPA 1FJ1B 4NO0D 5JORA 2G75B 4WAFA 4R5VA 1LO0H 4H5SB 3N1QC 1OO2A 3DXAD 2A9AA 1THCA 4TULH 1FGVL 1ZRUA 2BDNL 3MV7A 4I1PA 3CMOL 2BRRL 1EZVY 1FZMB 4MKMA 1GGCL 2PXYB 1NPUA 4FJYA 2VERN 2VISB 1QAWA 5HI5D 5KOVC 4MJ4A 4XBEL 1JZ7A 3O2WH 4MHHI 3ULSB 3ZHLA 2JE8A 3MRNB 1F90H 1PPIA 5K1JA 1KJ2A 3O6FD 3HG1E 3DXAB 1JOIA 4UQDA 3VFTB 2XXCB 1FVEB 4W9LC 2GUOA 4JKPL 5J3HC 5JNYA 2YQ3A 3MV9B 3U6XS 1YN6A 4QHMA 4B41A 2BIMA 3VXSE 5EC2A 4HG4K 2CO4A 4PW4A 4NJAH 3LS5L 1U91B 2HX8A 3BMVA 3UERA 4YDKH 3RUGB 2IALA 1T3FB 4UQ3A 3CVIH 3FO0L 4JZNB 3CZFA 4JDTL 5KJ7E 1X9LA 1NAKL 5IHHA 1ZHKB 3GSVA 1IKNC 2H3XC 4EVNA 4NKOB 3D34A 4QHNA 4N2NA 3RVTD 3CSYB 3ZSSA 2KZ1B 2ZOWA 2F5AL 3ARDD 3CDCA 1OSZB 1ORQB 4LNVA 5AZEH 4ZD3H 3GK8L 3EH3B 3KPNA 2F8OA 2GITB 3JWNE 1W15A 2X4QB 4EKXA 4OLUL 2VSKB 1R3HB 3P3TA 4MJHA 5F1OB 1ZTXL 3QRFM 4OZFA 2WBKA 1EJ6A 1YNTA 3MLWL 5I18H 5CIPA 1HDMB 3FB7A 3RTQC 1R46A 1XD1A 4I9WD 1P4LA 2CJUL 1JDAA 1SEQH 5IMKA 3VU1A 3BRGC 2XWTA 4RBPK 1EXUA 2PTTB 4OCMC 5BZDA 4GUOA 5GJTH 1M7IB 2QELA 1EGJA 4XHJC 4Z95H 3MYJB 4YDNA 2Q6WB 2EXSA 2Y5TB 3IYLW 4I3SL 3S5YA 1XSJA 1VF5C 1ZV9A 4QIRA 3OZ9L 3BE1L 3H2WA 4IMKC 3BP6B 3CX2A 4OLXL 4J3OG 4PLOB 1KCSH 1NCDH 3EJQA 1UZ6E 3QPKA 3EOYG 4NN7C 4L8DA 4KZEL 3OKLA 1U8PA 1KLUB 1IARB 4G42A 1RLBA 3QWRD 5FCSH 4WTZG 3WJJC 3CSBA 3H3PL 4MVBC 4CVZB 4DIXA 4JPSA 5I71B 1RZQA 2HTLC 2ID5A 1J5DA 3AU1A 1ZTXE 2HT4C 4QNPE 2WKGA 3WV0A 5DJ6B 2VLRD 3MROA 5CINL 1FGVH 4Z7WA 5DTFA 3Q5OA 2C3HA 3VMOA 1J1OH 4TLSA 2DQJL 1GGCH 3BH9B 4ELMB 4P46C 4IBVA 5IHUL 2G4GA 3BPLC 2F68X 2H6UA 1I1RA 3NG5A 2P80D 1ZPLA 3U36B 4CMMA 3O11B 3CIAA 3LS4L 2E7CA 5ADPL 3HJEA 1KB5B 3IJ8A 3QWQB 1IKNA 1Z0NA 4NCC1 3ZPDA 1CGVA 3LRMA 2R51A 3RWEA 3SYPA 5EEVA 4MRBA 3FB8B 4OM0L 3IDUA 3QJUB 3JWNH 5JW3L 2XBTA 4G80B 3QUXB 5KTEH 4TL5A 4MDIB 1G1OA 3V6BR 5KJRL 