4QHKI

Uca (unbound) from ch103 lineage
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
222
structure length
218
Chain Sequence
VQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASLPVNAYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords UCA heavy chain
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 218
sequence length 222
chains with identical sequence K, M, O
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF07654 C1-set Immunoglobulin C1-set domain
I PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhkI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhkI01
1S5IL 1LMKA 1P1ZB 1TCRB 3OAZK 4Q7DA 2ZSVB 3S97C 4WV1C 1FBIL 1UH4A 4MQ7A 4UQ3B 4OFDA 4NUJB 2ADJB 1UB6B 2QSCH 4TPRL 2ZUQC 1PDKA 4POZC 5I8CA 4CGTA 5I73B 3KS0H 3RBSA 4JREB 3PWNA 4YIQA 2FBJH 1P7KB 4GXUM 4IOFC 4NM8H 3EHBD 4LNRA 1BD2E 3BAEL 1T1YB 3UBXI 3MZGB 1RZIA 4LASL 1MAKA 1BVLA 3HE7A 1WC7A 3KDMB 2IPKB 4XP4H 1VESA 4WTXA 4OT1L 1T0NB 3IF1B 3P4OA 4IOSD 2G5RA 5MHSD 2CDEB 4Z0XB 3RNKB 3U0TB 3EAKA 4E5XA 3MLSH 4KVNL 1UQSA 1L0QA 5ICXB 1CE6B 4W4OA 5F3HA 1GGYA 2CRIA 5GZOD 4X4XB 2AS5M 1VFBA 2E9WA 2H26A 1FVDB 3V4PL 2B0SH 1U3HA 3IU3A 3PJSA 1GC1H 2Y07H 4JKKA 3AC0A 5KOMC 1MVUB 3QIBC 3QAZC 1ZT4A 3TH4T 4BFIA 4JG1H 3EYFB 4IHOA 4NKOB 1SYVA 4EIZC 1SMAA 3DOSA 3SGEH 2IQ9H 4LFHG 3QIWC 3O6KH 4MLSA 4PREA 3G5XB 4JO4H 4HH9A 4AZ8A 3VXTA 4JY6B 3O2DL 3SCMA 4F7CB 2JCCE 4RMQA 4UI2A 1YEGL 5K9OB 5IHUH 5A1AA 1OT2A 5CEZE 3B9AA 4FTVD 3F12B 5FDYA 5FECB 4LSPH 2OTUB 1HEZB 3IVKB 2F5BH 1WBZB 1NGQH 2QADB 3QEHB 1DL7L 1QNZL 4PJBE 5FO7A 4KHTH 3SDXE 4IDLA 2OQJB 2NTSP 4JB9L 3IFNL 4L9DA 2CDGA 2D7MA 3ARBB 2ESVD 3KLAA 4MNQA 3M1BA 4TUKH 2DICA 2HJKA 2FYYA 4GG6E 3G6JB 2C3WA 1BAFL 3MTRA 4H25A 4NCC1 5CP3H 4U6TA 5K93A 3ZDXE 1YJDL 2JJSA 2V7NA 5L2JB 1UJ3B 5CBEA 5EIVA 3WLWD 3OPZH 1HSBA 5H37H 4LSUL 4M8QB 1NFIB 1HXYB 2HVJA 2AXFA 2FO4A 1ERNA 3RNQA 5K33A 4ODSL 4XBGA 3OKOB 1MI5B 3OZ9L 5I15H 3P9LA 1FZOB 4MNQE 4LEXH 4R90L 3NTCH 1BFVH 4LLWA 1JTTA 3LV3A 4OFIA 5EC2B 3ZZ1A 3ARSA 5D1XD 3DV4B 2ZG3A 1JZ3A 3EFDL 2IAMB 5GJSL 2DQHH 2N7BA 2X70B 4NYLB 3RWGA 4OGZA 4HWZB 4Y19A 4YBQD 3UPRB 4PLKD 2LTQB 3RX5A 4OZHA 4XI5C 1GOFA 5ISZA 4CVUA 3FO0L 1U8JB 1QSVA 4MA8H 12E8H 4H1LA 5HHPB 5FGBC 1NBYA 5I2IB 5FAAA 4OV5A 2VXQL 5DQJB 1UGNA 2X4OA 3KPPB 5DJ8A 1S9WA 1A7NH 5J9PB 4PP2A 2X89A 1TIUA 3D2UB 4HBCH 2EDBA 3TVMB 3BRFA 1AIFB 3GKWL 4PJDB 3PWUA 5IBLC 4YQXH 2MHAB 4GAYB 3BZ4A 3TC9A 2P48B 4D0BA 1RHHA 4DJMA 5IQ7H 1T7YA 4Y19E 3SO3B 3H7LA 5T1DH 3S88H 1XIWB 4NNXA 2UUDK 4YX2L 5ISZE 4ELMA 2NY6C 3S35H 3QO0B 1YECH 2ADGB 5EU6B 4OLWL 1F3JA 3Q1SH 4G9FD 4D9RE 2WV3A 1UVQB 1MPAH 3VA2C 3H3BC 4JN1H 3ILQC 1YYML 5KZCD 1A1OB 3ROOB 5I74C 1ZE3C 4X5XB 4OD2B 2HT4D 1MREL 3SGDI 3QUZB 3TV3L 1EFQA 4AMKH 4ELME 1XZ0A 2ED7A 4GKZA 3VXQA 3REVA 1FZKA 2H41A 4KKLC 1WBYB 2HH0L 2NY7H 4KKBD 1IZJA 2H3NA 3QCVL 2Z31D 1X5XA 1KJ3H 4WW1B 4U6HB 1GGBL 1A3LL 1NEZG 1OAXL 3FO9B 4HS8H 3IDIA 1PG7W 1LWRA 3QCTH 4FXGB 2X4NB 5DGRA 4AM0B 4M4PA 2DN7A 5BZWB 2ADIB 5GS0L 4NCC2 3CIQA 3MRIA 3FQWA 4JFXA 4KHXH 3T8XA 3UTTD 4P3CH 1KC5H 4XWOD 1EEYA 2OJEA 2OLDA 1KEML 3IFLH 2YRLA 5E8OB 5D7IB 1QKZH 1JGDA 5E2JA 2X4QA 3TZVC 2G9HA 3OKNB 3VFMB 4CN4A 3JV5A 3LSOA 4DKFL 1JPSH 1YPZB 5FXCH 3V0VB 4HX1B 4PGCA 4FXLA 3L7FA 3A6CL 3WS3B 4FQJL 1Z6JT 3T77A 1CLCA 3UBXA 2NR6D 2A6JB 2FBOJ 2B20A 5INCA 5I19H 3MRFA 3T3ME 2G75A 3P11L 3B9DA 4XBEL 1VENA 1I1FB 5GHWH 5F7UA 4JO3H 1KTKE 1FPTH 3HC4H 2HLAA 2X41A 1MCCA 5C0NC 2A83B 3DSFL 2Z4QA 5DD3L 2X42A 5GZND 2XWBB 2D7QA 3MRRA 1K5NB 3SJVB 3DX9B 3GMRA 4QCIB 5ERWA 2VDQL 5HDQL 5FYLH 2YKLH 4JFFB 3P9WB 4PIRF 1JMZA 5DVOA 1JN6B 2GSGB 2PXYD 3EGSB 2DAVA 5FK9B 3VXNB 3KWWB 1UXWA 2ZUSA 4YDKH 1VCAA 2IPTH 3EBAA 3VXRD 4ETQB 3O6FD 3RAJH 4MDJB 4GQ9H 5D4QA 3DMMC 3IU4L 4XT1C 1I3RA 1PD6A 1RUAH 4JO1L 2XNAA 2QR0B 4RIRA 3MV9D 2FWOA 3K8LA 3QG6A 4RGMC 3ZHLA 4ISVA 3NMEA 3VFWA 3DYPA 3K1KC 2ICES 2CKBA 4M62H 3TPKA 2R69L 3WNLA 2OTPA 3P0YL 4YBHA 1OGAD 5C92A 1T83A 3V0AC 3VA6A 3OR6A 4W6YB 4RBPK 2AJXH 5HI5C 5GSVB 2VDLL 2XIDA 1IGYA 3CX2A 2VMFA 1GGIH 2W9LA 4Y5XB 1IL1A 1PY4A 3X11A 1NCWL 3QUYC 4ZOEA 2BDNL 2DLHA 2PTTB 4UT7L 5C0AD 1JF5A 5D6DC 4R7DB 2ARJA 5KSAA 4KDWA 4EOWL 1JWUB 2VLLB 4X80L 4D3CL 4N5UA 3U4BH 5JR1H 1AQKL 1CR9H 5CINL 1IQDA 3DETD 1DUZA 3D39B 4K3GA 2J1KA 2DWEB 1EGJH 1YMHA 4MCZA 5C09D 4P5TB 4NRZA 5IJVB 1A3RL 1CTNA 1P7QB 1GGTA 3CSPA 5DVMA 3E2HC 4NQEE 4X6FB 5BS0A 3HE7C 3LRSA 4UDUA 5CBAA 3BGMA 1SY6H 4X99B 1U2CA 3HI6H 4X4ZA 3QZWG 1E4XI 1YDPB 1FH5H 5CZVL 3ULVH 4APQB 4UQ2A 2MFNA 4LCUA 3C5ZA 4MD5B 4G7YL 3TYGH 1KB5A 3EO9L 4KKNA 5KSUA 2ZUXA 3IETB 3MQIA 2ZPKH 4W4OC 1OTSD 1CICD 2VZVA 25C8L 4IRJA 2RJMA 3WO4C 4BQ8A 1U3HC 5HHNB 3BMVA 3QUKB 1HOCA 2DTMH 3FB6B 4WNQA 1J1PH 1FL3A 5IG7B 4JG0H 3HNTH 2AJVL 4PGJA 4W4NA 3DX6B 3TBSB 1UWXK 3ABZA 1Z9OA 1TDQA 4NNPL 1X7QB 1JZ8A 4M1DH 3V6FB 4GKSA 4P5KA 4FQQA 3SKNB 4XRCA 3GNML 4EXPX 3SCMC 4ZD3H 2V9QA 4LIQE 5IQ9A 5E2UH 4OZ4A 5L8KB 2FR4A 3WN5B 1FFNB 1ZHBA 1F4XH 1M7DA 4YGVA 2BC4B 2EC9T 2OL3L 4Y4HA 3VGAB 2Q7YA 3VWJB 2B4CC 4OLUL 1R3KB 3AB0C 4PRHA 2LV4A 1NAML 2C1OB 1EERB 1YEEL 4P9MH 4PJHA 4S0TD 5SWZA 