1S7WB

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Immune system
total genus 13
structure length 98
sequence length 98
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7wB00
4M1GH 5CWSA 4WTWA 1G7IA 4YXLH 4PR5B 1MELA 3N50A 5F7WC 2DTMH 2YA1A 3WFDH 3OZ9L 1E4XL 5GRUH 5CKGA 3NCMA 4WY7H 5D9SB 1MCFA 3FQNB 2MHAB 4KRPC 3GEWB 1UXWB 1LO4L 1NJ9B 2HTLC 1D5ZA 7CGTA 1D5XA 1PEWA 4KQ4L 2EDQA 1G6RB 2Q6WA 5FGBA 2F58L 3DIFB 4KU1A 4F3FA 3A0OA 1YN7A 2BNUB 5FAAA 1JHKH 4Z8FL 2R1XA 4J1UA 1MH5B 2EC9T 4JDVA 2HT2C 5KSUB 4EQ2A 1ZGLB 4JM2C 3VFGH 3KHQA 4IOFC 1KG0A 4JG1H 4DKEL 3VD9A 2VLLB 3HZKA 3G04B 3BT2H 2H8PB 4JGJA 4O00A 4XP4L 4K7PL 3B9KC 1E28A 4OUOA 3TBSB 1IARB 4GMTH 4AL8H 3U79A 1HYRC 4HC1A 5JW5A 1YC8A 4FQPA 1ZXQA 2OSLB 4G6KL 4RFNC 4ZFOA 4PJEB 1W0VA 2V7NB 4PJ5D 4HG4J 1YJDH 1AXSA 3HNTH 5D2LB 2D31A 3VWJC 3R4DA 3X3GL 5I19L 4HDIB 5BS0B 1NL0H 2W60B 1ZGLM 2ADGB 2G5BA 3AY4A 1CDCA 3FQXB 2CKBA 3P73A 4HGWA 4AIXA 4OUUB 5ITBH 1OSZA 1YNKL 2FJGB 5HDQH 4EJ1C 3QHZL 1QSFB 4QXTA 3S4SA 3H2WA 2NW2B 4KVNL 2L0DA 4U1HB 1GGBH 2AP2A 5JLZB 3OKEB 1OWRM 3DBXA 2PXYA 1OAYL 3OJDB 5GZOD 2WWMD 2PCPA 1TDQA 1PX4A 3JXAA 5I18L 4AT6A 4OZ4A 1KIQB 4QHNA 1MNUL 5C1MB 2NLJA 1U8PA 4PJBE 3QEGH 5JORA 5GSVA 3NCJH 3VH8B 3MBEB 3WO4B 1YPZA 2OI9B 4LSVH 3MOQA 3Q3GA 5LKNA 4O2FB 1T83C 5HHQA 2VKWA 2VJXA 4DCQA 3WNPA 4EKXA 2ZJSH 3ET9F 1E6JH 2YPLB 1LO2L 4MWFA 1CN4A 1XCTA 3E2HB 4FQXB 4U1JA 5DRXA 1MRDL 2Q86B 4JLRA 4JDTL 5EBGA 1BLNB 4X8JA 1T6VN 6FABL 1Q72H 3O3DB 3BGMA 4HFWA 5IMKB 2QL1A 4TTGA 3ZHKA 1IC5H 4YHLL 4KH2A 5KS9F 1C7TA 4X98B 2NY0D 1C8PA 4LGSB 4WHTA 2QLVB 3B5GA 2DBLL 4FTVD 4TSAH 1DLFH 4P99A 1R3IH 4M7ZC 3BKYL 4LVHC 3C6SB 5ENWB 