2BZ7A

Oxidized and reduced structures of a mutant plastocyanin of fern
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
AKVEVGDEVGNFKFYPDSITVSAGEAVEFTLVGETPHNIVFDIPAGAPGTVASELKAASMDENDLLSEDEPSFKAKVSTPGTYTFYCTPHKSANMKGTLTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords PLASTOCYANIN
publication title Protonation of a Histidine Copper Ligand in Fern Plastocyanin.
pubmed doi rcsb
source organism Dryopteris crassirhizoma
total genus 23
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bz7A00
2Q9OA 1AS8A 3KW7A 4HCGA 5AKRA 1BQKA 1NIDA 1AS7A 1TU2A 2AVFA 1KBWA 2BP0B 2CJ3A 4GP4B 4UF7C 3NSFA 4WTQA 1GY2A 2XXGA 3NSDA 2YARA 4AX3A 5LDUA 2DYRB 2RACA 3FSVA 3H4HA 3QJVB 1WA0X 3WG7B 1MG3C 4ENZA 2FQEA 2UXFA 2DY2A 2XUWA 3NJFA 1TEFA 4BWWA 1NWOA 4Q89A 5B1JC 2VW7A 3TASA 1X9UA 3OD3A 2Q5BA 4MFHA 1PCSA 1KDJA 4YL4A 3RYMA 4DPBX 2ZOOA 4DP0X 3OMAB 2JFCA 1J9TA 3CG8A 2JXMA 1WA1X 4NB7A 3ZIYA 4DPCX 3T71A 4YSUA 1HAWA 1E67A 1OCOB 4BK5C 2J5WA 2YAQA 3QJSB 2PP7A 4KO9A 3QQXA 1GW0A 4E9WA 1PLBA 3NJHA 1F56A 2BWIA 5I6PA 4DP9X 1J9RA 1JVOA 4FAAB 2BW4A 1A4AA 1MZZA 2VW4A 3SQRA 4HHGA 2WO3B 1NPJA 5B1JA 2MRYA 1IBYA 1HAUA 1I53A 1A4CA 2XV2A 1L9PA 2YAPA 1RZQA 2IDFA 2UXTA 2CAKA 4G71B 3UABA 4E9YA 1J5DA 3T6XA 2VW6A 3UGEA 1PY0A 1ET7A 2FQGA 2EIKB 3ASOB 3PCYA 1V10A 2BWDA 2AFNA 5I6NA 1PF3A 1PLAA 2CUAA 5E9NA 1GY1A 3U25A 4KNSA 1NIBA 3NJIA 2VSKB 2FT8A 2QPEB 1AAJA 4PAZA 3FT0A 3S3CB 4YSAA 2Y1AA 2B3IA 4YSEA 1KCBA 4HCFA 1ET8A 3BVDB 2H47C 2GC7C 3IE9A 4KNTA 4TXVB 2QPDB 1NIFA 1FFTB 2GC4C 4Q8BA 4ZK8A 1OF0A 4GP8B 1E65A 3NJLA 4FA7B 2XV3A 4E9RA 3FS9A 3S3DB 3IEAA 2DYSB 3ERXA 4E9VA 1IUZA 1RCYA 5ANHA 3FPYA 1BXAA 5EHFA 1IKOP 1YLBB 3NT0A 2XWZA 2QDVA 3SBPA 1PNDA 3X2QB 2FQFA 2XVBA 3X1BA 1DZ0A 2HXAA 3EHBB 2PPDA 3NJMA 3PLYA 1MG2C 1NDTA 4A68A 3AG1B 1ZDQA 1ASQA 5TK2A 2H5UA 3NYKA 1GS7A 3T9WA 2YXVA 4BXSV 2GIMA 1V54B 2YAEA 1GSKA 1QLEB 1PAZA 2EIMB 3FYEB 1FWXA 1IBZA 4M4RB 4G7QB 1CURA 3AW5A 2HX7A 1SHXA 3QJTB 2HX9A 4YSSA 1GS6X 3FQYA 2YAHA 2OCCB 5PAZA 4K9JA 4HAKA 2YQBA 2J57A 5TK4A 4HCIA 4YSOA 2DWSA 3FSZA 4G7RB 3UAAA 1W6LA 2XXFA 3CVCA 2VM3A 3G5WA 3PAUA 1A65A 2IDQA 3IN0A 1ILSA 3OM3B 1A3ZA 1ADWA 4W9ZA 3MX0B 3AZUA 4WKXA 4F2FA 1PZBA 2XX0A 1KCWA 3NSCA 1L9RA 2OV0A 1XB3A 4HIPA 1NIEA 4P5RA 1B3IA 1QNIA 2BP8B 1PLCA 1ID2A 2P80D 1BEXA 4AI7A 2CCWA 1SHWA 3CDZA 3TA4D 2W88A 2FWLB 1VLXA 2IWKA 4M3HA 1ILUA 4YSPA 6PCYA 3PAZA 3X1GA 1L9TA 2H3XC 3X1EA 6PAZA 1X9RA 1GR7A 2BZCA 3GYRA 1KDIA 3H56A 2J56A 1BYPA 3EH4B 4BDVB 1PZCA 2IH8A 2E86A 3EF4A 1KYAA 1M57B 1NINA 1BXVA 2AANA 1W8EA 4DPAX 1IC0A 3FQ2A 1NZRA 4KO6A 5PCYA 2Y69B 4NERA 4CSPA 1WAEA 2BW5A 3X1FA 4A67A 2BHFA 3ABLB 2GHZA 1ZPUA 1V55B 2VN3A 1E5ZA 1OE3A 2BP8A 2CBPA 1AR1B 2FNWA 4YSCA 1SDDB 3OQRA 4DP1X 2PCFA 4HZ1A 1DYZA 5I6LA 1RZPA 2PPCA 1ASPA 3MBWB 3TBBA 4UAHA 2EINB 3HEIB 4BDVA 3ZDWA 1ASOA 1WS8A 2IH9A 2CALA 2VSMB 3ASNB 2IWFA 2PPEA 2EIJB 3PAVA 4RH4A 1NTDA 2XLLA 1SF5A 3L45A 5AZUA 5B1BB 2HLEB 4DP6X 1AZUA 2DV6A 1XB6A 2FQDA 2ZXWB 4GP5B 1KGYE 2BZ7A 7PCYA 8PAZA 1AACA 3NJNA 3FSAA 2EILB 1MZYA 5D4JA 1AS6A 1SDDA 2J55A 4YSQA 5FC9A 3PPSA 4CSZA 1SNRA 1NPNA 1OV8A 3AY2A 2TSBA 3GXUB 3CVBA 1ZDSA 3ABGA 3UAEA 4BWUA 1A8ZA 1ZIAA 2TSAA 2FT6A 5D4HA 1NICA 4GXFA 2IDUA 1RKRA 2QT6A 1R1CA 4P5SA 1T5KA 3WKPA 3AG4B 1OOWA 3QPKA 3JT2A 4JHVA 3NP3A 3ABKB 2BO0A 4N4YB 4G7SB 5F7AA 1JZFA 2UXVA 3ZX1A 4EF3A 2X87A 1SF3A 3QJUB 3CDZB 1JZIA 3WKQA 1XMEB 2PP9A 2PLTA 1QHQA 1M56B 2IAAC 1MDAA 1FA4A 4QKTA 4DP7X 4A2FA 1BQ5A 1WS7A 3DTUB 4YSRA 4GY4A 2GB2A 2IWEA 1JXFA 5I6KA 1E30A 4KO7A 1L9OA 1CYWA 4HALA 1W6WA 4YSDA 4N8UA 4UANA 4DP8X 1AIZA 4KNUA 1XB8A 5F7BA 3BQVA 2MTAA 1SFHA 1PNCA 4AKQA 3OMIB 3FU9A 4L0PB 2YAOA 3ABMB 2PP8A 1OE1A 2HRGA 3FPXA 2VM4A 2GI0A 2FJSA 2I7OA 1OCZB 3JTBA 4BXVA 1CC3A 5I5IA 2WO2B 1E5YA 2GSMB 2JKWA 1ET5A 4HHWA 1AG0A 2PPFA 2AZAA 1UATA 2IDSA 5I5JA 3NJGA 1AQ8A 1BXUA 3KW8A 2FTAA 1NWPA 5B1AB 3FQ1A 4F2EA 1A4BA 1OCCB 1ETJA 1BQRA 1ZV2A 4W1TA 1BYOA 2WSDA 2I7SA 3UACA 3QJRB 4KOBA 4YVNA 2OJ1A 3EH3B 4KO5A 1AZNA 3T6VA 3NJKA 4GYBA 3TU6A 1JZEA 5B7FA 5IY5B 1J9QA 1M9WA 1OE2A 2XYBA 1JXGA 4X4KA 1JZHA 3ZBMA 2N0MA 2A3TA 9PCYA 3S8FB 2XV0A 5D4IA 2BP0A 3WNJA 1JERA 1ZIBA 3DKHA 4JKNA 1PZAA 2ZONA 3NP4A 1GYCA 3SBRA 3DIVA 4E9QA 3C75A 3NSYA 4A2EA 2HZHA 3FU7B 5AFAA 7PAZA 2W8CA 2VMJA 3HB3B 1EHKB 2AZUA 3FU8A 3QJQB 3N55A 3WIAA 1TKWA 5I6OA 4NAJA 3T6ZA 1URIA 1JXDA 3UADA 3IBOA 2R7EB 3OMNB 2YAFA 1KBVA 2HX8A 5B1KA 4AKPA 2UXGA 2XX1A 2P80A 1AG6A 1NIAA 2YAMA 4JHUA 3SBQA 3X1NA 4E9TA 2X88A 1AOZA 1JVLA 4DP4X 4A2HA 4AZUA 1HFUA 5B3SB 1L9SA 3CVDA 3T6WA 1JZGA 5I6MA 1J9SA 4G72B 2ZWNA 3FSWA 1AZRA 1J5CA 1OCRB 2B08A 3EH5B 3N2JA 1JZJA 4G70B 2YXWA 3TBCA 1TEGA 3FU7A 2XU9A 3PXLA 1N70A 2IDTA 2FT7A 5I26A 4E9SA 4F7KA 1BAWA 2PPAA 2UX6A 4BWTA 2R7EA 3CZUB 1CYXA 1JOIA 1EZLA 2UX7A 2I85A 1SFDA 3FYIB 3S8GB 4E9XA 5I28A 4KOCA 1SJMA 2PCYA 3V9EA 1AZCA 2HRHA 1GS8A 4A2DA 1L9QA 3WNIA 4QLWA 3D12B 5A7EA 3S3BB 4DP2X 2DWTA 1PMYA 4PCYA 3V9CA 4A66A 3NJJA 4YSTA 5I5MA 4YVUA 5B7MA 1AANA 2GBAA 1KV7A 2NRDA 3H4FA 3GDCA 3WI9A 4DP5X 2LLNA 3IN2A 4A2GA 1N68A 3AG2B 1AZBA 4AKOA 1CUOA 1WA2X 5B7EA 3AG3B 2QDWA