3CCHB 3I6KB 3VXUB 4HWBH 2H45A 3D3VB 1LP9A 4EQ2A 1AGEB 1S7TB 3EYSL 2R8SH 5KJRL 1CFBA 1G7MB 1KN4H 4QHLB 4Z77A 1NBQA 1VPOL 2NW3A 1F42A 3MA9L 1NBVH 2JJSC 4HIIA 1CVSC 5F7FA 3WFEL 4XMPH 4OCXL 4PTUB 4PRHE 5HHQA 2NXZB 3F7VB 3GSRA 4NJAL 2EDJA 4PYHA 5FIEA 2COQA 4PJHE 3KLSA 4ONFL 3EYQC 5BV7B 3FONA 1Z3GL 1LP9E 2Y7QA 5LCVL 3SY0B 2BOBB 5AUMA 1AKJD 1Q9OA 2WM0A 5EU3B 2ZUWA 4X5WA 3CFKA 4Y5YA 3LB6D 5IB3B 4N5ED 5SWQA 4NO0D 3HI1B 3GMPB 3N1GC 3IDUA 3V0WL 4X6DA 1IEHA 2DBJA 3ARED 4HS6B 4JQIH 4W68A 5MENB 2Z91B 5TGBB 2VIRB 5IB5A 3MNZB 4XPBL 1H3PL 4KU1A 4L4VB 3KJ6L 5F89A 4LMQI 2F19H 3C8HA 5EORL 5F9DC 4DK6A 3BUYB 3OSKA 3PWPD 4OFPA 4K2UL 3QHTC 1UCBL 1B2WH 3PWLB 4X6DE 1N4XL 1J7VR 3U0PB 1G84A 2VWEC 4D8PA 3EJYC 2BHYA 2XN9A 2ZCLH 4M8VA 3WIIL 2C4XA 2J8HA 5KS9F 4IJ3B 2WNGA 3KPLA 2VZ1A 2OYPA 2YC1B 4PGBA 3O2VH 2Y06L 2OJZH 1CFQB 2A1WL 1YEKL 4XPAH 5AAWA 5HDBF 4X9BA 3CXDL 1CBVL 2AJSL 1I4FB 2VDPH 1D9KA 1ED3A 4PTTB 32C2A 3GIZH 4K3JL 3GBNL 1QO3B 4N0YH 4U7KA 2EYTA 4RFNB 1XF4A 3MRQA 2XN9E 3MV01 4B5EA 4WU5B 4MGXA 3MV8E 1EIBA 5GS0D 3OKMA 3HCVA 3S36L 3L3GB 3STBA 4PBWD 4FXKB 1FZJA 1TJHH 1EFXA 4YXKL 7FABL 3H9SA 3OKDA 2QTEA 3KYKH 4YHZH 1LK2A 2AEIT 4FQPA 5EZJA 4AENA 4GS7B 1FLRL 2MOVA 1DQLL 1O0VA 4I18B 5D6CB 1EJ6A 4POZD 5DJ2A 3DXAB 3ARDA 3BEWB 5HYFA 3OR7B 5DDHB 3KYMA 4POUB 5AZ2H 3U7YH 5B3JF 3X3GL 4IOFD 2HVKA 4OF3A 1AGCB 3B9KB 4ZUVB 2A73B 3MRPB 5E9DE 3O4LA 1IC5H 4JFEB 4PRDB 5BRZA 3OGCA 4H20H 5ALCH 3B3IA 4NT6A 3S35X 1CD1B 4TSBH 4JM2F 2HTKC 3MRJA 3IAGC 3W5NA 1S8DA 3F65A 1KTLB 4ZS6C 4KKCD 1QHPA 4PG9A 5B39B 3MRHB 4S2SA 4KQ4H 3EO0B 1PX4A 2E8YA 3GI8L 3QI9A 5HHOD 3BW9A 1QLFA 3O4LE 4MQTB 2A9NH 3J8F7 2BCKA 4K7FA 1ZWIA 4U0RB 5E6ZA 5IBTL 3QIBD 4X7DC 1X6LA 1T89A 5I71C 4Z7VA 1ZLSL 3DO3A 5CKAA 2ATKA 1YNKH 5DJYB 3U7WH 3QIWD 1KIRA 1GZQB 4YHIA 4NQUA 3WE6A 1GIGL 1A4JA 1CE1H 3L3DB 4G9DA 4HV8A 4M9OA 5EZLA 2B8OT 1CGSH 3TT3L 4HQQH 4JLRA 4Y4KA 5FGCB 3DRQA 4YHLL 2AEPH 4PJAA 3B5HA 4R26L 3CH1B 5EN2B 3BN9D 4UTBL 4P46B 3R4DA 5GRJH 4DUWA 5JORA 2PKDA 4N90D 4OUUA 4C56E 1ZLVH 4G9FB 4Z7VE 3LH2H 6CGTA 5L8LB 5KN5B 1A64A 2MJWA 2W91A 4PB0L 5JDJA 5KZCB 3NIDE 5GGTH 5E6IB 4LPUA 2VXSL 5A40E 2E7HA 1RIVL 3TA3A 2Y36H 1S7XB 4GXVL 5JXEA 4OZIF 1QQDA 2R0ZL 3LY6A 2WIIA 5E94A 2YPKB 2XKUA 3ARFB 4PJ5B 1JZ5A 4PJAE 1T83C 4POYA 1IMHC 2O93L 3WUWB 4Y4FA 3HFMH 3VCLA 4HLJA 3ZLQC 1IEBA 3BHBA 3O11A 5F88A 2NPLX 4KJPD 3ZYZA 4G6FD 3RFZC 2V5TA 2BVYA 1P4IH 2CLZB 1WWCA 4MA1C 3PGFH 5KSAC 3MNVB 1NUNB 2ZUVA 1U8QA 3C5JA 2OK0H 3GMMB 5J1AA 5IVXA 5CP3A 1NEUA 5C0EB 2GKIA 5JW3H 4QHNB 4EDXA 4ENEC 3P30L 3AVEA 1MHEB 2JKXA 3L9RA 1LE9A 2NTFB 2QSVA 4G5ZH 1I3GL 4FQCH 3S5LA 5TE4H 1RZKC 3BKML 5I0ZA 1HINH 5HTSA 1MUJA 4RWYL 4LVHB 4YHOL 5DQDH 4XI5D 4ORZC 5IVXE 1WZ1H 1NDGA 1U8MA 4MXWL 4I0PA 2PUQT 3CNKA 2QHRH 2D31A 2XPGA 4Y5VB 4YK4C 5F6HI 1KIPA 1KPUA 5LBSH 4Z7WF 4C4KO 1F6AB 3C5ZC 2FH6A 2IH3B 4LPTA 3U9UB 1MAMH 1TLKA 2R4SL 1A0QH 2RFXA 3WCYA 1KJ2B 3DVIA 3L7EB 5IBLD 4IRJC 5DD6B 4UIMA 3SE4A 3EYVA 4N0FA 4CVXB 4GXUN 35C8H 1H5BB 1SHMA 2GJZA 4UINL 1XF2B 2NX5A 3MROB 5BMFL 1Z0MA 5CZXC 2NY6D 4EUPB 3TBVB 2HFEA 4YDJA 2UYLA 4LLUB 3LKNB 2MWCA 2CIIB 2GT9B 2PXYB 1MCRA 2AQ1A 5EOCH 1J0KA 3VI4F 1JPST 1F45A 3IXAA 5FM5M 4TSCH 5KW9H 1F11A 5IFAH 4Y4HC 5TPWL 1T7ZA 3U9PH 3FCTB 1PZUB 1BREA 1BEYL 4HIHB 4KKLD 3GSNB 3PHQA 1OGAB 4M6OH 5FDWB 1ZVYA 5EOQL 4J7RA 5EU5B 2HFTA 4LLAA 2N56A 1PAMA 4WJ5A 4L3AA 2BY3A 3VXOA 1M6OB 3OXSB 3G5YA 1RVFH 1JCKA 2HRPH 3GB7A 2VLKA 3QPXL 4PJ7F 4CJ0A 4NP4L 1WWAX 5F3BA 5IM7B 3RL1A 5GGSA 5BVJB 1JV5A 1X9QA 1N6VA 5GRVL 1LEIA 4I77H 1MSPA 5AYQA 4JVUA 2IADA 2GTWA 1RMFH 5TF1L 4C55A 3S36X 1ZS8B 1OAZH 3KXFA 1AQDA 3TZVD 4C57C 5DUPL 2FZ3A 4X8XA 1MRFL 3DGGB 1BZ7B 4Y5YC 3PL6A 1HHIB 1JGEB 4F3FB 1BM3L 1U95B 3S34L 2VLKE 5E5MB 4G8IA 4JFDD 4OFYA 4D0CB 2IBBA 1Y6KR 4RZCA 1M7IB 5HHVL 5BCAA 5ANMB 3OXRB 3NAAL 4PJGF 4KJQC 3Q6FB 4LSSL 4RRPA 1DQDL 2OTWB 2ZOLA 3V6ZA 5C0ND 1JL8A 3KLDA 2DIBA 1N64L 1SJEA 2HG5B 3LD8C 4LHUD 5TJWK 2YPVL 2GK0A 4ZO9A 1I9RH 2WBJA 4HWEL 3ARGA 2VXVL 3C87A 5E99H 4CADB 4QGTA 2YXFA 1PFCA 2Z35A 3OAUL 5C0DB 5DYOB 3RVUC 2DI8A 4HZLB 1J8HB 5TF0A 3T0EA 1HSAB 4GO6B 1U9KA 1FYTB 4XNQA 4UT6H 4Y2DD 3BOVA 3VFNB 4JY5L 5E03A 3DMMD 3CMGA 4KK8C 1KLUA 5C3TA 1D9KC 1YQVH 4GKNB 1F02I 3BT2L 3QJFA 4RAVB 1G7QB 3IXTA 4I3RH 3BPLB 4HK0B 1JRHH 2ZOKB 3VG9B 1ODAA 3BJ91 2I60H 2DWDA 2DBLL 3QQ4A 5HI5D 3T0EE 4L8CB 3TWCL 1T20A 3V52H 3R06A 1G6RH 3WHXB 3OF6A 3QUYD 3JWDC 2ITCA 2FH8A 2SEBB 5DMGC 4DTGL 2YPLA 4OCYL 2Q3ZA 5JW4R 2YBRB 4RNRA 4XP5L 4XP6H 5FYLE 4J3SA 4YZFF 3UZVB 1Z2KA 5GISL 2JB6A 4DW2H 5IHBA 4OGXH 3ARDC 3LEXA 5DRZB 5I1DB 5IVNA 1J8KA 5JXAL 4KROC 4HXBH 1CK0H 2VN7A 1H8SA 3GHEL 3QDAA 4U1MA 3GSQB 2EYRA 4B41A 2YPLE 3MRKB 5DRXB 3ZE1F 2HMIC 5DMKB 1MJUL 3HR5B 5H94B 3UJJH 1SBSH 4PLNC 5ACMA 3ZKXC 1QLRA 3K81A 3LMJL 2X9XA 3HRZB 4XC3L 4CAGA 1LO5B 1ONQA 1T2XA 1F3DH 1RZJH 3QI9C 4JPWH 5EBMB 1XF1A 1MIMH 1U8NB 1F97A 1U3HD 3TEUA 4KZDL 4JHWH 3EJZC 4D9QE 4KXZH 3U36A 4PJ9A 1CLYL 1FN4B 5H35A 1SY6A 3PWPB 3EDEA 4X98B 5HYJB 4LEOB 2JCCF 1C5DB 1FL6A 1T89C 4OIIL 5CSGA 5J13B 4ZUTA 2C4FU 5KS9B 5M95B 5JW4N 1WCBB 5K9QG 3DVGB 2J12B 3MLRH 3S5LG 