1S7RB 3GI9H 3BDXA 3QCTH 4HS3A 5E1AA 5I8EA 4HIJA 4HBCL 5T1DH 5T33L 1MCPH 1DEEA 1V7ML 2P44B 2VZ1A 2PTUA 3EGSA 5KVGH 4DFHA 1BREA 1F90H 1P9MC 3TVMC 4NKIL 1S7SB 1MJ8L 1S8DB 1KCSL 3TJHC 1X4YA 3KAAA 4K71C 2E7BA 4PJHF 4L4VB 4KTEL 3MLSL 1ADQL 1OGAB 4U0RB 4TULH 1Y18A 3AREC 3QQ9C 3LN4B 4KJPD 2D9CA 4NQUA 5C0ND 1LEIB 5C3TA 2HVJB 4I5BA 3L3GA 3QPQD 1U91B 2XQYK 1DQQB 1NDMB 1MCWM 1NPUA 1EPFA 1W0YT 3D85D 1MCWW 4PJDB 1DANU 2R4SH 4YDIL 4JRXA 4RRPG 5DURD 5C6TH 1INQA 1G7JA 3GHBH 3L7FB 1OAUL 2ZSVB 4U6HB 2EDRA 3LQAL 3CFJB 4GQPH 1EZVY 3QUMH 4L8BB 1T22B 1MHEA 1QD0A 4MB3A 3T2OA 1NLBL 2A9NH 4JB9L 3FOLA 1SBSH 2V2WB 3EOTH 3QUYB 3T77A 1RK0A 2F74A 4LHJB 1J8KA 5DVLA 1NCDL 3T08A 3TYGH 3Q5YA 1AH1A 5LAXA 5E9DA 3QWOA 3BIKB 3EHBD 3P0GB 2VISA 4JJHA 1UB5A 4KK5D 4LARL 4ODVL 3KYNB 5E1HB 1N8ZA 1WFNA 4MA7L 2QADD 4X83A 2VDPH 3DJ9A 5F7DA 2AEPL 3M8OL 1FFRA 4HAGA 5H94B 5ID1A 1S7VA 3LKNB 5C0IA 3M07A 4P23D 1NAML 3UROR 5JW4R 2FATH 2FGZA 3TWCH 2Z35A 3QEQB 2O93L 4TUOB 4TSBH 4X0KB 5ICXB 1A6TA 4AEIH 1HXMB 1K6QL 3UPCA 1IJ9A 5HDBE 1JYNA 3MACH 4WCYH 3F6IA 3RWIA 3GBML 1WLHA 1FL5A 2FRGP 3QISA 5GGTA 1A3LL 1L9NA 1F58L 5D1ZA 4I2XA 1FZJA 3B8SA 4AZ8A 4ONHB 4QYOA 5GS1B 2X05A 1UB6A 3EFFB 4YFLF 1Z3GL 2BHZA 4BQCA 4BKLB 1A1NA 3V52L 5B8CC 1H3UA 3CSBA 5MEOA 2IH1A 3O6FC 1S5HB 1D6EA 1YZZA 1CXLA 2Z9TA 3WCYA 2MSPA 1TTGA 2HG5B 4WHYG 1NCCH 5EU3B 2FIKB 1W2KT 5HVWA 4KZDH 4O02H 1WITA 2R0ZH 4ERSH 3ABZA 4LLMB 5I30H 3BPCA 4UI2A 3SE3A 4A2MA 4I0KA 2CDEA 4L4VE 3TCLB 3IU3B 4CDGC 3V0WH 4LGRB 2ICWI 4F8QA 5KSBE 4R26L 3SBWC 3RZCB 4J8RB 1PKQA 3MOAL 3T4AB 1G9ML 1XF2B 4PJDE 2WBJB 3HZMA 3MXWH 4ODSH 5K59F 1NGXA 1U3HD 3TT1H 5CJXC 2ITDA 3SO5A 4P46D 4X4YA 