4QHKI

Uca (unbound) from ch103 lineage
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
222
structure length
218
Chain Sequence
b'VQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTNYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCASLPVNAYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UCA heavy chain
publication title Affinity maturation in an HIV broadly neutralizing B-cell lineage through reorientation of variable domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 218
sequence length 222
chains with identical sequence K, M, O
ec nomenclature
pdb deposition date 2014-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
I PF07654 C1-set Immunoglobulin C1-set domain
I PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhkI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4qhkI01
1FZOB 2ENSA 3OB0K 5IGXH 5DWUL 3TNNA 1LEGB 1QPXA 4NWTH 1VKXA 1RZFL 1WWAX 4YC2C 5CHNA 1MJUH 4HWNA 2R2EB 2F53B 5BVJB 1T7YA 3PF2A 3B9EA 4NKIL 1FG9C 2C1PB 1MFAL 1CGWA 1D6VH 1X5LA 5ID1B 5E7BA 4OJFH 3W39A 2NCMA 3HZKA 3NOIA 2AJVL 4OM0H 5J1SC 8FABA 5HHPA 4OT1H 4PJXA 2K9UA 2XZQL 4PJ5B 5KOVC 4GW1A 5CP7A 2VITB 1BZ7A 4XNYH 4MNHA 5GJSH 1EO5A 4KPHL 3SE3C 2DF3A 3O2WH 3HUJF 1NAMH 4MXVF 3T0ED 3RTQB 1KIPA 2EIDA 3OKDA 4Z7QF 5D7KD 4J8RA 2Y07L 4ZOEA 3EYUL 2ADGA 3QI9A 2RGSA 4GH7B 4UINL 2WLZA 4HUWA 1P4BH 4O2FA 2QR0A 1EEUA 4OCWL 1J8HB 1UKTA 3IFNH 4JFXA 32C2B 4X99A 1HHIA 1UH3A 3EYSH 4TVPE 5CEYB 1MUJB 5GSVA 4PJ8B 4U0QB 2NZ9D 4M1GH 1NCAH 1YPZF 1WISA 4KRNA 3O8XA 5C07E 3QUYB 4JN2A 5T1KD 3HG1E 4HUKB 3VWJC 3GSRA 3MUHL 5EZOH 3DRTB 3HNTH 3ARFB 3QUXC 1EZVY 3MRHB 2E9WA 4KK8D 3CFEB 4UDUB 3CPLA 3X12B 4YQXH 5DMIH 2ZJSH 4ORGA 5D7IF 1TJIH 2NY5C 1I1CA 3UTSB 4LVNB 4QYOB 2XWBB 5KVEL 1UYWH 1RUQL 2WMPA 4NNXB 3HC0A 4K71C 1XCQB 4FP8L 1CE1H 1QEWB 4URTB 4FFYL 2DL9A 2PNDA 3PGCB 1LE9A 4FZ8H 3CMOH 3SDAA 5B3NA 4KUZL 2C3HA 4XXCC 5EOTA 1JRHI 3LD8B 4E9LA 1K3ZA 1FYTE 4HFUL 3TN0D 4Z76A 1I3UA 4U33A 4O5LL 4PP1C 1KLUB 1PQZA 2HKHL 3IKCA 1XZ0B 4OV5B 4GW5A 4LHUD 3DROB 4DTGH 5T5NF 2ESVA 2RJMA 3MRDB 4LLWA 3MR9A 3CU1A 3FB7A 1J8KA 3S34L 4NJ9H 1OP5H 2DJ4A 5KOMC 4DK3A 2HFTA 2R29L 5F9AC 1A1OB 1MJJB 4FABH 4GRLD 2AW2A 1MQKH 4PRBB 4Q7DA 3FQXA 4JB9L 2W9EL 4RFNB 4WO4B 5A2JH 3REWB 2AI0L 4NQXA 1RHHA 1I3RA 3FJTA 1JPTL 1URLA 3RA7H 4R7DA 3U1SH 1DZBA 2FYYA 5F9OL 1ZHKA 5CGTA 3QUZB 4NRYA 1UWXH 1I7ZA 2FEEL 2H6PB 2ED9A 3MYJA 4JQXC 4ZPVB 4PJFE 1QTYT 3UBXB 2Y5TB 3WJJC 3DTXB 1GSMA 1LO0H 5IBUG 1N5AB 1MCSA 2BOCB 2HH0L 1MCWM 3GSVA 3IF1A 3UDWA 1EHNA 2NLJB 3P73A 4ZS6C 1IGCL 4RISH 1I7RA 5IEHB 3UYRL 2OJZL 2BNRA 3GMPB 1RJZB 4Z7UA 3GMRA 2HT2C 2EEBA 3TBTA 3HE7D 2NY5H 4YX2H 1X5IA 3DI3B 2GSGB 5MHSD 4KH2A 3L3KA 3G5XB 1W8NA 4MS8D 4QEGA 2ZUQB 4JFEA 1HHHB 3UJTL 3ARXA 5TDOA 3MV9A 4DEPC 3EDKA 1T1WB 2NW3B 4LSPH 5HHOB 4PUBL 2ADJA 4Z8FL 5DTFA 4JJHA 2D7OA 5F7MC 5A16B 4QRSA 3VFPB 2HWZH 3KG5A 2ZCHH 1UM6H 5BZDA 1MVUA 3FT4A 2V2WA 3BGMA 4R4NC 3VDCA 1ZT4A 4MJID 2DLFH 1NL0H 4XP6H 3HN3A 2BNUB 4P48A 3ILPA 1U8KA 4YEEA 4KROB 3V5HA 4HK0B 5JDSA 1IGFH 4L3CA 5DC4B 1NGPL 4XVTH 2V5TA 1TENA 3KPMB 4P2QD 4GG8A 2EDEA 3MGTB 5IVOA 4GFTB 1AFVH 5I8OH 1H3WM 3LS5H 5E8PB 1RIVH 4NSKA 2VDPL 3K1KC 4G43A 4EDXA 2FX9L 1FNEB 3FRPG 2BZDA 4FQXD 2IH3A 2YUVA 1NGQH 2R0LH 1U91A 4JY5H 3EOBA 1JI1A 2FJFA 5JA8B 1S5HB 5IB5A 4OB5H 2DQUH 5AUMA 2EDDA 3M8OL 3OR6A 5D2NC 4IIQC 5TE6H 3DETC 4OCRL 4WY7H 3WFDL 4OZFH 3G5YA 2HJFB 2LU4A 5F7UA 3EUUA 4PLKD 3ZE0E 5DRNA 3RKDC 1G6RA 3QIWA 2CIKA 3ROOB 2NY3B 2NXYB 5CIPA 1KB5A 2EXYC 1MFEH 3MLYH 4LCIH 5GGRA 5JUEL 5KG9A 3RUGF 3QUKB 2P48B 4TVPL 2Y5EA 2Q6WB 5GS0L 2CDEA 4ODBD 4FQPA 2W1NA 5HDBE 2LV4A 4KHTH 4NKQB 1PD6A 1LE5B 5DQJA 2CDFB 1WV7T 2FEDC 3F5WB 2DM4A 3AM8C 3PNWB 1DUZB 5GRVK 3BWUC 1H8NA 1UACH 4GUPB 2WBWB 4LP5A 3QG6A 1BZQK 1OSPH 2JB5H 2FR4A 3VXRE 4ZUSA 4JO3H 1LO3L 1T2JA 2EDXA 3VXSA 5IQ9A 1BVKB 5IB2B 4N0UA 1P7KA 3VRIA 2EYSB 4J6RL 3ZL4L 3RGHA 4YE4H 1F4WH 2P5EE 3OBAA 2Q87A 1HXMB 3N1FC 4KVNH 1S9XB 5D5ME 5EU5A 3EO1A 4QXUH 3IJYB 4FQ1H 1PKQA 1X44A 4S1DC 4PBXA 3S5LG 2Z31C 3D85A 4R97B 4W6YB 3CVHH 4AK1A 5L0QB 5DEGA 3O4LA 1F3DH 4LF3A 1DN0B 1GAFL 3RI5F 1FLRH 4R4FH 2EH7L 3STZA 4GQ9L 4EEEA 3SBWA 4LRNH 3KLAA 5IQ7L 3KPSB 4RAVB 1G7MB 2HFFB 2V5YA 4GKOA 1FAIH 3KNBB 4XC1H 4X6CA 5DEZA 1G0XA 1U93B 2PO6A 1KNOA 5FM5O 3D39B 4J3WA 3D18B 3H3PH 4IS6B 1TPXB 3GSQB 5E6IA 3O9WC 5CCKL 5I1LA 2D4FA 2JB6A 5EBLB 3VGAB 1MELA 4YXLL 2D7QA 3CAFA 5DJ8B 3LIZL 3UMTA 1T4KB 2F15A 1RZKL 4A6YB 5JIPA 4HUUA 1DQLL 1IARB 1DBJL 1JIBA 3OKNB 1KENH 4NZRH 1I9EA 1T89C 3QPXL 3GB7A 4RGNB 1CR9L 4U1MA 3DX8A 1MRFH 2KQMA 3EDDA 4N0RA 3S9DB 3CCHA 3WUWB 4L1DA 4YK4B 1WAAE 4RFEB 5K9OA 4MD0A 1WWBX 5T1LA 1T2QH 1MCPL 1EUTA 3OX8A 4P46C 4P3DA 1F3JB 4UQ3A 1ZANH 2F54E 2HVKB 4MCYB 4TSAH 5EORL 4OLWH 1IGJB 3MZGB 4HEME 2C26A 4JRYB 2AGJL 5L8JB 1ZLVK 1Y18A 4KK6C 3GGWB 2ZUXA 1TJHH 3O6ML 2EXWC 2P8LB 5FYLH 1NUGA 5GJTL 2VAAA 2Y7QA 3PHSA 3N50A 4XH2A 5TQ0L 1U41A 4KV5E 2R2HA 4ODWA 4POYA 3OKLB 2EKJA 2X4RA 3CK0L 2HJKB 1KC5L 4HIEB 4JG0H 5DGRA 5GGTH 4I3RL 4UMGA 1JUFB 2WBJC 4XWGH 4GBXB 2X44D 1GGCH 3ILQD 5GGSB 5IMMA 2XYCA 1YEKH 4K3JL 5INDB 3JVGC 1ZHBA 4PLOB 1Q1JH 