1D7FA 1ND0B 3SCMD 1GC1C 4XCNB 3OJVC 1UWEH 1RJLA 4PJBF 4TVPL 5J06A 3SDXF 4Y4KC 1KB5L 4KTYA 4CW1A 5ID0B 2FEEI 1WZLA 2FATL 4HHAA 1MFAL 4QRUA 4XNYH 3RGVA 5MP6H 3UJIL 3MXWH 5GRUL 4GG6F 1UCTA 2BVOA 3ULVE 3PG2A 1K2DA 2CLRB 4NQCA 3ZDXF 4PR5B 4X7SL 2D7NA 2FHFA 5CLWA 5HPMB 3T09A 5AZEL 3TA3C 4Q74A 5J57B 4WFGD 1QFWM 3QCUL 5JXEC 4MNQD 3TNMB 5HYQA 3S4SB 1MCPL 1CFNA 3QUML 3IDMB 2R56H 4ZFGL 4P23B 1RQ5A 3DI3B 1LNUA 3N85H 3C60A 3IRPX 3EOAB 1A6AB 5JQ6H 4MSWA 2DQJL 2JB5L 4OAWA 4YWGH 4U1KA 4WV1B 5HD8D 2J88H 4NQCE 1DQJB 4HWBA 5C0IB 1RUQH 2X2YA 4FP8L 3MCKB 3V79C 3EYQD 1HI6A 5ACZA 1MFEH 5IEKA 4YC2C 4HKZA 5C0FA 1R3LA 3FN3A 5GS2D 5LAXA 2BJML 2F8VA 5ESQA 5C0BE 4JM2B 4WI7A 3KJ4B 1S7RB 4GJTB 3MYZA 4KRNA 4ERSL 1MLBA 4L5FH 3VFVB 3EOBB 4GH7B 3DROB 3T0WA 2AJUH 1G6VK 3B8YA 3UTZA 3O4OC 1Q0XL 3GRWL 3AS1A 2YSSB 1ZHKA 3GSUA 3N1MC 4WFHE 4GAGL 5ISZD 2A6KA 1O7VA 4J8RB 4LCIL 1IM9A 1LEKB 4I0PC 4X5LA 5HHOB 2JJWA 1V7NL 4YAQB 3W2DL 2B1HL 4D9RD 1SJXA 2AJYH 1I8MA 2X89D 1KBGL 2BVPB 5TDNA 4DN3H 3QAZB 5IFJB 2WWMC 5ITBH 4UDTB 4UMGA 3SE4C 2P49B 4TOYL 4IIQB 5HXMA 2OS7A 2OZ4L 3QIWB 3V7AG 5I9QB 1LO4H 3T1WA 4WUKH 3FB5B 3MGAA 5CILH 3OX8A 4B53A 3GO1H 3BKYH 3TJEL 1XGQB 1JPFA 1XF3B 3MRCA 3SKOA 1HIMH 3QDJA 4HIXH 4FNLL 4ONGL 1HH6A 1M05A 2UZYB 1QTYT 4HW6A 1A8JH 4MD0A 5FCUH 3VXSD 1AGFA 1EX0A 3TN0B 1EAPA 3P0VL 3S37H 5BOZG 4OZIB 3O3AB 1N6UA 3NCFB 3P2TA 4MJ6A 4ZUSB 3OKLA 4XNUH 2R0KL 1FC1A 5HI4C 2BVTA 5CIPH 4PJIB 2VLRA 5FF6A 1N0XH 4Z0BH 3AXLA 3OBAA 4NRYA 4NQDE 3RKPA 4LF3B 5HJ3A 4L3CA 4XNZB 1U8HB 2CK2A 4PJXE 2F54A 3LEVH 3QDJE 2AEQL 1ZMYA 3QXWA 2BNRA 3PIQA 3C6SA 4LSTL 4FABL 4PRBB 1SMOA 1XGPA 2ED9A 3D85A 5DHYB 3DX7B 1OPGH 4NKDA 4WY7H 3GMLB 4HJ0C 3FQNB 4QXWA 4YLQT 1MF2L 4QF1A 1OP5H 1D5BA 3DUSB 1TENA 4JDZA 1GGCL 2IQAA 2C3VB 3JWDL 3CGTA 4WCYL 2F54E 1Z5LA 1KGCD 4PBXA 2BNRE 2HTKD 3FO2B 2GI7A 1P4LA 3Q5TA 4ZS6D 4G42B 3T3MF 3LKOB 3RY5A 3WIFA 2EO9A 5BV7H 3UTPE 4JCLA 5INDB 4K71C 1XR8B 2FEDC 4U1NA 3GJFB 4KQ3L 1EBPA 5IKCB 4Z7WB 3E6FA 2PR4L 3O8XD 1YYLL 4NQSA 5CCKL 1FSKB 2XWTB 4R8WL 2IG2H 1CYGA 2B1AL 3H9YA 3NCYP 3ECBA 2UY7A 1IGCH 4D9LH 1OAYH 1CL7H 2W0KA 1INQB 4XCCH 5I8KL 3TIDA 2QSCL 2ZCKH 4NZDA 3HNSH 5L0QB 4G6JL 4P2OA 4FS0A 4ZS7H 3SKJH 2WBJC 3ARGC 2OCFD 5A2JH 4NM8L 4ZNEA 1B0RA 3JTSB 2NY6B 5GIRB 4ZAKA 3T0EC 4H0HB 3ZTNH 4PB9H 1KJMB 3V5HB 1S7QB 4OI9A 1ZLUK 1AR2A 3I02A 1DR9A 4F7PB 5HGBB 4OGYH 4XPHH 3BH8A 5EO1A 1VACA 5KANG 5FOBB 1E4XL 4AH2B 1A21A 3TCLA 2ZCHH 4F2MB 5DJZA 4F7MA 1JRHI 2BMKA 2YD3A 3CZFA 1CD8A 1Q9KB 4XCEB 1A7QL 4WUUB 4ZPTB 2HWZH 4O4YH 1KTDA 2B0SL 1MEXH 3WIHH 5F7MC 2Y5TA 3JUYA 2Y07L 3LOWA 3QULB 3AMLA 4ZNCD 4YDVB 3O41B 5D70H 4WI3A 1T21B 5GGTA 3G9VA 2DIJA 4PJCA 1MHPH 4OI8A 1D5IH 3P0GB 5KSAD 1WAAA 3O6KL 5TDPB 2E3VA 4NRXB 4UAOB 4GUPB 3L3IA 4Z7NF 2I07B 4YO0B 4C54A 2OM5A 1SEBA 4ENED 1VFAA 3UTSA 4LRNH 1H0DA 1NL0H 4GRMB 2E6QA 2F5BL 3QWQB 1NGQL 3G5ZA 4QXTB 3VGGA 2W9EH 2BZDA 3TZVB 3IDGB 1CXKA 1WAAE 4KHTL 4OCWH 5BS0D 1U3YA 3KYOA 1D5XB 3MSPA 4X9IA 5JDSA 1LQSR 3MCG1 4ZXBA 2VDNL 4GW5B 1P1ZA 3UTSE 3VFRB 2ZSVA 1F58L 4TVPD 3C5ZD 4NGHH 4UQ3A 4ZUUA 3HNVL 2ADJA 3L5WB 1E4KA 1S7UA 3BGFC 5HGDB 3MRLB 2EIDA 4IRJD 1GAFH 1JYVA 4LCYB 2PYEE 2V17H 3OPZL 1JIBA 4JPIB 3FFDA 5KVMC 4ODWA 4PJ9C 4NO3B 1FAIH 1T03L 3QG7L 5ID1B 1CDBA 1KJVB 1T1YA 3D9AH 5CZXD 4NN6C 3ULVC 1KULA 4LEXL 3NTCL 1KCRH 1T0NA 4X4MA 1BX2B 3ESUF 5L7XH 4JDVB 1QRKA 1GYAA 3IF1A 1U8KA 3WDHA 5D1QD 2ZKHH 4CJ1A 1EHXA 1UACL 1IGIL 2CDEA 3MLXH 1NEZB 3BDBA 3GMNA 5GGUA 3WLBB 1NUGA 5D2LA 3RNKA 5IIEB 2X7LA 3F8UB 5D8JH 1QSFB 4S1SH 1NJ9B 4X4XA 2DQHL 4Y4HD 5DFTA 3RGVC 2O5YL 4NO2A 4WRLA 3CZJA 3OAZH 4RGMB 1AR1D 1Y18B 1MVUA 4PRHD 1TQCB 2EE9A 2M2DA 1OARH 2HKHH 3QEUA 5SWZD 4X4ME 4G8FA 2V5RA 3EYFA 5F1NB 4OLXH 1BBDH 1MWAB 4F7EB 3PHOA 1SM3H 4FA8A 1A7NL 1RIUH 5D2LE 3UC0H 1SEQH 4HBCL 2PF6A 4YQXL 1N0LA 1YN6B 1BD2B 1SQ2N 4LGRB 2F74B 3WFHB 4JY6A 2RIKA 3ZKMC 4H8WH 4MDIB 1HYSD 4RQQB 1T5XB 1HH9B 5IQ7L 3SE3A 5GSRB 3C60C 5DJDB 2GJ6D 1RIHH 5FECA 2OTUA 3NA9L 4MQ7B 1HEZA 3IVKA 1WBZA 1IQWL 2DMKA 3HZYB 3QEHA 5TH2B 4KI1A 4Y0GA 3Q1SL 4K07A 1RULH 1P9MC 1MPAL 3PWNB 1T7XA 4HAFA 4MZ2A 1J10A 2OQJA 3VMOA 1CDCA 1YC7A 3ARBA 5TFSH 2CR3A 1E4WH 1J0JA 4WI9A 5I30L 5BJTB 1MAJA 1MQKL 3NABH 4AMKL 2X1QA 3HE7B 3JWNC 1WC7B 3H7BB 3CK0H 3U79A 1OD9A 3I9GH 2V9RA 4YFDB 1AXTL 4LOUC 4KJQD 1FGNH 1HXYA 2NY7L 3WSQL 5KVGL 1UQSB 5ELIA 4ESKA 1MI5A 3FFCD 5FV1L 5F3HB 3WFBH 1FZOA 2H26B 2JCCB 5I1IH 4UV7H 4O2EA 4HS8L 1SYSB 3WO4B 3IU3B 3PJSB 4LAQL 3SQBA 3ZE2E 5DR5H 1MJ7L 2CRMA 5EC2A 2CRZA 1HILA 1ZT4B 2D2OA 2XN9D 5GRYA 4JRWA 4U7SA 3RVUD 4IHOB 3DV4A 4C83B 4KHXL 1CT8B 4P3CL 4PJBB 5K9JL 1KC5L 1QYGL 3P4MB 4PREB 3SDXB 2IAMA 1TITA 3UJTH 4NYLA 1QKZL 1CU4H 4HWZA 1L0YA 1MI5E 3UYRL 3UPRA 4KK8D 5C9KA 1UENA 4O2CB 4GG6B 1EZVY 1U8JA 1D9KD 5HHPA 1E0OB 1JPSL 5I2IA 1NFDE 2VR4A 4EUPH 5DQJA 3QWOA 3ZYIA 3INUH 3KPPA 3RY4A 2BERA 4LDLB 5J9PA 3D2UA 3TVMA 1AIFA 2E7CA 3DPBA 4PJDA 5FO7B 1FDLL 3D0LB 1EFXD 4GAYA 4B50A 3H9SD 3L5XH 3W11D 1MCEA 4JO3L 1BLNB 1G9ML 2CDFB 4LKXA 3HC4L 2FDBP 4U3XA 1XIWA 1GCFA 2HJKB 2FYYB 5DMGD 3S6CA 4OFVA 3QO0A 3CDCA 2VDML 3RA7H 2ADGA 4HUWB 5EU6A 3QZWB 