2BZ7A

Oxidized and reduced structures of a mutant plastocyanin of fern
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
102
structure length
102
Chain Sequence
AKVEVGDEVGNFKFYPDSITVSAGEAVEFTLVGETPHNIVFDIPAGAPGTVASELKAASMDENDLLSEDEPSFKAKVSTPGTYTFYCTPHKSANMKGTLTVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protonation of a Histidine Copper Ligand in Fern Plastocyanin.
pubmed doi rcsb
source organism Dryopteris crassirhizoma
molecule tags Electron transport
molecule keywords PLASTOCYANIN
total genus 23
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2bz7A00
3BVDB 1DZ0A 2HZHA 4YVNA 4W9ZA 4YSEA 1WAEA 3T71A 4X4KA 2ZWNA 4UAHA 2YXVA 2JFCA 1ADWA 1NIDA 4YVUA 3WNJA 2FT8A 4K9JA 3S3DB 3U25A 3IE9A 2FTAA 2XWZA 3DKHA 1PLAA 2CALA 3WIAA 1B3IA 1SHXA 4L0PB 1AS8A 4E9TA 3QQXA 1NWPA 1BEXA 4DPAX 1GYCA 2I7OA 4G7SB 3QJQB 1AS6A 2HRHA 1BQRA 1KDJA 2VM3A 4BXSV 3QJRB 2Q9OA 4KOBA 2I7SA 4G70B 5I5JA 3S3CB 2CUAA 3NSCA 2CBPA 1N68A 2GHZA 2XVBA 2FNWA 3CG8A 1YLBB 3PCYA 3PAZA 2HXAA 4PCYA 3T6ZA 1BAWA 3ASNB 4M3HA 1HAUA 3PLYA 3QJUB 1IBZA 1JZEA 2GBAA 1PLCA 1ZIAA 3PAVA 4KNSA 3QJSB 1J9TA 1L9OA 4BDVA 2PLTA 4GP8B 2BW4A 4BDVB 3NP3A 3L45A 4AX3A 4DP6X 1KCWA 3HB3B 3H56A 4KNUA 2XX0A 3X1NA 3X2QB 4A66A 1PNDA 3PAUA 2XV0A 4HCGA 2A3TA 1V54B 4YSPA 2HRGA 3FQ1A 2MTAA 2PP7A 3NSYA 1JZFA 3X1BA 1BQKA 3TBCA 1J9RA 1PF3A 4KO9A 4QKTA 1E67A 1JVLA 1E30A 4UF7C 3FSAA 4GXFA 2PPEA 3WNIA 2XV2A 5B7MA 4CSPA 1IUZA 3FSZA 2UXTA 1OE3A 5I26A 2AZUA 3NT0A 1I53A 1XB3A 4YSCA 1CUOA 1NINA 4A68A 2YAEA 1KV7A 2VM4A 3SBQA 5TK4A 6PAZA 1NPJA 2GSMB 2EIKB 5TK2A 2WO2B 1DYZA 5D4JA 3NSFA 4DP8X 1KBWA 1W6LA 1WS7A 3AG4B 3N55A 3TASA 1VLXA 5PCYA 1AZNA 3FU7A 3N2JA 4CSZA 4EF3A 1URIA 1A65A 4NAJA 1EHKB 3X1FA 2YAFA 1OF0A 1SFHA 1MDAA 3DIVA 1ET7A 2PP9A 9PCYA 1WA2X 2E86A 1E5ZA 2NRDA 1BXUA 3CVBA 4E9WA 2J5WA 3BQVA 1PMYA 5I6MA 3T6VA 1JZIA 2IDQA 3PPSA 3FQ2A 5I5IA 2IWKA 5B7EA 1ZDQA 3FU9A 3AW5A 1OOWA 3UABA 3WI9A 2MRYA 2GC7C 2J55A 1NZRA 3UAEA 3FQYA 1MG2C 5AFAA 5D4HA 2FQGA 1SNRA 3IBOA 3WKPA 2BZ7A 4N4YB 2H47C 5IY5B 2AFNA 3NJFA 1A8ZA 2HX9A 4NB7A 2BP0B 2XUWA 3UADA 3X1GA 5I28A 2FJSA 3GYRA 2BP8B 3DTUB 1J9QA 2DY2A 2PPFA 4E9YA 3NJIA 1GW0A 1M9WA 1SHWA 1WS8A 3V9EA 3MBWB 3TA4D 2FQFA 2HX8A 1MZZA 3NJHA 2YXWA 1ILSA 1NTDA 4FAAB 4KNTA 1ZDSA 1OCZB 1JXDA 2EIJB 4DPBX 1QLEB 4G72B 3ABMB 4G7RB 5LDUA 1W8EA 2Y69B 5E9NA 4AI7A 6PCYA 1AQ8A 4HAKA 4YSRA 1CYXA 1OCRB 1MZYA 1X9RA 1PAZA 2P80D 3EH4B 2IDSA 1SF3A 5I6OA 2IH8A 1AZBA 1KYAA 4DP1X 4HHGA 1ID2A 3AG3B 2DV6A 3JT2A 2JKWA 1OCOB 2AANA 2OJ1A 2BP8A 2QDVA 3NYKA 3QJTB 4MFHA 2CAKA 2YAQA 2QT6A 1ETJA 3AZUA 2QPDB 1NICA 1PZCA 2W8CA 3FSWA 4A2EA 2IWEA 1GSKA 1SFDA 1QHQA 4DP9X 2PCYA 2ZOOA 1JXGA 4HCIA 3ZDWA 1ILUA 4E9RA 3X1EA 4NERA 3H4HA 1R1CA 4E9QA 4AZUA 2Y1AA 2FQEA 1FA4A 1IKOP 2IDFA 2RACA 1GS6X 4W1TA 2PPDA 1KCBA 1AZUA 1SDDB 2ZONA 2VW4A 2XXGA 3KW7A 4N8UA 4DP2X 4YSDA 1GS8A 4KO5A 4A2FA 2Q5BA 1W6WA 1L9RA 2BWDA 3NSDA 4DP0X 2YAHA 2VW6A 5AZUA 1AZCA 3CZUB 4AKQA 1T5KA 2VW7A 2CCWA 2R7EB 2BW5A 4ZK8A 1JVOA 2B3IA 1J9SA 2XV3A 2UX6A 3D12B 3GXUB 1SF5A 3H4FA 1RZQA 1JOIA 1M56B 2BP0A 5PAZA 1HAWA 3FS9A 2J57A 1KGYE 5F7BA 1AACA 2GB2A 4HIPA 4YL4A 2I85A 2BZCA 5B1AB 4F7KA 1TEFA 3T6WA 3ERXA 2VSMB 3EF4A 5I6LA 2UXFA 1KDIA 4M4RB 1AIZA 2TSBA 3NJLA 2X88A 3IN0A 5B1BB 3OM3B 1TU2A 2LLNA 3T6XA 3ABKB 1V10A 1QNIA 2R7EA 4HHWA 1PNCA 1ASOA 2HLEB 1UATA 2PCFA 3FPYA 1A4AA 1EZLA 1ZV2A 1GY2A 1ET8A 2YARA 5D4IA 2GC4C 3UAAA 1AG0A 3CVCA 2AVFA 2EILB 2WSDA 2FWLB 3FU8A 1J5CA 1SDDA 5I6PA 3CDZB 1NIBA 3NJMA 3QPKA 1JZJA 5F7AA 4YSUA 3TBBA 3NJKA 2J56A 3SQRA 8PAZA 3EHBB 4DP4X 3ABGA 3IN2A 3OMNB 5I6KA 1NPNA 1CYWA 3FYEB 1OE1A 3FSVA 1OCCB 1HFUA 1E65A 3EH3B 4ENZA 2IDUA 2W88A 3SBRA 1CURA 5B7FA 1XB8A 2DYSB 2CJ3A 1BYOA 1PZBA 5FC9A 5EHFA 3OQRA 3NP4A 4BWTA 4E9SA 4YSSA 2IWFA 2ZXWB 2BHFA 4HZ1A 4KOCA 3CDZA 5B3SB 2WO3B 3OMIB 3FYIB 1AS7A 2PP8A 3IEAA 1MG3C 3AG2B 4QLWA 3S8FB 4DP7X 4KO6A 3AY2A 1IC0A 2VSKB 1FWXA 1RCYA 3QJVB 1ET5A 4JKNA 1CC3A 4Q8BA 1FFTB 1GY1A 2QPEB 2XYBA 3G5WA 3ZX1A 3OMAB 1NIEA 1TEGA 2YAOA 4A2DA 1V55B 1SJMA 1AANA 2FQDA 2UX7A 5B1JC 1XB6A 3WG7B 1RZPA 4GYBA 2P80A 2YAPA 1PLBA 2DWTA 4GP4B 5A7EA 2JXMA 3FU7B 3ZIYA 1PCSA 7PAZA 3PXLA 1AAJA 3UACA 1NDTA 4YSOA 1BQ5A 1ZPUA 4WKXA 3HEIB 1JZGA 1OE2A 2EIMB 5B1KA 1X9UA 2B08A 4PAZA 3EH5B 1L9PA 4TXVB 3S3BB 1ZIBA 4JHVA 4AKOA 2TSAA 1L9SA 1AG6A 1NWOA 4P5SA 1JERA 2IH9A 1E5YA 3S8GB 3NJGA 1AZRA 3MX0B 2VN3A 3C75A 1RKRA 3RYMA 1PZAA 4A2HA 5ANHA 3FPXA 1NIFA 1KBVA 4AKPA 4DP5X 1M57B 2XLLA 4BXVA 3NJNA 4G7QB 1BXVA 3OD3A 3TU6A 2YQBA 1BYPA 2H3XC 3ABLB 5I5MA 4G71B 2DWSA 2DYRB 3NJJA 3V9CA 4Q89A 1JZHA 2GIMA 2QDWA 1A3ZA 1AOZA 2HX7A 3AG1B 4HALA 4GP5B 4A2GA 4GY4A 1IBYA 2EINB 1GR7A 2OV0A 1GS7A 2BWIA 2FT7A 2OCCB 1A4BA 1L9TA 2XX1A 1A4CA 1WA1X 1L9QA 5AKRA 4A67A 4YSAA 1AR1B 3FT0A 1JXFA 4RH4A 3SBPA 2IAAC 2N0MA 4E9VA 3JTBA 1ASPA 3WKQA 1WA0X 4KO7A 4F2FA 3T9WA 1TKWA 4DPCX 2YAMA 1BXAA 2PPCA 2UXVA 4JHUA 4YSTA 5I6NA 1J5DA 4BWUA 2UXGA 2BO0A 2IDTA 3CVDA 1XMEB 4YSQA 2AZAA 4P5RA 4UANA 3KW8A 2H5UA 3ASOB 3GDCA 4HCFA 5B1JA 4E9XA 2X87A 2FT6A 3ZBMA 4F2EA 1F56A 4FA7B 2PPAA 2XXFA 1OV8A 3UGEA 4BK5C 1N70A 2XU9A 1ASQA 4WTQA 2GI0A 1NIAA 1PY0A 7PCYA 4BWWA 2VMJA