4PBWD 1OW0C 2QV2A 3NABH 1HYSD 4LU5H 3QQ4B 3CX2A 3QUML 4D9RD 3KJ6L 3SKJH 1CK0L 4ZOAA 1VA9A 1DBML 1KJ2A 3O6FB 1ONQB 1ZSDB 3B5HA 12E8L 4NQED 2FHFA 3FB8B 5C8JB 1HEZB 2DQJL 1JGLL 3ZYOA 1EHAA 5E4EB 5J3HC 5E2JA 3RDTD 1CDYA 4Y19A 1A6AA 4MJ4A 5F9WC 4RCAA 1A4JA 3VFNB 2UYLB 2ERJC 1V5JA 3GI8H 1TDQA 4Z0BL 4ESKA 4Z7WF 4XXDA 5F7NC 3WLWD 4OZHB 1NCBH 4OGXL 5TQ2L 5I18L 4LFHD 3V6OC 3E0GA 3W11D 5EO1B 1DANT 5DEFA 1K5NA 3QIBA 1MFBL 1TETL 3R8QA 3G5VA 3RGVC 2BSTB 2VDKH 4P3WA 3C6LB 4HULB 5IFJA 2A38A 2B20A 2AV1B 3MV7D 3C09B 1LNUB 4BELD 3QEUA 1U6AL 2IGFL 3NIFE 5IB1A 4L8DB 1JZ2A 5KSUB 2IJ0C 4FNLH 2EDNA 2DBLL 1P4LA 2N1KA 3B8YA 4XPGH 5I9QB 5FO8A 1UH4A 3ZKND 5DJZA 5KSBF 4WW2B 5FGBC 1JPSH 2YUWA 3MUGB 4WFGE 4YHIA 4YBQD 3D3VB 2JJWA 4PJ9A 1A7QL 3LMJH 2R23A 5HI4C 1U8PA 5TE7H 4LNRB 4P23A 2UVFA 3GK8H 1B90A 1NBZB 2DQDL 1UXSA 5E7FA 1QSFB 5J8OA 2IG2H 2D7NA 4JPVL 2X89A 3ARED 3D48R 2EDBA 5FYKU 1CL7H 4TSCH 2HVJA 3UZEA 5EN2B 1G1YA 1P84J 4BH7B 4YHOL 4PLNC 4E41A 4JM2B 4Y5VC 1FE8L 4G8FA 3IDNA 2Q8BH 4KGLA 3WHE0 4N5ED 5FUZL 2MKLC 1AC6A 2J6EL 2R0WL 3R06B 2H1PL 4HWBL 3L3HA 4HS3A 3TT1L 5ITFB 2I25N 1MLCA 1U2CA 4WI5A 2VDQH 3QEGH 4DJMA 5DD1H 3MCLH 1YEGL 4F7CA 2AABH 1DVFA 2B1HL 4G6KL 4OIAA 1B0RB 4LLYA 1W0WB 5JA9A 1AR2A 1EJOH 1J05A 4ZXBB 1OM3H 3STLB 3IU4H 1I8MA 2ZUWA 1FDLH 3VGDA 1GGBL 4IRSD 3RAJL 4AQ1B 4JDTL 5TFSL 4M7KH 5LAXA 2JCCE 5IB3B 3W2DL 1AJ7H 4MCZA 2XY1A 4OLZL 3TVMC 2EDJA 3BP7A 5M7QA 1GYAA 4YR6B 3VXTA 4BUGA 2YN5A 4D9RE 5EC1A 4HUXB 1P4IH 2C4FU 1D9KC 3C08L 3PQYE 1U8JB 4GG6F 5E1HB 5ADOH 1HSAB 1I9JH 1G1CA 4C4KT 2I9TA 1NCWL 3MGAA 1W72H 2BSSA 5DUMH 2VDRL 1BFOA 4ZNEA 4I48A 2APFA 3SCMA 3BIBX 4JQVC 3HMXA 2CJUH 4Y5XB 1CTOA 3ZLQC 5ISZB 3GSNA 1PLGL 2J5LB 4LPUA 4LAQH 1B9ZA 3MV7E 4NQCA 3FO9B 5GIRB 1I9RL 2J8HA 3NH7L 2XTJD 2BDNH 4PJHB 2G9HB 3LSOA 3TYFB 2AJZA 1IQWH 2OSLA 5JPMB 3C9NA 4POUB 4RDQF 4K8RC 1NGYA 4PS4H 5B4MC 3QG7H 5FK9A 5D1ZD 2JIXA 1HH9B 4LPTA 1P53A 1HXYB 2R15A 3KLHC 4L4TA 2AEQH 4NM8H 4BQ6A 4WWKC 1LK2B 2WQRA 1NC4D 4DVBA 2VN4A 3ARDD 1XF4A 3VXOB 4ZAKC 3KYKL 1I8LA 4OQTL 4PJCA 5CSZA 2EDQA 3NZ8B 6CGTA 4Y2DD 4YHPB 4CVXA 2YKLL 3KDMA 3T0DA 5JW4Q 3AS2A 1FH5L 1F4XL 3CFBA 3RZCD 4DKFL 3ARGC 2PYEA 3OSKA 2CRYA 4P2OB 5E8DL 1OAQL 3AFLA 1HOCA 4OSUL 4XC3L 2YPKA 1N59A 4L8SA 3W0WD 1A1NB 5HGHB 3QWOB 2Y36L 5DA0B 3VD7A 1CICA 4X9GA 4F7PB 5GGUA 4G9FB 1YC8A 3LN5A 4FQJL 3QZWB 4XMPH 5FM5M 2V7HA 4R7NA 1TZGH 2BVUA 4M00A 4XB8A 1T0MB 2VE6A 4YBLC 3WS3B 3QISA 1A22B 1YQ2A 2I24N 1EEZB 3S37L 3GUTA 2DQFB 3PWJB 4H5SB 3IDJA 5BJTB 3Q48A 5BS0A 1MJUL 1UEYA 4X7DC 3DMMA 3SDDA 4I5BB 2NX5D 2G5BB 3BKCL 1ZLSH 5I73C 1K8IA 1P7QA 3BE1H 1WBZB 3OWEA 4OD3L 3T0EC 5F3BA 4X6EA 4K7FA 4JKKA 5D71H 1QHOA 4XBPA 2EDYA 4U1GC 1D6VL 5LBSH 4OFKA 3I85A 4OJFL 4X4YB 1LMKA 2AXFA 4MAYB 4CL7A 1YMME 3QCUH 3KYOB 3D5OF 4XNYL 4Y4FB 2AEWA 1S7SA 3FQUA 4H8WL 3FB5A 3S4SB 4XPFH 3T2NH 1M7DA 4GKZB 4TN9A 1JWUA 5C9KA 5JHDA 4DCQA 3QDJB 2W60B 3SPVA 5DVOA 3HG1B 3MODH 3RWHB 4KKBD 4LBEB 1P4BL 4K8RH 4ACPA 2P24B 4HF5H 4JAMB 1MWAH 4L9LA 1WZLA 4WI7A 5BRZA 1HK6A 1BFVH 2W9DH 5DRXA 5JIIA 5IG7B 3KPPB 1EXUB 3RPIA 4HBCL 1Q72L 1UM4H 4GAYB 1YNLH 1NCTA 4OCSH 4F80A 5E8NA 4WHYH 1OL0A 1VSCA 4HH8A 5EZOL 3DV6B 3HNTL 2FECI 3ARYA 3OKEA 5FYKD 1CXFA 3IFOA 4OF8A 1UJ3B 3VXNA 3HUJE 3FOMA 4Z7QE 3QI9D 4L8CB 4NFDA 2ZJSL 2WWKO 1TJIL 1GIGH 4LSUH 1CFSB 5SWSD 3TN0C 5E2WH 1WLHA 4Q9RL 1RZGA 1UYWL 5F9DC 1LP9E 4DOHB 5DJXB 3GJEB 2XNAB 3RIFK 5IF0A 4ZYKA 1CFVH 3TPUB 3G08B 5LKNA 3MNZA 2CGRH 1VPOH 3TJEH 4FZ8L 3CMOL 3MPCA 5I8KL 2Q86B 3WYRA 4PJ7F 4HIHA 2W9LA 2OX5A 5DS8A 5AWNH 2XQBH 3ARZA 5IVZA 3BW9A 1H3PH 1S5IH 3VD3A 4GRLC 4NN6C 1CFNA 4EI5A 1MJ8L 4HQQH 3KHQA 1UZ6F 4HUMB 4OKVB 5D7IE 2QJDA 5MEPA 4YPGA 2ED7A 4CW1B 1WCBA 4JCMA 2QADD 3AAZA 2OTWA 3FFCB 1FPTH 4FMFA 2GEEA 4XX1G 1DLHA 2NX5E 4YHLH 2ATPB 2V2TB 4MGXA 3ARUA 4NKOA 4FABL 1CGUA 1D5BB 3SDAD 1MQKL 3V5KB 3TV3H 4PJFB 3PXHA 1NAKH 4G8GA 3QJFA 3IJSB 3BP5A 1F11A 4QXGH 1F00I 1BF8A 1OY3B 5FOJA 3DX6B 1DN2A 3RA7L 4KRPB 3U1SL 5HI3C 1X5XA 2HRPH 2AKRB 2JF1A 2ESVD 3PABB 3MRMB 4HJJH 5K9KB 3KLDA 3TNMA 5JHLL 4Q2ZA 1NFIA 1N26A 3RWEA 1LO0L 2ZKHH 1UVQB 1MHCB 3GMLA 3E2HB 1P9MA 4KK9C 1QNZH 5IW1A 3TIDA 5F89A 5FYLE 4RISL 4PTTA 4I3GA 3QUMB 4FQIH 1MAKA 2YD3A 1FCGA 2GTWB 5TGBA 4DWHA 4PJXE 2DQIH 5FF6B 4YX2L 3QNYA 1NLDH 4XAWH 5KSAC 3RRQA 1AD0B 2ZOKA 1F2XK 3WLBB 3L7FA 5ICZA 4P99A 2GUOA 3PJSB 1DEEB 1YQVH 3UJJL 1A3QA 4Y4HB 2ZWLT 1TJGL 2WIIB 2VOTA 4LSPL 3B9KC 3HI1B 3T77B 1XGQB 4HGWA 1KCKA 4ODUB 1Q0YH 5DYOA 1TZIB 2WP3T 1ZAGA 2HWZL 1INQB 2ZP0T 1CTNA 3HZYB 3MA7A 2ZCHL 2BNRD 2WANA 5CJXA 2C3VB 3VGBA 1JPFB 3LKSB 1NL0L 3EYVA 3ARBC 4NJAH 4HKXB 1IGFL 4XVTL 1FSKC 4JFED 4NUGL 5FB8A 4NHCH 3I2CH 2R56H 5ESQB 4BZYA 2RR3A 1JN6B 2ZSWA 5DJ2A 1YJDC 3DRQA 3MV9D 5I8OL 2OL3H 3OAYK 5LWYH 3LS5L 2OYPA 1IILE 3U30B 1RIVL 4YIQB 3SO3B 4H0HB 3VFOB 3TM6A 5I19H 3EGSB 3U9UA 1EEYA 3RWGB 4PLKC 4X6FA 1AGEB 2VAJA 4AIXA 4JY5L 2WAHA 1F3RB 4NT6A 3KPOB 4HLJA 3MO1A 5FO9A 3CH1A 2COQA 3SKUD 2DQUL 4HH9A 2ARJA 1QFHA 1FVCA 3IYLW 1JPGB 2P5WE 4JDZA 3RHWK 5TE6L 4F33B 1VCAA 5C0IB 1MFDH 4WY7L 3P9LA 2ZNWA 2AEIT 2E5EA 3MBEB 3U4BH 2O61B 2IC2A 1MFEL 1FFOB 3MLYL 4JDVA 2G60L 1UENA 