5DA0B 5CSBA 2V7NB 5HYSG 5CBEB 1UVQA 3ARDD 4CVWA 5I1EL 2VB5A 3GSNH 2F8XC 5FYLL 1G6RA 2AK1L 3ROOA 4RMRA 4PJDE 4AL8H 3BP6B 5IB2A 2IC2A 2LQRA 4KK6C 2FO4B 4KROD 4X5XA 1FE8H 5EUOE 3O4LD 4K7PY 3P9LB 3MBEB 1YUHA 4IOIB 1T1XB 2IPTL 2EYSB 5BRZD 4M7KH 5FHBH 5EZIL 1Z9SA 4LLWB 4JFZH 4GQ9L 4KTDH 4DK3A 2HMID 1RUAL 3DWTA 3PDOB 3TJHD 5EU6E 1JF1B 1JPTL 4WHYH 4DZ8B 4KWUA 1WBYA 5AG8A 3C09B 2J8UF 1V7ML 3L1OH 2W0FB 5E8PB 4WW1A 3QI9D 3W0WE 3FO9A 2AJXL 2XTLA 1QPPA 4Y19B 4JHAH 3S37X 1JGLH 1GGIL 2I24N 2UUDH 2X4NA 2XZAH 3EJZD 4NC2B 4AM0A 1NBYB 3EOYG 2ADIA 4HIJA 4XXCA 2BNQD 5LQBH 5GRXG 2C9AA 1X44A 2UY6A 3QXAB 4WGVB 4XXDB 4ZTPL 3U4BL 5D7IA 1A5FH 3D18B 1CR9L 1X5FA 1PLGL 1TVDA 1ZSDA 5FM5O 2VXTL 1N7ML 3BZ4B 2EO1A 5DMJB 3VFMA 3OKNA 4UBDC 4P2OC 4BA8A 5F96L 3V0VA 3VJ6A 4HX1A 1RURH 4GRLA 4NNXB 1YY8A 1XMWA 4ELMB 2F58H 3FT4B 1P2CA 3EZ8A 3WS3A 3Q2CA 4A6YL 1TTFA 4ZAKC 1QZ1A 4G8GE 1FNHA 1Q9LB 2A6JA 5IESH 4I3SH 1OQOA 1S78C 5E4IA 1I1FA 1HQ4A 3HI6L 4EXKA 1F00I 4PPTA 1YEFL 3TA3D 4PJEF 1UWGL 5JXED 2A83A 4B7LA 1X5GA 3BPNB 4X7FC 5CJQL 2ZPKL 2IF7A 2XWBA 5T33H 5DMIL 5CEYA 2FECI 4LARL 2YN3A 1ZHNB 1J87A 1K5NA 5EIQA 3DX9A 3SJVA 3V5KB 1TJIH 5B38G 4QCIA 4Y4FD 5D6DA 4ZOCA 2DTML 1JN6A 2GSGA 3EGSA 5TDOA 4NZTL 3DX8A 5FK9A 3VXNA 3KWWA 2H3NB 3NVQA 4PGDB 1A1MB 4Z8FL 4LPVA 2IMMA 1G7JB 1QBMH 3C6LB 5C07E 4G8EA 3U6RB 5C9JB 3OB0K 4ETQA 2QQLL 4OJFL 2DL9A 1EBAA 4P0DA 3MA7A 4MDJA 4P57B 5DUBB 1PW3A 3VMPA 4GW1B 1F90H 3SOBH 4ZD3L 4EN3A 3TESA 3SJVE 1XCTB 3MRIB 1JNHB 3FQWB 4NFDA 1MCLA 2UVFA 3QXUA 1EVUA 3L3JB 3T8XB 2WUCH 2YZ8A 1CLOH 4JFHD 2UZXB 3S7GA 4KPHH 5GSVA 3PF2A 4M5YL 3LRGA 4M7ZB 4Y5XA 4QOKD 2X4QB 2VLJE 4P9ML 1IC1A 4EDWH 2HT2C 1D6EB 4NM4L 3H42H 4HWBL 4XPTL 4R7DA 1VADA 4I0PD 4ZXBC 5LXGH 1TZHB 5K59E 2R8SL 1JWUA 3DLQR 1KN2H 1KN4L 5FO8B 2VL5B 1J9CT 1E4KC 1NBVL 2G2RA 5I73C 2G75B 3BYYA 3NGBC 1KOAA 3OJMB 1F4YH 2XYCA 4JREC 2WWMD 4FFYL 2DWEA 3FT3B 2NY1B 3Q6GL 15C8H 4P5TA 2Z4QB 3AAZB 5IJVA 4QTIH 2WMPA 2NX5D 1EHLH 5I76B 2APXA 1P7QA 1CDHA 3ARXA 1T3FB 4BH7B 4X6FA 2CR6A 4ODBD 2VKXA 2R29L 3GMRB 5BZDA 5ERWB 2YHGA 3GEWB 1X5LA 4X99A 1W8NA 3C2SA 1YDPA 1NC4B 2A77H 4RBPH 5JNYB 3ROLB 4APQA 1OB1A 5C2BH 4FQLL 3HRPA 1QFUH 3RL2A 5ETUA 3RHWK 4XCFH 5HI4D 2VSCA 5HHNA 4XP9L 3BD3A 2JLLA 4WIQA 4W6WB 2F19L 1NCTA 3FB6A 2CKBB 3OKEA 4YFLI 5IG7A 4U1IA 4NWTL 3DX6A 1L0XA 5FV2A 4U3CA 2V2XA 4LDEB 1IGYB 1LD9B 1JZ4A 3EUUA 1T0PB 3QYCA 4HJ0D 1D3CA 5CIPA 2VLKD 4MA1B 3SE3C 2ARJB 4NQEB 3O2VL 1FFNA 3LPWA 1WGOA 3MJ7B 2BC4A 2YD6A 1TNNA 4XPAL 3B2UC 3CSBA 5HSFA 4S1QH 2H2SD 2QADC 3RWCA 3WEXB 1BJMA 1KTRL 1SVCP 5L9DH 2MQ3A 3KXFD 3CCHA 5IMLA 1YMHB 5IFHL 3FOMA 4MCZB 1LDPH 3TFKC 3PL6D 2G60H 4MXQC 4NRZB 5GJTH 1S7TA 2FEDD 2DRUA 2IFGA 4AYFA 2L0DA 1G7MA 4GFTB 4DVBA 4DVRL 4QHLA 2HFGL 4WHTB 4UDUB 4OFYD 3VFOA 1CDIA 3B4NA 3BGMB 3WXVH 2FGZA 2FHBA 3KYKL 1UWXH 2DMBA 4WENB 4ZFOB 4PTUA 1MCKA 3F7VA 3H9ZA 4JAMB 4UQ2B 4QRPA 1PSKH 4P59H 5L6YH 3BP7B 1HHGB 2I9LB 4IRJB 3SY0A 4JFYA 2BOBA 3CX5K 3MMEB 1RZGB 1IAOB 1HOCB 2WBJD 5IB3A 3ARGD 3V6OA 4WNQB 3HI1A 2M1KA 1GHFL 3FAXA 3T0ED 1DFBH 4HS6A 5EIIB 1BZQK 5ALCL 1OLZA 2Z91A 2IAMC 5TGBA 4QRPE 5T1LB 4JRYD 3MNZA 1ZHLB 4L4VA 4KTEH 2FX7H 4H5SB 3LZFH 5FYKH 5IQ9B 4OZ4B 2HTLC 3DGCR 4R3SB 1FFOB 1TCMA 5FYLD 2BRQA 5IV2B 4NKQB 1ZHBB 2JJUA 2E7BA 3V6OE 2CGRH 4HMCA 4Y4HB 3WFZA 3U0PA 2ILLA 2AV7A 3EYUH 3TVMC 4BM7A 4UOW1 1YZZA 2Y25A 3K4DA 4JPVH 1NUDA 5JZ7C 3SO3C 4L4VE 4QWWC 2YC1A 1D5MB 3CDYA 1ES0A 1XIWC 1CFQA 3U7WL 3LQZA 5MEQA 3CFJB 1C5BH 3BH9B 2EEDA 2NW3B 3MRBB 3WIHA 4PTTA 1ORQB 1QO3A 2E7LA 2AEPL 3GMQB 3I84A 4WU5A 1U58B 1I1YB 1B0GA 1V05A 2FEEL 3STLB 3LHPH 2Y7QB 3NZHH 5J3HC 2VRAA 2EDNA 3LH2L 4QT5B 4D9QD 4FXKA 5DK2B 1VB9A 2OMBA 3M8OH 3CSYA 2Y36L 3NH7H 3T4YB 1R3HB 2EZ0C 1VFMA 1S9XA 5D6CA 1KCSL 3B6SA 2XACC 3HFML 3OR7A 5F89B 5DGQA 1Z0NA 3L6FA 1FGVH 2FJGB 5F6HJ 1AGCA 1KCLA 3RHWF 4OCLC 3B9KA 4PJ9D 2GY5A 4W81A 4JFEA 4XXCC 1P4IL 4XVSH 5DURD 1UEYA 3LD8B 5C0RH 2GW5A 1II4E 5FHAH 3ULVD 2DQUH 1DBBL 2P43B 1RZJC 5JW3L 1T6VN 2XN9B 5IW6B 1T2JA 5ILTH 3O45B 4DQOL 3MV8B 1FFQA 1KTLA 1FORH 4EVNB 5B39A 4PGBB 3QFDB 4GRLC 3EO0A 4G5ZL 2AW2A 4TSAL 4LSRL 4JFEE 5D5MF 4XHQA 3TT1L 4P48A 1WZ1L 3ORJA 1UM6H 1AI1H 3A6OA 1XF4B 3NFPB 1IGJA 3SKMB 1I7ZB 3DARA 2MSPA 5F71A 1OAKH 4RDQG 5DJYA 3OKMB 1AE6H 4M5ZH 1EK3A 5HVFB 1GZQA 1A0QL 1CG9B 1FZJB 2DQCL 1WWBX 3L3DA 4GAFB 2XXCB 1QOKA 5E9DB 3ZKMD 4YHKH 1UADC 2OR9L 4HEPG 4DKEH 5E4EB 2VITA 4KMQA 3PGCA 3C60D 5EZJB 3CH1A 3QEGH 1CN4A 4P46A 3E8UH 2JELL 4PY7A 1D5ZA 5C2UB 1MFCL 5EWIH 3F58H 3KYMB 2ATPA 5E6IA 4KROB 4OZGF 5EOCL 4EN3C 1F3RB 4J1UB 5LGHL 1A6TA 1VDGA 4TSCL 2AKRB 2YPKA 5I1AB 3ARFA 3OGCB 5KW9L 5BOPA 5IFAL 4NT6B 4D0DB 4P4KB 3LEYH 3WUWA 3MRJB 3ZKXB 4LHJB 2PYFA 4LOUD 5CD5C 4S2SB 4LLYA 3PP3K 3Q48A 5EBGA 1I75A 2CLZA 5EZOH 1IM9D 4NZRL 1AD0B 1QLFB 2UVEA 1NGZA 1VERA 1NGPH 1EO8H 4JEGB 3WS6A 2XY2A 4QHNA 4G43B 4JDTH 4F15B 3KPSE 3IYLW 1ACZA 4IRZL 2QSTA 4KGLA 4C56B 1MHEA 3TM6A 2VZTA 4RGOH 1INDH 2MCPH 5F7YC 4P5TC 1KIRB 4I77L 4MAYB 3NA4A 1KCVH 1DANU 1RMFL 3GFUA 4HF5L 3DUHA 4G9DB 4HV8B 3MO1B 2N4IA 4YEEA 2YS4A 1KACB 3BIKA 1Q1JH 1IEAA 1G0DA 4Y4KB 3DRQB 2KQMA 4K94H 