chains in the Genus database with same CATH superfamily
4PJIE 1HSAA 2PR4H 1BEYL 3BT2H 3D52A 3LX9A 2IF7A 5FGRA 4TNVK 2HFEB 1PL3A 1T22A 4CU8A 1K2DB 1D5BB 1Q0YL 2VISB 2GY5A 2YARA 1MFDH 4Z7IA 4KJQD 5C9KA 2V7NB 4M6NL 1W16A 3QQDA 3C6LD 3DSNB 5EIIA 4BFBD 4ZS6D 1D7DA 5KOMC 2BSRB 4ZTPL 1QLRA 2JSFA 1Q0EA 2O4EA 5HHOE 4CJ0A 3NJFA 5H2BB 3RBSA 4AK2A 4HEME 3SGKA 3Q8FA 2ZICA 3WBDA 1AXIB 2WMPB 2FJUB 3FUKA 5TF1L 1R75A 3OKOA 4HF5H 1CVSC 4B9YA 2D3VA 3IWVA 3K2KA 3ULUD 5EOCH 2HMID 3KZ8A 2JLPA 5DJ8B 1CIDA 3S2CA 3V7AG 3BP5A 3ZKMD 5IESL 1J05B 4PWGA 5BRPA 1NGWA 2BFGA 4GW4B 4LQFH 1MY5A 2OTPA 4XR8C 3MJ9A 5SX5H 3WO3B 2A9NH 1I3UA 3D39A 1MAKA 3W11C 1IBGL 4YL9A 1SEBA 3A4AA 1Z3RA 2X4QA 2OMWA 5B3NA 3K71A 1WGVA 4QXUH 5DZOA 4OD3L 3F6IA 2V37A 4B0MM 3G08A 4F7PA 4OVUA 3QO0B 3RVTC 4U3HA 1IC5L 1XH3A 4RAUA 3FT2A 4LEOA 3EZ8A 1YJDC 1RLWA 4K3EL 3QNYB 5BVJB 1A4CA 5HGBA 1EBPA 1IM9D 1K4CA 3LV3B 3MUUA 1MCOL 2X7LB 3RIFK 1MY7A 4AIEA 4RSVA 4UTBL 4NENA 4YHNB 5IT2H 1S5IL 3OZKA 2PETA 2XRAL 3ZE2F 2OMYA 5DHXB 1T5XA 3O4LD 2VDOB 3QXTA 4QRQB 1H3VA 4TTDD 1D2OA 3HI6L 2AXWA 4MQXD 5I6NA 3VXNA 3SB3A 4Z8FH 1JPSH 2HWZL 2NNAB 4WK0B 4OF3A 4OCXH 1FFPB 4BH8A 1HEHC 3LKNA 5E9DD 4N2CA 4AZ8B 2CPUA 4D0DB 3QIBA 3CSBA 5ACLA 1CQKA 1ET8A 4XWGH 3U0PB 3M46A 3UERA 5LG1A 1E4HA 1JF1A 3RA7H 3SPHA 2GC4C 3CAFA 3AREB 2QR0A 4RWHA 4BFNA 1PZSA 1VB9A 4OCYL 4K9EH 2NX5A 1I9IH 3UYRH 3UJJL 3APCA 1H8NA 3FB7A 5TH2A 2VL5A 5D7SL 4Z78B 3BLKA 1KTJA 4IK7A 2KZKA 2Q7NA 1RZGB 5ANHA 3VFUA 4ZSOE 1NFDE 1OGAD 5CJQH 5IF0B 1HN1A 3SBPA 4P59L 2BVTA 2Q8AH 3SCMA 1RUAH 2RJMA 1YAZA 3M1BA 2WNWA 5LDSA 3ZTNH 4FJ6A 4ELMB 4UOQA 2Y1VA 5JOPD 3L2MA 1NDTA 2G75B 3Q44A 2X9ZA 5EZIL 3BSGA 2QQLH 2CHNA 3BP6B 3WS6C 1F6FB 5T1MA 3BEVB 5HPMA 2ATPA 4K2UL 4LLUB 4PWJA 1V54B 4YHIA 5GSVA 2EIMB 1UZGA 5E4AA 1Q1JL 4B7IA 1THCA 4Y5VB 1YSOA 2X1OA 3U83A 2CKBH 3OHXA 5LQBH 4PWKA 1RUML 4B9ZA 3AXIA 1FSKB 5JDJA 1DVYA 4Y5VC 3ARGB 3I2CL 1UZ6E 4OZGE 4Q56A 1OM3L 1BLNB 4OTXH 2FHCA 2Y0SA 1KBGH 3EAKA 1FSKC 3CZGA 3UBXG 1IFHL 2H1XA 3ARGC 1L7TL 3NFNA 1ZTXL 3H55A 2J57A 3T2NL 3SPVA 1LDPH 1S9YA 1KCRH 3DXAA 3SGDI 3L9RB 2FSEB 3EO0B 4FQLL 4WIQA 4W9ZA 5IHZA 1CE1L 1KLGA 1M7IB 2G5BA 1TZGL 1YJDH 4D2NA 2P80D 4AI7A 1IMHC 5ETUA 3WUZA 1BFTA 1AGBB 2H2PD 4WUUB 2RQ8A 2E9BA 5DVNA 2JJUA 5EEXA 3V0VB 1CIUA 3PAZA 2R23B 3X1EA 3KVQA 3F58H 3P4NA 4H8UA 4BKLB 2DQEH 1D9KB 2XWEA 2J56A 1QPXA 4KGLA 1T21A 2J1ZA 5I75B 1PZCA 4PJAA 5DD3L 1D9KC 3S35L 4D3CL 1AH1A 2VDOH 3DJTA 3HUJE 4R4FL 2JTYA 5C08D 4MCMA 3TBSA 2AANA 4JO1H 4QF1A 5CHNB 4X6EA 4NM8L 3GJFB 2ED7A 2OMUA 3FO1A 2QGCA 4L2LA 3CUPA 4XNMA 1S9VB 3P11H 1BJ1J 3WENA 3MA7B 1OAJA 4O58L 2WQVA 4UDUA 4LHQB 2BP8A 4DGYH 4NQDE 1E9PA 3BAWA 1GZQB 1SDDB 4OT1L 5AKTA 1KGIA 1Y6KR 3LQAL 3CVHL 4L37B 3PP3K 4QAMB 4UV7L 3DX9B 3WIHA 2KPWA 4L4TE 3TYFB 4F1ZA 2EINB 3E2HB 5M94B 1U8LB 1DUZB 8FABB 2A6IB 3T3PB 3KYKH 3E2HC 1J0YA 4M5ZH 5T1KA 3QXVA 4ODHH 4F7TB 2EUVA 4LKXA 3V7AE 4HUUA 5H35A 1S9XB 1FNSL 1QSZA 4PV8B 4QWWC 2V3DA 2O5ZL 4FGMA 4A63A 1G5GA 3T5WA 5GZND 1KTRL 1WIUA 3V0FA 3S35X 3EUUA 3RE0A 1MWAL 4N20A 4I2XA 4NQSA 5CWSB 3BI9X 4WSGA 5B39A 7PCYA 3MRDB 1YEGL 2EYRA 1MZYA 2O6DA 4QHKI 3DX6B 3LTVA 4M62L 4PJ8B 3MLUH 5SWZA 1U95B 2ZSWB 5IEHA 1BBDH 3UG4A 1SNRA 3VFGH 5CBAA 3AY2A 1J0ZA 4PGEA 2QVTA 4MZIA 4F9PC 1ZWIB 3LQZB 2YLHA 4ZUUA 5FM8A 2FT6A 3IF1A 1SN0A 4P2QD 3QS2A 4ZMVA 4XN5A 1OT2A 4KQ4H 1I7UA 5C6WH 3DBXB 1NCDH 1FZKB 4XPTH 2P5WE 3QEUB 5F3FA 2G9HB 3EIFA 3RX9A 4JPSA 5KVGL 3G04A 4DP7X 3EJJX 3RPKA 1SYSA 1WS7A 2ERJB 3DVNA 4FQCH 1KENH 4LCIL 4PGCB 4Q14A 4IIZA 3FONB 5LHDA 2ERJC 1X4XA 4J4PA 3VI3F 1L9OA 5I1EH 4Y4KA 1YEDB 2BY1A 2FYVA 2GVYA 1NCAH 2DQJH 3ZRFC 3OZLA 3V0IA 4NUMA 3OXSB 3GJFH 1TNNA 1R9FA 4X6DF 4LB8A 3IBEA 5ITFA 1CWVA 3AS1A 5KZCB 2PTVA 3TC9A 1J9CT 4A6YL 3HC4H 5L9DH 3BKYL 2ARWA 2YK1H 1OW0C 1IAIM 1R4XA 3DPDA 3LXCA 4PGBA 3O6FD 3MZGB 3QUML 1J5OL 3HE7C 4MNQA 1J1XH 4J8RB 4G8EA 4XBMA 3WUWB 1E5YA 2D3JA 1KWKA 3HOGA 3KR3H 3ILDA 5I71B 1G7IA 1U30A 3SO3B 1GC1C 4N6RB 4FLQA 4IJ3B 3TZVA 2JCCA 1UATA 4ODUB 3Q3GB 5EOCJ 2BVPB 5EZLA 5EC2B 1CD1A 4P5KA 3WMPA 3SO3C 1G7JA 3KW8A 4JR9H 4PRAA 5I71C 2N4IA 5F0MB 3G5XA 1JXKA 3JV4A 2V5TA 4WQOA 2Y72A 3D09A 5J3HD 3RWEA 1J1PL 5CF3A 5KS9F 1SOQA 5IVNA 3K6IA 2J4WL 4JJHA 4PVLA 2WXRA 3H6JA 1G84A 2Q86A 4X99A 3L9EA 1D6VH 3S36H 4IOSA 4PJDF 3SE3C 1IARB 2Z7ZA 3N1GC 3P0YH 4IKNA 5JIHA 3DURA 5DEZA 5E8DL 5DHMC 4YX2L 5MENE 3II2A 2VDML 1MIML 3L5XH 4FTVA 2F8IA 2C3HA 2CLRB 2K4AA 3K2IA 1T6BX 2X6VA 4J39A 1TDQA 5BRQA 1H9VA 3C5ZA 4ATWA 3VMNA 1JERA 3EBHA 2Z8WC 3PQYB 4DOHB 1BFVL 3N3EA 5GGTH 4MHHG 1XHHA 2EDLA 5IR1A 5JHDA 1X5YA 3BYYA 1FF5A 4E9QA 4U6VH 3EH1A 1YY9C 3FT4B 4LBEA 4PLKD 4WFEE 7PAZA 4NNPH 5I0YA 1MW0A 3VFOB 4ADIA 1QSED 3UYOD 1DDTA 3BVVA 3CC5A 1IGFL 1JWUA 1WFTA 4A39A 4Y4FA 2EO7A 5JTWA 4X7TA 4FQ2H 5KVFE 2AJVL 3UPCA 3D3VA 2VLLA 4XN8A 4LZKA 1CZ8L 4XO9A 1JUFA 3JT0A 1ZHLB 3Q8AA 3CTTA 1P7HL 4XAWL 4CMHC 4WFHE 4JHUA 4ZO6A 4X5WB 5TFSH 2GIXA 2HKFL 2CMRH 1N8ZA 4MDJA 3K4ZA 5AW1B 4YDZA 3GO1L 3GM8A 4FI7A 2L04A 2VLKD 1NL0L 1MW2A 2CRYA 4AMKH 1KYOJ 3F7YB 2A9ML 3WEXB 2XTJE 5L8LB 1YNKL 3UZEA 4TL5A 4BEIA 4JFTA 4N8CH 1ZS8B 4M61A 2ITCB 