1PX4A 4F58L 1QQDB 4TOYL 1QSFD 3L54A 4N26A 5HHQA 3UADA 4PGBA 1JWSB 1IQWH 3MGTB 2HKLA 4A2LA 4JBSA 4YR6B 3RTQA 3KBPA 4JDTH 4ANVA 3S9DB 4KNTA 2HG5B 4MJ5B 3ILDA 4X6CE 4YHPB 4B60A 1P7QB 1R33A 1XGUB 1HINH 4OGYL 4H44C 3SOTA 2WY3B 5DC9B 1JF6A 3SE3C 1QSFB 1TKWA 3JWNC 4TNVF 4WY7H 4JFQA 2Z31D 4U2YA 3RNKB 3HNSL 1FGNL 3RVXC 4OUUB 4IMKA 1HKFA 3B9KB 3MRHA 2AK4A 1L6PA 1GPOL 5E1AB 3OKEB 2QKSA 4C56D 2X4UB 1KIRA 2G2NA 1QSEE 1ZTXH 5JPNB 2CHZA 2VLJE 4Z7VE 2A6IA 3BQUB 3MLWH 3OWRA 3IDNA 3WJJA 3WNNA 3SQOL 5I30L 5D1QB 2OMXA 4ESKA 5K9JH 3GBLA 5DQ9A 1NGYB 2FIKA 1HHGA 2AQ1A 2NDGA 5FM4A 3F65A 4EUPB 1HAUA 1SYVB 3GPEA 4XZUB 5FUOL 2DQ6A 3L3OB 4LOUC 3ZL1A 4BKTC 3EOAB 2R0LH 3IKCB 4LGPB 3GSXB 4QRRD 4EDWH 4I3SH 4Z77B 1SZNA 4H25A 4P46A 2BVTA 4WW1B 3OZ9H 1JPGA 5CFHA 3IDMB 4K5OA 4Q9BA 4OCXL 2B7DT 4FKHA 3HG1A 3KD4A 5C0ND 3NJGA 5DO2C 1IEHA 5D7JD 1CGXA 4O2FB 3E7JA 4BZ2A 4E9LA 2QKIB 3BEVB 2F7PA 2LU4A 5ILTL 1Q0EA 1S7QA 3FT9A 3H6JA 3FH5A 3LKRA 1DQQB 1B4TA 1B4JL 2EE9A 1CF8L 4N1EA 4DQOH 1UOVA 2WBJB 3IF1A 1CGYA 4X9HA 2PP9A 3F12A 3L1OL 4P3CH 3QDMD 3MBEB 2MTZA 2LVCA 2FNBA 3MFFB 4FQ2H 5DD5L 1BYPA 5IHUH 3MZTA 4I2XB 1PDKB 4M56A 1FV1A 2FLRT 3JVGC 1OIOA 3LS4H 4G6AC 4XPFH 4TF4A 1TQBC 1V3LA 2WAQA 3JQOB 1WFUA 1FFNA 3MNWB 2K7QA 1ECYA 4OM0H 3SE3A 2VDLL 4JHUA 3T3ME 1Z9OA 2G9KA 5KJRH 5E5MB 3OR7A 3CVCA 4K3EL 1XH3B 4W6YB 3RWFB 4TOYH 3WJLC 2H0EA 1DVSA 2XA8H 5GSRB 3QEUA 4PD4J 3QO1B 2Q5BA 2BMKB 3K2IA 1J5CA 2P8PB 1Q4NX 1HHHA 1J1XL 4NUJA 1LO5B 4NKQB 4OGYH 2NLJB 3QUZD 1E42A 3JYBA 4HH9B 1G87A 3EDDA 5GRWA 4HGMA 1JVOA 3Q44A 4L3CB 2H8PB 1TU2A 1KG0B 2FJHA 5C09D 5G2NA 3HNSH 2QPUA 4K8RD 4HU8A 1JIBA 1MFUA 3SPJA 4KRPC 4R0LB 1KTDB 1VA9A 2ARJA 3O3DA 5FDYA 2O61A 1U2YA 3MLPA 4UOQA 3NCWA 3ARBB 3NFSL 3B43A 3B2DC 3SDAC 1B2WL 1CL7I 2VUKA 3QUZB 3DARA 1G7LB 3ZW3A 