2O61B 4Y5VA 1ZK9A 3QDJD 4DGVH 1F4AA 4APQC 5JORB 3MGTA 1DCLA 2IH3A 2X4PB 4B0MM 1J1OL 4CRPA 2H6PB 5IR1B 3L7EA 5DD6A 4OBSA 4CVXA 2VLRD 1MQ8A 5A43C 5ADPH 1H5BA 3LPGA 1K85A 1XF2A 3MROA 2Y72A 4EUPA 3QFJA 4FQ2L 1FL5B 2F54D 1OTUD 3TBVA 4OF8A 2BNRD 2WLZA 1IAKB 3PQYA 4LLUA 5T5FL 3LKNA 1I9RL 1IEBB 4NQTA 3C8DA 3D85D 2ENSA 3PP4H 2GT9A 3L3HB 4L4TB 5JHLH 3UTPD 4K3DL 1MWAH 2XA3A 2YR3A 4HULB 1D6VH 4UT6L 5J1AB 5IVXB 3BKCH 2EDWA 1HK6A 1F8TL 4H88L 4OLZH 4U1JA 3QFJE 3FCTA 1INEH 1MCDA 4V1DB 4R7NB 1YQVL 2O5XL 1LGVA 2Q7NA 3PQYE 2AABH 3GSNA 4EI5B 2A9MH 3EO1B 3L9RB 1QEWB 4L1DA 1CFSB 4NQXB 5FDWA 3WL9A 2H1PL 1JRHL 3VWKB 5EH1A 3S5LB 4LHQB 4XGZB 3OXSA 1T7WA 4R2GC 1VEMA 1NMBH 4XX1G 1Y6MR 2EDLA 4QRRB 1TJGL 5DLML 4I0PB 2HYMA 5JIKA 4OM0H 5IM7A 1PY9A 5BVJA 2ZWLT 1HKFA 1G7HB 4IRSA 1U0QA 1IC4H 1IGMH 2WAHA 5BV7C 2UV3A 2RFXB 3CMOH 1ZS8A 1X5HA 4PFEA 2JTDA 2PNDA 4KH2A 3F7YB 4OGXL 4UIMB 3EYVB 4P2OD 2R4RH 5TQ2H 3DGGA 1BZ7A 2GJZB 3V6OC 1HHIA 1RZFL 4JGMA 1WV7T 4M03A 1U95A 4MQXC 1CK0L 2IGFH 2LAGB 5E5MA 3IB4A 4HIEB 4ZAKD 3AS2A 1WIOA 4MAUH 4DOHE 2JF1A 4RMTA 4YDJB 3QHFH 1BQLH 1M7IA 4IDJL 3S96B 4FHBD 1TETL 3HMWH 3UJJL 3UMTA 1SBSL 3OXRA 3U4EB 5E2VH 5LVEA 2J4WH 3Q6FA 2ORBL 2P5WA 2OTWA 3ZDYF 2ZZUT 1UFUA 4PRAA 1V3MA 1RZJL 3PWJB 1A7OL 1F11B 3RVWD 2AXHA 4U6VL 5GS1B 2GEEA 1MIML 4JHWL 4M6NL 3HI5L 2HJFB 4CADA 1U41A 5DRNB 2DQGH 2D03H 5DYOA 3PHQB 4IJ3C 4Q6IA 1HSAA 4JO2H 1FYTA 2K1MA 2P5WE 5EBWA 1VEOA 4NN7B 2Y1VA 3VFNA 3LS5L 3RJDA 2O5ZH 3GB7B 4GKNA 4JZJA 4E0RA 3UTSD 3QB7C 4KV5F 5F3BB 2E7LC 5SWSB 3RL1B 1G7QA 4RFNC 2Y6SC 3QIUB 4PYGA 2RCSL 2ZOKA 1LEIB 2B39A 1PBYA 2GTWB 1IGFH 3MXWL 4L8CA 5A2KH 2LE9A 4LKCB 1MCBA 1YNLL 1J0HA 1F4WL 3WHXA 3QNYB 2SEBA 2DYPA 2WINB 4K71B 5DZNA 4GS7C 4G8IB 4WI2A 5C08E 3JUZA 2YD9A 4LPCA 1A6UL 1RSFA 5DRZA 1FO0B 3TYFA 2XQBH 4HFUL 4U1HB 1YEHL 2V2WA 1IARB 5JQ6L 4YWGL 4XAWH 4ODUB 3B9KC 2J88L 1ITCA 2WK2A 1RUQL 4JKPL 2DTSA 5KVFL 1MFEL 1P69B 3MRKA 2EICA 5F1OB 4OLYH 5ESVB 5DMKA 4U2YA 5H94A 3KR3L 3CPLB 2XV6B 1CXHA 4PV8A 3HRZA 1L9NA 3GSXB 1DTUA 1WJ3A 3KG5A 4ZODA 1Q9WB 5D9SB 1YQ2A 1LDSA 1R5VB 4G7VH 4DCQA 5EBMA 4HS3A 1U8NA 2VQ1B 1RFDH 4QHUA 1VGEH 5EOCJ 1IBGL 4U0RC 1YY9C 2XZCH 4BQ9A 5FGSA 3K4AA 5HYJA 4OIBA 5I18H 5L88H 1MCJA 1C5DA 3RKDD 2NY5H 4YHMH 3BKJH 4MJIE 5KS9A 1VFOA 2ENYA 5F9OH 3DVGA 3B2VH 2DWDB 3QQ4B 1JJUA 4K55A 4N68A 3G5VB 1H9VA 4DGYH 3R06B 1SBBA 1J0YA 3E3QE 3VGHA 4HK3N 1ND0A 2ITCB 4MNGB 4XCNA 4PGZA 1ZV5A 1B88A 5CJ8A 1EZVX 4M7JH 2YPLB 5E1HB 3UEZA 1LO4L 4RNRB 4P46C 4JRXA 5D72L 3U7AA 4JKLA 3B2UD 5CILL 3IDXH 2QADD 2BY1A 1E27B 4R4BA 1A2YB 2CLRA 4PR5A 3SDDA 1U6AH 5E6IC 4HIXL 5H8DA 1NMAH 4H8WC 1T80A 3ARBD 3TFKD 2Q76A 5FCUL 2OI9B 3CDGB 4M43H 4WHDA 3ARFC 4LLQB 3RWFA 3MX0A 4XNUL 4PRNA 4P23A 4JRXE 2YUVA 4HJGB 4F80A 3SHSA 3EOAA 1A6AA 5B8CB 1OHQA 5J4MA 3N06B 4WV1A 1DSFH 3I75B 1DQJA 4J23A 5C0IA 3T65B 3MR9B 3FOLA 1MI5D 4K7PX 1NMCC 2JE8A 1Q0YH 4QYOA 4Q0XH 1UEMA 3WS6C 4WY7L 5GGRB 2CKNA 5FM4A 1CVRA 4JM2A 1FL6B 4G3YH 1I8IB 1FC2D 1QHOA 4NN6B 5DT1H 5JMRA 3U0WH 3IKCB 3OTTA 3MACH 1BHGA 1A14L 3DROA 3SDAB 4KI5D 5D7SH 4Z7QF 2IAMD 5B3JE 1P5UA 3MPCA 2YSSA 1R0AL 5D5MB 4YHYB 4NWUL 3C8KB 1LEKA 5BV7L 3JWOH 4HHAB 4YAQA 3WKML 4PS4L 3RGVB 3O3EB 1MRCL 4M1GH 1EV2E 2BVOB 3D2UD 5SV3A 5DFWH 3R8QA 3TVMD 4HUMB 1ROWA 4NQCB 5IFJA 2IG2L 4LU5H 2DQTL 5LG1A 4IIQA 4ZSOA 1A4KB 5JZ7D 4QWWD 1H5BC 4D9LL 1XIWD 5GGVH 1OAYL 4XCCL 4P9HL 2CIKB 2VDRL 4KUCD 3FB5A 3VU2A 1C08A 3MLPA 1WFOA 3IDJA 3CDFA 1CXIA 2DQIL 5EU6D 1TPXC 1S9KC 5C0BB 1XGQA 1FCCA 1XF3A 1IGTB 3H6JA 3SKJL 2C3XA 1LNUB 3WMSA 1A9EB 1LVEA 4K3EL 4U1KB 2RBLA 4KRLB 2ZUUA 1JNLH 2ZG1A 2Z8RA 3TN0A 2WP3O 3U30B 1ADQL 3ZTNL 4ZSOE 5J3HD 5FYKE 5ACZB 4OZIA 3O3AA 4ZUSA 3G08A 4OGYL 1R3LB 3WD5H 5SV4A 4NQVB 2PO6A 3OHXA 1C8PA 5LAXB 5ESQB 4XPGH 1A02N 1I9IH 4LF3A 2ZCHL 1PEZA 3FQTB 4ONHB 2Q8AH 1U8HA 2WWKT 3QO1B 3VDBA 3BZFA 4NDMB 2W0LA 1IC7H 3UTZB 1G9NH 2FECL 5DHYA 3REWA 1EVTC 5IB4B 4YBLB 1ZHKB 4OZIE 5CEXA 3GMLA 2KKQA 3FQNA 4G6ML 4RWHA 3P4NB 1KCKA 3QA3B 2V5MA 1MHPL 4NSKB 1D5IL 3DUSA 4V2BA 1CLZH 3ZKSD 5FUOH 1BWWA 4IRSC 4YR6B 1I8MB 2C3VA 3O2WL 4I0CC 4X6CF 5TDNB 2AGJH 4PY8I 1A7RH 3MV7B 2YEZB 3JSSA 4RAUB 4XWGL 1NPUA 4G42A 3T2OA 4WI5A 4E9LA 3LKOA 1DEEA 1L9MA 5INDA 2VDKH 1N5YL 1XR8A 4JVPA 5AYUL 1A6VH 5IKCA 2W9EL 4Z7WA 1MCWW 4NNYB 2ZUTA 1JPFB 4OCWL 4NQDB 3MRCB 5T5NF 3CSGA 4ETYA 5JA9A 4NBXB 2XWTA 4PJXB 3QDJB 3D25B 2FNBA 4MD0B 1AGFB 3WUZA 4J3TA 1EAPB 4NGHL 5DUML 4XVJL 4Y1AA 4MJ6B 2XA8L 4U1GB 4NHCH 1I7RA 3FHAA 1GAFL 3SJVD 4Z7WE 5I1GL 5JTWA 2XRAH 3AXLB 3BSZL 2IH1B 2X4TA 1FAIL 1K8IA 3JTSA 4H0GA 3D5OF 1KYOK 5GIRA 4ZYKB 3D9AL 4Q6IC 3MUGA 5J1TC 5ICZA 3C6SB 3V5HA 2UZIL 1XGPB 1KCRL 2OXHA 3D85B 4OCSL 2J3SA 1IILE 4F7PA 4Q9RL 4Y1AE 5L7XL 3L3OA 2EH7H 4HT1H 5FOBA 4AH2A 3MLXL 1AJ7L 4JZJC 4EN3D 4QF1B 2Z8WC 1D5BB 1FBIH 4JDZB 2P1YA 4N8CL 2Z0BA 4XCEA 1Q9KA 2AEWA 3BPLC 4QRTB 4TPRH 4WUUA 5D8JL 4ZPTA 1LO3H 1I1CA 4MD4B 3MBXH 2C3HA 2NLJB 3QULA 1BMGA 4PV9A 2MKWA 1P4LB 1OARL 2HKHL 1T21A 2YA1A 5CD5D 4WFFE 3NPSB 2YUWA 2BVQA 3NFSL 4M6AA 3QP3A 2ZNWA 4XC1L 5CJXA 1B6UA 4PJ7A 3HR6A 1SM3L 5TDPA 4NRXA 2AI0L 1RIUL 2QQNL 1E6OL 4GUPA 