chains in the Genus database with same CATH superfamily
5I0YA 5KAQF 1OF2B 4FQXB 3T71A 3K3QA 2E0PA 3BWUC 3QUKA 3QJFA 1H15B 4GIOA 4ZTPL 3I6LE 4X0KA 4XWOC 4AEHL 2GABA 4FNLL 1PX3A 5E6RB 4MJ5B 1J1OL 1RIHH 1TNMA 2EDRA 3UG4A 4JFVA 4LVNC 3RJQB 3JVGA 1X7SA 2OR7A 4PJBE 3SGEH 4PS4H 3HZVA 4JPSA 1RIVL 5BV7B 2RB8A 3CLEH 1UCBH 4XE5B 4GB9A 2DMKA 1FZKA 2FDBP 3VXME 4IOIB 3VFGL 2OQJB 2RH0A 2ZUQC 4N90E 5K59E 5H8DA 3IJ9A 3NZ8A 3RFZC 4LSRL 5AYUL 2GHZA 3CIAA 3EFDL 4OJCA 4UNTA 2XWCA 2K9FB 4JHAL 5INDB 2P47B 2VITB 3O6KH 4G83A 1XSJA 4FDWA 2BSBA 3DHPA 2JJSC 4M3HA 4Q0XL 1KEGL 3L5XH 1SQMA 3TYFB 4BUGA 1HAUA 5EEWA 4WV1C 3FUHA 3AU1B 3QJSB 1HXMA 4YDJB 3UEZA 3G6AB 1U6AH 2QPSA 3L16A 1QYGL 1ZLDA 1HSBA 4U1IA 4NN6C 4JVUA 3HW7A 3TNMB 1M7IB 3H56A 5C07D 3X2QB 2VL5A 3B2MA 4MNGE 2TRHA 5BXFB 2A3TA 4PJFB 4YSPA 4JZOB 4JPKH 5DJXB 1PZDA 1MCSA 1GH7A 2F19L 3D3VA 3CPLA 4M7JH 3NIFE 4GLRH 3RWJB 1P9MA 3Q7JA 2BJMH 3MYJA 1GYVA 3QZBA 4KO9A 1FORH 1E67A 4TUOA 2VZUA 1TIUA 3VE0A 1B9KA 2ZCKL 3L08A 2DIJA 2JB5L 3HE6C 5D7IB 1UXLA 3RX5A 3GBNL 3WXVL 3FQTA 1NC2A 4J3BA 5CCGE 3RY5A 1CUOA 3HZKB 3BP4B 4HSAC 1TUPA 1L7TH 3VXRD 3GINA 4HC1L 2VM4A 2A5UA 2VQTA 3P1VA 4OSUL 4LB8A 1UWYA 1LE9A 1CD9B 2R23A 4ERSH 3PV6A 4F2ME 1OHQA 1NFDF 2HRPH 2YGVA 5CJOL 1BVKB 4YBQC 5AD0B 2CDGA 1XGYH 3HG0A 2AABL 1JN6A 2K8MA 4UDUA 5DUBB 5ENWB 3V52H 4EF3A 3LS4L 5KBPA 2NTSP 1INDL 1JPEA 4HWNA 3O41B 1DVXA 4M7ZB 2MHAA 4AVKA 3MROA 3QYCA 1MCBA 3QHFL 4XB8A 3V4PL 1WWWX 4PJCA 1FVDA 3MNVB 4N3TA 3KWUA 4BHUA 4JFPA 1GYAA 2MNUA 4YPJA 4NXKA 2ZF8A 4ZFZA 2IPKA 5JORA 3L4CA 4MMXC 3ET9F 3CSYB 2IOIA 3HR5B 2JKNA 1QR1B 4R97B 3FQ2A 1YPZE 2KPNA 3LNHA 1N9PA 2SODB 2YMXL 3NGBC 4X8CA 4U6HA 5KS9E 2Q0ZX 4UM8B 4LKCB 3HAEG 4ZS7L 4O02H 2KQNA 3REVB 4L1TA 4G5AA 4ELDA 2AQSA 3FQYA 3TV3H 4HLEA 1EHXA 4W9EC 1SJHA 2FX7H 4NI3A 1NAMB 1YEHH 1WAAA 2WXNA 5A2IH 4DESA 3WFZA 3TBVA 3L5JA 2HX9A 1FBIL 3BUYB 2SEBB 1WCQA 1T4WA 2XZZA 1E8ZA 2YOCA 2VTFA 1E2ZA 4L4TB 2YBGA 3G5VB 2OP4L 5CIPA 5E6SB 4MJIB 5C08E 2IVFC 2K78A 1ACYH 3MBWB 3N9GL 3HBGA 4XC1L 3T0AA 2G0KA 4JZNB 4KQ0A 4GW4A 2CPCA 3B2XA 3K6FA 2AK4B 2C9UA 4R96B 4QMEA 3MTXA 4L1DA 2OMUA 1TPXC 4RZCB 2C1OB 4KNTA 5CEZD 1QX1A 1U8KB 3NIDB 2HTLC 4DJMA 4P9ML 1KLGA 1MUJB 1OP3K 1XO8A 2K6ZA 4XCEA 2R4RH 3O8XD 4ZFGH 1MCFA 3OAYK 1WC7B 2QQQA 3IDXH 1FHGA 3IGLA 2IAND 1H8SA 3HS9A 4FXKB 5DZOA 2UY7B 3GXDA 2CA3A 2YPVH 2EABA 2D7MA 1F1DA 4OIBA 5JHLH 2GJ6A 4L8BB 3LNGA 2BDNL 4QCIB 1W0VB 1OCOB 1EDYA 3T77A 5E1GA 1T1WA 3EBAA 5TE4L 2QT6A 1DZBA 1H0DA 1HSBB 4JLRB 2QPDB 2VLRD 3NN8A 4G80A 3RA7L 3V0FA 2NNAB 1O6VA 2EH8L 3BO8B 4ZOBA 5DLML 1U4FA 1YQVL 1EFXD 3U0WH 4ZX5A 4B5ZA 4HMCA 1XEUA 4PJFA 4HX1A 4HCIA 2V17H 4AM0Q 4E9RA 4TYUA 4Y4HD 2W60B 1C5DA 4JPKL 4N2NA 5E95B 3ZDXE 5LBVA 3HI6L 3MLUL 4LCCB 3WEAA 1IKOP 4P2QD 2Q8AL 4TPRH 4U1NB 1N6QL 4HEMA 4LSTL 2F6AA 2PETA 4HZAA 4N8UA 5GSRA 2W07A 2Q6WB 3I9IA 3MU3A 5TE4H 5LXGH 3ILDA 3VE0B 2X6VA 3JV6B 3LD8B 3QORB 3UX9B 2LV4A 5IEKA 1OAKH 3HHRB 4PIBA 2ZCKH 3PDOB 3QWNA 2VW6A 2VMEA 1MRDL 4GSDL 3RTQC 3KPNB 4GXVH 1BWWA 1ZANH 1U3NA 2EEXA 3WTYA 3CZKA 4WNSA 2B3IA 1QFUL 3APCA 4ALAL 15C8H 1AGFA 3H4FA 1OAUH 3PQYB 4Y8DC 3QXDA 2XTJE 3Q6GL 3KL5A 3CH8A 2CDGB 1SRDA 3HC0A 4G9DB 5C2BL 4DKEL 3UFIA 4A38A 3M7OA 4OCSL 3N44F 2MHAB 3ULSA 2BCMA 2WYTA 3VWJD 5EBMB 1UOLA 2YFNA 4LDLB 3U79A 2H1PL 3S5LG 4R2GD 1PIGA 3WTXA 3UOAB 4EDWL 1S7UA 1UFGA 5EEVA 4GO8A 5CZRA 4ZD3H 4L4VB 4B9GA 3FQWB 2YN5A 3P0YH 3BWZA 4ZS6C 2YJLA 3ZKSD 1A0QL 1PNCA 3GMPA 5CMAA 1XH2A 4XP4L 4YEEA 1UOKA 5EEUA 5FYLH 1PKQE 3VWKA 5D4IA 3VXMD 4AGLA 4P59L 4TS6A 1O7SA 3MUHL 3SKNA 3F58H 4HIJB 3JWOC 2APSA 2SEBA 4JRWA 4BZ1A 4KJQC 4OZ4A 3CDZB 1D7DA 1KGWA 1OAQL 5JOPE 1QP1A 3CN4A 3QA3A 3QIBA 4JQXA 2WBJC 1N64L 1WD9A 3V6OC 3ABGA 1WT5C 1R3IL 3VXSD 4ZMVA 3SO3B 3ATBA 2V5RA 4K7PX 3T4AA 3QXVA 3ARSA 3FYEB 4JQIL 3TEXA 2F2HA 2VDOH 1AO7E 1QZ1A 4D9RD 1IBDA 4I9WD 1RI8A 4PB9L 4B9CA 1A3QA 2R2HB 2YD9A 1EO5A 4KOCA 4K5OA 2OI9B 4QF1A 5EZIH 2BMKA 4TNVK 5BOPA 4PGEB 1C12B 1MI5D 2KUTA 3IEAA 2D2CC 2J5LC 4QLWA 1NC4D 3FFDB 3FSOA 4NKIL 5ID0B 5HYJE 5DVNA 2OZ4L 2Q3AA 3RDTD 3FXIC 3OL2A 4MB5A 3H54A 3MZGB 2HFGH 3MLXL 1KB3A 4JFEE 4M1GL 2R2BA 3MPCA 5IVXA 3PDDA 2CIIA 1UZ8A 4JFEA 2HAZA 4Q7DA 3WEXA 4G6KH 5DJDA 5EO1B 3BD3A 3K0YA 2UX7A 2MWCA 3IU3B 3WJJA 1MF2L 1A1MA 4X7TA 3ZE1B 1OGTB 1GVIA 2ZKHH 5HHXH 2QKIC 1A3RL 1TT6A 1SJEB 1RP9A 4LEOB 3N5AA 2LFGA 3FHQA 3TM6A 2V5MA 2WWOA 1O7DC 2Y5EA 1V3KA 3FBKA 2ZXQA 1MJ8L 1U93A 1PCSA 4GKLA 3RX7A 1PJ9A 5HHME 1WFOA 1C5DB 1OAZH 3K80A 1CT8B 1BQUA 4LHUG 4MJIE 5I1IH 4P57B 4A1RA 5HYSG 4YFLI 1AFVL 1AQKL 1L9PA 1XX9C 5FUCC 5TE7H 1MWAB 2F19H 3LKSA 2ERJC 1NGQL 3OPZL 4PRBA 1S78C 4UZGA 3KWTA 4G8EB 2LU4A 5C0BB 1NWOA 2DEXX 4GQZA 3F7KA 4U1HA 1X4YA 1KLUB 3VD7A 2CM5A 2VLJA 1CK0H 3UYRH 4FEMA 3ARVA 2WJ7A 3H3KA 1S9YB 3NQIA 1Y18A 4CNIB 4DP5X 1NA8A 1E5AA 5BMFH 3NZUA 3GJEA 3NCXA 5KYNA 4KTEH 2H9GB 3OPZH 1FO0A 4JJHA 3JV4B 4EZKA 3MO1B 5F71A 4UBDC 1PIFA 2BVQA 2EZ0C 5EBMA 2Z92B 2ADIA 3VRLE 4H1LB 1AYRA 1T6VN 3FK3A 3T8VA 3S88L 1KBGH 5EBWA 5DHEA 2PABA 4BQ6A 1KXHA 2JJTC 3KNBB 4IRZA 4AK1A 1CF8H 5HI5C 4ZMQA 