2ADJB 4XP5H 2W95A 1WSST 1X4XA 2IWFA 3SKOA 4M03A 5EB9A 4XWGL 2FUTA 3HAEH 1I8KA 5CD5C 3U1PA 5HY9A 4JNXA 4ZSOB 3PP3K 1MFDL 4A39A 3JVGA 2K9UA 1NFIB 2WSKA 4LLYA 1WCBB 4I77L 4D7BA 4RMUA 3QNFA 4OIIL 1T03H 4D0CA 2BO0A 3EBHA 1AO7D 4HUVB 2CGZA 4PSRA 5HPMB 3HPLA 5EZLA 5H2BA 2F54E 5ILTH 5BCAA 2HRPL 4HKJA 3KJ4B 4KKCD 4DGUA 4PJAA 5IV2B 1P0SE 1RHHB 2BSSB 4P3WA 4DFHA 4KKAC 4PJIE 4B96A 4N2DA 1SXBA 2DQMA 2OR7A 2XXFA 3OLIA 3WJLA 2J56A 4Y7MA 2NZ1A 4KI5E 3TYFA 3LRSA 3TBBA 3MSPA 3QIBB 4X6CA 5I2IB 1WTLA 4PV9B 4LEXL 3K2KA 2HCZX 2WK2A 3TF7C 1WFOA 4UZGA 1C5DB 3WKNA 3L1FA 4GNKB 3E8UL 1GXEA 2XN2A 2ILLA 3WNIA 3MBXL 2CK2A 4A1RA 5C0CD 2CR3A 1M05A 2F53D 4RZKA 3WE1A 3LPPA 2BZCA 2VQUA 4HF5H 4JQVC 1QSEA 3H9SE 4R7NB 5L2KA 1KZYA 4Z7VA 3KYKL 5J0BA 5EU5B 2LR4A 4P07A 4PJXA 2OJ1A 5EBMA 5IMMA 3C9NA 3H2PA 1HILA 1TEGA 5LGHH 1P1VA 4MS8D 3I85A 5HYSG 4TSAH 5FO8A 1A5FL 1F4XL 2CJ3A 3QH3A 4IOFD 4KX8A 3C60A 3AT0A 4NGHL 4OZGA 2KHAA 3NCCB 1TZ8A 1BMZA 4GT7A 3HZVA 4PCKA 3U1SL 4LVNB 4AXWA 4EXKA 1PY9A 2JJUA 3DX1A 4Y4FC 3GI9H 4LPWA 1Z3GL 3B3IB 1SJHA 3VI4F 3QJFA 1OF2B 3UZVB 4K7PH 5DEFA 1QI4A 1OTUD 1L4IA 5DMIH 1NANI 4MNQE 4PJGA 3WGVB 3F04A 4LOVA 1BOGB 1T89A 1AD0B 4O9HL 4DKEH 3CK0L 5KYNA 1EX0A 3AADB 3EJTA 3IU4H 3P69A 4OFQA 5DMGD 3S5ZA 2NT0A 3UJTL 5HGDA 4YHZL 3BW9A 1NMAH 4XXCC 1USQA 3DX7A 4G2AA 3VRLE 4QWWD 5HYQA 4JRYE 4LSDA 5CAYB 2XYCA 1J88A 4NNPL 1XBDA 1F3DH 1NEZG 4G1EA 4LHQB 3T4YA 3ARRA 3EW3B 1TTGA 3KHOA 4I87A 4GLRH 4U3HA 4WNQA 1OARL 3FT1A 4EE2A 2B16A 1KTJA 5K59E 4JREC 4JFZL 4YHIA 4UU9B 5FKAB 3U0PB 2KLRA 1AQKL 1QTPA 3RZCC 3DX3A 4ETQA 2VM4A 1JXKA 2A83A 4MQTB 3QUKA 4OIIH 5HHPA 4DT2A 4WI6A 1IC1A 3RIFF 1D7BA 4O5LL 3ZGHA 5I16A 3SBQA 4JQVA 4KI5C 1A9BA 3EGDB 4OLYH 1UT1A 1M7XA 3AC0A 3FO9A 1M1SA 4BSWA 1E5UI 1T22A 4XO9A 3RWDB 3VXQB 4PMEA 1U8LB 