3I50L 2ESVE 5E9DA 3SDXA 3VXRB 3RNQB 5HYQB 1C1EH 3KPNB 2G2RA 1FNGB 15C8H 5C2BH 1GGIH 1EPFA 4MQ7B 3V7AE 4JFFA 4ELMA 1I7TB 4M9PA 2GKIA 4ZFGL 4U3XA 4KHTL 4YAQA 1EHLH 2P5EB 4NO5B 2PW1A 5D5MB 3FZUD 3D0LA 1NFDA 1UACL 4PJGE 2AP2A 4YGAB 1CE6B 1TCRA 1OSPL 2JB5L 5B3JF 5JPNA 3MV8A 4JO3L 4AJ0A 4TVSa 1V3KA 4BSWA 4HX1A 3P4LA 3QIWD 4YE4L 3FCTA 4R2GC 1F4WL 4ETQB 3P77B 3CGTA 1XIWC 4KVNL 4UQ2A 4N0FB 4MA3B 4FQ1L 3RQ3A 3HB3C 5CP3H 3Q6GH 5GGVY 2GAZA 4NPYA 3CFDB 4HJGB 4ZUWB 3LVEA 4ODXB 2O5XH 3CVHL 1KJMA 1UKSA 3MFFB 3TC9A 5MERA 1H8SA 5E94B 4O58H 3NGBC 1WUNT 4FHBD 4R4FL 5F96H 2Y4SA 1F90H 5A2LH 1A6VH 1YJDH 4LRNL 1CDJA 4S0TD 3F62A 3ALPA 4IOIA 1IEAB 1KULA 3RX8A 3H3PL 2MQ0A 2E6JA 5ITBL 1MCCA 2PYFB 5HJ3A 3D85D 3MV9E 4LCYB 4BK4A 1G0DA 3C8KA 4YHYC 1PSKH 3AU1B 4HUVA 4ONOA 3O4LD 4KHXH 1GL4B 5E2TH 3BH9A 3MRRB 2F54B 1KENL 5D1QA 2UV3A 5HYJA 5ACZB 2XFXA 1YY9D 4U1KA 1L0XA 1OGTB 2H9GA 1MCQA 2EE6A 4JFYB 4OBRA 4PGCA 4WU5A 1ND0B 1PJ9A 3MLZH 2PO6D 1T2QL 2D4DA 4K7PY 4FG6C 1JWSB 1ZANL 5E6ID 1PG7H 2ZOLB 4OLWL 1RY7B 4E0RA 2X1PA 3ILQC 5EZLA 4PGJA 2MTPA 3BMVA 4TUOB 4QRUA 1TJHL 1HYSC 3L5IA 2ITCB 3PWPA 3AMKA 2KUTA 5FYLL 3HMWH 1M7IB 4P5TD 4XVUD 3N1QC 3VRJB 1NGXB 3H7BB 3QQ9C 1MF2H 1DQDL 1CFBA 1F4YH 5GGTL 3GMMB 1VGEH 4XWGL 5T1LD 2EIZA 4IRJA 3MLPA 1BAFH 2YD6A 5HHVH 3NABL 4HZLB 5D7JA 4LU5L 3RKPA 3X14A 1G7LB 3BEVA 3WLWC 3SKJL 2HKFH 1A7NH 1WK0A 1X5AA 3SE9L 3UTPD 4BJLA 4N9OB 1SMAA 1NCDH 2DD8L 3UTZA 4FTVB 2X1WL 1KIQB 4Q0XH 2HFEB 3V9FA 4OTXH 2FH6A 4ZFFA 1HQRA 2FIKA 3GI8L 4RGMB 2DQGH 3R0MA 1XCTA 4G80B 3NIDE 4NBXB 1NCBL 2BVQA 4PB9H 2OQJB 4HCRH 4MD5A 1A9BB 3SJVA 2IMMA 2HFGL 3VXSE 1MRCH 1YA5A 4YBQC 4YFDB 5IV2B 3MJ6A 3H0TB 5TF1L 4CDHA 4U31A 1RJYA 1KPUA 4TUJB 1CFTB 5C0FA 3QBTB 4FNLL 2CUMA 1PKQE 4MNQE 4XPGL 2Y9RT 1RUAH 4Y19D 2PTVA 3CSPA 1YECL 2GYSA 2X09A 4M8VA 5BOPA 3OGOE 1JPSL 3O4LE 3ECBA 4NKDA 5D96B 3LMJL 2V9TA 1PX3A 1X7QB 4Z7WE 2GCYA 5IW3A 3FQNB 3GK8L 3IETB 1AD9A 5AZ2L 3QIBD 4HFWB 3V0AC 2IG2L 4RRPA 3O3AB 1CL7L 2QQLH 1VFAB 4TSCL 1F97A 2OXHA 5GS1B 3M1BA 4IHOA 1XF5A 4PGEA 3MLWH 2Q8BL 4E42B 3TESA 4BSJA 3FN3A 3QQ3B 2F19H 1QBAA 3BZFA 4MJ5A 4XCFH 1WSST 3CFJA 5DZNA 2F5AH 4YC2B 2JCCB 2DB8A 4UU9A 2VDQL 3QEGL 4G8IB 5KSBE 5DD1L 1JMXA 4PJ9D 1G0YR 1TZHB 2AABL 3AS0A 1UWGH 3CFKB 1R0AH 3GMNA 4P23D 4XGZA 4NO2A 4NOFA 3IU4L 1Q38A 1AR1D 2R1WA 3PQYB 2X89D 4M7KL 3O2DH 1Z0MA 4OZGB 1HH6B 3WN5A 1JHTA 1A1MB 1KV3A 1FZOA 4WGWB 4E41D 1NLBL 5IEKB 1MCWW 1M7XA 1LEGA 1FFQA 4C58B 2V9QA 3PIQA 3L5HA 4F57L 5D93C 2R2EA 4X4MA 3VG0H 4Y89A 4G8EB 1N64H 1P4IL 2F53A 5BVJA 5KS9F 1ZLVH 2LAGB 4BUHA 5ADOL 1JI2A 1I9JL 1DVFD 4LOUD 2C1PA 4S10A 1VEOA 1W72L 5ID1A 2XTJC 3MRKB 4PJ5A 1BJMA 1J0KA 2VITA 3F12B 1ZKAA 2X2YA 2CJUL 3RY5A 2DTSA 2OTPA 4QT5B 3RTQA 1MPAH 3GMOB 4NNPL 4JKPH 1RFDH 3WFHB 4PLJD 3E3QE 1OTSD 4FS0A 1XT5A 3TYGL 4JO4H 4ENEC 1F3DJ 1J8HA 1S7XB 3OKMB 5DC0A 2GY5A 2HT3D 5CZVL 32C2A 4GG6E 2DBJA 5CEYA 1MUJA 5B38B 1XF3B 1IQWL 4PJ8A 2VUOA 1T04B 3RZCC 3EAKA 3SCMD 5C3TA 4PS4L 1SYSB 1ZT7B 3QUYA 4WCYH 2AK1L 4N68A 1W0YT 3DRTA 3ARFA 1KYOJ 2JJSA 4NM8L 2AEQL 1SM3H 5INCB 1G7QB 5J0BA 2E8YA 3GNMH 3MRHA 4U6HB 5F7EH 1JF6A 3CFEA 4WFFD 4TTDC 1V7NH 1FL5B 4UDUA 1DQML 3X12A 3H9ZA 1A3RH 5GZNC 4KJPD 1AP2B 4NQCD 5FAAA 1A7OH 1KG0B 1E0OB 4QYOA 4IDJH 2XWBA 5DUPH 2P43B 1GHFH 2XTLA 4NNXA 4R96B 1QEWA 1U8OA 4XRCB 4YEFA 1ERNA 3E8UH 3FAXA 5HVWA 3PGCA 4MDJB 4POZD 3BZ4A 3TO4A 1NMBL 3FB6B 2BX5A 2C4XA 5DVKA 5MEOB 4L4TD 3VFRB 4JPIB 2C7UB 1U3ZA 3TWCH 2NPLX 3WIFB 1TZGL 1KLUA 2BK8A 2XZAH 3KPRB 2VIRB 3QFJE 4OV5A 2OS7A 3DROA 3P11H 4PY7B 4H26B 1GPOL 1VGKB 1YMMB 3MRDA 2PYED 3BVNB 5E99H 5J12C 3BE1L 2VDMH 4N90D 2RBLA 4HXAH 2VTFA 3B2VH 4X83A 1A1OA 1CICD 1MJJA 4QHMB 5KVFH 4XBEL 4ZQKB 4U2YA 4ZSOE 3MACL 5AYQA 3QFDB 5I74C 5BO1L 4PRBA 1WQVT 5LBSL 3O11B 1F6FB 4KKBC 4WO4A 3REWA 5LGKA 1TTFA 3VH8G 3ZKXC 3GJFH 1LILA 3FQWB 3O4OC 3BPOB 5HYSB 4N0YH 5JMRA 4LL9A 1JZ5A 2DQEL 4XPFL 1RIUH 3QUZA 3O3DB 5BS0D 4O9HH 4OD1H 2H6PA 5IHZB 4XP1H 4U1JA 3DMMD 3SDDD 4EBQH 2PCPB 4PRAB 5DK2B 4ZPVA 3UBXA 2Y5TA 4IOFC 2A83B 3DTXA 5IW6B 3V52H 4K8RL 1DDHB 3VFSB 3ZDZE 1I3GH 4HF5L 1MWAL 2BOCA 5C08E 3QWQB 4DEPB 1BFVL 2W9DL 3BI9X 3HUJB 3RVXD 1C5BH 2NLJA 3QCTH 5IHUH 2GFBB 4NFBA 3MRIA 4G7VH 1JYWA 2EECA 5IEHA 1YNLL 5DLMH 3RBSA 1BF2A 3GMPA 1RJZA 4OCSL 4DK6A 1IC7L 2IQAB 1WJ3A 2MSPA 5DJCA 3WFBH 2GSGA 1JCKA 4UILH 5HI5C 4YFEA 4NRZB 4D0BB 4RNRB 5JHDD 3G5XA 5I8CB 1L9NA 3CVHB 4AEHH 4KUCD 2IQ9H 4FFVC 4A2LA 1HHHA 1YPZB 4LSUL 5E2WL 3RNKB 3T8XB 5HHOA 1T1WA 2NW3A 1HCFX 4YHMH 5BRZD 1HSBB 4WI4A 1CG9B 2F9BT 3BQUC 4JFQB 4X9FA 3TIEB 3PGFH 1CFVL 3D69A 4MA7L 5A16A 2FSEB 3VFPA 1QBMH 3DURB 3MCKB 2CGRL 3TJEL 3SQBA 2NMSA 5D7IB 1IRAY 1P84K 4KI1A 4QO1A 1QFWI 2BNUA 5AWNL 3TCXA 3EFDH 4HK0A 3FMGL 1H3PL 2DM3A 4RGOH 2XKSA 4IIQB 4HQQL 2OJEB 3KPMA 4IMKA 5TDNB 1LWRA 3MGTA 1MFCH 1JZ3A 2AQ2A 3EJYD 5T5FH 3U0PB 4G3YH 5E8PA 5FECB 3O41B 4YDIL 5TPWL 2VWEC 1FPTL 2EDLA 5T3ZH 1X6LA 5J13C 4NWUH 4YHLL 4I3SH 4N0CC 5CSGA 2XOTA 2EE2A 1S5HA 4ZD3L 5DJ0B 3VXQA 1NAKL 4BH8B 2X10A 3WIHA 4QXGL 5DT1H 4PP2B 3QH3B 4EI5D 1KPRB 2HJFA 4KZEL 5FYKH 2V2XB 2XN9E 1DUYB 4LKXB 1A2YB 4BQ8A 1JF5A 1UZ6E 3ROOA 1F45A 4WNQB 3W5MA 