1QVOB 3V5KA 2WSPA 1HINH 2BNQE 2IDTA 4WEBL 1BBJA 3AROA 4Z23A 2UX6A 1YNLL 3IJEB 3V4VL 1F4AA 3O45A 3BIKA 1ECZA 1FC2D 4CL7A 1GC1H 1UD2A 2K9UA 4XC1L 4LSUH 1JWMA 1OAXL 5DD1H 1I8UA 4FQJL 5BOZG 2R2CA 2GFBA 1IC7H 3WXWH 4LP5A 4MB3A 3THMH 2XN9B 3QRFM 3QPXL 5FGCB 2R0LH 1AZCA 1OTTD 1S8DB 4HS8H 4ANVA 4F58L 3IFLL 2JJTA 2OSXA 3TPUA 2QGEA 3UIYA 5D7JA 5I5MA 2VN5A 2NQCA 2OXGB 3SPIA 2R69A 3A24A 1KV7A 1M05A 3N40F 4HGWA 1AXTL 2NRDA 3AFLA 4N8VA 4PJXE 5I16B 1O75A 4KK6C 5C0JB 2WUCH 3NUKA 3KPOB 3FC8A 5EU4B 5BXFA 4IU3A 1LEGA 2V17H 2JXMB 4JAMB 2OL3B 2MQCA 4L3AA 4RESB 1LK3L 2QDWA 1NSNH 2H6UA 5FB8B 3IU3B 1KIPB 2NCMA 4PJ7A 3VYNA 4PUBL 2A83B 3QS3A 4NO0A 4PY8J 5EOQH 5CEYB 4CDHA 3EYSH 3V5DA 5CM1A 4YS4A 3NSDA 4WW1A 4XCFL 3DIFB 3LN5B 4HKBA 1T89C 1AR1D 5HVHB 1IM3A 4WWID 3PG2A 4M4PA 4Z5RA 3T0WA 5EEVA 5HVHC 2Z7UA 4LFHG 2IOOA 1G0YR 4H8HA 4ZQTA 1U9KA 5JW3L 4ESKA 3L48A 1CDYA 5ANMB 2HFFB 5AD0B 1YMHB 2UVFA 5AW2B 4DWHA 3BRGC 1OSZA 2HJFB 1IQWH 4LCWA 3FUJA 1DQVA 4PCTA 3VM7A 4PSPA 4PJ5D 4ZBJA 3S98A 1QLFB 1N5AB 2WJ5A 4Y16D 5EZPA 4U1MA 2ZXBA 3UROR 1F2XK 1E67A 3ZKXC 5I17A 2J5WA 5EWIL 2PXYB 2YAQA 4BYHA 4NC0B 5FDWA 1IGIL 4GKNA 4TSAH 5HDRA 4E5XB 4N2HA 2XG4B 4FEIA 4TVPL 4EO5A 4DUVA 3VNZA 3DX1A 4L9DA 4RGNB 4FXKB 3RY6C 2C26A 2E0PA 4WUKL 2EUXA 4ZFFB 3IETA 3ZIMA 2DICA 3MV7D 5J8OA 3GDBA 1CICB 4RGNC 4N0CC 2K0RA 4FXKC 3TO4D 3UIZA 5I1AA 2EYSA 5CP3A 1KXVA 1QQDA 4OCSL 3D2TA 3HG4A 4X4ME 3V9FA 1CICC 4B53A 4NJ9H 1YEJH 3BQUA 4MA3B 1ORSA 5IQ7H 4BIKA 3AAZB 2XWXA 1UM6L 4R5VA 4Z7WF 2IEPA 5KYWA 3MUY1 1KBKA 2F5BH 4AJ0A 2CO1A 3O41B 5EDXA 1DL7L 1TVBB 3LXUX 2WKLA 4CMMB 1VHPA 2H41A 3ILPA 3IDJB 4UILL 4ES9A 4QD2E 4BQBA 4ZUSA 1PLAA 3TV8A 3II3A 3MFFB 5LNEA 2B1OA 1NIBA 4F9LA 1A3LH 2MOGA 4ODXB 5LXGL 4R4ND 2ZOKB 4OGXL 4XO8A 1DBBL 2BFVL 5EV7A 5MEPA 2D2OA 3WNMA 4QY8B 3D06A 3GTNA 5IREA 2P43B 2B5IB 1FFTB 3HG1A 2KLTA 1OHZA 1QUNA 4ELKA 2IFFL 5DJ0B 3FFCB 2B5IC 3EYUH 4NDMA 4QHNB 2OL3H 3MOQA 3LDBC 4JPWH 2MNWA 4H7VA 1AC0A 2NY2B 4HPOL 1MCCA 2YO3A 1IQDB 2D7QA 4POUB 1C5DA 5EHFA 3VD0A 1GAFH 4FXGA 5AAMC 4YHZH 1AFVH 2NY2C 4ODSL 4X9IA 5IMOB 4OF8A 1FPTH 1OWRM 2OI9C 1DZ0A 3QP3A 5K9OB 3SE8L 1SJXA 2EC9T 4H4NA 2EH7H 4ZX5A 3Q9QA 3PLYA 4AJVA 3QEQE 1DFXA 4JRYE 5JPNB 4LGRB 1ZDQA 1Q9LA 1KELL 1LO4L 1KZQA 1UA6H 1IU1A 3MBED 3NYKA 1JXJA 3NCJH 5EMYA 5JPNC 2WBJA 2YFNA 5GRYA 3SDXA 1AXSB 3LRGA 3VJ6A 1PZ2A 3NIDB 2PWDA 1AP2B 1SLXA 2CRZA 4KROB 3TT1L 3CZLA 3TS8A 5JLZB 3WUWG 1FZMB 4LLAA 4P23D 1E40A 3LRSB 2ZD0A 3RWGA 3QUZD 4PG2A 5J56B 3VXRE 4KROC 3FQYA 1G1CA 5SX4H 3VI4A 5IVXB 2AEPL 4EUPB 3RKDD 4S0SD 1MIEH 4N0YL 2JJSA 4YHLH 4MAYA 3APMA 3CFKB 3KWVA 3AS3A 5EN2B 4HX1B 1CXIA 4RFEA 4ABQA 3OM3B 1Y6MR 4IK6A 5ID1B 4XH2A 5CLTA 4XI5D 1TYJA 4GKOA 2MKWA 4C58B 3RBGA 3UMNA 5D1QD 3VXSB 3K6OA 1KPRB 4LIQE 1XL4A 1KTKE 3TA4D 4ERSH 1A1OB 1VFAB 3V5HB 2DQHL 4XMPH 1M1XA 2PCFB 3FT9A 1KGXA 2XHNA 4U1SA 5T3XH 1RZKL 4CW1B 2BZCA 3W81A 5H37H 3HMXL 4UUJA 5DFTA 1WWBX 3HJEA 4KGJA 4MMYA 2FZ3A 5K1NA 4GG6F 3QUXA 1PZ3A 4OKDA 5HYJE 3UAJD 4NEHB 2AXJA 4FNSA 1A7PH 3D25A 2Y69B 5BCAA 2DQFA 1JJUA 3BHBB 3Q1SH 1SBBA 4A67A 2IGFL 4FYQA 2VR7A 2PTTA 4X5RA 1YECH 2RA1A 1E5ZA 4FYRA 2HVBA 5A6LA 5IOKA 3D4YA 5AVSB 4JFUA 3ZYZA 5JR1H 5FUOH 4J1UA 1RIHH 3T8MA 3DJZA 4JY6A 2CKNA 3ZHDA 5F8RC 1RZPA 4JO5A 3GHPA 3SJVD 2WTOA 4UAHA 3NCBB 3CXFA 4KKRA 5DD6A 1E8YA 4IDJL 3U1SL 3GSWA 3ASNB 3EJPA 1AY1H 3NAAL 5FIEA 1SRDA 4OCWL 5JW4R 4LCCA 3I6KA 2KERA 3C60D 3MJWA 2XLLA 4OFKA 4ZMOA 32C2A 4NN5B 4IRJC 4X4XA 3LB6C 2ZX5A 4CSTA 1WG3A 4XX5A 5IHUL 4NN5C 4F7CA 2CHWA 1MFAH 5L6YH 2ORBL 2Q2LA 5DJ2A 5C8JB 4OU3A 3BMWA 4HCRH 3WIFB 4AEIH 3BD5A 4CN6A 1Z5LB 1BZQK 5F1NA 5KTEL 3NA4A 4WGVB 2GTZA 4RFOH 1MJUH 3SPGA 4KKNA 4NNYA 3T1WA 1EZSA 1HI6B 4EUPH 1ZLDA 2RH0A 1D5XB 2OLDA 2HKHH 1BCIA 3W5MA 1W80A 5L8JB 4YHYB 4GRLB 2CGYA 4PP2A 1TJHL 1NLBH 5GGQL 1T5KA 5KN5B 3ZQWA 4GRLC 4YHYC 1CU4H 1A6ZA 4LEXH 4BSWA 2UXVA 4GFTB 4EF3A 3WD5L 5G55A 3I50L 4YEFA 1XF4B 4IHOA 2N7SA 2A99A 2WXKA 2GY7B 3D39D 4OQTA 3MUZ1 3GD1C 1FA4A 3NEXA 4QKTA 1BF5A 2WN2A 4R5XA 1BQ5A 4LNVA 3CLEH 3RIAF 1BM3L 1XBDA 3JVGC 5MEOA 4GW5B 2GB2A 3FOMB 1B0GB 1CGWA 4U1HB 3C8HA 3L4VA 2KMWA 3V7MA 1CFMA 1NLDL 2VT0A 4P3DA 5F7DA 3EBAA 2CIIA 4PWIA 4MCYB 2JI1A 4NQCA 4A7SA 4Z7UA 2FR4A 4NQEA 3FB8B 4KDWA 4HXBL 4G9DB 2Y4SA 1GZHC 1KJ2A 2FBOJ 3NZ8A 4ZXBB 1ZLUH 4GOSA 2ZG3A 4XNZB 4ONGH 5AAWA 3RFRA 4ZXBC 1A9VA 5D7IF 4XNZC 5LBSH 1HCFX 3HLKA 4XHQA 3Q48A 3QIBD 4RVBA 1XZWA 2AJXL 1F18A 1RJZB 3L5HA 3AM8A 1WAAF 1NBZB 3X3FH 5DF0A 4AK1A 4E5XG 4NKIH 3HRPA 5B1AB 2LU5A 2BHYA 1SMOA 2GSIA 1H3WM 2NX5D 5I1DA 4W1TA 3CDFA 3DO7B 1BYOA 3HE6A 3MO1A 4BFJA 5IFJB 2VIRB 4NNXA 2OJ1A 1DQIA 5CEXA 1SMDA 5F3HA 4OF0A 3LH2H 2GJPA 2HLFD 3HC2A 4V1DE 3O2DL 5H37G 3DYOA 4IEFA 5B7FA 4YMPA 3EBGA 1QTYT 1HC1A 2MSPA 1MPAH 4KZ0A 1JXGA 1GVIA 1WFNA 3KDPB 5CCKL 1SOSA 1ROCA 3B4NA 4PB9L 4RWYL 4ZTOH 3UBXA 1M7DA 2BZDA 3QCTH 4DO6A 4LLDA 3L4ZA 1JGLH 1Z9PA 3UTPD 3PNRB 4PJFA 2CM6A 4A7GA 1NM4A 4BE5A 3VD1A 3NIFF 1U8HA 1MHPH 3VXMA 1C08A 3N85H 3QXWA 3TIEA 4JHBA 3BLPX 2AERT 1EHKB 3JWDC 3L3JA 5BS0B 3HAEB 1AGCA 3PQYE 3W38A 4PVBA 4DOHE 1TKWA 3RVWD 3QG6A 3D0AA 4N24A 5E00B 1HYSD 2F74B 