2EDMA 3EJRA 3W39A 1G7PB 1MHPL 1BD2E 5F89A 4HJ1A 1KCLA 5ECJE 1RY7B 3F7LA 3E8UH 4IBWA 4NP4H 2R0KH 2HH0H 4U1GB 4APXA 4IGBB 5SWSB 2A73A 1USZA 1WD8A 4OCRL 1BAGA 1NSNL 4ZMZA 3K6FA 2EDTA 4KKBD 1DVQA 1YPZF 1BG9A 1U8QB 2OTWB 4Y4FA 3TNNB 4PP1C 1JZ2A 3DX0A 5L8KB 5EHFA 2F7RA 3WHE0 4KJQC 4WUUA 1FZKB 5EU6E 2MOQA 2R2EB 2ZCZA 3FT3B 3S3BB 2BLFA 1XF2B 3KGUA 3VFOA 4HMDA 4RMSA 2FLMA 4XXCA 4WZ9A 1F4XH 2WQ8A 1NGXA 2X42A 3QDGD 3HMXL 3O0RL 1GZHA 2WQRA 3VXNA 3RPIA 2ZXBA 1U8JA 1FFPB 2ZJSL 2VO5A 4I5BA 4ODXA 1UOWA 4HUWA 2BWIA 1XH1A 4LKXB 3K72A 2WN3A 1Z3GH 1MRDL 1CG9A 3RDJA 2XIIA 4NO3A 1V3KA 4GW5B 4L1SA 4OGAC 2H7WA 3LB6D 1I1FB 3CU1A 1AZVA 3MFGB 4V1DD 3VFVB 3ZDXF 5IT2L 3RZCA 4FG6C 2D7OA 4XMLH 3C6LC 5HYJA 2F54A 3S4SB 1R9FA 4O9HH 1CLCA 5DUJA 3UJTH 1UJ3C 3L48A 2QMJA 3TA3D 3BPNC 4I1RA 5E70A 3L9EA 4HPOL 2AERT 4S0TD 4Y5VC 3SB3A 1MRCH 5I76B 4G6KH 1MVFA 3UJJH 1BVLB 2W60A 4QOKD 2EZ0C 4GXFA 3FTZA 2VR9A 2MEJB 4V1DB 1J11A 1HXMB 1SUHA 2DV6A 4PTUB 2YPKB 5JW5A 3VYNA 5MI0B 3NIDF 1FBIH 3SJVE 3CCHA 4QRUA 3IFLH 3WLBB 4JFZH 2FE0A 4X83A 3ESUF 4KTYA 4QCIA 1AQKH 3K4AA 4LBAA 4CGUB 5J06A 1HQRB 3BDXA 1MXGA 4MA1B 5D4QA 1O6VA 3FL7A 1KDIA 4W9KC 4XOCA 5I1GH 2Y2TA 1UH4A 1GAFH 3ZL4L 4TNGA 3D3VA 4L8SC 1BJ1J 2R69L 4KROC 3SDXE 1DZBA 4PRHD 4F8OA 4P9MH 5CJXC 1EHLL 1O7VA 1U3HD 5AB9A 1B0RB 1OWRM 1U2HA 5IVOA 2MNWA 2I7OA 2M1KA 3I50H 4PPTA 5HHNB 1NZRA 4EF3A 3BDYL 1NCWL 3KS0J 3PIQB 3CBRA 4PJ7F 1QR4A 4XNQA 2AXJA 3LH2L 2VDML 4CVWA 1Z9PA 4KUZL 4AZ8B 4LVOC 5TGBA 1EO5A 1RZGB 4OLWH 15C8H 2V37A 4PJEE 1IEAB 2O6EA 1PCXA 4XH2B 4HKBA 1R19A 3PS6A 2EUVA 3K0YA 3CMGA 1U92A 3ARGC 2DLEA 2YPLD 1D7FA 2XZCH 3CDGB 4MNQA 1T5WA 4F33B 2W0FA 1CDYA 4HX1A 3NJXA 5J13C 3HS9A 1YEIH 3C6LA 3AZUA 4KJWD 4HYTB 3TJHD 2OXHA 4ICWA 2XPYA 1BQLH 4JRYA 2PYED 2X7LA 7CGTA 5F8RC 2KQMA 5F7DB 