2BZ7A

Oxidized and reduced structures of a mutant plastocyanin of fern
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
AKVEVGDEVGNFKFYPDSITVSAGEAVEFTLVGETPHNIVFDIPAGAPGTVASELKAASMDENDLLSEDEPSFKAKVSTPGTYTFYCTPHKSANMKGTLTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PLASTOCYANIN
publication title Protonation of a Histidine Copper Ligand in Fern Plastocyanin.
pubmed doi rcsb
source organism Dryopteris crassirhizoma
molecule tags Electron transport
total genus 23
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bz7A00
4E9YA 2BZ7A 2BZCA 2NRDA 4YSQA 4X4KA 1RZPA 4UAHA 2J56A 5LDUA 1M57B 4ENZA 4KO9A 1RZQA 5I5IA 2P80D 4YL4A 5PCYA 3S3BB 3GXUB 3TU6A 2PCFA 5D4IA 1J9TA 1PCSA 1T5KA 2VW6A 2GB2A 2AANA 3TASA 2YAPA 2OCCB 1OE1A 5AFAA 5I5MA 1KCWA 4ZK8A 3N2JA 2CCWA 4F7KA 2PPEA 1XB3A 4AX3A 4YSOA 1IUZA 2GI0A 1NIBA 3NSDA 4HZ1A 1M9WA 2AZAA 2HRGA 2DY2A 3CDZB 4MFHA 2XYBA 2YAFA 3HEIB 1V10A 2TSBA 3FYIB 5FC9A 2EIKB 1OOWA 1JVOA 3OM3B 5AKRA 1SJMA 1GSKA 3IEAA 1HAWA 4M3HA 5I6PA 3T9WA 1AZRA 2DYRB 4A67A 1J5CA 4YSTA 3UAAA 1AS6A 3NJJA 3NSYA 3ZBMA 1DYZA 1L9TA 4W9ZA 7PAZA 3OMIB 1JXDA 3JTBA 1WS7A 4WKXA 2I7OA 4QLWA 2IAAC 2CBPA 3T6ZA 3CVDA 3RYMA 2HLEB 3N55A 3WG7B 3TBBA 1W6LA 2GC7C 4P5SA 1M56B 5I5JA 1A65A 1JOIA 2JFCA 2IDQA 1F56A 2QPEB 1HFUA 1WAEA 2VM4A 2DWTA 1SDDA 1FA4A 1L9PA 4BXVA 4KOCA 4DP1X 1PLAA 2UX6A 1CYXA 1NIEA 2X88A 1ZIBA 3S8FB 1IC0A 3ABMB 1PNCA 3NSFA 3X2QB 1KBWA 3C75A 3MBWB 8PAZA 4A66A 1OF0A 1BYPA 3UGEA 2AZUA 3IE9A 4DP7X 2PPDA 4QKTA 1RCYA 3FU7A 4G7QB 1CUOA 3OMNB 3T6WA 4A68A 3SBPA 3CG8A 3OQRA 1TKWA 3H4HA 3CZUB 3AG3B 1JERA 1NIFA 5I6LA 1SNRA 3L45A 2QDWA 3NYKA 2PLTA 1SHXA 2CJ3A 3T71A 1A3ZA 4GP8B 1WA0X 2J5WA 1SDDB 1WA2X 2YXWA 4NERA 3FU9A 2ZWNA 1AACA 2X87A 2VW4A 2XWZA 3SBQA 2XX1A 3NJGA 2FT7A 3X1GA 3FSWA 2VSMB 2HXAA 3CVBA 3HB3B 1FWXA 1PNDA 1NPJA 3ASNB 3NJHA 2XV2A 2YARA 4DP9X 1TEFA 3FU7B 5F7BA 3UABA 5A7EA 2XV3A 2FQFA 3ZDWA 1L9SA 3AZUA 3PAVA 2IWKA 1BXUA 1BEXA 1JZFA 3UAEA 2IH8A 4YSPA 3T6XA 1ZIAA 3ABGA 1AQ8A 1ET7A 3FSAA 1PLCA 3MX0B 1ZPUA 1JZHA 1MG2C 2H3XC 4K9JA 3QQXA 1KBVA 3QJVB 2I85A 2H5UA 2W88A 2VM3A 1W8EA 1OCRB 3EH5B 3PPSA 1V55B 4DP2X 2CUAA 4BXSV 9PCYA 4A2HA 2Y69B 1OV8A 4E9XA 4NB7A 4E9WA 1WA1X 1XMEB 1NINA 3PAZA 1A8ZA 3PCYA 4TXVB 1IBZA 1URIA 1ET5A 2IH9A 3QPKA 4YSRA 2PPCA 2XX0A 2BW4A 4DPCX 3JT2A 4YSAA 3V9CA 1DZ0A 2B3IA 2FT6A 2PP8A 2BP0A 3QJQB 2EILB 2HX9A 2EINB 1FFTB 4HIPA 1AR1B 2WO2B 4E9QA 4DP0X 1HAUA 2Q5BA 1QNIA 1PZBA 3D12B 1ILSA 5I6OA 2XUWA 2FT8A 4DP4X 4JHVA 5B1BB 3FQYA 2BO0A 4AI7A 1XB8A 2N0MA 2EIMB 3AY2A 2ZOOA 4KO5A 1BAWA 3KW7A 2YQBA 2XLLA 3IBOA 7PCYA 3PAUA 3NJKA 3SBRA 1AAJA 2DV6A 1BQRA 1GYCA 1X9UA 2OJ1A 2DWSA 1I53A 1PZCA 1BQKA 1N68A 1ETJA 3S3DB 3UACA 2QDVA 2UXFA 4W1TA 4HCFA 3NJLA 1A4CA 1JZJA 2A3TA 3G5WA 4N8UA 5B7MA 3GDCA 3AG1B 3FPYA 1BXVA 1MZYA 2XU9A 3X1EA 1JXFA 4G70B 2MRYA 2BP0B 4N4YB 5I28A 3QJUB 5I26A 2UXGA 4FA7B 3DTUB 1GR7A 2EIJB 1AZUA 1JZEA 2E86A 4E9RA 1KGYE 2Y1AA 2R7EA 4F2FA 1KDJA 4BWTA 2IWFA 1KV7A 1GY1A 4YVUA 3WKPA 3FQ1A 4Q8BA 1QLEB 4KO7A 4P5RA 1ZDQA 1NIDA 1X9RA 1PMYA 2LLNA 2AVFA 3X1FA 2PP7A 1GS7A 4UANA 3FU8A 1TEGA 3AG4B 3GYRA 2YXVA 1ILUA 5B1KA 1OE3A 1R1CA 1AIZA 3ERXA 1N70A 2GSMB 4A2GA 3TBCA 4DPAX 3S8GB 4HAKA 4BK5C 3FT0A 1ADWA 1SF5A 1V54B 2IDFA 1EZLA 1GS8A 2DYSB 2IDSA 2VN3A 4M4RB 1MDAA 1CC3A 2J55A 4A2DA 4A2FA 4HALA 3QJTB 4YSUA 1A4BA 1J9QA 1GS6X 2XXFA 4E9VA 2R7EB 1PLBA 1SFHA 2PP9A 1UATA 2JKWA 3FPXA 1J9SA 3EF4A 1AANA 4AKPA 3NJMA 1NZRA 1OCCB 2CALA 2AFNA 3NP3A 4DP6X 3WNJA 3FYEB 2TSAA 4CSPA 3ABLB 2ZXWB 4CSZA 2UXTA 4Q89A 4GXFA 3DKHA 1SF3A 3BVDB 5I6KA 3UADA 4HHWA 1BYOA 4YVNA 4WTQA 5D4JA 1L9QA 2J57A 4AKQA 2BW5A 3S3CB 2FTAA 3NJIA 1JZGA 3NJFA 4A2EA 2IWEA 4UF7C 1JXGA 3FSVA 5D4HA 2ZONA 1ZV2A 2HRHA 3H4FA 1WS8A 1EHKB 1KYAA 1PZAA 4HCGA 1ASOA 5TK4A 1OCZB 1TU2A 4GYBA 2I7SA 2P80A 2B08A 1W6WA 3AG2B 2VSKB 1CYWA 3OD3A 1ET8A 3CVCA 3TA4D 3X1NA 3X1BA 1NPNA 1SFDA 1AOZA 2IDTA 2BP8A 3EH3B 5I6MA 1JVLA 4DPBX 4G71B 3ZIYA 2VW7A 5AZUA 4EF3A 1RKRA 3PLYA 1BQ5A 2FNWA 5F7AA 2PCYA 1PY0A 6PCYA 2UXVA 5IY5B 4FAAB 3FS9A 2JXMA 1MZZA 2QPDB 2PPAA 5PAZA 3QJSB 4YSEA 2XXGA 1J9RA 3EHBB 3WKQA 1ASQA 2BHFA 1L9RA 1NWOA 1AS7A 1KDIA 1SHWA 2FJSA 1E30A 3PXLA 2YAOA 3ZX1A 4L0PB 1NICA 2IDUA 4YSDA 1IKOP 4PAZA 2PPFA 2XV0A 2YAMA 4AZUA 1OCOB 4G7SB 1AG0A 2BP8B 2W8CA 2HX8A 4KNUA 4PCYA 3U25A 5B7FA 2H47C 4GP5B 5TK2A 3WNIA 2RACA 1VLXA 3FQ2A 4RH4A 3SQRA 4BWWA 4DP8X 5EHFA 2MTAA 1ZDSA 4NAJA 4JKNA 4G7RB 3FSZA 3NJNA 5B1JC 4GY4A 3NSCA 3OMAB 1BXAA 4YSSA 1QHQA 1AZNA 1E5ZA 3NP4A 4DP5X 1AZBA 2BWDA 2WO3B 3AW5A 1KCBA 2VMJA 3BQVA 4HCIA 4KO6A 3WI9A 3H56A 2HZHA 4BDVA 3T6VA 1A4AA 4HHGA 3NT0A 1E5YA 1ID2A 1PAZA 2GHZA 2BWIA 1IBYA 3IN2A 1MG3C 4KNTA 1GY2A 4G72B 6PAZA 5E9NA 5B7EA 1E67A 2FWLB 2OV0A 3WIAA 1OE2A 2GC4C 3V9EA 2CAKA 2FQEA 2YAHA 2YAEA 4BWUA 1NWPA 4JHUA 5B1JA 1JZIA 1J5DA 2FQDA 3QJRB 4E9TA 2GIMA 1AS8A 5I6NA 4YSCA 1NIAA 5B1AB 1YLBB 1GW0A 4E9SA 3EH4B 5B3SB 4KNSA 2FQGA 1CURA 3ASOB 1AG6A 2YAQA 4KOBA 2HX7A 1XB6A 1NDTA 2GBAA 2UX7A 1NTDA 1B3IA 2QT6A 3KW8A 3IN0A 3CDZA 2WSDA 1E65A 4BDVB 1PF3A 3DIVA 4GP4B 1AZCA 5ANHA 4F2EA 1L9OA 3ABKB 1ASPA 2Q9OA 4AKOA 2XVBA