4MCZB 5DZVA 2VH5H 3ZYJA 4OZIF 2H0PA 3DXAD 1QHPA 4TNWK 1NANI 3MTRA 2WJ7A 1MUJA 4YQXL 5I9QB 1A2YA 5AL8A 3TESA 4G43B 1UFGA 3A6CL 2WXGA 4I48B 5I9QC 1WEJL 3OKNB 1TZIB 1AOZA 3DDFA 2XZZA 3MCYA 4K7PH 5GXBB 3QZPA 1FDLL 2ALWA 2E7HA 2YFOA 2AVGA 3B6SB 4NCC1 5L88L 3DO3A 1J9SA 4WFGE 1IAKA 1P4LB 2E8YA 2VDNB 4M1GH 2N1TE 4I0KA 5DT1H 1A8JH 3AWGA 3QJHB 2FEEI 1NQBA 4FULA 1TQTA 4B0MB 1CFTA 1WT5C 2H3NB 2OFQA 4EXPX 2XPGA 4BGLA 3CZJA 3MLVH 4Z7QF 4URKA 1E4KA 3MKKA 4W4OA 2WWMD 3D85A 3T6QC 1C5CH 1CDIA 2K6ZA 2XKNA 5AL0A 1ITCA 1CR9L 3OF6A 3CMOL 3H1ZA 3MRHB 4EUPG 4NYLB 4IS6B 5I28A 1KJMA 4JFPA 1E4JA 4YGVB 2AEWA 1I85A 4ZUWA 4HD9A 5HDQH 3MLRL 4FZ8L 4AQAA 4QLWA 3BWAA 1IL1A 2W60A 2FJGB 3R8BB 1GA2A 5DZ9A 4L3FA 4WO4A 1C16B 3AQXA 1AANA 4P4KA 5CGTA 3BGFB 2XN9E 2WYIA 2YN5A 1GZPB 1IIKA 4W70A 1IGML 3ZQXA 1QD0A 3BGFC 3LJ3A 1XSIA 1HE8A 1Y07A 4MJHA 5T1KD 3IN2A 3QCUL 3V0WH 4ZMTA 4QYOA 4AKOA 1WA2X 3TFKC 3AG3B 3TWCH 4KKBC 5H8DA 1KSRA 3SPJA 4BM7A 2H26A 5D6CA 1DQDL 1NDGB 4IJTA 3CX2A 4MZRA 4RETB 5KYUA 4KTYA 5JHLL 4H0IA 4QHLA 5D1ZI 4WW2A 5BW7A 4WK4B 1DQKA 4MJ6A 3L5JA 4BQ8A 3PFUA 3BP4A 3QDAA 4QR7A 5SWZD 4BFFA 2VNCA 4I7ZC 4MGXA 5JDSA 5DC9B 2VXSL 4ZFGL 1T0MA 1MRCL 4KRPB 5G2NA 3HAEH 1V3JA 1E5UI 4JFVA 1VFUA 1BQHB 3LRKA 3TASA 4XOEA 4XVSL 4DPBX 5INCA 1T1WB 4KRPC 3U79A 3ZKSD 5AB2A 3OMAB 3L3IA 1RAMA 2OMVB 4TULL 4RNRB 2JMRA 2WK2A 5IFHL 1GTFA 1J5HA 4PLOB 3T4YB 1HKFA 4M1CC 3TCTA 1DUYB 2BXZA 2EDMA 1WCBB 4JO8A 4QRPB 1FLRH 1HWGB 1QACA 1NGPH 1PLBA 3DK2A 4U1KB 1BFSA 2HFEA 2NZ9D 2AV7B 4BA8A 1K2DA 1D5BA 2VISA 3AMLA 3BIAX 4XP6H 4DZBB 2VLJD 2V7NA 3LKOB 4XNQB 2MCPH 1F2QA 2X2JA 1SVZA 2DM7A 2I60L 2VDNH 3KXFB 1PKQB 1O6SB 3N9GH 3EJYD 3CDCA 4JFDB 3UTSB 4LSQL 1G7MB 1QUPA 5CGYC 4HK3J 4WJKB 1N8OE 5ILTH 2WMPA 2YJLA 4GI8A 4PR5B 3GMPB 1S3KH 3MXVL 1WZKA 2CKBA 4PRBB 4RA3A 4UNIA 4XNUH 1MCWM 3DJ9A 5CS7A 2YS4A 4OFDA 1J05A 2FQGA 4U49A 4I18A 2NY3C 3P40A 4YDJB 1ETZB 4X5PA 5EUOB 2DOCA 2X2YA 4LARH 4ZNEA 3NJIA 1E7UA 3ETTA 4NFCA 1AQDA 2QJDA 1W15A 5G5DA 4MNQD 2GBVA 2W1NA 4LPXA 3AY4A 3HZMB 5DFAA 3RVUC 4JFEE 2YOCA 3QO0A 4LRIC 3VFNB 4AEHH 4BFIB 1NIFA 4J3XA 4RCAA 4TVPD 3DV4B 5I8OL 3K46A 1JF6A 4Y4HC 1VPOL 3H9HB 3QNYA 4GP8B 4RMRA 3VXOB 5J7CC 1GGBL 4MXVE 1JNJA 4XMKL 3W57A 1NGXB 2X7LA 1OLLA 2CDFB 3S3DB 3VD3A 4YHNA 4N9OB 4C4UA 4MVBC 4MLIA 2Z4QA 1BGXL 3IYLW 5D2LE 5KYNA 1LMIA 1KY7A 3RI5K 1UGKA 4QRQA 2HXAA 4OZHB 4QXTA 2X1PA 2NNAA 1WFOA 1WZLA 3IU4H 1T03H 2CBMA 3BSZL 2HG5B 2E27H 1S3RA 2LAAA 3EYQC 1CXFA 4WY7H 4FQIH 1S7XA 4P46A 3ESUF 4AZ8A 3LEVL 4JN1L 2Z64C 1A7OL 3VGHA 3KMDA 1NFAA 4LP4A 4KFMA 4XCNA 5KVFL 1V5JA 3BP7A 5BO0D 5DZPA 1AO7D 3C5ZD 1QI5A 4K07A 4AQOA 2HJLB 4M4RB 5FOJA 3AREA 1CURA 3AW5A 1WISA 4GBXB 3MDJA 2LU3A 4N5EC 3TJEL 4GBXC 3ESNA 2GYSA 1RZGA 4P9HC 3L4UA 3CCHB 5TK4A 3TBYB 1D2PA 1OARH 2HRPL 5IF0A 4AOFA 4ZFOA 3C08H 5KSBB 4JFYB 4AGPA 2CO6A 4WK2B 3PAUA 5HY9B 1DCLA 1H5BA 2C3VB 2J8HA 3KLHD 3D3VD 3T0DA 4KC3B 3VQLA 3ZDXF 2EDFA 1A1MB 1SUHA 4ELMA 4H44C 3F8UB 1U3HC 4W9CC 3ME0B 5T8IA 1GGUA 2KT6A 4NC1C 4TUJB 2CCWA 3OGOE 4FG4A 6FABL 4LLUA 5IQMA 1O5PA 1ND0B 3FOLA 5JHDE 4XMXA 5JIQA 2APVA 4Y5VA 2AQTA 3K4DA 1ZVNA 2IANB 3DSFH 1TTCA 1BLNA 1TT6A 3KPQB 3VG9C 2PABA 3NZUA 1E42A 5JYLA 3NRFA 4XXDB 1HESA 1MCIA 1SXCA 5IHWA 3EYVB 1CK0L 2ZYHA 3W37A 4WI0B 2NQDA 2YPVL 1IFGA 2M2DA 2AW2A 1TENA 3VFVA 1D5IH 1ZA3B 2ZKHL 3L9RA 2GAZB 1W0VB 5DD0L 2FSEA 3EO0A 3SEPA 4LLYB 1T7WA 1UWFA 1JG9A 1V55B 4KZEH 2F53D 3GI8L 1SJEB 1H0DB 2OCJA 4LU5H 4AGNA 2BMKA 3QDGB 4UB0L 4WUUA 4M6MH 3VWJB 5LGHH 4F8PA 4HOXA 4W9FC 2R0ZL 1RUQH 2R23A 2OR7A 1N7MH 3HA0A 4UQ3B 4FLRA 2EADA 3VWJC 4GEIA 1D9KA 3MRKB 1WFJA 5D7JD 3TBBA 3FZUD 2R56H 3S9DB 4OJDH 3O2WH 4AGQA 5EZOH 5AVVB 1MCEA 3ZO9A 2AP2A 3QDHA 1BW8A 4MD0A 1DJZA 4YDVB 5E4EB 5T3ZE 5F7KC 4LESA 3C9NB 4XNYL 1BQUA 2NZ1A 3UTTE 4X80H 5E4EC 1RJYB 4HWBH 5GRVL 3IS0X 2CJUH 4JFHD 1RULL 2HAZA 5DC2A 5BOJA 3MLPA 4MASA 4ETQB 2YGNA 3KPLB 1XWVA 3RZWA 4NQXB 3SD5A 3MA7A 4NFDA 3OLDA 1N18A 4NO0D 1MCLA 4QNPF 8PAZA 5J4MA 1QFWL 2AK4D 1HEZB 4I3RL 1ZGLP 1FUNA 1KTLB 2XWTB 1SDDA 1L7IH 5DTFB 2CK2A 1IM3D 4OH2A 3ARFB 4NWUH 4P9HH 3C5JB 4TQEH 1LO2H 1KOAA 1A7QH 3DX9A 3VD5A 3C12A 3ABGA 1FL6B 3MI6A 1U8LA 1DUZA 4L3CB 8FABA 4LOVA 2AV1B 1DVFB 1L0QA 4XBGA 5D4HA 4LCWD 4F7TA 5BJTB 4W9LC 1KJ3H 4HUVB 4KBPA 3Q6GH 1S9XA 4PV8A 1DVFC 4PJ7E 4O00A 1T1YB 3QULB 3ZDZE 1H3GA 3ZX1A 3QJUB 4YBLC 3V4PL 3OAYK 4Y1AB 2VZUA 4UBDD 3CIQA 3KWXA 1Y18A 1N0LB 3MRDA 4UM9B 3GI9L 3KLDA 1GHFL 2VXUL 3DTUB 5T5FH 2XKSA 4JMXA 1JHLH 4PJ8A 1RZ8B 5I6KA 1MF2H 4GO8A 5DHDA 5CEZE 3LHPH 4S1SH 1U95A 2ZSWA 2ZKYA 2MCG1 4PJEF 1CYWA 4HT1H 3ETBF 3UZVB 1TSRA 3OJ2C 3BQUD 5K9QG 3QA3B 1ZHNB 1ZWIA 2YGVA 4M7LH 1QFUL 4WZ9A 5GGTA 5K5YA 1JFHA 1AHKA 1DE4A 4Y9BA 2MTAA 3STZB 3SDXF 4OZFB 2Y23A 3DBXA 1BQHG 3JWNE 1FZKA 1F02I 2Y25A 3QEUA 2G9HA 3J7HA 5FFGA 4KMTH 4TLKA 5KVDH 2MH4A 3MODL 1KN4H 1INDL 4X6BB 3ARBC 25C8H 1TTGA 1IAIH 2V2TB 4KPHL 4PGCA 1NCHA 1SXBA 2IDSA 2IMNA 3FONA 5IVOA 1JIBA 3B5HA 4AIOA 4QO1A 1XH2A 2E56A 2YOAA 1YEDA 3KEHA 2Q8BH 1UCTA 3NA9L 1QSFB 3DTXB 5CILL 2DIAA 5CSGA 2J43A 3BESR 3BH8B 2R0KH 3OXSA 4MQ7B 4YVNA 2VDQL 4TOYL 1FH5L 2NY5C 1NAKL 4JCMA 