1JPTH 3A3YB 3CHPA 3V6BR 1S7XB 2CRYA 3HLAB 1MRFH 1BCIA 2ICEB 5C09B 3BEWB 4A67A 5D1QB 5D7HA 4ZI8A 7CGTA 2L7EA 4R84A 3O6FB 5EU7C 4DW2H 1ORSB 2R1YA 1X6NA 2P28B 3ALXA 2OXHA 1G6RL 4NBYB 3L3GB 5ANME 2HVJB 1K5NB 4M8QB 5F0JB 1JZ8A 3L5XL 4L9LC 3Q44A 4N0YH 1G1KA 4JY6B 3GSUA 4LSPL 5I1LB 5JYMA 1T2XA 3EUDA 1PGRB 3T2LA 5C0CD 1FPTL 1UD4A 1T0NA 5A3IC 2UXGA 5FKPB 1HKFA 2FJHA 2H32H 5DRXA 5ABAA 1GPOH 1V8HA 1IBBA 5T3ZE 4P5RA 3FAWA 1ZOXA 2W65A 3DMMD 4GG8B 4TLKA 3DSNB 4TQ8A 3CZNA 3HHSA 1TJHL 3SO3C 5I19L 1B0GB 3T2QA 1AD9B 4Z76A 5DYFA 4Y9FA 1T6WA 3UGEA 4O9HH 4WTQA 4WWKC 5ISZB 5DJXA 3TL5A 2YQ2A 2WUCH 4UQ9A 3BAEL 2OXGA 5SWZD 1XF2A 3SOTA 3VI4A 1EFXA 2J6EL 1FNFA 3LEXB 2ZXCA 1LEKA 3TONA 3MXVH 1JF1B 2EYSA 5B38B 2Y9RT 2VLLA 5IQ9A 2FL5B 1YNLL 5AW2B 2AJVL 4XVOA 1ADWA 1UB6B 3KEDA 3FUNA 4FMFA 2Q2LA 4G8GB 5J12B 5C6WH 4N2BA 3NACH 3LIZL 1X44A 2DEWX 5I0VA 4HW6A 2VZSA 1CFTB 4L0PB 4XMLH 3QQXA 4E9TA 2D31B 2GK0B 2WQRA 4WDIB 3WUWA 1SN5A 4P2RA 3VI4F 2WNGA 2AKRB 4K2UL 5KN5B 5C0JA 2QADC 3MLSH 1PD6A 4BXSV 2DWEA 3G04B 4HBQA 2ZAHA 1CFQA 3EFFA 4EDXB 1P4LA 4JO1H 5MEQA 3AUWB 4F7TB 5GSVB 2EKSA 3MUGB 3AGWA 2AJ3B 3NACL 3PAZA 2DPKA 4JO3L 4QUOA 4UT6H 5KYUA 3NFSH 5TPWH 3UBXA 1TYJA 1TTRA 5EOCH 1HL8A 3CJJA 4CW1B 4OBSA 3QXUA 4XNYH 4HD9A 4L3CB 1W9XA 4WSGA 1QR4A 2J4WL 3L7EA 1XMWA 4O51A 5ACMA 3SDAC 4JM2A 4UINL 3WN5B 1KCWA 3P77B 1YY9D 3Q8BA 4IS6B 5C0FB 1D6EA 4LRNH 4IU3A 3LHPH 1A2YA 3QFJB 4JO2L 3UZVA 2ROYA 4C8XA 4NUMA 4MZIA 3GTVA 2ICWA 2IG2L 1EZSA 3JTTB 3KH4A 4NEHB 1IC5L 2C4FU 1TFHA 4FKEA 2CHXA 3FHAA 2HH0L 5E8OB 3BQUD 1NGPL 2X2HA 3VWKD 4XNDA 3DYPA 4S1SL 4X4YA 2ENQA 2XV2A 1I8LC 4LESA 3Q1SL 3EH2A 1E6OL 3FU6A 4GG6B 4RFNC 2UXTA 3CZLA 2GSGB 3LMJH 2HYMA 1I53A 1OP5K 1NINA 1BVLB 2LE9A 2ZPKH 4LAQL 43C9A 5I8CA 3V6ZB 3DDFA 2LR4A 5JOPD 4GRWE 4DN3L 4LXFA 4N2GA 4C56E 4RZCA 4TF4A 5FGCB 1KF9B 1IGYB 2AJXH 1DYZA 1QATA 4QXVA 5D1QA 3QUYC 1N2RA 4R26H 5EV7A 1R46A 1G7PA 1UEMA 3TH4T 1WPCA 5JOFB 2WQ8A 3CFDB 4OZIA 4JZJA 2Y7MA 3EUUA 5IEHB 1URIA 4PJ9D 1A9BB 2JWYA 3A6CH 2K6YA 4KRPD 3MQIA 2PP9A 2BS9A 3DX7B 2IANB 1UASA 5K1NA 4QRSA 4NQEE 4FQLL 1NGXB 4NZTL 4OUUB 4ANKA 3DO7B 3QWOB 3BQVA 3QDGE 4HPYL 4PSPA 3BZEA 1FPTH 1CZ8H 3F01A 3CSTA 3ZDYF 3SKOB 1G5GA 3KLHC 2DQJL 5DC0A 1MFNA 3FU9A 3ARQA 4KTDL 2DBJA 4HXBH 1RZKL 3CFNA 4LLQA 2XQYG 3V5KB 1KTLB 3ZQXA 4X9IA 2IADA 1D3CA 1U92B 3N43F 2JH2A 1BWMA 3PXHA 1JGEA 4XPFH 3I9GH 4D94A 1BSIA 5E1HB 3E3QC 4J3OD 3U0PB 3VFUA 2DTMH 3H2WA 4PRDB 2A6DB 5BUGA 3TBSA 2C7FA 5HHMD 1OKEA 3PL6A 3KLQA 5IMMA 4HK0B 3KWVA 2FQFA 1T1XB 2XJKA 3DX8A 3Q9PA 4FNTA 5DK0B 1MWOA 4EXKA 1NCOA 2ZCLH 1TZOA 1P7KA 3RIAK 2YEQA 5KVDE 1UM4H 1I9EA 3DJTA 1XCTB 3GRWL 2NY3B 4HGWA 4MA1C 3QUZB 4QHKI 4OI7A 3B9KB 1J1XH 1I8UA 4Y2DD 1A22B 4PTUB 4NZ8A 1O6SA 2GAZA 1ITBB 4LLWB 3EFFB 4AI7A 1YMMB 4G9DA 4LU5L 3RFZA 1SYVB 3CFJA 4F7MA 3IMRA 2I9TA 2EKSB 3D87B 3MUGA 3OWEA 4X0NA 3O0RL 5C9KA 1J8HD 3C5ZD 3GJFA 4NO5A 1N4XH 4R4FH 4GRWH 1IFHH 3B37A 3MLTB 1SF3A 3SKUD 4FNQA 1DSFL 3FOLB 5EU4A 3ZRSA 2ZOTA 4KI5F 3VFSA 5HDWA 5K9QG 5KSBA 4DVRH 1JRHH 2NOYA 4KX7A 2HJLB 2G0LA 1C08B 4P9HC 5KS9A 4GW5B 3NCJH 3AZUA 1N7ML 2VXQA 3IFLH 4EI5C 1AQKH 5TE7L 4YPGA 3QEGH 3ZQ9A 1EUTA 1ZVSA 2HP4A 1D6EB 4ODHH 3L3OC 2PCYA 2EP6A 4ADGA 1YSOA 3UAJD 3JUYA 3E3QE 1R1CA 2ZUVA 4OVVA 3H7LA 3H9YA 5ADPL 3ARGA 5DFVD 3ZYJA 1N26A 2XT1B 2OMYB 4FI6A 1LYQA 2YUWA 2C4XA 4JPQA 3WIHA 4EKJA 4FL4B 1RFDH 3WGUB 2Q5BA 4YHKL 2CXGA 4NRXB 2CSPA 2FAUA 1NCBH 1SJVA 2Y6TE 4L23A 1BPVA 1HQ4B 2NYYC 5EU3A 4HLJA 2YAHA 3ALPA 4L1HA 5CN2A 4FNPA 3BESR 4MD4B 4XVJH 2DIBA 3D3VD 4NRYA 3FQXA 1HSAA 5FR3A 2J8UF 1U8NA 1EAPA 4ZK8A 4B96A 5T3ZD 1OW0C 2ENPA 3VNYA 1T0MA 1T83A 4OLUL 5C6PB 1YEIL 3QH3B 3IDNA 5K1VA 3H85A 2QTEA 2L0DA 3O6FD 4EOWL 4AQEB 2WXGA 3JSSA 4E68A 1TQUA 2HKFH 3KMDA 4CJ0A 3RILA 1JDCA 2OMWA 3QBTB 1OL0A 1HL5A 1YPZB 2W9EH 5GGQH 1CIDA 2DD8H 3EGDB 3BKJH 4G6JH 1UM5L 3SIKA 2X88A 3IN0A 4AXWB 4TVPD 3QDJB 4IGBD 2YD1A 2AABH 5L7XL 2LLNA 4DZBA 4QTHB 1MFEL 4P9HL 3D2TA 2CA4A 1MN4A 1FC1A 4Y5VB 4WK2B 4ACPA 1UWGH 4OLVL 3H9ZA 2HLEB 3R4RA 2RIKA 5IUSA 2XZAH 4ANXA 4NQEA 5EC2B 3HLKA 4PFEA 2YD2A 4YHMH 4TUOB 4G5ZH 3SPIA 3NH7H 4HU2A 2V6HA 3BAEH 3NEOA 3O2DH 4QR7A 1J5CA 4N5EC 3WTUA 5DHVH 5IV2B 4DKFL 3B8YA 1CGTA 5EO9A 2NXZB 3TBBA 4RGMC 3DX8B 1K3IA 2VLKA 5DK0A 1MI5A 1TSRA 3EDEA 4GO6B 4JRYA 5EF3A 3AROA 5F7DB 1MY7A 2CE6A 2KZBA 3QSKB 4C54A 2BVOB 3WE6A 5KTEH 2Y7LA 1KGUA 3T2NL 1GGTA 3B4NA 3B9EA 5HYEA 5JOEA 1ZT7B 2EDMA 3UTQB 1OSZB 4Q9BA 1WFJA 5CCHE 3MNZA 3CXFA 3JV4A 2BY2A 2DLFH 2PP8A 2VKWA 1FQ9C 1CQYA 1J8SA 1MG3C 2X6UA 4RETB 4QRUB 1KIQB 1J12A 4KO6A 3BQUA 3SCMA 3FO9A 2CK2A 5B38G 3BDYH 2MMXA 1U21A 3KGSA 2CIKA 2IAMB 3QPXL 2A0LC 4H25B 4PGBA 1GY1A 3CBJB 4MAYB 3PWLB 4OIFA 1HL9A 2J2ZB 1WUZA 4LSUH 4AG4L 1VIWA 1AANA 2CUMA 5GHWH 4IDJL 5HHOA 3KS0H 4YPGB 4M5ZH 1KG0A 2BNQA 4L3FA 5INCA 4IMKC 3DRQB 3REVA 5D1XD 2X0VA 4E5XG 4JFUA 43CAB 4NQQA 4ZSOB 1DBKH 2NLJA 2LU5A 4G8FA 2AITA 5A2LH 5ABDE 3H2PA 5T33H 4TLTA 5C7XL 2E4TA 2F9BT 2QPUA 4D0BA 4LL1A 1KFAL 5IHHA 5LBSA 5FECB 4X5WB 3VFTA 1J18A 4QGTA 4U3SA 3GSOB 5DD6A 1UYWL 5FKPA 2EDNA 5EEXA 5E2VH 1PZ3A 1RZKH 1WFMA 1M6UA 1NGPH 5JZ7D 5C0AB 1QNZH 2PXYC 