4HWNA 5HHMD 3UYRH 2P24B 4M7ZB 4UIMB 1QFUH 1CLYL 1IC7L 1MIEH 4QF1B 3BOVA 1IQWH 2DQCH 4U1IB 4ZUVB 5I66A 1SJHB 3OHXA 2XA3A 1MCOL 1GC1C 1XR9B 2J8UE 4O51B 2VDKL 2XNAB 4G6JL 5C8JB 1HZHH 3TNNB 4GKOA 2Y72A 4JQIL 3CUPA 1RHHB 3ZHLA 3CLEH 1BAFH 2BZDA 4LLVB 4YBQC 3FMGL 4Q0XL 1WFOA 5IKCA 3T3PE 2PYED 3UCRA 3IDJB 3TO4C 3AREB 3Q6FB 4LSTH 3QZWA 2E6QA 5JNYB 3GBNH 4Y5VC 2E7HA 4GAGH 4P3WA 3L5JA 4QTIL 1JTTA 4GAYB 4Z77B 4Y16C 1ONQA 4L8CA 5DTFB 2A6IB 4JG0H 1KTLA 1P4BL 5IF0A 2CLVB 4JN1H 3WD5H 4F80A 3VJ6A 5CEZD 3VXNA 4JKPH 2Q8BH 1FE8L 1MCNA 4Q9BA 4K3GA 5IG7A 3HC4L 4LL9A 1F4YL 4HS6B 4HW6A 1HCFX 5EOQH 3H3PH 4K8RD 4QRTB 4PJEF 2RHEA 1WEJH 4JE4B 4PJ5A 3IRPX 2XT1B 1ZA3A 4GW5A 2V9QA 2H2SD 5D2LF 5MEQA 5TJWK 1NFDB 2P7TA 2YUVA 2DLTA 4Z7OF 5TE6H 1I85A 4NOFA 3KPRB 4NQDB 4U1LB 4U6YA 1VGKB 1N6UA 4J2XA 5FUZH 2UWEB 1PD6A 4KKNA 3U7YH 5IOPB 5IHZA 5BV7C 4QRRD 3RAJL 5IR1A 1J5OH 5KVFH 4LFHD 3WL9B 4FABH 4OZFG 3GMNB 3NPZB 4IRSC 4MHHI 3C60B 1LE5A 2ZCHH 4IOSD 2O5XH 5TPWL 3BWAB 3EO0B 5TQ2L 3W39B 1JWSB 4YPGB 1R0AH 1OD7A 2IPKB 3BZEB 4MA1C 5DEGA 3RKPA 2R0LH 4LEOA 4XP1H 3ULVH 1TZHA 3WLWC 4LLDB 4WUUB 5FGBC 4H0HB 4TVSa 1BQLH 1VFBB 3IFOB 3S5LG 4Y8DC 3UC0H 3QJFB 2J4WL 2Q8AH 1P5UA 5A40E 4XCCL 1KFAL 4C83B 4JDZA 4OM0H 1EJOH 2JTDA 4NWTH 2EXWC 4JFFE 5GJSH 3K8KA 4X80H 3ZDYF 3BH9B 1AGBA 2ITCA 3BSZH 2FX7L 1MHCB 4ZO6A 2Z93A 5AZ2H 2VZUA 1MFDH 1MFEL 2VZSA 3KLSA 5IROC 3ZTNH 5C0DB 3LPWA 4Y5XB 3U6RA 1U0QA 1ZS8A 2JB5H 2UYLA 5IBUB 5DS8A 5F9JA 4FTVA 1KXVC 3U7AA 2D03H 4IJ3B 5DQDH 4JFFD 4AH2B 3C8KB 5K9KB 1AI1L 4PJ9C 4WWKB 3B9EA 3FN3A 4N0YL 1K4CB 3I6KB 5FYLH 4MYWB 2VB5A 2W9EH 1EV2E 4BUGA 2W0PA 5CBEB 1MQ8A 1AQDA 2GTZA 3AY4C 4YQXL 3QDME 