2FSEB

Crystallographic structure of a rheumatoid arthritis mhc susceptibility allele, hla-dr1 (drb1*0101), complexed with the immunodominant determinant of human type ii collagen
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
186
structure length
186
Chain Sequence
PRFLWQLKFECHFFNGTERVRLLERCIYNQEESVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRRVEPTVTVYPTKTQPLQHHNLLVCSVSDFYPGNIEVRWFRNGKEEETGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDPVTVEWKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system, structural protein
molecule keywords H-2 class II histocompatibility antigen, E-K alpha chain
publication title Crystallographic Structure of a Rheumatoid Arthritis MHC Susceptibility Allele, HLA-DR1 (DRB1*0101), Complexed with the Immunodominant Determinant of Human Type II Collagen.
pubmed rcsb
source organism Homo sapiens
total genus 36
structure length 186
sequence length 186
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2fseB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 2fseB01
3ZT7A 3D69B 5DS8B 2KZ1B 4NM8H 1OGTB 4FFWD 1F90L 2VLMD 4I8DA 4GKSA 4F58H 4JRXB 1ZV5A 1QEWB 3SGKA 3NCEB 4XT1C 2P5WA 3K2UL 4P2YA 1RIVL 1IBGL 3OKKA 3G6JB 1YYLH 4FQ1H 2DKUA 2DQDL 3BE1H 2CKNA 3S4SA 2PXYD 3BD3A 4LLMB 4J3SA 1QTYT 5IFJA 1R3KB 5FUCC 3U46B 2GSIA 5B38G 3F5WB 5IVXF 3MREB 3MLVH 5DZNA 1ED3B 2N56A 1RZIB 5I1LB 4PD4K 3JV6B 3UTTE 3ZKXB 4JO2H 5ICXA 5I71B 5DJ2A 4YDVA 2QSCH 3D0LA 4CUCA 5DT1H 4F57L 1RZGB 4ZUWA 3L6FB 2QQLL 4W70A 2CIIB 5IEKB 3V95A 4LLWB 1GVIA 3IFLL 1Z9MA 1GPOH 4Y89A 2KH2B 4NGHH 5CJXC 5E08L 1KLFA 4UIMB 3T0EE 5DK2A 4IOFC 4NC1E 5E4EB 5DFTA 5DQJB 3HTLX 4EI5C 1PEZA 3O4LB 2UYLA 1RUKH 1DANT 2A9NL 1QOKA 5MENE 2P42B 2VDLL 1CE1L 2HRPH 2OK0L 4S11A 1NCWL 2A6KA 1A14H 5IB3B 3RUGF 3O3DA 2D7OA 2ID5A 5FYKD 5KSAA 1T7WA 5JOPD 5FGCE 5GISH 4XCFL 3O45B 4L9LA 1HQ4B 3EDEA 3WIHL 3D2UB 2X4TB 4NQUA 4M02A 3CMOH 3VXSD 1JCKA 5IFHL 1EEZB 4ZXBA 3HE7D 5DEGA 4JREC 4PRDA 1R3HA 1M4KA 5F1IB 1IT9H 2VSCA 3QFDA 5IHZB 15C8H 2A6DB 1PYWB 3QI9B 1GC1H 3U0WL 1DQLH 3VFVB 5C0FA 2FB4H 3REWB 4JG0H 5SX5H 4PRHA 4X9GA 4EQ2A 3MRLB 5C2BH 2BVTA 1U8IB 2ZUXA 4YUEL 3B9KA 2W9DL 4MD0B 3OF6D 1JF1A 2EKJA 4HEME 4JZJC 1I8KB 5CIPB 2EYSB 2GCYB 3C8KA 3QA3B 5D1ZB 2C3XA 3JV0A 2D7TL 4KUZL 1X5GA 3BP7A 2JJWA 1RU9L 3EYOA 3G04B 3KPMB 4OLZH 1A7BA 2P5WE 4OZ4A 1C5CL 3FT2A 1BVZA 5I15L 4R0LA 4K3DH 3FB7B 2VAAA 1XGUB 4LF3B 4RAUB 1CDCA 4E5XB 5J1AA 4XVTH 3GMOB 4L3ED 5D7IF 1D5IL 4GSDL 3SOBH 2BP3A 3VFRA 3DLQR 1EA9C 2D0FA 4TUKL 5FDWA 1DSFH 3EZ8A 4YHNB 1ZHLA 4HX1A 3EJJX 1Q0YH 4JM4H 4NN7B 3QISA 5D7JB 1HYSD 2NY2D 4TSCL 2Z8SA 1N64L 3EYSH 3TP4A 1OAZH 3VXOA 4MD4A 2Q8AH 1DBJH 4JFPB 4R96B 1QFWL 4HPYL 4JFYA 3CFDB 4XVJH 2I25N 3VFSA 4PJXF 4JFOA 4EI6B 3BGMB 2ZOKB 3G6JF 3FO1B 3TLRA 4NRXB 2BJML 5HPMB 4NNYB 4N0CD 4LRNL 3BP5A 5F97E 3LRSB 3MPCA 4X9FA 3LD8C 4MB4A 1HWGB 2EXYD 1HKLH 3K0WA 2NY5H 3L3IB 3U4EA 2RCSH 3QIWA 2E6QA 3O8XD 4HV8A 4JAMA 5B22A 1CCZA 3WFCH 4ODSL 4XPAH 3DX8A 4OZGB 1U9KA 2AERT 4XVUC 3V9FA 1A4JB 1KPUA 5MERA 3PUCA 2CLVB 4PRHE 5DWUL 1KC5H 5EUOF 1CFVL 1T2QH 1GZPB 1JFQH 4IIQB 4XGZB 3S96A 3KPQB 4LLAA 4QRUB 3KPNA 1CN4A 4KJPC 3NIDF 1JPST 4JO4H 1NMCB 4PGDB 1F45A 3QWRD 5HI5D 2F5BL 4X7FC 3U7WH 2ZSWA 1MRFH 3QUYD 2VDMH 4W6YB 2BNRD 4P5TA 3O9WB 4RCAA 4TRPH 2MTPA 3QPXH 3P0GB 2DQCL 1QLEL 5DUMH 1S7SB 1EERB 3ARFB 4JFQA 3FQRA 3IETA 1OTUC 4NQCB 1NEZB 3VW3H 3WE6A 2HVJA 1KFAL 3SKUD 3T1FB 4OZFH 3BDXA 4UQ2B 1G7MB 4DZ8B 4OTXL 5GS1A 1JGVL 3M17B 4PRAB 4AIZA 3GHBH 5DRWB 4M3KB 2A73B 4U6XB 3K8KA 3WJJA 1M6OA 2WIIB 1QFWM 1IAKB 1W0YT 5C0DB 2VQUA 5T3ZD 1Z5LA 5C0AB 3RWGA 4JVPA 4UDTA 5TE6L 1LK3L 5CHNB 3RX5A 4Z0BL 5IK3B 5BS0B 3RWDA 1M7XA 4U6YA 4Z7OE 3WS6A 3SJVB 3U82B 1LQSR 2HTKD 1LO0L 2DLTA 1MAMH 3VXUD 4HUXB 3WO4C 4KAQL 2PYFA 4A6YA 1Y18A 5F6HJ 5FHAL 5CEZD 1I3RB 1QQDB 1AD9B 3U1SH 3MLWL 2W1NA 2ADJB 3AREA 1WZLA 4Z95L 4M1CC 4KDTA 3F6IA 4KQ4H 4HAGA 4FXKB 2QR0A 2XZZA 1AIFA 4HCRL 3OKLA 2D9CA 3O6LL 1C1EL 5CEXB 2H45A 4ACPA 1A7OL 3MYJA 1FN4A 2WZPD 3BEVB 2W9LA 5ACMA 3CJJA 5LGKA 1TJIH 1DBKL 4QY8A 5E1AA 5GRUH 1T1ZB 4WFEE 5GGTA 5D93B 2ATPA 4H25A 4PREA 1QPPA 5EZLA 2F74B 4WO4D 3OAUL 1HQRB 4JB9H 3QCUH 1FO0L 1INDH 5C0RH 1HSAB 3ZKMC 3B3IA 1X5FA 4C55A 2C3VB 3TN0B 4F2MB 5A3ID 3Q3GA 3VWKA 1ZA6A 5DJCB 4KMTH 1G9MH 1PGRB 4TULL 2PKDA 4F7MB 3SDCD 1KULA 2LV4A 3X3GH 4PUBL 5FM8A 1PDKA 3RTQB 2APFA 5IB5B 3IXTB 1Y0LB 1QYGL 1N59A 5D1XC 4HG4J 3U9UB 5AG8A 3PHSA 5DI8A 4I9WD 5CS7A 1VGEH 5HHVH 1TVBA 2ICES 5CLWA 5IJVA 4G9FD 4Y19B 4Z5RA 4BQCA 1IARB 2XQBH 4F37K 5ADPH 3MNZA 4MGXA 3ARBD 3MLSL 4IRZL 4WJ5B 5CWSB 5IKCB 1JWMA 1BFVH 4WUUD 3B8SA 5DRXA 2DI7A 3KLAB 2EC9U 2D03L 5F9OL 4Q2ZB 5BVJB 1S7RA 4NZUH 4R97B 3S4SG 1BX2A 35C8L 1QBMH 4DKDC 5TQ2H 5E94A 4L8CA 1ZEAH 2ZCHL 4K8RD 1K4DA 4P3WA 1Z9LA 1YUHA 5JDSB 1OCWH 3V5KA 2AV7A 3LEYH 4WVRA 1UYWL 3TVMD 4HWBA 5J3HD 4G8IA 1QFOA 1UWEH 4LVNB 2YMXH 5F72S 1NFDB 1H0DA 1BD2A 3TBYB 5IMMB 4H1LH 3O6FC 1A6AA 2X9XA 1T5XA 5KZCD 3PL6B 5GZOD 2B7DT 2ARJA 1K4CA 1G6RA 4J3XA 4RQQB 2C26A 3NIFE 3KPRD 3TO4C 5D2LA 3PNWA 1U6AL 1U58B 1Q9WB 3HNSL 5EZIH 4JFEB 4S1QH 3ULSB 3QDGD 5GGUA 1KJMB 4I9WE 1IC7H 3ZDYE 4JJ5A 