chains in the Genus database with same CATH superfamily
4GQQA 2BZCA 4WCYL 2D3LA 5GSRB 1G7LA 1AQKH 4RESB 4XCCH 4WUKL 1CTNA 2CDEA 2XQYK 2OZ4H 3RY6C 5GHWL 2ZT9C 1QUNB 4OZHE 2ZXCA 1A4KB 3CZSA 4KJYB 3U30B 3MRIB 5HHPA 4HPOL 1ZHLB 4WY7H 3OKNB 4ZTPH 4DK5A 1T2QL 1YQVL 3FB7B 1JPSH 3TU6A 4K8RL 1YEJL 3EH2A 2VW6A 1T5KA 4QXVA 2Y07L 1RJLA 2CO7A 1LP9A 3NOIA 1QTPA 2EEBA 4ZFOL 1A3RL 4MCZA 4N0CD 1MCNA 1GPOH 2DM7A 2YA0A 3IPFA 3MLSL 3QJZA 4LQFL 1P2CB 1G7QB 1G6RL 2ZCHL 4J3SA 4UYQA 5AQ0A 4QWWC 4GKSB 5HDQH 2OYPA 1OIOA 2NR6D 1QPPA 3UTZA 3T9WA 4YDNA 5KBLA 2LE9A 2KQMA 4YSTA 5D1ZI 2ZYSA 5CHNB 5CIPA 1FVEA 3TJHD 3N1MC 4QY8A 5F9JA 3JWNG 3OMIB 3UMTA 4M8UA 2WJ5A 3U6XA 1ECYA 1WBXA 2P1YA 4KVCL 4H1LG 1T4KB 1HHKA 4WW1A 5HYJE 5T33L 3ESNA 2KT6A 2BRQA 1OD9A 5D1ZA 3WG7B 4FLHA 1FNLA 3X14A 4HEPA 5D6DC 2IXQA 1IGYB 4MJIA 2JFCA 4Z7QF 4QRUA 2GW5A 3OPUA 4Z5RB 1CGTA 1MCBA 4OKVA 2GBTA 3ZRCC 3L9BA 1MJUH 4WFFE 1CYXA 1WPCA 1XXDC 4I4WA 2XN0A 4IRJC 2FCBA 4K07A 2X4UB 3QZWB 5DI8B 3T0BA 2NX5E 4EIGB 1RZGB 4FKEA 5ACLA 1IB5A 4KI5F 4PJAA 2Q86A 4LDEB 2B1AH 3E9UA 1RCYA 4D3CL 2ODIA 4HV8B 5DD0H 4R97B 1HIMH 3LAFA 4KK5C 3TJPA 5IFHL 2J12B 4IDJH 3LKSB 1UKSA 1QLEL 2J2ZA 4YXLH 3NCWA 4Y4HB 5DK2A 3U83A 4ODWA 1KGWA 1WHPA 3BVNA 3L3HA 1J1PL 1SNRA 2F7QA 4PJEB 3TVMD 5FV1L 1HE7A 2WZ0A 4UQ3A 4Y5VA 4YHLL 1OP3H 4FHKA 2PW1B 2DMKA 1OTUC 3IJHA 3WOVA 4WJKB 4MHHG 3T8XB 4HJIA 4NPKA 3B2XA 3N1FC 3VNYA 1N6QL 1UWYA 4NZRH 4A04A 2A77H 1YA5A 4DAGL 3MZGB 3RHWF 3QH3A 2DI7A 1ZGLA 1AXIB 2A9BA 4KXZH 3NRQA 4XPHL 3W81A 4HS6B 2F54A 1T1YA 5LN4A 1WBYB 4IU3A 3U82B 1A5FL 3MV8D 3DX6B 4OFDA 4UT9A 3ATAA 4Y7MA 1XZWA 4MNGE 5T1LA 1J0JA 2BCKA 2JB5L 1SY6H 3N1GC 4TPRL 1EGJL 1C08B 5DRZB 3ZU8A 1BEXA 1CDGA 2HAZA 1QD0A 2FGWH 2J8UF 4LOFA 4PJGA 5ESVB 1PLCA 3AAZB 3VDBA 4ONFH 1TXKA 2FVNA 4X9GA 4URTB 4M02A 1HHGB 3DXAA 4N6RB 3NDYE 4TVPD 4L48A 4J28A 3GSXA 2VDRB 4PJIE 3W39A 4UT7L 3HJEA 1INEH 5FEBA 4YX2L 1NFAA 2LAAA 3OKOB 4HKBB 2E7CA 4ZO6A 1MW3A 2X6AA 3KBEA 4FQJL 2DQDL 3V0DA 1OV8A 3REWB 3EFDH 3MLUL 4APXA 2R0LH 5HJ3B 5A40E 2VDRH 5EOQH 1X5GA 1LQBC 1CG9A 4P23A 4NOFA 1BBDH 3KBHE 3PAZA 2EE2A 2W91A 3AY4A 1A7QL 3RWIB 1YECL 2XN9D 1ZE3C 2MOGA 1G7HB 4KHTL 2ZUTA 3NIFF 4OIFA 3JWOL 1FE8L 4IGBC 4EAEA 3IFNL 4LCCC 3PWUA 4TUUA 4NKDB 5AW2B 2MCPH 1BQLL 1HX0A 1S3RA 3LEXA 3D18A 4O02A 5DWPA 5C7XL 3T0EC 5J8OA 1S5HB 5TPWL 4OY9A 3OC8A 1INDL 3RJQB 2DI9A 2VXUL 4Q9BA 5IR1B 5EU3B 3IKCB 1YEGH 2ZKYA 4GKNB 4M3JA 4Z1PA 3PP4L 4PJDA 3FQYA 4DUWA 4AQ1B 3C87A 2AGJH 1E2ZA 3ECBA 1XCXA 3HPLA 2YQBA 3LVEA 5LQBH 4HBQA 3ORJA 1VJSA 4LSUL 1DVFA 4WAFA 3QCUH 2OMZB 1U58B 4NUQA 5E23A 2LU4A 4AEEA 5DVMA 3FQTB 1IZJA 5GSVB 4L8CA 4RZCB 5H94B 3FQWB 3QNXB 5IESH 2FWUA 4BH7A 3UACA 4ANUA 1M05B 3DX9B 3L7EA 1EPFA 1NMBH 2C8NA 5DC2A 1OM3L 3MNZB 5T1KB 3UTTD 2WP3O 3KYKH 3BPCA 4JM2C 1GZHA 2OJZH 3F6JA 5E2VL 4JFOA 5F7EL 1LWJA 5CEYA 1MCKA 2YD1A 4IEFB 4OQTA 5BS0B 2MQCA 1JGVH 3VXTB 6CGTA 3I6LD 4YQXL 4L2LA 3QO0A 1AHWB 2XTJD 4N8VB 1U8HB 2R29H 4JJHA 3VXRE 2V2TB 3SE9H 1U8QB 5HGBA 3UZVA 1IEAB 3VJ6A 5CBAA 3C60A 1A9BA 3HC2A 3BAEL 4FQXB 3TEXA 1E28A 4KROB 5EU4B 3L4YA 3FO2A 4HQQL 4WNQB 3X17A 2QELA 4BK5C 4GI9A 3CDGB 3ARBC 3KJ6H 3VWKD 4X4ME 5C2UB 3BHBB 1FORH 2AMUA 3F3HA 1FGVH 3W1ZA 3OPZL 1GS8A 2PO6D 1BMZA 3GXIA 2IDSA 1GA2A 4QRTB 5E6IA 1K2DA 4GQ9H 1J9QA 1NGWA 4M93B 4XP5H 1KIQB 3OJVC 3O9WC 1W91A 2CR0A 3CFKA 4MCNA 4NNXB 2EDQA 1FAIH 1KIUB 2IH3B 4NZTH 4PWIA 1NZRA 2H1XA 5KVGH 4ODUA 3JVGA 3NK4A 2NYZA 2F8OA 5H8DA 1EDYA 2VDNL 1ZY9A 1MSPA 1P4LB 2VR3A 3ZR5A 1X4XA 6TAAA 1XGRA 5FYKH 3QQ9C 2JSFA 3VUAA 4J1UA 1UQSA 3B3BA 2WBJD 3MGOA 2OW7A 4OF7A 4TL4A 1BZ9A 2OCJA 4QHLA 4ZW6A 5BRQA 2YRPA 1S7RB 3WE1A 2V7HA 4Z76A 3QUZA 4XT1C 2VXQL 3A6BL 2NQ3A 1JZGA 2FUQA 5DQJA 2WZ5A 2YBRB 4HSAC 1DDHB 3MA7B 1FCCA 3LIZA 1NFDF 4XO5A 2VWEC 3E38A 2ZKHH 4YO0B 2IPKA 2VZ1A 2OMNA 2XWCA 4PRHA 2QLYA 3T4AC 2APXA 2WTPA 3FN9A 4L3CB 5A16B 3V6OA 2WN3A 1GOFA 5D7KE 5F7YC 4QT5B 3I9IA 2C9XA 3HI1B 4CC4A 2XTLA 2SEBA 4MD0B 2EO7A 1UD4A 3BP7A 2V5SA 4JLRA 1QSZA 3WE6A 1ZSHA 2HB0A 3DDGA 3EH3B 5CZXC 1DVYA 2XWDA 4GMSH 2ESVA 4PJEE 4P4KC 5GS1B 5I1LA 1AXTL 4O2EA 4EIZC 1NBVL 4XXDB 1JK8A 4QRFA 1S4IA 1NAKH 3MTRA 3PLYA 3CC5B 3IDIB 2FNWA 1XR9B 3NPSC 2ZOUA 2A99A 5HVHC 5IY5B 3LPWA 5HDBF 2NT1A 3VWJB 4R7DB 3P2BA 5HHMD 5KUMA 5DDHB 3H7BB 4IRZL 2RA1A 3EJPA 4UTCA 3F62A 3OVUB 1EH9A 1ZA3A 3QARA 3ARFB 3QUYD 3TN0A 2OMYA 4WHYG 5MEPB 2NDFA 2XKNB 4JQXC 1SJEB 3NRFA 2OR9H 5EV7A 1ZT7A 5EIIA 3HB3C 3OHXB 3G7TA 1QRND 4GLRH 3VRJA 3VFGL 2EEFA 4WRLA 4PAZA 5BQDA 3MXWL 4NC0B 2YAMA 3KYNB 3ZQ9A 1CMOA 2NXZC 1JTOA 1AG0A 4OUOA 4F1ZA 5AW1B 3F7VB 2WY3B 3LS4L 4M7KL 3PY9A 4X5XB 1DR9A 3CFEB 2GTWA 2ZE0A 2DB8A 1M6OA 4G42A 3UO8B 1AD9B 3SE6A 2VN4A 1UT9A 1ACZA 4WGVB 2OK0H 2C3HA 5BVPH 1O7DE 3MACH 2XBDA 5K1VA 2R23A 2ZUQB 4P3WA 2XI9A 1E5ZA 4FFYL 1UZ8B 2AXWA 4DP5X 1JHKL 2BWDA 4CGUB 3N50A 3AVEA 5HHNB 4XAKE 5CN2A 1U3NA 3VE0B 1NGQL 4GQRA 1OF2B 1JI2A 3GZPA 4RFNC 3ALXA 4X8CA 1JXKA 2WLYA 1RXLA 1UWXK 1HDMB 1SXZA 1IBYA 5CGMA 4WHCA 3WIHA 5ANMA 5B7EA 1G7IB 4G11A 2Y7LA 4YNYA 2R51A 3IMRA 5K1JA 3EJQA 5BUAA 4QTIL 3T8VA 4QNPF 3BT2H 4GI6A 4NNPL 4YWGL 2BC4B 