4QHKI

Uca (unbound) from ch103 lineage
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
222
structure length
218
Chain Sequence
VQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASLPVNAYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords UCA heavy chain
total genus 35
structure length 218
sequence length 222
chains with identical sequence K, M, O
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF07654 C1-set Immunoglobulin C1-set domain
I PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhkI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhkI01
1GGIH 2DQFA 2WINB 1MIEL 4LGSB 3MV11 5DC4B 1DE4B 3QAZB 4UV4L 4KK5C 2EC8A 4GMSL 4HH8A 4UB0L 2EDRA 1OWRM 3IFNL 1KCVH 2V2WB 4O58H 4DEPC 1OAXL 5FUZL 4JHBA 3SDDB 2Y6SD 1OGAE 5GGVL 1GIGH 5EUOB 4L3AA 1VGKA 2Z4QB 1T5WA 4XVSH 2IAND 2XTJD 1S7WA 4QRRB 5EIVA 3G9VA 4Z5RB 4AEHH 3RGVD 4OLZH 3RVVD 2FHBA 3V6OA 4S1RL 2FHFA 1IGCH 2I9LA 4EUPG 1AJ7H 3O6KL 1YY9C 5HHOE 4CU7A 3LKSB 3U6RB 2PO6D 4TRPH 5BJTB 2HP4A 4GG6F 5FYKL 3R1GL 1UVQA 4CGTA 4ETQB 1JI2A 4L8SA 2R0WL 4HJ0C 4HQQH 3VXRB 1I9RL 1G9NH 4QF1B 5D7LB 4O9HL 1A4JA 1FAIL 5EFIB 5F3BA 1J87A 3X12A 3ARXA 4P5MB 3E2HB 1WGOA 1LK2B 4XP5L 4RGMC 1QOKA 3HE7A 5DFVC 5E8PB 1NFDB 4KTEL 4OGXL 3O2VL 4P9HL 5IROA 4Q9CA 2AS5M 4U6VL 1DN0B 4YK4B 4HWZB 2VDKL 4G42A 5C2UB 1T7YA 3DUSA 5ITFB 4O2FB 3FQNB 3FB7B 1MFBH 1MHPH 3H7BA 4HUVA 2ZCKH 1BFOB 3MFGB 4F58L 1AC6A 4MJ2A 1MREL 5CEYB 5T33H 5F7DB 5FF6B 1S5HB 3QIUB 1LEGB 4P59H 3GJEB 4XVJL 1UWEH 5IOPA 3O8XA 1UZ8A 3UPCA 4JFDA 4DVBA 2VL4A 5D7LA 2HN7A 4LDEB 3MYJA 4A6YH 2XZCH 1D5IH 4KUCD 2QBWA 3E0GA 1QKZL 1N2RA 4FQXA 4N0YL 3VFMB 4YHNB 3RL2A 3NACL 3D6GA 1AXSB 3H3KA 1U8JA 5HVWA 2HG5A 4U1KA 3BD3A 4EBQL 4P2YA 3F12A 4HC1A 2NY2D 4L4VB 1RZIA 3MRDB 1J5OH 4N5UA 1YEIL 5DVOA 3FRUA 1OTSD 5FYJU 3IDJA 2BK8A 4R7NA 2FGWH 5DJAA 5TDNA 1FH5L 4M7LL 2XTJC 2UZIH 3NA9L 5F96H 4TVPE 4P2RE 1RY7B 4NO5A 1F00I 4DZBB 5HHPA 5EZOH 1NCBL 1PG7H 3ISWA 5JW3L 3B5TA 2PXYB 4M1CD 3W5MA 1P4IL 5F72S 2PUQT 3NH7L 3FCTA 3BVNA 4GSDL 4Z0XA 4JFXB 2NX5D 4XXDB 4KQ3H 2V5TA 4G9FB 3GSQA 1RIHH 3N1PC 4AM0A 1YPZF 4WJ5A 4DVRH 1M05B 4YQXL 3LN4A 4YXHH 5DJ8A 5IB2A 4H1LG 1DTUA 3TYGL 2LAGB 1G7PB 2F19H 1HKLL 1N8ZA 3GSWA 2IANA 3RVUC 4UTAH 4G6KL 5ICXA 4HDIB 1E28B 3AAZA 4JPIB 2ENYA 4G8GA 3B83A 1JRHI 2IC2A 4Y89A 3O41B 4RFOL 4KJYA 3VXTB 1G7JA 3BP5A 5D2LB 1K3IA 3QEHB 3TBYB 4EI5D 1MJ8H 4CKVX 3K8MA 3CDYA 4HK0A 5DD3L 4OZIA 4NC2B 4KZDL 1WZKA 3SGDI 4M5YH 3SDDC 2KZWA 2YUXA 3MLXL 5T5FL 5F1SA 4MWFA 3CLEH 2F5AL 1PG7W 3AMLA 5CJQL 5FM4A 4A2MA 5C6TL 1VHPA 4PB9H 5KS9E 3QPQC 1MCIA 5C8JB 5I8OH 4KROC 5HI4C 3VFRB 1AQKL 4NT6A 2HAZA 4M1DL 5DUMH 3OB0K 1A1NB 2VAAA 5FK9B 2AJZA 5C0GA 2WIIB 3TF7C 1HYRC 3OKLA 4M48H 1NBQA 5MERB 3NCYP 4P4RB 1K8IA 3QQ9D 3OAUH 1FFPB 4QRPB 4HW6A 3PDOA 5KS9F 5ITBH 1ZA3A 2PKDA 1GXEA 3R8QA 3MRRA 4QHNA 3V95A 1U8NA 3QCUH 1AXTH 4P2QA 5C6PB 5GZOD 1T0MA 4XBPA 4X4XA 4L8CB 3Q2CA 1BQHA 3TA3C 3QJFB 3T0EB 4P3CL 1AC0A 4APQD 4PD4K 4Z6AT 4Y4HC 3MC0A 4B53A 1KELH 3HMWL 4F7MB 1DL7L 2J5LB 3DIFA 1R24B 2JK5A 3BH9B 5E6YA 1DQJA 1V3JA 2F5BL 2DQCL 4OLWL 1B0GB 1XR9A 5CWSA 4JKPH 5I9QC 1BM3H 1KN2H 3I02A 2R2BA 5E00B 4NKIH 4P3WA 1TJIL 4I0PC 4HFWB 3NIFF 3A0OA 2AK1L 1RVFH 1KT2A 2FEDC 5C07B 4NZTL 2F53A 3QUXA 3ZL4H 2P24A 1Q9OB 4Y4KA 3ZE0F 5JHLL 5FUCC 1NCDL 5TH2B 3T1FA 3MACH 3QDJB 5HDOA 3MRPA 1WFUA 3ZHDA 1ZWIB 2DQHL 3TIEB 3EDDA 1PVHA 5EU3B 1A5FH 1CQYA 1G7IB 4PJ8B 1BEYL 4B7IA 1FL6A 2NX5A 5DI8A 4GG8A 4MAYD 1S3KL 5D8JH 3AM8C 3O6LH 4JDVA 4P4KB 4U1IA 2C4XA 2VR9A 5C09B 1F4HA 4MHHI 3QI9D 3S88L 1XF3B 3RHWF 3LKOB 1XR8A 4JHZA 3BT2H 3FRPA 1WICA 3WNKA 4C58B 2F58H 1PDKA 5ACZA 1NAMA 4K7FB 4OCXH 4JPWH 5JZ7D 1KJVA 3H9SD 2X1PA 4JO3L 3O4OC 2P5WB 1G7LA 1HDMA 1NKOA 3WDJA 4XPHL 2DS4A 3MSPA 3AMKA 3SKJH 4YK4C 3WEXA 4MA3B 4BQCA 1RZKH 3HPJB 3FB6B 3ULSB 1CD8A 2YD6A 4NNPL 3QULB 1BZ9A 3HR5B 5E8NA 4LHUA 5HD8D 3S35L 4JVWA 2ZUQB 2OMNA 5IM7B 3KG5A 1K6QH 3FQNA 3V7AE 3F7RA 2CDGA 2VDPL 5FGRA 3O3DA 5ITFA 3WYRA 2GTZA 3UPAA 1KXTB 1S9XA 4JZJA 2ICEB 4OQTH 4TVPH 3RJDA 1H5BC 2BNQD 1NJ9A 1U8QB 2YD2A 4L3EB 5D1XC 1EDQA 2VABB 4D0CA 4WW1A 2BOBA 5I8KH 4L4TA 4PY7A 5C0ND 3SCMC 3U83A 1EZVY 2E27L 3L7EB 4QO1A 2NY7H 3RDTA 3WNPA 5EDXA 4DKEL 3CVHB 3CAFA 4HFUL 4P4KC 4U7KA 5T1KA 5K9OA 5LGKA 4PJ9C 3VRJB 4U6TA 4LPCA 1NGQL 4P57B 1FG9C 4LCYB 2XZZA 3V0VA 5CJBA 2XQBL 4XMPL 2OQJA 3C5SB 3SGEI 1MJJA 2VE6B 3MFFB 4RFNC 2Q1EA 4YPJA 3RA7L 3RFZC 4LIQH 1FBIL 4DN3H 2O26U 4Z77A 2SEBB 4XPAH 2H8PB 2OZ4H 1J05B 4V2CB 4HS3B 2DWEB 5BV7L 4UT6H 2KH2B 2XN9D 3RI5K 3EBAA 5I1CL 4PV8A 4XAWH 1NDGA 1GGTA 1LO5A 1SJHA 2C7UA 3DI3B 4M9PA 1XGQA 2C4FT 5ACLA 4ZFOL 3FT4B 4JFHD 4NN6B 3TVMC 3MBXL 2YD1A 4S0SD 1FZJB 4YHPA 2GJ6D 2QQNH 4PRIA 5ETUA 4F15B 1JYVA 4I0KA 5A2IH 3F65A 2NCMA 2DMCA 1PZ5B 3FHQA 5JPNB 1QFWM 2UY7A 4GRLB 1Q94B 4NHCH 3ARYA 4LHUG 1BJ1H 1JRHH 5TQ0H 4NFBA 1A7BA 3V6OE 2VZ3A 3TJEL 3FO1B 3FOMA 4TTDC 5KVFH 1ZLUK 2HTLC 4OLXL 3V5HA 4XMLL 1TZHA 3MOBH 3L5JA 1SY6L 3IFPB 1M71A 1UWXH 4FFWD 4PRHB 4P5TB 3UJIH 3CMGA 1CXIA 3WV0A 1XH3A 3IS0X 4PR5B 1G6VK 4LLUA 5DQ9B 4HXAL 3RUGA 2C1PB 2GK0A 4JFPB 1CFSA 3FQTB 3WXWL 