43CAB 3UC0L 3E6FB 3PWVB 2I07A 4YO0A 4UILL 4LVOC 4XAKE 5C7XL 4AY0A 1GH7A 3D39D 3ECBB 1RIHL 2ID5A 1YEIH 4GRMA 1ZLUH 4KVNH 4P5TD 3ULSA 1LK3H 3TIDB 5F93C 4QXTA 4RDQF 1KUMA 1P7QD 4XVTL 4PJ7E 1RULL 3IDGA 5FFLA 4AEHH 1AD9B 1QVOA 2VQUA 1D5XA 4JVWA 4YGAB 2VN4A 1JNNL 5FYKU 3RVVC 5KSBF 2PW1A 5TFSL 3DUUB 5MEPB 3VFRA 2FB4L 1E4WL 4PJGA 4APQD 1OWRM 5HYSB 3RJQB 1RUPL 2YXMA 3NABL 2XZQL 3KYNB 3NCCB 3ISWA 5JW5B 3CK0L 2C1PB 3O2DH 5L8JB 5EO1B 4LCYA 1CDGA 5I8OH 3TCLB 4NO3A 1R5IB 4QEGA 3U46B 4CDGC 2BMKB 1KJVA 1YA5A 2XWJB 1DLHB 3BQUA 2ZSWB 5I1IL 4UV7L 1UT9A 2DM4A 3EDFA 1E4JA 1CZ8H 1DL7H 1QNZH 4PJGE 2Y5TB 2GAZB 3VE0B 1OD7A 5GGRY 1BX2A 2R1XA 4JB9H 2BXYA 5D1ZB 4LBEA 5EU4B 1NEZA 3TO2B 3WLBA 4R0LC 5IIEA 3CLEL 3QUXB 4BQCA 3QEQA 1NJ9A 1P53A 4LLDA 1ACYH 3L3IB 2NMSA 1JPGA 1KJ2L 4HGMA 3UJTL 4BSWB 3VWJD 4BH8B 4Z7OF 2HA1A 2D0HA 3SDDC 3HTLX 1H0DB 3CLFL 2AP2A 3VXUD 1QSEB 2FLBT 2Z8SA 1MWAA 4F7EA 3G9AB 1ETZB 3G5ZB 5IUSA 4MB5A 2PYEB 1ZANH 4R90H 3MRNA 4KUZH 4KDTA 1QR1B 1YN6A 1KB9J 3QEQE 3T0XA 2F74A 3BPCA 4R2GD 1QFWH 3ZHDA 4P23C 3L5XL 4KKAC 1T5XA 1HH9A 4E41B 1L7IH 2DL2A 4RA0C 5DJDA 3BWAB 4ZXBB 3RUGE 3BO8A 4UTAH 2NXZD 1DBMH 4ZUUB 3HZYA 5GJSH 5TH2A 1Y6NR 1S7UB 3NGBB 3I6LE 4R4FH 4LQFH 3FO0H 2ITDA 2WSKA 3FFDB 4ODWB 2VXQH 5D7LA 4YZFE 3P3YA 4JM2C 2LVEA 5B38B 3KJ4C 4HUUB 5BJTA 4DUXA 3MJ9H 4LCWA 3M17B 1AY1L 4M7KL 3H7BA 5FHBL 2ZJSL 1OP9A 5MEND 4JFZL 4KTDL 2ICEB 4MWFA 1U8KB 5EBLA 2OR7A 3QDGB 4L4VD 4WEMB 4GMTL 1ZVSA 1TTUA 4HFWB 5GGUB 3GMNB 4YUEH 4YX2H 5D2LB 2P44B 2X7LB 2NY0C 3ZE1E 4Z78A 2JCCA 4PLJD 5D7LE 4OLWH 4NO2B 1SYSA 5IGXH 4LCWE 4ZOBA 4I9WE 4GRWF 3QEUB 4JFQB 4G8FB 3IGAB 2F53A 1MREH 4IIQC 5AAMA 4C83A 1KCUH 1IVLA 5FYJL 1CT8A 4PJBA 3PHOB 5DC9B 3SDXA 3P4MA 4OF5A 2F5AH 4OFKA 5I9QC 5CJOH 1A5FL 4GKOA 5D93C 3CVIH 3AU1B 3THML 5J8OA 3LKQA 4O2CA 4GG6A 3WFCH 5A16B 2Q6WB 1RURL 2HH0H 1BBJB 1FNFA 2Y6SD 3MRMB 1PX3A 4DGIL 1A3LH 1JVKA 3TN0C 2F53E 3TLRA 1EDQA 3RIFK 3Q5YA 4OB5H 5HDLA 1JI1A 4IMLA 3D0LA 1GZPB 4KGJA 3ARWA 3GHBL 1FJ1B 1BLNA 2PO6C 3MUHL 2CDFA 1I8KB 1JYNA 2X09A 2IANB 3OKYA 1T1ZB 4XNZC 1KEMH 4QY8B 4HUWA 3R8BB 4AIOA 5T33L 3QZWA 5FUZL 4WWKB 2K7PA 3DXAD 1CIUA 1U8IA 1YC8A 5HGAA 4K3HA 4URTB 3BP6A 3T04D 3LAFA 1JZ2A 3A6CH 3B9KD 4JFED 2X1XR 3MBEA 5F7HA 4IOIA 1QBML 3MXVH 1T1XA 2EYSA 4O2EB 3DRTA 3QDHA 1NFDB 4X6EB 4XBEH 3TBWB 1FV1B 3PDOA 1HILB 3RZCB 3O6LL 3TPUB 3CFBB 4Q9BA 1JF1A 1EEQA 2GSIA 3FO1B 3I2CL 4DZ8A 3BD4A 4DKAA 4XTRC 1DDHA 1N6QH 1CLOL 2W0FA 5E8PA 4RAHA 3BWUC 1QA9B 2VZUA 3BDXA 5T1KB 4XZUB 2MPAL 5HDQH 1OLLA 1R3JB 1FLTX 1YY9D 1FSKC 5TE7L 3H42L 4OF0A 1KFAL 2CO6B 3QWOB 5LXGL 3QXAA 4XXDA 3VRLF 1RZ8B 2VC2L 2WLYA 1KN2L 2D7OA 1MJJA 4M48L 4X83A 4KK5C 3D18A 3F5WA 1PG7X 4GLRH 5L0QC 5EUOB 4QRQB 2XXMB 4WTZG 3HA0A 3BGAA 4LKXB 1FRGH 2R69H 3AGVA 3UZEA 15C8L 1QRNB 2BRRL 3FT4A 3VXMB 1IT9L 4QTIL 4O02H 4JR9H 4P46D 4MJ2A 2VZ3A 2GYSA 4J4PD 1ZT7A 1Q9LA 3W5MA 4F33B 3HB3D 2NY4C 4UT7H 1G6RB 1P6FA 5E6ID 5IB2B 2A77L 3W0WB 1Y0LA 4EOWH 5MHSE 5J7CC 3OQ3B 1KIQB 4X80H 1YUHB 1B0WA 4D3CH 3I3DA 1NH6A 3ARFD 4IM8A 4PJ5D 1HCFX 4XCFL 1ZHNA 3V5KA 5CINH 3RY6A 2HT3C 5F97E 4HXAH 2HRLA 1KLGA 3QHZL 4RMUA 5DI8B 3FRPA 4ZO8A 3MREB 3QR2A 4PGDA 4O9HH 1A1MA 4GQPH 5CJXC 5JW4Q 1G7JA 3C6LA 3AS3A 1U2HA 2FX9L 3U6RA 4UAOC 5C9JA 4P57A 1FNLA 2WUBH 3S9DB 5DUBA 8FABB 5D2NB 4GT7A 4GW1A 5ECJE 2DLEA 4HIJB 4X6CB 4G8GB 5C0JB 3DVFA 5CZVH 1XCTA 4RCAA 1JNHA 1NGYA 3SE9H 4G7YH 3L3JA 5JW4M 2BHUA 3MOBH 2PN5A 2ZG2A 3EO9H 2X1PA 5JHDA 1JUFA 2E27H 1HHHA 4S1QL 1ZSDB 3BPOB 1FO0H 4QTHB 3VI3F 3ULUL 2R0WL 3P73B 3VJ6B 1D6EA 3W39A 4GRLB 5DXWA 1YY8B 5ESAB 4N9GB 1LDPL 1P2CB 2G60L 2FO1A 1TZHA 1U8OB 3FRUA 1BQSA 3MODH 1HHJB 2FX8L 2VJXA 4DUVA 5E1AB 5FO8A 2VL5A 2VDOL 2Y23A 2J6EH 3FMGL 4I1NB 1JHTB 3GNMH 5I66A 1HQ4B 5JHDE 5D1XA 3RIFF 3FT3A 4U6YB 5C07B 3OB0H 1RHFA 3FB7B 1AC0A 3AAZA 1PSKL 1FYHB 4P59L 1CI5A 2OL3H 4K94C 3HMXH 3EYOB 5I76A 3QFJD 3BQUC 5CEYB 3PXJA 4RFEB 1T3FA 4BH7A 3X14B 4TTGA 1J5OL 1YEEH 4XP1H 2PW2B 5TDOB 1WF5A 1NC4A 3DX8B 5FKAB 5JNYA 4U7MA 2C5DC 3ROLA 4N8VA 5KJRH 1DFBL 1JBJA 2VLJB 2WBKA 2ZNXA 3RDTC 4G8EB 3GDBA 1VPOH 3MA9H 3MA7B 2D4DA 4W70A 4CUCA 4M9PA 4KTEL 2FX7L 4M02A 1FNEB 4EN3B 1TQCC 3O0RH 2CLVA 4ONFH 1Z3GH 5E8DH 1A6WL 5LCVH 1LD9A 2AV1B 3IDYB 3EYUL 1QFWI 4KDTC 2APBA 1CQKA 3I85A 5BO1H 4OD3L 1G0YR 3BD5A 4L4JA 1VADB 4NQEA 1QBAA 3MJ7A 4PJFF 1E6JL 3BE1L 5GXBB 5CGTA 4U05A 5EC1B 1M4KA 4TQEH 2G2RB 3KJ6H 3WEXA 4AEFA 5F21B 1CDUA 1G7LB 4PLOB 2APWA 5KAQF 5EORH 3SE8H 4JANA 3UYOD 1KPVB 4NN5C 5IT2L 3TBTB 4Z7NE 2X1WL 5KSBB 1UCBH 1NUFA 1RK1B 3NZHL 4J12A 2VOTA 3C08H 1TXKA 5FYJD 4WHTA 2HLFC 5BZDB 3LS4L 1P7HL 2D7TH 4ZFOA 2H8PB 3IFOB 1OB1B 1N2RB 2Y06H 4JAMA 5DS8B 1IAIM 4NCDA 2KUTA 1YEKH 1DQMH 3BP7A 3RL2B 1HHGA 5ETUB 2I9LA 1Q8MA 3CXDH 3ARQA 1CBVH 3QH3A 3V9FA 3O9WC 1NCNA 3MMEA 1RZGA 2X1OA 1IAOA 1RI8A 1FGVL 3OKEB 4U1IB 1CS6A 4XVSL 3SGEI 4KRMB 3VH8G 2BY0A 5C0RL 3N0PB 1J8HD 1WVZA 5FHAL 3S36H 3VD3A 5EIIA 3HC0B 1FYTD 2DQUL 4EIGB 2V2XB 5T1LA 4HUVA 1ZHLA 1WCQA 5ILTL 4H5SA 1PJ9A 3FZUC 5CIPB 1BPVA 4R3SA 1FFOA 1W2KT 1FLRH 5IV2A 1DQLH 1Q38A 2A0LC 3A6BH 4M1CC 1NSNL 3TO4B 3RWCB 2X9WA 2WBWB 2WQ8A 1BF8A 