1FZMA 1X3DA 4U2ZA 3JWNC 4K3GA 3T2OA 4GRWE 4XBEH 1UCBH 1H15B 3HZVB 5J1TC 4BZ2H 5K9OB 3ZL4H 43C9B 1U3ZA 5K59E 4OKVA 4QRQA 5I66A 1HOCB 3P0VH 4L4VB 5ACZA 5M94B 4WUUE 4KGJA 3ZSSA 3DUUA 5TH2B 2YUWA 4TTDC 2P49B 5IV2B 4K07A 2PTUA 3QG7H 3D3VB 1JK8B 3PGCA 3MSPA 4RFEA 3KXFB 1YY9C 1U36A 4MAYA 5DSCB 5EUKB 3FQXB 3G5ZA 4UILL 1UKSA 3EYQC 2EC8A 2E8YA 5SWZA 4I0CC 3HNTL 3GI9L 3N1FC 2FJGB 1OF2A 1ZVSA 4ODUA 4GFTB 2GI7A 2R0WL 5L88H 2EDLA 4GRWH 1WSST 4ELMB 3ZE1F 4NHUA 4J1UB 3L3DA 3CAFA 4LARL 5GGTH 5LBSL 4QLRA 4F7EA 3MUGB 5DC0A 3BYYA 3BZDA 4BJLA 4NZRL 2EIEA 2D7MA 4ZNCD 2J3SA 4CGTA 5D6DA 3KPRE 3L5HA 5EN2B 3N85L 4U33A 1T1XB 4P46C 4YGVB 5GRVK 4KTDH 5T33H 1JV5A 4CNIA 1X4ZA 4C56B 4O2FB 1MCFA 1AFVH 1WEJL 4GW1A 3CDGA 2BNQA 3FONB 4Y1AD 2QHLA 1KCVL 3FQNB 5J1SC 1FNSL 4ZTPL 4Y4HC 4X4YB 1PKOA 3QIBC 2NR6C 3NA9H 1TJGL 1WBYA 4Z77B 1F97A 2OTUA 2GTZB 4PJAA 3GSOA 1BD2E 4KVCL 3B5HA 1FG9C 4YHPA 4F33B 3AU1A 4JFDA 3SO5A 1VENA 1BF2A 4ELKB 1A02N 4HZLB 1IAII 4Y2DD 3UEZA 2XN9B 3SE3A 1I7TB 4P23C 2BVOA 4JZOA 2H2PD 2QSQA 1QKZH 5D2LE 2FSEB 3DXAB 5KSBB 5J89A 4Z8FH 5LQBL 2IH3B 5T3XL 4IRJC 2N7BA 1AI1H 1K5NA 3MLYH 4JRYB 4LEXH 3ABZA 1S7WB 2ATKA 3LY6A 4NKDB 4I18B 4JFXB 2PCPA 3D0VB 2X89D 5F1OB 1TCMA 3Q0HA 3IJHA 5EPMA 3L3HB 1IGFL 4MD5B 3RVTC 3E8UH 4P4KA 1HH6A 4MQXC 2YSSA 3BKML 2NTSP 1J10A 2YD1A 4J23A 3H9SB 3PP4H 1MHCA 3NACL 1IM9D 4PGBA 5CJQL 3BRFA 1FZOA 1X5KA 3OXRA 1G6RH 4IJ3B 2NY4D 3JXAA 5SWZE 3BHBA 2J8OA 1EV2E 3BPOB 4AEHH 4L8SA 3GIZH 3RVUC 4M1DL 3DIFA 3AVEA 2DIJA 3EO1A 1P53A 2DM2A 4GLRI 1DVFC 4Y0GA 4U1IB 4P3CL 3GIVB 1I8MA 1A6TA 1MLCA 2H8PB 3AXLA 3FFCB 4O58L 1RJLB 5DUBB 5E9DB 3HFMH 5DEFA 5F7DB 4P4KD 2NNAA 4XPHH 2JCCA 3DETC 2GJ6B 3FJTA 3MROA 4GUPB 5CZXC 1Q9LA 4KMQA 1A1OA 1J0JA 1LGVA 1N26A 5IVOA 4E41B 1OGAD 3TZVB 3EKCA 5FA4B 4J8RA 3LKPB 1UJ3A 4XWGL 1YNKL 5FOBB 4PJEE 4QHKI 2BNQE 2R9HD 4NO0B 4KPHH 1X44A 1FBIL 4MDJA 3VFMA 5C0GB 2QBWA 1S5HA 5JXAH 4K3EH 4JY6A 4LVOB 4TQEL 1NGPL 1RURL 1A7QL 3NFSL 3FQWA 1VFAB 4PJAE 1B4RA 4HIHA 2XG4A 1S7UB 4OGAD 5TE7L 4GG6A 1RI8A 4KMLB 4JFDE 3ZE2F 3DO3A 3VFNB 4ENED 4GBXA 1LHZA 3QEGL 1ORQB 1RZKH 5SWSD 5JOFA 4BZ1L 2VDQH 3LB6D 3NBNA 5D5MA 3QQ4B 3C6SA 5K33A 4UINH 2FECL 3S37H 4P2RB 2E27L 5EZOL 2AK4B 3LEVH 5DGRA 3I2CL 5D8JH 5AZEL 1IGIL 3MRHA 4TNVK 5TF0A 4OF8A 3DVNB 2QQKL 3LAFA 2B1AL 4KK6C 2H32A 5I0DA 3IJSB 1AO7B 4R4FL 3LOWA 4U0QB 2AJXH 1RZ8A 5C09B 2Q7YB 2R1XB 4G42A 2IQ9H 3DHJA 4NDMB 4WI5A 1ZGLA 2E9BA 1Q72L 1Y6MR 5KBNC 4G6FD 5DK0A 4XMLL 3DBXA 5JOEA 3HR5A 3SDAD 2FWOB 4OCWL 2DYPD 4NQDB 3LQAH 4U1HA 3AUVA 3MRGB 1E28B 1IEBB 2Y5TA 3B2VL 3ARGC 4R90H 1J11A 1R5IA 3FRPA 1CG9A 5DJAA 3RNKA 1A3RL 3RWFB 1IGJA 3BGFB 1QFHA 3G5XA 3EDFA 3KLDA 5I9QB 3S7GA 5BW7C 3ZDZE 2YUVA 2DJUA 3QUZB 5JLZB 1HIML 1N4XH 3BWAA 5I30L 4JRWA 2P7TA 2C3WA 2VE6A 3DX7B 2HLFD 1T83A 4OLUL 2ZNWA 2JCCE 4MQ7B 3ZTNH 2O5XL 2FYYA 4MQTB 4HBCH 5CP3H 2IANB 3IS1X 2D4FA 5E8PB 1FZKA 2FL5B 2X44D 1P2CA 1I1AB 3ROLA 2VXUH 4R4ND 4KXZH 4M8QA 5GJTH 3WHXA 2W9EL 4WI4A 3PV7A 5EBWA 2HJKA 3QFJD 2WINA 4M4RA 1IAIL 2X7LA 5E2UH 1PZ5B 1XF1A 1A3LH 2ITDB 4NT6A 4TVPD 1A8JH 4ZSOA 5GS0C 1QRND 5C71A 5F9JB 3V4VH 4DEPB 1BLNB 3HS0A 4TTGA 1BZ9B 4GG6E 3SGJC 3PIQB 1CDYA 2P8PA 2XTLA 4RAVB 3RL2B 1CIUA 5DO2D 3AY4C 1E4KC 1CXKA 1IC5H 1J87A 2R2EA 2YRLA 1JNLH 1SJEB 2L0DA 2AXFA 5D5ME 3IDXH 1LEGB 4XPFH 2XKNB 4QHUB 1U8OA 2WWKO 4WWKC 3GHEL 1B6UA 1I8IA 5JW4M 2VOTA 4UT7L 2J12B 4KY1H 5EOTA 1SBSH 4DN4H 1WF5A 3E2HC 1WTGT 1YPZB 4X8JA 4UZGA 4MNQA 4R4BA 5T1MA 3S34H 3VRLF 5IESL 4Y5YC 5HVFB 5I8OH 3OR7B 2IQAB 2BZDA 5HHQB 4ETQA 2HN7A 2IF7A 2R8SL 5B38B 4GQ9H 3QDMB 4FRWA 1A6ZB 2BNUB 4JFFD 2A74A 3LV3B 4R2GD 1QO3B 4W4OA 1PY4A 5HGDB 1S3KH 3LIZL 5C0JA 5FKPB 3MOAL 3V52L 5C6TL 3E3QC 3I84A 1I7RA 3GKWL 1NDMA 4FG6C 4F15C 4TVPE 1MCPL 1ZAGA 4R7DB 5IBTH 3WD5L 4PJFF 2UVFA 1JUFB 2XYCA 4I1NB 3TPUB 1F4WH 4EDXB 2VB5A 4KKCD 4JE4B 5DHYA 2BCKA 4Z7VF 4NCDA 1IGMH 3BD5A 4ZTOH 4P2OB 4Z6AT 4MAUL 3ARVA 1SEQH 1IKNA 1MQKL 4M6OH 1KTDA 4HLJA 1NDGA 1QVOB 1CT8B 2AXGA 3HE6B 1BWMA 3MA7B 1QSFA 3OKOB 3BJLA 4XNMA 1Q38A 4LNRB 1KLGA 2Q76B 1IAIM 3VXMD 4ZS6D 2BSRA 2C1OA 1C08A 1G7QB 3EJZC 3CH8A 1A7NL 3T4AA 3PDOA 4NQVB 1HILB 4LASL 3IFPA 4BH8B 1OSZB 4G5ZH 1Q1JL 4RWYH 5LXGL 1J0ZA 3CCHA 5FIEA 4W68A 4GLRH 3EUUA 1Y6NR 4G8EB 3JSSA 1NGZA 2NXYD 5GS0L 2BMKB 2HG5A 1I4FB 1XH3B 4E42B 4JPIA 2ZJSL 1MCKA 3PP3H 4JHWH 5E5UB 2E5EA 4KKBD 3IFOB 3BUTA 4JANB 1ZT7B 1DFBH 2DIAA 3KYNA 2X70B 4J4PD 5HD8D 4KJWD 5TQ0L 1ZLVK 2V2WA 2K7PA 2HKHL 3GMNA 4MNQE 3WXVH 2WWMD 3CH1B 4WY7H 2VQ1B 1NBYA 4XC1H 1RSFA 1FG2B 2YN5A 4YAQA 5F93C 5I1HL 3BP6B 1KB5A 3O3BB 2Q87A 1CFSA 5FYLD 3ULUL 3V7MA 2ZP0T 3JV5A 1JE6A 1S9XA 1NAMH 1Q8MA 3WEXA 4LSRH 1KIUA 1T04B 4Y16A 1KN4L 3SEPA 1JGEA 4DVBA 3MODH 3NFNA 2IALB 3EJYD 4U6HA 3ARUA 4LCCB 1N8ZA 3H0TA 3TJEH 1GOGA 3CUPA 5H2BB 3OGOE 3QO1A 3WJLC 5DA4A 4HUVB 3SE9H 5FM4A 1TZIB 1ZHBA 4QRSB 1W72H 4F3FB 1WQVT 4MB3A 2R29L 4FFYL 1U2HA 2NX5B 1QHOA 1YPZF 2Y07H 1NC4A 3R06B 5EU6D 2DLGA 1NLBL 4APQB 5AG9A 1E4XI 4PGZA 1AHWB 1UB6A 4I0PD 4M93B 3FOLB 4PRIA 2ESVB 2IPTL 1QSFE 4OCXL 1VB9A 4EN3D 3UDWA 1CR9H 3P4OA 3TV3L 4OD1H 3ZHLA 2BOCA 4JDZB 2AEQL 5F1SA 3PWNA 1LO2H 3CFKA 1RHHA 5FYJU 4WW2C 5L8JB 2V2TA 3BJ91 