2ILLA 4PP2A 3DTXA 1V7ML 3TESA 1NGYB 1UYWL 1S7VA 5SV4A 3MV01 3F8UB 4YHYB 4FQHB 4MB5A 3HE6C 3UBXB 4YO0B 1KCUH 5AD0A 4MJ6B 3WIHL 4LHUD 4XT1C 4YFEA 2D4FA 4JKKA 5DK0A 4Q7DA 4OD3L 5CILH 3E2HC 4DCQB 2VDNH 4HMEA 1YNLH 1MRDL 1YEDA 1EGJH 5C92A 2BNQA 5ICYB 2IADA 2P42B 5DTFB 3QEQE 3OAZK 1UM6H 1F45A 4P2RD 4ZFGL 5B39A 4QHLA 3VE0A 4NN5C 3TO4B 2MPAH 3LKPB 5JW4N 3BOVA 2NW2A 3EYVA 4E41D 1G9EA 3FZUD 1RUPH 3PL6B 1QYGH 1WTGT 4NSKA 5INCA 4Z8FH 2ZJSL 3HUJF 2XA8L 1PQZA 4ZUWA 5H94A 4WFEE 2IPKB 3QR2A 4TSBH 3BQUA 1I3RB 3BKCH 3LQAL 5ILTL 4F8QA 4JRXA 1FLRH 3NTCH 3QNZB 1F3JA 3WIIL 4X6FA 1R3HB 4ZNCD 2B2XL 5GZOC 3L3DA 4L4VE 1UB5A 5D1QA 1JTTA 4BH8A 2HVKB 1BVKA 1VPOH 2HTLD 4RWYH 3O6ML 2BVQB 4LVHC 5TFSL 4GKOA 1JWSA 3E6HB 4OCRL 5E2WL 3BUTA 3LV3A 2QQLH 1ADQL 2VDOL 4X6CB 1Z9MA 3FO9B 4N1EA 2G2RA 4PJDE 1T04B 4F9PA 5DJ6B 3MLWH 3TWCL 4OFKA 2GJ6A 2UYLA 1FNGA 3U4BL 5IHZB 3IU4L 5DEGA 5ISZE 5EOQL 4NUJB 3AVEA 3BGFC 2B1HH 2X4RB 3CXDH 3O3BA 5J13B 5HHNA 1DLFL 3KPMB 4NUGH 1FC1A 2EE9A 1ZHBB 4OB5H 1FGVH 1A02N 1ZAGA 4FQQB 4ZPTB 2UWEA 3O11A 2NQCA 2DQUH 1GCFA 3N50A 4LLMB 4DJMA 1I7TA 1MI5B 4E42A 5LCVH 3NGBB 3WNOA 3P0GB 3G6JB 2A74B 3M1BB 2FDBP 1YY8A 1CS6A 4U1MA 3JV4B 4PJAA 2YD8A 4L8BB 1S9VA 2AERT 1DLHB 3LSOB 2YXMA 1B2WL 2APXA 4U49A 5IWLC 2XFXA 4QHMB 2AP2A 1ZT4B 4O4YL 4ODXB 4U31A 4ZUVB 1I7UB 2HA1A 5EBLA 4ZS7H 4HAGA 4RFEB 1XGUB 3QUYD 2X4PB 3GIVA 3FFCE 4UT9L 4YGVB 5IJKA 5ID1B 3P40A 1DANU 3TBTA 2NY0D 1ZHLB 4UIMB 3C8KB 4CVXA 1M1SA 4MDIB 3AGVA 4KQ4H 5HHVH 3KLHC 3SJVE 2YD9A 4ZYKA 3P73A 2MTPA 3UTZB 4H26A 4O5LH 1Y0LB 1MCSA 1T7XA 3QZWG 2FRGP 3ARFB 4JGUA 1FL5A 1IAKB 4P2RA 3V4VH 5E5UB 1JZ7A 5LWYH 1LNUB 1MWAL 5AUMA 3RGHA 4C56D 3IDYC 4PUBH 3PWPA 1KLGB 5HYQA 3NGBC 5CHNB 3QRGL 1IT9H 1BQSA 3DVNB 3KDMB 1BD2B 1T04A 3HE7D 4XP9H 4MDIA 1A6WH 1XEDA 3SKOB 1KENH 3S34L 3SOBL 3BPCA 3ARTA 2VR5A 5FKAA 3IXAB 2ZG1A 4QXUL 1EZVX 4HMCA 3HI1B 5LQBH 4P9HC 4GMSH 4MNQD 1DDHB 4JFYA 3W39B 4CDGC 4P46A 2V7NB 5F7YC 5I0ZA 1F6AB 5HBBA 4WO4B 3GBLA 1MNUL 5FIEA 1EH9A 1K2DA 2Y5TA 5FFLA 2Z92A 4I77L 4JFDD 4KMLB 2J8UE 2V5MA 3UTSA 3PGDA 3RWFB 2X1OA 4EXKA 3W2DH 4HPOL 5HGAB 4NKOB 5KAQG 1SYVB 3ZDZF 2YBRB 3DVNA 2DLGA 1U36A 5DFWH 3U7WL 3TZVA 1FJ1B 1P7KA 1JWUB 4HH9B 5C2BL 4PJCA 5AZEH 4PJXA 2CUHA 5D7JA 3G5XA 4TUOB 4G6AD 3SDYL 1I9RH 3IAQA 2A6KB 3VXQA 5L9DL 1CZ8H 3ESUF 3UAJC 5KSAC 1KIPB 5HJ3B 1YQVH 2FBJL 5JXED 1CGSL 2EEBA 4JHAL 3EOTL 3UBXG 4TUOA 5C08E 4DFHA 4U6VH 3EYUL 3TN0D 3G9AB 2Z9TA 1X5IA 1UWGL 4JDZB 3REVB 5IMLB 3ULUD 3GSNL 1Q9LB 5AD0B 4GXVH 1Z9OA 1FNLA 3GB7A 4Y5YA 2AEPL 1T2QL 3DX6A 5EA0L 3RBSA 1NMBL 5E9DE 4PGDB 5TDPB 3CH1B 1MUJA 5ID1A 1ZGLM 4XNUH 4F80A 3PJSB 3U82B 1FFOA 4JM2A 4RAVA 4BH8B 1I4FA 3KHQA 3QB7C 5DWUH 2ZSWA 3H9SB 3T77A 1XGTB 4ZFFA 2XWTB 1T1XA 4TPRH 1U58B 4XNXH 2EEDA 1HH9B 4WWID 4Z7NF 5TF1L 4TNWF 3AXLA 4JO4L 2XZCL 2MCPH 3WUWA 4PJAB 1T2JA 1VEPA 3CUPA 1N64L 5JORA 4APQB 4PTUB 1FDLL 2A74A 3QIBC 1N5AA 2O5XH 3DX6B 1S7SA 1A6TA 4EVNA 3MRCB 3JVGC 3CMOL 5J12C 4X5XA 4GBXC 4LLQA 3IFOA 3JWDH 3ARPA 5F7LB 2UUDH 4POUB 5IEHA 2DBLL 4M43H 4DOHB 1MCPL 3SY0B 4OZHE 4YBQD 3KPOB 4QKXB 5IW3A 3ECBA 4PJHA 1Q9WA 2D31A 4FFVD 4HHAA 3S5LB 5GRUH 3ZKSD 4O58L 1AGCA 2DI8A 4X7TA 2EDBA 3QCVL 5MEQB 5GXBB 3DECA 3ECBB 4PJHB 1YZZA 3NABH 1J12A 1HXYA 4ZTPL 3L6FA 1X5JA 3P73B 3CFDA 3NCYS 3QWQB 4OT1L 4DAGH 1BX2A 3D69B 4JRWA 2V5YA 1MLBB 4CJ0A 3MRLB 3GKWH 3G5ZB 4MJ6A 3X11B 1BOYA 5JW4R 4X6CA 3ABZA 4UIMA 4RZCB 2BC4A 3MRCA 4PD4J 43CAB 2EZ0C 4JLRB 4RNRA 3BN9C 4YJZL 4GAGL 5GS0L 2HVKA 2OXGA 2Z92B 3DWTA 3U48A 2Z31C 5C08D 4LAQL 1QLFB 1KPUB 2A77L 4BH7B 1IC7L 1MQ8A 4TOYL 1MLCA 1RUKH 4OZFB 3AU1B 3VXMB 4DGYH 4L5FH 4PP1C 3BUYA 3LIZL 4P2QD 4HSQA 1KFAL 3VRJA 3I3DA 3MV9A 4WI3A 3VRLE 1LDPL 2AJXL 4LSTL 3L9RB 1KNOB 4ZO7A 1HIMH 5CGTA 5DD3H 1RQ5A 2GSGB 3LMJH 4X99B 4D0CB 4HIJB 5FGSA 2ADIA 5J9PB 3ZDZE 4I1NB 5GRWA 1LEIA 4JDZA 1QHPA 4JDTH 3REVA 1NBVL 1MREH 4Q9RH 4PB9L 1BFTA 5I8OL 2RIKA 5HDBF 1U3HC 5CBEA 4GKSA 4WW2B 4YHIA 1QSFB 2FWOA 7FABL 4G5ZL 2GAZA 4HUNB 4M1GH 1A21A 1RJLB 4Z0BL 1DBJL 3T0DA 5IB4B 2Z31B 1C7TA 1G0XA 3FO9A 1QKZH 4RBPH 2IQ9H 5T5NG 3HZKB 4JM2D 1D3CA 2X5PA 2YBRA 4KK6C 4UMGA 2VXUH 1GOFA 1VCAA 4BSVB 1KBGL 3CGTA 4MNHA 5C0AA 1CDBA 3FFCD 4FFVC 1BLNA 5ACZB 2BY0A 1DBKL 3H2WA 3HNVL 4WUUB 5MENA 2DQJH 3QFJB 4HS8H 1XR8B 5F9JB 3DYOA 1PX3A 4KK5D 5F96L 3B8SA 3HNTH 3RVWC 1CTOA 3LQZA 3KNBB 4M7KL 4X4MA 5F9DC 2RAMA 3O4OB 3BZFA 3Q1SL 3EYQC 4GO6B 4OLYL 1IQDA 3V0WH 2E9BA 3LN9A 1A1MB 2R0KL 1DLHA 1TZHB 1TJGL 5C0BE 2ARJB 1NAML 3AS0A 2B4CL 4Y5YB 4AQ1B 2W38A 4NC0B 3N9GL 2NMSA 1CGXA 2NW2B 2VOTA 1S5IH 5FYLD 4L3EA 5A3IC 1TQCB 2DD8L 2FJHA 2VKWA 2X70A 5E94B 1YMME 3QUZC 4KGLA 3BW9A 1KT2B 4IHOB 5HYQB 1C1EL 4KGJA 4YXHL 5CP7B 1ZT7B 1EFXA 3TYGH 5EUKA 3BEVA 4XHQA 5L2KE 2BXZA 3HTLX 1AGDB 4U05A 4KWUA 2VR4A 4H5SB 1A4KB 4FQPA 4OGAD 2FO4A 4HUXA 1SMOA 2UV3A 3V7MA 2P46B 4HUKB 3PP3K 3SDAD 1Q72H 1RZFH 3NCJL 3L3IB 3MLYL 4MNQE 1TVBA 5DEGB 2X4SB 5DK2B 4Z95L 3OKMA 5FCUH 2GFBB 2E8YA 4Z7QE 1V3LA 4WI2A 1MCWW 3MXWH 1GZQB 3ES6A 2IGFL 4Z77B 3WFEH 4R3SA 1GGYA 2D3VA 3MLXH 1A8JH 4OCXL 3MFFA 3WE6A 5L2JB 1LGVA 4HKXA 2PW1A 1SVCP 2LV4A 4LKXA 1RMFH 