5KBNC 2BNRB 5SX4H 2V5YA 1BOGB 5I8KH 1XF3A 4MAYD 3MRJA 2X6CA 4K3JL 5LG1A 1OAXH 2V2XA 5I18L 1V7NL 3LRMA 5D2LB 5HGHA 5BO1H 5DZJA 3FH5A 1JWUB 3B37A 1QSEB 1ZTXH 3EH4B 3GMPA 3V0FA 3TYFB 5GS0L 2K9FB 4B41A 3P9WB 3VO0A 1J05B 1I9IL 1KIPB 2H2PD 1JGUH 2JJTC 3CU1A 3TO2B 3TBVA 5ICZB 3QDAA 5AALA 3B5TA 4DKEL 1J0YA 4JZJA 4RAVB 1G9NH 1WBZA 2R2CA 4AQAA 3AM8C 3RI5K 1CU4L 4JDEB 3CHRA 5ALCH 4NI3A 4FFVD 4KKCC 1CZ8H 3H54A 4PSPA 4N4YB 4ERSH 1RU9H 32C2B 3U4AA 3E2HB 3V5KA 4F2MB 3G5ZB 2NY1C 1SUJA 1B4TA 2WXFA 3I9AA 3AABA 2VLJD 3RJOA 2PXYB 3CWGA 5AUMB 4WW2A 3AWEA 1FGNH 2E46A 5EPMA 1ZXQA 1SMOA 5FKPA 4W4NA 3QQ4A 3S3BB 5PCYA 4ES9A 2O30A 5BS0E 4HHAB 4LLQB 2XY2A 4K23L 4L5FL 3HNSH 4JKKA 4KI5D 1KTRL 5HHQA 3HE7A 4X9YA 1NCBL 1IUZA 1BPVA 1I9RH 3FT3A 4MVBC 4MFHA 1M9WA 3VXNB 4F15B 1SYVA 1TEYA 3KPRD 3V9FA 3NPZB 3HN8A 3INOA 2VRKA 1Q9WB 3PGCB 4E5XA 3IXTB 3DA0A 1NLDH 3IEAA 4HBCH 4MA1B 4UNIA 3QJOA 5FOJA 4D0CA 1KYOK 2NY0B 1XWVA 2BINA 2K7QA 4XBMA 3REVB 2D7TL 1AE6H 2L0DA 3ZTJH 1BIHA 3LKQA 3M1OA 1KTLB 2LFGA 1INQA 4EUPG 2Z31D 2WLLB 4YBLC 1OGAD 2DQFB 2ORBL 4QLWA 1ZLSL 2OXHA 4OM1H 5D1QA 5KVGE 1J86A 1MRDH 2JELL 2N7BA 2Y23A 3B9KB 4M8QA 1HOEA 1LGVA 1M56B 5E4EC 3IFPB 4OD3H 1I9JL 2J6WA 4HIEA 2P26A 3TWYA 1DBAL 2WMPB 2I27N 4NHCH 3RTQA 3VXQB 3IJSB 5KAQF 1JGDB 1T5WB 4XVUC 2CKBA 5I17A 2GBVA 1ZT1B 2ICEC 3DTDA 5LBSH 1NBZA 5LGYA 3U4EA 1R9FA 5IUCA 1IC0A 1OGPA 3ABMB 3FFCD 1RZJH 1YY8A 3HG2A 4LVNB 4PRDA 3O45A 3DO4A 3UO1H 3AITA 1V3MA 3ISRA 2WVVA 2KLTA 1O6TA 5DF0A 2IFFL 4NDMA 3S5LG 3U9PH 3BAYA 1G6VK 2BSDA 3FU7A 3DLQR 3T1FA 1PKQA 1E6JH 4KDVA 5L8LB 4A68A 2RIKA 3KLDA 3B2MA 3IGAB 3B4NA 4K9EL 1H5BB 1A1NB 1IKNC 5EZJA 2B1OA 2E3VA 4G6ML 4HISA 2X4SA 5KSBF 4B3EA 3EYFA 2FL5A 1P4IH 1MCEA 5BV7C 3GSVA 5FYJE 4ZDHA 3N1PC 1G9ML 1DN0B 1L3WA 5GGRY 1SEQL 3GSWB 4ZOCA 1U8LB 4U6XB 1AACA 1IC4H 5A3IC 5T1DL 1PL3A 2FX7L 5E6ZA 4G8EA 2DQUL 5K9KB 3GMNA 4K15A 1QA9B 4MKTA 4JDZB 3TEYA 5IQNA 2YK1H 5BRZD 2O6CA 1PSKH 2UZYA 3AJ7A 3WKML 3QUKB 4ATTA 2XICA 4FQ2H 1VDGA 3SDXF 5ITBL 1NL0H 3SGEH 2ENYA 4TOYH 1LQSR 1T7XA 3GSQA 1H8LA 3V6FB 4UV7H 5IGXL 4TQEH 4WHYH 3OKKA 5DD1L 4Z77A 2A6DA 4U1GC 3ZDWA 3KXFB 3WFEL 3RWCB 4DN4H 4HU8A 4M1CC 4FNSA 2IWKA 3QYCA 5JW4M 4AIZA 1KACB 1GXEA 1LD9A 5JW5B 2R39A 4BSVA 1ZIAA 2W0PA 2ICWB 2P4AB 3OMZA 2IG2L 4UTBA 3ARVA 3MX0B 3LKOB 4OLXL 2XZAH 4TV3A 5KYXA 4JM2F 5BQ7A 3D30A 2ZQKA 4NQSA 1IGTA 1LO0L 4RRPA 1U8PB 1E4XH 3MRCB 3D51A 4FZEH 2UUDH 4JQVC 4FZ8L 4LSQL 4J3BA 3LH8A 4XVSL 4NC1E 3SJVB 5IW6B 4U1LA 3QC6X 2DQCL 4A2HA 1U2YA 2BSEA 3AC0A 3FUJA 1BQHG 3US1A 2B14A 4AV5A 5JQ6H 4OJEH 1G7JB 4RA3A 3V4VL 1MW2A 2F1EA 3QHZL 1SJHB 4L8DB 1PZ2A 2Z93A 3BO8A 3NA9L 3WEMA 3LDBB 1U0QA 2BNUA 3ARSA 4WI6A 4JQIL 4WSKA 5KYWB 4PLKC 4NQCA 1WAAF 1ZHNB 2YEZB 3VYOA 1ODUA 3F7QA 4IRSC 4XNZB 1TSHA 1VSCA 3VFTA 2WBXA 3GI9L 1WT5C 2WTRB 3BKCL 4H26B 1QR4A 3TX4A 5D1ZD 1BGXH 4NBZB 2ALWA 3FTGB 1DLHB 4QR7A 1ZTXE 2V17L 4GRMA 4LVEA 4MJID 1HQRB 2HFGL 3STZA 2BNRE 1O6SB 3JTSB 3D12B 3D87B 2XUWA 5A6IA 5FUCC 5D2LE 5EN2B 1NKGA 2F2HA 2CIIB 2WAQA 4JHVA 4Y4KC 5B1BB 2HLFC 3W3BA 1FL6B 2IAMC 1RUMH 4GT7A 4IJ3C 1Y7VA 4UQ2B 1ZJBA 3RBGA 5CKGA 3K6OA 1EANA 3C5XA 4XO9A 4Y4FA 1R4XA 1ICTA 1X9UA 2CHZA 1HS6A 4HFUL 4JEGB 2ENQA 4WU7B 2NNCA 1T1WA 2IV9A 3PGDB 1A6WL 3STLB 1DP0A 2OQJB 1EK3A 2WUBH 1EJ8A 3S3DB 2EH8H 2X4NA 4XPBL 1P5UC 3QHFL 2WLHA 3E8UL 3EYUH 3GDCA 3NIDE 4D9QD 3SY0A 3S9DB 3H9SA 3MCLL 1S7QB 2JK5B 1EHAA 1M1XB 1UXSA 2YOCA 5C9KA 3DJSA 4HWZB 4NYLA 2VLMD 4K7PH 5ACZA 4X98B 2G5BA 3WN6A 5GRWA 1JV2B 3RVUC 3S35H 5JIKA 4E41A 2FB4L 1JZEA 1P9MC 2HWZH 1FC2D 4R7VA 5TF1H 3UC0H 5K59E 2Y3AA 4L29B 5D7LA 4TQ8A 4AQZA 1I7TA 1CD0A 4AM0B 2W81C 3W11C 2MMXA 2VIRB 4RX4A 3T2LA 3QDGB 4HUCA 5FCSH 4LHUB 1JTTA 1MWAA 3GIZL 2VAAB 1IJNA 1AYRA 1CIDA 1QFWL 3ML8A 3LZNA 1RJZA 4IKJA 3OGCA 5GGQL 5JTWA 1T5XB 2DQGL 5HHOA 3KEDA 1AI1L 1L0QA 3HUJF 4NCDA 4OLWL 3TBCA 5GGTL 4A2GA 3FB8A 3GSOB 3H2WA 1XTMA 1X7TA 2A0LC 2YMOA 3M46A 4M5ZL 2YA1A 4WENB 5F0JB 1H3PH 1ZK5A 5AYUH 5EDXA 3B1TA 4Q9QH 2KI6A 2E4FA 1MW1A 5T1LD 1CI5A 5GGSA 1QO3A 4N2FA 4P46D 4H7VA 2DYSB 1MHCA 1TR7A 5AVSB 3DETC 4RMUA 1G5AA 4JN1L 4XOAA 4N0RA 5C70A 4JFHE 3WS6C 2OTWA 1MNNA 3L4XA 1RP8A 3FQUB 2H9GB 3A4DA 4NBYB 3FPXA 1AQKL 4K5PA 1XCTB 3DXAD 5IJCC 4DO6A 5AKVA 3BC9A 5IHUH 5KN5B 2AFNA 5FCUH 2XDHA 1NDGB 4XCYA 4ZTPL 1NUFA 1TQCC 3V6BR 1OY3B 5IHWA 1JPSL 3O3AB 4PN6A 2PTTA 3T0VA 3KDMB 2C4FU 3CZFB 3IYLW 1E8YA 2WGXA 4U1KA 4ZT1A 1PZUB 4ZMNA 2BMKB 4YDIL 3QDJB 3DVNA 4P23D 3MYJA 2FJHB 2YLHA 1HSBB 1WCBA 2GBUA 4J2QA 4OVVA 2WXLA 4WTQA 1L6PA 2J57A 3DMMB 3MUY1 3QUMA 5AWNH 3SE4C 1F6AB 3VFOA 3F8UB 3HR5B 2OMUB 3ULAB 3P4OB 4K2UH 2VITA 2OI9C 4I3RH 4ENED 5H37G 3TCLB 4EI0A 2F8IA 5HDQL 2ZX7A 1CR9H 2DM3A 5BXFB 3O0RH 1LNUA 4GYBA 3K2KA 3CVCA 4RNRB 1NC2B 5BZZA 1XH1A 1ZVNA 4KJPC 3SZ6A 2NY3B 4DPBX 3PWJB 3ULVC 2WIIB 5GRXG 5EO1A 1LO2H 1BD2D 2Q76B 2ZWLT 4MA8H 2ARWA 4AZ8A 6PCYA 1WZ1H 2MH4A 5K1NA 2J4WH 1Q72L 2BSSA 2D3VA 3Q6GH 4P48A 4DERA 1GYVA 4PSRA 4ETQB 3QDMB 1U2CA 1OALA 4X83A 2EYSB 2Z6FA 3AREA 4CDGC 1HH6B 2YPKA 3VGEA 5JA8B 3V10A 5DUBB 1EXHA 1QEXA 3VFRA 2WKOF 1QWNA 3HC3H 4JFFA 4ALAC 1S78D 4B50A 6FABL 5TQ0H 3IDMB 