3SDYH 2W92A 1ES0B 4G43B 3VWJA 4LHUD 3C5ZA 4HDIA 1NGXA 4YHOL 1KTLB 4HH9A 4NQED 2GT9B 2OI9C 4OM0H 5C0CA 3ZTJG 2VYRE 3ZLQC 4WNQB 1EJOL 1YNLH 2IAMB 4NUGH 1PJ9A 1YQ2A 1R5WA 1W0VA 5INDA 4RGNE 2E7HA 4HWEL 5DJ6A 4FFZH 1FRGL 3Q1SL 3K4DA 1C5DA 2VLKA 5I16B 1MI5A 1CU4L 5GSRB 1HHJB 4GS7B 1FL6B 4IRSC 4L4TB 3WIHA 1MNUH 5K9QI 3H9HA 4XP1H 3BKYL 4HJGA 3E1F1 4XCCL 5ERWB 1B2WL 2V7HB 4HH8A 5AUMA 2PO6B 3C6LA 2VL5B 3F12B 1JGDA 1MCQA 5H94B 5A16B 5GRXG 1MJJA 3MACH 5E6ID 3ARDD 3BIKB 5F9WC 2X4PB 2I9TB 3DTXB 4BZYA 1GGCH 5IQ9A 2PYED 3QDHA 3WS3A 4OF6A 4LOUD 1BVLB 4XC3H 3G5YA 3UJTL 2QKIA 1FAIH 3EYVB 3BQUC 4U1LA 3ZHDA 1AR1C 2Z93B 2AABL 4XNZC 4XRCB 3P11H 3W39A 1I7ZA 3RKDC 1XF4A 3QUML 3KLHD 4IMLB 3V5DA 4JQIL 3FRPG 4NNPL 4M7KH 5DRNA 5KW9L 1QR4A 3UTTB 1H8OA 1MCJA 3FO2B 1VADA 5DJ0A 2F15A 4Q0XH 4PRIE 1KB5H 2GJZA 4ZQKA 1MRDH 5I8EA 3GFUA 4OIIH 2EDYA 3L3OA 2EZ0D 1BGXH 5DYOB 3L7FA 1IM3B 3LN4A 5FM5M 4LLDA 3WXWL 3ZYOA 5DD5L 5EIQA 4BSWB 4ZD3L 5C0BA 2ED8A 1QFUL 2YD3A 1CXLA 4OLVH 1I3GL 3T0EB 3QIUC 3CZFA 5C92A 5D1QC 4FMFA 5EBLB 3STBA 1LK2B 2YD7A 4PJ8B 3BSZH 1HDMB 4OLXH 5C0CE 3NPSC 2A6JA 2DAVA 3NN8B 5MENB 2NMSA 1WZKA 3EOAA 3X14B 2DQDH 5CJXA 1YN6A 3VRIB 3MRNA 3QRGH 5FK9A 4CMMB 2WBJB 4EI5A 1L7TL 2VQTA 5HYSA 32C2A 1FYHB 4GAYB 5FGCB 2VIRB 5E00A 1HZHL 1T20A 1SY6L 2VLKE 1KCUH 5EU4B 4KV5F 5KJRH 1E27A 4XAWL 1KEGH 1DLFH 1Z6JT 3V5HB 2ZKHH 2QQLH 3HMWL 1LD9A 4K7PH 3BW9A 4HIJB 4RDQG 5T5FL 1M05A 2KQNA 4X7EC 2ITCA 3O2VH 1G9NC 2A9ML 5A2FA 4LNVA 4M7JL 1H5BC 4HK3J 5E2WH 3CLFL 3SCMD 3UYRH 5GRVL 1PX4A 3MYZA 1OD7A 1BAFL 3VCLA 4ZOBA 4DTGL 2OK0H 4GKSB 1RVFL 3RA7L 1NMAL 3EFDL 3G6AA 3O6MH 4RFNC 2P5WB 1KXTB 1RULL 3OKKB 3U30B 2QHRL 1E4XL 3T2PA 2DOCA 3S4SB 4JZJA 2OBGA 2LTQB 3W11C 4U1JA 4K7PY 5A2IH 1QBLH 3QUXC 4N8VA 1C12A 5GHWH 5IFJB 2GSIB 4KZEH 3MLRL 3PWLA 1NUDA 1GAFH 4G7YL 5HJ3A 4DUVA 1IQWL 1JNJA 3EZJB 1UACL 5ICXB 1O5DT 4YDVB 5JW4Q 1I9IL 3D0LB 4ZUWB 5L7XL 5L2KA 5FUCE 3MV8D 1SEBA 2IH1A 1GRWA 3O2DL 4HK0A 1GJIA 1NAKL 5C0BE 4IM8A 3SGDI 5GQBA 5DK2B 5KG9A 2VC2L 5LAXA 3VGBA 1DQJA 4OGXL 2F58H 1MEXL 5HDBF 3BDYH 2UYLB 3BD4A 4EBQH 2EEAA 3RI5F 1UWXH 2A6KB 4BFBD 2P5ED 2R0LH 4LRIC 4JDTH 3O3DB 3SE4C 3H9ZA 3G9VA 4U3HA 4DGIH 4FZ8L 1CBVL 5KSAB 4G80A 1CGTA 5AAMA 3TBWA 5TDOA 3MNVA 4L9LB 3ARPA 3IDIA 1PLGH 4D2NA 3QXTA 3D48R 4ZXBB 3RHWF 5DEGB 4PRDB 1R3HB 4D9QD 2AKRA 3QFDB 3T8XA 3RU8H 1MCDA 3SGEI 3SQBA 3UROR 5BVPH 3U6RA 3WBDA 5C0FB 3ZKQD 4TSCH 2ZUUA 4O2CA 4KRLB 3T65A 4PRHB 5E99L 2ICEA 2I60L 3LH2L 4X80L 1F6LL 3SO3C 3B9KB 1MRCH 1JF1B 1FPTH 1T4KA 4I3SL 4MXWL 4XP6L 3RVVD 3C8KB 4X9HA 1G9NL 1C5BL 1FO0A 3H6JA 3BP7B 1A1NA 4X7TA 3EYOB 2YBRA 1YQVH 3EYUL 3EO9L 1JMXA 1CLZH 1TTGA 1JIBA 4OZ4B 4NCC1 4OUOA 1RZFL 3FT2B 2P1YA 2YR3A 3GBLA 4R0LB 4QNPE 2VAAB 2VZVA 2GK2A 1I7UB 4UAOC 5J1AB 2D7PA 4HJJL 4V2BA 4KWUA 4O5LH 3VFRB 3DMMC 3WN5C 5CAYB 1OQXA 1RMFH 5FDWB 1D9KC 4ODSH 4KJYA 3QJFA 1CFTA 2EEDA 4I2XA 1ZHLB 3FMGL 4M7LL 2B20A 4WUKH 1IFHL 4HX1B 4LLVA 5L2KE 4HGWA 5DWUH 3QDJA 4KROD 3L3GA 4M48H 1MAJA 4QTHA 1JBJA 4YH6A 1K8DA 1JGUL 1FDLH 4KI5D 5FYJH 3PWPA 4D9LH 3DX9A 3NIGE 3SQOH 4QGYA 5DUPL 3B9DA 4WW1A 3VXOB 2Z4QA 4MD4B 2XY2A 4G6KL 1DQDH 1TJHL 4NWUL 5EDXA 3UJIH 2ICCA 1PD6A 1BEYL 4JFYB 5GZNC 3VFSB 3MUHL 4JFOB 2CD0A 3MZGB 1YN7A 4YO0A 5DF0A 4K9EC 2FHFA 3QO0A 3TT1L 4ZS7L 1MY7A 3DARA 4FP8H 3MA9H 2VERN 4YNYA 3DYOA 4FQQA 3BP5B 4WCYL 3T2NH 3TH4T 3AS3A 3W9DA 4LSQL 4OF3A 2XOTA 3KYAA 4HUMB 3D85A 5TFSH 4NHCH 1BZ7A 3UCRA 3U4EB 4PR5A 1X5ZA 3QIWB 3T0BA 4HV8B 3CK0L 4JAMB 1PQZA 5FHBH 3BPLB 3DX8B 5ISZD 1YDPA 1YJDC 3LZFH 4LGRB 3RJQB 4OTXH 2R0KL 4MDIA 1KPUB 5MERB 4PY8I 3CFCH 1WIPA 4TUJA 1U91A 3K7UA 1UG9A 4MS8C 4PY7A 2NY1D 1JVKA 1H9VA 3CX2A 4BELD 3RNQA 1DBBL 2NY3B 2Z31D 3L1OL 1R0AL 2M1KA 5AYQA 3S96B 3KPNB 3U79A 4H26A 1DDHA 1ZT1A 1ACYH 5CGYC 2DD8H 3QP3A 3GM8A 4U6VH 5C7XL 1BQSA 4MA1C 3CLEH 2ZSWB 2APWA 5I73B 4WRLA 1J9CT 3QCVH 1RJCA 4P5TB 4IOSD 2Q86A 4X5XA 4UV4H 5FUZL 4O2EA 1RZJC 4PJBF 1TQBB 5JW3L 4YXLH 5DA0B 2ZUVA 1YEFH 1JF6A 4L1HA 4JFQB 2E7LA 1SHMA 2LABA 3FQRB 3IETB 3UAJD 4ERSL 2EXWD 4OSUL 1MCOH 4BH7A 1MJ8L 5J12B 3TCXA 2HVJB 4AH2A 5DMGD 4HKBA 2G5BA 2A6IA 4JPKL 1U3HD 4I2XE 2VISA 5KN5A 7FABH 3K74B 2W0PA 3F7RA 3MRCA 1TFHA 3RGVC 5DD3L 5KS9E 4LGPB 2W0FA 3QDJE 4YHLH 2B0SH 3RY5A 5GS1B 1GSMA 4RBPK 1OLLA 2P24A 2R56H 4XI5C 4AIZB 2IMMA 3SHSA 5BZDA 3PWPE 1PBYA 3B9EA 1M6OB 5JIIA 2CJUL 3IFNH 1FE8L 5F88A 4QGTA 4QCIA 5DRZA 1Z5LB 3ZKMD 1A6UH 2H2SC 3MFFA 3RWGB 1C8PA 1SQ2N 3T0WA 2XTJD 4WTWA 4UDTB 4G6AD 3TM6A 4XPGH 3RWDB 4U6YB 5CCKL 1WICA 3WSQL 2OR7A 5F7NC 2DL9A 5DMKA 4KKNA 5D1XD 1CGSL 2PYFB 4A6YB 4K23L 1IGYA 1DZBA 5EORL 4K9EL 1LEIA 2OJZH 3GI8L 4GMSL 5BV7C 3AREB 1Z3GH 2QADC 3CVHL 3QXAA 2QR0B 1AIFB 3W0WA 3OKLB 5DJDA 1A6PA 4XAKE 2AGJL 4FQXC 3SGDH 1XIWC 4R26H 3MYJB 3PABA 4X5WA 1FN4B 2DQEL 3O6FA 2XRAL 4GRWB 4UV7H 4QY8B 5E1AB 4MYWB 5E4EC 3U46A 1I9JH 1SBBA 5D71L 2ATPB 4H25B 3TO4A 4PREB 3EDKA 5HYSG 5EZLB 1YJDL 3C60D 4OCYH 4XB7A 5E95B 2E9JA 2HT3C 4TPRH 5EWIL 2UV3A 3RDTC 3B3IB 5L9DH 3DUHA 3JV4B 3GSNL 4XMKH 3Q3GB 2WUCL 3VWKB 1ZA6B 1LO5A 1T1YA 3K1DA 1ADQL 4PTUA 5FF6A 1UYWH 5T1LD 4QRRD 4JQXC 2HT4C 1EEYA 2R1WA 2UWEF 1CF8H 2FGZA 1ORSA 5HI3C 5KTEL 3ARTA 1N59B 1OTTD 