1CGVA 3N40P 4L5FL 3JTSB 2A9DA 2X4SB 3L7FB 3BP4A 3MRNB 4Z7WF 3SGDI 2R0WH 5ISZA 5C3TA 1T89A 1QAWA 5JIHA 1PY9A 3GIZH 1CDGA 3UO1L 4K3DH 4JFQB 1XBRA 3V10A 1MHEB 2R39A 4R0LC 5HHMB 1I1YB 2OS7A 5F3BA 1T20B 1EANA 3EFOB 4N6QA 3CFCL 3HRZA 4MQSB 2XICA 2ZOLB 1JN6B 3N04A 5ENWA 1EEYB 2UY6A 1MKFA 3Q8CA 1FL3B 2NY0B 4JQIA 4HJIA 4FLSA 4B7IA 5IB1B 4GBXC 4XX1E 2GBTA 15C8L 2EINB 1BPLB 4O4YH 4OZGF 3H3PH 2C3VB 5D7LD 3ZR5A 2AQ3A 4YHYB 1A4BA 1G7JA 3BGFC 1VADB 2XQYK 1JXFA 5MP6L 4KK6D 5FYJU 4PBXA 3THMH 4RDQG 1LVEA 2V3DA 4PJXE 1A14L 5DCCA 4FG6D 4GQRA 3C87A 3VWJA 2X2IA 3DMMA 5CGYD 3KZ8A 2NUTB 1CFMA 3IXTB 2B59B 1WAAF 3CD4A 1J05B 2AQTA 1SMAA 1J48A 4NQEB 5EC2A 2WVUA 5F3HB 5CZXD 1TZAA 5D2LA 3D2UB 4ATWA 1LLAA 5CJXA 3OJDA 2WKOA 4MA8H 1J86A 5H35B 3B34A 3WFEL 2JQZA 1Q4NX 4M9OA 4O51B 1WZAA 5FK9B 3PDOA 5IQ7L 5G4MA 5FM4A 5HJDA 4JMNA 3SEPA 3ARBB 2Q7YA 2O72A 2R2EA 4F2EA 1A2YB 1QSFD 4TM9A 2XN1A 4FX5A 1IM9D 1DBBL 4PJBA 2HH0H 2VDOB 1NCHA 2APFA 2Z64C 5EC1A 3QZPA 1FJ1B 3L95B 4Y4KD 4H26A 1MUJA 4X5XB 1EH9A 5C0RH 1JAEA 4FQCH 2JFCA 5JMRA 4J6RL 2DL2A 2HRLA 4YVUA 5DJ6A 3Q8EA 1J5OL 5FOJA 3IE9A 2GBUA 4ODVH 3QK0A 1H3WM 1XF3A 1SHXA 1HVXA 4D0CB 5KVGE 4OCLC 1W0VA 3MLVH 4ONFH 1U3HD 1SOSA 5C08D 5D71L 5C3LD 5IMOA 3VXUD 2D8KA 4MJHA 4X83A 2QADB 1ODAA 3LXBA 1U8JA 2P48B 1FGVH 4LCUB 4NJ9H 5D2NA 2KZKA 2P8MB 1MHPL 1Z9SA 2Z34A 1VACA 2R69H 3NN8B 4QRRD 1JPST 4IEFA 5CSGA 4U1KB 5JOFA 3D8MA 1M1XA 4IMLA 5GGTH 5I5JA 1WAPA 4I2XE 3D39B 3PJLA 1BQSA 2XVBA 3C8KA 2UZXB 3FUEA 3N43B 5HVWA 2V2XA 4IBSA 1NM4A 1HZHH 4D7BA 1A7NL 1E0OB 1UGNA 5IG7B 4OV6F 4NBXB 5DLLA 1EA9C 2P5PA 4XOAA 2CLZA 4OIIL 3ZE1F 3IFNH 1KFAH 4JUTA 5IMLB 2C3XA 2FB4L 1FNEB 1L9OA 1OP3H 1I8KA 1OP9A 3HR6A 4KKLD 5J6GA 1TZGL 2APBA 3LIZH 2EO1A 4NOFA 3NCMA 3SDYL 3U9UA 1JK9B 4FFWD 2R8SH 1JDAA 4KZDL 1U33A 3PAUA 4URKA 1BFTA 2DLIA 1O9VA 5DRWB 5HJGA 2WMPA 1CICC 4JVWA 1WGVA 2EE3A 3TBCA 2VR5A 1NGQH 1FNHA 1ZTXH 4MD0A 1QSVA 2XA3A 4IBLT 4MQXD 4APQB 5IQNA 4ZRGA 4FG4A 3B2VH 3PHOA 5FUZH 5F93C 5T3XH 1P4BL 1G6RA 5BVJA 2VR9A 2ZCLL 1T5WB 3NT0A 1KGIA 4TQEL 4EIZC 4BFRA 1F0LA 3BRFA 3DVFA 3FOMA 4HXAH 1DVYA 5IFHL 2KLSA 3LEVL 2BNUA 4J12A 1E9QA 3IU3A 1NOFA 5H2BB 5FYKU 3RY4A 4IRSD 1NM9A 4PTUA 5IB3B 3IKKA 4H20L 3ESNA 5MENA 3RVWC 1YMMA 5C86A 4LKXA 2G30A 2I9TB 1NC2D 3TBYB 2XVKA 4JPWL 2J1XA 2H1XA 4PJCB 3SD5A 1JRHL 1SXAA 3PNRB 1KT2A 2FJGA 1RULL 3JYBA 4IDJH 2R0LL 1MRFL 4XOCA 4V2BA 2EXTA 3PYCA 3P0VL 1BXUA 4RSVA 2P5WE 3EHBC 1WCBA 4G5ZL 4GRLC 4RGOH 2WCGA 1TQTA 4UM8A 3QIBB 2VR8A 2VDRH 3GHEH 4KKBC 1XF1A 2WQUA 3CQFA 2E8YA 4I77H 3FB7B 4B9ZA 4X5RA 1EJ8A 5C0CA 3SDCA 1WFNA 3UTSE 3Q06A 4N4YB 3TWYA 1IGMH 2R0LH 3L95A 4KQ4H 5CN1A 1A8ZA 1RJLB 3VXQA 3ZGHA 5KBDA 4PJ5B 4FN0A 5MEQB 4G3YH 3L4XA 4DQOH 5HYFA 2PCXA 4YLQT 1Z2KA 1JV2B 1P7HL 3WV0A 3NJIA 1C12A 5KSAB 5IBTH 4ZXBB 4YHNA 1F1AA 1CXHA 3TA4D 3JUZA 3Q2WA 3QZNA 4MWFA 3ZVVA 2YEZB 1XH3A 2VOTA 3HMXL 4F7EA 5DJ8B 1ILSA 3HG1E 2DJMA 1NTDA 5IVZB 5GZOC 4FTVB 2G2RB 2CDFB 2NW2A 3MC0A 4NQTA 3WEXB 5D71H 1VACB 1E90A 3JWDC 4G72B 3N0AA 2H3NA 5T1LB 2Z8VC 5JXAH 4GSQA 1MJUL 4MS8C 3DGCR 1FFRA 2BHYA 2FRGP 1PS3A 4L29B 3H42L 1JIBA 3O8XB 4HJGB 3II3A 3A4EA 3GSNH 5E2JA 5GS1C 5I74C 5D7LB 3CDFA 4BSJA 3LNDA 1IIIA 5TDNB 1AZBA 1QLFB 5CZVH 3FO2A 4OGAD 3QPQC 1XDTT 1A14H 2AANA 2QDVA 1OALA 4XPTH 3O3EB 3ARGD 5DS2A 2KS0A 4OB5H 4WU5B 4KUZH 1BOYA 1X5LA 3IFNL 5DZLA 1I3GL 4H13C 1RZ8B 4MMXB 1HESA 4FZ8L 4NNPH 3QQ3A 1GSKA 1CLYL 2FHFA 3U9UB 5GGVL 2J1ZA 5EDSA 5GJSH 2XNAB 1ZT4A 3V0HA 5JPNA 3VMNA 1DQMH 4G9FD 1ILUA 2JQAA 3P3SA 4HP5A 2FNBA 4NERA 1EGJA 2W60A 1DQVA 3FFCD 4E9QA 4AE1A 1NCWH 4PW3A 2LLGA 1R3JA 4OTXL 1E9PA 1YEGL 3SY0B 4BK8A 2W07B 3ARDC 5BQDA 1SDDB 1EVTC 3BGMA 5C8JA 4OCXL 5EZLB 4NGHH 4DO4A 1KCRL 1AVAA 3HMWL 1QSFB 4XVUC 5D70L 4AQAB 4DP0X 5H4ZA 1G6RB 1NOLA 2BVQB 2ZOKB 3BAKA 3ROOB 3Q8AA 2CXKA 1KCSL 1GIGL 1KCUL 1YUKB 3VD2A 3DTXA 1NGWA 1P4BH 4GSXA 1NEZA 1B9ZA 4NWTH 5JO5B 3A6OA 3SPVA 1URLA 1E9QB 3FTSA 1SF5A 3GZOA 3BEWA 3Q1SH 4KGLA 1RZGB 3O81A 3QUYA 1G7MB 4FXKC 1P4LB 3AS0A 4FD0A 3S3PA 2BDNH 3GHPA 3MNZB 3ULUF 3PQYD 5CAYB 1V3JA 2VDNH 4YIQB 3HMWH 3LS5L 4A37A 4I3SL 2P3YA 1F02I 2DQFB 4DN3H 3FL7A 3QULA 1NBYA 3ARFC 4MQTB 1GCYA 3TN0A 2DMGA 4L37A 3DETC 4J4PA 3R18A 4JFDB 5E2UL 4Z7AA 2P5ED 3GMQB 3CU1A 5I1LA 4J23A 5FYJE 3RVTC 1MJ7H 1U2YA 1BYNA 2OMTB 1B4TA 2NQ3A 1WG3A 3AACA 3KJ4C 4P8QA 1JYNA 4YGVB 5DRXB 1J5HA 2NCMA 1ZS8A 3SGEI 4MAYD 3ILPA 4ZUVA 3CVHB 4EUPA 2VQ1B 5DZNA 3VXUE 4G6ML 2VLKD 4K7PL 4WNQA 3EDDA 1ET8A 2NY6B 3SY6A 3TBTB 5JXED 5IM7A 5IW6B 1MQKH 3N85L 4PUBL 5GQBA 3U6XA 4DUWA 2GEEA 1K72A 3C6LB 1VEPA 1LEKB 1OLLA 1CZ8L 3D85B 3QNZB 3QORC 5DD6B 2BY3A 1FSKC 1NIBA 3F6JA 1F42A 3EHBD 4GRLD 1JV2A 2ZCHL 1BBDL 4HXBL 4JPVL 2MKLC 2ZXBA 2XRAL 4XO8A 4F9LC 3QO0B 1S9VA 1MFAH 3JT0A 5I1GH 3JWNC 1NEPA 1WO2A 5IQMA 3SCMD 4YAQA 1NPNA 4GO9A 4KKAC 4GNKB 1IGYA 5DURB 4KJYA 3X13A 2LFEA 4Y16B 4JDEA 1GOFA 3KYKH 4JCLA 5DJZA 1W0WA 5F3BB 1RIUL 1YDPB 2YWZA 3BIAX 3FH7A 3MXWL 2BMKB 2IWFA 5B3SB 1NCAH 5B8CC 4H8WC 2F68X 5K59F 5DJ0A 2FD6H 2VM9A 4UQ3A 1BQHA 4JDZA 4QHNA 2VZTA 3ZE2F 3O6LH 5FYJL 1EV2E 2VSKB 1BM3L 5TE6H 2EEFA 5IT2H 2P9RA 4MHHG 5E94B 3CFIC 2ZCZA 