1SVZA 4JVUA 3BXNB 5TQ2L 2VQ1A 3TA3B 4X4ZA 1MCBA 2LE9A 4LF3A 5HGHA 4IRZH 4PRPE 4NDMA 1OPGH 4N68A 1FN4B 1P69B 3O0RL 1GGCL 5GRYA 3STLA 1JNLH 1V7NH 3EJJX 4UQ3A 3VWJD 4KUZL 4TSCH 5C0GB 1N7ML 2FGZA 3MODL 5BMFH 1OP3H 1JHLH 4PJ7E 4LOUC 5CZXD 3ARBA 1IILE 2EO1A 3G6JA 3M1BA 1BQHG 4CMMA 4LCWB 5DHVB 4BSWB 3EUUA 3LEVL 1CGWA 4DZ8B 3QCUL 4DWHA 4FXLA 3FHAA 4HKBB 3VXRD 1FPTL 1R0AH 2P5EA 4KRMB 4G6ML 3RBGA 3PWPB 3IDNB 4UIKH 4XPTL 2R4RL 1OTSC 1EO5A 5JLZB 5ABDE 1U8KB 3EO1B 1EAPA 3QHZL 5HHMB 3WSQH 3RPKA 3WL9B 1DBML 2AXHA 5EO0A 4CN6A 1B6UA 4KHTH 2HT3C 2DYPB 2J88H 3C2SA 1CG9A 1K5NA 3QXTA 1NGQH 3MV9E 4G9DA 1OP3K 5KN5A 4MX7A 2GJ6B 1F4AA 3VA2C 4X6DB 5C0FA 4ZFZB 5KSUB 3HI5L 4YBHA 4TN9A 1JWSB 3E6HA 1CFTA 1S7RA 1ZHKB 5GGUB 3TT3L 4HLJA 1CDUA 3IJSB 4ERSH 4JHWH 3GSQB 4RCAA 1FO0H 4WW2C 5FDWA 2YD3A 4NC1C 2VLJB 2VNCA 3HRZB 1EFQA 1P7QA 4LAJH 3MTRA 5SWSD 3DJ9A 4PJGA 3IU3A 4I9WE 3A6OA 3O6LL 4XVTL 1BGXH 1BAFH 5TE7L 4HIXL 5I1DB 1GIGL 2VABA 3UO1H 4JFFB 1J10A 4XVSL 3V5HB 2G5RA 5I30H 5IR1B 3OKYA 3S37L 2XWBB 3LEYL 3GI9H 1KB5L 5F9WC 5DMKB 3ZKNC 4JZJB 4IIQB 1C12A 4OKVB 4W6XB 5DMJB 3BKYH 3LKPA 2ZUYA 4JPWL 1JMZA 3FKUS 5F88B 4I2XE 1BIHA 4OZIB 4QGYA 5GHWH 3I6LD 1CICD 2JELH 3PQYE 2R29L 4WI5A 4K71C 4XVUD 4WGVB 4AENA 3SDAA 4EDXA 3ARDD 4OI9A 4E41A 1B0WA 1B9ZA 2FB4H 4WHDA 1C16B 1BECA 3FB6A 1EAJA 1T6WA 3OG6B 1GOHA 1FNEA 2AXGA 2B39A 3K80A 3QP3A 4ODVH 1IAIH 4N8CL 3UBXA 4Q58C 4J8RB 2QHLA 4P2QB 1J8HB 2Q6WA 2CXGA 3FQUB 1UKQA 3GMQB 5KVMC 4TULL 3NMEA 4H0HB 1WWWX 1CD0A 3O6FC 3M17A 3P30H 1H8NA 4PJ7B 1WWBX 4R90H 3VWJA 5DR5L 5ALBH 4IIQA 4PJFF 1U8PB 2DKMA 4EN3A 1VFAB 4APQC 1U6AH 2VLRD 3D18A 3MJ9H 4M6OL 4R26L 2VXVL 4LPXA 2NY5C 2F9BT 1TETH 1IAMA 3HMXH 2Z93A 4NSKB 3G6JF 4GMTL 3MCLH 4XMPH 1NCWH 5C07A 2YOCA 5JNYA 2BJML 1C5BH 1KTLA 4FQJL 3F7VB 4HIIA 3EOAA 4GRWF 4JO1L 4U2YA 5B39B 4PFEA 4F3FB 2VDQL 3VFMA 2ZJSH 5DHXB 2IALB 3HA0A 1W8OA 5EIIA 3S96B 4JG1H 2F54B 2V17L 4X6DE 1N26A 4ZD3H 1WZMA 1DUYB 3PNWB 2IFFL 5J57B 5GPRA 2WWKO 3ZDYF 4KU1A 1KULA 2J2ZA 4RA3A 4JG0L 3NVQA 5EWIL 5GGQH 1XGQB 1E4KC 1AGEA 3LB6C 4WI7A 5IOPB 2PR4L 2UZYB 1LEGA 1A3RL 3UTTE 4HS3A 1YMMB 3JUYA 4FABL 3FJTA 3MUJA 1G7LB 5TFSH 5E2WH 5GISH 2BSRB 5D7JC 4P2OB 3RUGF 4FS0A 3IDNA 5GGRY 1G1YA 1P7QD 1AE6L 5D5MB 3MLWL 4EKXA 4NRXB 5JOFA 4J23A 3R1GH 4JAMA 3P3YA 5D2NB 4WEBH 1A7RH 4L4TE 1LO0H 4JN2A 3V6FB 1I9EA 2OR8A 1NFDA 4GG8B 4HCRL 3C6LA 4MA7H 1M71B 4OZHF 4NT6B 2P1YA 3ARVA 3RKDC 2VLKB 1XIWD 4ZO9A 1FNSL 2H2SD 2IBBA 4LRIA 2FR4B 1MCJA 2CK0H 1UJ3B 4MHHG 3VD4A 2HT3D 1EHNA 5E2VH 5TE4H 4U6YB 3DO3A 1FCGA 4OCSH 3T0BA 1I1YA 3KPRA 2P24B 2VZTA 4UOW0 2A83B 4AIZA 4AEEA 1N59A 5JOFB 1FVEB 1Q38A 2WQ8A 1FL3A 4FZ8L 5DJ0B 4WNQA 1I1FA 1GOGA 4RMVA 4Y19B 5C9JB 5J1AB 4NPYA 2A6JB 3KHOA 1YNKH 5D6CA 5F6HJ 1S78D 2EXYC 3ZKQD 1ODAA 1SBBA 5E8NB 4GQPH 5LXGL 4OD3H 5CILL 4NN7C 1BZ9B 1N4XL 5KSAB 5HSFA 4J3XA 3OG4B 3QDGB 4TUKH 1G7PA 4JB9L 4JKLA 4OSUL 3HB3D 3KYOA 2AJUH 3RY4A 5F7DA 1BQLL 5ESQB 5EU6E 1JZ3A 4UT9H 2WINA 1AR1C 1SHMA 3S6CA 1RUQL 1J05A 1NEUA 4H5SA 5EZLB 4X4XB 4L8CA 3H7BB 3ARZA 3BAEH 5SWZE 1P9MA 4NNYA 3SGDH 5EIIB 4M6NH 4WNQB 2VLRA 1BWWA 3IGAA 4F9LA 1LO4L 3Q3GA 4S1DC 1P7HL 2ESVE 3AC0A 1HHKA 4D0DB 2BXYA 4KRLB 3TBSB 3UTSD 5SWSB 3BKCL 2FGWL 3G04B 1P4LA 5MERA 3X12B 2D7PA 4R96B 1N6UA 1QFPA 3QXDB 3V4VL 3FFDA 3ARDC 3RDTB 1A1MA 5SX5K 4WHTB 5L7XH 1TJHL 3UYOD 1KSRA 5F71A 2PYEA 2R0ZL 1AKJA 4Y4KB 1NJ9B 1U8QA 4GW5A 4DN4L 3HLAB 1ULVA 5EOTB 1QVOB 1ZA6B 3BD4A 1X7QB 4EIGB 5BRZD 2XXCB 2EYSA 4W4OC 3RKDD 2FX7H 1KLUB 4OGYH 2DQDL 5B21A 5FHBH 2ITCB 4HZAA 4BSVA 5F9WB 5DD1L 4MA1B 1I8LA 1S9WB 2YMXL 4K94H 5HGGS 5LBSH 3HPJA 3QO0B 3UYPA 4Z7WA 5HGBA 1KB9K 4OZHA 1KEGH 2O5ZH 1HXMA 2XI9A 4Q0XH 5D8JL 3ULVF 4P3DA 1KJVB 1O7VA 4LSQH 2Q8AH 2OSLA 1IAOA 5CIPB 3QCTL 3BGFB 1QSFA 2FWOB 3V5DA 3BT2L 1NFIA 3KPNB 3VFNA 4M9OA 2Q7YA 1BBJA 1XF3A 3BO8A 4JN1L 1U41A 4NQSB 4WTWA 5BV7C 4GAYA 3CFBB 2YUZA 3BGMA 4R4ND 3CZFB 3WS3A 1AQKH 3OKLB 4M1DH 2APFA 5DUML 3B8YA 5HHPB 3UBXI 2NY2B 2AK4E 1IM3B 5J12B 1OSZA 3KPRD 4LIQE 3T0EE 3LH2H 4MJIE 1UVQB 4XPBL 4XTRC 3RHWK 4WU5A 3T1FB 2GUOB 2YHGA 3V5KB 1REIA 4IRSD 1SYSB 3U9UB 3Q5TA 1ERNA 4IOFD 3HRZA 3VXMA 2WP3O 4JANA 4HX1A 2W65A 4OQTL 4R0LB 2VN7A 1D5ZA 1MCCA 3VXOB 4Y2DD 2PTTA 1U0QA 2DLIA 3VXTA 4M5ZL 4R97C 1ZLSH 5IJVA 3TEUA 4O5LL 3DROA 1R5WA 4JM4L 2DM3A 3MYJB 3IFLH 3T1WA 4DKEH 5FV2A 5E56A 1L0YA 3B9KC 5TE6H 3L1OL 4YE4L 1N5YH 4KDTA 3KYMB 5C08A 1KCKA 5CMAA 4GRMA 4E41B 5CEYA 3BP6A 5KOVC 2NR6D 5SWSE 4WHYH 3CFJB 2Q7YB 3KPOA 3TBWA 4XP9L 5EPMA 2Q76B 3MUZ1 2DQIH 2J8UB 3DRTB 2OSLB 5E2TL 3WLBA 1OF2B 4HJ0D 3FT2B 4QXUH 4E9LA 1M7XA 3S36H 3ZE2E 3R4DA 2X4TB 2E8ZA 3W82A 2IH1A 1OSPH 3KYNB 5D7KD 2D9QB 2PYED 3KWWA 3K1DA 2PO6B 1I7ZA 3HE6B 2F74B 1BZ7B 1F02I 1EMTL 5C8JA 1PGRB 1BPVA 4ZOEA 2YSSA 2R1XB 5C7XL 5I1AB 2CRYA 1MQKL 1CL7L 3H9SE 4XI5D 5BRZA 5ALCH 3MRQA 1TVHB 4EZMA 3LHPL 4LF3B 2YPLB 1AH1A 1YA5A 1ORQA 4BZ1H 4TNWK 3VMPA 5SWZA 2HMIC 4P23A 3MUGB 3RL1B 5IK3A 1KV3A 4G8FA 3TJEH 4ZXBB 4Y16A 3SKJL 2JB6B 1S7WB 4GKNA 4G8GB 3JTTA 1BBDH 1LO2H 2WSKA 5BV7B 1T83A 3I6GA 3FB5B 3VXSD 1QSFD 2V2WA 5K33A 2FHCA 3EYOA 5DJ8B 1SEQH 2XOTA 1OOAA 3G5VA 