1RZJH 5DRWB 1EH9A 2EABA 4GUPA 2H2PC 1F4HA 3C08L 3HMXH 3RAJL 1J05B 3TH3T 2VXUL 2RMNA 4E42B 4Y5VA 4CSZA 3V6ZA 5C07B 4XNDA 1WAEA 1AKJB 2YD3A 2JI1A 3DTUB 5GJSL 4BDVB 5E8NB 2DL2A 1A4KA 2WBXA 3PL6C 2CGRL 3MUGA 3WNJA 2VC2L 5CN1A 3QEQD 3VD1A 2DLFL 1SRDA 2Y36L 3M46A 1R3LB 2C7FA 2DQEL 4IHOA 1TVBA 3SO3C 1YMHB 1OCCB 2NCMA 3FRPG 1OB1B 3S0PA 5KN5B 5EEUA 5IT2H 1T83C 1D9KC 1RJYB 3UTQA 3VXMD 1HSBB 3U46A 4Y1AE 4IMLB 3BRFA 1PZUB 1ZWIB 1JHKL 2WOYA 4JFEE 4X0KA 4L8SA 3SE8H 4FFYL 1RZJC 3E2HC 1RZ7L 3B7RL 4HK3J 4XB8A 3CFBB 4TVPD 4F20A 4U1JA 1IBYA 3FU7A 1QTYT 4W9JC 1RJLA 2GK0B 1F58H 2AK1L 2VDOH 2P47B 5FKPB 5TE6L 3LKNB 1WAPA 4X6DE 2GTWB 5GGVY 3EYOA 4ICXA 3S98A 3PWUA 3KL5A 3PXLA 4U7SA 4JRXE 1O9ZA 2EDWA 4GKOA 4IOSA 1Y07A 3LXUX 2V2TB 1X9RA 4Q2ZA 3GMPB 3P73A 3ZL4H 3ARQA 5BUGA 2G9HA 1CFQB 3ARGA 1UA7A 3DETD 4QRSB 1H0DB 5I82A 5E6SB 2IH1B 1A64A 1A0QH 4S1QL 3IGLA 1EHLH 3HZYA 4L23A 4YN3A 1IO4C 1OK0A 4FNUA 4MB5A 2PWFA 3OAYH 3UO8B 3OJVC 1WA0X 3DTDA 1CYGA 3BDYH 4Z5RA 3KPPB 2QZQA 5IFAH 1NCWH 3U4EA 1KCUL 3BVUA 5JORB 4GAGL 1BEXA 5TH2B 2PP8A 5DJXA 2XQ0A 2BY3A 1MCOL 2IANE 3MZGB 1UD6A 2WVTA 3GXFA 1UWGL 5EMYA 1VPOL 3PF2A 3QNYB 4IRSD 3MV7B 4LSRL 4M6NH 4UAOB 4DF9A 4L1LA 2GCYA 4YSPA 2X2JA 3PL6A 1NBVL 4KTDL 3KYAA 2AC0A 3IETA 1NM4A 2QQKL 4PY8I 1SOXA 2C9XA 1T83A 2PR4H 4PS3A 1D9KA 3KDMA 3WFEL 1KJ2B 1UEMA 3NSDA 1DBKL 3QCUH 3WDIA 2ZUVA 4UV4L 1L7IH 3P30L 4Y19A 2AI0L 2WVVA 2GUOB 4PI2A 4LGSB 2PPAA 4M4PA 3SE4C 1YN6B 4QTFA 4QHMB 3MXWL 2GJ6E 4HK0A 2BJML 2R2BA 5EC2B 1BVNP 2Q7YA 4AM0A 3MUY1 3CN1A 1TO5A 4NN5C 1FNSL 2IALB 2IGFL 1YRKA 3VFPA 1ND0B 1E4XL 3CZFB 3DVNA 5E00A 2O72A 4RGND 2P52A 1J12A 3GSVB 4URTB 3EJUA 1ZLWK 4ZX6A 5LDUA 5ALBL 4QHNB 3CFDA 5MEQA 3SDXA 1AQDA 3MRCA 1JHKH 3OQRA 5A2BA 2WQAA 3LQAL 3PU7A 4M6ML 2VDPL 4D0BA 3KPNB 3HI6L 4PJ5D