1U8JA 4R8WH 5DI8B 4N9GA 4FFWC 1TVBB 2O93L 1QLRA 3LMJL 3MJ9H 2AXJA 5IJVB 2FR4A 2EYTA 4Z5RB 2LU4A 2HTLC 3RAJL 2CK0L 3MNZB 4OF7A 4PJ9D 3TO4D 2WLYA 4RA0C 4HXBL 4WU7A 1JMZA 1JWMB 3UTSA 1KSRA 1URLA 2PXYC 1E6JL 5DRXB 3NAAL 5HTSA 2O5YH 3ALPA 1P7QA 3MXWH 1A0QH 3GJFK 1UZ6E 5FUOL 2EICA 1S7RB 2V7NA 2CKBH 1BX2B 3P73A 3KPOA 5E94B 1I8LC 3QH3A 4N8VG 4L8CB 2OL3A 4N8CH 5MHSD 1K4DB 2D0HA 3DPBA 2DLIA 5EC2A 3SBWC 4TTDD 3WYRA 1YUHB 4NQXA 4HS3A 1C16B 3WFEH 2NW2B 1AGDA 3V5KB 2AV7B 2H6PA 1XGRA 3CXDH 4KI5F 1IEHA 4KK5D 4L1DA 4GT7A 4P9ML 5J11C 4G8IB 2EIZA 4NUJA 1MWAH 3WIFA 1H0DB 1BD2B 2Q3AA 4LLUA 3SDXF 3EYQD 2AI0L 1A6AB 4KI1A 1T5XB 4Q7DA 4HXAL 3ORJA 4DAGL 2ARJB 5D96B 4JO1L 1K4CB 3QIBA 1G6RB 2C9AA 3MGTA 5D2LB 5I6XB 1FYTD 3PNWB 4JKWA 3W0WE 3HC4L 2SEBA 1KJ3L 5GGUB 2MKWA 2EDTA 4JHAH 5MP6H 1ZXQA 3QHTC 4JJ5B 2NPLX 1AXTH 1FZMB 5BV7L 4DWHA 8FABA 1DBAL 5HYEA 5T3XE 1ZOXA 2VXSL 3R1GL 4P23A 4OKVB 2VDOH 1NCCL 4QRQB 2Y25A 5I66B 4GO6B 3HE7C 5ACZB 4P46D 3WFBH 5AWNL 1CXFA 1KENL 4IRJA 1WEJH 1A6VH 3INUL 3DUUB 5ESAA 2ZWLT 4YDLC 5IQ7H 1FNGA 1FNSH 4MSWA 2Z8WC 5E8NA 5HGBB 4N5ED 4GXVL 1S9KC 2X6MA 1T03H 1P7HL 4Y4HD 3PGCB 3SDDD 2A1WH 4RFEB 4MAYB 1N6VA 3SKJL 1NLDL 3MV9A 3G5ZB 2Y23A 2BHYA 5F7YC 4JZNA 5DR5L 5SWZB 2X4OA 3NIFF 4OB5H 2QSTA 3BVNA 1OF2B 3T0VA 1ZVSB 5EO0A 4JM2D 2R2BA 1CXEA 4ODUB 5GPRA 2WIMA 3QR2A 3S35X 3K81A 1OTSC 2PR4L 3O3EA 4BA8A 4GRWF 3GMRA 1AGBA 2LQRA 4NHUB 5FOJA 1FFQA 3L3DB 4OJFH 1MCWM 3I6KA 4P5MA 2XI9A 1TVHA 5F3BA 5D9SA 1JNHA 1BM3L 4F7EB 1IC4L 1JZ5A 4WI8A 1UH3A 3MOBL 1RJZA 1H3VA 3DECA 3P9MA 2N1KA 5EBMA 4G6JH 1DVFA 4HUWA 4YBQC 4PRPD 1JWSA 1KEMH 3L5WA 3KJ4B 1JV5B 3GKZA 3EBAA 4CNIB 4GW1B 3CDGB 2BNQB 3LKOA 3WKNA 3HZKA 2AK1H 1VGKA 4YHZH 5C3LD 4N1HB 4YHIA 1GGTA 3FN0L 1N5AA 4S0TD 4IBLT 5HI4D 2NY2C 4XXDA 4Z7NF 1WBYB 1MREH 4A2MA 2R0ZH 4LLYA 2OTUB 2GQHA 4PJAB 3GSOB 3O2WH 1E4WL 3RP1A 4K3HA 2OQJA 4MVBC 4YHPB 2RQ8A 3AU1B 4JFDB 5FXCH 2NTFA 4HF5L 3EFFA 4Y4FD 4N0YL 2BVOB 4AM0A 4JZOB 3C9NA 3P3YA 3ARWA 1NPUA 4XB8A 2MSPA 5E70A 2LVEA 3EYFA 1HSBA 4HEPG 4N0CC 3MR9A 2ZUQB 3W81A 4DGVH 1K5NB 3VFGH 2VUYA 1IRAY 2ATKB 5CGTA 1MSPA 2OL3H 2XNAA 4G8GA 2EXYC 5E4IA 1OLZA 1X4XA 2YPLD 5CZXD 8CGTA 1WCQA 1WV7T 2CIKA 2PCPB 5DMIL 5FYKL 4BFEA 3O8XC 1JPFA 3IJHB 5EPMB 2HFFA 3HN3A 4P0DA 4P4KB 3NA4A 1HH6B 4BYHA 2YSSB 1W8NA 1MFEL 4CADA 4TQEH 4PRPE 5C07A 1MHCB 2X05A 1U95A 1NUGA 4Q6YA 5CIPH 4Z0XA 4PGBB 3P2TA 2PTVA 4CVWA 1JHKL 3MV9E 1FZOB 4D3CL 4MJID 3OXRB 2NYYC 2JJUA 5HSFA 2G5RA 5CJBA 4QXGL 3BHBB 3L5IA 5D2LF 1F3DH 4GRLD 4L8SB 3X11A 3ARGA 4H20L 3DIFB 5HI5C 1ERNA 2G2RA 3EO1B 4WTZA 5EZOH 1Z2KA 5SX4H 1LO3L 3ULVD 2VLJA 1DP0A 3QUYC 1I8MB 1A6TB 1MLCB 3AXLB 3NTCL 4PJCA 4PYGA 2B1AH 2VLRA 5DEFB 3BZ4A 4Y7MA 4OLWH 2NNAB 5BW7A 2JCCB 2Y06L 3GM0A 2FBJH 3MROB 4R4FH 1AD9A 1Q9LB 3GSRA 43CAA 2ADJA 4L3AA 2F8VA 1MFCH 3PF2A 5T1KD 3AGVA 1FIEA 3FHQA 2JIXD 2LU3A 2F8OA 4J8RB 1UJ3B 2VDPL 1J0KA 2O5ZL 1OM3H 3BEVA 4MDJB 3VFMB 3MRPA 1FGNL 3TBSA 1S5HB 3MJ7A 1A5FL 4ZO9A 4Z78A 2FCBA 4JY6B 5E8OA 4B7IA 4EXKA 3FQWB 4MJ5A 3MLZH 4ZUSA 1HQRA 1V05A 4HIHB 3NABL 4GG6B 1NEUA 1A6WH 1EMTL 2J5LB 4N0RA 1HXYA 1U8NA 4ONFH 4GBXB 4M6AA 1P7KA 2D7NA 1T22A 5JOFB 5MI0C 5D5MB 3C6SB 2E6PA 1G7JA 2BC4A 3P4LA 4RGMB 4YDKL 2HTKC 2G9HA 4MJIE 1BMGA 3SGJA 1BIIA 2YD8A 1S7XA 2NY0D 4Z7WE 1RUPH 2OR9L 3AY4A 1E4KA 3MRHB 4G9DA 3STZA 4JGMA 4G8GE 1H3GA 1VCAA 4X9BA 5CJ5A 1FSKB 2H32B 4G3YH 3N9GH 2FLRT 4WWKA 1ZLSH 1RZ8B 4PGCA 4PD4J 5GGVL 3CVIL 4G42B 4N5UA 1ZGLB 5IVZA 5DK0B 4PS4L 3DBXB 3HR5B 2J4WL 4XMPL 5DD0L 4PJ5A 4U1HB 4OKDA 4FOMA 2Y5TB 5C07E 4RMWA 1R5IB 3IDGA 1CG9B 2Z8VC 5DJAB 3RNKB 4Y5YA 1GCFA 2I27N 2I5YL 1BFOA 5B3JF 1D5MA 4LSPL 3PL6C 1IGJB 4OZIF 3G5XB 2FGWH 5A3IC 2BY0A 2DIBA 4GXUM 1KV3A 4TYUA 3SDCC 3HC3H 1V7ML 1VKXA 1J0IA 2VLJE 1RIUL 3S6CA 1AE6H 3RBGA 5HYQA 4UT7H 3BWAB 2F19H 4PJCE 2P7TB 2VLRE 3MBXL 2VE6B 4DKEL 4YE4L 4HGKC 2PUQT 3DV4A 4W81A 4XPTH 3GK8L 2FYYB 1UVQA 3IAPA 3RY6C 3RY4A 4GAFB 3ULUD 1FZKB 1K6QH 1MFDL 4AIXA 1P2CB 3F8UB 3ARBC 5EOQH 1SJVA 2X4RB 3ROLB 1HINH 2Z92A 3QAZB 4M8QB 2JKXA 2R8SH 3WHXB 5JMRA 1BOGA 4NKOA 5EBWB 2HJKB 1KELL 2WINB 2X7LB 4NT6B 2W07A 4ZSOB 3MLXH 1ZHKA 5BRZA 1NSNH 3GBML 5F7HA 3LIZH 2VXTH 1EIBA 3MOAH 4QYOA 5C6TH 1HOCA 5JQHC 3HS0B 2FX9L 1A3QA 4UTAH 3RGHA 4K8RC 1MCHA 1G9EA 2P8PB 3R4DA 4MXVE 1F4YL 1EGJL 4HPOL 1WZ1L 4RX4A 3D9AL 2VDKL 2R2EB 3QG6A 1AC0A 2AXFB 4DW2L 1IGCH 2AJSL 1U8OB 3PWVA 2B4CH 3TVMC 5LGHL 5J3HC 1I8IB 2LE9A 3TBTA 4HC1L 2IC2A 5EOTB 3V4UH 4FQPA 3KYKL 1H3WM 1H3XA 4FQCL 4UTBH 4X8JB 1ETZA 4MNQB 4FXLA 4R4BB 5CJOH 5T1MB 5E2VL 1QUNA 5I19L 3TJHC 1OP5H 1J8HA 4GRMA 3BMWA 4HQQL 4LQFH 4JG1L 4Q9RH 2E3VA 1P6AB 4KRNA 5CEZL 1DANU 4UOW0 1EO5A 2F5AL 3I50L 4ETQB 1WJ3A 2JB5L 2M8XA 2HN7B 4PJ5E 4FTVD 3U4BH 1O7VA 1U3JA 2X41A 5IWLC 5TE4L 1B3JA 4ODHH 1WITA 5A1AA 2A74B 2XZAL 2W0KA 1CICC 5C70A 5T1DH 3U0PA 3A6BL 2YWZA 2B2XL 5C0JB 4HBQA 1A7RH 3S5LA 1CGVA 4YWGH 3RI5K 2J88H 1I7RB 4RISH 5E2TH 4BQ6A 1H3TA 1NDMB 1FIGH 5L8KB 5JUEL 3GO1L 2X9WA 3DRQA 3BKCL 3MJ8A 5EU3A 4ODTH 1BIHA 2FBOJ 5DHYB 2BCKB 4YC2B 5GGQL 5JW5A 3E3QE 4WTXA 5CILH 4E0RA 2CRYA 4I18C 5IGXH 4WENB 1J1OH 3QUMA 2RGSA 2YPKA 2FEDC 4NZTH 3WJLA 1KTDB 4YR6A 2AXGB 1QSFB 1EFXD 1FV1A 