1KN2H 5C6PB 3PP4H 2DYPB 3IXAA 1P5VB 4UNVA 3H8NA 5GJSH 3IJHB 1GGYA 4G6FD 4E41E 4J8RA 1XGUB 3WUWA 4N0RA 9PCYA 1KCVH 3OKMB 2FATH 4Q6IB 2ZPKL 1TUPA 4N6RA 1ZLWH 2EZ0D 1UM4H 4GQ9H 5JUEL 4ODUA 3Q3GA 3HG1E 2Y07L 3QUKB 5DS1A 1JYXA 4Q6IC 2E5EA 2KKQA 1G0DA 5TE4H 2MMXA 3V0JA 5IW6B 4EBQL 1MI5B 2C34A 3OX8B 2P47B 1E9QB 4LOFA 2WIIB 4HIIB 4FG6D 2B2XH 3Q5TA 4LIQL 3FQTB 1UT1A 2Y7QB 3HBPA 1NMAL 5IWLC 1BVKA 3A4DA 4GMSH 3P4MB 4IDLA 2FYYA 4JQVC 4TRPL 5KBMA 3SE3A 3UADA 1XCQA 2QVIA 2KQMA 4RMBA 3HUJF 4JQIL 4CDGC 2EDWA 2UXGA 4U7MA 3TGXA 3QHFH 4UYPA 3TEXA 2Y3NA 5HJBA 5JOEA 4MMXB 5D5ME 4ABUA 3H9SE 1MFUA 3LNDA 3S88L 4F5CE 4FQHB 2CLRA 4AYBA 1CXHA 2NNXA 4JLRB 5CJBA 1S7UA 2DMBA 1V8HA 1EXGA 4ZMPA 4YHKH 4OLZL 1FIGL 3ZHKA 5I6MA 3ZZQA 3WTVA 4XPBH 4QJ3B 2MHAB 2DI9A 3U2SB 4WWNA 4HKJB 2XJKA 1OP3K 2J88H 1MFEL 3FT4A 4AY0A 4JJ5A 4K5MA 4BSJA 2RCSL 4TSCH 4JK0D 1BZ8A 1KXTB 4WEEA 2Y24A 3K2UL 3PXLA 1N70A 2BNUB 4Q9RH 5E99H 1BAWA 1LO5B 2WV3A 3BVNB 5FXCH 2BVOB 3Q2LA 3HFMH 4JY4B 1HCYA 4DF9A 5IM7A 4HBCH 3GBEA 3WE1A 4K4KA 3IGUA 1WJ3A 1TU2B 1BLIA 1ZMYA 1SFDA 4GO6B 3IDMA 3WJJC 4YXLH 5I1JH 2XWCA 1MWOA 1UACH 4MJIE 4UIMB 3EUDA 5GS2D 4XCCL 5JA9A 12E8L 2HRHA 4X5WA 4LL9A 4YHMH 3L9BA 1A9BB 4CU7A 4NI3A 1LEIB 1W72L 4ZAKB 5IFAL 1MRFH 1ZANL 3PWJB 2AJSL 4LNRB 4DN3H 4RIRA 4LVNB 4TTGA 1CG9A 4AM0B 3WEXA 4LVNC 5CD3A 3RX7A 2GK0B 5K9KB 3E0GA 5I8EB 3TFBA 3MRBB 3PRZA 2ITCA 3P3UA 4FQ1L 3TA3A 3RZCD 3MRPB 3DGDA 2P24B 1A66A 1AJ7H 3L6FB 5CUSL 3IJEA 4CKVX 1A5FL 2XZAL 4U4BA 4XN1A 2DLGA 4H26B 4RZCB 3BUYB 2PYEA 2DBLH 2CJ3A 5H94B 4F7EB 2VMEA 5EU6E 2OSLB 2J1KA 2Y1ZA 4FFYL 4N2AA 1OAQL 3H4HA 1S8DA 4HV8B 4Z7UF 5DA0B 1MG3C 3IPBA 4YDMA 3KPRB 4UT7L 5CZVL 3LPGA 2PNDA 5CD5C 2J1WA 2PW1B 2NUTB 4OI8A 3AT0A 3ECVA 1VEMA 5D7LB 2BXYA 2ZOOA 5C0JA 3KPOA 5EU4A 1LWRA 5J1AB 3GBNL 2R15A 2JXMA 2OL3A 1MXGA 2ISDA 4DFHA 2LFEA 3TIDB 5FB8A 3IU3A 4LCYB 2AGJH 1KIPA 4CNIB 4G6AD 5DRXB 2A83A 1D5MA 4JVWA 3DIFA 3LPWA 1R3KB 3LN5A 4GINA 2CBOA 5D96B 4IKLA 1ZY9A 2BK8A 2BW4A 1BXXA 2ZJSH 4P2RB 1HHHB 4QRPE 3C6LB 5D96C 2BJML 3REWA 3BKJL 2VE6B 3WKYA 1U8MA 1OSPH 2BDNH 2EH8L 2V3FA 3BZFB 3ESOA 3MUJA 5E7BA 2HFFA 5AD0A 1YMHA 2WM0A 1PS3A 4CVWA 2I26N 3TT3H 1PKQE 2HJFA 2VW6A 2G5RA 3F6LA 4NQED 1FGNL 3B1UA 2XQBL 1BG1A 5E23A 2LABA 3ISYA 1QLFA 1N5AA 2OR9H 2XWJB 3GEFA 4X0KB 1M53A 3DX0A 2PXYA 4KNSA 4N26A 3RY6A 4J2XA 2ADIB 2XG4A 4A7GF 2A6KB 4IW4C 3S2AA 4FXKA 5CMAB 4H8WL 4ZFFA 3U46B 4Z0BL 2DLEA 4KNTA 4B96A 3V4UH 2A1WL 2QPDB 4F92B 5EEZA 3ECBB 1OF0A 2VXVH 4G42A 5J0BA 2R4SH 1R0AL 3OR6B 5DZJA 2OS7A 2XN0A 3AAZA 2KC0A 1IZKA 3QUYB 3VFMB 3WFDH 5H37A 1RCYA 1SBSL 4O4YL 5DJZB 3O41A 2GEQA 1TVBA 3HE6D 3MNDA 3QUYC 4CMMA 1CI5A 1OQXA 2XOTA 3EJRA 5FV1L 3FN0L 4LSTH 5A1AA 3EHBB 1BVLB 3ZDYF 5FDYA 3NJMA 4P8QA 4MS8C 4ODXA 3EHBC 3NDZE 1B0IA 3UPAA 3MLXL 1FJ1B 1GS7A 1C1EH 2LU4A 4OZFG 2ZOKA 4NWTH 5D1XB 2HN7B 5HHMB 4ODBD 35C8L 3ZKQD 4AENB 2JTDA 5L2KE 4A38A 5D1XC 3B2PA 2DF3A 2ZCLL 1A25A 4QY8A 2DJ4A 1PG7L 3D30A 3INOA 3US0A 4DKEL 3WFCH 2HX7A 3N41B 1PDKA 1ULVA 2MPVA 4JO4L 4FFVC 4R7XA 5DJ0A 4HG4J 3FFCA 1GS6X 4QHNA 5C0RL 1ECYA 4GRWB 5FFLA 3VXMD 1V7MH 4NZTH 3TYGH 3QEHA 3TM6A 5DURD 1IQDA 2YMXL 2ADFH 2QFRA 3FSZA 4YFLF 2XXFA 1WGOA 4HW6A 5IMOA 3VD7A 1IKNC 5DMGC 3S3SA 2L7QA 2Y06L 2BIOA 3VQ1C 5K9OA 3B34A 4G80B 3ZR5A 1PZBA 1FNGB 1K8IB 3BZDA 3AT8A 3CFCH 5DK2A 5AVTB 2EDRA 2IGLA 2Y9RT 1J7VR 4YE4L 4M7JL 2IWKA 1F8TL 2B9BA 4IU2B 1L9TA 2GT9B 3LKSB 4NC1E 4OKVB 1SDYA 3VXUB 4D94A 2MPAH 5BQ7A 2E76C 5FAAA 4HCRA 5ICYB 3KAAA 4FFTA 4M8QB 3MV8B 1JGVH 1UOKA 2UUDK 2APFA 4XBPB 3EH4B 1FZMA 3EGDA 3LRSA 4MXWH 4N2MA 7FABH 4NN6C 3ATEA 3ULUH 5F1SA 4GEJA 4DGWC 5GZOC 5IVXA 4MWFB 5EC1A 1M2VB 4EUPA 4NZUL 1JK9B 4B97A 4GT7A 1I3RA 4HWEL 1U6AL 3QDMB 3CFKA 5PCYA 5EN2A 4KK5C 1WAEA 3D85D 3CIAA 4JZOB 3RJQB 2OA9A 3OF6D 3ESPA 5ID1A 5JXAH 1TLKA 5JYMA 1KYOK 1S7VA 4HIEB 1XGYL 3W1ZA 5GGVL 2QZ5A 4KTEH 2HT2C 2VLRA 4KWUA 2Y2WA 2X9XA 1QR4A 2FNWA 4H1LB 4K3DH 4MMZB 4YE0A 5DR5L 5AWNH 3VXSA 1KPRA 2CSPA 1NKOA 2WOBA 3OQRA 1A1OA 1VFAA 4L29B 4L4VE 4MMZC 4M3JA 2PCFA 4QLRA 1YMMB 5I8KH 4CW1A 3FTUA 4WO4D 2CWRA 1I1FB 2OMXA 5IGXL 1BM7A 4FNRA 1Q0XL 1MJ7L 4XPHL 4HWNA 1G9NH 4BZ1H 2QGDA 3E8UH 3CPUA 4P9MH 4ZOCA 1A7RH 3UO1H 4S1QL 1VFOA 3QJFA 1TJIL 3L45A 1IGYA 1YAIA 3BHBA 1AZUA 1JK8B 3WTYA 5IJVB 3CXHJ 5CGBA 4KHXL 1BZ7A 2NDFA 4ENED 2NW2B 4NXSA 1KT2B 2K6YA 2K9FB 2UWEA 1BIIB 3KGUA 5LBSA 5B4MC 2NQ3A 4O02L 4B27A 1H6TA 4IKJA 1DN0B 1NPNA 1MVUB 1HZKA 4GRWH 3GXUB 3C09B 1N26A 1U8QA 4OCRL 3HNSL 4JM4H 3X14B 3C09C 1OTSD 1IJNA 1CBVH 3CLFH 4UM8B 4AYSA 3KBHE 2YPLB 3F83A 4NZ8A 3SGDH 4DVRL 2WD0A 1A14H 5BUPA 1FFRA 1CXEA 3CX5K 5E6IB 4M6OL 3ZYIA 1ACYH 1WHPA 1OPGL 4OB5L 1MCPL 3WNKA 3WEOA 2PP9A 5CN1A 5E6IC 5CR8A 3GMRA 5C8JA 2HLAB 1G7QB 3S8WA 4B5ZA 4R2GB 2DQGL 5GQBA 3WIFA 4PJCB 1FE8H 3T1FA 3Q0HA 4L23A 4R2GC 5C07E 1X7SA 3G5VA 1P6FA 4M8UA 2V9QA 1AGEA 2GCYB 2JV6A 2VXTL 1A7BA 3AQDA 3OAUH 1HI6A 3OKLB 4TPRH 4FFWC 1D5XA 4M8VA 4Q7DA 2WXLA 3ZTEA 1XB8A 1LK2B 4L3EA 4GRLA 3EADA 3KWUA 1KG0B 2WZ0A 3B2XA 2ZAGA 3FW6A 4K5OA 1O6VA 3AITA 2PWGA 2X9WA 3L2NA 2P3YA 1A9EB 4H1LH 4O51B 3W11D 5C0CB 1XF4A 3T4AB 4S2SB 3JVGA 2WO2B 