4JM2F 2WUCL 2ZOKA 5DYOB 4XNQA 4LLAA 3WXWH 1MCRA 2D0HA 3QEUB 4HV8A 1D7FA 5K9QG 4F57L 4TVPL 1KB9J 3OKOA 2OS7A 1NMBH 4TTDD 4DZ8A 3WJLA 3RZCB 2X70B 4FNLH 2FJHB 1EEQA 3WDHA 1YY9D 1G7HA 3WIHH 1MEXL 4IRSA 2VAJA 5MEOB 1IC5H 3U7YL 3QDGA 3GSRB 2Y5TB 4NHUB 4HFUH 5DSCB 1A4JB 1KTRL 3KXFE 3GEWB 3T3PE 4KV5E 4YDJA 5DD0L 1OL0A 1EFXD 3FRUB 4WENB 2LABA 3O2DH 1MCEA 1F3RB 2ENSA 5J6HA 4O2EB 3TV3L 4NJ9L 3GSUB 4U1LB 5T3ZH 1QO3B 5F9JA 4K8RL 3RA7H 1FBIH 2A6IB 4ONOA 4MZ3A 3T3PF 5C0CD 1DBKH 5E2UL 1XZ0A 1VB9A 3SDCC 2FR4A 2XA8H 5JHDE 5HVGB 5LAXA 1IL1A 3BDYH 3GJEA 3Q6GH 3C8HA 4UV7H 3QHTC 3NABL 1QSVA 5ISZB 1HHKB 4D0DA 2Z31A 1RD6A 2WUBL 3GBML 4I48B 2W9DH 5M94B 4JFZL 4OCYH 1WIUA 2O61B 1NGPL 4PREA 1YMHB 3PWLA 3UTZA 5B3JE 4ZUSB 1ONQB 1CVSC 1H5BA 1Z3GL 4R7DB 3TWCH 3U4BH 1QA9B 4NQCE 3MOBL 4J4PA 1OT2A 1FYTA 5HGDB 3PV6A 1IC7H 5EOQH 3FFCB 4OD1H 5KSAA 1E4XL 5GGSA 8CGTA 2GIYA 4PRPB 2PTVA 2V2TB 3BJLA 3VXRA 1QBMH 3VI4F 4Y16B 4HXAH 1IGMH 2CKBH 5F3HA 4JQIL 5E6IC 3CC5A 2AXJA 2HWZL 1RK0A 2MFNA 2Y23A 4LCCC 1N59B 4JREC 3TCXA 4BH7A 3RAJL 3NIDF 3FQRA 4NFDA 2D4DA 4GW4B 3VFTB 1IZJA 2VISB 4KXZI 5F8QC 2IH3A 3C2AH 1TQBC 2R1XA 3MLZH 1I7RB 1QLRB 4MNQB 1ZLVK 1ES0A 5DJDB 2Y07H 3LQMA 1KCUL 4URTB 2MJWA 1X5FA 3C09B 4C55A 3MRKB 3MLUL 4QGTA 4G5ZH 2CLVB 3U1SL 2Y7QA 3DX7B 4HJJL 5JIHA 3UJTH 4LLDB 5C0RL 4FMKA 1VFMA 1NCAH 3WFHB 1DE4A 2UWEB 1K4DB 2DAVA 3PP4H 1MIML 1N7MH 3H42L 2IG2H 5I76A 2OJZH 3ROLB 2D03L 1YEJH 4EUPA 2YWZA 2OMBA 5HHNB 4K9EH 3P77A 2BCKA 2J6EH 5JHDD 3GMOA 1VEOA 4K8RC 4B0MM 3NCCB 1HEZB 2YA0A 2Q3AA 4WV1C 4GRMB 3DBXB 5C0BB 3S3PA 4ZUUA 4RA0C 1VFBB 3EYSL 1ZGLB 3TO2B 2EECA 4HF5L 1S7UA 3EJZD 3QHZH 4JCMA 4RGNC 3C60A 4K23L 5CEXA 3PWUB 1DBMH 1EHLH 2XT1B 5KG9B 4XP1H 1PKQA 3MV9B 1FSKC 5LWYL 4NGHH 4GG6B 4YHML 5ACMA 2BOCB 3BUYB 3T04D 4QYOA 3QNZA 1A7PH 5F1OB 4G80B 3VXNB 4LNRA 4IRJB 4N8VB 4U1HA 2OXHA 1DJSA 4M00A 3V4UH 3QRGH 3BIKA 5EB9A 2B0SH 3RWEA 4ZUWB 5H94B 4NRYA 3U9UA 4JHWL 5ELIA 5TF0A 2B5IB 1KENL 3S34H 4JLRA 4RNRB 2YZ1A 1KUMA 1QPXA 1BF2A 1ZHNA 4O00A 1IM3A 2EYTA 2R56L 3IU4H 4JGJA 4OZ4B 3KYKL 2QSVA 3QAZC 3STZA 3CVHH 3QEQB 3TNNA 3K46A 1CFVL 1J0ZA 3O3AB 3PABB 1U8PA 1BJMA 1HXYB 1QRKA 2H3NB 2K1MA 3CPLB 1MFAL 2AJYH 2NTFA 5D9SB 5JDSA 1YN7A 1Q72L 1RZFL 3OXSB 4XVTH 4NM8L 4PJ7A 1U3YA 1KJ2A 3QUMH 4WI6A 5TE7H 3U36A 5T3ZD 4JFHE 1KTDB 3UTPE 4NO2A 1KIQA 3QRFM 3VFNB 5FA3B 5TJWK 2Q6WB 3LRHA 4DW2H 3PP3H 3L3HA 1SEBA 3VWKD 4NZUH 3L5HA 1LE9A 4H25A 4WFFE 3LVEA 5CAYB 4IS6B 1FZKA 2AXGB 4CVZB 5C07D 2DICA 5C0JB 4WU7B 5I1LA 4IRZL 4LLYB 1S9WA 2EDJA 4RISH 4CVWA 3O0RH 4HKJB 5DD5L 4PTTA 5EORH 3H7LA 4F33B 3OR7A 2EYSB 1CGSH 2ADJB 5MHSD 4OFVA 2JJTC 4XBEL 1DBBH 1TFHA 4K2UH 4L8DA 5EOTA 2EIDA 2CR6A 4GW5B 5F7WC 4ZSOE 4EJ1C 5J6GA 2R2HB 1TZIB 4D2NA 1OGTB 4QRQA 1T2QH 2DYPD 4X4YA 4WHTA 4IMKC 1S9YA 3OX8B 4LPYA 4XPTH 5B38B 3O6FB 5DR5H 4PJGB 2OR9H 5GJSL 4LLVB 1FFNB 5IVOA 2GCYB 1UCTA 2J1KA 1GAFH 2MQ0A 1KCSL 2DTML 3O9WC 5C1MB 3W9EB 1FGNH 1J7VR 1A6ZB 1JUFB 4X8JB 3IDIA 1EERB 5J1SC 3RWJB 5DK3A 1U2HA 3LD8C 1YPZE 4M7ZC 4EDWH 3HI5H 1JYXA 4W4OA 1JGEA 3L3GA 1CGVA 2ATKB 1FDLH 2VL5A 4WI9A 1VSCA 5I71B 1OGAA 2BNUA 3C60D 1WBZA 1MFEH 2W60B 5CSZB 4MD4A 1OQXA 5A40E 1Q9KA 4MNGA 4G9DB 5KN5B 5DJXA 1HOCA 4H0IA 2V17H 1PSKH 1JGEB 3L3GB 4G3YH 3A6BL 1U91B 5A16B 3PIQB 1DQLH 1MJJB 3DV4B 3VH8B 5MI0C 1UXWA 1BD2D 3RWJA 2OBGA 1HKFA 2EC9T 5CINL 1JFQL 5IBTH 4ODUA 1A6ZA 4UNTA 2EO9A 5DHYA 1U3HB 2BVPB 2CPCA 4JFYB 4HIXH 2AXFB 3LPGA 1AQDB 2N56A 5E9DB 1QSFE 1G6RL 3RP1A 5HXMA 4I77H 3BEWA 3KPPA 5HHQA 3WKML 2GITA 5I1KH 4LPWA 5L8LB 5F21B 4MCYB 4PIRF 3VFSA 4RQQB 1IM9D 4NQCA 1WCQA 2N4IA 3WFDH 3STLB 5IT2H 4M62H 2FB4L 4R4BA 2MCG1 2DQTH 3GMLA 1R3IH 3O4LB 4ORZC 2M26A 2VQUA 4JHAH 3VWKA 1K4CB 3MA9L 1OTTD 3FMGH 3PWJB 1UZ6E 4Z7UF 4HBCL 2CKNA 1OAUH 1WBXA 3OHXB 3QXUA 4JKMA 3MRGA 3PXHA 3BHBB 2GFBA 1QLEH 3VRLF 3BPNC 2G2RB 1F58H 4X5WA 4EQ2A 1EEYB 1OB1A 4I0PA 3UTTB 4QRPE 1AKJD 1AGEB 3INUL 4XNUL 1RIVH 3VXUB 1JZ6A 3EO0B 4JO2L 4PS4H 4D3CL 2ICES 1F8TL 5FA3A 2BVQA 4LARL 2UVFA 1RJYB 4G7VH 3KLHD 3LKOA 3KS0J 4W6YB 7FABH 3QUZD 4X8JA 3HFMH 3GMLB 1QQDA 1INEH 1YDPB 2FIRT 2FZ3B 2IWGA 4JQXC 5IKCB 5KTEL 4ACPA 4RRPA 5C3TA 1NCCL 2Z8WC 4OCWH 1KPRA 1LWRA 5GRVK 3VI4E 4XZUA 4RWHA 4BK4A 2HKFL 2CIIA 3L5XL 4HXBL 3LRSA 2AK4D 4MJIA 3TIEA 3IKCA 3QISA 4OLZL 2W92A 4Y1AE 1A14L 1NC4D 5D2LE 4IEFB 1UM5L 3BEWB 1BMGA 3KPPB 3S4SG 4FTVD 2ZKHH 3VWKC 3QNYA 2X42A 4V1DA 4ZD3L 3EJYC 4U0QB 3DUHA 4LLMA 3C08H 4PJ9A 4U1NB 5FYJL 5JMRA 3B6SA 4PJ5D 4YAQA 2VITB 3SKNA 15C8L 5DHYB 3IVKA 5F7MC 5EU6D 1GC1H 2CLZA 4Y5XB 2IADB 5F7NC 4BELD 3G5YB 2DM4A 4MCZB 4Z78B 1AD9A 3EGSA 4OLYH 1FYHB 1P4BH 2EDOA 4OT1H 5A16A 5DUBA 1AXIB 1C08B 3FONA 2CXKA 4PV9A 1GZPB 3L3KA 1K85A 1ZLVH 3W9DB 5D5ME 4U7MA 1S5IL 4OUOA 4OIIH 5E0QA 5SV3A 1S7QB 4KK9D 5F1NA 4RX4A 2F8VA 1IAIM 4XNZC 2WWMC 1MLBA 3ZYOA 2MKWA 3ULVC 3TVMA 4HUUB 1A9BB 4XVUC 4W81A 3GMNA 1O5DT 2NXZB 4Q9QL 4Z78A 3U36B 3AS2A 2MQ3A 3DGGB 3G5YA 4MCZA 4K7PL 4LSRL 3PDOB 4OCMC 4X6FB 1EBPA 1LK3H 1X5GA 4Y8AA 1CFSB 2VZVA 1V3KA 3JV0A 2O5ZL 4JJHA 5EC1A 5JPMA 1UC6A 4X9BA 3RUGB 3VW3L 2VITA 4R2GD 4S1QL 3STZB 3NFSL 2ADIB 5BQ7A 5J9PA 