3QUKA 8FABB 3VFWB 2Z93B 5BS0E 4TSBL 5T3XD 4L1HA 3MJ9L 2P4AB 3TP4A 1SJHB 2ZKHL 2Q6WA 3BRFA 4PV8B 5CBAB 1D5IH 4KKCD 4O00A 3F5WA 1RQ5A 2CDFA 2ZUUA 2CIIB 3PNWA 1DUZA 2Z31B 4G8GD 4D3CH 4FQIL 4GUPA 3P9WB 2MHAB 2QR0B 2DQIL 3B43A 1M1SA 3VA6A 4B5EA 1NLDL 1XEDA 1BVKA 1D6EB 4XAWL 5IB2A 4LGPB 5EB9A 1DQJB 2EYSA 2R9HD 5F1NB 2EE3A 2FL5B 2PR4H 3D87B 3FN0L 4CU8A 1HXMA 2IAMC 2YS4A 1S9XA 5FA4B 2GJ6A 1YQVL 1RUKL 4XI5D 2EKSB 3BIKB 4BK5A 3O8XB 2A6IB 3LAFA 3MLTB 1MLBA 2APBA 3BAEH 3D0VB 2EDOA 5BRZE 1Q0YL 3RP1A 1EBPA 1DN0A 4W4OC 3EOTL 1MCJA 2X1XR 4P2RB 1NBYA 1BECA 4QHKI 3KPSA 1WZ1H 4RAVA 1MH5B 2I9LA 1G7MA 3K81A 2HFFA 1V3LA 4NJAL 3ZE2E 3HC0B 3KNBA 1BBDL 3E1F1 2OMBA 2VXQH 1EFQA 4X7TB 5HDQH 1U93A 2UUDK 3BWAA 3D39A 4EN3D 4NHCL 3D18A 3I2CL 2R56L 4IS6A 1J10A 1TVBB 3GSQA 5E70A 2BVTA 4FA8A 4P46B 5LWYL 1Q9WA 2P5WB 2J8OA 5I19L 5DJ8A 1OTUD 5MI0B 1T4KA 4A6YA 3AY4C 1AC0A 1NMCC 3OKNA 1PQZB 4NYLB 2JJTC 2VZOA 4KDVA 3QHZL 3GBMH 4EUPH 4XNXH 4PRHE 4AIOA 5A3ID 3WO3B 1KEGL 5HGBA 3WNOA 4YNYB 4NCC2 5D1XC 3RZWA 3WUWA 3HNVH 4RFEA 1J1PH 5ALCL 4GRWF 2BSED 1JVKA 1WWWX 4HWEH 2V6HA 4MXWH 4NP4H 2N7AA 1F3JA 1QA9B 3FZUC 5ILTH 5SWZA 4MCYA 4XVJH 2V17H 1AY1H 1IGJA 4JO1L 4OLVH 3U4BL 4PJGB 3MRJB 2KZ1B 3IKKA 2EYTB 2ZG1A 4JRYA 1QD0A 5EO9B 4XPTH 1M05B 4TQEH 3GGWA 4HKBB 1GGIL 3QIWC 1O0VA 2P8LA 1FRGL 4DFHA 4GRMB 3S3JA 3W5NA 1EHLL 1GC1L 5EPMB 4ZS7H 3DGCR 3OKLA 3S36H 3LH2H 3BZEB 5EOCJ 3KXFA 2HJKA 1YYMH 4HIEA 3RUGB 5F9WB 4OIIH 3T2PA 1JUFA 3SN6N 4GBXA 5GGSA 1IMHC 3UC0H 1IC5H 4TUKL 5INDA 2WUBH 1B2WH 4XVSL 5BXFA 2W0KA 3P73B 3QQ4A 1W72B 1I7RB 5KVGL 3RGVB 1FVEB 2LTQC 4FXGB 2X4OB 5SV4A 5LQBL 3O6FA 1TTUA 2EDTA 3Q6GL 1ONQA 4JGJA 1ZSDA 4JFFD 5C8JA 1HEZA 1N6UA 2SEBB 4G6MH 4JPKH 4RMVA 2NY2B 2O5XL 4QOKB 4V1DA 5I1AB 5E5MA 2VXTH 1DANU 1FN4B 5F96L 1HI6B 3WNNA 5FV1L 1OAKH 5TDOB 3MV8D 2DLIA 2VO5A 1F90L 4OZHA 1A6VL 1YJDL 5JW5B 5B3JE 1X5FA 4P5KB 5EO1A 1B88A 2YK1L 3SKMB 3QO1B 5F1IB 4RZCB 3LB6D 3C6LA 1BGXH 2FHBA 5J11B 4ZG1A 2AV1A 5I1GH 1BQLH 1QFUH 4L8DA 1ZGLM 5KSUA 2X41A 5F1OB 4YPJA 2PO6C 1BREA 1PSKL 3RJDA 1U8KB 1IGYB 2XKNA 1KEMH 4KHXL 3TGXA 1BBJB 3NTCH 5E6IC 3MUGA 4S1RH 1RU9H 2HT4D 3S8WA 3G9VA 3QCVH 5ICXB 4LNRA 1DR9A 3I6LD 1NBZA 2DRUA 3EOYG 2EH8H 1QSFA 3BKYL 1UXWB 4P5TC 3MLZL 4XVUC 3RVWD 3IAGC 1MFNA 4JR9H 5EN2A 5H37G 1G6RH 5DD0L 1U91B 4BH7A 4JM2A 2M1KA 5IBLD 4JY6B 2X4SB 1KB5H 1PG7L 5I30H 5DVNA 5IESH 3OR6B 4JKMA 1PW3A 3OAYH 4N9GA 3R06A 3WNMA 4FN0A 5ITFA 3HMWL 4JN1H 1D9KB 2DJUA 3NFSH 1B0RA 1W0WA 1BQHG 2CIKB 1ZA6B 3TFKC 1F4YL 4ZXBA 3STLA 1VGEL 5HHQB 1FFRA 1I8KA 1FV1B 3MBXL 4PJAF 5IB3A 2VN7A 4L3EB 3RL1B 5HHVL 3HC4H 3MLRL 1KTLB 4I18A 3SGJC 1OT1A 1JNNH 4YR6A 1JNJA 2HKFL 1A7NL 5CGYD 5JIHA 2VXVH 2D0FA 4HUXA 2IF7A 3LKNB 5E9DE 3SDXE 2FO1A 1NCDL 3F7VB 4LP4A 5IQ9B 5BV7C 3AROA 3OKKB 4XHQA 4Q0XL 1RZJC 3PE9A 4JFFE 4XNMB 4ELME 4NN5C 4OTXL 3ZSTA 1P1ZB 1SVCP 3JWDC 1JK8B 2JTDA 4APQC 4PB9L 1PKQB 2BJML 4IRJD 4MNQB 3MZTA 3UTQB 4HCRL 5C3LD 1MRCL 4Y5XA 1MWAB 5GS3A 5D7JD 4M62L 5DEGB 5ISZA 4EQ2A 4LF3B 1YYLH 5BW7C 1YMHB 2VZSA 4RA0C 4Z7WB 4ZAKB 3FO9A 2QQNH 2YSSA 5MEND 5GIRA 4PJHA 1RUAL 1WVZA 2G9HA 3TYFA 3QXDB 3EYFB 1CN4A 1EUUA 2BP3A 5E8OA 5GS2D 3U9PH 5JPMA 3JUYA 2Z8WC 4CMHC 4CVUA 3SJVD 5BVPH 3A67H 3ZKSD 1HH9A 2QLVB 2BVPB 1HXYA 1DBBL 3EFFA 1LK2A 5KSBB 2DDQH 4M1CC 2QQLL 5I16B 3VXOA 4OD2B 3NZ8A 1NANI 4KQ3L 3MLWL 5EBMB 4YBLB 4DN3H 2H2PC 2O5YH 3DX8B 5F7KC 3OAZH 2QBWA 1MCDA 2F19L 2I27N 2IEPA 2XQYK 2F5AL 1CT8B 5DDHB 4P2OA 2NY0D 3ZE1F 5FGCE 5KSVB 1R0AL 1UWGL 5J6HB 2PTUA 5HGHA 1PG7X 3QWOA 4UQ3B 5I73B 4OBSA 4H0IA 4F7PA 4UBDD 4G9FA 4X0KB 5HYJE 1LEIB 5IP4A 2AXHA 3DOSA 3UZQA 3O3EB 1KTDB 4I9WD 3QZWA 2KH2B 4GRWH 1N5YH 4U1GB 4QRRE 3O2DL 1DQTA 1T0MA 3WS3A 3LV3B 4HWUA 4WFED 2VAAB 2Y7QB 5BV7H 4L4VB 3ALWA 1RZJH 1EEZA 2ARJQ 3LEVH 1U42A 2DQFA 4H5SA 4KUCF 5JQ6H 4IOSD 5BJTA 1NCCL 2Q7NA 4NHUB 3ULUF 4TYUA 3VG0L 4PBVC 2G5BA 2VZTA 4JEGB 3JWDH 4WTWA 1WBZA 2A9NH 4OI8A 5BCAA 3PWPE 3HLAA 5JOEA 1CLZH 4ONFH 2GY7B 4MAYA 2FB4L 2HT3C 3V0VB 5IMOA 4ZUTB 4GG6B 1U3YA 1MCHA 3C87A 3UAJC 3D6GA 4D9LL 4KKLD 3S4SA 1MPAL 4GKZA 4RFOH 4YWGH 1RFDL 2UWEF 4OIBA 5DZOA 5E08L 3QDJA 2W60A 3DSNA 2F53D 5DK3A 2X1OA 3HG1A 3NIGF 4LBEA 1T66C 4JO4L 2P24A 2VXUH 1T1XB 4CU7A 1JF1B 4NDMB 2AQ3A 2H32H 5IG7A 3KPPA 4PG2A 5IFJB 3EIFA 3A6OA 4GAYA 4PJ5D 4WCYL 1BIIB 1GOGA 3K80A 3DV6A 3MOQA 1HZHH 3Q3GB 3SJVE 1SM3L 3RTQD 5CEZH 1UJ3A 1H3GA 2GITB 5F7EL 3GBNH 2VH5L 4QHUB 3RVTC 4M43H 4L8CA 1A3RL 5JDJA 4KK5D 4LVHC 1XF2B 1A7OL 4H25B 3NAAH 1J8HD 4IDJL 1I8LC 4MXQD 1GHFL 5DJXA 3GJEA 2XNAA 4J4PD 4PJ8D 4TNVF 3QFJB 4F8TA 5HHXL 4BSVB 3G08A 3QA3A 4LPVA 5E4IA 4PRPB 5ADPH 1CLYH 4KJQC 4QGYA 3MUZ1 3QUYD 2Q86A 3L9RB 4XB7A 3VA2C 3ARFD 4X7FC 4JRXB 1TQBC 3GZKA 4HMCA 4YDJB 3TWCL 1OP5K 4I9WE 1MLCB 3H3BC 5E6YA 2XZAL 4ZSOB 4F7CB 2ID5A 1U2HA 4XP9L 3OAUL 4YXHH 3WFEH 3K3QA 2GJZB 3I84A 4WV1C 1N0XH 4OKVA 3UTSD 4ZFZB 3SGEH 2QQQA 3B5TA 2VZUA 3IXTB 4BKLA 1I8MB 3FFCA 3G6JA 3OJDA 2B0SL 2VDML 5T33H 4HXAL 2V2TA 2FGZA 3B2VL 2ILLA 1FGVH 1UWXK 1D5BA 4P9MH 3VXUB 4PJFA 5D8JH 7FABH 3WS6A 5GGQH 3IJSA 2VR9A 1WBXB 2PXYC 4CUCA 5D2LF 3DX6A 5C08B 5DFTA 3RVXC 5IJKC 4K3DH 4N0YL 2ADFH 2ORBH 4Q9QH 