4OZIE 3CSPA 3DX9B 5EPMA 4EI5B 2AEPL 3FRPA 5SV3A 1XZ0B 1PTZA 2WK2A 2YA0A 3HC3L 1W0YT 1N5YH 3V5KA 2V7NA 4JG1H 4DNLA 2MPAL 1U8PB 2D0HA 4LEEA 1B4JL 1AAJA 2VSDA 1IEAB 1OT2A 1LM8V 5FYJH 2VDLH 5DQJA 2B08A 4F2MB 3F3HA 4LIQE 3WFCL 4GUOA 3QNFA 5D9SB 32C2B 2BVEA 5FM8A 3QJFB 1CLVA 2XXCB 3KPMB 3BZ4B 2LU7A 3HS0A 3LZOA 3HB3C 1HHJA 3S4SG 4Z78A 4WY7H 5E4OA 2VLJB 3G9AB 4WSKA 2R2EB 3MBEB 2X4QA 3NJGA 4PRPE 4XNQB 4R3SA 3C75A 1CU4L 2YA2A 3DXAD 1MCOH 3RYMA 5JO5A 1U8MB 4NZUL 2EIZA 4AENB 1IGTA 3ZZ1A 4OZHA 3KS0J 1KCKA 1BW8A 3IPEA 4GW1A 4YHKH 3R4DA 4WQOA 4PJ7A 1Y6NR 4WEBH 2WZPA 1OTTC 4G7QB 4PVLA 3BKYH 3L5HA 3WSQL 1U30A 5F0PB 3V0EA 1BYPA 5HGDB 3V4VB 3DO4A 3MV8D 1NQBA 3QZWG 3V9CA 4QAWA 2X6MA 2P44B 1UZ6E 1BBJA 1NFDE 2QDWA 3BX7C 4KROD 4L0YA 1N19A 1ETA1 4MNHA 1MVUA 3GWJA 3R19A 3UMNA 1SXZA 1U8LA 3GSWB 4P9MH 4ENED 4DZ8B 2PYEA 1QI3A 4E9LA 1FIEA 3BFOA 2YS4A 3NK4A 3GZQA 3AU1A 4XCCL 4GW5A 1HXMB 3F6IA 4FZEH 4PI0A 4YDJA 1DQDL 5GIRA 4X6BA 2P7TB 2EDWA 3O6FA 1ASPA 3F7YB 4YDNA 3KXFE 4I3RH 3W37A 4YXHL 2OSLA 1XH1A 2DM3A 1LK2B 3EYUH 1VRSA 1JP5A 4MRCA 1KGJA 3LTVA 4O2EA 4WW1B 3T9WA 2P5WB 4AM0B 1U92A 2PW1B 3PWVA 2COVD 4IGBA 2ZKXA 3SE6A 1JBJA 1AGEA 1QVOA 4LCYA 2X28A 5DJAB 1EJFA 1INDH 4CRPA 4JFXA 2EH7L 3B2UC 4N90D 4UANA 4YZWA 4OIAA 5C0EA 2IH3B 4KHXH 5AW9B 4I0PD 1NCWL 3GIVB 4O4YL 3EYOA 4MVBD 2UV3A 3ZTDC 5BO1H 4GKZA 5FV1L 2VABA 4ZTOL 4N2IA 1HOCB 3APDA 3AC0A 2IALB 3LEXA 3QI9D 1TSHA 5C08A 2A6KA 3IDNB 2YKKA 4NCC1 1CIUA 2W0KA 2GSIA 4JY4A 1QYGH 1Z3GH 3VXSB 1NUGA 3U25A 5F9OH 4APQD 3GJFB 1J8KA 1FN4B 4OT1H 1UFUA 5KZCB 3NK3A 4H0HB 1PLAA 3GMOA 2LQRA 5L8KB 1HN1A 2GUOA 4BGDA 4G8AC 4HOWA 5BRZE 1UUNA 4BM7A 4ZX4A 2WLIA 2XKSA 3GM8A 3RTLA 5J6HA 2PWGA 1HIMH 5IFAL 2CJTA 4XI5C 3C5SB 4YFDB 1XZ0A 1TTGA 4FABL 1JYXA 5LNEA 3S3CB 4RMWA 5HYSB 1P69B 1U91B 1DDTA 2OR9L 1EFQA 3MRMB 4ZZKA 5KYUB 5FYKH 5LJYH 3VFNA 5IVNA 3HAEA 1PKOA 1ZHLB 3HJ0A 2XKUA 4ZFGL 3FFCB 3HA0A 1MFUA 3PAVA 5I2IB 3P0YL 2PLTA 1G4MA 1SOKA 3ESMA 4M6OH 4AQOA 3W9DA 1ROWA 4Q4EA 1E4XH 1YJDC 4YDVA 5DF0A 1CXFA 5JW5B 4Z18A 4CC4C 4FABH 4BZ2H 4I2XB 3EOAA 3BUIA 2P5EE 3L3JA 5AWNL 1WIUA 3FQNA 5JIQA 3TIDA 2PXYA 4R8WL 2CGZA 1E7UA 1HSAB 3NABL 1P6WA 5HPMA 1QI5A 5ICXA 4ZMNA 3ZQWA 1A7OL 5E9DE 2IEPA 3DX4A 4TNEA 4NJ9L 4Q9QH 1CWVA 2XWTA 5KVEL 12E8H 1T0MB 5CBAA 1BZQK 1RL1A 4D9LH 3QEHA 2PPEA 2ARWA 5DMYA 1QNZL 3EFDH 3UPAA 4W6WB 1Z9LA 2GYSA 5KSAA 3GI9H 3N3EA 2O4EA 3CZFA 3FQ4A 2GY5A 4JM0A 3IRCA 2D0GA 3DV4B 1XB3A 1J5IA 4ODXA 3GFUA 2JTDA 2AJSL 5TK4A 5IJVA 4OBRA 1FG2B 4DGWC 4OCYL 5TF1H 4AXWA 3GF8A 5ICYB 5I15L 2P7TA 3QISA 3OHXB 4LBEA 2OSWA 4HGMA 1ZHBB 1E27A 2GTZA 4S11A 4YLBA 3TBVB 4PVBA 4POZD 4GUPB 1DQJB 5F88A 3DOSA 3I6KA 4OZGB 3G5ZA 4D0BB 1A1NB 2XIIA 4JFFA 4WW1A 4XNBA 5B1CA 3T8MA 1CDJA 2G4GA 1BAGA 1WA2X 1E5ZA 3PWNA 5BOJA 3DJ9A 3JV5A 3MRLA 5D1QD 2FHCA 2WWMD 3MBXL 3RP1A 1BOGA 4DCQA 2CMRL 1ZKAA 4U3CA 3DUUB 3RNQB 3GLZA 5GS0L 4BSVA 2ADYA 4JUSA 3GXNA 2ISDA 2JE8A 5AW6B 1KLGB 4NKDA 4Y4HC 1ZDQA 2EH7H 2J6WA 4FNRA 3TWCL 2C5DC 2CKBA 4FFZH 1TNNA 4Y4FB 4HLZH 4WU7B 3WFBH 2IANE 8FABA 3QQ9C 1KIPB 4NN7B 3MRBB 4XN9A 5CU9A 2BZ7A 2K0RA 3CSBA 1CD1A 2IBZX 2WWKO 2H47C 4TQHA 3TBWB 5SWQA 5F9JA 5CJOH 5EBGA 3MCLL 4ORZC 4XBEH 3PF2A 3LN4B 1IVLA 3QCUL 1GGCH 1LWHA 3S6CA 4NWUH 1IGCH 3RTQD 2BSTB 1RIVH 2XWXA 3OBAA 4OLZH 1EZVY 1NEZG 1J9QA 5IB1A 4HKZB 1RIUH 1XVSA 4XXDB 5EF1A 2FX8L 4AYFA 4YHZL 2AEOA 4GAYA 4JFSA 2AK4D 1BP3B 1ML0A 4D8PB 4NO3B 1NGWB 1R17A 2HLFC 1UUSA 2YXWA 2NY1B 4JKMA 1OAQH 3OAWA 5DTFB 2FEEI 3PP3K 2Q8BH 4JO8A 4HX1B 3NTCL 3VQMA 5ITBL 1TLMA 4DN4H 1ZDSA 2R1WB 4N6RA 3DLQR 5CBEA 4KWUA 4BFIA 4BH8B 3B2PA 1DANT 1KYOK 3QRLA 4YK4B 4AE0A 4O02A 1V7NL 3MLZH 4P23A 3CZSA 4NKMB 1DN0A 3QUZD 1W8EA 3DXAE 6PCYA 2RFXB 1XF5B 4K5PA 2PCFB 4FQLH 4NO5B 5KJRH 2WZPD 4NC0B 1ZLSH 2P80D 2FX7L 2J73A 1U3HA 3MLVL 4KTGA 5AOZA 1MRDH 2IDSA 2ZWSA 1MRCL 3C6SB 1Q0XH 4ODWA 4OU3A 3D0LB 2DQUL 1KZYA 4IBTA 4YDIH 4DOHB 3AG3B 2HKHL 1QFWM 1ND0A 4ZMTA 5I30L 4X5WA 2ZUYA 4JGMA 2BP8A 3MRJB 1JD9A 2OMTA 3ARUA 3NCEB 4IHBA 4LDEB 4XAKE 4OJDH 2FO1A 3RGBA 4PJDA 2ODHA 2B3RA 5F1OB 3EYUL 3VFRA 3C5JA 4NNYA 2R0ZL 3HNSL 4Y2NA 5ADOH 5K9KB 2WIIB 4PJFE 2OX5B 5H37H 1FFPA 3MJ7B 3OX8A 4DP9X 4KKCD 1DVZA 2R4SL 3PP4H 4AZ8B 1TQSA 2L7QA 3EJYD 3QC6X 2BY1A 2AGJH 3EXLA 2IDFA 4N0UA 3DOIA 3D51A 3EJSA 2PPDA 3RB5A 1R5IA 5LB1A 5HHVH 3S4SA 3SDYH 3TT1H 4PD4J 2XTLA 2F5BH 3BDXA 3OV6A 3PPEA 4DK5A 4ILDA 4RDBA 4CVXA 3WKYA 2EDKA 4M62L 1GC1H 1KJ2B 3FQWA 3WO4B 1DVFB 2F8OA 3V9FA 2BM3A 2E9JA 1UH2A 2R2BB 4Z7OF 4Y0GA 6FABH 5IVXB 5AW7B 4ZT1A 3L4WA 3W5MA 3L9BA 1Q9LB 1I7UB 4LLMA 3WNPA 3V4PH 1HHHB 4B95C 1HJBC 3VSVA 2E7LA 1NBZB 1RUML 3V55A 4K55A 2FD6L 1CF1A 3G9VA 1DQIA 3TO4C 2VXQL 2E46A 1T66D 5F9AC 3FTGB 3KD4A 1SY6L 4LPXA 3DX2A 3QCTH 4CN4A 2L04A 3DI3B 3TIEA 1TEFA 2X9YA 1KJMB 3VQ1C 5I6LA 4M4RB 1BZDA 4OLEA 5E5RB 4KXDA 2VXSH 1AIZA 1TYRA 3RDTA 3BT2H 2X05A 4LHUA 4FJYA 4Z3JA 4JRXA 4JFZL 4JG5A 4M1CD 1PZ5B 2Z3FA 3KJ6L 3EZJB 4GRLA 3ZE2B 3OKMB 4JG1L 1QNIA 3ARBA 3B9KC 4UT6L 3D4GA 4N24A 4WZ9A 5TPWL 2F1EA 2X4RB 2HT3C 3ZMNA 2EDFA 3QCTL 5CJ5A 3W11D 4NKIH 4PGDA 3UAAA 2DQTL 4A7GF 1M05B 5FCSH 1NBVL 1O7DE 1N3NB 1NEUA 2H0JA 