5E2VL 1WQVT 2ICWA 4HK3N 1UM4H 3CFKB 1BFSA 3TGXA 3RI5F 1IGIL 3CX2A 1KGCE 4KI1A 5IMMB 1GH7A 2J6EA 2NY3D 1G9MH 4FZ8H 5I2IA 3FO2A 1A0QL 2DWDB 4JFOB 5JORB 5DA4A 4K55A 5I18L 1DANT 4OI7A 3BWAB 1NBVH 1XF1A 3ARFC 4Q9RL 2X1WL 4ZXBD 6CGTA 2DM2A 4YXLL 3GBNH 4G80A 4PJEF 5EC1B 2ADJA 5JPMB 5DRZB 1FRGH 1QR4A 4AK1A 5HPMB 3GMPB 4JB9H 3CC5B 2MHAB 3DGGA 2LU3A 3RDTC 2ORBH 1I4FB 1ZHKA 2HRPH 4I0PD 2BDNH 1NDGB 1RZGA 1S7QA 1UB6B 1P84K 4M6NL 4XWGL 3EO9H 3D25A 3QUZA 3BSZH 1YUHA 3SDXB 3HAEB 1Q1JL 4KXZH 3HNVH 4JRXE 4BM7A 3BE1L 4C83B 4KAQL 4PJEA 3BPLC 3MLSH 1YN7B 3OXSA 5HPMA 3V0VB 1Q0XL 3HNTL 3CPLA 5DRZA 5HHME 4KHTL 4GS7B 1WT5C 5E4EB 5IIEA 3VGHA 3VGDA 4U1NA 1F2QA 1VDGA 3OAYH 1YPZA 2OYPA 2OTWA 4JRYE 2YD7A 1Y6MR 4X6BB 1U8IB 4DN4H 4D8PA 4GQ9H 12E8L 3GHEL 4NRYB 2VTFA 2YC1A 3B9VA 4AQOA 1OTUD 5DXWA 3RPIB 3UTPD 5EU6A 2ZG3A 5T5FH 2I60L 2JB5L 4U1KB 2CIIB 3VXNA 3BN9D 5CGYD 4I3GA 1DR9A 3PWNB 1KXVC 4PYHA 2FEEI 5JPNA 5GJTL 1PZ5A 5L2KA 4GG6A 1ROWA 1XF4B 4XNZB 3JWNC 4P5KB 1YYML 3C60C 3I2CL 5CJ5A 1TIUA 4KI5E 5I1JH 5FO9B 3U4EA 1C5CH 1U91A 2Y1VA 3QDGD 1T3FB 2P4AB 4QOKA 2QADD 3W5NA 1MCFA 5ITBL 2WK2A 2NW3B 3FQWA 4L9LA 2IGFH 3ZTNH 1MHEB 3SO3B 5DJYB 3HE7C 3BKYL 1PLGL 5FYLL 3ULVL 1IEAA 5DUBB 5IROC 4NOBA 1H15A 4ALAL 2KBGA 4MB4A 1CE6B 1EXUB 2ICWJ 2O5YH 1K4CA 4POZC 4Y5XA 2VMFA 1CXKA 4LSSL 4ZS6D 4PLOB 1JUFA 1YJDL 1RURH 2IAMC 5HYJA 3D48R 3OKNB 3WFHA 3TCLB 4DFIA 5IF0A 1ZT7A 5D9SA 1JNLL 3PL6C 1SEQL 4PRDA 5E5RB 3MODH 3N1GC 1D9KD 1JHLL 5ANMA 3VXRE 1W2KT 1G84A 5HGAA 4Z7WF 3ZKND 3L7EA 4F9PC 1CLYL 4QT5A 3TBTB 1VACB 5F6HI 2ARJA 2EIEA 2C9AA 2XNAA 1MHHB 1OWWA 5E03A 4OLUH 2ED8A 1KIUA 2UWEF 3HZVB 5I15L 1T66D 1TITA 4IRJA 4N8VA 3UCRA 3U4AA 2WWMD 4R97B 4ZTOH 1YDPA 5D7KE 2H1PL 5TPWH 3GIZH 5F9AC 1VGKB 3MJ9L 4M6OH 4WEMB 4R26H 4WUUA 4JPKL 3GGWA 2QADB 3JV4A 5BRZE 3C5JA 4HC1H 2A1WH 1LEKB 1NEZG 3TYFB 3KPLA 2JJSC 2HT2C 3MCG1 3VG0L 3P0VH 4E42B 4MVBC 2DL9A 3BYYA 2VDQH 1U8NB 2J8UA 2X89D 5GRVL 5ADPH 2V9RA 4DKFL 4YHKL 4S11A 4NO2B 4FFWC 5HDBE 3RVTD 1FP5A 1RZKL 2GTWA 3Q6GL 4HIEB 2NTFB 3GK8L 4FQIL 3ZHKA 2H2PD 2DRUA 2QHRH 4ZYKB 1DP0A 1NGZA 5CJOH 1FNGB 4X6DF 3S35H 5E8OA 3DMMC 1GGBH 1KJ3L 2HKHL 3GI8L 1MH5A 2WW8A 4F15C 3LHPH 5I30L 3SDAC 1H8OA 4OZGE 2Z8SA 2VWEE 2Y9RT 2QTEA 3VXSB 3QZWA 4YDLB 5IVXE 5IB1B 4ZS6C 3F7YB 1IZKA 3Q5OA 4BA8A 3GSVB 4P2OD 1I8IB 5A43C 3MNWB 4GOSA 5JHDA 1LO2L 1OARL 2EIZA 2NY7L 4ODUB 4X98A 1EVTC 1A7RL 3I02B 4F33A 1UXWB 1D6EA 1T89A 1QBML 1SYSA 2E7LC 1B0GA 1XR9B 3RX5A 4HKJA 4UINL 1J11A 4MD0A 4U1JB 5KG9A 1SBSH 5CLWA 3MQIA 1OSZB 4WIQA 1MVUA 3IXTB 1CU4H 2PNDA 1T0NA 3QUKB 4PJHF 1IAIL 4N8CH 1UKSA 3RU8H 1D6VL 4GUPA 3RWCA 1H3PL 43CAA 4K07A 4F7EB 4OZIF 4F37F 3WMSA 4HKZA 4XCEB 3CFDB 2H32B 5HYJD 3GMOB 2GHWB 1KIQB 3LN5A 4HWEH 3HC3H 3HC4H 1OTUC 3ZT7A 4XXDA 5K93A 5C0IA 4HJJH 3RVXC 1NCAL 3BFOA 1PD6A 4FTVE 1E6JH 4QXTB 3TNNB 1MCWM 2VXVH 2W59A 4OSUH 4M1CC 1OP5K 4X7DC 3IFOB 2R2EB 3ARFD 3V52H 1W72L 1FE8H 3BZ4A 1LDSA 2EKSB 5FKPA 5FM5O 4PTUA 3LCYA 4APQA 3IRPX 4Z7VE 5E4IA 5HI5C 1I3GL 2AQ1A 3MROA 4E0RA 2GK2A 3DPBA 1YYLH 3WN5C 3EYSH 2E3VA 3QEHA 5D2LA 1Y6KR 3UMTA 3DV6B 1MWAA 3MRBA 4PRNB 3NPSB 3UTTD 3DX9A 3C6LC 4XP1L 1CICB 4OGZA 3U0PA 1WEJL 5DRNB 1I7ZB 3HE6A 3PWUA 4F7CA 5IESH 2X41A 4WEUD 5FOBB 3FFDB 1TCRB 4LCWD 5GS0D 3QIBB 1BREA 1HH6A 3T4YA 4OQ1A 3ARGB 4I3RL 4MAUL 3WUZA 2W07A 2EE6A 3BJ91 5ISZD 3MJ6A 5C3LD 4HUVB 2O61A 1QFUL 1RIUL 5IFJB 1WWCA 5EUOF 5AWNL 3UX9B 2R9HD 1KC5L 3DUUA 4I48A 3D3VB 1LO0L 4K3DL 1CFVH 2Z91B 1M6OB 1W0VA 2YMXH 5DYOA 2ZOKB 2WZPD 4OZ4A 4E5XA 1HSAB 3L7FB 4HH9A 1QG3A 1KEGL 1FNSH 4YPGB 4P5TC 3DO7B 2Y25A 1OP9A 4Q0XL 4JJ5B 1JGVL 3MMEB 1UCBH 5TE4L 2VN4A 4LSQL 2VXTH 1T03H 1JPGB 4OM0H 3QWRD 5CKGA 2A6JA 3SE8L 1PEZA 4OI8A 1U3JA 4FZEL 1S7TB 5D1QC 1FVEA 4J3WA 4Z8FL 1F42A 1I1YB 3ILPA 3LKQA 2G60L 4X80H 1RZ8A 2A0LD 4HS6B 1U8MA 4PJAE 3RWGA 1VESA 4V2BA 5HYFA 3DSFL 1BZQK 4NQEA 4H8WL 4U1GC 5DSCA 4K3HA 3GSNA 3BPCB 3CDGA 1ZV5A 4KMQA 3U30B 2YK1L 4D9RE 3SKOA 2VUOA 3NIGF 4L4TD 4OTXH 5KVEL 3TNMA 1GPOL 2P8PA 2W0LA 4FFZL 5CFHA 1A7NH 1BFOA 5K9JH 3BZEB 2CUIA 5HVHB 4O02L 3O3DB 1UA6L 3PL6D 5T1KD 4OZFG 3EFFB 1BF8A 1JGLL 4WVRA 3TBWB 1QD0A 1M7DB 4LHUB 1EV2E 2GY7B 3WHXB 1ZT1A 4DGIH 5DEFB 3TIDB 4XNQB 5H8DA 3QULA 3ARFA 3RWHB 5IBLD 1TQCC 1IC4L 3T2NH 2OP4L 2P44B 3KYMA 3B9EA 5E8PA 4Z76B 1RZJC 1HILA 5EN2A 5MHSE 3CDGB 2G5BB 1P5VA 4OD2A 1FGVL 1TJHH 3C8KA 1T66C 4CVXB 3LS5H 2DQUL 4MXVF 1CK0H 1UG9A 2ZUUA 5GGVY 5IK3B 4Z9KB 2NXYC 3FQRB 1I1FB 3LKSA 1LP9E 2VLMD 1P1ZB 4LCIL 3QDMB 3X14B 1AY1H 5ECJE 5E2TH 1FG2B 3WD5H 3KPRB 1AKJB 2ZWLT 4HWBL 4GXUM 3EOAB 4G3YL 4HX1B 1CR9H 4Y1AD 5KZCD 4MXVE 3HNSL 5FV1L 2YPVH 1MFAH 3VFWB 2AAVA 3MGAA 3EAKA 4LSDA 1X5AA 3KWWB 5TH2A 4OAWB 4MJ4A 5GS2H 4E5XB 3VI3F 5IG7B 1Q9OA 4ZUSA 3HG1D 4AEHL 1X5HA 1HNFA 2H2SC 4KK8D 3RTQA 2BNRD 3QUMA 5EBWB 2Z8VC 3IGAB 4NIKB 3CLFH 4NZUL 5DS8B 4GAYB 2X9YA 4HULB 2CD0A 1FQ9C 3AS3A 1NANH 1AGFB 5E00A 4WTZA 2DDQH 2R23A 1BD2E 2IQAB 4LBEB 4MJID 4AEFA 2XWJB 3NZHH 3T4YB 2GJJA 1R24A 2JK5B 4M7JL 3ZDYE 4HD9A 1R3IL 3EKCA 2OL3B 2VIRB 3D9AL 1GHFH 4N9GB 4ZAKB 3T0EA 3TM6A 4LMQI 4P9HH 43C9B 1V3MA 1KB5A 5HYSG 4M3JA 4PJ5A 