5F88B 3RIAK 2AKRA 1RIUL 2OP4H 1SMOA 4O9HL 4OD1L 5KSAB 3N85H 5K9KA 2R69L 4XP1L 3GKWH 2VXSH 4EBQL 4QF1B 4F9PC 4OFYA 3LN4B 3NPZB 3V52L 4D9QE 5CJ5A 2EDRA 1UVQA 1MHCA 3PDGA 2F53E 5DJDB 3WFZA 4U1LB 1NEZG 1C5BL 3B9KB 3GHBH 3QCTL 5IHUL 1A02N 2QTEA 4PJDA 4OZFG 3T3PF 3ULUC 1JYVA 2H45A 2MNUA 4G7VL 4WO4D 3QUMA 3PP4H 2CMRH 4L9LC 5DLML 5HDLA 2GTWA 1SBSL 2D0GA 4GAFB 5FF6A 2XZCH 5H94B 1X4XA 4UILL 1AD0A 4ZUUA 3WLBA 3QUZD 3ARBB 1S7WB 2IQ9L 1ZLUH 3GSOB 3PJSA 4KVCH 4C57C 3ARSA 4Y4HA 1FSKB 3IDIB 2WIIA 3HI1A 2JIXB 5B8CC 1KACB 4YHML 3EJZC 3ZKMD 1FGNH 1XGQA 3K2MC 4ODUA 2MQ3A 3AVEA 3BKMH 3PGFL 4BYHA 4BZ2H 1YEJH 2OMNA 2VLKB 3HZYA 1INQA 1QBML 1RK0A 1S7TA 5FYJD 2C3VA 4OCYH 3LKSA 1XGRB 2YWZA 1N6QH 3EFDL 1NJ9B 4HKXA 3OJVC 3U0WH 4RGOL 1B0GB 1KPVB 1DCLA 5ESQA 1JN6A 1MFCL 1KTKE 3MXWH 2I5YH 1OAUL 2VQ1B 5HHOD 5T5FL 2LVCA 4BA8A 4PJ7B 1L0YA 4YIQA 5KW9H 2VDOH 1AQKL 3LQZB 3VFOA 1EEQA 3EGSA 5T3ZL 4XX1E 3RWGA 5L2JB 5J06A 3CUPB 2L4OA 4NWUL 2QSTA 2XN9B 3KLSA 3P3YA 4I3SL 4MQTB 2D9CA 1SY6H 3KPOA 5TJWK 4KAQH 4WTZG 3OF6A 5DMGC 1OTTD 2NTFB 4J3SA 4Z7OF 1JPGA 5IBUB 4KROD 1G7HB 5DT1L 5HVHC 2J6EA 3H3KA 4F33A 5C0IA 5C6PB 4HWBA 1NQBA 5F3BB 1OWRM 4U1HB 2K7PA 3SGKA 3MBEA 3JV6B 5K59F 1X6NA 4YLQT 2O61A 1R5WB 1FFOA 4HMEA 4G7YH 3ULUH 3X11B 2AXFB 4R2GB 3NCMA 3VXRA 4ORZC 3THMH 4JPWL 3RNQA 1I1YB 3WUZA 2P47B 1XIWB 1T6WA 5HD8D 1HKFA 3KPNA 5HYQA 1DE4B 1FNGA 2R9HC 4ZOBA 3UCRA 4G6FB 1D5IL 1I7TA 1NUFA 2MMXA 3QXWA 1FFNB 4Y1AE 5AYUL 4NIKB 2P5EA 3RWCB 1WWCA 1ZEAH 1EZVX 2DTMH 4NO5A 4XI5C 5D5MA 4KTEL 4WI2A 1LQSR 1EAPB 4D3CL 2VZVA 3QDGE 2YMXH 1IGIH 4LCCC 2O93L 3FT2B 4HS8L 5C6TH 4M8QB 3NGBB 1PBYA 5D4QA 3EDEA 3P30L 3MLSH 3T09A 2PR4L 2NY3D 2NXYD 4ETQA 4QHKJ 3P77A 3F65A 2ICWB 2YZ1A 4AIZA 4N0FA 3MJGX 2DIJA 2XG5A 3CFDA 5IB4B 3BAEL 1CLOH 4ZUWA 4ODXA 2AJXH 1ZE3C 4EN3C 4DVRH 1KYOK 2C5DC 3KYMB 3MFFA 4FZEH 1FC2D 3B9VA 3D9AH 4YHYB 5LXGH 3D25A 5E94A 1QOKA 4LDEB 4A2MA 3T2QA 2EEDA 1CQYA 3DNKA 1AIFA 1KBGL 3UO1L 5FYJE 5IBTH 4WI6A 3K4AA 4OF6A 2MCG1 3LEXA 1EGJH 4GS7C 1QLFB 4JGUA 4PYHA 1FO0A 1IEAA 4ZYKB 2VXQL 5FFLA 3TA3C 5HDQL 1O7VA 1QLEH 4JZNB 2BRRH 4PRHB 3WJLA 5DHYB 3MOBH 1WAAA 3WEXA 4LCYA 5HHOE 3AU1A 5T3XH 1HWHB 5JXEA 4LKCB 4CNIA 2WNGA 3DVNB 3MRRA 5CLTA 3OJ2C 4JFPA 4MA8H 5ACZA 4M6NL 3GBML 4XNXL 4XPHH 3KPSD 3HR5B 4DGVH 1KJVB 1OGTA 2W65B 5MEPB 1A7RH 4LVEA 4JFYA 2OTWB 1J1PL 1T7VA 5E0QA 5JOPD 1ND0A 3ZDYF 4NQEB 3D39D 4QY8B 1JWSA 2IANB 5ILTL 4XVJL 2W07A 1IAII 1ORSB 2J88L 2V17L 1AY1L 2ZOLA 3EO0B 1JGEB 2V5RA 5EU6A 4H1LG 4KXZH 3QRGH 1AO7E 4IEFB 4PJEF 4TUOA 3LRSB 2ITCA 2X7LB 4UOW0 4C55A 4RGND 5GGVH 3B6SA 4RAHA 1M7IA 1OQOA 1KSRA 1FL3B 1HNGA 3U4AA 3S36L 1G7IB 1NGXA 3H7BA 3VRJA 3CX5K 3SGEI 2NY4B 1OPGH 4LASH 1YYML 4OIIL 3V4VL 3S5LB 4X6DF 4ALAL 5GRXG 4Q9BA 5F97E 2OXGA 1IC5L 5A40E 4ZNCD 1EMTH 2WUBL 2HTKC 3EOAB 1MJ7L 2A6DB 4HZLA 1II4E 4ODTH 4LHJB 4JRYD 4PTTB 1BMGA 2WWMD 4LCWB 1ZS8B 3JV0A 2HJLB 3RU8L 5SX4H 3VMOA 4YUEH 3LB6C 1N6VA 3Q1SH 1GOHA 1T2XA 4JPKL 4G6ML 4W68A 4FTVA 1KIQA 2HFEA 5C1MB 1GGUA 4PYGA 5ICZB 4TRPH 2VXTL 2VSCA 4UUJB 3R8BB 4G80A 5DGQA 1OAKL 4GBXD 3ARQA 4RMWA 3VFMB 2OQJA 3DJ9A 1A9BA 2FHCA 1KN2L 1FP5A 5GISH 2HT4C 2D03H 1BGXL 5I1HH 3ZDXF 3H0TA 3MA7B 4MQSB 1A5FH 4TUJA 3O6FD 2H3NB 4K7PH 2GJ6E 3P4MA 1WICA 2FIRT 1QFUL 3IVKB 1IM9B 2YRZA 3CH8A 4QTIL 2Q8AH 5EH1A 2QL1A 3LHPL 5IBLC 2XICA 3NTCL 2CKBH 4MJ6A 2P8PB 3HZMB 4IDLA 1CXIA 4S1RL 1RU9L 5GRJH 3HC3L 3QCVL 1X7QA 5JOFB 3FQNA 2MWCA 3IETA 3VXPB 1CWVA 5CBEB 3U9UB 5K33A 4HFWA 4EXKA 4HKJB 3KPSE 3WDJA 5I1EH 3C6LD 4DW2L 2BRQA 3O3AA 5KBNC 1VFAA 5JZ7D 4JR9L 4DN4L 5GS1A 4ZFOL 1U8NB 5CEZE 1JHLH 3WFCH 4Y5YA 2OTUB 1VDGA 4MX7B 3D39E 4UB0H 5FO9B 4E42A 3HZVB 5I30L 3ISWA 1YC7A 3QQ3A 3HAEH 4UV4L 1T6VN 2EDHA 4FQCH 2JCCA 1C5CL 1QO3B 4YDLC 4ZOCA 3QXVA 3P0GB 2KQNA 2E7LC 2GJJA 4GAJH 5C0AA 3ZT5A 4G8IA 3NCEB 3D3VD 1TZHA 3CFKA 4JN1L 2P42B 2LE9A 3A6BH 3L5JA 3NFSL 3C5ZC 4RGNE 4NC0B 1RVFH 3HPLB 5CGYC 4D2NA 2DI7A 1CU4H 1QSFD 1T3FB 4LLQB 5E9DB 3PQYA 4OZGA 1ITBB 4NQDA 1Y0LB 1S7RB 1XGTB 4PB0H 1OAZH 1VHPA 4JM2D 3HPJB 4OZ4A 3HC4L 2YN3A 3SE3A 1H3TA 5SWZE 5HXMA 5CUSH 4LLMB 3V4UL 3LPGA 4IRJC 4XMKH 4OCXH 2JELL 4JRYE 2VXVL 3PWVB 4G8EA 5JPNB 3QEHB 2QHLA 1PGRB 1A6UL 4XHJD 1S7QB 4UOJA 4ZXBD 1TXKA 4UQ2B 1RZ7L 3KXFE 4YDVB 3FAWA 3Q5TA 3F12A 4WW1A 3S98A 5FA3B 3U7YH 2VC2H 4QT5A 3VXME 3VWJA 4U6TA 3GMOA 1YYLL 3PUCA 3GFUA 3L3JB 3WFHA 3QUXA 4UT9L 4NQVB 1IAOA 1J7VR 4LARL 2P8MA 1M4KA 3F8UB 1Z6JT 1H3UA 4GAGH 1ADQH 1S7XA 3OKMA 3ARPA 4MA1C 4NC1E 4BQCA 1NKRA 4HS6B 2AXGB 3C60B 3MROB 5KTEL 5B38A 1XF3A 4V1DE 5H2BB 1SYSA 2XXCB 2IPTH 1ZT7A 4W70A 5GRUH 3C8KB 1WIOA 1KELL 3R1GH 1G7QA 4OAWB 4XXCA 5ISZD 1AGBB 1U8IB 4WUUE 5FGCB 2L7UA 2EZ0D 1KCVH 4U6HA 5I15H 2NY6B 1FL5A 4B7IA 1AP2A 1LHZA 4WU7B 1B4JL 5IFHH 2R8SL 4QRRB 1DLFL 1T5WB 4O51B 6FABH 3QWRA 4NGHH 4R96A 1C12B 2X4NB 4XRCA 3TZVC 5J12B 2FATH 3PHQB 1AXTH 1GGTA 4NZUH 4MDJA 5CKAA 1KOAA 1VEMA 4BZ1L 1A0QH 2EDFA 3FB6A 5MEOA 1S9WB 3WIHL 5I74B 3QQNA 3TT3H 4M6MH 4MMXC 1N5YL 3VFRA 4JPIA 2C7UA 1QRNA 1FL6B 3WIFA 4K3EL 4Z9KB 1XGPB 3LDBC 2YA2A 3KPRA 1FNSL 3PWPB 2VIRA 1EO8H 5GHWH 3T3ME 5F8QC 2YZ8A 1ES0B 3B2UC 4H20L 5I6XC 5BV7L 5F7DB 3LEVL 