1UM6L 4L3EB 5IMLB 4OCRH 5GRZA 3FOMB 1C5CL 4QO1A 1U93B 1D5MA 4XVUC 2RB8A 2J2ZA 4M5ZL 1TFHA 1SJHB 1A22B 3CFJA 4FQXA 3BH9A 4DVBB 3ES6A 4LVNC 5IF0B 4LLVA 3VFOB 3MV9A 3MRBA 4R2GB 4TULL 5JIIA 3WJLA 5K9QI 1BFSA 4OM1L 4YHKL 1WEJL 3ZSSA 2J7LA 1ORQA 4NZUH 1DVFB 3BEVB 1YEJL 5ITFB 3GMQA 5CMAA 3GI8H 2D9QB 1EO7A 1U58A 1I1YA 4QRPB 3QEGL 4U4BA 5IW1B 4NFBA 3STLA 1GRWA 2C3GA 3MBEC 4QT5A 4JFYB 3CFEB 5DK2A 1X4YA 4JHZA 5IBTH 4JFPA 3RVVD 5L2KA 4YXHL 3MV9E 1BOGA 5FB8B 3T4YA 1R3HA 2BP3A 2DQEH 3EFFB 5FGRA 2DJSA 3C09C 1IZKA 4L9LA 1GIGH 4M3JA 3FRPG 3LEYL 5IB1A 5C8JB 1CFVH 3TT3H 2XKNA 3RU8L 2FJGA 1TZGH 4R26H 1W72L 4UTBH 5HYJD 4GRWB 4YHPA 4P5MB 1OSZA 5L2KE 5IBUG 3ME0A 5IVZB 2R1WB 4F57H 2AV7B 4GLRI 1NGPL 4PB0H 3GJEB 4X0KB 5IW6A 3O45A 4JDTL 3MV8A 3O2DA 1RUMH 4WO4B 4EVNA 2D3VA 1QFPA 4RGOL 1INDL 1BP3B 1ES0B 3QFDA 4PGEB 1I9JH 2MCPL 1QFHA 3LQZB 5MEQB 5C09E 3LN4B 1C16B 4YE4L 1KCVL 4HUXB 2NY5C 1MFDH 2P42B 4GG8A 4L29B 3KYAA 1FG9C 4Z76B 1Q1JL 3NFPA 3QRGL 3SKMA 1I7ZA 4DGVL 2W65A 4WEUD 1B0GB 4Y8AA 4KJYB 4PJ8B 2DS4A 3BPNC 2OP4L 2I26N 1HDMB 3PV6A 1CG9A 1CGYA 5E9DA 5KTEH 3CSYB 4P23D 4KKAD 4KK9C 3RY6C 3FQXA 3ULUD 5E70A 5T3ZH 3IJHB 1I3GH 3QDMA 1S9XB 1DBAL 4QXGH 2W38A 3B6SB 3C6LC 1DQQA 1OAQH 2EE6A 2GUOB 4JM4L 1RUKH 4N8VG 4YHOH 1MCFA 1RJCA 1V5JA 3L6FB 2QBWA 3QNXA 1F2QA 4QNPE 2EH8H 4F9LA 3PUCA 4J1UA 1MWAL 4JM2D 5HHMB 5B21A 4OKDA 4BQBA 2AKRA 5I1AA 1D6VL 2R4SH 3BKCL 4D0DA 2J8UA 4P4KA 2IWGA 3QDME 4OLZL 3LCYA 3FN0H 1INEL 4M7ZC 2CRYA 4XMKH 4I48A 1WSST 4P2RB 2A9ML 1YN7B 3OWEA 4UINH 4CN1A 5BMFH 3WJJA 5DD1H 4O5LH 3UX9B 4O51A 4NBYB 1NCUA 2D7PA 4HMEA 1AH1A 2HFFA 1AD0A 1OY3B 5IMKA 2EE2A 1AKJA 2H2PC 3MJ9A 5EU7E 2XTJB 4OKVA 3O6MH 4G43A 4Y16B 2J8UE 4NO0A 1IGJB 1NGXB 4U6XB 5D1XC 4C56A 2B5IB 1T2QL 1UH2A 4I3GA 5FYKD 5LWYL 2NY1C 1JNJA 1IC4L 4MAYA 5GQBA 5SX4H 3C2AH 1IGML 4KMTH 5TPWH 3JWOC 1AFVL 3FHQA 1U8PB 3MNWB 3GK8H 3MO1A 4OCMC 5J6HB 1FHGA 2VITB 5TQ2L 2NY2B 4JPKL 3PGCB 5DVLA 5AWNL 2O61A 4LDOB 1OAUL 4S1DC 5EOQH 2IFFL 2IGFL 2WQRA 2JK5A 3GIVB 3MRDB 4MAUL 4PY7B 2X4PA 5F9AC 4PJEA 3SO5A 3TN0D 1D5ZB 5IOPA 3QHFL 5CEZL 4S11A 1BQLL 1MCOH 2H6PA 5IR1A 3PP3H 3NN8A 2ATPB 3RP1A 3HMWL 3QPXH 5DMYA 5HVWA 3P77B 2J4WL 4NP4H 3GM8A 5DA4A 3X3FH 2AVGA 3UO1H 3GUTB 2YUXA 5KVDL 1A6TB 4BELD 4H26B 1XR9A 1FL5A 3KPNB 3KPSB 4Q9CA 4MXVF 1IAKA 3DHJA 2DDQL 5DUPH 1MFNA 1YNTB 4PJEE 3VGFA 2PYFB 3IRZA 2DQGL 3L3HA 4L4TA 3HC3H 2P7TB 4LLYB 3V4VL 4Y8DC 3S34H 5H2BB 3O3BB 4JO2L 3RI5K 2HN7A 3E0GA 2B4CL 2R2BA 1NGZB 2C4FT 3MGOB 5F1SA 1NMCB 4EI6A 4RISL 5HHVH 5D71H 2X40A 4V1DA 1KF9B 4R7NA 3C5SB 3U83A 3G6JF 1G9NC 5DWUL 4TRPH 4LSSH 3VRIB 4EI5A 4I0KA 1URLA 2YD1A 3EO1A 4LFHD 1QEWA 1K4DB 1CFSA 4Q2ZB 1RU9H 5FCSH 4XTRD 5FKPA 4NQXA 1N64H 1T1WA 3VWKA 5KANI 4L4TE 4OLVL 5C1MB 5E08H 3FQRB 5C6TH 4J6RH 5EOTB 4XGZA 2XICA 4I5BA 3L95B 2CD0A 4HWEH 4MS8C 3BIKB 2W9DH 3FQUA 1IEAB 3OAUH 5F7KC 4QRRA 5I16B 3WO3B 4V1DE 1T5WB 5IVOA 3W9DB 4XWOC 1G7HA 3MGTB 2OSLB 3RWHB 1MHHA 1T22B 2FD6L 1CFTB 5T1MA 1FVEB 4Y1AD 2EKSB 4KK5D 1ZTXH 4JY5H 1FVCA 2B2XH 4BSVA 3F7YA 1AC6A 1J1XL 1LE5B 2XQBL 1QBLL 1EMTH 3UROR 4KI5F 4XAWL 4CMMB 2BFVL 2VE6B 4NUGH 4QRRE 4UOW0 3RWIB 3QFJB 4HIEA 1JHLL 5CKGA 3VGEA 4EBQL 1Q94B 1NCBH 2ARJQ 1TPXB 1UM4H 2X5PA 3PQYB 4ODHL 4WFFD 3S96A 3ILQD 2AQ2A 4NJ9H 3U4EA 4O00A 3NIGF 4Q9QL 1KENL 4WWID 4JFOB 1FIGH 4OCYH 4DTGH 1UB5B 1OP3K 4UIKL 4CNIA 3PWJA 4NKIL 3RWEA 1I1AB 4G7VL 4WUUD 1T04B 5GS1A 4U1JB 1OF2B 4FFZH 1AO7B 1QP1A 1RFDL 1VGEL 2HJFA 2HT3D 2FIRT 5CJBA 5DRNA 2XZCL 3LPFA 5JMOC 1DLFH 4W6XB 1QSZA 3TF7C 3HS0A 3WL9B 3GHEH 2NY5L 1A6ZB 4YHML 3BKJL 5CLTA 5CWSB 2DM7A 1CIDA 4FQXC 4C58B 3KGRA 5A2FA 3NCJL 1MJUH 4DGYL 3WJLC 1RZ7H 3B9VA 4DOHB 3LMJH 5DD0L 1ZEAH 5SWSA 3B9EA 4M7JL 2FHCA 3QIUA 3F7QA 4IRSB 1BJ1J 3BZDA 3TH3T 1LO2H 3LKRA 4KZDH 4LKCA 3TIEA 4NIKB 4S1RH 2VQTA 1CLYH 3QNYA 4DFIA 3T0DA 5GS3A 1QBBA 2WINA 2DIAA 1JK8B 3BIBX 3C9NB 4WI4A 1GOHA 1WT5A 4HJJL 1RJYB 1MJ8L 4L9LC 5SWSE 3GKZA 2P4AB 2P8PA 1AGBB 3GI9H 1FO0A 4Y88A 4HUKB 4U1HA 2P5WB 4ODUA 4LP5A 4M6MH 3V7AE 2APTA 3DNKA 1MFAH 4PRAB 5GRUH 4HC1H 2VUYA 4ORGB 4YXLH 1YPZF 5LGJB 1Q0YL 2PTUA 2A6IB 5ESVA 4X7SH 2J6EA 3CPLA 3IJYB 5EG6C 4G3YL 3QCUH 4Q6IB 1KB9K 3GSXA 4P2QA 4UV4L 3MACL 3E6HB 4MHHG 1Q9WA 5D9SA 1CICC 2OL3A 1R5VA 3QUMH 5EBWB 1QSFD 3HMXA 3VXPA 4ZFGH 4YDIH 2VQ1A 3RI5F 4R4NC 5F8RC 4JCMA 2GCYA 4JZJB 4E0RB 2JB5H 1GJIA 3N1QC 1P6AB 2GHWB 5C08B 1RJZA 5DFVC 4X7EC 3A67L 3RUGF 1C7TA 2E9IA 5F7EL 2MNUA 3G5VA 4P2QE 2YD7A 1MFBL 2R15A 4HD9A 1NFKA 1BD2D 4LU5L 3H9HB 4MNGA 4CKVX 2BJMH 1M71A 5E4EC 1FIEA 1UJTA 4ZMAT 1K9TA 5CP7B 2DYPB 2PTVA 5GGVL 1ZGLA 3ZE0F 1MIEL 3MRGA 1T7VA 1W0WB 3O3UN 1Q0XH 4LVOB 3GRWH 1E27A 4P49A 1A2YA 3TYFB 4XCYA 3WV0A 2CKBL 2V2WB 3WNNA 1CQYA 3RBGA 1BFOA 3HLAB 4LCIH 3QXDB 3CFIC 3UYPA 4F9LC 1VA9A 1DBKH 3I6GB 4MNGE 3W2DH 3CDGA 1K6QH 5EU7C 4NC1E 5BQ7A 3Q5OA 4LLQA 4I4WB 4LCWD 1KBGH 2FIKB 3HE7D 4P4KC 4WFEE 2HLFD 4N0RA 4PY8J 4OTXH 1DZBA 4HJGA 3QISA 1X4XA 4MJIB 4TOYH 5B8CA 3GSVB 2H9GA 1I9IL 5JO5A 4PV8B 2OZ4H 3I75A 1EGJA 1XGYL 1XGUB 3WJJC 2Q8AL 3T65A 3MR9A 1JHKL 2F9BT 5DEFB 1IC7L 1CGXA 4DCQB 3ILPA 1FP5A 1UZ8A 4HS3B 4QHUB 4ZDHA 