3CH1B 3NFSL 3QWOA 2GSMB 3WTWA 3T4AC 4PJBA 2FSDA 5AZ2L 3RVTD 1FAIH 3T08A 1DQLL 4JVUA 4NZFA 2OULB 5HYSB 2JK5B 2IGTA 1JPFB 4MA8L 4XPFL 3FOMA 1B0GA 4CC1A 3EYOB 5TE6H 1QFWI 3WYRA 4G1MB 2WCSA 5FPIA 1B4TA 1QWNA 4FABL 5E6RB 1JRHL 4FXTA 4ELMF 2DLFL 5ISZA 4NQQA 1BP3B 3CN4A 4EZLA 3A5VA 1A4KB 1A6PA 2YGQA 3E9UA 3UBGA 5HJDA 5TDPA 1GZHA 2WSDA 3NN8B 3UCQA 1A47A 3FB8A 4PV9A 2E7LA 1FFNB 3EH3B 4G9DA 5FECB 2QBWA 4AIXA 3N43B 3SE9L 3T6VA 3QQ3B 4JRXE 3HG3A 2X12A 4ZXBA 5FYJE 4O2FB 1JZEA 5IJKA 5FHAL 1NBYA 4FFZL 2EUZA 2GQHA 3VVWA 1IEBB 4KQ0A 1P4IH 3BWSA 1M9WA 3DUUB 2D03L 3CDYA 4D9RE 2V5YA 4F8LA 3IM1A 4P57B 4V33A 4JZNB 3BXNB 1EO7A 2H7WA 1RJZA 3DNKA 1NBZA 1Z3GL 3ULVE 4G6JL 4AXWA 3LVTA 3ARED 1JDDA 3CSFA 3NSYA 5KJ4A 3DROA 4GUPB 1N59B 1JE6A 2AZUA 4KDTC 5DUBA 4B7LA 4GRMB 4G9FE 2HJKB 2VIRA 4ZPTB 1URIA 2O5YL 4UMGA 3D69B 4X6CE 4D8OA 1MI5E 5I1GH 1CFQB 3U9UA 2DIEA 5FYKE 3W2DL 4K5PA 5ACZB 3S37X 2XX1A 5GGRY 4EKXA 4MJJA 3MJ6A 1LL1A 4G1EB 4F8TA 3P3SA 1WDAA 3EJQA 2BRRH 4ANUA 1QZ1A 1UWXH 5HGHB 1JV2A 1PZ5B 4X9BA 3E9TA 4PY7B 2JQAA 3QWQB 3W39B 1J5CA 2VN6A 1JZJA 2DQCL 4HSAC 3ARGD 5BS0A 1QA9A 3T09A 3HAEA 1CN4A 4G5ZH 4NGHH 1MJ8L 1CGYA 4I85A 4LL1A 2C4FT 2X41A 2YSTA 2F74A 3HHMA 3QEGL 4MCZA 4JZJB 5E00A 2BC4B 4YZFE 1Y7VA 5C0GA 5DJAB 3S3JA 4GFXA 3QNZB 1T1XB 2DI7A 3ARTA 3B9VA 1S7SB 5BMFH 4E9XA 4G43A 5T3ZL 1OP5K 3F62A 4OIIL 2IOIA 4JPVL 2I9TB 2Z65C 1IGCH 1CLYH 3T3PF 3OKNA 3B9AA 1TZIA 4G7YL 5DMKB 3L8QA 5E2TH 4WJ5B 1FO0L 4UT6H 4J23A 2BS8A 3OAWA 2J8UE 3R1GL 2VDRL 3SKMB 1IILE 3IGAA 5FM4A 4AL8H 3QQ4A 1D9KD 2RHEA 4JPIB 3QJHA 5D71H 4DP5X 2H3NA 3GSNB 4DQAA 3Q6FA 1R5VA 4MB5A 3ZGHA 5KJRH 2KUTA 4Z95H 3ARZA 2G2NA 4Q2ZA 4R84A 5B7EA 4FQPA 4LCUB 4YHPB 1ZLVK 1Q94B 2JE8A 1AS8A 1BD2E 2A6JB 4NM4H 1EAPB 1YUHB 1EDHA 3MRHA 3L16A 2FWOB 4U3XA 1KCLA 4NYLA 4DAGL 4DGVL 4IS6A 1AYOA 1X5LA 3HW7A 4YGVA 5F9AC 2DYRB 4PREB 4LFHD 4WNJA 3W0WA 1WA0X 2B0SL 3KJ6H 1F4XL 5BVPH 2BSTA 4MJ5A 3F7VA 2FJGA 4IBLT 1C16A 3ZE1E 4G82A 4H1LG 4LDEB 3PREA 1GZPA 3NSXA 2J71A 3PUUA 1FFOB 5F96L 4QWWD 1J9TA 5TJWK 2AXGB 3FBKA 1U3ZA 4BCZA 1QLEL 4S0TD 1MCRA 3PHQB 5L0QB 1DQQA 1AE6H 2DKUA 1I1RA 3MLWL 1REIA 4N0FB 4M8RA 5D7LE 1EO8L 2P7TB 4UWQB 1NDGA 3SY0B 4BRJA 2NXZB 5L0QC 1MRDL 2X70A 5K9JH 5DGQA 2NXZC 2HG0A 3E1F1 1NOFA 3C2SA 4ZMLA 2ZUSA 1A4AA 3BGMA 3ASWA 2AEQL 5DLML 2Y7OA 3BDBA 4PJ8D 1E3FA 2VRKA 4JHWH 4JM2B 3IDIB 5AKVA 2YQ3A 4HU8A 2IDFA 4JG9A 1GPOH 1BQHA 1WITA 5CAYB 3S5LB 1HL8A 3NESA 5M95B 4FL4B 2VDKB 3LAFA 1SUJA 5AVUB 2VUYA 2OMVA 2IDCA 2NY7L 4FL4C 2EIKB 2X4NB 3T4YA 4Z7NB 1XF3A 2YSSB 4G8GB 1V10A 1DUYA 1PY9A 5EO0B 4JFFA 1R5WB 5IIEB 3G3LA 3K0WA 1WCBA 2CR6A 1FYTB 2FIRT 2QQKH 4KH2A 4N0UB 4GAJL 4BCXA 5B8CA 5BRZB 3BAXA 1UG9A 5CNHA 2AV7A 3NDYE 4QRFA 4DZ8A 1F4YH 2BRQA 3LKOA 3DTDA 3MLSH 4IIQA 4EI6B 3KXFA 1LE9B 2C8NA 3L3HB 3RFZB 4JFDA 3ARPA 3T2OA 3TV3L 3UTSA 1G7MA 3TEZA 1UD4A 2XXMB 4F57L 3GSNH 1FRGL 3RFZC 4PR5A 3GMPA 3QRLA 4CA4A 4PRBA 4WI9A 2OTWB 3J2PA 4MDIB 2BY0A 3MACH 4F24A 4L05A 1VZIA 1BXAA 3GUFA 4LDCA 3BAIA 4M7ZB 4JDVB 1YNTB 4OD1L 2WLHA 3OC8A 4PU2A 2J7LA 4R97B 1U4FA 4YDJA 5KZCD 1QYGL 1ETZA 5I1CH 5EUOA 4M7ZC 1IKFH 1U8OB 4OIBA 3F84A 5D8JL 5EFIA 2JKTM 4DK6A 4R97C 5J89A 3NH7L 3PHAA 2NY1C 2K1MA 5A40E 3MFGB 1OAYL 2XXCB 4X6FB 3JWDL 3VRLF 2YAEA 5CJXA 3HZMA 4LSVH 5LBVA 3BSHA 4YIQB 5FHBL 1G1KA 5C0NC 3VFNA 1IBZA 4GI6A 2ZE0A 4G3YH 2Z92B 5EORH 4IRSC 1N67A 1TJGH 2C9AA 4JDTH 3VXOA 5JPMC 1SHXA 1DLFH 4HBQA 4NZRH 3RDTB 4QGTA 1NGXA 5HYSG 2CDFA 4RGMB 2KL6A 3SE4A 3SZ6A 3P77A 2W9DL 3RDTC 2PTUA 3RGVB 3MRMB 5E6UB 5FYKU 4FMFA 4RGMC 1B2YA 4Y9FA 2IDQA 3IN0A 3BKCL 1A3ZA 2DMGA 4OZHA 4WCYL 1L9RA 4HWBA 2HG5A 3OWRA 2GTQA 5TPWH 1PLCA 3PAYA 5FYLH 5E2UL 4F3FB 1KEMH 4M3HA 3AB0B 4O2CA 4KKQA 2Q76A 4LE8A 3GHBH 1TZ8A 3BFQG 1M9SA 3MYJB 3PQYD 1E0OB 2HJLA 3AB0C 3H56A 4M4RA 1YY9D 2VDKH 2Z7YA 4KKPA 4IRZL 4CN1A 4GBXA 2IH8A 4AYMC 2A9BA 5F9OH 3EJCA 1DANT 4PIBA 4K0OA 1KYAA 1INQB 2ZXDA 3T0EA 1W8EA 3TBYA 4RSYA 2X2HA 1RI8A 1MHHB 4NUQA 5E5UB 3QDJB 4QHKJ 4YHOL 5KSBA 3HNTH 2RFXB 5HY9A 2C3VA 2YD8A 3FQNB 3LXAA 1FL3A 4LSSH 1N0XL 1A1MA 1BJ8A 5GS1B 3CQQA 1KULA 2GUYA 4LSRH 4HVBA 4QI3A 4CJ1A 1GRWA 1WSST 5GS1C 1RZ7L 1BEYH 3GSOA 4PRHB 4DW2L 4XGZB 1LTXA 3N0AA 4XMTA 5G4OA 4I0PB 3GK8L 1ND0A 3QAZC 3ELQA 4L1HA 4OGZA 1Q0YH 1DYZA 3DOSB 2VO5A 1IBHA 1T0NB 3SDAA 5T5FA 4F7MA 2FEDC 4M6NH 1NGQL 1RURL 1ZJAA 2YMOA 2DEXX 4I0PC 4Z77B 2L8AA 1QTSA 5AVQB 1FG2A 2ZKMX 2WCGA 4M6AA 3JUZA 3KPQA 4ZTPH 5JNYA 2VABB 4XXDA 3EYVA 2IH1A 2VKWA 4WI0A 3FUIA 3FTGB 2C9VA 1BPVA 5BV7L 4CKQA 4PJ9B 1ZA3A 2X2IA 2GAZA 3ARRA 4LSPL 4JPKL 1XDTT 1KIRB 4M48L 4ZYKB 5IESH 4LOEA 4LLYA 4ZDHB 3WS3B 5AOZA 2A5UA 1H0DA 3U0TA 1FBIL 2XN9D 1FZJB 3QDGA 3G6AB 3LHAA 4HIXL 3FAXA 3VWJA 5TD4A 4N3TA 2J55A 4XN2A 4UQ3A 1TXKA 4BUGA 2J1YA 2MCMA 1QNZL 1EXUB 1JPGB 2G2RB 1Z9SA 3OVUB 4OD3H 2O5NA 1I9RL 4ETYA 4ZNCD 3EXLA 3E80A 1UQSA 3K6NA 1ZIAA 3QZWB 2VJ8A 2IOMA 3FCTB 1DQTA 5CP7A 1QMUA 1R34A 1UH4A 2AQRA 2P8MB 2WLLB 4K3EH 2ZSVB 3C9NA 3RUGE 1CL7L 3WKPA 3JT2A 4JHVA 1MCOH 2F7QA 1RJYA 5SWSB 5C0BA 3KGSA 4OCNC 4UTBH 3MR9B 2PYEE 1S5IH 3KGTA 5FA3A 3CDZB 2XRAH 4NHUB 3KPLA 1HJBC 5ERWB 5EBLB 3WKQA 