1HN1A 4XNMB 2LAGB 1BREA 1NCAH 1KLGB 1S7VA 4FQ2L 1B0WA 5CSBA 4EDWH 2BSRB 4WFGE 2C1OB 1C08B 3MGOA 3T4AB 1CD1A 3PDOB 3K4ZA 1F3JA 3IFPB 5I1EL 5BRZE 2ADFL 2G60L 2EIBA 4Z7QF 4DGYH 3CCHB 2MCG1 5SV4A 4XNYL 1NGZB 4WW2A 3VXRD 2HG5B 4WI2A 2WUBH 1GYAA 5DQDH 3T0DA 4JPIB 3HI6H 4LSSL 1KLUA 4RGNB 1KB9J 4HFUH 4Z7UA 3LDBC 4K8RL 1RQ5A 3ZKND 4S1SL 5TGBA 3JTSA 3NZHL 2Q8BL 3KYNB 1OOAA 1UM4H 5EG6C 1Q94B 5L6YL 3B9VA 4MJ4A 1BJ8A 1SY6A 2V2WB 2KKQA 4BUGA 4X4MA 4KUCF 1UA6L 2IPTH 4JKPH 1L0YA 3GMNB 4Y2DC 1CZ8L 2EE2A 2Z0BA 5J7CC 3RIFF 1J8HE 1JYVA 1LE9A 5GRJH 5FKAA 4YPJA 2QTEA 1NBYB 5EO1A 1X5JA 1SYVA 2HVKA 4YAQB 1IE5A 1KB5B 4FNLL 3S35L 4IRSA 5DD1H 1CFSB 2IG2H 5GGSA 3K80A 3TNNA 5D7LA 5IB2A 1S9XB 1XGYH 3WEXB 1M7IA 3GRWL 3RWJA 4Y16B 4DVBB 1JGEB 2OZ4L 5IT2L 3NFNB 1UH2A 5C6PB 3CFIC 4U6HB 2VJXA 1RAMA 1WFOA 1KBGL 2GY5A 5ANMA 1N8ZB 4QHMA 3H0TB 5HHXH 2CLZA 3GSUA 4WHTA 3CUPB 4M5YL 2DWEA 3BESR 5CBEA 3QO1B 2I24N 4QRPA 1ZHBB 4KFZC 3VGAC 3QZWA 3W2DL 3GBNL 2MPAH 3QXUA 4OFYD 2J6EH 1NGYA 1NC4B 3OBAA 2NY4C 3BQUA 3R8BB 4D0CA 1UB6B 4PRIB 2YC1A 4AENA 2GK0A 1I9RL 3WFDH 3HMXH 2FIRT 2DRUA 3P4OB 5BCAA 3D39A 2BOCB 1I1RA 2YRPA 4OT1H 3PWNB 4J6RH 3CFKB 1RHHB 1SMOA 1YEEH 4WTZG 3E0GA 2IFFL 3O2DA 2V2TB 1TPXC 3PGDA 4K55A 3VWJB 4Q9QH 3C5ZB 2BDNH 4HDIB 4XP5H 4MA8H 1ROWA 3UBXA 4KTEH 5C0CB 3T08A 1T5WA 4HHAA 3QCTH 3L95A 1R5WB 2FWOA 1W0VB 2R9HC 3G6DH 3QIUA 4JPVL 5INDB 1KCRL 5D1QA 4Z7UE 3QXDA 2BRQA 3DJ9A 4WFFE 2XT1B 4U1GB 5DJ6B 4OI7A 1C5DB 2VLKB 2VRAA 1MI5B 5I8KH 4LSTH 4OGAC 2JJTC 4H8WC 3MV7D 4X4ME 5LWYH 4ENEC 1QD0A 3H9HB 4HJGB 3OJMB 1ZSDA 3DVFA 3LB6C 3E6HA 5AUMB 3WXWH 4LSUH 4JKKA 3C6LB 2EDHA 5C3TA 1JGDB 1FORH 2DQJH 5JHDA 3MCLH 3ME0A 4RSVA 2NZIA 1MJJB 3RZCD 5GRYA 3L5XH 5D7LE 3HG1A 5AZ2L 3UTPD 5C08A 3RFZC 3RX7A 1HYRC 2VKWA 2CR3A 4M1GH 2YKLL 5DZLA 1AH1A 1NBZA 3GUTA 1INQA 5IQ9B 3MV11 3WS3B 5DVLA 4PJIF 3G5YB 3MRIB 1DQML 5ANME 5TDPA 2QKIB 4AG4L 4KHXH 3QEQA 1H5BA 1ZVYA 3SDAC 1REIA 4LK4A 4U1LB 1ITCA 4CAGA 5I17A 1CTNA 2GSGA 3IDYC 5J56B 4QRPE 1EO8H 3UJJH 3W39B 1I7ZB 4CJ0A 4HW6A 3IU4L 4M43L 1XF4B 1CD9B 3LS5L 4N0FA 5DURD 1RHFA 3VGGA 1UWGL 2C4FU 3V5DB 1MFAL 4OM1H 1J1XH 3S36X 5FYJD 3HNVH 5DRNB 4JO3H 5I1KH 5L2JA 3TWCH 1KCSH 3DURA 1VADB 5DJ0B 3QHFL 2WM0A 1RFDH 4YX2L 3V0VA 4JY4A 2GJZB 4QXUH 4ZQKB 3QUXA 5I8EB 1GGIL 3L3OB 3KPPA 3L7FB 2DQTH 3D39E 3LN4B 1P1ZA 4LLDB 4UT6H 2WQRA 4M7JH 3TIDA 5HYJD 1KPVA 2VH5L 3WUZA 3B2UD 5C0BB 4POYA 2HLFC 4M6NL 4MWFA 3CZFB 5B39A 1VACA 5D2NC 4X6DF 4LAQL 1YMMA 5E8DH 2CGRH 3BAEH 1OAKH 2A6JB 3HPLA 3EOAB 5DVKA 2V9TA 5F44A 2QHRH 1YN6B 2YK1L 3MRNB 3GMQA 2FD6H 1N7MH 1P4IH 5FK9B 4RMVA 4EI5B 1MF2L 2GFBA 2DQUH 1LO4L 5HYSB 32C2B 3FKUS 2ZUWA 3LCYA 3CZJA 3QUXD 5E00B 1T20B 3OSKA 12E8L 4KRPD 4X6CA 2IPKA 4DQOH 1SM3L 1E27B 1UACH 3IAGC 4Q9CA 4LRIA 3HE6C 4YQXH 5DO2C 2R23A 1XZ0A 4DVRH 4ODVL 2GEEA 3P30L 4G8FA 4GKNA 1LD9B 4H8WL 5IMKA 3LKQA 3BW9B 3MNWA 2NY6D 1M05B 2ITCB 2JB6B 3U2SA 3G5VB 4JDVA 2K1MA 4JREB 3TYGH 3HG1E 2DTSA 2EDRA 4NKIL 2FX7H 5F7LB 1CT8A 2EH8L 3VCLB 4FZEL 3QDAA 3ISWA 4O4YL 1GOFA 3G6AB 4IDJL 4Y4KD 3QEQE 3U7AA 2DS4A 4NM4H 5HHOA 3W82A 1OHQA 4JZJB 1GGBL 2UY7A 4U1JB 3OKMA 4N8VB 3PDDA 1C12B 3ZE0E 1ZTXH 1GOHA 1UXSA 4XCYA 4G7VL 3MBED 3PWLB 3C08L 5HJ3B 1KCLA 3EDDA 3QXWA 3PJSA 1G0XA 2A77L 2XPGA 2BFVH 3IXAA 3S5LG 1MJ7L 2F9BT 3MRBA 2DLFL 5L2KB 3DMMA 1SEBB 3PQYD 3WN5A 4UU9A 5JHLH 2IH1B 4V1DA 5IVXA 4HK0B 5IROC 1D9KA 2IGFL 1NC2D 4P9HH 4TNWF 4ZAKD 1KG0A 4IOIA 5KG9B 5KAQG 5LAXB 1PEWA 1DQJB 1C5BH 4X7CC 4QOKA 1YEHH 3VDBA 3F7QA 3EW3B 2QSVA 4U49A 2BHZA 4RRPA 1CGYA 4ZS6C 3VH8A 4AQ1B 2BOBA 4G80B 3GSVA 3TBWB 5TDOB 4XNQA 4XPBH 3MNVB 3NGBC 2AJVL 1FLRL 3IDIB 1HHIA 3QEUA 4X6CE 3JVGC 2WWKT 4OLEA 2GYSA 2NXYC 3EOTL 3FMGH 4M7LH 3RUGA 1IFHH 2K9UA 3H3BC 2AKRB 3T8XB 2ICWI 4RFOL 3CVHA 4KKBC 3LD8B 3U6RB 4UB0L 5IHUL 3EO0A 5DMJB 4O2CB 1BJMA 3T65B 2ICEB 5HD8C 4KJWC 1S8DA 2PW2A 2YPVH 1JHLL 1KOAA 2IJ0C 1T4KB 1IEAA 1WTLA 5C0ND 4OGYH 1FO0B 1A1NB 4X7TB 2AEWA 2YBRB 3P9LA 4L3CA 5DQ9A 3VXQB 1YYMH 1ADQA 1TZGL 4OQTL 1OAUH 5HHOE 1RUML 4P2QD 4YFLF 1YMHA 2KPNA 3UTOA 1U8LA 1KTRL 4P57A 1JL8A 1OAQL 2XA3A 5CZVL 1A7PL 1EH9A 4KJYB 4K7FA 1NCDH 3QJFB 4MB5A 4JGUA 5IBUG 1CFTB 1K3IA 3O0RL 4I2XB 3GMMA 3NCFB 1V7NH 4LLVB 5ESQA 4HGWB 1JPSH 3QDJB 5ALBL 5IFAH 3L3GB 4V1DE 3T0XA 5IVXE 4QTHB 1K8DB 3PWPB 2FHBA 1RK0A 1S78D 3DX9B 3QZWG 1J7VR 4WW1B 2Z4QB 4FN0A 1WIUA 3DRTA 4I0PC 4B41A 4X7DC 3RGVA 5CD5D 1CD8A 1W8OA 5C7XH 4QOKE 4EN3C 3KPSA 4HKXA 1VESA 2Y1VA 3FL7A 1YN7B 4YO0B 3BKJH 2MCPL 4L9DA 2WQ8A 3QO0B 1DL7H 2HFGH 3P0YL 4WGVB 4P4RA 4YBHA 4YNYB 1CS6A 4AZ8A 4BM7A 4FQQB 3W9DB 2W65A 2B39A 1YEIH 1F02I 2XXMB 3T4YA 4P49A 4PJXA 5D7SL 5BO1L 4OSUH 1QNZH 3D85B 5KVFH 4NCC2 1X4YA 4S2SA 1BZ7B 5GGRA 3I3EA 4PR5B 5IW3A 4M5ZH 2CMRH 4GMTH 1QLFA 2F53A 1AKJD 1UM5L 4JPKH 3RUGE 3WO4B 1M71A 1PQZB 3KNBA 3UBXG 2P48B 5IIEA 2VDRH 1QSEA 1YDPB 2JF1A 4WGWB 3A67H 3C8HA 4MDIB 4ALAL 4TUJB 1T6VN 1U91B 2X2YA 1YEGH 1GC1C 3FAXA 4PY7B 4W6XB 3KPSD 2ZUYA 1YECH 3G08A 3TA3D 3RNQB 2ZPKH 6FABL 1JZ6A 4I3RH 4J2XA 3VRJA 1RUQH 4YFDB 3DSFL 4YHKL 3U48A 4FQXA 3VI4F 4H26B 4NNXA 1XIWA 1DDHB 1AY1H 3A6CH 2AQ3A 4JRXD 3OPZL 3JWOH 3TT3L 3DHMA 5TF1L 3MRJA 5EUOA 1CE6A 1AGCA 5E6IC 2VR4A 