2CK0H 3K8KA 5CEZD 3RWJB 4N5EC 1RK0B 5I1JL 4HGKC 4F15C 5GGRA 5IROA 3S3PA 4BK4A 5EUKB 1RZKL 1I8IA 3CFCL 3JV4B 5F1IB 4JFDA 3IKCA 5FUOL 1KXQE 2M8XA 1VFUA 3SDAA 3QQ3B 3R1GH 4MAYC 5LJYH 5HVGB 3K0WA 4XBPA 2AGJL 1A7RL 4ZFOL 3AUVA 5D5MA 4KAQL 2XFXB 4J3UA 4TNVK 1A3QA 3BIAX 5DJ6A 3MUZ1 5CAYB 4R0LB 1GPOH 3C8KA 2AEQH 3SGJA 2A0LD 4JRXB 3O3EA 4LIQL 2QJDA 4M1CD 4NFCA 3NOIA 2VXUH 4FABH 1A6VL 3VG0H 4JFDE 1SVZA 3IFPA 4U3HA 4R4BB 4BZ1H 4JQVA 4NPYB 1PQZA 3NIFF 3SDDB 4Z5RB 4QLRA 3BP4B 2YMXL 1BVZA 3BX7C 1A4KA 2Q76B 2QQKH 4XVUD 5D5ME 1MCNA 3RQ3A 1JE6A 1NCAH 1G1CA 1K3IA 2AK4A 2CIKA 3MLWH 1BF2A 4FOMA 3RWFB 4OZFG 4PRNB 5C0BA 4NHCL 5DRWB 1IGTA 3OKKB 3S3JA 5CSZB 9CGTA 1A9EA 2XRAL 1G7IA 2MQCA 4XNXL 3KAAA 4OZGA 3FOLB 5T3XH 4KQ3H 3MBED 3AMKA 2PR4H 1P9MA 2EXYC 1YYLH 3ZT6A 4I2XB 4QYOB 1T66C 2AK4E 3MCLH 4NQVA 2B1AH 1F4HA 1KXVC 4HT1L 4EI5C 4ZFZA 4H0IA 3FQTA 4ONHA 4WU7B 1GXEA 4MMXC 5I8KH 3QO1A 4Z7UF 3VWKC 1LO3L 3DBXB 4NDMA 3BYTA 3MBXL 4OZGE 3V6BR 4G6JH 3QNZA 3ZYOA 4Y19D 5IB4A 4FZ8L 1ZLWK 2AJ3A 4JJ5B 4TYUA 3W9EB 3H3PL 3P4NA 1JWSA 3HAEG 3QA3A 3QQ9C 2NY0B 5E8NB 4NSKA 5IEHB 3KPRB 4YR6A 5E8EB 1GOGA 5J56B 1S7VA 1V8HA 3EJYD 4GBXB 2HAZA 4LGPB 3MV7A 2YEZA 4KKCC 4RAUA 1E4XH 1YMMB 2HJLA 4ZSOB 4R9HA 1HZHH 4RGNB 5DJAA 1S9YA 1YEIL 1EUUA 1A7QH 3ARTA 1LK3L 1C08B 1MOEA 5D93B 2YD8A 3IDJB 4P99A 3D48R 4KDVA 4NNYA 3MLYH 4NQDA 4IBLT 4AEHL 4PJXA 2DQDH 2DLTA 4O58L 4ELKB 3D25A 1EHAA 1CWVA 3MV7E 3RGHA 3OV6A 5HVHB 3DURB 1I85A 3G08B 3RWDB 4MX7B 5GS1C 2WP3T 1WISA 2PO6B 3OHXB 4KK9D 2CQVA 5I8OL 3JBG7 1EXUB 2W92A 2IH1A 3BN9C 4JHBA 5EULV 5IMMB 1MNUL 4ZYKA 1OOAA 3MOQA 3BZFB 1Q72H 3K1DA 1CZ8L 3C6LD 4XHJC 3REWB 4ONOA 5D7KE 4NN7C 1F6LL 3RPIB 1U92B 5CEXB 3T1FB 2P5EA 5JLZB 4Y89A 1UYWH 1IJ9A 2VDNH 1A9BA 1F58H 1UA6L 4WHCA 2NY3C 1NGWA 3QIUC 4PUBL 1MHCA 3HNVH 1MLCB 4QRTA 1L7TH 2L7JA 1ACYL 4PRIB 3N9GL 1XH3A 4MD4A 5JHDD 5E7BA 2NLJA 5LGKA 1WFTA 4KJPC 1VKXA 1T03H 3QG7H 2Z93B 2QLVB 1EJOH 3FT2A 3IS1X 1DEEB 2P5EE 4KZEL 4TNVF 4WFGE 1TVBB 1WT5C 1ZANL 43CAA 2H2PD 1NC2A 3PWVA 5E0QA 2VISB 4KUZL 5T3ZE 3BMWA 1DP0A 3LQMA 2I9TB 1QFWL 1UACH 1IGIH 1L7IL 1EO5A 1Z9MA 4UTAL 3O81A 2BVEA 2NY1D 1DBML 4Y1AB 4U1SA 1HCVA 2O5YH 3SDCA 5JA8B 4R4FL 1I7RB 4MCYB 3HHRB 4LQFL 5E95B 1AD9A 5E7FA 1H3WM 2NQCA 2C7UA 1DN2A 2FBJL 5I75C 1HQRB 2CSPA 2X4TB 4GRWH 1K8IB 3DUUA 1NC4D 2JIXA 1NLBH 5MEPA 4S1DD 3MUGB 5HYSA 5ICZB 3MJ9L 5FA4A 3KYNA 4U1LB 3HUJF 4J2XA 5JW5A 4XP4L 2C1PA 2NY4B 3L3OB 1OM3H 2RGSA 5JOFB 1X5ZA 4X9GA 5ADOH 4OZHE 4YUEL 7CGTA 1R5IA 3U46A 3NA9H 3VGBA 3MLSL 1IQWH 2XWJA 1IFHH 1DLHA 2ZSWA 3MOAH 1X5IA 5C71A 1NLDH 1LO0H 2BSSB 1GC1L 4MJ4A 2GAZA 5IGXL 3VE0A 4PV9B 3SPVA 3ZDYE 2VWEE 5D1ZA 5EU4A 5EFIA 4YFLF 4JG1L 3G6DH 2BVQB 4XB8A 3VXSA 3TO2A 1KCUL 3ALPA 4NC1C 4PJ7B 2IQ9L 5I30H 4NQED 1MQKH 3QUXA 3F62A 4AEEA 2F5AL 5CJOL 4JO4L 1E28A 2QHLA 4BSWA 4LHUG 3KNBA 3CVIL 3FKUS 4JY4B 4BH8A 3VDAA 3WFCL 1AXTH 5J12B 4K8RH 5C86A 5IHUL 1OGTA 4D94A 3GBMH 3WSQH 2H32B 5KVGH 4LSPL 4G6KH 4HSQA 4ODTH 1QSEA 3BVNB 3ULSB 4U31A 1X6NA 1ETZA 5DK0A 3VXSE 2OI9C 2PYEA 3QJHB 4WW2F 3S8WA 4YDLB 4LAQH 2EEBA 1MJ7H 4PG2A 4OB5L 1QR1A 4KV5E 1QVOB 4MS8D 2KL6A 4E41A 1I7TB 2PW1B 3HZKA 3TH2T 3BWAA 1OW0A 5B8CC 4TUKL 3SGKA 4PJGB 5K9JH 1GVIA 1QYGH 3DVNB 2KPNA 1HYRC 3KPQB 5AEAA 3UYRH 1QSEE 3ZTJH 4CMHC 2GTZB 2UWEF 1WFUA 4KXZI 1XCQB 1I8LA 2Q86B 4HG4J 5IROC 4BKLB 3KVQA 1JWMA 5B38A 4E41E 5I15L 4HUUA 1K3ZA 3BQUB 3MXVL 1QFOA 3M17A 3O8XA 3SDAC 4YPGB 1BFVL 1FDLH 2ICEA 5T1LD 2R1XB 2BOCB 4LBEB 3QDGA 1G9MH 1KGCE 4YHYC 1A1NB 3EZJB 4HFWA 1AXSA 5F6IB 1N6QL 4HPYH 3RDTB 3QEQB 5C0CB 2VDMH 4LLDB 3SGJC 4LK4A 5J11B 1JPGB 5KOVC 1ZGLM 5IK3B 5CFHA 4UNUA 3RUGB 5I1EH 5ABDE 2ERJB 2V2TB 4MA8L 12E8L 2AK1H 4JQVC 1JGVH 2EDHA 1HKLH 1J0IA 4JFQA 3H0TB 3IGAA 4BZ2H 3QDGE 3LQAH 4Y2DC 1OL0A 5KVEH 5EZIH 1PVHA 1BVKA 3MRNB 4FQXD 1HNGA 5B22A 3AU1A 4OF7A 5HGGS 3BPCB 2DI9A 4TVSa 1VSCA 1JPTH 5A16A 4G6AC 2Q6WA 5T1DL 1FRGL 3BO8B 3S88L 1BBJA 2QKIB 1V7MH 4MB3A 3MRMA 4O02L 4KJWC 3S35L 4JR9L 3IT8D 2CUMA 1YECL 3U30C 4NHUB 5I1KH 1GZPA 1PKQA 2ITDB 4JN1L 1FJ1A 4AQ1B 4NN5B 5D7LB 5L2KD 1I8KA 1WBXA 2Y5EA 2IANA 1S7WA 4ZTPH 1T1ZA 5MEOB 4LCWB 1EA9C 4QY8A 1NCCH 1PLGH 4WWKA 2VXTH 1YEDB 1N7MH 4MWFB 5E2TH 3T0AA 5DQ9B 5EBLB 1IE5A 4YBLC 5F96H 4GAJH 1ZVSB 4HXAL 3OG6B 1PKQE 5EO0B 4A6YH 4O9HL 4WI6A 4Z78B 1KJ3L 3SBWA 2EDDA 2IANE 1BGXH 3O9WB 3QCTL 2VH5H 2WUBL 1NFDA 4X6EA 3TBWA 1FV1A 3CJJA 3RZCA 1AGDA 3TPUA 3CFBA 3FO1A 3MV8D 1YEFH 2F53B 4X8JA 1UC6A 3TBYB 3SE9L 1UWGH 4RX4A 3MOBL 3QPQC 4FG6C 5CJQH 3NFNA 2BSED 2FJHB 2OX5A 5DHVB 3WKNA 3ARRA 3IFLL 5TE6H 5DMIH 2E27L 1GSMA 1S7SB 4LARH 1QA9A 5HGHA 4HC1A 1FO0L 5T1KA 4XZUA 3LKQB 2L7UA 4R4ND 1R3JA 5BS0E 4NZTH 5DC0A 4CU6A 5DFVD 2GFBA 4L8BB 4Z8FH 4Z7QE 2R2HB 3MODL 4FQ1H 5EPMB 4BUHA 1RZ8A 4TVPE 2QQLH 4OJFH 1K4CA 3QUMA 5D1QA 5HBBA 5I19L 1I85C 2J6EL 4HDIB 4IMLB 1C1EH 2BX5A 4U1GC 5GHWL 4XNMB 4QRQA 5E9DD 5EUOA 2ICWB 3T2NH 5DD5H 2RHEA 1FPTL 2VABB 1FNGA 1QRNA 2DLFH 4H1LG 3VXMA 4FQIH 3VFSB 4QNPF 3HMXL 3QDMD 4LCCB 4LVNB 2VUOA 1J88A 4M5YH 4F33A 1JF6A 5DJCA 1U8IB 2ZP0T 1UKQA 5HGAB 4XP1L 2YKLL 4NM4H 1CGWA 2V7HA 4Z9KB 4XPTH 3W0WA 1JTPA 4MVBC