5D9SB 2PLTA 4J6RL 2GEEA 1E5BA 1NUDA 4HUMB 5L4IA 3WFEL 3HI6H 1HEZA 3CHRA 2HWZH 4APQC 1KTLA 2LLGA 2WYTA 2X3AA 4G6ML 1HYRC 2XWTA 4UQ2A 3WEAA 3N5AA 3X13B 3HHRB 3ARFA 2Q3ZA 5ES4B 1SHSA 1FL6A 1WIOA 4L3CA 4PJCE 4B41A 5LB1A 5J13B 2H9GB 2E6PA 2AV1A 1IGTB 1FVDA 1AR2A 1DVFA 5BJTA 4DSYA 4OCYH 4HUVA 4MXVF 4L5FE 5ALBL 3CVHB 3UJJH 4HISA 5D7SH 2JI2A 3QULA 4P04A 2PXYD 3X12B 4P59H 1JD9A 3HR6A 4YR6A 4CU6A 5EEWA 1CTMA 1N0LA 4UM9A 3Q5YA 4RGND 4N0CD 4HIJB 1NBCA 1RY7B 1YEHL 3V52L 3QAQA 2Y36L 5EZIH 2ID5A 1CICD 1RZ8A 3IK2A 4Z3IA 4K2UH 1MWAB 1DFBL 2PWHA 3MRQB 3PHOA 3UZVA 4IBTA 2CCLA 4NN7B 1QI4A 1RIUL 1Q1JH 1ZV2A 4WU7A 4WWKB 4BHUA 4BA0A 1UOLA 4KRNA 1TZHB 5K59E 1RUMH 1KB5L 4OZ4B 3UACA 3F2LA 4PH8A 4WWKC 3I2CH 3B8YA 1TEYA 1OM3H 3STZA 5D2NB 3BE1L 2WSKA 4W6XB 1IFHH 3NIDF 5B1CA 1L7TH 3S5LG 1ZTXH 3EOAB 5D2NC 4UU9B 3SDDA 3T2NH 3D0VA 2ZUWA 2FLMA 3SY6A 1I31A 3BVUA 1R3JB 4LF3B 3JTTB 1JZHA 3S6CA 1U4EA 3ZBMA 4X6BA 2X1QA 1VSCA 4FQLH 2VDPB 4PGZA 4MAUL 1CE1H 5IVXF 2V2TA 1TZGH 4UNUA 5AKSA 2W95A 4YBQC 1EIBA 3T8XB 3BD3A 5EEYA 4A2EA 2HZHA 4LHUA 5E2WL 2VKXA 2VZ1A 1QSFA 3DTXA 3MCLL 1MHCB 2DQ6A 3BH8A 3U30C 2NY2D 4ZMXA 1NKRA 1DVQA 4ZOAA 4KKZA 4MQ7A 1CLOL 5FGBA 5DD3H 4QOKB 3S35H 4D3CH 1G6RL 1KBVA 3HVNA 1ONQB 4R4FH 1P7KB 3ZY7A 2DYPA 1P5VA 3JV0A 4NM8H 3IJHA 5T1DL 1LP9B 4LLMB 4HOWA 1QRNB 5ENWB 4LRNL 3RPBA 3PDDA 4C56B 1EAQA 4KKAC 1DJGA 3HN5A 4Q6IA 4HGKC 4O58H 4X7DC 4A6YB 3K72B 3CVDA 3HBGA 5J06A 3WIIL 5IMKB 3CXDL 3FSWA 3BT2L 4KROD 3QUMB 4OT1H 5IW6A 5C3LD 4EN3A 1RQ5A 3OX8A 3NSJA 1E9QA 3IE4A 2WIIA 4P06A 4HIIA 2DAVA 5EO1B 3LQAH 3CVHH 3FQTA 2Y7QA 4UV7H 5I26A 4E9SA 1HQRB 3P4MA 1HZHL 4Z7VE 4I5BB 1HVXA 1JRHI 1CYXA 3HR5B 4NSKB 3PXHA 4DIXA 1ZVYA 1FNSH 3P9MB 4XVTL 2O5ZH 4RQQA 4UZUA 1CB4A 3QZBA 3FF8A 1T4KB 4MMXA 2WVVB 2M26A 4U1LB 1QFWM 2BVYA 4A2DA 1BAFL 2VAJA 3VXSD 2FO1A 2X4UB 3B9KB 1MWAH 4JLRA 4S10A 4DP2X 2ZX7A 3IAGC 2APTA 5MI0B 1T20B 1YEGH 2LTQB 3LS5H 3B9KC 3PF2A 4LQFL 1CBJA 4A66A 1HWWA 5I18L 1J8RA 3ZL4L 2MHAA 1Z9LA 2IQ9L 5MI0C 4M62H 2OSWA 3VGEA 4HKJA 3UO8B 5HYQB 2L7EA 1LE5A 3GDCA 1XGTB 2WGXA 3WI9A 3GSUB 4RMWA 3S5YA 3OL2A 1CUOA 3CHQA 2V2XB 1LO5A 4BH7A 3BVNA 2NYKA 4JY4A 3FTWA 1H3PH 1A1NB 1DJWA 1H8SA 3KW7A 3QJXA 4TSBL 3WJJA 1NIDA 1TU2A 5IP4A 4WKZA 4HMDA 1KBWA 3BVXA 1SQ2N 4ZS7L 4D9QE 3QZLA 4UIMA 4QPEA 1EWHA 1NCJA 2XN2A 3QJVB 5C09B 1VEOA 2ESVE 2FQEA 5KVGH 2WTPA 2Z0BA 4ONFL 1FN4A 4Y5YB 2ENJA 5D1ZB 3VACA 1WAPA 4HS3B 2X6MA 4ZAKA 2IXQA 2P28B 3PWJA 5KUMA 4LNRA 3FO2B 5DVLA 2BNRB 4Y5YC 2ZKXA 4LCIH 5D1ZC 3SN6N 2Z31B 4YL4A 4ZFZB 1CDBA 2GK0A 4MNGB 3ZZLA 5I8EA 1OEZW 3MRBA 2Z31C 4ES8A 1I8LC 3P4OB 4XWGL 4OLUL 4UZSA 3LB6D 2V0AA 4WI3A 3L6FA 1MAML 5IB1B 2Y5EA 1NANH 3CD4A 2D3NA 4PWEA 3QRGL 5T33L 2PP7A 4H26A 4RZCA 2WO4A 3QIUB 3BUYA 3UYRL 3QO1B 4IBWA 4R26L 4F7EA 5H94A 3QC6X 4A6YH 3QIUC 5LLIC 4AT6A 3BKYH 4Z7AA 1D7BA 3V6OC 1JVOA 3V4VB 2E7MA 5EOTB 1J5OH 3KPRA 2WO3B 1R24B 1U2CA 5JOFB 3HZVA 1IFRA 3QT2A 3WFHB 2PW1A 1KLFB 3BCFA 2F7IA 2J72A 1TJXA 2YXFA 5DHYB 1NCBH 3CWGA 2Z1KA 4HOZA 2ATKB 1UVQB 4XMZA 2DM4A 3ZTJH 1E3ZA 3TN0B 3QARA 3MN8A 5J1AA 4GRLD 4W9EC 1ET7A 3GMOB 5IB4B 1F42A 3EYFB 2NY6B 5HHPB 4GQPH 3TIDA 1U8PB 3QZWG 1J1PH 3TBVB 4LCYA 4G11A 4CNIA 2J4WH 1E7VA 3U4AA 4EIUA 2QPEB 5DRXA 4AGLA 5CEZD 3A67L 1AD9A 2WTRA 1K9TA 3S3CB 2BSSA 5J11B 3ARXA 4B9JA 1ZT7A 4Z7NE 4PJHB 3ABZA 2NYYC 1R3KA 1XAKA 2IADB 4HCFA 5FUZL 3VTAA 3GRBA 4YX2H 5E8DH 2GC7C 3AXLB 2VDMH 4P2RA 1HHHA 5FYJL 1GXEA 5KVMC 1MIMH 3C6LA 4ZK8A 1FYTE 3WHXB 4PMEA 3PWPE 5A3IC 4OGQC 2VE6A 2NY5L 5F44A 3WTXA 4OAWA 3BZFA 1WZMA 1BFVH 2DYSB 3O3EA 5C0AE 3FPYA 5A2IH 3UC0L 2EVIA 3ULVL 1PNDA 2FQFA 1LDSA 2YC1B 3F58L 2XWJA 3MRFB 4PFEA 4ZXBD 4X0KA 1IGFH 1YYML 2JF1A 3HS0B 4PBWD 2ADIA 5TDOA 1ASQA 2AJVH 1N4XL 2H5UA 4PJBE 2A6KA 3QUHA 1ZSHA 5HHNB 1CZ8H 3JZYA 3HS0C 5CMAA 3OR7A 4BXSV 1MFBL 2WQUA 3LRLA 5C3IA 3U46A 3L7FB 3O6LL 5CJOL 4XAWH 4MZ2A 1ICTA 4A55A 2DB8A 5EO9B 3LIZA 4EJ1C 2HKFH 1PZDA 3ECBA 1N3NA 3G6JB 1H15B 1L3NA 3GO1H 3ZSSA 1IM9A 3MRGB 4LGPB 3VFMA 2F1AA 3O11B 4WEMB 1QR1B 1OKEA 3JXAA 5DJZA 4WU5A 4YNYB 4RRPM 2A9MH 5GS0L 1W6LA 1VGKB 1YNKH 3BPOB 1DQML 3ZU8A 4BZ1A 4K5LA 2WQAA 5AYUL 1ADWA 4WKXA 1BVLA 3P9LB 3BPOC 1KCWA 4WEBH 3BEWB 4P5RA 5FR3A 1YNLH 3V4VH 1QFPA 1AHMA 1UJTA 4ZFOL 2H0EA 2Q7AA 5D7KE 3FO9B 5D1XA 3HN8A 2HN7A 4XC1H 1OAXH 4JG0L 4PD4J 4FQJH 1CGSL 2DH2A 3K3QA 4AENA 1JFQL 3MGAA 4I4WB 3GYRA 3FFDA 4GB9A 3WY3A 3QPXH 1E9OB 5L7XL 3TH3T 2KH2B 3LKPB 2D2CC 4F58H 4HEPG 3IFLH 4IYKA 3U0WL 4GKZA 2WOYA 3L3KB 1E5AA 5BS0D 3G6DL 4PRNB 3KPPB 2P48B 4JO3L 3F6JA 1AXTH 5F9JB 1NZRA 2FO4B 5JW4N 4J3TA 3FCUB 3H9SD 5I1LB 3HRZB 4WI4A 1S78C 4CADB 2EIZB 3G7TA 1PJWA 4G80A 1IBBA 1XH0A 1ZPUA 2GHZA 1FNGA 1K8IA 3FB6B 3V55A 5CCGE 3WCYA 3HRZC 5DGRA 4P49A 1LK3H 5GIRB 4NCC2 4X8XA 1S6NA 4YSCA 4N9GB 1SVCP 4PUBH 2LVEA 2MNUA 4WTWA 3RVVC 3T2LA 5LNGA 4IU2A 2GT9A 3VWKC 2FUTA 4OKVA 5I23A 1SXSA 5CCHE 4XCFH 2PPCA 5ICYA 3ZHFA 5GZOA 4M8QA 3MV8A 1QEWB 4XBPA 2GTWA 2ZTBA 3L4TA 1NGZA 3MV11 4RH4A 1OB1B 3SQBB 1JK9A 5JW3H 2E4FA 3QDMA 3OBAA 4H13C 4UT9L 5I1EL 1UXLA 3MV01 2HFTA 1ZGLM 2DQJL 4KTDL 4HIEA 5D72L 3TBTA 2BZ7A 1G4RA 2PKDA 1AACA 2VSCA 3FSAA 