1RZJL 1BLNB 2CKNA 2UZYB 3EHBD 4H26A 2VLLB 4LSSH 4PY7A 5DJYA 5JQ6L 2O5ZL 1Q0XL 3WN5C 3FQRA 1VGKA 1YMMA 4QTHA 3BVNA 4P2OD 4JZJB 5I76B 3JWDL 3WHXB 3IDUA 2A9NL 2EIZB 4HLZH 4JQXA 4KKLC 2B7DT 3WJJA 2J8UF 1RAMA 2DM2A 4QHMA 3N1PC 4ZQKA 1V3JA 4G9FD 5D7LA 1PG7W 3O11A 2EEAA 4ONFL 4FRWA 4FQ2H 5GZOD 3OHXB 2XA8L 4I0PC 5KS9B 3FQWA 5HYSA 3LRHA 5KZCB 1FYHB 1ZK9A 4X80H 1UM5H 2Y72A 4OFDA 2X4QB 3U2SB 4RFOL 1U58B 2E27H 1MCIA 2FCBA 2PCPA 5J4MA 2IPUG 4PRAA 2A9MH 3RIAF 4KKAD 1XCTB 3BO8B 5IW6A 2JK5B 2HLFD 1OP3H 3ULUE 1DDHA 2VXUL 4MD5B 1SJEB 2QHRH 4NUJB 5AAMA 3HUJA 5AZEH 2GFBA 3BQUB 4Y88A 4MAYD 4P3CH 1K3IA 2AJUH 5E8EB 1K4DB 1X5YA 3EDFA 4GXVL 4XTRD 4Y4FD 4K2UH 4TVPD 4J4PC 4MJ2A 5GS0D 1GH7A 4PJ8C 1HZHL 3P0VH 1V7MH 4CN6A 2YBRA 2ITDB 5CEZL 5EUOF 4D0BA 1J0HA 4RNRA 3CZFB 4ZUVB 3V6FB 3NFNB 4KI5F 1F6AA 3CVHA 2CDGB 5I8CA 3QDJD 5DMKB 1OT2A 3KPTA 2UWEE 3HG1D 2HTLD 1YPZA 4UT6L 3ARVA 3T8XA 3RNKA 2OR9H 3BGFB 1CG9A 4JFQA 4PJHE 3TIEA 2FSEA 3G6DH 3F7PC 3DURA 3MCKA 4IHOB 2VABB 4OUUA 2MPAH 1U8LB 5J13B 5C7XH 1IGMH 4PGEB 1CLYL 5D7IA 2HMID 1T1YB 3HI5L 1KIRB 4LHUG 4OLYL 2BOBB 3BN9D 4K55A 3KR3H 1AGDB 5JMOC 5F9JB 2IPUK 5HTSA 5I1CH 5D2NA 1HCVA 1IFHH 4IIQA 2OJEA 4YXHL 4XCNA 5FDYA 3WFEL 1IBGH 5TDNA 3F58L 2DN7A 4O02H 4NNYB 1N0XL 4JCLA 3MRQB 4R4BB 1TQCC 3U0PA 5FECA 3O41A 4RDQG 3HTLX 5F1KC 2Q3AA 4XP4H 1VFMA 5EBWB 1U92B 5T33L 4ODSL 4O2CB 3LPWA 3GM0A 1YN6B 4PGBB 3SOBL 5DJ0A 4P9ML 5D8JL 4G9FE 7FABL 3PIQB 5GGQL 1TFHA 4BH8A 1INDL 3AM8A 3WKMH 3O0RH 4PJIF 4PP2A 1EERB 3QH3A 1JGVH 1KPRA 4K3DL 3HE6C 4GMTH 1VENA 3JWOL 3IRZA 2V2XA 2ORBL 1DUYA 4LKXA 1A2YA 1DEDA 1QSEE 1L7IH 4PD4J 1NBVH 4WNQA 3N85L 3ZTNL 2ICEB 1EHXA 3VFWA 2Z93A 5C09A 3CXHK 2IAMB 1RMFH 5GGTA 4N8PA 4QHNB 1SJHA 3QUZC 4PV8A 1BEYL 2AQ1A 5GSRA 3AXLA 5CBAA 5JLZB 4NQTA 4XCCH 4R26H 2VDLH 3ZYJA 3GHBL 2CIIA 1CZ8H 1EO7A 2Z31A 5JW4R 4XMLL 4HKZB 2CMRL 3BSZL 4YZFF 3ZKMC 5B39B 2MHAA 4G6JH 4KRPD 5D2LE 2XZCL 4BM7A 1D6EA 4EIGB 1AGCB 1DQJA 1MCLA 4NZTH 5F1NA 2FL5A 4U6VH 5CINL 5C2UB 5FA4A 4LEOB 4IRZL 4P59H 4OFYD 5I8EB 3QDJE 1BVZA 2EKSA 3BIKA 2A6IA 4RWYH 3MLTA 1RK1B 1OARH 3D0VA 1FGNL 5HHMB 3O9WA 2UVEA 5E2VH 2O26U 2F8VA 3BKML 3OPZL 4BZ2L 1YEJL 2Z4QB 3AS1A 5MEQB 4KDTC 3V7MA 3VW3H 4P2RA 1B6DA 1NMCB 4OCYL 1T89A 4O4YH 1ZLWH 3QHFL 5F70A 2BY2A 1EH9A 1MH5A 4YHNB 1NCUA 3U0WL 25C8H 5D1XB 4X7TA 1U8OB 4XCYA 4FQQB 5DRZB 3AUVA 1VACA 2OZ4H 4Y4HD 1TVBA 3BZ4B 2I5YL 5E00B 4P46A 3TO4B 5KW9L 2VDOL 2P5WA 3CLFL 1RPQA 4KI5C 4F9LC 1CDHA 1MEXL 4DOHE 3CSYB 4JKWA 2CQVA 4IBLT 2VR5A 3GKZA 2DWEA 4NYLA 1SY6L 1WTGT 4ZFOB 2WQ8A 2Q76B 3BPCB 4J3XA 1VESA 1T5XB 5HD8C 4F7EA 4YNYA 1U8QB 3UTTB 1TMCB 4NZDA 4Y1AB 4B53A 2WBJA 1QA9A 1F02I 5E2UH 5FKAB 2P49B 1XGYH 4PJGA 3QDGB 2WK2A 3MRJA 2NZIA 2EYTA 1OW0A 4G7YL 5EO9A 2G5RA 3VFVB 3ULUL 1UCBH 3BPLC 3P9MB 1DL7H 1M05A 4PRIB 5HYEA 3FFCE 1J5OH 2A1WL 4HKBA 3G6JE 4HSQA 2LTQB 2NXYC 2CXGA 4GRMA 3OF6D 1ZEAL 5EPMA 5D70H 1F8TL 3C2SA 3BZEA 4CU6A 2R2BB 4U1JB 2FD6H 4Z7OE 5GRYA 2YMXL 2J3SA 4LAJH 4Q74A 3RUGA 5K9JH 5C6TL 5IMKB 3T04D 5FUOH 1UB5B 1BJ8A 3FQTB 5F44A 3MBED 3MLUH 2CRMA 3QULB 4WVRA 1IC1A 1P5UA 3MRIB 5K59E 1W72A 1QACA 3VXRD 3RGVA 1E4XI 1FVEA 1WCQA 2X4OA 4FXGA 3SDCC 2IALA 4PG9B 3DSFH 4MDIA 3NA9H 5I17B 4DGIH 1CLOL 5DJCB 5FCUH 2SEBA 2P5ED 5EZJB 2Y06H 4QOKA 4WW2F 3VI3E 4YHKH 1A6WH 3U7WH 1WFNA 3ULVE 1N6QL 5I1AA 3D9AL 4MMZC 4PJDE 1FN4A 1HI6A 2ED8A 4R97C 4W6XB 5FGBA 3C5SB 4OFPA 3Q6FA 2A77H 4AEIH 1GXEA 5JW5A 1P5VA 1EGJL 3MFGB 4U7SA 4P5KA 3QNXB 3SKMA 3QO1A 5D72H 5F1IA 4C54A 4RZCA 3HR6A 3D69B 4F37F 4HHAA 1QLEL 2D7TH 2BRRL 1FZJB 2F58H 1LVEA 3MOBL 4C4KO 5DI8B 1GRWA 2AERT 4Y5VA 2V9RA 3QDAA 5DJAB 3GIZL 1IGYA 3IDMA 5F1SA 1WITA 1FNAA 1F13A 1BBJA 4X5LA 5DUBA 3MC0A 4LMQI 4CN4A 1JTPA 4Z5RA 5C0EB 4MA8L 5ICYB 3IDYC 1IM3B 5ICXA 2RCSH 4XPHL 5CILH 4DGVL 1AO7B 3ALXA 1WFOA 1ZWIB 2AS5M 3GIVA 4AT6B 1C7TA 1IC4H 1UXWA 3TBSB 2J7LA 3VWKC 3IFPA 1R24B 4RAUB 1R6VA 2LFGA 4LPWA 3RWJB 3NACH 1ZXQA 4JFHE 4JY6A 3S3SA 2X4SA 1UH2A 3WDHA 1FC1A 2HLAB 3VXQB 3BPNC 1DTUA 1PX4A 5CJOL 5JXED 4AH2B 2VISB 4KJWC 3LQAC 2F54D 1D5ZB 2IADA 5GGVL 5FDWB 3WCYA 1D9KA 2DMCA 4Y16C 3QDMB 5BV7B 1ZA6A 3LEYH 4ZTPH 1OPGL 4LASL 4NN5B 3RL2A 1S9VB 5HHQA 4QRTB 43C9B 1FV1A 4HXBH 1EMTL 4L3EA 4APQB 3RL1A 3OGCB 4JQVA 1KTLA 1KXQE 1A7PL 4XBGB 3WKNA 1BX2B 3IFLH 1WEJH 5EWIL 5EU4B 1J1XH 3E6FA 1LDSA 3X13B 3LKNA 1I1AB 3S7GA 1WGOA 3F7VA 4X4ZA 3T0VA 3Q1SL 2CO6B 2X4UA 3OKKA 3FKUS 4JO2H 1U3HC 4XNMA 4LFHG 2FBOJ 1QR1B 1GZQB 3V0WL 3O6FC 5FUCE 1NDGB 8CGTA 1P1ZA 4TRPL 1FNHA 2X9YA 2GJ6B 4LLVB 1JK8A 1I7UB 4LSVH 4GO6B 1ZTXH 4KQ4H 4MNQA 3UTQA 1MLBB 1MWAA 1T1ZB 2WSKA 1Z9MA 1DSFH 2D03L 2H32B 1MRDL 1YMHA 3KYAA 4WWKA 3WSQH 1Z3GL 4AMKH 1A5FL 2NYYD 3D1MC 4Z7WA 4K7PL 4ZAKA 3O3BA 1NBYB 5IOPB 5LVEA 4FTVD 2Q8AL 4QWWD 2I9LB 2G75B 3C09C 3KPLA 4DUWA 1NKOA 3QXDA 3EYFA 4S2SB 2CKBL 4RSVA 5ESAB 5C92A 1AGFB 3BWAB 5KN5B 1E4WH 3L3GB 4JFDE 2R4SL 4WW2C 1Q9WB 2VLRE 2BVPA 1YNKH 5I1EL 4WFGD 3H42H 2A0LC 5KSBA 3OJMB 5I16A 2C3GA 4OD2A 4NCC1 3T0AA 3IXAB 1JHLL 3LQAH 3WFCL 1FJ1B 5EBMA 4WTXA 4ELKB 4M1DL 3C6SB 3TO2B 5BMFH 2YUXA 5HGBB 2HN7A 4W81A 4UT7H 4FQCL 1CT8A 2KBGA 5DDHA 5L6YH 5D6DC 5HGDB 1XMWA 3VFGH 5GRZA 5KSVA 