1L6XA 3PXLA 4HAFA 3MBXH 1I7UA 3U48A 4X7SL 4R84A 1IKOP 1QZ1A 4K94C 3HHSB 3BVUA 1KGJA 1TU2B 3KXFE 4UQIM 1NCAH 4JNXA 1T1ZB 4WTZG 5D1XC 5DMYA 3QPQC 4U3HA 1IFRA 1OVZA 1A7OL 3U1PA 3ZYOA 2B1AL 3KPSA 1OAKL 5B7FA 4OCSH 2Q3ZA 2VJXA 3P02A 4RH4A 5CBEA 2V3FA 1X5IA 4I18B 1XT5A 4NZ8A 2J6EA 3MMEA 4X9BA 4YHPA 1LL1A 3EOBA 3NSCA 3PV6A 3RG1C 1MEXH 2FSEB 3BQUC 3MUUA 3BD4A 3C60D 3SDYH 1AYOA 3SJVE 1KCBA 2BJML 1BG1A 1P5VB 3BI9X 4YAQA 4FG6C 4I85A 4HHGA 4DKAA 3ROLB 1NCWH 4DNLA 4NZRL 4PI0A 4WI5A 3I6SA 3HRZA 3QZBA 3H3PL 2Y2WA 1LLAA 5E6ID 3WFCH 1E67A 2F53A 3OAWA 4APQC 1MCSA 1DQJB 3PRZA 3ZYZA 4F8OA 3S96A 2FO4B 4JHUA 3CJJA 2KDYA 3PAYA 4G3YL 4QCIA 4Z7WB 1XBDA 1OTUD 5I30H 5I9QB 1SY6L 3F2LA 1ND0A 4LLDA 4V33A 2HT3C 3T2OA 1RL1A 1XBRA 2EDHA 3UYPB 5IOPB 5D5MB 5FYLD 5C0GA 4KOBA 3NTCH 1MHEB 3O2WH 1B0GA 1CTMA 4LF3B 43C9A 2GBAA 3CVIH 3FCTA 3FAWA 4ZTOH 1NTDA 3QAQA 1S9YA 1B3IA 4P9HC 4A7QA 3HAEG 5DZPA 5KTEL 2IADA 5F93C 1OGTB 1R3HA 4ZFOA 1AZCA 4FXKC 1L9OA 3KYAA 1PIFA 3QUZD 1ASPA 1XL6A 4Q7DA 1INEL 2AITA 2J5LC 2NNFA 4RMRA 2AJZB 3VD4A 4OZGA 4W6YB 2FD6H 1G6RA 2K3TA 4ZO8A 4UNVA 3X13A 1BLIA 3WFBH 1UWFA 3EFDL 1NBYA 4PRHD 4PJFA 2R0LL 2DTML 4AYMC 4XN7A 4ZJ9A 2VDRL 4GO6B 5TE6H 5G2NA 2ROYA 1P1ZA 4EO5A 3TVMB 2EXTA 5C09A 5AOZA 3GXUB 3DDFA 2P8LA 2VL5A 5CJOL 2C9VA 4X4XB 2CO6A 3BIKA 1JPGB 3HPJA 4QYOA 1MAJA 3IU4L 4PS8A 4LLWB 2AJUH 4XPAL 5IB5A 5J6HA 2HJKB 3WXWH 4PJ5E 3FFDA 3X3FL 3QDGE 1HQ4A 2G60L 3MA9H 2D2CC 2R1YB 3KWTA 3NRPA 2DY2A 2VE6B 3UG3A 1F4WH 3TZVC 1FVDB 2AJVL 4CN4A 5F1OB 3L9EA 1A22B 3FTZA 4JM4H 3TCTA 1I85A 1GSKA 2D03H 1E5BA 3MV8B 4MDIB 3TN0D 3RJDA 4M3HA 3ELQA 4DH2A 4A67A 2WLJA 3CFDB 1JZ3A 3RDJA 1JNHA 1SDAB 3QISA 4KK6D 4WFHE 4ZW7A 4W9ZA 3QCUL 1CLCA 1I7RB 5EBWB 1F11A 2HJFB 2QPUA 1JPST 2OXGA 3HUJE 4PJBF 3FO1A 5EBGA 4HETA 3L5WB 5T8IA 4HKZA 2QJDA 3AS1A 1YN7A 1CBVH 1TCRB 5IQMA 2G3ZA 1QVOB 5MEQB 3GRWH 5JW4N 2YD6A 4C54A 1KCUH 2IDQA 3DBXB 3W9DA 1TJXA 5J1SC 1SDDA 2VQ1B 3CHXA 3ME0A 5LJYH 3OLEA 2ID5A 1T20B 1PLAA 2FLRT 3WEAA 3SOTA 3Q9PA 4TVPH 3AACA 3ETBJ 4ZUWA 4OZIA 2EDMA 3WEXA 1DVXA 3ILQC 4XZUB 3X2QB 1U42A 2YKKA 3MNWB 1T7YA 3DURB 5CZRA 4NN7B 1KBWA 2GUYA 5GJSL 5IWLC 3C75A 4OGXH 4NWUH 3SKOB 2Q3XA 1TTGA 2BRRL 2XN9B 4NWTH 5JUEH 3SE9L 1A1OA 3U7WH 1JYNA 4TUKH 3SB3A 3EO1A 3HG5A 3K4AA 2APBA 4AIXA 1NAMB 4N0UE 1N0LA 3WEOA 2BHUA 1N8ZB 1Z6JT 3BAKA 3D33A 5JXAH 1JPEA 3IK2A 4Y5XC 5EC2A 4HK3J 4FTVA 4BQ8A 4XPGH 2AQNA 1MY7A 1FORL 4JKMA 1YNTA 1OT2A 4L4TE 5GISH 1ZHBA 2MQGA 4J3OG 1NAMH 4KTDH 4NCC2 1A9VA 1CT8B 2DQMA 1EJFA 2YGNA 2YXWA 1EGJA 4NM4H 5T1MB 3GLEA 3PJSA 3BQUA 4Y5YC 5AG9A 3EOAB 1R5VB 4Z7UA 3CSBA 3HR6A 1E2VA 4XP5L 4PGEA 2FR4B 1RK1A 4ZAKA 1LEGB 3NJGA 3SKNA 3PHSA 4X7CC 2APWA 2VSMB 4NZTL 3BRDA 1WK0A 1PNDA 5E8OA 3VM5A 3QDME 1E9OB 3NIGB 3SE3C 4ZMWA 1X5LA 4Q6YA 3ZKMD 4ZUTA 1T0NB 3CX5K 4R4ND 2NSMA 3WD5H 3SDAA 1JDCA 5FYKL 3UTTB 1X3DA 1BFVL 4M7ZB 1OWWA 4Z78A 5INCA 1WZMA 5DRXA 1R19A 4EVNB 5I76B 3L5XH 3ZTEA 3I9GL 1TITA 1CI3M 5CJXC 3IB4A 2XTJB 1ORQA 4G6JL 1QEWB 4YR6B 3ZHFA 1JYXA 3QI9C 4LPXA 3UZEC 2E0PA 3HE7D 1H0DA 1SQMA 1U8NB 4YDKH 3DUUA 4F3FA 2YS4A 1V55B 4OVUA 3IDYB 4B9IA 1TQTA 2HYMA 2HT4D 2QVMA 2QTVA 4GMSL 2NY5H 2H6PA 3MR9B 3BD5A 3TO4A 4UB0L 2DYPD 5IFJB 2VXVH 3VWKB 5KJ7E 5EWIH 3ARQA 1HCVA 3MUGB 3ZDYB 1AH1A 1IBZA 1ZHKB 4HCRH 4MXWL 4U1NB 4WEBH 1MLBB 2PO6B 3WUWB 4A38A 3TLRA 3O11A 1Q1JH 4K73A 1IC5H 3OC5A 4EI6B 4IBQA 2G5RA 4KJWD 4KHXL 1X9QA 3MJ8B 3VMNA 1QBLH 1UA3A 4EDXB 1RFDH 1VFMA 3I2CH 4ZRGA 2WO2B 3OLIA 4X0KB 2OR9L 4HIHA 1EXUB 1WH0A 1PY4A 3HZYA 2OYLA 4ZFFA 1QSVA 1YEKL 5M7QA 3OAUH 1JHTB 3RTQD 2J88H 3HAEB 2FEDC 1FVCA 4DP4X 1UWXH 3RILA 1WUNT 4B7IA 5GZNA 1KNOA 2CK0H 4P5MA 4I1PA 4HT1L 1FP5A 3CFJA 5E5MA 1UOLA 2WBJB 4N2GA 5D5ME 3PAUA 2HRPL 4LRIA 1G84A 3HMXH 4HSQA 3HAEH 1RZKH 2DV6A 1EEYA 2DLIA 5H2BB 4F37F 4GXVH 5D7JA 1I53A 4FXGA 3HB3D 2YD0A 5BVPL 3VFWA 5I1JL 5DRNA 5KS9B 1O9WA 1TVBA 5I0XA 2Z7YA 1DBJH 4R7NB 2DQJH 3M17A 1ETJA 2QDVA 4J7RA 5I1KH 3KE0A 1XGTB 3UBXG 1FFRA 5AW9B 4XPFL 4IKIA 1BXVA 3LEVH 5DQDL 1MHPH 1GKEA 1TJGL 4GI8A 1AP2B 2ZXQA 4LCYB 2M2DA 3FC8A 5AW3B 3LXBA 2UXGA 4WDIA 4GG8B 2X05A 2AQQA 1TZAA 1TZGH 4FA7B 4FX5A 1MOEA 4H2AA 4M61B 3QG7L 3FCSB 1E9QB 1D5ZA 3GZKA 1IE4A 1KTCA 2R2HB 1HOCA 1Q9KB 1VEPA 3CVHA 2XZCH 4HWEH 5CZVH 2QADD 3KLHC 4JO4L 3HLAA 1CFNA 1LO5B 5I8KL 1GS7A 1JGEB 1WCQA 3D85A 3H3KA 5HHMB 1NJ9B 2Z92B 3ULVF 4XH2B 3MOBH 4IU2B 3QUYB 4ZODA 1BLNA 1N70A 2Y5TA 2GSMB 4P0DA 1TJMA 2TAAA 1HI6B 1UWEH 3B56A 1QRNB 4P2QE 3LNHA 1XIWC 2AQSA 2N3JA 2IQAB 5K33A 1IAOA 3ZTDC 3ARWA 4A2DA 5ALCL 2NNRA 4HALA 3QNZA 4XNUH 4FQPA 4JHBA 4ERSL 1RU9L 2VXQA 3ULUL 1XGQA 4G8AC 4HIIA 3NQIA 3BUBA 4GAJH 4PWJA 4NQED 2GQHA 2HPOA 2DQEH 3QIUC 1MFDH 2Z65C 3MXVH 2ITDB 2VJ0A 2QQKH 4TVPE 4KV5E 1N7MH 1XDTT 3B3IB 4AL8H 4DP6X 3KM1A 2XVGA 3V2AR 1PX4A 1H3UA 3V0JA 1FZMB 1HSAA 3SPIA 4KKLC 2OP4H 5I0YA 1CICC 2BSED 4N87A 4X7TB 4GUCA 4AXWA 4JPWL 1A25A 5EG6C 2NY1D 4PJXF 3ECQA 3K6SB 4UU9B 1HHIB 3ETBF 2W9DH 3QXWA 1H8SA 3S3CB 4Z7UF 1I9RL 3ZQWA 4N24A 1RIHH 2D31A 2WP3T 2XN9E 5D4HA 4KU1A 5J13C 2XT1B 2ZONA 4QKXB 4MD5B 3H4FA 5JIHA 1S9WA 4NQCD 5E08H 4X4ZA 2DIEA 4IRZA 1U8MB 2VRAA 1N0XH 