8FABB 3DVFA 4EBQH 1FVDB 1JE6A 3GSWA 2KKQA 1NMBH 4P59H 5E5UB 1W72B 2JIXD 3IJHB 1S5IL 1JN6B 5E5RB 5KANI 3WNKA 2Q76B 1CLOH 4GW1B 1CD9B 4O2CB 1G7HA 3V8OA 3D85A 5H8DA 1OGTA 3R1GL 1OAXH 5J13C 5DMGC 4XMLL 5C08B 1G7QA 1B0WA 1RJLA 5CJQH 3VFTA 4XCYA 2BC4A 1AO7E 2P8PA 4NQDE 1O5DT 3QAZC 1NGZA 3WJLA 1S7UB 2BNRE 5AYUH 4ZG1A 4OI8A 1I9IL 3LHPH 5ADPL 2CDFB 5DMKB 5LWYL 1JVKA 1X9QA 3PL6C 5F6HI 2Y9RT 2A73A 1YEJL 3CXHK 1UXSB 2Y7QA 5IIEA 5HI3D 2P8LA 4JFYB 3QIUC 4LCYA 5FO8B 4RFOH 4BSVA 1OQXA 1AO7D 3EOBA 4PJFA 4UNTA 4E5XA 5B3JF 3DVNA 2EIBA 3KPOA 5ILTH 1WCQA 4NDMA 3BN9D 3PNWB 5JIIA 4WI5A 5HGAB 3OKMB 3JTSA 3HAEA 5FFLA 2VZOA 4P23A 2WWKO 5D6DA 5DFVC 4PRHB 1I75A 1TITA 4HIIA 3HS0A 4NKQB 1ZANH 3LKQA 1E4WH 4HKBA 3RUGB 4ZOCA 1ZT4B 4X6DF 3CLFH 1Q9WB 1YNLH 1DN0B 4WW1B 1FAIL 4WTXA 3AGVA 1YEFH 2XQYG 5E2TH 1B0RA 4UQ3A 3C6LA 1HKLL 1D5BB 4UT9L 2P5EA 5EWIL 5FOJA 5CEYA 4KK8C 5BV7B 4AM0B 3O6FD 1I8IA 1NCWH 2YPKB 3BHBA 3L5HA 3H9HA 3H7LA 5CWSB 1G7IB 2HMIC 5FDYA 5EORH 5I74B 4OLYH 1QSED 4RWYH 3LSOB 3QFJE 4PJAA 3F58H 4M6ML 3LRGA 3WFCH 5JW3L 3BD5A 3BDBA 4CNIA 2WLZA 1QFOA 1D5ZB 4PGJA 1D5XB 2Q6WB 3JVGA 5BZDA 5HGDB 3MV7B 5SWZD 5AAMA 3UP1A 4J1UB 4Y4HD 1MJ7H 2XOTA 1EJ6A 3T8XB 3QFJD 1G9NC 4KKAC 1XF3A 4U3HA 4LSUH 2YK1H 4L9LC 2HTKC 4PB9H 3IJSA 2NY2B 3DV6A 3HZKB 5JR1L 4I3GA 5DWUL 5I15H 3KYMA 3EBAA 5SWSB 4ELMF 1E28B 4QCIA 1DBMH 1U3HA 5C0RH 1SMOA 2KZWA 4P46A 1IAII 1UFUA 2V2XA 4ZS7H 4XTRD 5HHOE 5JW5B 2ZG1A 5I76A 2MKLC 1IAKA 3CVIL 4ELKA 3NCFB 4HUUA 4XNUL 4ZFOB 3QDGE 2GCYA 2EKSA 4LHUG 1AXSB 4YNYA 3EIFA 5MERA 4LPXA 1SY6A 3ZKMC 4S1RL 5INCA 1O7VA 1ZVYA 3RBGA 2D31B 4AIOA 1RZJH 4N0UA 4K7PY 5GZND 4JFOA 1M7XA 5HHOD 3WNMA 3O3AA 