3HHMA 4LPUA 3SHSA 2F15A 2XYCA 1A8JH 4X6DB 3QI9B 4BZ2L 2PW2A 2VNCA 3QPKA 3VO0A 3VYPA 5EUOB 1FO0B 5F7AA 4KI5D 1D5XB 2I60H 4MHHI 3FT2B 2BOCB 1SHSA 2OJEB 4MNQB 2AC0A 4RFOL 2HSIA 3P11H 1F4AA 5ETUB 4L1SA 1MCOL 4ZYKA 3Q3GA 3T4YA 3MLRH 3SDCD 5KVEH 3HKFA 4M7LT 5A2KH 2VT0A 1BJ1J 2LAGB 4QHLB 3AJ7A 5FS5A 1G4RA 2DIEA 1Q94A 1HFUA 1I8AA 4GW1B 3NAAL 5LBGA 3GRWA 3GK8H 1XB8A 2DH3A 2UUDK 3L3IB 3SYCA 1NAMH 2B39A 3U1SL 2KPWA 2HTKD 1KBBA 4HKBA 4N8VA 3DX1A 5GRYA 4X80L 5AAMC 2BFVL 1XF5A 1CR9L 2DD8L 3LKSB 1N59B 3TO4B 4N9GA 3QW9A 2BNRD 2P8PA 1M71A 2Y24A 5EOTA 5EUOF 4BQBA 3GB7B 4XXWC 4JY6A 3U36A 3VMOA 5HVFB 4P46D 4WEMB 2Y6SD 3SGJC 4JKNA 4LLAA 4P05A 1BM7A 1SEQH 2AJVH 8CGTA 5E08L 4WWPA 2CUIA 2EDDA 1RJYA 3VDBA 2BNQB 3KYMB 5BW7C 1MCKA 3A47A 3T0ED 4C57C 1EJ6A 1ZWIA 1FFPB 3HG2A 2YAPA 2C8NA 4LHQB 5E9AA 3E8UH 4UV4L 3K1KC 5D1XB 1QQDA 5FV2A 5D2LE 5JPNC 2F8IA 3GSRB 4XODA 3AITA 4KMLB 4GXVL 4PJ5A 5SX5H 1U6AL 2DQJH 4GUQA 2H32A 2YSSB 2BSRA 4JFXB 3AMKA 1HH9A 4ALAH 2BRQA 3L9YA 1DVFC 2FO8A 4XMWA 5AB1A 1VFUA 4FRWA 4WTZG 5L2JA 3PGDA 4PJGF 3L3DB 5FKAB 1IARB 5T3XD 4JGNA 1ZGLM 4JM2F 2OKMA 4IJTA 2ITDB 1QI4A 2VABB 4LPWA 1PU0A 1E2VA 1YA5A 2H26A 3J07A 4JG0L 2BNUB 5JIIA 2CM6A 3X3GL 4BYHA 4RA3A 2CJUL 3OLIA 3BPOB 2NNCA 2H1PH 3II1A 3LHPL 1MCCA 4U0RB 3RWEB 1G7QA 3UP1A 3BH9A 4EDXA 3VXSE 3GSQA 2LU3A 2V0AA 3BD5A 4TNWK 3LKRA 3TBYA 1XF4B 3U4EB 1OAZL 4GP5B 4YGAB 1PQZA 2QVMA 3EADA 4JDTL 3VXNA 1B0GA 1O6TA 2EDQA 3CE1A 4CBZA 2FBJH 3P4LA 1L9QA 4BFEA 4JQVC 3WN5A 4W4NA 4AIEA 1WCBB 5FUOH 4CGUB 5L6YH 4CN1A 4IU3B 4M56A 3S7GA 4WI7A 1IC4H 2O6FA 2DQUH 2NYKA 3GUTB 1JF5A 1KFGA 1G94A 2O5XL 1P9MC 4PGDB 4DT2A 3GC3A 3QDGA 1F5WA 4G2AA 3OZ9L 4MDJA 4HETA 4OFYA 5DVOA 4XR8C 4ZFOA 5KVFL 3LRMA 1O9ZA 1NBVH 4LLDB 4Y5XB 5GRUL 3H0TA 3K7UA 4AGPA 2IAMC 4PWEA 1XMEB 4A63A 1MLBB 1MFCH 2NMSA 3FT2A 2ORBH 1QO3A 5I0ZA 5D7JD 1GGCL 3KXFB 4RMVA 3NPZB 2XFXA 3DTXB 3SE9H 4DFHA 1JZ6A 2CO1A 3OKLB 3K5SA 3O11A 5H94A 4BK5C 4WUKL 1N70A 2FECL 2OMZA 3IT8D 4ONFL 1W72B 3U46B 4WI9A 1UXSA 1NIAA 1JFQL 4FFYL 2VCOA 1MH5A 4CKQA 5FGCE 7PCYA 3UBXB 1R3KB 1QFWL 3MFFA 4XCFL 1QKZL 4MDIA 1UA3A 3Q5OA 4AH2B 1IT9L 1S7WB 2Z9TA 1LK3L 4FLQA 4NPJA 4QRFA 5CLTA 2RR3A 4N9GB 5INDA 3BSZH 2Z7WA 3LSOB 5CILH 2JELL 3RFRA 3RNKA 3NFNA 4RGNB 3RVVC 4QJ5B 1IO4C 1XF3B 3CVIH 4NZDA 3DGGA 4MQXC 2IC2A 5I1CL 3KAAA 3V7AG 2A73A 2E9IA 2X1PA 5DS1A 5IJVB 1E42A 3QIWB 4FI8A 4YNYA 3BVNA 1MAML 4JRLA 3QJRB 4KI1A 3QP3A 4OJFH 5GRJH 1IT9H 5ILTL 1TJHH 2VL5B 3UO8B 2CBPA 1BZ7B 3IJHA 5FO2A 1DQJA 5F88B 3H1ZA 5SX5K 4KITB 3CXDH 2DLEA 3T6ZA 4ZOAA 1IAKB 4O2FB 4XP9H 1NGZA 3GJFK 3QJUB 4FLHA 3ZTNH 2B9AA 2VR3A 5TFSH 2EDOA 3MRRA 4U1LA 1N5YL 3WKML 3QHZH 1WJ3A 2X2UA 3QT2A 1YQVH 3U0WL 1KV3A 3BSZA 3HS0C 1MCJA 4YXKH 4A66A 3APFA 1FNAA 4AVIA 8FABB 3HE7D 5AKVA 3PY9A 5HDOA 4U6VL 3B43A 4CDGC 5GS0D 2HRGA 2H26B 3BPLC 3WEMA 4PI2A 2DQEL 4F33A 3X1BA 1GZQB 2P42B 4PJEE 4FCAA 4FNSA 5AOJA 2VITA 4IRJD 4MXQC 4RCAA 4QTFA 5I24A 1G7LB 1MREH 4EUPH 3WHXB 1G7QB 2OYMA 4GXFA 2JCCF 1CL7I 5EIIA 4OW6A 2NZ9D 1YEFH 3EYSL 3SZ6A 5DJ0B 3VX1A 3CFJB 4F7MB 4PWGA 1IUZA 3AABA 2J1YA 2HKAA 5I26A 1BEYL 1G9ML 2F8VA 3MLTA 3NFSL 1BLNA 1ESOA 1U8OA 4ZNEE 1OY3B 4OD3H 5MEOB 2AQRA 2OP4H 4XCNA 2PR9A 2ADJB 4BKLB 2J4WH 3T5WA 4XMKH 5BRZA 5DEGB 1NFKA 1XCXA 2QSCH 1CR9H 3MV8A 3QUHA 2EADA 4U6HB 1MLCB 3S37H 2JKTM 3VD0A 1X7QB 5E8DL 2NPLX 2V7NB 1G9NC 1S5HA 2MIZA 3D9AL 3NG5A 3IDGA 3KPRD 2PYED 2WLNA 2EZ0D 4PRDA 2YAFA 3ZKMD 4FHBD 4NSKB 3PWPA 4S1QH 4ZQTA 3LZFL 3RGVB 3GHBL 3SDXE 5CM1A 4HC1H 4J3UA 1UM6H 3BYYA 3OSVA 3P3TA 4LVOC 4IRSA 4R7DB 1CLZL 4G1MB 1IL1A 1MLBA 2YPLB 1ZE3C 1CL7L 4G3YL 2WUCL 3VD5A 1CFNA 3MV9D 5MEND 2DDQH 3VVWA 2J6EH 3HVNA 3SJVD 2Q3XA 4QPEA 3UBGA 3O11B 2FJUB 2DYPB 1SLXA 5DMIL 1EAPB 5AFAA 1KTJA 3HZMA 3O41A 4G1EB 3B2VL 1W8NA 4K9EL 2WC7A 4UQEA 4Y16A 4ZDHB 1R3KA 3VG0L 1J1PH 5C2UB 3MNVA 4N0UB 3I84A 4PVMA 4F7PA 1XZWA 1H9VA 3F8UB 1BREA 3GQFA 4JFOA 4X8JB 1GJIA 3HUJA 3L1OL 2DQDH 4NYLB 4O00A 3N41B 4Q9RH 4I0PA 1TVBB 2UY7A 5DWPA 2OZ4A 3EYFB 4E9YA 1KB5B 2EDBA 3D0AA 3HC4L 1JL8A 1XTMA 3PIQA 4X80H 1TCMA 2ENJA 4B9YA 4AYGA 3QR0A 3ESPA 4H40A 5DJ8A 2YPLE 4OLWL 3TV3L 2IF7A 2ZNXA 2AQ2A 4ISVA 2G2RA 3GDBA 4A7UA 2QQNH 3UL4A 3U9PL 2RALA 1U8QA 1JGVL 3F7YA 4RX4A 1JUFA 1P5UC 4S2SA 1JPTL 2BOBB 1CE6A 5TGBA 1LK2A 1BAFL 3QRGH 4YSRA 2DM4A 4FC3E 2K4AA 2W81C 3S96A 1S3KL 1X9RA 1EXGA 1FC2D 3I9AA 2HFEA 4MXVE 4LQFL 1WZMA 1QTPA 3A21A 4JCMA 3D3VE 1KJMA 2BNQE 4H8WL 3V0WL 1LNUB 3TJPA 1L6XA 2JKWA 1P84J 4X99B 5D4QA 2KERA 3UIZA 2VDPL 2YUVA 1IX2A 3FQXB 3JV6A 5ALBH 1IGCL 2FSDA 4PW9A 3MJ9H 3MNWB 2WVTA 1XSIA 4QRRB 4M1DL 3APMA 2OMUB 1JTTA 1R5VB 3HJEA 3P0GB 4LOVA 3IS0X 3AADB 4A2EA 3F6LA 4KQ4L 1QHQA 2A2QT 3QQ4A 3VXPB 4CC1A 4LSUL 4MQ7B 3VRLF 2K3TA 3ZE1E 3X1EA 3GRWH 3ARXA 2DQGH 2GT9A 2LOEA 3GUFA 3N42B 4G9FB 4RQQB 4D2NA 1CGUA 5A2FA 5D1ZA 1FA4A 4GUCA 1DJSA 3UTPE 2OMWB 4PIRF 3MJ9L 1UEYA 2G60H 2VLRE 3BWAB 4RESB 4WHYG 1W6WA 4OFYD 1IQDB 3M07A 3ULSB 2PXYD 3MLRL 2IBGA 3TEZA 3DVGB 4RFNB 1TQBC 5KSAC 5LQBH 2BRRH 4HQQL 3EO0A 3ARPA 3EO9L 4GMSL 4MNQD 2CCWA 2F53A 2V37A 4Y5VA 4MMZB 5D7JA 1HILB 4AGQA 4JX0A 1AO7B 5EMYA 3RZCB 3WJJC 1JWUB 5SWSB 