2ZSVB 4JPVL 2IQ9H 3VW3L 5CJXA 2OBGA 3FFOA 2Z8WC 1NLDL 5SWQB 1S46A 4MAYB 2I7SA 5DCCA 2B08A 3OD3A 4N5EC 1SOXA 3KVQA 4MD4A 3VFUB 3GXFA 4DGYH 4F33B 2BSRB 3ARUA 4UMSA 4DKFH 1W0VB 4KDTC 1UH3A 4HEPG 1IQWH 3COOA 5H4YA 1E3ZA 1KYUA 2A6IA 3C6SA 3MJ9H 1VPOH 4OM1L 2HLAA 1KWGA 2XKUA 1KEGL 4S1QL 1F97A 2EC9U 4UI2A 4FGMA 1NEPA 2ZX9A 2ZIDA 4Y4FD 5E95B 1MZZA 2QPDB 4F5CA 1UT1A 3FXIC 1P7BA 4S1DD 1EBAA 1J9RA 3WKQA 2I24N 4R0LB 2OS7A 4B27A 3RWFB 3EJJX 5BZWA 4L37B 2VLJB 2IVFC 2R0WH 5E4AA 3SEPA 5AYTA 4PJ7F 1PFCA 4ZSOA 1BAFL 4N90D 1I8MA 2NXYD 5LBSL 3MLRH 2QVKA 3GSNA 4RFOL 3H9SD 2WW8A 5IOKA 2EEDA 2WO4A 3WTUA 1SXBA 2XRAH 3D3VA 3O3DB 4XHJC 2EIZA 1LJMA 2WQRA 4E41D 2HX8A 1UKQA 3O41A 5EB9A 5I8EB 3DX1A 5ISZA 3U9PL 1VENA 5D7LD 2DQHH 3O2DL 3OAZK 1E6JL 2Z0BA 3I6LE 4L23A 4QRRE 3TH2T 4RX4D 4YPGA 4RGND 2JLPA 1CE6A 5CMAB 5C0BA 3DPBB 3VG9C 4ELKB 2Q2LA 4NCC1 4GY4A 2DJSA 1T1XA 3KPRB 2GJZA 2NLJB 4RGMC 2N1TE 5C86A 1AZNA 5A2CA 4IBZA 3K2MC 3ZDZB 4JRFA 4NENB 2QTEA 5JO5B 1EJ6A 5HHOD 5H35A 3BUIA 4R8WH 3HG3A 3KLAA 4G83A 3BXNA 1HILA 1XAKA 3ZE0E 4BA8A 4JANB 1I1AC 3VXMA 1D6EA 3ZDYE 2OX5A 3I74A 3VD2A 3ESMA 4MTMA 4GW4B 4BCXA 4R9HA 1F5WA 1RUPL 2Z31B 6PAZA 3P0VH 4G8GA 3UTOA 1OGAB 1BVKB 5TE7H 4E42B 4ILDA 5C0FB 4LO9A 5HYSA 1NL0L 5J1AB 1I4FA 5CP7A 4OCRL 1UM5L 2WWMC 2NW3A 2ROXA 3MRBA 4TQEL 3ZT5A 1PEWA 1ETZA 4XVTL 3EYSH 4PIRF 1JK9B 5CO1A 2UWEE 4R7XA 1YLBB 3VACA 3RUGA 4XOEA 4AGPA 2WKGA 4BZ2A 3B2DC 4WWOA 1KTJA 1WFJA 5JMOC 2YC1A 2J8UB 5AOKA 3T65A 4XX5A 2XZAL 1QFUH 1HINL 1Z9MA 3B7YA 2XZQH 3FFCB 3PUUA 4FNTA 5GRJH 4IBVA 1BMWA 5DMIH 3IN0A 1B0RA 3K4ZA 1E4XL 3JWDC 3L95B 3QRGH 3M1BA 4FS0A 2BZ7A 5KVMC 4GG6F 1H15A 2P42B 4LPVA 5KS9E 3WJLA 1AGBB 3MLWH 3DGDA 3FQRA 2OR8A 5C3LD 2VDPB 2DRUA 2GAZA 2ZOKA 5A6MA 3HFMH 1OANA 1OL0A 2X4PB 3P73B 1YPZF 4KO9A 3A23A 1CL7L 2IJ0C 4JB9L 2ZG2A 4LT7A 2YD3A 4OLVH 1QBMH 1N59A 5B38A 3NESA 2VDPH 1KEMH 3WNOA 5FECB 1N4XL 1DUYB 4ZK8A 1XH0A 2VLKD 3T8MA 1K4DB 4PGCB 1NIBA 2B0SH 4HWBL 5BRZB 5IG7A 2EO1A 3IXAB 2E7BA 3C5JB 3S2AA 1TDQA 3ELAT 4LAJH 4NZFA 1EX0A 2P46B 1NUDA 5ECGA 3KBFA 3ARED 1T21B 2V4LA 4HOMA 1U6AL 3EGDA 3OM3B 1PDKA 3IDJB 4JFFD 2FHCA 5LCVL 5DVNA 4R26H 2GJPA 4PP2B 4M1DH 1WZLA 2CDEB 4IRSD 4PRAA 1X5KA 4RAHA 3TFKC 1NOFA 4Z3GA 2Z91B 4L05A 4ZPTA 1WFMA 5HHPB 1FDLL 1YN6A 3VQ2C 1H6UA 3IJEB 1EQWA 3EJZC 1RJLB 3KPSD 4P5SA 4WNJA 2R2EB 2CO7B 1LP9B 4XP1H 2HLFD 1A65A 4FADA 3EYUL 1UUNA 3MVSA 3ML9A 4N2LA 2J1WA 2VR6A 4MCZB 1UKTA 2FIRT 1NGPH 1BZOA 4KY2A 4K7PL 3AQYA 4QXGH 4UINH 4Y2DC 3S35L 1NIEA 3QNYA 2K7PA 3QUXC 4FYTA 5TD4A 2HWZL 2MNJB 1ZOXA 5TF1L 3CFUA 1NBCA 3UC0L 3WJMA 5EU7C 2WYHA 2A4CA 4XNQA 3CH8A 4AC2A 4GRWE 2P7TA 4YDLB 1IEHA 4YIQA 3CPUA 1FVEB 1MJJA 2XG4A 5CIPB 4QY8B 5EBMA 1KB3A 5F9JB 1WWWX 3D06A 4HLZH 3O4LA 4WO0A 3WELA 4BELD 4DW2H 4BYHA 1FLTX 1CUOA 5DURD 5LO7A 1WBXB 3RVUD 4F9PC 4WW1B 5CIPH 3OQRA 5I16A 1KY6A 1J0KA 5D1ZB 5DZNA 3EGSA 4TSCL 1TFPA 3X14B 1BVLA 2IXQB 3L45A 4MJIB 4QRUB 4Q9QL 4XO8A 4MJHA 4GSDH 2W5PA 2D0FA 3G5XA 5CCHE 3VGBA 3RVTC 1XF2A 2X87A 1KPRA 1OOAA 4JKPH 1SOSA 2HT2C 5E5LA 4K8RD 2V3EA 3K2UH 4V2CB 5I73B 1JFQH 2ZCLH 1FZJA 1L6ZA 5ESQA 5HPMB 4Y88A 5KVEL 2MHAB 2A0LD 3OX8A 1V7MH 3CVBA 5DYOA 3UIYA 5JDSB 4Z0BL 3KR3L 1NPJA 2XZZA 4PJAB 3MRPA 5A7EA 2ARJQ 1N5AB 3VFPA 5TQ2H 2WKLA 3U79A 1B3JA 3WLWC 1IGFH 3P2TA 4X0NA 2J2ZB 4UV4L 3HS0C 2DIAA 5DK2B 1HYSC 5I71B 5DJ6B 3QIWA 5L8JB 1AJ7H 1FFNA 4ODWB 3JSSA 3BVNB 3L3HB 3V4VA 3S88H 5C09D 3GZQA 3PQYA 4UQ3B 1N26A 3RTLA 5AB0A 3AFLA 4Y5VB 4K2UL 1MG2C 4JQIA 5I1DA 2H3XC 1MFNA 1Z9PA 3QQXA 1ACYL 3IJHB 4WGWB 1A47A 4TNWF 4Y1SA 4PIBA 2XPGA 1TLKA 3BDBA 3LHPH 3O0RL 5FS5A 2LOEA 5E1HB 4UMGA 2BOLA 1DO5A 3N44F 3O6KH 1OHQA 1BJMA 5B3JF 3QH3B 3CK0L 2ZWKA 4DQOH 3X12A 1T1YB 1P7KA 4PGDA 1E4WH 2G3NA 4HH9A 1ROWA 3GI8L 3ZDZE 3C2AL 4P49A 4F7EA 1LO2L 3H6AA 4Z3IA 4TNEA 4KNQA 4MA8L 2BFGA 1A8ZA 4NO0A 3ZKQD 4ANWA 3CLWA 3K71A 1WZ1L 5T1LB 2BCKB 3K6DA 1F4YH 2AQ1A 4GEIA 4P46B 3GBEA 5KBPA 3VQLA 4W70A 5DHMC 1DZ0A 2X0UA 4PJGB 4JL1A 4UT9H 5CILL 1OGAE 3HC3L 1A7BA 4FQCH 1FBIH 2HX9A 2CRIA 3EO0A 4MB5A 4OBSA 4ZMOA 5C9JA 3DXAB 1IARB 1DANU 1KLGB 1PZBA 3GSXB 3W39B 7TAAA 4BE5A 2UY7A 3UPCA 1USZA 2QV2A 5LGJB 1CXIA 1CGSH 1ACCA 4PLJC 3D5OF 3AGWA 3MN8A 3AY2A 1Q0XH 1QFWI 1N5YL 1HL9A 4E0RA 1YJDL 4GW5A 3CLFL 4P23B 4XGZA 4XMPH 3MRQA 4PJ8A 3FFCE 1ZLWK 3S37H 4Z18A 3U2JA 2B4CH 5FA4A 1MAML 1UEMA 1JZJA 1MEXL 4CMMA 1MY5A 4FNLH 2FK9A 4OLZH 4NJAL 3B9EA 3ZMNA 2MCMA 3SDYL 4MQTB 2DM4A 1QLRB 3G6JF 3PWUB 5EF2A 3C2SA 5DZOA 3WIFA 3DIDA 4FLSA 4DESA 4JKWA 3LEXB 2FWSA 3D18B 4GB9A 2G3XA 4O02B 1FPTH 4KK8C 4GAGH 4FTVD 1HJBC 4GG6E 3UG5A 2FH6A 3G9VA 1YMHA 1NCWL 4FD0A 4E9RA 1KGYE 1OSPL 3GFUA 4ACPA 4UQBA 3SYOA 4KC3B 5F8RC 4O02H 1KV7A 1F1DA 1GY1A 1K6QH 2ZOWA 3L3JA 1ZMYA 3BQUD 1BD2B 4LLVA 4PJDB 4YVUA 4CMHC 3OTTA 3ECBB 3MREA 4MAUH 1Z3GH 4S0HA 4H8WL 4ZAKD 3BT0A 4G5AA 1Z9LA 5IHBA 3T3PF 4L8CB 4FG6D 4PD4K 1J87A 3ERXA 1VESA 4P2YA 3O4OC 4BH7B 2EDYA 4ISVA 1YYMH 2O6DA 2XVKA 2J43A 3L7EB 4O2CA 2WNXA 1W72L 3WBDA 5J4MA 3SDAD 2FBOJ 1FIGH 2X12A 2WWKT 4G9FA 5IBUB 2MOVA 3BPCB 2HH0H 2NZ1A 4JFOB 1NCDL 5F2FA 3IDGB 2PYEE 1ZHLA 2A6KB 2GABA 4NN5B 1NCCH 2ZYHA 2H1PH 