3ARDC 4NM8L 5INCA 3RDTA 4X5XB 2Q86B 3V4PH 4YHMH 3IJYA 4F58L 4PG9A 3UTZA 2D31A 4I4WA 5FECA 3QBTB 4JQXA 1MIMH 3VMPA 4FQ1L 1YYLL 4BH7B 3BE1L 4R6UA 3WFZA 4P2CG 3BDBA 4AH2B 3L3JA 4LPCA 3EOYG 4HKBB 2G5BB 2A6IB 3VGHA 2VISB 3E6FA 5KN5B 4DFHA 3MRCB 4H0GA 4OCNC 3WLWD 3TESA 2W0FB 5K9JL 5F6HI 3MLVL 1CFNA 4NRYA 1T7XA 1TTUA 1F3RB 2P24B 5BZDB 5CUSL 1CGUA 1D6EA 2HH0H 1VHPA 4F8TA 3KLHC 2Q1EA 3BX7C 4JO2L 1JWUA 1T80A 5FGSA 4U2YA 3O4LD 2BVEA 1XGPA 2QSCL 3H8NA 5F88B 5DT1L 1B6DA 2PXYA 4QCIB 5DRZB 4H88H 3QQ9D 3MFFB 3VG0L 2VUOA 3KPSE 5F7KC 4R3SA 2EZ0C 4LCUA 4HIJA 1GPOL 3X3FH 4NGHL 5KTEH 5EOCL 3MX0A 2LTQC 5I1JH 1I8LA 3NCBB 4BK4A 5I74C 2XZQH 4OCLC 5DMKB 5HI3D 1Z9OA 1I1YA 1G7PA 4UIKH 3ZKSD 1JNNH 3L7EA 1RUKL 3D5OF 5KOMC 3SBWA 1IGYB 3D2UD 4NN6C 2Y7QA 1D6VL 4PJXE 1LEIB 2HRPL 5CSZA 3RL1A 1YEJH 2W91A 4LHQB 4ZO8A 3T77A 1YY8A 3I6LE 1FFRA 4OD2A 1RZJH 1A14L 3KPLA 3PDGA 2HTLD 5B39G 2F8XC 2F53E 2NY5C 3QXAB 1WK0A 3W0WB 3QI9D 5DJDB 4TOYH 3MRMA 3TO2A 3OJVC 1LP9A 1QSEE 2XWBA 5GISL 3MC0A 4J7RA 5TPWH 3PABB 4X5WB 3O6FB 3BN3B 3CMOL 3TO4B 1IT9L 2OTWA 2OR8A 15C8L 3HA0A 5AYUH 3MXVH 1GIGH 2XA8H 4ZPVA 1GC1L 3S36L 4PBVC 1DQLL 4S1DD 5F7EH 2FB4L 4Q9BA 4JG0L 3FRUA 3X13A 4PJHF 5FF6B 1LO5B 1T1YB 5C2BL 4PTUB 1WAAF 2AVGA 5DVMA 3KHOA 3VXSA 1EO7A 1EEYB 2R1WB 5EUOE 1VFOA 1ZLUH 3HE7A 4FXGA 2P43B 1ORSB 1TITA 3RJDA 4X6EA 4NP4H 3SCMC 2AI0H 1U8JB 3LPWA 4N9GB 2DBLH 2J8UF 1QLRB 1BFTA 2EECA 2C5DC 3ZMRA 3F7PC 3N1GC 2FR4B 2EYTB 4HD9A 4JPWH 3FO9A 2X4NA 4K3DL 3R0MA 1X5HA 3OF6A 2JK5A 5F6IC 5BV7H 4WU7B 4XVTL 1P9MC 1WBZA 3UTSB 2VLME 5D7JD 3SOBL 1DUYA 1P7QB 1UXWA 4CN1A 1DSFL 2V7NB 1BHGA 4HT1H 1OB1A 3P73B 4HJ0D 1KPRA 1XGTA 3KPOB 1NGQH 3QH3B 4NOBA 2OL3B 4PP2A 3RWHA 1Q0YL 5J6HA 4LP4A 4BQBA 4JM4L 5JNYA 5EC2B 1F11A 5F1KC 2OXGA 1R24A 4L3EA 3WFHA 4P3DA 4NQXB 4WDIA 4HS3B 3QPQD 1AGDB 5E56A 4F7CA 2H6PB 1XGRB 3EYSL 4JFZH 1TTFA 1OAZL 2WANA 2C1PA 1A22B 1DBJL 2EIZB 3F62A 5FGBC 4XVJL 4NUJB 4TUOA 1KT2A 3WIFB 4LLUB 4LBEA 1ZANH 4Z18A 1D5ZB 5ILTH 2APVA 4FFVD 3RPKA 2PR4H 3QIBB 5DEZA 3MGTB 4PY8J 4KQ3H 4PBXA 1OTSD 3PE9A 2SEBB 1LP9E 1UZ6F 2ZUTA 4JY5H 8FABB 1I7UA 4RRPG 2NXZB 2NY5L 3VI3E 2ZUSA 3VH8G 3VJ6A 4EIGB 4P23B 2RCSL 2G75A 4DCQA 3OAYH 1ZKAA 1RIHH 3WFCL 4XPAL 4YBQD 3U9PH 4CMHC 4IRJB 5FYKE 5ESAB 5JOPE 1P4LA 4NZDA 3BWUC 2J8HA 1FNGB 3FN0H 4MSWB 1KC5L 4PP1C 3VXSE 3BO8A 5E8NB 1T2QL 1UH4A 1G9MC 2VITA 3O9WD 3O8XA 3ILPA 4M7LT 4CJ1A 5EBGA 3ARFD 1EEQA 3MV9B 3FT4A 4JO4L 4PFEA 1NBVH 4MVBD 4JZNB 3RVVC 1MJUH 2X4OB 4JR9H 3KWWA 1XF2A 4NQCD 4ZPTA 3S37X 3U7WL 3BVNB 4KDWA 1DE4A 5EO0B 2R2BB 1DEEA 1B4JH 3AROA 5MEOA 2PETA 2VDML 5J9PA 3O3EB 4TRPL 3QPXL 4J3WA 3GMRB 1AGBB 3LRHA 1MFBH 5DUML 3I6KB 4P5MB 1TVHB 2ZG3A 5ID0A 5F3BB 5D9SB 1JNHB 2GHWB 1RJZB 3QWRA 2DL2A 4MJ2A 3P9MB 3VW3L 5EBMB 2NLJA 1DVFB 4LQ1A 5HHNA 4HUWB 5C0AD 3QUYA 1JWSB 3L5WB 1AP2A 2BNRA 1U8PA 5BS0D 4L3EE 1DLHA 2ZCKH 1HXMA 3ZHKA 3SJVD 3LKOB 4TN9A 3ZYIA 1JPTH 2WP3T 1UJTA 3GHBL 3HZKB 4J3VA 5FAAA 3ROOA 1VGKB 1NJ9A 4KROC 4YHIB 1N5AB 4KI5C 2EDOA 4XXDB 3QHZH 3UTQA 4LLYB 3NMEA 5I1IH 1T6WA 3L9RA 1BP3B 2OQJB 3Q5TA 2NYYD 1RZ7H 4PGEA 3UZEA 4NN5C 2NTFB 3EFFB 1CLCA 3WNOA 1KB9K 2IFGA 4AM0B 5J13C 5ITBL 3C9NB 1EGJA 1MAML 1YEDA 2C7UA 3EYFB 1HSBB 3MR9B 5JQ6H 1MQ8A 4PLJD 3AMKA 1S5IH 3U1SL 4EXPX 3WJJC 2XNAB 4G8GB 4KQ4L 1RUAL 1E0OB 5KVEL 2CIKB 2E7MA 1TXKA 1UT9A 3TN0D 1JPFB 3VXUA 4HKZA 2HFFB 5L8LB 1TJIL 4KJQD 5GRUL 4EUPA 1DR9A 2ERJC 4CADB 3AMLA 3RTQD 2NY1C 5C07B 4JB9L 1U95B 4ZUTA 4Z0XB 3QCUL 2Z31C 4LCYA 1INDL 1NL0H 25C8H 2DI8A 1MCRA 1F58H 4Y19D 4KMTL 4CN6A 5E5RB 2D2OA 1G9ML 3MFGB 3X11B 3ARGB 4RGOH 2DI9A 4GOSA 3X3GL 2IBZY 1XCQA 2G2RB 4PB0H 1HCFX 3VE0A 2OSLA 1FNHA 4WO4A 3DV6A 4CBPA 2VLJB 5IOPA 3BPNC 4PTTA 4KHTH 3TIEA 1I85C 4KVNH 1WIOA 2OR9H 1VGEL 5HHVL 1UKTA 4PJCB 4O9HH 2VLRB 3BZ4B 4TSAL 1HEZA 1EDQA 2XQBL 2GITA 3KS0J 1L6ZA 5ADPL 3UAJC 3LRGA 3GSRB 3SDCA 43CAB 2EXWC 1N3NA 3ZE1E 1BFVL 2BNRE 5DMGC 3CMGA 5EU5A 4MNGA 1U3HC 3VWKC 2VKXA 3QSKB 4PLNC 2UZIH 4LKCA 4NZUL 3RY6A 3MRPB 1AGFA 3T3MF 4G9FA 3TBSB 5HDOA 4D9RD 2C4FT 1QBML 1T2JA 3MJ7B 4LHJB 4Z78B 5TQ2L 3WNPA 5D7KD 3ARBA 5E8OB 5B8CC 3GMLA 2RHEA 4MJ5B 4C83A 4PRBA 4ZUSB 4WUUA 1PY9A 3PL6D 1HXYB 4UNUA 1U8NB 4XNUH 2XTJC 1OCWL 5F7WC 4G6AC 3JV4A 1P7KB 3LEYL 1T22B 4NPYA 4JFED 1RIUH 1G7JB 1MIEH 2BC4B 5FCUH 2AJUL 4Y5VC 1UWEL 2YMXL 2YRZA 2G9HB 3WL9A 5T3ZE 5DLMH 1BIIB 1S7XB 5F1NA 2BVPA 3H3PH 4BKLA 1YNTA 4G9DB 2DMBA 3STZB 3BEWB 1UM6H 2Y6SD 4L4VD 3BPCA 3WUWA 3CSPA 5EZIL 1CK0H 5GS3A 4S1QL 4WWKB 1XF3A 4HWZA 4OZGF 4PGCB 3TVMA 1IC7L 3VXUE 3HUJA 4IDLA 2R69H 1NANH 3FAWA 1U2CA 1HHKA 4HZAA 4XBEL 5IVZB 1UCBL 4BZ2L 3D3VD 3ZL4L 2XQYK 5CEZE 4PJ5B 2H1PL 3E2HB 2B8OT 4OFVA 4EEEA 3BH9A 3GBMH 3KG5A 3KXFD 3P0VL 3HPJA 3QEHA 3IDGB 4TVSa 3KPRA 3I9GL 3GRWA 3C60C 4Y5YB 1ZVHA 4OCRH 3QDGA 1BFOB 2OZ4A 4OIBA 1D5MB 1VFUA 5J57B 1EGJH 4F8QA 1FL5A 1WZ1H 3OKEA 3AC0A 3QG7L 5I8CA 5KSUA 1Q0XH 1C16A 3GEWB 5T3ZH 5IWLA 2NW2A 1NKOA 3QNZA 5D7KE 3RVWD 1B0GA 5I75C 2DQGH 1VKXB 2Q6WA 5HYQB 1OTTC 4LPVA 3DV4B 1U8MA 1EHNA 3GDBA 5KVDH 5LGJA 1UVQB 5L88L 5FCSH 1J1PH 1UC6A 3TJHD 4PJ9C 1KACB 4C56D 4MNGE 4ZFGH 1M1SA 2Z92B 3RWEA 1T0PB 4ZMAT 1J86A 1JRHI 1BOGB 4NKOB 4U7KA 4L4VE 4G9FE 