2QKIA 4GXUM 4HBCH 5GGTA 2QHRH 1QBML 2W92A 4Z5RB 5AZEL 4MSWA 1AKJB 4IU2A 5F96H 5HGHB 2J57A 4CDHA 1CFVL 4FQQB 1EJOL 4Y7MA 4PJXF 4ZODA 2G3NA 1RPQA 1KBGL 4RMQA 4F5CE 3T6WA 2R9HC 4AM0A 4ZNCD 1Z0MA 1WAAE 4N0CD 2O5XH 4LPYA 3TC9A 4U3SB 1I85A 1QRNA 3GHBH 1F6FB 1CFNB 3IWVA 4JG9A 1ZS8B 2KC0A 4LF3B 4JFFD 1JMXA 3DIDA 4FYRA 2LVCA 2R51A 1O7VA 3BH8B 4P3WA 5HPMB 3FPYA 1A4AA 5KSUA 1ZV2A 3O3DA 4P2QB 3JWDH 5D1XA 1GY2A 3MRIB 1CGWA 4KDTA 1KCRH 3C6LA 4ZX3A 2EKJA 3AMLA 1BQLL 4HWEL 3S8WA 2NY6D 1T7WA 1T7VA 3V0VB 2Q3ZA 1SDYA 2Q10A 4QF1B 1PVHA 5ITFB 3D07A 3TO2B 2DI7A 1M2VB 3NVQA 1IRAY 3SQBA 2RCSL 2H6PA 2GCYA 4JM2D 5CKGA 2FWOA 2ITDA 2J21A 3BKJL 3QIUA 4G6JL 4YDLB 2IDUA 1PX4A 3DX0A 4HU8A 1WSST 3C5SA 4BUHA 1RSFA 2F74B 5LAPA 4BRVA 4JB9H 2WCPA 5FOBB 4F58H 3CDZA 4EZLA 3LJ3A 5EN2A 1CDHA 4X4MA 2ADFH 5I74B 3G7TA 5CINH 3MRMA 2D03H 5F9JB 2ESVD 5CCKL 2VKXA 4PB0H 1BDYA 1U3HC 3OSKA 3RGHA 5ANMA 3RHWF 1G0YR 3NH7L 1FFTB 2XYBA 3OMAB 4HZLB 4K2UH 1KTDA 1RXLA 1J5OH 2FVNA 4BSVB 4MNGA 5E2WL 4EIGB 2X2YA 2IH1A 5C92A 3TZVB 2DJUA 2ITCA 4FG2A 4XOBA 1NDMA 3VQLA 1JXJA 5KUMA 3LKOA 2P80A 4FCHA 1PL3A 4JAMB 5AVSB 4KRPB 1XGRB 3A24A 4F9PA 1FZOA 2WXRA 2ADFL 4P3DB 4J39A 5I16A 2ZP0T 4CNIA 1KYUA 2KKQA 1S9XA 3JZYA 4XBPA 3T0WA 4E5XB 5ID0A 3V4VL 3I6SA 3ML8A 5C1MB 2A77L 2WB1A 3GS4A 2WOYA 3EH5B 2BVPA 5J12C 5DI8B 2VDMB 4R90H 3LRSB 4Z78B 3QWRD 4I3GA 4M48L 4J3SA 2CZNA 5DMJB 2JJWA 2XTJC 2XQBL 2MQ0A 1INQA 4Z23A 2VJ0A 1NCIA 4G42A 3V5DA 1JTPA 5D7JB 1AGBA 1HINH 2FUTA 1HC1A 3FPXA 4PJIF 2CBMA 3MV9E 5D6DC 1FG2A 2C3WA 4YZFE 2EVHA 5AAWC 4ONOA 3O3AA 3UERA 1IM9A 2WAQA 2ZKWA 1LO2H 4MDIB 5T1KA 2H4EA 5FO7B 1E6OH 1S7WA 2CKBH 2QSCL 1RZFH 2RFXA 1WBXA 1LO3L 4FFZA 3Q43A 4LCWE 3OKEA 2QGCA 5GS2H 4XNXH 2NYYD 4PJFF 5DFAA 2AXFB 1TTBA 1X4XA 1K4DB 1RH8A 3BISA 2WLZA 2ZPKL 5IVXF 3M1BB 3FH5A 4L4VE 5D72H 2Z65C 2EVIA 5C3IA 3SDAA 1MAMH 3KL0A 1B4RA 5IMLA 3NIGE 4AL8H 3RDTC 3E0GA 3MCYA 5JNYB 3UZQB 1F3JB 2E7HA 1AIFB 2WP3T 2QFPA 4NNYB 2D7QA 2EYTB 4N2AA 2J7LA 4Y2DA 4UQAA 2KMWA 2P5WA 4JFDD 4ZTOH 2ZKYA 1EFXB 2DW5A 1AHWA 1PYWA 4MMYB 4O02L 4R7NA 4UQIM 2YXMA 5DJ6B 4DEWA 5DMIH 4WY7L 2A1WL 3MV7A 1NGZB 3P4OA 1RZIA 4EEEA 1I8LA 1P1VA 2QVTA 2Z93B 1BQLH 3MV7E 5ITFA 3GPSA 1YN6A 2IDTA 3ARBD 2AZAA 4OJEH 4WJ5A 2D3NA 2N3JA 2IFGA 2AEWA 5FF6B 2H5UA 2VDQH 2ZQKA 3ZW3A 4GAYB 1N5AA 4CC0A 1UJ3C 1LQBC 4JN2A 4TN9A 1WHPA 1SOQA 2XU9A 1ASQA 5I8EB 4CAGA 2IALA 4RGNE 2WLKA 1TJXA 3RJOA 2F54E 5EU5B 4M5YL 4IIQA 2G9KA 2I5YL 2WXMA 2CDEA 3MODL 4HIIA 5FUOL 5IG7A 3CLFL 4O02B 1F6AB 3BVDB 4JZJC 3B3BA 4W9ZA 3MMEA 3HZ3A 4UAHA 3KLKA 3QUXC 5L8JB 3VXSA 1MCDA 4FZEL 1PW3A 4XVSH 1AO7D 3DSNA 4D9RE 5I19H 1RV6X 5JIDA 4WHTB 4HSCX 5L88L 4F92B 4L3CA 3DBXB 4FTDA 2ADJA 3MBEC 2DB8A 2QZQA 2VJXA 4XZUA 1UQSA 4BFGA 5C71A 4HWBL 5BJTA 1NDMB 4LDOB 2H8PA 3OG6B 1K8IB 4OLXL 2I7SA 3RWCA 5D93C 5FYKD 4NAJA 1SUHA 2WNWA 5D8JH 1UYWH 1A4KB 3BEVB 4JRXE 4P46A 1IFHL 4APQA 2ICWB 1TZHB 2C7UB 2QGBA 4MCYA 5KS9F 3LX9A 1A6AB 3Q2VA 4OZIF 2N01B 4KPHH 1OANA 4YL9A 3AY4A 3HKZA 4H4NA 2KLRA 4NC1C 3PL6C 4Y1AA 3HZYA 4GG6A 3D25B 1KJ2L 2JKRM 2XHNA 1QRND 4N3UA 5CJ8A 1KJ2A 1TJGH 3KYNA 2X41A 4G42B 3TNNA 2FATH 4PRNB 1X9QA 2DQ6A 4KUZL 5ERWB 2MTAA 2HJFA 4F7TA 3L17A 3ZO0A 1BQKA 3SGDH 2Q7AA 4C56B 2L8AA 2APWA 1KXQA 3ULVH 4HUNB 4F7PB 1UG9A 2KDGA 3DRTB 1QRKA 4X98B 1D5IH 5IB4B 1C8PA 3UBXG 5HYJB 4L29A 4EN3D 4G6FD 4JM2B 5EU6B 1Z7JA 5CSBA 3ZU8A 4APXA 2VRAA 3BAJA 3T04D 2B7DT 5KVDH 4DKEH 2PNDA 4N0RA 1P53A 4U3XA 5C0DB 2CQVA 4FYSA 5E5MA 4V1DA 5DHVB 1HL4A 4CMHC 4EXPX 2WLMA 1L5GB 1A4JA 3U9PH 4Y2OA 2DWYA 3BZEB 1IC5H 3UTSD 3BPNB 3OXRA 3Q0HA 4XN1A 4AL8L 3WY1A 5IJDC 2EYTA 2J12B 3L3OA 3V4PB 4JCWA 2BWQA 2NY3D 4MJ2A 1FIGL 1UM4L 4X4YB 4HJTA 5FA3B 5GPRA 3FCTB 2BINA 2O5YH 5KVFE 1FP5A 1LEIA 5AYUH 4LOUC 1AHWB 1PYWB 1ADQH 4RWHA 2RA1A 2W9EL 3C12A 1VZIA 5GGQL 1TMQA 2ZTBA 2HVKA 4DVBB 3B7SA 1FFOB 3D69A 4MWFB 1AXTH 1XH3B 3BYTA 4IM8A 2QSTA 2EXYD 5F8QC 1D5ZB 1ERNA 1JZIA 2ESVE 3FQTB 5E03A 3NZHL 2WZ5A 4GRWB 5A3ID 1C5CL 1Q1JL 3QCVL 4KKZA 4K07A 1JI1A 1SLUA 1S7RA 5E2UH 3UG5A 1I9JH 4NQXA 3CX5K 1PZ2A 2Y07H 4OR1A 2ARJA 4XN4A 1ZS2A 1ZSHA 5JLZA 3OXSB 5EU5A 4IOFD 3DHUA 3SODB 1M2OA 2VAAA 4OD2A 3SDDB 3VFWB 5LXGL 4Y5YA 2AJZA 4ONHA 3CFUA 5AG9A 3BMWA 2BP0B 2N0KA 5ACZA 1WF5A 4AGNA 3SPJA 3S0PA 2EDJA 2P1YA 2X2JA 4K3DL 1IM3A 4GT7A 4QY8A 2EUVA 4U1IB 4PB9H 1YZZA 4BE5A 3BXNB 1FVDB 2GIYA 2XSKA 3D33A 5SWZE 4GMTH 2MCPH 5HJ3A 3VH8A 5SWZA 5KSBB 2M8XA 4XVSL 3UG3A 4XNMB 3MUUA 3MOAL 5EOQL 1E4KC 5IKCB 1JFHA 3CX5J 3D3VB 4GT0A 2Q7NA 5CD5D 2AEQH 2DDQL 5DRNA 5I1EL 4HWBH 5IHZA 2G9HB 2G5UA 3DETD 2EDTA 1MZYA 3C5XA 1ZA3B 2OFQA 1PAZA 2VRKA 5A6MA 2Y06H 5EZOH 3EH4B 4QT5B 2VSCA 3B1TA 3ROOA 5A16B 3ARGB 1ID2A 3FH8A 3JT2A 4P5TC 1KWKA 1EQWA 4Q4IA 5D1ZD 2YMOA 5FGBA 3ZZQA 1N0LB 1R24B 5EO0A 2HG0A 5L4MA 3LKQA 3O4OB 3KDMB 3FSWA 4EBQL 3G6DH 3SDAD 3O6LL 2ICEC 4MA8L 1N0XL 4PGZA 1QSEA 3B5HA 2F7IA 4AGOA 1KJVB 3QUYB 4ADJA 4NRYB 2QPFA 3PGDB 2VDNB 4UDUB 5L8LB 3BSGA 5E8EB 1QWNA 2PO6C 3T2PA 4ANWA 5KSUB 3FCSB 4QI3A 1IC7H 2Y1ZA 3MROB 4OLZL 4C56A 2ZD0A 3P69A 2NY5L 1YNTA 3A67H 4HT1L 4LK4A 1ACXA 2XA8H 4P2OB 2Q76A 1KCBA 2B8OT 3KW7A 3QG6B 2VW4A 5JW4M 3NDZE 