1ZLDA 4E9VA 4ZW5A 4HS8H 5FFOA 2F19H 1I31A 1UATA 2FD6L 3QO0B 1E6OH 2EIBA 2FO8A 1RZFH 2ODHA 4L3AA 4M43L 3WFBL 5LXGL 1KB5B 1WVZA 1XF4A 4OQTH 1LP9E 5F7LB 1LE9B 2VUOA 3FRPA 1CN4A 3MV7A 5HGBB 1K8IB 3U6RB 1OHZA 3UZVB 3GB7A 3NAAH 4KKNA 4NXSA 3VJ6B 5CBAB 3C60B 1IAIM 3NH7H 5AZEH 4XE0A 1A9BB 1KB5H 4D94A 4FNPA 3AXHA 4LLAA 1E28B 4NUMA 3FO2B 2NY2C 4I0PA 3TO4D 4N68A 3NZUA 2H0JA 1BWWA 4OZFA 1HEZA 2WB1A 1F58L 3WXWL 3FKUS 3SQOH 5AVVB 3RP1A 4EKJA 1UVQA 3KMDA 2HRHA 5E6IB 1K2DB 1EHKB 2CD0A 1XSIA 5E1AB 2A74C 3CFKB 1W9XA 4EIUA 4N2CA 4XBPA 5KZCD 1N8OE 4LVHC 2DMCA 4ODUB 5T5NF 4MJIE 4MNQA 5LWYL 1GHFH 1R5WA 1JDDA 3RY5A 1CXKA 3S4SA 1ZVYA 1XGRB 3LPGA 3BYTA 4ZX5A 4HX1B 3U46A 3TZVD 1CBVL 1UQSB 3BKMH 2ZUSA 3NQKA 3MGOB 4U1SA 3PNRB 4QHLB 3GRWL 1KCUL 3GIVB 3JV4A 3KH3A 5PAZA 5FYLH 3QZWA 4LVOC 2V7HB 5D7JD 1CGVA 3QUZB 5ABAA 4Z76B 3TURA 1W80A 3L4CA 4X80L 5DQJB 2A5UA 1UG9A 2J1XA 4WJ5A 1SHWA 3X11B 5F21B 4LK4A 4PJAE 1L7IL 2IPKB 4PRHB 1LO4L 3NN8A 1JGLH 5AL0A 1FH5L 1WTLA 4KUCD 1DLFH 2E5EA 3M45A 4LSTH 4M29A 4XI5C 4D9QE 2SEBB 1S9VB 2R8SH 1ESOA 5FWRA 3BP7B 3LIZH 4NWTL 5JUEL 4JLRB 3WE6B 2VLME 3IVKA 4PV9A 4TUKL 4O2EB 1BDYA 4A6YA 1IGJA 1JK8B 1TQWA 3CHSA 2PW1A 4N2OA 3A24A 7FABH 1RZIA 2YKLH 3RAJH 5JXAL 2FYYA 5DHDA 4XXCA 1MCCA 1Q94A 1F18A 4RGOH 4O9HH 4PBWD 3EBIA 4XPGL 2YPVH 1IGCH 5GISL 4YSSA 4AVIA 2YGVA 1KXTA 1TZIB 1QSFA 1PS3A 4Y19E 1SY6A 2F5BH 1NGZA 1ZA3B 3MUHL 2QBWA 4MQ7A 4JK0D 3C5SA 1WBYA 3TN0B 2F54E 2R9HC 4HCIA 1JNNH 3H56A 5ELIA 1MXGA 3DX6A 1ZT7B 5DC0A 1CTOA 1D5BB 2GK0A 4LCCB 5EIIB 4A37A 3VRJB 1FZOA 2C3VA 1FG9C 1S3KH 1ZE3H 2BWIA 4NFBA 4Q4IA 1VB9A 2QFRA 3ROOA 4MYPA 5DRZA 4AT6A 3FNKA 1CDHA 5F1NA 2OJEA 3P9LB 4WI4A 5J6GB 3V9EA 5TDPB 4IMKA 1XGPA 2OTPA 4PJGE 2GTWB 4EBQH 1N9PA 4M6OL 5HYFA 1HHGA 5K39A 1M6OB 4YSCA 5FR3A 3DXAE 1RQ5A 3L2LA 3VD0A 2X5PA 5DVLA 4ZXBA 1XF5A 2R23B 1BFTA 3L5XL 2N59A 1R3LA 3JV5A 2I9TA 4QO1A 1G1KA 5EOCH 3T0XA 3CFBA 5GGVH 1VGKA 3WXVH 1MELA 2AK4D 3RWIA 4MA3A 1H3GA 3GRGA 1T0MB 3MROB 1CK0H 1G7HA 4BIKA 2ZICA 5CU5A 1ZVHA 5AKTA 2ED9A 1KCRL 5ANMB 1A1MA 4YNYB 2AC0A 5ETUA 1RZPA 2R0ZH 4WU5A 1A6PA 5EWIL 1IQDA 1XF3B 4UWQB 3MRJB 1RIUH 5K9OA 3WIHH 2V2XB 4FYQA 5I15H 2RMNA 2VUKA 3G6DH 3TL5A 4WEBL 4Y2LA 3B2VH 4PY7A 3GMPB 4G1EA 4KZCA 3T4YB 4AVJA 1KCWA 4F7CA 1KTDB 2VC2B 3TBVB 4Y16A 3N2JA 2CCWA 3K46A 4PJDE 2VQUA 4YSOA 3BFWA 2V9RA 4JZJB 2JE8A 3WTWA 3NSDA 5FHAL 1WBZB 2OMZA 1U58A 4AQAB 3P11H 3KPQB 4XVOA 5I1CL 2VC2H 2E7LC 4RZCA 4U4BA 3AS2A 2LFEA 1V27A 3QAZB 2EIKB 2IMMA 3Q8AA 4F9LA 2NTSP 1M05A 2NSXA 2CK0L 1KBGH 4LLYA 4N6QA 3MNZA 1L9TA 2HFFB 2V5RA 3NMEA 5EPMB 1RZKL 3BAXA 1F13A 3Q3GA 4GXVL 1JXDA 1XSOA 1I75A 3QQ4B 1YYLH 2EJ1A 3LIUA 3D3VD 5D8JH 1YY9D 4CVZB 2YRZA 4YDVA 2ZXDA 3N55A 4BE6A 1C5CH 2X1WL 4KX7A 2YD9A 5I1KL 1AHWA 4N8VA 3O8XA 1GGBL 3LEVL 1MCIA 5HHQB 1TJIL 3HE7B 4Y0GA 4Z7OF 3TONA 1OT4A 1JN6A 4ELME 5L88H 3FT3B 1BBJA 3MRDA 5KYUA 1SYVB 1U36A 1IEAA 2UX6A 4ZO7A 3ZL1A 2RH0A 4QLRA 2W59A 3VCLA 1D5IL 5DEJA 4E5XB 2DYPB 4HLEA 4WNQA 1F0LA 2KKQA 4EEEA 2OYKA 4D0CB 3T4AB 5DQ9A 1A7RL 3VXMD 3WJJA 2FRGP 3BZEA 1NFKA 4DP7X 4QPEA 3LKQB 3B6SB 4YXHL 1INQB 5K93A 4G8GD 2IALA 2OKMA 3NCYS 3QO1A 3BGMA 2YUVA 5HTSA 1FNHA 1RMFL 4L4JA 4M8QB 1FI8C 2L04A 4LPUA 4OSUH 3NPSB 3S7GA 4BRVA 3HN3A 4HIEB 4ZMLA 5BVJA 1NOLA 3ZXAC 4OW6A 3RTQB 1WA2X 4PVLA 4WK0B 4DT2A 5HVHB 5JPNC 2ZPKL 3APNA 4FN0A 4XNUL 5JHMA 2E7HA 1J5OH 1ONQB 3S6CA 2GG1A 5FYLE 4BUGA 5EEUA 3U4EB 4RCAA 1BM7A 1IILE 1S9XA 2VSDA 4IBTA 3X1GA 1YY8B 2YFOA 2HXAA 4GAJL 4EDWH 4PRDB 5KVDH 1T6BX 5CNHA 4WFED 2DQEL 3HB3B 2XY1A 4CN6A 2VN7A 1XIWD 1B9KA 4NDMB 3FUNA 2YBRA 5HYIA 3FU7B 3SGKA 1WUZA 4G43B 1A7PL 3N9GH 4GAAA 2W60B 2EEAA 1U41A 4M6MH 4B0MB 1YAZA 5DD6A 4PRHE 2LW3A 1TTBA 4QJ5B 3V6OE 1E9PB 2X4SB 3T6XA 5E8EB 2FL5B 2W9DL 4PJHA 5FUOL 2QMJA 4FI8A 5F1IA 4ZDHB 1PTZA 2CO3A 3MNMA 4JDVB 4OLUH 1KBBA 3ZHKA 1DUZA 5E08L 3IE4A 2QADB 2ESVE 5F9AC 3LXCA 4U6VH 4HUVA 2AQ3A 1N0XL 2WXKA 3GMNB 4RMSA 2IQ9L 5CINH 1K3IA 1H3TA 5LAXA 2DLHA 5CP3H 1Z66A 3BE1H 3GUFA 3M7OA 1NFIB 1KBPA 5L2KA 2UZYB 2NYYC 4I5BA 4RFNB 3FT2A 3BFQG 1D2PA 1IBGH 5DDHA 4MXVE 3H7BA 3WFDL 5L6YH 1BZDA 5FA3A 3HC0A 2WXGA 3ATDA 5E6YA 5HJGA 3ESPA 3OKKB 4OD1L 2XKNA 4Z77B 3MJ9L 2A6DB 3OAZH 4PG2C 1UC6A 4UUJB 5IBLC 3UYRH 4LSRH 2GIYA 1U8CA 2YUXA 4P2CG 1ET5A 5I24A 4NQDE 3QIBC 3IPBA 3C5ZC 1LD9B 2VXSL 3QHTC 4BSVB 3BVXA 5F9DC 4D2NA 3D48R 3FF7A 4NLAA 1QI3A 3P30L 2OMBA 3ZDXF 4XP9H 4AQEA 5BQ7B 3RKDC 4NQEB 4NQSB 3RX9A 1IGTB 1AGDA 4XCFL 1AD9A 1QNIA 5B39A 1URLA 3HI5L 1ILSA 3MLRL 4UTBH 4NKIH 4PFEA 3MBEA 2EIEA 3QB7C 1FHNA 4P9MH 3VI3F 1S7VB 2N0MA 4U1LB 5C0NC 1NEZB 3IBOA 4KRMB 5DJ8A 3B1UA 4LZKA 2WUCH 2NY1B 3L3OA 1EHLH 1MREH 1OF2A 4FYSA 4OI8A 2Z93B 5IW3A 4PUBH 3WS3A 3B8YA 2BNUB 1ROCA 4N22A 1BCIA 2DEXX 2YJLA 2YUZA 3O4LD 1E43A 4U2ZA 4P2OC 4NQCB 1G7IA 1EDQA 1J8SA 1ZV9A 2ENJA 4XHJD 5D2NC 2XU9A 1MZYA 5G4MA 4DJMA 1NCTA 3VFTB 1PX3A 2B1HL 2P48B 5KJRH 3BWSA 2NNXA 5LXVA 4GRMB 3RDTA 4WI0A 3STZB 2FWOA 3HC4H 4I77L 1QSEA 4GRLC 4BWTA 5TE7L 4FYRA 2VDOL 2EDBA 1KIPA 3HS8A 1UZ6F 2A9AA 4ODTH 1JS4A 3DI3B 5DUMH 3X1FA 1T83C 4Y4FB 1ITCA 3GF8A 3EYSL 2QR0A 3TH3T 1DQTA 1DFBH 1T1WB 4QGTA 