5J6HA 3A6BL 2OI9C 3GHEL 5SWZB 1JYNA 2VL4A 4X0KA 4HGMA 5I1IH 1LEIA 1RVFL 3FO1A 1OAXL 5CJBA 3O3EA 1KTDA 3K0WA 2KPNA 3C5JB 2VSDA 3VFTB 4PB0L 4XHJC 1OAZL 3LV3A 3BD3A 2B39A 4JFZL 4L4VA 2C4FT 3V8OA 1U95B 3KXFB 4XMKL 4WRLA 5EU6E 4NHUA 4OCXL 2XZQH 1N2RB 1JTTA 1U9KA 5C0NC 4KPHH 3ULVL 4RWHA 2FJHB 3VXMB 5GGRY 5BXFB 3BESR 3MREA 1FAKT 3L1OH 1QQDB 2X4PB 3ELAT 1PKOA 3EYUH 3UBXI 3PQYD 5TE4L 3V0VA 3GSUB 3VCLB 4LPCA 4ZUTA 4GG6A 3MJ9A 1D5MB 3U7YL 1OHQA 2VC2L 2YA0A 4OGYH 4V1DB 5E5MB 5FCSH 2DLGA 5IKCB 3F6IA 4Y5XC 4QCIB 3MJ7B 1FZMA 4GAGL 2J12B 1T1XA 4LVHB 5HSFA 1JF1A 4NDMA 4P4KC 4S1SH 4WUUB 4YH6A 4FTVE 1G9NC 5EFIB 4Z78B 4M5YL 4K7PX 2M2DA 1H3VA 4LHUA 2E9JA 2D3VA 4AL8H 5GRUL 1JRHL 3TH4T 1BIIA 4TPRH 3DX9A 3NFPB 5GPRA 4KZDL 3Q3GA 3R1GL 3MRPA 3AMLA 4C56E 2XKNB 4J12A 5T1DH 1UQSB 2GITA 1KCVL 5I15L 4H1LH 4QHUA 4CADB 3DVGA 4GRLA 2YRLA 1OGAE 1XF2A 4H25A 4WI9A 4P2CG 1ACYH 2ICES 5IFHL 1MHHA 4I8DA 4M02A 4WV1B 4NKMB 2RB8A 1E4KC 1GCFA 6FABL 4NGHL 3QFJA 4QLRA 5I1DB 3EHBC 4BSVA 2FATL 1AXTL 2E9BA 5DFVD 3PL6D 4PRPA 5L9DH 1R5IB 3P4OB 3L9RA 2GT9B 1I9IL 1M71B 4MNGE 4JRXA 3TT3L 3WDIA 4N9GB 4YDJA 3BZDA 4KMLB 1MIEH 1A8JH 2R29H 1CFQB 2PXYB 4ZSOA 3VMPA 4PP1D 1NEUA 4DAGL 2I07B 2GJZA 4X9IA 3GI9H 1DBKH 4LSSL 1QHPA 4K3GA 5GZOC 2DLTA 4ZFZA 1FORH 1ORQA 5CZXD 3IXTA 1C8PA 4MSWB 3GJFK 1JYXA 2WP3O 2E6PA 3L7EB 3QWRD 3AS3A 1JPTH 3DYOA 1I8KB 2Z35B 5C0AE 4PJBF 4RX4D 3LKQA 2NY1C 5F9OH 5F8RC 4TNWK 2YWYA 4I18B 3ZYZA 4EKXA 5FOBB 4HC1H 3VXUA 2HLFC 4FQ2L 4AQOA 5DQDL 1WBXA 5ALBH 3KPRD 5C08A 4OZGE 4NQDE 5F7LB 3MV01 3P40A 3QIUC 4X80L 4QRQB 5F88A 1XR9A 1CGYA 1PAMA 5KSAA 1YMMD 2E27L 2N4IA 3UYRH 2OJZH 1G9NH 4Y4FC 4QF1A 2MKWA 4XPAH 2A9ML 1B4RA 5GS0C 3OZ9H 5L7XL 1KJ3L 3QJHB 1WBYB 3ZHDA 3LN4A 4D8PA 1Z9SA 3DARA 4MJIA 4FOMA 5DO2C 1P6AB 3G5ZB 2DIBA 5DJDA 2Z91B 4U1LA 1QYGH 2J8UE 3B9KA 5J1TC 5B8CB 4PRNA 3L95B 2HTLC 1S7UB 5J89A 2UWEB 4ZS6D 2AJUL 2H26B 2APXA 2RAMA 4XP5H 3S88H 2YSSB 1CIUA 5H94A 1FO0L 1V7ML 4F2MB 3HCVB 1UKQA 3ARBA 1S7WA 4X8XA 5ECJE 5E8OB 4M61B 2F5BL 3CU7A 3RVUC 3GSOA 4ETYA 1CF8H 1DBAL 3IDIA 5HHNB 1SEQH 3RPKA 4JVUA 3BN9C 2OR9L 3G6AA 4M3KB 3MV11 1N8ZB 3SE8H 3EFFB 4EXPX 1VADB 3ZE0F 4HMDA 2VLKA 1RHFA 4Q6IC 4OKDA 1IGML 4QKXB 2VDPH 1XGRA 1MI5B 3UZVB 2E6QA 2FX9H 3TBYB 1NJ9A 1BM3H 9CGTA 3H9HB 3EJJX 2VLJE 1B0GA 1KPVA 3MXVH 1IFHL 3U79A 1J87A 1CDGA 1IBGL 5L88H 1NGZB 4O02L 2VQ1A 5C0CE 1CD9B 4PJ7A 3VH8B 1RZKC 3LQZA 1F4HA 3KJ4C 4NCDA 2MJWA 3SGDH 4XZUB 2VZ1A 5L2JA 2X05A 1PFCA 3CUPA 4OCRH 3WFDH 2XN9A 1QSEB 5IWLC 1X9QA 4UDTA 1S78D 3MCG1 5IGXL 5D5MF 4NWTL 3SE4C 1F6LL 2RFXA 4LLDB 2NTFA 3NN8B 3QHTC 5JUEH 5ETUA 2BSRA 1G7HA 2ATKB 5GS0H 1JGVL 1QRNE 4LCCB 4LLAA 3V79C 1WT5C 4U1HA 3DETD 3WS6C 3DGGB 3KPRE 4Z7VF 3RVVD 3HLAB 1L7IL 1NBVL 2FJGA 1JL8A 3JV6A 3FFDB 1R5WA 3EYOB 3DIFB 4OM0L 3X11A 4KRPC 4L4JA 1I1YA 4OT1L 4EUPG 4Y8AA 1XIWA 1LO3H 5IMOB 5D2LB 1DE4A 5GJSL 4XNQA 5EOCH 4XCCL 1FFNA 3O2WL 1JZ7A 4J6RH 3ZL4H 2VDLL 3KPQB 1NAML 3RWCA 2NZ9C 4UAOC 1MNUH 5CJ8A 4M3JA 1DP0A 5D7LE 2FEDD 1EAPA 4JKLA 3E2HC 3D2UB 5IVXF 3FT2A 4LVOC 4G6JL 4M8QA 4FQLH 4PJIE 2B5IC 3IFNL 5FYLD 3EYSL 3NCJH 4KK8C 4NZTL 2NQCA 3IRPX 2I60H 3HRZB 4NO0B 2ICWA 1A47A 3MJ8A 4P59L 4M1GL 3ESVF 1NCAL 4GQ9H 2WUCH 4KTYA 3TA3B 1KT2B 3K4DA 3DUSB 4RA3A 4X5XB 4OF3A 5IB4A 4S1QH 2E9IA 3C8DA 4HCRA 3DVIA 5E2VL 2Z31D 1Q9KB 3KYMA 5B21A 4L5FH 4MXVE 4AZ8A 4QNPF 5L2KE 3JV5A 4YQXL 5DMIL 5CCKH 3PXJA 4O4YL 1H5BC 3FRPA 5ANME 3L6FB 3LIZH 1QLFA 5B39G 1RZKH 1FQ9C 2NY7H 4IM8A 1CE1L 25C8L 3MNWB 1SVZA 1OOAA 3QPXH 3O81A 4DFIA 2CKBB 2ZPKH 3QA3B 2OZ4L 3JV4A 4JZNA 5DVLA 1I85A 2DKMA 1JP5A 4RMQA 4MB5A 4PRHA 3O8XD 1P7HL 1VB9A 5DHYA 1IZJA 1YPZE 3B5GA 4D94A 1AHWC 2APWA 7CGTA 1HE7A 4LKCA 2YOCA 2VQTA 1MCPH 3DVNA 4WGVB 3DO3A 3U30C 3SO3C 4P2RD 2AK4B 1M6OB 1WZKA 5F71A 3NA4A 1E6JH 4DTGL 1BOYA 4NO3B 4Y4KB 5HYFA 3I02B 3HR5A 1KJVA 4U3HA 2W65A 2BNQE 3PDDA 4BKLB 3QO0A 2P1YA 1CCZA 3MOAH 3G6JB 3OJDB 4ONHB 3BDYH 4NJ9L 4NQEA 4UV7H 5DURB 4QY8A 2E7CA 2IANA 2YPLE 3ARTA 2YUZA 5D2NE 4P46D 1ORSA 3BD4A 1JBJA 3EO0A 1JGEA 1XGYL 2P5WD 4NN7B 1KC5H 4I1NB 3FTGB 3MYZA 1UCBL 3QEQB 4I3RH 1CGTA 3I75B 4HK3J 4J3TA 3LRSA 5F7YC 1J5OL 3O2DA 4M6AA 2X7LA 2FX8H 1FL3A 4OZIF 3WHE1 5BQ7B 3KJ6H 1G7IA 3K8MA 3NIFF 1K8DB 1AI1H 2YA1A 3HE7C 2Y6SD 3KAAA 3S5LA 3UX9B 2DWDB 2XG4A 4CRPA 5EC2B 1JGLH 5IT2H 1ZGLA 5DXWA 3EOAA 1F2QA 4MS8C 2A6DA 5D6CB 4PJDB 3M07A 2FEEI 4LCWA 1ZS8A 3K8KA 2HJLA 3DSFL 5C09E 2DQHH 3NA9L 4DGIL 2NY5L 5FCUL 4DUVA 1ODAA 1TETH 2Y06L 4YHKL 1A6WL 4ZUUB 3U7WL 2DMBA 5J3HD 4QHLB 3DHJA 3MGOB 4UUJA 4FXKB 4JJ5B 1U6AH 2IGFH 2WLYA 3VFMA 4AEIL 2EYRB 5IVNA 4HPOH 2VQUA 1E28B 2YC1B 4CVZA 1SYVB 1F4AA 3FONB 4DKEH 1S8DB 3RGVD 1C7SA 1RK0B 1UM6L 1S7TB 2H3NA 1U36A 2F58L 4JFOB 2DQDH 2DLFL 3IVKA 2UZIH 4FQXC 4HAFA 4XP6L 1IM9A 1VFOA 3WL9B 2NY2D 4QOKD 5AAWA 4RMTA 2P8PA 4D0CA 3HZMA 1R3HB 1FE8H 1J11A 5HBBA 3PWLB 1AFVL 2BY1A 5JOFA 5JXEC 3WNKA 2RCSL 4P2RE 1EV2E 5HI4D 3C5ZB 2YD2A 2R0WH 3VXPA 5CBEA 3TT1H 1J9CT 4GKNA 4HKJA 5I1KH 1MQ8A 1NGQL 2R0LL 1U8NA 3NACL 2OTUA 3DXAB 4G6KH 4MX7A 4O2EB 3HFMH 3HZVA 3KVQA 1IKFH 4OB5L 5JNYB 2CD0A 4PGDB 1QO3A 1XH3B 5MP6H 4KFZC 4JM4H 2NXZB 4PREB 3J7HA 3MSPA 4OLZH 