1DUYA 3PNWA 1L9MA 4KKBC 5T5NF 4KI5F 2F8OA 1IGTB 2PYFB 4Y19A 5HHOA 5J1AA 1U95A 3F6LA 1TVDA 2HFGH 1HZHL 5BVPH 2IPTL 4S10A 5HYIA 4F3FA 4XNMB 4PJBE 5F88A 2BMKA 2ZCKL 4OZGF 1VKXB 5I1IL 2ZP0T 1ZLSL 4F58H 4FNLL 5DVMA 5JNYB 4X83A 1B6DA 1T4KB 2HRLA 4LARH 4N1CA 3IKKA 2VB5A 4PJ8A 5IW1A 5CCKH 3IFLL 2H32H 2VLKA 2FH8A 2NY6B 5C0DB 4IRSB 1PQZB 2R2EA 4KJQC 3V8CA 4A6YL 4H88L 5IVZB 4MSWA 1UXSA 3PL6A 2HYMA 2R1WA 4PJGF 2APBA 3M17B 5B39G 5B8CA 3IRZA 2HT4D 4KDVA 2DQEL 2X2YA 3G6DH 4WO4D 1J5OL 1YEIH 3V5DB 3O6FD 3QFJD 3ZT5A 5GGRB 2HLAA 3S36L 1TLKA 5HVFB 5D1QD 15C8H 3AAZB 4JPIA 3MGTA 1RHFA 2APTA 4IRJC 4R6UA 4UV7L 1BQHB 1B88A 1AD0B 1PG7L 1DUZB 3BGAA 4BKLB 5C7XH 3EYFA 5KSBF 1F90L 2VLJE 3HS0A 4EDXB 1UWXK 1UWGH 3MA7B 5JLZA 1D5ZB 3VXOA 4PJDB 4Y1AA 4X6CE 1TVHA 1ZS8B 2JJSA 1I8IA 2AEPH 3WJLC 1C12B 1RULH 4PRAA 1H3GA 1L6XA 1IEBA 1TZGH 2AJZB 5DWUL 4YC2C 3MRIA 1FAIH 2HJKA 3P0YH 5E8OB 3SBWA 2X4TA 3FO1A 3FOMB 2CIKB 3H8NA 1LE5A 3CZFA 3T2QA 2VH5H 1DSFL 4YHYC 5DC0A 2P45B 5FDWB 4WW2F 2HWZH 1OAUL 1J1XH 5D2NA 1T1ZB 4YEFA 4HZLB 1N64H 5D2LF 3DMMA 3TA3A 3MRMB 3FZUC 3O2WL 3Q3GB 1BBJB 4YHNA 2AEWA 5D5MA 2PW2A 3OF6A 5HHOB 2A9NL 2EDEA 3PHQB 1CN4A 4HCRA 5L6YL 1NUGA 4LSPL 2NZ9C 2VDLL 1MCPH 3EFDL 5ICXB 5HGBB 4JFDB 4M03A 3TT1H 2Z35B 3TH4T 3GMRA 3CCHB 3MREA 2DWEA 2XZQL 1CFNB 1PEWA 4GAJL 5F7FA 2HTKC 3TV3H 5J4MA 2PTTB 4CN4A 4K9EL 3AB0C 4PJ8D 4Q74A 5BVJA 1XIWB 4OLVH 1X9QA 7CGTA 4JE4B 2VLLA 3ELAT 4C56A 4NN6C 4YDVB 4NKDA 4FRWA 1FSKB 3BN3B 1CGUA 2VLJD 3HMWH 2RGSA 3ZDXE 3ARGC 1OD7A 1IARB 4R4FH 4PY7B 2Q8BL 4YHMH 3HB3C 2AJVH 1BM3L 1RZIB 2VDMH 4DUWA 3BKML 4XCFH 1IQWL 4KC3B 2W9DL 1VFAA 4KHXL 5KJRL 1YMMD 1W0YT 2ICEA 5AZ2L 2JCCB 3HZMA 2VLRB 2NY6C 4ZMAT 1IMHC 4KKBD 4K3JH 3I6KB 5H35B 3MNZB 2HJFB 3MNVB 4P46D 2HN7B 3NAAL 4Y88A 1CDJA 4G8EA 1FZMB 2AJSL 2W0FB 3H3PL 4CJ1A 4D9QD 4Q9QH 3L5IA 3JV6A 3S3JA 3ULSA 4G6KH 4YHOH 5CZKA 5HI4D 4MQTB 4Y4FD 2DIBA 3MLRH 1NKRA 2AJYL 1A4KA 5I1JL 3PE9A 4LCCB 1WUNT 3FN3A 3I6KA 1DVFC 2GI7A 1ZA6A 2DN7A 2BHYA 1T0PB 2FCBA 4AENB 3EDFA 1I9IL 2PF6A 5C0EB 3BZEA 4KZDH 1F6LL 2J8UF 1YNTB 1ADQA 1GRWA 2JJVA 4QRTB 2A83A 4AIZB 1OLZA 4PJFE 1JV5B 1NLDH 4YR6B 4OAWA 4PJCF 5CJQH 5EU6B 1QZ1A 4Z7UA 2YA2A 4YHZH 4OV6F 4P5MA 1KN4L 3FN0H 1NUNB 2K7QA 2YEZA 3I9GH 3HN3A 4K3EH 2E6JA 3VFUA 3VFWA 1VFOA 1NUFA 4X6EA 3C5ZD 4L4VD 3QXDA 1ZWIA 2QEJA 4WHYG 4X6BA 1RUAL 2EDKA 2OLDA 4JY4B 4ODSL 2ESVD 3T0VA 3TA3D 3QDJE 1MIMH 5IIEB 3MXVL 5DRXB 5DVNA 3V0WL 2V6HA 3AU1A 4MQXD 4PY8J 5DUPH 4YFLI 1YEJL 3OL2A 4DGVH 3QDMA 3X14A 4J4PC 5MENB 2PW1B 5KZCB 2L7UA 4XCYA 3N9GH 2XY1A 1CFNA 3A6CL 1ZOXA 4PBVC 4ZPVA 4NQEE 3EJYD 2BVYA 1URLA 3MRFB 1J8HD 3P11L 1U8HA 1Q0XH 5F97E 2NXYB 3RZCC 4HWNA 1XF2A 2WV3A 2NYYD 2YPLD 3GRWA 1AGDA 4NGHL 4QRUB 4YWGL 4X7TB 4U7SA 4FQCH 2A1WL 4HC1L 1TJIH 4HHAB 3S5LA 3I84A 3KPSB 3QHFL 4PGEB 2HMID 3SDAB 2X1QA 1P6FA 3GHEH 3VD9A 4PJGE 4D9QE 2XZAL 4HGWB 1SJEB 4QHUA 3ULUE 1L7TL 3ZL4L 2R0LH 5JQ6H 1TNMA 4G6JH 1FIGL 4U3HA 1NCDH 4FN0A 1A6VL 3MACL 4UU9B 1YEGL 4YHKH 1N5AB 3W0WD 5EULV 2JCCE 3B2VH 1IFHL 2RCSL 1MFCL 1IQDB 3K0WA 3KYKH 1HCFX 4KTYA 5JZ7C 1JNNL 2QQNL 4KVNL 2DL2A 3DV6A 3SJVD 4WWKB 2VXSL 2QQKL 3GI8H 3O8XC 3VWJB 3NCEB 4YDKH 1ZS8A 3WFZA 5IB3B 1WAAE 4RIRB 1G6RH 4HK3J 4G8IB 1BQUA 3FN9A 2NY4C 3PJSA 1JK8B 3ILQD 5FKPB 1A7QH 3QSKB 1DBAH 1T20A 1HI6B 3CXHJ 5I1GH 1SY6H 1HHGB 2V2XA 4LKCA 4N0FA 1WF5A 4IDJL 1VEMA 4H0GA 1M6OA 1W0VB 1FO0A 3WSQL 2Q7NA 2XTLA 1RJLA 5JW4Q 2CGRL 2FECL 4TUJB 2EDNA 4WW2A 5EC2B 4LU5H 4PY8I 3QIBD 3W11C 4K2UL 3HUJE 1IKFL 3OZ9L 3HE6D 3PGFH 4HIIB 3BW9B 3C5ZA 2NXZD 4K9EC 2CRMA 4TYUA 4LCWA 4JRYB 4U4BA 1UZ6F 1F4XL 2E6PA 1LD9A 2NYYC 3UDWA 1RJZA 3FQXA 3UTSB 1F97A 3P4LA 3QIWB 2E7LA 4OFIA 4S2SB 5TPWL 4FQ1H 4OFYA 1SJXA 1KEMH 4MD5A 1NMCC 5JUEL 1FN4A 1EGJL 5BXFA 1MAMH 2A9MH 4JFQA 1GYAA 2XWTA 1DQTA 1XGTA 4ZFFB 1FE8L 3GSVA 2XQBH 4ZFGH 2DOCA 2LFGA 4UOJA 5MEND 1U8OA 5FA4A 3IJSA 5KS9B 1P1ZA 1U95B 3OJVC 1N2RB 5D72H 5KAQF 3U0WH 4NP4H 5FGCB 3DETC 1KB5H 3QQ3A 1J8HA 2Q87A 1BIIB 2YN3A 1J1OH 3QT2A 3CIQA 5CEZL 5EU5B 1AIFB 5AYUL 1ED3B 3C6SA 4ONFL 3SHSA 4DKFH 1NDMA 5ICZA 3X13B 5J3HD 2HTKD 1OD9A 5CGYC 3MCKA 1OW0A 1OAQH 2X6MA 1MPAL 1KLGA 1KCVL 1NL0H 3WL9A 2W9EH 1CDYA 4I18B 3C5ZC 2WLYA 4IMKA 2XQYK 5D1XD 2H32A 4RAUB 5L8KB 3W0WA 3JWOH 5FECB 1OQOA 2BRRH 3RTQB 5FGCE 2CUMA 4MAUH 3D87B 3EOBB 2XWBA 4EXPX 5E8DL 2K7PA 1WISA 3FQWB 4TSAL 4ODHL 1AP2B 4YUEH 5EBGA 1I85C 3IDMA 4PGCA 4CU8A 4EOWL 2FSEB 1ZEAL 3V6BR 2EXYD 1ZVSA 3SJVA 3VFOB 3HC0B 5FYKH 2B1HL 5ALBL 2XPGA 1HSBB 3AXLB 2DLEA 1N0XL 2EIBA 4M62L 5I1HL 4PJXF 1H3VA 3KXFA 4X98B 3W11D 2X4PA 1NGXB 3MV7E 1XGUA 1ZTXH 4MS8C 1I7UA 5EBLB 3VW3H 1NGXA 2C26A 1S7TA 3RU8L 3F7YA 1WCBA 2X4QA 4KK6D 5J13C 2VXTL 1A7OL 1KCRL 4G6FD 2E9WA 5DJXB 5E2JA 1MHPL 4PGCB 2Z0BA 5DA0B 3DHJA 5CBAB 5DLML 4KPHH 3GSXB 5MEPB 4M6MH 5AYQA 5I66B 3PDDA 4MGXA 2BC4B 1L0XA 1OGAB 4RZCA 1R3KB 1T7VA 5T33L 1QUNA 1EEZA 4G7VL 4XHJD 3RWHA 4V1DE 3HFML 3WHXA 1RV6X 3M07A 1RZ7L 3DETD 2EKJA 3EFFA 2QSQA 4BFEA 1NCCH 5B38G 1UEYA 2D31B 2P5ED 1DFBL 3U30C 2HRPL 2YN5A 4KKCC 4KUCF 1GC1C 1A9EA 1LEIB 3DSNA 1O7SA 4WI4A 3KPLB 4LLVA 3I3BA 1FV1A 5DJZA 3KPQA 1YYLL 