1O6VA 5HHVL 4A7GA 4GMTH 2B8OT 2X4NB 5I1GH 4NM8H 1Z2KA 2IF7A 3ZYJA 2CO2A 2NXYB 4I9WE 4BCZA 2R4SH 3LEYH 2PXYA 2CA4A 4FL4B 3SY0B 3H9SB 4BSWA 2WWMD 3TF4A 2YXMA 3PIQA 3AQZA 3N91A 4M7JH 3T0DA 2BOCB 3QWOA 4NYLB 4RMQA 2OMTA 4J6IA 2G5BB 3V0VA 2WXOA 25C8H 2JCCA 3PQYD 4E41B 2Y7SA 2BFVH 1EZSA 4JFVA 5D7LB 2GSGB 2B9BA 1I7TB 2EAEA 1K4CA 5DUJA 4RGNB 3C6LC 3VSVA 4XPTH 3FTVA 4HK0B 1PG7L 1X6LA 2Y36L 4I2XB 4PWEA 4CNIB 3NACL 4GT0A 3SCMA 4ZFGH 4AENA 1MWAB 1CLOL 1X44A 4OLVL 1SLWA 5KVFH 1RJZB 1SF3A 5HHOB 1KEML 2QZQA 4O4YH 1Q9WA 1NDMA 1T04B 1TUPA 3FB8B 1MWAH 1YMMD 3HMWH 3P4NB 5D4JA 3KLQA 4IOSA 4NO0D 3RWGB 4KAQH 4PH8A 4P57B 5GGSB 1QO3B 3S36H 4G6FD 1J12A 1MHCB 4XRCA 4LDLB 5BV7B 5DLLA 4HCGA 4LNRA 3W9EB 3KAAA 1X4YA 4FNUA 1I1FB 1HCYA 3FULA 2OTWB 5IVOA 3INUL 3B9KA 3DHPA 3DUHA 4YFLF 3ARTA 3GQFA 3MLYH 3MNVA 3ILPA 3OR7B 4M1DL 4UQEA 5D1QE 2WC7A 4HXBL 1LO3H 1PU0A 1BJ1H 2G4EA 2V2WB 3SPJA 4NI6A 5BV7H 3VXQA 2N4IA 4XCYB 1A2YB 3DYMA 4PJCF 1JGDA 3FT1A 3BUPA 4U0QB 2UZIL 2VERA 5KVDE 1NA8A 2PTTB 3O6LH 2G2NA 4U1KB 5EC1A 3WTTA 4XP1L 3O2DA 3DVNB 4PJ9C 3T6QC 1WCBB 4KKBD 4PJ8D 4U1GB 3DTXA 4IHOB 2DEWX 3QUMB 3GMRA 3D09A 1BZ7B 2VZUA 2G2RA 3VFOB 3FHAA 1IM3A 4CN1A 1MUJA 4KQ4H 2BHFA 4GJTB 4QXGL 1TVDA 4UINL 3VDCA 2VITB 5FM5O 3SDCC 2PTUA 3ULSB 4LMQI 3QUMH 3IGAA 4JY4A 4LP8A 1PKQE 1A1NA 3VQMA 4TUOB 2O6EA 3SGEI 3UJTH 4YC2C 4DO4A 5AL8A 4JUTA 2HPTA 4PCYA 5F3FA 4N2IA 1A6AA 4XNXL 1U8LA 3HCVA 1J8HA 1GZPA 5F96H 1GJWA 4Y2DD 5C3IA 1VLXA 2VLKB 3QUXD 2K8QA 3LNGA 3K72A 4UT6L 3K6IA 5K9KA 4J23A 2MTAA 1ZDSA 4AZ8B 2LHAA 3LKNA 3FSZA 3MGTA 5C1MB 2OPCA 4N0YL 4ABWA 3QUKA 3AREB 5IVXA 2Q2EB 2G9HB 4FA8A 1HHJA 4XWGL 3VFRB 4JFFB 3VXOB 4MB1A 4P2OA 4X6CF 2GUOB 2YPLA 4JFPB 4IRSB 1I7UB 4KGLA 1F4XL 2AVGA 3G5VA 1PAZA 4G9FD 1JFQL 2Q8AL 1DTUA 1GY2A 1GC1C 4G6AC 1SLUA 1V7ML 4OH2A 4XNYH 3HJ0A 1C12A 2X40A 4EPSA 2NUPA 1OE2A 2IPUK 2CAKA 1CL7I 4K3DH 2P5EA 3KPSB 3MCYA 5L4MA 1Z3RA 5MEOA 2QV4A 1EZVY 3BUQA 2Z7WA 1NIAA 1IGFL 3M6DA 1U8PA 2G0KA 3MRCA 4K7PX 2FLBT 4ZNCD 3S35X 4N5UA 1AJ7L 5B3SB 3MMEB 3MV7D 4YHPB 4D0DA 1M2VA 1KT2A 4F57H 4LHQB 3PV6B 3OJMB 1JUFB 2WYZA 5GS2D 4W9CC 3TESA 3QRFM 4L9LC 3WNKA 4CW1A 1NDTA 1N64H 1NH6A 1LEKA 3SPVA 3KW8A 4YL9A 2ATAA 3S98A 2V5MA 2PUQT 2Y7MA 4I0PD 2JNZA 1FF5A 4YZFE 3LHPL 3OWEA 4BGDA 3GNMH 5DFVC 1JZ2A 3H8NA 1BZ8A 3OZKA 3ARXA 4HWBA 4RZKA 3O6KL 3MJWA 5DURB 3S3SA 5F9WC 5ES4B 4ZMYA 4DQOL 3Q1SH 1L7TH 4UAHA 3UEZA 3NCEB 4NRYB 4TTDC 3S96B 5LCVA 2DBJA 4RDQF 5TFSH 1A0QL 3T77B 3AB0C 4U6YB 1O6SA 2J3SA 2ZNXA 5D4IA 4LLDB 1ND0B 1MQKH 1ZLWH 3II2A 2QSCH 4MNQD 5DEZA 5BW7C 5C0GB 4N20A 4B5EA 4NP9A 2IANA 4WUKH 43C9B 2FAUA 4UQ2A 3FCTB 5GHWH 4FQCL 4X6DF 2GI0A 1V05A 1FBIL 2ERJB 3GM8A 1B4JL 3FUIA 4JGNA 2EE6A 4HPOH 1R3HB 2NYKA 3WV0A 1YQVH 4JN2B 3FT4A 1UZ6E 1YEJH 4K8RH 4AG4H 2OQJA 5DHXB 4DZBA 2CGZA 3EOTH 1CGSL 2PR4H 2Y07H 3ETTA 1G6RB 4M9OA 4MMXC 3V4LA 3X13B 43CAA 3VX1A 1TLMA 1NBYB 3NJJA 4PJFB 1DN2A 4EI5C 1A3RH 1EEZB 2GT9B 4N90E 3MLSH 2O5XH 5ABZA 1P1ZB 4HWZA 3H9SE 2E74C 3DOIA 4GIAA 2ZCHH 1G6RH 4LDCA 4LQFH 3F7YA 5C09B 4WKXA 3RB7A 2MTPA 5B8CA 1RZ8A 1E7VA 5CJ5A 4AWJC 3K2IA 2HVKB 4E41E 2CO6B 3FU6A 4K5LA 3EJYC 4FNLL 5E4IA 3LH2L 3BZFB 2VIRA 5D7LE 1FYTA 2B7DT 4QYOB 3VXSA 2DWTA 4Z3FA 5IB5B 1EBPA 1IKFH 5J6HB 5HVFB 4RGNE 1FPTL 5AG8A 1HQ4B 2VAAA 3CPLA 5BOPA 2QKIC 4X99B 4K4KA 3LPFA 1QSFD 4QTFA 4YHKH 3ZE1E 3ZZLA 3D08A 3JTTA 1K6QL 1AMXA 2F74A 2OI9B 3RGVC 3BCDA 3VM7A 4KQ0A 1DJHA 1N12A 4RWHA 1JNHB 4NOBA 1F11B 4ZW3A 3GBDA 2OXGB 3ATFA 3D9AL 2VZTA 3FO1B 2JTDA 5GGUA 2WXQA 1DHKA 1UTDA 3BWUC 2OL3L 3LS5L 4HKZB 4Z7VA 4J4PC 3BRGC 4P59L 1YN7B 2BNQA 1BV8A 4KXCA 2H0PA 1D7CA 1GVIA 1MFEH 2XBZA 5DHYA 4LPCA 1KGUA 4PRBA 4ZFZA 3VVWA 5CZKA 5T3XL 3W9DB 3MOQA 3QGVA 1F1GA 1LMIA 1WA0X 1SDDB 2HH0L 5KN5A 2QQLL 3ME0B 2AQ2A 5LGHH 4OFKA 5DJAA 5D96C 4ZXBD 3QT2A 3UBGA 5IFHH 2DPKA 4ZUWB 4OZIB 1VRSA 3QORA 2J8OA 2RB8A 3UP6A 4B95C 1YEFH 2AEQL 4U05A 2YN5A 1E6OL 2EC8A 3WN5C 4OGAD 2FJHA 1J1PH 2VR8A 4QTHB 2X28A 3DMMA 4TQIA 1TPXC 1A1OB 1E8ZA 2BZDA 3HR5A 2NQDA 2YARA 3KD4A 4ALAH 3EO1B 3NAAL 1IIKA 2C3GA 4HH8A 2XACC 4YHLH 4FFZA 3NH7L 3QFGA 5AZEL 1KB5L 2BVYA 1NQBA 5HI4C 5BXFA 3EHBC 4FRWA 4K94H 2IH8A 3V5HA 4FTVB 1N6QH 3CDFA 4DAGH 1YNTB 2MQ0A 3FSAA 1NC2A 1OWRM 3Q13A 1PYWA 4K3EH 4XPHH 4Y9FA 3SQOL 1Z9SB 4NSKA 5DJ2A 3VXUA 1KB9K 3OF6A 5IIEB 1FH2A 3T3MF 4Q14A 1PCXA 4K9JA 3BQUB 4Z7UB 3HNVL 2CJSA 1NCUA 4PGEB 2B39A 2W88A 4Y16D 3LVTA 3P54A 4ZAKB 2HVBA 2JB5H 4AYDC 5L4JA 4TPRH 3RFZA 1ID5I 1EGJH 2NY2D 5DMGC 4PS4H 5E6SB 2J73A 4GAYA 2WZPD 2ZP9A 1LWHA 1GHFL 1TQBC 3B8SA 5DUBA 5C3TA 3R8BB 3SGJA 5L0QC 1T89C 4JO2L 4MAZA 5HD8C 3N43F 3SDAB 1JF6A 4JFFE 2XETA 1CFTB 2OYMA 3FU5A 3HE6A 4BV1A 3B7SA 4KWUA 3BKML 3RIAF 2WQXA 5INCB 3ZO9A 2HN7A 1KXVA 3HHSA 4UT7H 2XX0A 5DRXB 3ZT6A 1OGSA 4FQJH 2PMZA 4KTGA 1E27A 1E5AA 1CDUA 2DI8A 2DQDH 2ZUXA 4UZSA 2P3YA 2EILB 2AJSL 1ORQB 5DVPA 3DGCR 3NABH 3O6FC 3KPSE 1H6FA 3O8XD 5F8QC 4BFBD 4Z8FL 3FZUC 1A7QH 1H0DB 1YECH 5KWYC 4F3FB 1SYSB 3DIFA 1AQHA 4G7VL 4HDIA 2X53A 3JWOH 4AI7A 4MXQD 2APFA 2O93L 1U3HA 3A4EA 4FXKB 4X9IA 3IFNH 4YDJB 2J5LB 3UTSA 2B77A 2JI2A 4P9HH 1BQLH 1H9VA 2HA1A 5F71A 1OB1B 