1GS8A 3OPUA 3GMMA 3W11C 4KNQA 2E7DA 2L3BA 3HE7A 4K73A 2YD5A 3BAWA 5DQ9B 4U6VH 2YPKA 3V0DA 4LKCA 2WY3B 3GNML 4KJQD 1V7NH 4ZFFA 1ACYL 2FWOB 2R7EB 3BZFA 3GIZL 4PV9B 1ZV9A 1ETZA 3ABZA 1DQTA 1CICD 3UO1H 3MCKB 1Q9LA 1MWAL 4LLMB 4BZYA 2QSVA 3WUZA 1I3GH 3FF8A 1F00I 1ZA6B 3P3RA 4LGRB 4LRIA 4JK0D 1AGDB 1MHCB 3K8KA 3I74A 2GPZA 1TDQA 4V1DE 3N06B 1AACA 2UWEF 1LEIB 3TIEB 3QAZB 5JHDB 3K6IA 5E6YA 3C09C 4MD4A 1FUNA 3WD5L 2DLTA 2V9RA 2UXFA 3GHEL 3UBXI 1MWAH 1KTDB 1P0SE 1JGDB 2CUHA 5D7SL 2DAVA 1FYTB 4K3HA 2ZAGA 4I48A 4HIEA 1U3ZA 2IGLA 1R3LB 3H55A 3VYOA 2BIIA 4I9XA 1KXVC 2WD0A 1HWWA 4RSYA 5LHDA 1HXYA 2AGJL 4JAMA 1H3PL 1ES0A 2YWYA 3OTTA 4GMSH 4BQ8A 4R3SB 1HOEA 1F4HA 3IJSB 4AG4H 2IV8A 5CR1A 4KZ0A 4I0CC 1ODUA 4L9LB 2D3LA 3HFMH 4R0LA 4Z95L 2BX5A 1FZJA 5HI3C 3GEFA 4GS7B 1DR9A 1KIRA 2HT2D 2WSDA 5AZEH 1R33A 3FU8A 3BJ91 3MA9L 1PBYA 1A7BA 2YGQA 4JRXD 5TJWK 1T1ZB 4DH2A 1KCVL 3ISWA 1EAJA 2OJEA 5J13C 5I8OL 4I0PC 3SCMB 1BLNB 3ML9A 4KVPA 5JQHC 1YEHL 1S7QA 4GMTL 3ZYZA 3PHAA 4Y88A 2AXJA 5MHSE 2JI2A 2G2NA 3KBPA 3WIHL 1TXKA 3FSVA 1VGKB 2E75C 4L4VA 3HG1B 5EZPA 3DXAA 1OP4A 4XMLL 3HN3A 3AAZB 2HUEA 4ECNA 2C9QA 2CH8A 5FC9A 5T1KB 3CFEB 4IKKA 1YHPA 1P5UA 1WITA 2WO3B 4D3CL 5F2FA 4WO4C 4PJIB 5AUMA 4DP7X 4AYBA 2R56H 1NMAL 4PW4A 1FWXA 2ZJSL 4M6NL 4OZ4B 3WL9A 2YQ3A 2NTFB 1AGEB 4L05A 2BSEA 4G1MA 2H0EA 1TEGA 4A2DA 3I2CL 1AR1C 2VN6A 2A99A 1U8MA 1FO0H 2VN4A 4WFGD 3G5YA 2VH5H 4JPIA 4NZFA 1SM3L 3DX3A 2ICES 2CLRA 1J10A 3CMOL 3G6DL 2UZIL 5T1MB 2WP3O 4ZTEA 4MB1A 1BV8A 3EYOB 2VUKA 3F62A 3EO1A 3HZMB 4RGOL 4ATTA 1KJ3H 2YO3A 1F90L 1KZQA 2A9BA 3VXTB 1HIML 1A7RH 2FJFA 4FQJH 4MJ4A 4YEFA 1WZKA 2XBZA 3MV7B 3RJDA 2CJUH 5D1ZC 3Q9QA 4KMTH 3AVEA 3HTLX 1NCAL 1UURA 4C83B 5HJBA 1E4JA 1T4KA 4WJ5B 1S7VB 3EH1A 1JPSL 2FGWL 4M8VA 4NN6B 5KW9L 4HFWB 5HYQB 4N5ED 1L0XA 4OZFH 5INCB 4P48A 1C9SA 1IKFH 4XN2A 2NSMA 4FXGB 4N2OA 1ETZB 4P06A 1PZAA 3IKCA 2EIEA 3UC2A 3V95A 4A2HA 3ULVC 4Z7WA 1PG7W 1XCQA 3HUJE 3PFUA 3ZT7A 3VW3H 3UDWC 4PJ5D 3UTZA 5HBBA 3ATAA 1A6WL 2ATKB 3QS2A 4XH2B 3VB8A 5I23A 3B3IA 4N87A 3OJVC 3UTSB 1MLCA 2X3CA 2XPGA 3OD3A 3PWVB 4M6AA 3HC3H 2H3XC 4WWKD 4OF5A 4UQDA 1MCQA 3HNTL 1KB5L 5T3XL 4Q89A 2J1WA 3LKRB 4ZUSA 4F15B 1M3JA 2XI9A 5EWIH 3HE6B 3CUPB 1EX0A 2NDGA 3EJUA 1DEEB 1I9RL 1Q9KB 4HALA 4D0DB 1D5MA 2Y4SA 5EFIB 2QR0B 3V4LA 1VEOA 5HI4C 1KXTB 1FYTE 4KHTH 4N2DA 5IESL 2XX1A 4B9IA 5C0BA 1DANU 1NKOA 2ED9A 3QR2A 3TESA 3BSHA 5G4OA 3RURA 4NUPA 3SBPA 4ZOEA 3U0TA 4OFDA 4R5XA 1F8TL 4NN7C 4PM1A 4WRLA 4FOMA 1DJIA 3BKML 2WVVB 1S78D 4K3JL 4J8RA 4DPCX 5I75B 4JN1H 4G1EA 4GS7C 4IK6A 3UTTE 1E5CA 1F4XH 4ZDHA 2J71A 4WV1B 5D7LE 4NRZB 3QJHB 4ZPVA 5H37G 3W39B 5HDQH 3QEHB 2PN5A 1TZIA 3UC0H 3MO1A 3G6JA 1TVBA 3N1QC 3J8F7 1T03L 3WY2A 1RMFH 1OXYA 3NGBB 3PIQB 2FT6A 2VUOA 2NY4D 3LAFA 1CDCA 4PGCA 4FA7B 1JGLL 3RZCC 1AO7A 4BCZA 4DOHE 3TPUB 5IW3A 1OK8A 1LO0H 1U8JB 4HAFA 4MTMA 2DWXA 5E51A 5LWYL 3UYRL 1KCUH 1GIGH 1HCZA 4PJHF 3MZTA 1TYEB 2HJKA 2WQSA 1YEEL 2X70A 1RUPL 5IBLC 1NCUA 2D9CA 3EYQD 2V3EA 5CEYA 3IMTA 4HS6A 3FFCA 1J1XL 4PRBB 1CE6B 3BC9A 3BHBB 5I0DA 4AYID 3E6FB 5KZCD 1OZTG 2F7OA 2FT8A 4NJAL 4X0KB 3VFVB 4A7QA 3CVHL 4IBYA 1EO7A 2FTAA 3UPRB 3BN9D 1OTSD 1P7QD 1F58H 4TL5A 3GM0A 2CLZB 4WWNA 5JW5A 5K9JH 2B0SL 3ETBJ 1D9KC 4FG0A 1I7ZB 3BUBA 4X6CF 4XBEL 2R56L 3N42F 3WFHB 1FNEA 3TIDB 1R6VA 4PJHA 4TNFA 1JNJA 3WN6A 3OXRB 1A6ZB 1QUNB 4H2CA 2PWFA 1BF8A 3GLEA 1E3FA 1P5VA 2HB0A 2BSSA 2DQCH 4KOBA 1OIOA 4XNUH 5DR5L 3A6BL 4FHJA 3D2UD 3PWJA 4FMVA 4JFHD 4N25A 1I3VA 4NDMB 1KN2L 3MHZA 4HIXH 2W59A 2WMPB 3BP7A 1YLBB 2FJFB 3QUYD 4M1GH 5IWLC 2CRIA 5CGYC 4ZUWB 4G6MH 4K7PH 4M7ZC 3VTMA 3CH1B 4W6YB 3DV4A 5HHOD 3KVPA 3O3BB 4KNSA 1WEJH 4XP1H 1LWJA 3U6RA 1J9TA 3IGFA 2VLJE 4PJEF 1IQDA 1CXEA 5KJ4A 3HB3B 4LFHG 2P5EA 5J11B 3A22A 3MGOA 3OGCA 3OHXA 5F7EL 4EN3A 3ZKQD 1HT6A 4BJLA 2WXOA 1JPSH 3VA2C 4X5QA 2GK0A 2J44A 3V4VH 2E56A 4F7CB 4HPOH 1G9NH 1F4WH 3MA9H 1DSYA 2FX9L 4LSSL 3MDJA 3S5LA 1AQDB 1MPAL 5D6DA 1WGOA 4R90L 3B3IB 3K74B 5K9OA 3GRBA 4Q6IB 1MIMH 3QUMB 5I1CH 1EHNA 3C8HA 3LKPB 1IM3B 3ZZLA 2KBGA 1LL1A 4PLOB 4I13B 1OE3A 5IR1A 2AXWA 1XSOA 4NWTL 3HOGA 3NAAH 3D4ZA 4PJEB 3QIWC 4NKDB 4GBXD 4Z3IA 1HE8A 1QWHA 3L9EA 2JSFA 3IK2A 4N1EA 5IKCA 1VFAA 3FU3A 4BSWB 4FKKA 1CE1L 5BS0E 3TX4A 1XF2B 4YUEH 2Z4TA 3MRBA 3KEHA 1TPXB 1UA7A 2X09A 4MD0B 5E5UB 4OM0L 4HWZA 5IHZB 2XWJA 1O75A 3QFJA 3WS3A 2CBTA 2KZ1B 3F7VB 5PCYA 1IQWH 1D2OA 5T5NF 1UB6A 3RRQA 4KROC 2YN3A 2L7JA 2DZEA 4EMZA 5TFSL 4AIOA 1JNHB 3ARDA 3UBFA 4QRPE 4M8RA 3ETTA 4GIAA 3EG9B 1H3UA 2VH5L 2WQAA 3ZK0A 1FVCB 5E1QA 1FLRL 1PAMA 1MCHA 4ZAKC 3JVGC 3HFML 1SY6H 3NPSB 3GSNL 5I6MA 4DN4L 1OD7A 1YO4A 4XNZC 4ESKA 4B9KC 3ULUC 4XNYL 1O5DT 4L48A 2WKOF 5I1DA 3AW5A 3VGHA 1WFUA 3KCWA 1YYLL 3HNVH 1DE4A 5HGAB 4R6UA 1SNRA 4OM1H 3CHQA 5HDBE 2FJGB 2ZG2A 3D0LA 1RUPH 2EEAA 2FWUA 4Y4KC 4XN5A 5IB5A 3CK0H 2AAAA 4BINA 1N8ZB 2IMMA 4BELD 4OSUH 4MCZB 3QXTA 1S9KC 3KG5A 1UT9A 3D52A 4Y9BA 1UWXH 2DQMA 4WEEA 1KYFA 1NC4B 2PCPA 4TMPA 1NGXA 4U31A 5B4MC 5JHLL 2V2TB 1AQHA 2CHNA 2QGEA 4RMUA 3WE1A 4J3OG 1LE5B 3PG2A 1FG9C 4AV4A 3CTTA 3LKNA 3U2JA 2CMRH 4LSVL 1WHOA 2HTKC 3PFQA 1YNLH 4RZKA 3S35X