1S7XA 5T1MA 3E3QE 1G0YR 1KNOA 3L9RA 4QTIL 4FXKB 4KRPD 2FJGA 3IYLW 3WLWD 4TSBL 2ATPB 5KVDL 1XF5B 3DVGB 5I8EA 1PY9A 3S97C 2UZIL 4HCRH 4ZNEA 1XF4A 3LAFA 3OSKA 5L2KB 2H2PC 5IESL 2VQ1B 2X9XA 9CGTA 4D9RD 1CD9B 2R1YA 3KXFB 4POZD 1FNAA 4HWUA 1T83C 4CMHB 4LP5A 3JUZA 1VPOL 4RWYL 2IPKA 4NQXA 4OCRH 5HPOA 4H20H 1KG0B 1NMCB 3BPOB 2VDOH 3NOIA 1AY1L 1G7QA 3KPSE 3AS1A 3P9LB 5DMGC 4JZNB 4XC1H 2D7OA 2P8LA 3BPOC 4U33A 5D71H 1I7TB 2F54D 1X6LA 1F3DH 4YQXH 3OR6A 5HHOD 5FECA 1RK1A 1MAKA 5D1XA 2QR0A 1G9MC 1LNUA 5AUMB 3DUUB 3IDXL 3W0WE 4K7PH 4LSRH 1ZHBA 5C0IB 1CDGA 2IF7A 4TUKL 5EUKB 3QFJE 5HHXL 4XAKD 4PJEB 4GKSB 4YHIB 4UZGA 5F89A 5CZXC 3LN5B 3V6ZB 1UCBL 5E95B 4D94A 4HKZB 4CADB 1MHEA 2GT9A 2QSCL 3ARDA 5ESVB 3K2UL 1T1WA 4X5XB 1AIFA 1YEKH 3X3FL 4M4PA 1T3FA 2HVJA 4M5YL 4F7EA 2XACC 4JZNA 3NPSC 4FZEH 2Q86A 2NTSP 4D0BB 3KS0H 5IHBA 1OY3B 1II4E 5GRXG 1MRFL 3UTQA 4EIZC 1A6UH 1AO7D 3PGDB 4I9WD 3RKPA 4XBGA 2OM5A 2G60H 3BZFB 5D1QB 3JWDC 5KSVB 1S9KC 4EI5B 4YHLL 4LPUA 2RFXB 3MRBB 4WO4A 2CKBA 5DFTA 2YRLA 3QFJA 2BOCA 2V7NA 4AEIL 3OXRB 4BQ9A 4YAQB 4GKZA 5KSVA 1QACA 5C09D 3BESR 1I75A 1KCLA 3GFUA 3JV5A 5LGJA 1L9NA 4MNHB 5C0AB 4OM1L 2EYRA 4WY7L 4XPFH 4UU9A 4JRYA 4O02H 4CW1A 3I50H 4LL9A 1AXTL 5DQJA 3DBXA 4CNIB 5HHMD 2OK0H 3LKNB 1T5XB 4KAQH 3M8OH 4P3CH 2ZOLA 4GRLA 5E6ZA 2GW5A 3HRPA 3ARQA 3Q48A 2GTWB 5C0CE 3OJ2C 3GMNB 4H88H 4NQVB 3T65B 1FNFA 4EUPH 3QWOB 3B5HA 5E5MA 3D3VE 2UYLB 5B3JF 4NKIL 4LLDA 2WBJB 4LKCB 2AK1H 1NC2A 4ESKA 4ZSOB 4X5WB 1EA9C 4LSVL 2W91A 3GSXA 5AAMA 2RR3A 4J6RH 5CGMA 3X17A 1NEZA 1W72B 1J0KA 1DEEA 1BVLB 4LVEA 5BZDA 1UB5B 1CBVL 4XCYB 3G6AA 4ENEC 4HMDA 2DQHH 4YGVA 1C7SA 3OF6D 2XKNA 4QHKJ 4X7FC 3RIFF 2EIZB 3OJDA 2ADFL 3GRWL 3QCVH 2CO7B 1YYMH 3ALWA 1TENA 1DDHA 1XH3B 2FIKB 1S3KH 2MOVA 1H0DB 1ACYL 5I74B 3FL7A 3UYRL 1GGBL 1KJ3H 4RMUA 2XQYG 2GY5A 3S88H 2Z8RA 3VCLA 2CDFB 2PXYD 2Q86B 3SE9H 5GIRA 4MVBD 1HHHB 1S7XB 4KTDL 4JQVA 4GAGH 5GS0H 3GB7B 3P4OB 3LDBC 5IHUL 3IDMB 2WNGA 1CE1L 3ARDB 5ESVA 2ICWB 3MRLA 3Q6FB 4JO3H 2DDQL 4X0KA 5MP6L 4G9FD 1HHIA 2BFVH 1ZLUH 1MJ7H 2JKXA 3JWOC 3QQNA 1OARH 3TCLA 1CZ8L 3D0LB 2CDGB 1V8HA 2C3GA 5HJ3A 3P2TA 3QEGH 1WC7B 4WCYL 4N8VG 3C9NB 2B20A 5D1XB 4PJXB 5E8EB 1INQB 3ZLQC 1FZOA 3P9MB 4YO0A 4CAGA 1H3PH 2HFGL 3T0EC 1CF8L 3VDAA 5I75C 4KZEH 1RUMH 3CUPB 3RNQA 2HJFA 3ALPA 3WXVL 4KI5C 2YPKA 4NFCA 4GG6E 1MIEH 3E1F1 1MCNA 1E27A 4LCYA 4TVPD 4P5KA 1OSPL 4YBQC 1E4WL 2YXFA 1DBJH 4IJ3B 5IBLC 3MO1A 1FVCA 2EEAA 1OAXH 2EICA 1JGUH 5FUZH 5KSBB 3PWNA 4IJ3C 3REWA 4M3KB 2DBJA 1HSBA 5CP3H 3IXAA 3BP7A 2F53E 1VACA 1CFQB 3QDJA 1HYSD 3F7PC 4YC2B 3KPQB 4KROB 4P5TD 3KDMA 3OWEA 3QIWD 2P5WE 3ZE1F 5IVNA 3HPLA 4WV1B 3SQBA 2PETA 4QRTA 5BV7H 5IGXH 1XT5A 4M43L 5JXAH 5F1KC 5CD5D 2EZ0D 1OAYL 2HLFD 4I13B 2FZ3A 1IEHA 4MLSA 4RGNB 2JJTA 2B1AL 3LOWA 3B4NA 3OKDB 3Q1SH 1EXUA 4XP5H 4MXWH 1CLOL 2A38A 2R2CA 3EDKA 3KPMA 2QHRL 5D7JB 3GMRB 5IWLA 1F90H 1V5JA 3T0WA 1JWUA 4FG6D 2J4WH 5C0JA 5A3ID 5KANG 4ZO6A 3WLWC 5A2KH 5D70L 1OM3L 3WEXB 1NCTA 4MYWB 4W6WB 1FZMA 4G8EB 5DJ6A 5CBAA 4QNPF 3JTTB 4HBQA 1INQA 4F57H 1T20B 3L3HB 3D85B 5ADOL 5C07E 3HZYA 5KVFL 4LAQH 1U42A 2AQ2A 3O9WA 4I5BB 1KJ2B 3L3DB 5E1AB 1KC5H 1IC5L 3U7YH 4JDVB 4P4KA 5BRZB 1KFAH 1F6FB 2H3NA 3QUXC 4PJDF 1SBSL 3I75B 3L95A 4ZFOA 1PKOA 3SJVB 3VFOA 4AH2B 4OUUA 1JBJA 4LSTH 3VD3A 4L4TB 1PG7X 1RJCA 4F7TB 1T03L 2NY4B 2I07B 3P4NA 4OM0L 1HHJB 3LPFA 5IFHH 3IJHB 5ANME 3CVIL 2DI7A 3STBA 1ACZA 5HI3D 1AQDA 5DURD 3BPLB 5BQ7B 5E2UH 1F3DJ 1WZ1H 5DTFA 4L3ED 5D6DC 4GT7A 3HS0B 4MLIA 1NFDF 3AY4C 3BDYL 2X40A 4WTZG 2VDNL 3PIQA 4ODSH 3O41A 3RZWA 3WO4B 4ELMF 1SM3L 5CLTA 1P53A 2FX9H 2NY5H 5I74C 1XGRA 1A9BA 3FTGB 3PGCB 2IQ9L 3MLTA 4YGAB 3NH7H 1HHGA 2V2XB 1CGTA 4GSDH 3WJJA 3QQ4B 4FFZH 5GS3A 4LFHG 2IMMA 1BIIA 5CS7A 1T89C 1NGPH 3ROOA 1R0AL 2ZSVA 4AM0B 2PXYC 3FONB 2VC2H 2YS4A 5A2FA 3ZKMC 1ZA3B 3W9EA 2VE6A 1QBLL 3SQOL 3GMPA 3PHSA 4ODXA 1UACH 1JGDA 4FP8L 5FM8A 1DVFB 4IIQC 1CIUA 5ILTH 4EI6A 3IVKB 3LKNA 1FLRL 3NTCL 2J88L 3ET9F 4Y2OA 3MOAH 4Y0GA 4P5TA 3QIWA 5CIPH 4QRSB 3VJ6A 2FX8L 1LP9B 1U3HD 3RAJH 3HMXA 1R5IB 1AI1L 1FLTX 3BIAX 4GKZB 4U1SB 3CLEL 1QFUH 1B3JA 4G9FE 1YEGH 3VD7A 4G7YL 1G7JB 3BP5B 1DCLA 2RFXA 1J8HE 4HEME 3JVGA 1OVZA 5FYKE 1L7IL 1QQDB 4K3DH 3R8BB 5IM7A 3R0NA 1DUZA 1QBBA 3MLRL 5CEXB 4JY6B 2X4RA 4PJ7F 3V7AG 1G6RA 4PRPA 3NCBB 1BGXL 2VIRA 4ZAKA 1SJHB 4P23D 5GSRB 4N0FB 4IS6A 1CTNA 1U93A 2IG2L 4Z7WB 2XYCA 2EDFA 1IBGH 1I8MB 3LEYH 4OFYD 4UNVA 3GI9L 1QFWH 4XPGL 3BKJL 3IDUA 3LPWA 3MRGB 2ZUSA 4MMZC 4EN3C 5GHWL 1UKTA 3P77B 1UQSB 1G1CA 1OT1A 4YHZL 3KJ6H 5I1GL 3FCTB 3I9GL 3QIWC 3FQTA 1WK0A 3VWKB 1QVOA 3GNMH 3VD5A 3BQUC 2C1PA 2GK0B 1INDL 3DNKA 5T1DL 4R4BB 4P49A 3HI6H 3DSFH 4DZBA 4O4YH 2CGRH 3TP4A 2KL6A 1I1CA 2P8LB 2DQCH 3MLVH 4OLWH 1LK2A 4JY4A 5K9QI 1IGJB 1EUTA 3L3JB 4QF1A 2NY1D 4M7LT 3UEZA 3PHOA 2IH3B 4J3SA 4YDVA 5SWSA 2QADC 4PRBB 3ZZ1A 5AAWA 4C56B 1BFVH 2B0SL 5K9JL 2BMKB 1VKXA 4HGWA 4QHUB 4RSVA 3WNLA 3F62A 3F6IA 3P30L 4UIKL 5BVJB 3GSUA 5I1IH 35C8H 1JGLH 2OJEA 2I9TA 1Z6JT 4CN1A 1UH3A 1QTYT 4Z5RA 3D0VA 5JUEH 1NFDE 1MWAH 3PV7A 2CDEB 2AV7B 2VSDA 3EZ8A 5MEOA 1IKNA 2FH6A 2YD5A 5CSGA 