1AGEB 4XXWC 3TO4B 2H0FA 5C7XH 3PS6A 4RETB 3FMGH 2QL1A 3VA2C 5AB1A 5TPWH 1CDCA 3ROLA 4NC2B 1INDH 3FUFA 2DF3A 2YPVL 5IJKA 2ADFL 3PP4H 3V0AC 1WZKA 4NIYE 3NEOA 5KEZA 1G4RA 2F53E 2FO4A 4OD2A 3VNZA 4LSUH 4LGSB 5KZCB 4XB8A 1W72A 2WINA 3HZYB 3P9MA 4ZFFB 1S3KL 1AVAA 3HG4A 4F2FA 4OUUA 5FYJU 5JYLA 3FRUB 2HTLD 3ZE2E 4D8OA 1W0YT 4HJTA 1KNOB 3S5YA 4P5MB 4LQ1A 3TZVB 5D6CA 3QFDB 4LF3A 5E5MB 4DGVL 1ML0A 2WN2A 1PMYA 3F7PC 2AVFA 4EBQL 4L1BA 5F7EH 4XN8A 1CBJA 1TEGA 1EEYB 2R9HD 4HUXB 4IOFC 4YUEL 3BAIA 2FBRA 5D7JB 3VFWB 1PQZA 1D9KC 1JG9A 5DRNB 1DJGA 1TVBB 3M17B 4HULB 3MO1A 3CMGA 4YQXH 1BXXA 4R3SA 4D0BA 5D7IE 1ADWA 2KLRA 3EG9A 4OZGE 2FNBA 2MKLC 3KLLA 1CQKA 1X5YA 4R2GD 3RU8H 4WK2B 1CXFA 3SQBA 1H6TA 5DHVA 4ECNA 5EOCL 1S9KC 5FO7B 4PJFE 2BVTA 1MDAA 1CC3A 5AAPA 4WDIB 4XOCA 3CGTA 4LCVA 4OF3A 4YZWA 5EUOF 1CK0L 5C09E 4ACTA 1D5ZB 1SFHA 2J7LA 3BAEH 4HJUA 5BPPA 1HOCB 4X4XA 1UB5B 1I1CA 3CVHB 4HQQH 1AR1D 3HKFA 3NJMA 2R0ZL 4LLWA 1T80A 5FLVA 5B38G 3LD8C 3NP3A 1CFNB 3DARA 3OPZH 4Z7VF 3CXHK 3WN5A 2EXYC 5I75B 3CVHH 5L2KD 2R1YA 2OW6A 3LZOA 3BKYL 1G1OA 4TS6A 1YPZB 5J11C 3MRRA 5I6KA 2VCOA 2XBTA 5GGVY 2Y5TB 3RL2A 2LVCA 3DK2A 2VDNB 3MV8A 2WQVA 4Y8DC 5I8OH 2A73A 3ZZ1A 2ATPB 3CFDA 3EADA 4MKMA 4FLRA 4P5TA 3VGAB 2YMXH 2KQNA 4Y5XB 5HDOA 1E4KA 5IJDC 1IAOB 4Z7NB 3GRWA 2DZEA 2VDNH 5J5EA 1WS8A 2VC2L 3QNZB 1I8AA 3L5WA 1UXLA 3GO1L 2MPAH 4ZD3H 3D8MA 4L2YA 3O3EB 1IBHA 1SGKA 4M56A 1SFDA 1XEUA 2NY7L 2VXQH 2CLZB 2J20A 2ZF8A 3CQPA 3BYYA 3L6FA 4H88L 3EFFB 4TLKA 2VW7A 5GGRA 3MBED 5D8JL 4EF3A 4MJ2A 1HSAB 1JD7A 5CR1A 1D7BA 3QEQA 2AS5M 3IMBA 2WAHA 4AXWB 4I87A 4S1SL 5I0VA 1T89A 4NKOA 1U4EA 1MCFA 2Q7NA 2P8MA 4OZIE 1XFPA 1WIPA 1EO8H 4PYGA 3HIZA 3WENA 1J7VR 2AK4B 1DCEA 2P24B 3GBLA 4UQDA 4JRXD 1VCAA 3UXFA 4EOWH 5I1HL 4KRLB 2D31B 1FRGH 4HWUA 1AXTH 4M7LH 2AXFA 2X9WA 4JO5A 2X6UA 1ZTMA 2JB6B 2YAOA 5BJTA 3AT9A 1N8ZA 1E3XA 2WOBA 4XO3A 4MD4B 3RDTD 4G7SB 5EFIB 4FTVE 2CO4A 4IRZH 4L8SC 4JO3L 4AJVA 4ZUUB 4BFRA 2EZ0C 1UD2A 2JF1A 1JF5A 3D1MC 1P4BH 1I3GL 3C6SB 2FR4A 5JMRA 3KJ4C 1UJ3C 2HLAB 4Y1AD 3ULUD 5JXEA 2ZG1A 1BXAA 4PI2A 3MXWH 2EYTB 5HI3D 4H44C 1KENL 35C8L 4JFZL 2X2HA 3HBGA 3LS4H 4M7KH 4KI1A 5BZWB 2EABA 3CHQA 4WWID 1YEEL 4EKXA 1G7PA 2HKFL 1ID2A 4ZSOB 3UTTA 2EECA 2DQ6A 3GSNB 4NGHL 3J07A 4MJ5A 4K71B 1IBFA 2ZAIA 3FHEA 3D3VB 5I76A 1YC8A 3A0OA 4OLYH 1G7MA 2EIDA 5J12C 3WIAA 2C7UA 3O41B 3GSNH 3BP5A 4MRCA 2MKWA 4Q2ZA 3U1SH 3N9GL 1WEJL 2Z64C 5CGTA 1NGQH 4OM0L 4YPGB 2L7QA 5BOJA 2PWFA 1A7NH 5LG6A 5J57B 2DLFL 3WAKA 3SCMD 3TTYA 1T1XB 4NRZA 1AG6A 2GJZB 4ZS7H 5LNGA 3N3EA 4UYPA 4GW1A 4ZQKB 4JGJA 4HA1A 5H35B 4R7LA 3SBWC 4AYSA 4YWGH 3BXNB 4U49A 3THML 4LCIL 4U6VL 4K3JH 5DLML 2W9EL 4EN3C 3PWPA 4IOSD 3VXMB 5I18H 1KWKA 2OX5B 1ZHKA 4U1NA 3WUWA 3HVDA 4E9YA 3UPAA 3DECA 3EYQD 4TRPH 4X7DC 1DJXA 1R6VA 3QEHB 3TA3A 3GHEH 4G8GB 4L1LA 4XNBA 5IQ9B 4MRBA 1IBGL 1QBAA 3I9PA 5HYSB 1I9IH 4HF5L 5L6YL 1I4FB 1CE1L 2XWXA 3G9AB 2NW3B 4DKEH 2XKSA 1M57B 1Q8MA 3MRBB 4EDXA 5A2AA 1VFAA 1ETZB 4X0KA 2CRMA 2CSPA 3X3GL 3UYRL 1EXUA 5AVWB 1THCA 1EFXA 1CU4H 3ARDA 2O5YL 1P0SE 2PCFA 1PCSA 3RUGB 2JCWA 3BWUF 1FL3A 1JHTA 5IHZB 4PCTA 2IBZY 4R97C 5IQ7H 4LU5H 2WWOA 2NYYD 3I3DA 3VD9A 2G2PA 3GS4A 3DJRA 4F7KA 2ENSA 2YC1B 3V55A 5BCAA 2GY5A 1D5XA 2WBJA 3OR6A 4Y4HC 3VH8B 4ZMZA 5H2BA 4BZ2H 1B0RB 1AZVA 2X4TA 3CN2A 2WD0A 1XIWB 3M1BB 3TT3L 3SSGA 3GDBA 4B6ZA 4HGMA 1IM3D 3QIBD 4R7NA 3C5ZD 1H15B 1LILA 3TBYA 4P9ML 4K5OA 1AZRA 4S1RH 3FQRB 4L5FH 5K9JL 2W9LA 4MX7A 2ZOKB 3ZBMA 2FZ3B 3SDDA 1NCBH 1AP2A 5DEGA 4W93A 4KJQD 5CR8A 4KDWA 2MFNA 2GC7C 1ETA1 4W9FC 1SXAA 2BIMA 2GJ6E 3B9VA 1J8HD 1WITA 3C09C 4X50A 3S48A 2F58H 2VLRA 4NN6B 5C0ND 4AEIL 3T1WA 2Z1PA 4IYKA 1LO5A 3VYPA 3QC5X 4K55A 3UC2A 1F42A 2D7TH 2JKIS 1BM3H 1KFGA 5HJDA 5BO0D 1LK3H 5E94A 5CEXA 3MGAA 4OZHF 2WVUA 3HC4L 3IMSA 3VMOA 2NZIA 3VRLE 2ORBH 4MCMA 3TBTA 3EGDB 1ZLSH 3S8FB 1PDKB 3N42B 3R4DA 4P2OD 1O7DC 2H3NB 2YPLD 4A66A 2F7PA 2L8AA 4G5ZH 5FUZH 4AUUA 1DBAH 2JTYA 4M9PA 4ZPTB 3DV4B 1M3JA 1KMGA 3LQAC 2BP5M 3RURA 1BVNP 2R56L 2VZSA 5E8DL 4Z7NE 2CPUA 3FHQA 1Z5YD 2CUIA 3QXAA 4L8SA 4IIZA 3CZUB 3T3PB 2P5ED 3VI4A 5I1GL 3OJDB 1AQMA 3NK3A 1N10A 1LDPH 2PLTA 4BQBA 3LEYL 4X8XA 5ITFA 2VO5A 4IMLA 5C2BL 5EEZA 1S7UA 5CFHA 4P8QA 3EBAA 3VDAA 4HXAL 4PWGA 3RX5A 5G55A 3UBFA 2VW4A 4MJ4A 3UAJC 2BFVL 4JFSA 5IROA 5EF0A 5IJKC 4ZMPA 3WJMB 3NEEA 5L2JA 4K9EH 3APCA 3RZCA 2P7TB 2ZZUT 3CMOL 4G6MH 3V4PL 3PL6A 4HUUB 3N0AA 5EBMB 4EIBA 2XG4B 4ZFGL 5BOZG 3K0YA 1NCHA 4AJYV 1B6UA 3O4LB 5EZIL 1G9MH 5KVFL 5CN1A 4AQ1C 3ZL2A 1R0AH 2D7MA 2EH7H 2Z7UA 3A6CL 3WTYA 1L9SA 2FX7H 4OZFG 2DQUH 3V95A 4YBHA 4KKAC 5I16B 4H13C 1EAQA 2JIXA 1MWAL 5SWQA 3R7RA 1MCPL 1KB9J 1I3UA 3MJ9A 3WKMH 3VFUA 3CIAA 4XBGA 3WUZA 3TIEB 4UQAA 3DHJA 5B1CA 4PCSA 2BSRA 5E8PA 1TJHH 1W0VA 3N40P 3G5XB 5E2UH 1XF2B 2V9UA 1KPRB 1URZA 1DJWA 2AJ3B 3R06B 5DD1H 4LLUB 2IAND 1H3WM 1G0DA 1FZJB 5ESQB 4GXUM 4BRJA 2BVEA 2CUAA 3LX9A 4UIKH 4WHTA 4GSXA 3MCKB 3OX8B 5DYOB 2UZPA 3S4SG 4ZMTA 4KXDA 5BV7L 1E90A 4NB7A 2IG2H 4F5CE 4XMLL 4XO4A 3IGLA 4R0LA 3MRPB 4OLXH 2AEOA 1QYGH 3VFPB 5ADPL 1SN0A 1C16A 1B9ZA 3PCYA 4YXKH 5JHDA 3O6LL 3QZWG 1KN4H 4BFOA 4TXVB