3IDUA 3AS0A 4TSBH 1ZHKB 3KJ6H 4FQJH 4KTDL 4O02H 5BRZB 5T33L 3BIAX 1CICD 4QYOB 1AFVL 2FATH 3PG2A 4JN2A 4M6MH 4X5LA 2XN9D 5F71A 4DOHE 3GO1H 3SKMA 3WLBA 5KVGH 1CVSC 3QG6B 3DXAD 3NA9L 4O51A 4A6YH 5HGBA 1RZKC 4J12A 4WFHD 3PWVB 4KK5C 4YDIH 4JRYD 4KXZI 1DUZA 3TBTB 2Q20A 3ZE2E 2FEDD 4Y1AA 2GY7B 1DJSA 3MUJA 4PJGA 1ETZB 1QKZL 1J8HB 2D0GA 1V8HA 4Z8FL 4GRMB 1D5XA 3HUJE 1AI1L 3MLYL 4LEXL 4UT9H 3H9SD 3GJEA 3WCYA 1BBDH 3GZKA 3GJFA 4TNWK 4Y2DA 1OAYH 3V7AE 2ADFH 3LQAC 4LPXA 2NZ9D 4JQVC 5BMFL 3V0WH 3B8YA 2XV6B 3U0PB 3IT8D 1MH5A 5GS2H 3QDGE 1FCGA 4DUWA 5IJKC 3E8UL 3S5LB 5IMOA 2BERA 3ZZ1A 4Q6IA 3TYFA 4S1RL 4XNXH 4PJEA 3OKDA 3DRQB 4K8RH 3MJ8B 4S1SH 5EU3B 4N5EC 3HI1A 2ZUQC 2X89A 3FFCD 5D72H 3CX5K 3SDDC 5E9DD 1G6RL 5JW5B 1MPAL 4E0RB 1TIUA 2GJ6D 3QUMB 2EYRA 4AEHL 2YPKB 2WBWB 3GIZL 2BRRH 4HUNB 4YR6B 3MJGX 4JM2C 4PJFA 2CO6B 4E41D 3TZVD 1IM9A 1FV1B 3OGCA 4NBXB 2DM3A 4RBPH 4Z7VA 1S7VB 5JXED 4NO0D 3HFML 4PGJA 5F70A 4XPHL 4IMKC 4YEFA 3HI5H 3OJDA 2AJ3A 2V17H 2EDBA 5I1GL 3MGOB 1T0NA 1CD1B 4YEEA 3OWEA 1F3JB 2OTPA 3PHOA 1JGLH 1H3PH 5EH1A 2P4AB 2IWGA 4AL8H 1B88A 4M8VA 4NJ9H 5JTWA 4KPHL 4WW2B 2YUZA 3KDMA 1XR9A 5JXAL 1F4XH 4K3EL 4HWBH 5BZWA 1KLUB 1T1WA 4ISVA 3V8OA 1CD0A 2RFXA 1GHFH 2OI9B 4P2RD 4Z7UB 3W2DH 4ONGH 2AK4D 5HI4C 1NFDF 1A2YA 5TGBB 3JTSB 5F3HA 1OGAA 3ZDXF 3N1PC 3OL2A 1ZLWK 3NH7H 1N2RA 2HKFH 1F5WA 1RZKL 3ELAT 1MOEA 1FL3A 2VDQL 4Y1AE 1AO7D 4P59H 4PJGE 4ZUVA 5C09D 3WIIH 4Y4FC 3FFCE 4UINL 4YXHH 5FO8A 5GIRA 1LE9B 3S37L 4GQPH 5FKAB 3QXVA 2WLZA 3LEVL 3LKRA 5EO1B 1SYVB 2HVKB 3Q6GH 2DDQH 4QT5A 4NQDD 3SE8L 2JJTA 2QQNH 5D8JL 4IRSB 2IFFH 4L5FH 1GH7A 1T3FA 5HVHC 5GGSB 5SV3A 1INEH 4KKLD 3TNNB 5D7LB 5IB2B 2XFXA 1HKFA 5ESVA 2EO9A 4JLRA 5SWSA 1M7IB 3RWJB 2AJXL 3AAZA 3VRLE 2IQ9L 4BFIA 4GW4A 3LPGA 5IBUB 2YEZA 2LU7A 5F7UA 1FGVL 4LDOB 3LQAL 5ANMB 4QHMB 2CLZB 1E6OH 4K71C 3GSUB 4WHTB 4IEFB 4X7SH 2DWEB 4R90L 5F9WB 1OWRM 5CBEB 3QUZD 1O0VA 4XTRC 1R3IH 4QRPB 3QZWB 3QJHA 2YZ1A 4EUPG 3MRQA 4NWTH 2DTMH 2FO1A 1NCBH 1NGYB 2CDGA 3REVA 3U7YH 1FSKC 3BQUB 3SDAA 2DYPA 4K7PX 2IAND 4D0CB 4GRLC 4XNZB 5CLTA 1CGWA 4LU5H 4P2RE 4ELMF 3MO1A 4PJFE 2YC1B 4AENB 1BFSA 1I1AD 2GK0B 2HWZH 4C57C 4OCSH 3UC0H 1EUUA 1N4XL 3S97C 3C2AH 3V79C 3ULVC 3B83A 4Z7VE 3D39B 4JFHD 3VGDA 5E2JA 3QNXA 5AZ2H 3RPIA 4LFHD 4P99A 1BQLH 1N5YH 3ZTNL 4HBCL 1LILA 3PGDB 1A1MA 4KZDH 2BSSA 3EGSA 3THMH 4EVNA 5J4MA 1EK3A 1VFBA 1J05A 3UBXB 2VXUL 1EHLH 2V6HA 4I77L 5GJTL 4ZODA 3MZTA 2BXYA 1T5WB 4HHAB 5E2UL 1A3LL 3L95B 3QIUB 4WV1C 5D1QB 5D2NA 5EC1A 3QXDB 3V4VL 1UQSA 3NPSB 2YD9A 1Z0NA 1OGAE 5DDHA 5JO5A 2AEIT 1I3VA 3D18A 4OLYH 3LKNA 1IC5L 1JNLL 4LVHC 3QFJA 5A43C 1E4JA 1MFNA 4NQSA 3IDXL 3GSWA 4WEBH 4XPFL 3MLPA 1ZSDB 1JRHH 1AQDA 1QRNA 4JHBA 5KSBF 2EH7H 3E6HB 3CFEA 5FFLA 4XVSH 1ZGLP 4OFPA 4KY1L 5JHDB 3QDMD 1SBSL 2NY0C 4DN4L 2I07A 1YEKL 3DVIA 4DKFH 3HG1B 2X1QA 3S34L 5C08B 5SWSE 1QBAA 4M7ZC 1NBZB 3GUTB 5I8OL 1INQB 4WW2F 2L7JA 4LKXA 4AMKH 1VPOH 2Q3ZA 1TQCC 4KGLA 2ZZUT 4ORZC 3GB7A 2EE9A 2X4RA 2FH8A 5TDPB 4ONHA 3WUWG 3QEQB 1H5BB 4Z7UF 5IR1A 2D7QA 5LCVH 2AJYH 4WHDA 4RIRA 5I17B 1Q9KA 2GSGB 4OQTA 1OQOA 1OSPL 1S3KL 5C2UB 4P2OD 4N0FB 1SM3H 3H3KA 4RMTA 3FN3A 3LHPH 4HKJA 3NZ8A 4X6FA 4RFNB 3V7AG 5HXMA 4YHYC 1VEPA 5ICYA 1C7SA 1LNUA 5IBTL 3HE6D 5L2JB 3DURB 3P30H 3K46A 3V0VB 4JY4B 4JVWA 4JFFA 3QUXB 5ALCH 4U0RC 3O6KL 5HHMD 5EA0H 3KPPB 3ZTJH 4ZTOL 3TIDB 1P1ZB 3HZMA 1KPVB 1V3MA 5GJSH 4EOWH 4PRNA 1SEQL 2NY7H 1CTOA 4M6OL 1UENA 4H0IA 4MWFB 4W4OC 3ULVL 2A0LD 5B39B 4U3CA 1VACB 3LQMA 4HUUA 4RA3A 5C1MB 1YMMB 3ULUC 4IDJH 1HI6A 4AQOA 3HPLB 3K3QA 5IROA 4HSQA 4I48A 4LPUA 4U05A 4CU6A 4X0KA 3GMQB 4MLSA 1OAXL 1EUTA 3IF1A 4G5ZL 3OB0K 4YGAB 2GFBB 5D2NE 2Z91A 1EAPA 4RWYL 2YA1A 4HS6A 1CLOH 1JN6A 3MUY1 1GGYA 5DHXB 3MQIA 3VXMA 5BJTA 4X6CB 2IPKB 3IU3A 1IKNC 2JELH 2VDNH 4LMQI 3QFJE 2R23B 2EO1A 4JHWL 4U1MA 1XZ0B 4MCZA 1QRNE 3SKNA 4XP4H 5DXWA 1DFBL 4G8FB 1MELA 4GKNB 5IMKB 3H7LA 3LKQB 3MNWB 5CGMA 3A6OA 4NJAH 5FM5O 3W9EA 3U83A 3JVGA 3U2SB 3M07A 2H32H 4JDVB 5D70H 2EEBA 4QTIH 1BQHA 3WXVL 1KGCD 1F2QA 1FC1A 3CFBA 4WY7L 2CR6A 1QPXA 2X4SA 4XC1L 5HHME 3P4NA 4C4KT 1U92A 4LVEA 3VXNA 1L0XA 4J4PA 1KJ2A 1BJ1J 3SO3B 1NAML 4ZG1A 4OI9A 2Z8RA 1HHGA 5HHOB 4LSRL 3U4AA 3MODL 1AXIB 1EJ6A 5F96H 1XF5A 3OKMB 2EKSA 4LCWD 1UXSB 4XCYB 4TVPH 1FHGA 4ZFOL 4APQD 3EOTH 1FFNA 4UNVA 3LQZA 2ESVD 4UOW1 2HJLA 3PJSB 5TDNA 3SE9L 5ADOL 2XPGB 3O11A 1W72L 2DMKA 3IXAB 4JFFE 2VTFA 3MRBB 1DBMH 1NH6A 2Y07L 1WWBX 3DMMB 3WN5B 1ZGLM 4UU9B 4V1DB 5IVXB 1W0WA 1Q94A 3FQTA 1D9KB 1G7HA 4QF1A 2IMNA 3CSYA 1KG0B 4IOIB 5DJXA 5CKAA 4ZOCA 3VA6A 3LN5A 1CR9L 2OMNA 2HFEA 4OD1L 4QOKB 2GKIA 3BZFA 2IAMD 5I1CH 1PX3A 1LO2L 3H2WA 4OQTH 1OWWA 1WC7A 1X5AA 5EU6A 3SDYL 3VH8B 1KGCE 4HS8H 2GJJA 3IDNA 4YBLC 3ZE0F 4I0PA 2BOBB 2CUMA 3X12A 1CYGA 4OM0L 3GSVB 3J7HA 3IVKA 4EN3A 4XNQB 2ICWA 4XCNB 4L4TD 4K94H 1A7PH 1HHIB 3QEUB 3VXME 4NUGL 3GNMH 3QULA 5E7BA 3RUGB 2BY2A 5CINH 2AS5M 2A38A 2ENSA 4LLQA 2PO6D 4LHUA 3CVHB 4FFZL 4LCWE 5ALBH 4OUUA 2R4SH 4NQEA 4FABH 3BT2H 4GAJH 4TNVF 3ZKNC 1L9NA 3EO0B 5DJ8A 1G1CA 1BF8A 4KV5E 1MNUL 4RZCA 2ZCLL 4EQ3A 4U4BA 4XP1L 1S8DB 2PW2B 5IG7A 3KR3H 3HCVA 1J0YA 1IEAB 4JEGB 4U6TA 1PG7H 4MA7H 3KYOA 