3QHFH 1WIOA 1Q9KB 1T22A 4MNGB 4NOFA 4Q97A 5IQ9B 1F13A 1JTOA 3CFIC 2BJMH 2DQFB 4JFEB 1CK0L 1HDMB 1ZANH 2VZUA 3UROR 2F58L 1T0MB 1NAMB 2KQMA 2R0LL 4K7FA 5I1EH 5JQ6L 4ERSL 4PP2B 5CEZH 4MAYC 4HV8B 4PJXE 4X7SH 3BVNB 4Z0XB 2N1KA 3WD5L 1IGYA 4X7CC 4RRPG 4JFPA 3QI9C 1E4JA 2IFFH 1OAQL 4FXGB 4NO3B 1R3LB 5EWIH 3QI9B 5DJ2B 1UH4A 3H9HA 3HE7B 4JR9H 3UPRB 1MOEA 3JXAA 2W9EL 1UJ3A 1J9CT 4Y4FC 5EORL 1VADB 5GS1B 3CDCA 4TTGA 4XP4H 1SMAA 3T0XA 2H9GA 4EN3D 3BPNB 4QTHA 3WFCL 2HJKB 4ETYA 2W9LA 4OFDA 3JWOL 2A6IA 4Z7VB 1Z0MA 5IQ7L 2Y6SC 3CLFL 1WCBB 2X4QB 5KSAD 5E8DH 4MWFB 1DZBA 3U46A 5C0EA 2JELL 3ZYJA 5A2JH 1AE6H 4ONGL 4ORGA 5SX4H 2BVPA 3E3QC 3UZEA 4Y1AB 4S1SH 2AABH 5E99L 5ETUB 2BSRA 1R6VA 5I17B 1GVIA 2ICWI 4YDJB 3E6FB 4CRPA 5CWSB 4LQFL 3MGOA 2DQGH 4QWWD 2NY1C 4O51B 2P7TA 3BZDA 1EHAA 1GAFL 1WV7T 2Z35A 4GS7C 3JV6B 3EOTH 4GRWE 4IOIA 1FGNL 3UDWC 4LRNH 1DSFH 1F11B 2IANB 2XTJB 3MGTB 5DEFA 3TIDA 3WBDA 3PWLB 2H8PA 3LEXB 3WUWG 4ISVB 3FT2A 1OF2A 2PYEE 1CWVA 1M7IB 2MQCA 3MNVA 4Q6YA 4U6XB 4WTXA 3CDFA 4R90L 1W8NA 3SKUD 4NM4H 4I18A 2L4OA 2BSED 1DN0A 3G5VB 1S8DA 4LSPH 1HH6B 3T3MF 2P48B 3GM0A 4CU6A 2C3HA 5INDA 3OKKA 4MSWB 4N0CC 4XNXL 2X10A 2WIIA 4M93B 2ID5A 1RZ7H 5J8OA 5TF1H 4F7CB 3P9WB 4GKNB 5B8CC 3QXWA 4ELMA 5CD3B 1NLBH 3SE3C 3P4MA 4NJAH 4GAJH 5DJAB 5IVXB 3ILPB 3LKQB 4FQJH 4P23B 5I75B 2DLTA 5SWZB 3V9FA 1XIWA 4L8DB 4HIHA 4MA8L 1FORL 2UZXB 1CL7I 4NKMB 1MELA 1AHWC 5AYUH 3MRQB 1N6VA 3JWDL 4O2EA 4JFQB 5GGTL 4PJBA 3TBVA 2UY6A 1TCMA 4TRPL 2H26B 4QRRA 4MD5B 3OR7B 3FO0L 4KJYB 5EOCH 4PTTB 3FQUA 3VU2A 2QKIA 3MREB 4WFHE 3MV7A 5E7FA 4J8RA 2GQHA 3HR6A 1G9NL 4ELMB 5CD3A 3DIFB 1KB5B 2V9TA 1CXLA 1J0JA 2BVEA 1R3JB 3K81A 4QHKI 4MA3A 5TGBB 1WVZA 5L7XL 2YD4A 1A3RH 3L5WA 3BGMB 4Y19E 2WIMA 4AL8H 4ZUUB 1FNHA 3GKWL 5KJRH 4P2CG 2VDKH 2Q76A 2P5EE 3GKZA 1LO3L 2FECI 4OF8A 3SPVA 3CU7A 4K3JL 3TJHC 5BW7A 4PJFB 3BP6B 5C09A 4J3UA 2YRPA 5EBWA 1T1YB 1IC1A 3FAXA 3D2UA 3FB5A 1G7IA 4XVJH 4NZRH 3RGVA 3T4AB 1ZHNB 1SQ2N 3P0YL 4L1DA 5L88H 5DRNA 1D5XB 3WS6C 3MRIB 5KTEH 3NFPA 2CK0L 3VFPB 1D5IL 1F4YL 2IAMA 1PW3A 4GRLD 4W70A 1TPXB 3GO1H 4QXWA 1J1XL 2RB8A 5JW5A 4L8SB 1A7OH 4H1LH 3VFTA 4XX1E 4AY0A 3K2UH 4YFLF 2YRZA 5BO1H 1LQSR 4YBLC 3O81A 5CUSH 4LNRB 1FG2A 2A9NH 2D7NA 1NLDL 3MA7A 1YNKL 1OAKH 4KRNA 4M02A 4OKDA 3GSOB 4JEGB 1PKQB 3BH9A 4G43A 1YJDC 1K8DB 2QJDA 2Z4QA 3RQ3A 1ZVHA 4M1GL 4UB0H 4OD2B 1PX4A 5DGQA 4DVBB 1CD1B 4MX7B 1BQLH 3D2UB 5BCAA 2DYPA 3LN4B 2HLAB 1GJIA 2I24N 3WFBH 5IJKC 3ZE0E 3O45B 4OM1H 3MRRB 4QHNB 4S1RH 4EUPB 4LDOB 3MRJA 3O8XD 4O2FA 4OLVL 3RGVC 3C09C 3C8DA 4P3DB 2JE8A 3SGKA 2PXYA 3RY5A 5KVDH 3EDJA 4LGPB 2PO6C 1R3JA 1WTLA 3ARBB 4O9HH 5C0DA 4FQXD 1VA9A 1MY7A 2FL5B 4MD0B 4U1JA 1YEFH 4LK4A 1FAKT 3DVIA 4KK8C 3O2VH 4I2XA 4RFOH 4S1QH 5T3XE 2VISA 2B4CH 1VGEL 4R0LA 2ED7A 2W65B 5AZ2H 2HFFB 5DJCA 2C1OA 3WN5A 1AXSA 4JANB 2H6PA 2HFTA 3NN8B 3HLAA 5JW5B 5DRXA 3CSBA 1Z2KA 3WN5B 5LG1A 3LQAC 4G6JL 3PXJA 3VXMD 5I18H 2DQDH 1U8LA 5IFAH 3LKRA 4ELKB 1CBVH 3H3PH 4BZ2H 2EDQA 5DURB 2XG5A 2ZUTA 1IFHH 1MH5B 3IDXH 4Y2DA 2F15A 2ADFH 3GRWH 5C6WH 2FL5A 1YC7A 5B4MD 5EZIH 1K3ZA 4DTGH 5JIIA 3S3SA 1NC4B 4N5ED 3NIGE 4KVNH 2DI9A 1HSAA 3T8XA 4NO3A 4OF5A 2JCCF 4WJ5B 4HUXB 2E9IA 3IT8D 3OAUL 4WFGD 2Q8AL 1YNTA 1YMHA 3FOLA 1E4KA 3SGKC 3OKOB 1NFIB 3KPNA 4QY8A 3DI2B 4LEOA 4XGZA 4N0YH 4NNYB 2WQRA 3NACH 3MUHL 1AHWB 3X3GL 4M61A 4DKAA 1P2CB 1WBYA 2FATH 5I19L 3BSZL 2D7TH 1HXMB 3CU1A 5E94A 2BFVL 5E08H 5ESQA 3OGCA 3QDJD 2EH7H 4Y2DC 3IAGC 1QSEB 3QFDA 1KELL 1T6VN 3NA9H 4H1LA 5EFIA 2NZ9D 3WIFB 5J3HC 1GSMA 2ZPKL 2UWEE 1WLHA 4JKPL 5BMFL 3MNZA 4LP4A 3LQZB 3WKNA 6FABH 5BJTA 4DGVL 1Q8MA 1HQRA 3OZ9H 3SKMB 4FQXB 3MRNA 2XNAB 1QHOA 3A6CH 2K9UA 5J6HB 2NR6C 1NSNL 1Q0YL 2GJ6E 1NGWA 2OK0L 4DVRL 3PHOB 5DGRA 3TJHD 2H9GB 1MEXH 3BZ4B 3VI3E 5SWZD 1VADA 3OKKB 5GS1A 3SDXF 3CX5J 3P11H 1D5XA 3UPRA 4Z76A 1JGUL 3L7FA 4YE4H 3OGCB 1S8DB 2X4OA 5ESAB 5HYJB 4YWGH 2A9ML 2AGJH 5IB4A 4WFFD 1IGYB 4P4KD 2C3VB 4X8XA 1RSFA 4PJ9D 5EPMB 3W2DL 2VJXA 4LCWE 3QEUA 4XRCB 1UJTA 3DUSB 5D72L 4C83A 3CFEB 5HVHC 3ZTNL 3CFJA 2R4SH 4EI5C 3FAWA 3U7WH 1GGUA 5C2BH 1FIGH 5CMAB 5JXAL 3HCVA 4X99A 1ETZB 3BD5A 1MFCH 2P7TB 1BJ1J 1ZVYA 3ULUH 3QPQD 1G6RB 3D0VB 1NAKL 4YH6A 4QLRA 4M48L 3LKRB 4ELKA 1U8LB 3GBMH 2I5YH 4KJQD 2VXSH 4NPYB 2J4WL 1BAFL 3EOYG 2IALA 4GH7B 5IJVB 1FL3B 5DJ0A 5D70H 5KOMC 3UO1L 4OZFA 5DQDL 3TVMD 3VGEA 3MBEB 3DMMB 5JHDB 4IMLB 4GXVL 3MNWA 4KTDH 3DXAA 5GSVB 2BRRL 2DMKA 2NY1B 1ND0B 4OKVA 4PRBA 4L3CA 3IJHA 4BYHA 4TSAH 4P9ML 3ZHLA 3GZKA 3FO2B 2R29H 2OL3L 5IVXA 4MAYA 1SJVA 4RGMB 3CSPA 4LHJB 2I25N 1MI5E 4LMQE 4IDJH 2DKSA 1LHZA 3T4AA 3QI9A 4GRWH 3V6FA 5I1HH 4PJ5E 3ZDXF 4JAMB 3WHE0 1L4IA 1P7QB 2DIJA 4Y4HD 4EI6B 4JO4H 2MCPL 4NQDA 4CVUA 2W0KA 3CK0H 4ODVL 5SX5H 2E7BA 4PJDA 2WP3T 1JVKA 3VMOA 3O3UN 2QSTA 2B7DT 1WAAF 3VG0H 3OKEB 3P0VL 4TULH 4KZEL 2ITDA 3CVIH 5EU4B 2GJZA 1L6ZA 4NZTH 2OTUB 2OZ4L 3V4PL 2ARWA 3QXVA 4X6DA 5C0FB 1I8MA 4KPHL 4I3SH 4M6ML 5J11C 4GRLC 1NBYA 1WZ1L 2W0PA 4PV9B 3IJYA 1MVUB 4FQ1L 1NUDA 3MBXH 3U0PB 1EHXA 3PP4L 1XCTA 3O2DL 3EHBC 4OCNC 3U9PH 4KJWC 3N85H 1JJUA 1KPVB 3TBVB 1QR1B 3D39B 4NJ9H 5HYEA