2BSEA 2F53B 3OLEA 5EWIH 2WXFA 1IGIH 2CE6A 3PYCA 5E5MB 2VR5A 4GAGL 5HP5A 4TVPH 4L29A 1T7XA 4YSQA 5FC9A 5IQ9B 4WUKH 1YMMA 1G7PB 1ZA6B 2ZX9A 4B60A 4G8IB 4JRWA 5EBWB 3VFRA 1F6AB 2C7UB 3ZDXB 2WZ6A 3TNNB 4OCSH 1BMWA 3E6HB 3H7BB 3DVGB 5LCVL 5DSCB 1RH8A 3CFNA 2X0WA 2Z8VC 2ZKWA 4F37F 3TFKD 4MX7B 3CFUA 4KKBD 3KNBA 5SV3A 4NZDA 3NP3A 2PCXA 3KYNB 2V6HA 4R7DB 5C08A 3KYMB 1UM6H 4AC4A 2XQYK 1Z6JT 3CZEA 2X87A 1DL7H 3SKOA 1RK7A 1O9ZA 2ZXGA 1AHWC 4OLWL 4NO5B 1M56B 3MAWA 4PVMA 1CD9B 4UILH 5IJVA 1TYRA 4LP8A 5F2FA 2P44B 5SWSE 2NW2A 2BS9A 1K85A 1BIIA 2P5EE 5LXGH 1E30A 1YRKA 2NY4B 1S7WB 3K80A 4NQVB 1DN0A 5FWQA 4C55A 1MVUA 4OGXH 1IE4A 1DBBH 2BFVH 1KB9J 4YSDA 2IAMB 5EUOF 4KRPD 3J8F7 4PRIE 3UTZB 4AQ1B 1U58B 3BZ5A 2IAMC 1CFVL 4UM8A 4PJIB 4AQ1C 1UADC 2IFFH 2YPLA 1TZOA 4M1CD 4ZZKA 4WNSA 4FG0A 3PDOB 2YR3A 3RAJL 4HPOH 4YH6A 3NCMA 3GBLA 2FJSA 3C6EA 3L13A 4G8AC 2MCAA 4QRPD 1D6EA 4ODSH 3S34L 5GZNA 1OP4A 4I77L 4HUNB 2NCEA 3FU6A 1G7QA 1NCGA 3SE8H 1UENA 5K9QI 1G1YA 5HHOB 1CE6B 3PABB 3QR0A 2ZUQB 5CGYD 2APSA 4NPJA 3UH8A 1KELH 1LO4H 1NEUA 3KXFD 3M88A 3MNZA 4Z3JA 4LQ1A 2GCYA 4JFDD 2BP5M 1DEEB 3UTSD 1I1AB 2WYHA 3H2PA 4OZHF 1BPLB 2LW3A 5I0DA 1FGVL 5DDHB 4B3VA 3WN5B 1I1CA 1I1AC 2DDQL 3TT1H 2H0JA 4ZOEA 4UQBA 4ALAC 2WXIA 3QZNA 3S36X 3CHOA 3WN5C 1KG0A 2V9RA 4JFFE 5CJ8A 1MOEA 4XE0A 4I3GA 2AEPH 1BFOB 2VZOA 4N0YH 1A9EA 3MGOA 4O51A 5LXVA 5C0CA 1CL7I 5LKNA 1OE2A 2XYBA 3T4AA 1OAKL 2RIKA 1KWGA 1UWGL 4ANXA 1KCUL 2Q6WB 3RVUD 2JJVA 1KGCE 2NLJA 3JV6A 2NTFB 5HYSA 3M1OA 3DKHA 3FQRB 5I0WA 4Y4HD 1JPFA 3DX7B 5A43C 5KSBF 1KEGL 5D70L 3EYOA 2X38A 4UNTA 4YBHA 1NOLA 4G1MA 5F89A 3T65B 1EX0A 3MOAL 4PGDB 4UT6A 3K8MA 2DQHH 2FL5B 3U4EB 1YEWA 1RZKH 2KDYA 1A4KA 4MVBD 4KI1A 3WKNA 3WIAA 1RLBA 1CLCA 2R0LL 3NN8A 3Q01A 3HMXH 1RZIB 3BKML 4HPYL 5FECA 4RBPK 2EC9U 1ADQL 1TZAA 3IJ8A 3QQ3A 3VG0H 4NS0A 3NACL 4D9LH 2VZVA 1KYDA 5B1KA 1T2XA 3I9PA 3EYQD 3NGBB 1FORL 5DYOA 2UZXB 1U3NA 4C4KT 4HG4K 3DX8B 3DUUA 2ALAA 2ITDB 3NGBC 3O6FA 2O6EA 4OR1A 4QOKE 2IGFH 4BZYA 1WBZA 4P57A 3GZPA 2IBZX 4FP8L 3VGFA 3MTXA 4JZNA 3QFJE 4ZQKB 3CHPA 4EIZC 2OKMA 3T6WA 3HC3L 4YN3A 4KK9D 1AZRA 1FG9C 3UEZA 2ZQKA 5EU5B 1TEGA 2D3LA 4GBXD 1NFDB 4GUPA 1N59A 3CZFB 1MCWW 3AJ7A 1BOGA 4ZPTA 1RK0B 1DJYA 4BWTA 3CU1A 4IDJH 3KPSE 3D69A 3U1SH 4N28A 1Q9WB 3FTYA 3NAAH 4GXUN 1F90L 2CK0L 3I6SA 4I9WD 4JS7A 4OCWH 4ZX6A 5ACZA 3VI3A 3KDMA 1A6VL 4LVEA 1FV1A 2AJ3B 1QW9A 4KQ3L 5IHUH 5HYIA 3OHMB 3D12B 4U1JB 2ORBH 4RISL 4OZGB 5HGHA 1DHKA 1PZ5A 3EJSA 1LO3L 4R7NB 1F13A 2YA2A 1TFHA 2HPOA 1FNFA 3GWJA 3H4FA 3S48A 2IAND 4GMTL 1V7NL 2LLNA 2H45A 1U92B 4E68A 4XP9L 3HNVL 4V2BA 4HUCA 3DECA 5IROC 4JZJA 2Q9OA 2BC4A 2XKUA 1RSFA 1RZJL 1Z9NA 1T1XA 4Z7OE 1HHGB 5JHAA 5IKCB 4BGDA 5KW9L 1TJHH 2R29L 4HJ0C 1S7SA 1T7YA 1U8IB 2FECL 3GT6A 5F88A 5GGQH 1UD8A 5KANG 4UF7C 5IQ7L 2XXGA 4XVJL 2I9TA 5C0IB 1M3IA 2LFGA 1KIQB 2OW6A 1E27B 3L3OB 1F0LA 3WD5H 3I50H 1RZFL 3KEDA 3PGFL 4K5NA 3QDGD 4PS7A 5A2AA 5KBPA 1P7QB 1N6QL 2F8XC 4WJ5A 3O6ML 1I8IB 5HDWA 3OKEB 1NCIA 1OGTB 3L3OC 3VWJD 4CC4A 3R4DA 2XWRA 3QYCA 2F19L 3VO0A 4IBUA 3SKMA 1NC4B 1BM3H 1NWOA 2FO8A 2YRZA 2VLKA 1ZXKA 4CILA 2J44A 3CFQA 4JPIA 5C09E 4G83A 1TVHB 1T0OA 1VZHA 2OCFD 2Q7YA 3GSNA 1YQVL 2UYLB 1ED3B 1NLDH 3ZIYA 4AQEB 3F7QA 1X5GA 5DI8B 3RZCB 3EFFB 5MERA 4JN2B 4LCUA 4YHPA 2J25A 1OCOB 1Q94A 3QJSB 1IC1A 2JVUA 2A6JA 1FL5B 3KLSA 4B6ZA 3ZVVA 2FWOA 1WBXB 1P4UA 1V27A 3BDYL 4FG2A 4NQDB 1FFQA 3EG9B 4DP9X 1IAMA 1EUTA 1NJ9B 4L5FL 4H8VA 4PREA 5E8OB 4C59B 2OZNA 1J9RA 4KV5F 3RY4A 1AFVL 4L4TB 4QRRB 3Q13A 2ZOUA 3SOBL 2PO6B 1PGRB 3V6OE 3KLAB 3ARFD 4YUEL 1HXMB 1RZQA 4LO9A 4JE4B 2K70A 4G71B 2PO6C 1HHIB 2AJXH 4K71B 2B4CL 4NRYB 4PWHA 4PRPE 1CFBA 5IBUB 3MLTB 1UA6L 5F7LB 4K71C 4FJZA 1FFOA 4L8SB 4ELDA 5AB1A 4TKWA 4TYUA 1DVFD 5C0BE 3CSYB 1X6NA 4A1RA 1JNHB 2CUAA 4GT0A 4N0FA 2P7TA 1HE7A 2EDXA 2AMGA 1UUNA 2ZCKL 4XB7A 4YXKL 4Y1AD 4ADGA 3FT0A 1NCTA 3O2DH 2HPTA 4UM9D 2VN4A 4L0YA 3A6BL 2ZXCA 1HJCA 4OY9A 2F15A 5CCKH 5CN3A 4PW3A 5IJCC 4JM2A 2CZNA 5B21A 3IDIA 4PB9H 4RWYH 3X3GL 3ZSTA 1HX0A 2GSGB 3U6RA 2G2PA 1WICA 3S5LA 3Q1EA 4JUSA 1IUZA 2GIYA 3JUYA 3O8XB 3MBWA 4GIPD 2DWXA 3R0NA 1WD9A 2P5WB 2XWZA 5DO2D 3RU8L 3T2PA 3EJTA 2H32B 3GNML 3O8XC 3SGJC 2YSSA 5T3XL 1K3ZA 1NC2B 4G8GA 2AQPA 4DUXA 1OCWL 5FM5M 4W9IC 2BCKA 2P4AB 4LT7A 5ICXA 5BRZA 5TK2A 1RU9L 2WXNA 3B56A 5IBTL 4E36A 4FLSA 2HKAA 4M00A 2GIMA 4YQXH 4FOMA 1MEXL 1HHJB 3LS4L 1MLCB 3A6CH 4EI6A 1LE9A 1G9ML 1QBLL 1WLHA 3T04D 1P4BL 1WEJH 2P26A 2ZOTA 3IMUA 4G7QB 2E8ZA 3U7YL 1QHOA 2HX9A 2CO7A 1ML0A 3REVB 2JB5L 3MCKA 3WU1A 5L88H 3MNWB 4OD2A 1QSFD 2OTWA 3IXTB 5ECJE 4A7VA 1EZVY 3TX4A 4P3CL 1A3RL 2NMSA 1YNTA 3G5WA 4JDVA 3VXPA 5B3JF 1ILSA 4L8DB 4P4RA 2QSCL 2UZYB 4CRPA 4AH2A 4PJGE 3VDBA 3AZUA 1U8OA 2XX0A 4ZW5A 1XB3A 2X4OB 3LZFL 4D0CB 2DYPD 4FNLL 5CJ5A 5FO9B 1EJOL 2HRLA 1CR9H 1OF2B 2LAGB 2O5XL 2X53A 2FGWL 4QJ4B 1SYVA 1ZD6A 2CGZA 4KDVA 4M1DL 2R2BB 3D4GA 1BYPA 1T6WA 3MLRH 4FZ8H 2DM2A 4BDVB 1EAJA 4BD4A 1X9QA 4N90D 1MI5D 3RDTA 3BZEB 2Y3AA 3PGCB 4HKXB 3P73B 5FYKD 2F54E 3OXRB 4RAVB 3HN3A 1MFCL 2B14A 3N44B 4NIKB 4QRSA 3GZOA 3RGVA 3NOIA 3MRMA 3D0LB 1IGMH 2VXQL 3UG3A