3TH2T 2BVOB 3UJIH 5E1AB 3HPLA 4JREC 3FOLB 3JBG7 4LCIL 4HT1H 1T3FA 1VFUA 4LLQA 4PJEB 3MRCA 3SGDI 1Y0LA 1J1OH 5C0DB 1S7RA 1W0VB 1XGTA 4AG4H 3TJHD 3H8NA 4HXBL 2CXKA 3IAQA 3HPJA 2FZ3B 3MRBB 3O6KH 4Z18A 4ZODA 2VDRH 4LLMA 4ZMAT 4P9HC 3CFIC 3IFLL 1WEJL 4WEMB 1QSVA 1FG2A 1V3MA 1J1XL 2GK0B 3PWVA 4X6DB 3GSXB 5DHVH 5I1JH 1CI5A 3DYMA 3GJFA 3QEHA 4MLSA 1D9KD 4JO2L 1CXHA 3SO5A 3QDHA 1PLGH 4MA1B 1S7QA 3X3GH 1EFXB 3VI4F 3U4EB 4AIZB 4C59B 4QXUL 4YDVA 4LSVL 1ZTXL 4KQ4L 4H8WC 3RUGE 4C83B 2QEJA 5FA3A 4RGMC 1PEZA 1DSFL 3M45A 3V6OE 3L3JA 3D25B 4AMKL 3W0WA 3P0YH 4NQVA 3STBA 1FLRL 3MQIA 5ERWB 4JFDB 1OAYH 1AXSB 1AIFB 2VLRB 3VXSD 2NTSP 4LPXA 3LEXB 3T1FB 4Z7NF 4HS6A 2AXGA 1FO0B 3C60A 1W8OA 1FAIL 3MROA 4XC1L 4QOKE 3KYKH 1KXTB 4OQTH 3V6ZB 3AB0C 5FKPB 3OAZK 4L9DA 5H2BA 4M48H 1IQDB 1E4WL 4MNQD 3TZVB 1FH5H 5SX5H 3C8HA 3Q2CA 4DKFH 4K8RD 4NZJA 5LGHH 3WEXB 5B4MD 3L5WB 5GRWA 1RD6A 5H8DA 5E8DH 1OAQH 5F7WC 4OAWA 4WWID 1UFUA 1JGDB 1AGBA 1U8IA 4CNIB 3ZHKA 3LQAL 4NZRL 4JANB 4JFPB 1BQHB 2BC4B 1CIDA 1TCMA 4KKNA 4ZAKD 2FDBP 3EYQD 5BMFL 4WU7A 4FQJH 5H35B 2HP4A 1MRFL 3DPBA 3S97C 5I6XB 4QRRA 4UT7L 1T5WA 5L6YL 5C71A 4O51A 2WV3A 3GBLA 1C12A 2X4NA 3VFGL 2YHGA 1KN4H 3PHQA 1DQQB 2AXJA 2Y1VA 4L29B 1BFSA 4TSAL 3S37H 5I1IL 5EU6B 1S9WA 5C0BB 2E3VA 2QQKH 1EIBA 4P9HH 3SY0B 3H2WA 4LRIC 3BKCH 1FL6A 3ZYIA 4OD3H 1XGPA 1LD9B 5C6WH 1ES0A 1HQ4B 3B6SB 3CDFA 4I0PB 5AD0A 2X4TB 4CBPA 5F7DA 1XGUB 1BLNA 2VLLA 1T83A 2CUHA 4JG0L 4JZJA 5I76A 3OR7B 3WHXA 3RDTC 1GGCL 3JWNC 2DQTH 4H8WH 3OTTA 1YEKL 1Q1JL 3L1OL 4TNWF 1KB9J 2XPGB 3W11C 3OHXA 5SWSA 5KS9A 1LP9F 3EW3B 1OP9A 2FECL 3N1GC 4LEXH 5JR1H 4RBPK 4OGYL 4L4VD 1RZIB 2X4QA 4L3EE 3U2SA 1NAMB 4HBCH 1U58A 1Q72H 5I0DA 4X9BA 1TVHB 5IHLB 1BD2E 3O2VH 1Q9OB 3BO8A 2JK5A 3ZKNC 1SJEA 5IJVB 4NUJA 4C56B 5CS7A 4S1SL 2YR3A 5F72S 5EG6C 2VDKL 3EZJB 2V5SA 1LO5B 3BQUA 3ZMRA 1L9MA 1OGAB 5E8EA 1K4DA 3P4MB 4AL8L 2AJ3B 1LO4H 1QFWH 3CDGB 4F7TB 4TPRL 2PETA 3AREC 4Q9RH 3U82B 2B2XH 3EO9H 4LSTH 2ITDA 3SKNB 3VDBA 5T1DL 5DFVC 3CZFA 3PL6C 2A6JB 4ZUVA 3V6FA 3NFNA 4D0DA 4MJ6B 2CDGA 5DMKA 4N5EC 4KC3B 5I8KH 5TE7L 5DD6B 4MNGB 1ACYL 3O45B 1RULH 1TQCB 4RMUA 4PRDB 1BHGA 1MJ8H 2VABA 1U8LA 4Y5YB 2R1YB 3BYTA 5CZXC 1T1YA 4R90H 5L9DL 4IRSC 4KTDH 2ZSVA 1KIRA 2HG5A 5EU7C 1S7VB 2BOBA 1MIEL 2CUIA 1AGDA 5F9JA 1MY7A 5C0AB 4GW4B 4M7ZC 4G6AD 1YEIH 3MCLL 1OCWH 3GI9L 4H88H 2GTZB 1DBKL 3HE6B 4NNYA 5JIKA 1MIMH 3TCLB 3MRQA 4R4BA 1FORL 1ZVSB 2XWTB 4EUPA 3GRWH 3L3IB 1EJOL 1OM3L 1JZ4A 1FDLL 4PJXF 4NQDB 5EBWA 1U92A 3QFJD 2CK0H 1S3KH 4O2CA 4PRPD 1YN6A 4NC2B 4OZ4B 1AJ7L 1QSZA 4PGBA 3H9SB 4N8VB 3T0EE 4HC1L 3RY6C 4JRXD 5D7KE 4RIRB 2DLEA 5JHLH 4N8CH 4OF5A 5ALBL 3NPSC 2J8UB 3B3IB 1OWWA 1MCBA 3I3BA 2IFGA 4JVWA 5HI3D 4L4VE 1L4IA 5DUML 1G9NL 2AJSH 2ICEA 3BPOC 4NQUA 4U1SB 4XPAL 2W59A 3T0XA 1XAUA 3OZ9L 2F74B 2IAMA 3PWUB 4QHNA 1JNLH 1HHGB 5JLZA 2Q3ZA 2GI7A 4WW1B 1T80A 1QYGL 1TNMA 4JHWH 4PJBE 1ZLUK 3VWJB 2CLZB 3VXUD 4KK9D 3ZSSA 2Z92B 4HKZA 1K2DB 3QUXB 3SKOB 3UJJH 4LAQL 3NBNA 1IAOB 5D1ZC 3DECA 4JE4B 2P8MB 1TJGH 3LKRB 5B39A 4W4OA 5IROA 4XP5L 5C08D 3S88L 3UPRB 1Z2KA 5C0JB 2BDNL 1AGCA 3ARDC 4XCEA 5FEBA 4MLIA 1E27B 3HS0B 4HWZB 4Y2DC 5KSAD 5E03A 3M17B 4IJ3C 4LEOA 1CF8L 1L6ZA 4K71B 5CMAB 2J2ZA 2HA1A 4NRXB 4WHTB 5I8EA 4KJYB 1SEQL 3IJHB 5HDOA 3QG7L 5DZLA 1RK1A 4OF0A 4WIQA 2ZUTA 3PGDB 3SE8L 2EIEA 2AEPH 3B9KD 1A9EB 3MUY1 5EUOB 2VLJB 1IKNA 2Z4QA 5MEQA 1A6PA 4NUGH 4U1NB 3AY4A 1Q8MA 2C3XA 5C0CB 1MCEA 2APVA 4CGTA 3DBXA 1X5HA 4R0LC 1H9VA 3KS0J 2JJTA 1T7XA 4J1UB 2YD8A 5DD5H 4B7LA 1GOFA 4YHNA 1BM3L 3ARBD 2LU3A 1S78C 5D1XA 5DRZA 3MXVL 4FQQA 2YD9A 3BYYA 5L88L 4PJGF 5E00A 1X5KA 2JIXD 1KUMA 4XMPL 1QRNB 3ZTJG 1KLGB 3RVVC 2VLKD 5ACLA 3CSYA 4I2XE 3BPLB 4GT7A 3MRNB 4I4WB 4CAGA 4X6BA 4U6YB 2Z8RA 4ZFOA 3U36B 4EOWH 2DS4A 2Q76A 5DJYB 3BPCA 4PRPE 2G60H 1T5XA 3FQRB 3I50H 1U8QA 4QTHB 1CYGA 3UTTA 2JJUA 5FHBH 4JRXE 1ZLSL 4KGJA 1NEZB 2GSIA 4Y1AA 2Z9TA 4ZFGH 3KWWB 3QB7C 4OZFB 5FO7A 5D71L 5T1MB 5D7LB 5FKAA 3T2OA 3QDGA 3GMQB 5JW3H 5SWQA 3VFVA 5CEXB 4Z7UF 1D5XA 3P9MA 3QCUL 3NMEA 5IHBA 4PJIB 4PRIA 2DOCA 2XN9D 1R3KB 5EOCL 1O7SA 3SDCB 4TTGA 4X4XB 3U6RB 5J9PB 2OBGA 4MHHI 5MHSE 1MNUL 3T2NL 1K6QH 1CVSC 2R2BA 4HIJB 4YGVB 3VXUE 3MODL 5IMKA 1P7QD 1N0LA 4JY4B 4LIQH 4FQLL 2RQ8A 1UB5A 1TTGA 3NCJL 3FQTA 3QI9C 3QULA 3OV6A 4Z7VE 2I60L 5L2KB 3IB4A 4UTBH 4R2GD 2PTTB 1KCRH 5J1AB 1UM4L 5K93A 2WUCL 1XIWD 3FO2A 3PV6B 4M9OA 4PG9A 5ANMB 3BP4B 3MUJA 4G6FD 4S1QL 5I17A 3HB3D 1DJSA 4MJIE 1JZ8A 4U0RC 5EZJA 3B4NA 4U3CA 2YBRB 2DM7A 1F6AB 3BFOA 4L5FL 3O8XC 4P57B 4MAUH 4MWFB 5ITBH 1AH1A 2YD4A 3C5SA 3ULSA 4P2QE 1GIGL 5IVXE 2EE9A 4F15C 4TNVK 3IDYB 1QVOB 4EDWH 3QNXA 1BZ9B 4M7LH 4EIZC 2NY7L 3T0WA 2QSVA 5F6IC 5C0GA 2R1XB 4W4NA 1BWMA 4OUUB 2ZPKL 1FZJA 4P5TA 3VWKB 1VPOL 2QADC 2BNQB 5DI8A 1INEH 1T21B 2MCPH 4HDIB 2CR6A 2IPKB 2XQBL 1CXEA 4QXWA 5DJAA 1YDPB 1S5IL 3BPNB 2YPLB 3SDAC 4OGAD 1J0IA 5D2NB 3R4DA 5C0EA 2VLKE 4XCNB 2ZNXA 1PZUB 5ICYA 2Q20A 5IK3B 4QNPE 5MI0C 1IM3A 3REVB 1E6JL 4BFIA 1AO7A 1YZZA 2DYPB 4NBYB 4Y16B 1ZWIA 2FGWH 1IT9H 4QRPB 3MOAL 4AT6A 3TBSA 2ZUYA 2L7JA 1R24A 3BDYL 4RAUA 4UV7L 3RWJA 3WV0A 4PRHD 4FG6D 5A43C 3TV3L 2Y6SC