4M3JA 2K3TA 1ZA3A 3K4AA 5L0QC 3P9LB 3MACL 1NBQA 2XZCH 4L3CB 2VR5A 5DQ9B 3FO0H 3NFPA 2Y5EA 1X7QA 3RZWA 2O26U 1YMHB 1GGCL 3IAQA 5GSVA 1U8LB 4P57B 5F9DC 1KN2H 4XC3L 4MA1B 1FAIL 2XKUA 3UTTD 5FYLE 1QFWI 4K7FB 4X6BA 5E6IA 3ARDA 2BX5A 1X5YA 3GMMB 3F58H 4POUB 3VG9C 1N0XH 4PLKD 4HK3N 4L4TE 5ESQB 2X9YA 2PYEA 1SYSA 4OCMC 3B6SA 3T0ED 1CL7H 4M7KL 2EIDA 1RK0B 4YFLI 3M8OH 1CXIA 2DQHH 5AAWA 4Q0XL 4PV8A 4MX7A 1FFOA 1KB5L 4PJ8D 1MRDL 3DRTB 1KJ2H 3V6ZA 3OPZH 4OIIL 5ID1A 2CK2A 3RGVB 5MEND 1TETH 1BGXL 3VXTA 3ZT6A 3KPSB 5TF1H 4HKXB 2IADA 3EAKA 3LS4H 1P4BH 1HH9A 4OLVL 5EU6E 2WBJD 1BOYA 4HLZH 1KYOK 2VXQH 4P4RB 2W65B 5HDBE 3BSZL 4OLXL 3HRZA 2Y36H 4M00A 2AEPH 1XEDA 3T4YB 5FYLH 4PJXB 1EVTC 1DTUA 2FRGP 2ARJQ 4S2SB 5GGRB 1R3LA 3QRGL 4N0UA 5EO9A 1QLFB 1YZZA 2F53B 2VO5A 3MRIA 1X6NA 3VFUA 2DBJA 3RVXD 1M71B 1J5OH 3KNBB 2HA1A 5IIEB 1QSEB 3PWUA 2GAZA 5AD0A 1MHHA 5K9JH 4NQEE 3WNKA 5JR1H 5JW4R 1KCUL 5CUSH 5A2LH 2W60A 5DZOA 5BV7B 5KJRL 3G08B 3HKFA 1G1YA 5IMLA 4F80A 2YXMA 1KEGL 2QADB 4NZJA 5JORA 5EIVA 1DLFL 3KYMA 1KXVC 5HDQH 1S9WA 1PW3A 3VRJB 3KHQA 2BVQA 2ZKHL 4FQXB 4CL7A 4POZC 3VG0H 4NNXB 1XIWB 4K7PL 1AQKH 4FHBD 4J3UA 3O2VL 2P5WD 5EOCH 1ND0A 3VFWA 2XWTA 4OD3H 4U31A 3WMSA 3MRJB 2FO4A 2N7AA 1CE6B 5EUOB 5E2WL 2ZSVA 3C5JA 2XWJA 1AGCB 3UYRL 4GKZA 3RZCC 2DJSA 5INCB 3RDTB 1D6VH 1F90H 3IJYB 3H42L 5CEYA 4PG9B 3UTZB 1WFUA 2D31B 4I4WB 3MCKA 5FECB 4WHYG 3GMPA 3O6ML 4OF5A 4N68A 2CQVA 4PJDA 3LPFA 3K2UH 3LSOA 1RIVH 1IBGH 4IS6A 1JYNA 3L3JB 3SCMA 3E6FB 1QBLL 5FDYA 5GHWL 2DQIL 2C4XA 3B5GA 4KDVA 4PJBA 1I9EA 4KZEL 2PYEE 1CFNB 1GAFL 4NRYB 1T66D 4U1NA 1D6EB 1R6VA 1JWUB 1Y6KR 3S36H 2VL4A 4FQHA 1XGPB 1P9MA 1JPGA 2PXYB 4JN1L 1A9BA 1MAKA 4F57H 4OZFA 5F8QC 4X98A 2AP2A 2HMID 4R3SB 1JTPA 4LCUB 5A2JH 3IFLH 5IB1A 2JB6A 5E08H 3B2UC 3G5VA 4NO2A 3UYPA 2XY1A 5KSAD 3KPTA 2F58L 3VMOA 1F6FB 1I1YB 1G7PB 1NCTA 3BDYL 3L7EB 4D0BA 5EOCJ 5I76A 2A9NH 2Y7QB 5DC4B 4EBQL 5CSZB 3MV8A 3RL1B 4ZXBD 2VDLH 1CE1H 4Q97A 1EFQA 3N06B 1NCWH 4M9OA 2ICWJ 3T77B 1YY8B 4OD2B 2R0LL 3LKSA 4N0UE 3KPLB 4XHJC 4JDTL 2Y4SA 1UB5A 5J11B 3UPRA 4DGIL 3C09C 3MRMB 5FGBA 3TO2B 1LP9B 2XWBB 3TCLA 2VZ3A 4P5KA 4QRTA 4XCFH 1XR8A 4PRHD 2AJZA 1IAOA 3B4NA 5IW6A 3WIHH 1PLGL 2FJFA 1SJHA 1MCEA 3B9KD 5IFHH 3T3PF 4KRPC 2VWEC 3BN9D 4MA3A 2OTWB 2P5EA 3RU8L 5LJYH 5KVMC 5BVPL 4ZPVB 4RNRA 4NC2B 3TFKC 2F54A 3U0WH 4X8XA 2B5IC 5J8OA 3FRUB 1TVDA 3X13B 1MHEA 4X4XA 1RD6A 2NY6C 2MMXA 3VXSB 1WGOA 3IGAA 2ZG1A 1MRCL 4YUEH 2W59A 2W9DH 3HE7B 3O4OC 4FXGB 1FPTL 4X6EB 4PG2C 5JPNA 1F8TL 2E6JA 4YDLB 2YXFA 2WP3O 1A47A 2D7TH 4KUZH 1YQVL 1RU9H 1BQHG 5I1AA 4PJDE 1CLZL 1V5JA 3FO9B 4Y4KC 2UWEA 1C5CH 2X4NB 5I15H 1EHAA 2X4UA 3D1MC 2JK5B 4X83A 5BXFA 2OP4L 1WBZB 4KKAD 1D5IH 4LGSB 4PJBE 4O5LL 1DUYB 2F54D 4GSDH 4HFWA 1UXWB 5GRWA 1RMFL 4TUKH 5E6ZA 3MBEC 1OB1B 5B21A 1KPRB 1XGTB 4CVUA 1OP5K 4WUKL 3BOVA 4HLZG 4PP2B 3RWHB 3Q5YA 5J6HB 4UUJA 2VNCA 4ZO7A 5JNYB 5KANI 1F11B 1R24B 4L3EB 3WFHB 4P3DB 4WDIB 4HCRA 4NFDA 5LG1A 1T2XA 4M48L 5IVNA 5FYJL 4F7CB 1FDLL 3C8DA 3H7BA 4PP1D 2FZ3B 4D9LL 1OVZA 1N64H 2RBLA 3SQOL 1PKQA 2C1PB 3CC5A 1DQDL 3UJIL 4ZAKC 4NO3A 1QFWH 1KT2B 4TUOB 4J3OC 4HPYH 4LBEB 4OFIA 1KIQA 4HMEA 2B1HL 3RRQA 3MV8E 3TGXA 3QIWD 4FA8A 2BJMH 2CDEA 2ADGA 2V9QA 2WK2A 2NY2B 4FP8L 3MA9L 3PV6A 5IW1A 3VXQA 4LRNH 2DWDA 3T2NL 4WI6A 4CRPA 5IEHA 3L3KA 3SDXA 3V6FA 4WFED 4H1LA 4NHCL 5TFSL 3VJ6B 4K3JL 2NY3D 2P47B 3QUKA 2G75B 4QHNA 4DCQB 2P5EE 5DHVA 5FHBL 2GIYA 3LZFL 1KNOA 3HAEA 1DN2A 3AB0C 3CFCL 1U8QA 2F54E 1P4LB 3R8QA 3VDAA 5KS9A 3F7VB 5FA3A 1M7DA 3BO8B 5FO9A 1OPGL 4LDLB 1CFVH 4LHUG 3VMNA 2VITB 4P5TD 3O8XB 3ILPB 4D9QE 1ACYL 2DD8L 1S9VA 4EJ1C 5ISZA 3FT4B 4B7LA 5MEPA 4U6VL 3Q2CA 3CLEL 1AJ7L 3KWWB 5C0NC 1XF2B 4ZPTB 5ITBH 2F5BH 4YK4B 1DE4B 1NCUA 1LP9F 1DEEB 3FZUD 3OZ9L 2UWEE 3R0NA 5MEOB 1RJYA 2Z31A 3QCVL 4UNTA 4LPYA 1IKFL 4DZBA 5J9PB 2X4QA 4UV4L 4OBRA 3VI3F 2DQCH 1QLEH 5ELIA 4YXLL 5ID0B 1YEFL 2L7UA 1RUAH 4FMKA 1GZQA 5KVEH 1MCOL 1LEKA 5E5MA 2NLJB 3OR6B 5HHNB 1KFAH 3QUYB 1I85A 7FABL 1AP2B 2BNRB 2R15A 3I85A 1U8PB 4YHLL 1DLHB 2B0SL 1HXMB 2R56L 3VGEA 1JGVH 4YPGA 3ROOB 1NJ9B 1AXSA 3IFNL 1CDGA 1PKQE 1S78C 1S9YA 1X5XA 3EHBD 3UTQB 1A6UL 1U3HA 3L9RB 3UXFA 5IHLB 2E7LC 5TE6H 1LK3H 5CD5C 4PGEB 3ARED 4XPGL 4Z0BH 1DN0A 4F9LC 2K7QA 3SY0A 1KIRA 5ETUA 4KI5E 2D9QB 1YEDB 2C7UB 1LO0H 5M7QA 4CW1A 5B8CA 5AEAA 1MCSA 3C5SA 4KAQH 5EZJA 2YS4A 4RMSA 4TSAH 2V5TA 4AT6A 5FHAH 3SDXE 3DGGA 5DJYA 1O7SA 2OJZL 3JTTA 4LEOA 2ORBL 3MLWH 4Z95H 5MI0B 2J2ZA 1Z3GL 3CPLA 5F89A 2X1XR 3HHRB 4Y5VA 4HCRH 2MHAA 3O6LH 3VXUB 1C1EH 4R26L 5D1XA 2EDKA 4HKZB 5GS2D 1A7OH 3VWKD 1UFUA 3V6OC 4UV7L 4U7SA 4EUPB 2HRLA 1DBKH 4Y5XC 2DF3A 3DYMA 1I9JL 4Z9KB 1HWHB 1KUMA 4QXTA 3I75A 4OZHA 1NQBA 4OCYL 2JJVA 4MZ3A 3NOIA 3TA3C 1P69B 4D0DA 4TPRL 3OAUH 4ZUTB 1N6UA 4LCYB 4AYFA 1FO0H 5L9DL 4AEEA 4LIQL 5ISZE 1WT5C 1ULVA 4XMKL 2DMCA 2FEEI 3FT3A 2I9LA 2V5SA 2AW2A 3NCMA 4TULH 1CF8L 5HGAA 2AJUH 1XCQB 2DJ4A 1DQQA 4PUBH 4F7PA 5C8JA 1L6XA 3VE0B 2OSLB 3C60A 4WO4B 1QYGH 2FJHA 3DV6B 5M95B 5IOPB 4R8WL 4PTTB 3TIEB 3JWDC 4ZUUA 4L8DA 5C6WH 3MJ9L 1GGUA 5DHVH 1QA9A 4WWID 5BOPA 1HEZB 4S0SD 2GITB 3HAEH 5T1LA 2RIKA 4QRRA 3SDCB 2DICA 3ZKXC 1N3NB 3MLSH 4IRZH