4ISVA 3GO1H 5B38G 1NCUA 2CKBB 2P49B 3P73B 1EO5A 2PYEA 4F58H 4ZPTA 2FX9H 1B88A 4YK4B 4CBPA 1XGYH 3IAPA 4DK3A 1FVCA 5EOCJ 4QXTB 3S4SB 4UINL 3RUGE 3DBXB 2A1WH 2PXYB 4YXHL 2PCPB 3X14A 1WAAF 3G9AB 4LLUB 5HGBA 2CUHA 4MB5A 4AT6B 4OZ4B 2LQRA 4QHNB 2BVQA 4TRPH 3HUJF 1KLUB 2LE9A 4HT1L 2NLJB 5KVMC 2IQ9L 5JORB 3MLTA 5GSVB 2D0GA 2BOBB 2OJZH 4FG6C 3FOMA 1RUKL 3Q3GB 1I9RL 3DNKA 2OQJA 3MV8D 5HHQB 1JHLL 1XZ0A 4AY0A 4J3SA 4DCQB 4XVSH 3L6FA 3ZE1E 4GRMA 3SCMC 4MWFB 5HYSG 5FUOL 1XCTB 43C9A 1XGTB 4U1JB 5JMRA 5DRXB 3S3JA 1NFDF 3PP4H 4JLRB 2FH6A 1UG9A 5E95B 3WFEH 3O2VH 4LPVA 4BH8A 4X8JB 4FA8A 4KRNA 2FSEA 5GRJL 3D18A 3BGMB 2X4NA 3IYLW 4HFWB 4HMDA 3MV7E 4RMTA 3ZE2E 2I25N 2UWEF 1F4HA 2OP4H 3AS3A 3IXAA 4N0FB 32C2A 5DGQA 3V4UL 3VD4A 4QRRA 4WEUD 2F8XC 5EH1A 1A6AA 4JZNB 3GM8A 2C3VA 5L9DH 4HS3B 4OCXH 2VABA 5E1AB 3NFSH 4HIJB 3QDJD 5IB2A 1ZLSH 1DEEB 2GQHA 3EGSB 2UZYB 3WHXB 4WENB 2ZUWA 3NIGF 5SWSE 4PRBB 1JP5A 4P48A 3O4OC 3OL2A 3BRDA 3PUCA 3EZ8A 3O3UN 2A9MH 4LDEB 1J1OH 1Y18B 4Y5YC 2QR0A 4GH7B 4X4XB 1IL1B 3CFIC 2ILLA 5I8CA 1CG9A 1UH2A 3L3KB 4I5BB 3L3GB 4IOIA 3KXFE 4GFTB 4RDQG 4AEHH 4FMFA 3NACL 3Q1SH 5JHDD 3X3FL 4JRXB 4EDWH 1INQB 1KXQE 3QQNA 2H6PB 3EOAA 1G7JB 2AI0L 5A2JH 4GS7B 1FORH 3U9PL 1N6QH 1YYMH 2DJ4A 2W9DL 3TV3L 1NBVL 3FOLB 2KH2B 4H8WL 3OR7B 3EO1B 2ORBH 2XY2A 3LN9A 4DQOL 1XIWD 5KVEL 5LAXB 2QQNH 5E9DB 3QWOB 4LCWA 4G5ZH 2QSTA 2VISB 1UB5B 2X1XR 3OKLB 2E3VA 1N8ZB 3CDGB 3V6BR 3STZA 4TNWK 5BOZG 5E8OB 4JFHE 5DEFA 5F7DB 3NBNA 1CGVA 5T3XH 1WIPA 5ID1B 1CF8L 1S7VB 4LRNH 2GHWB 3FFCA 5C0IB 5JOEA 1S7QA 3MRDB 3RTQC 2Z35B 5DJ8A 1OT1A 2JIXA 3THML 2G2RA 1LEGA 1A6TB 4XP5H 2CLZA 4RWHA 4UUJA 1K8DA 2QSCH 2X5PA 3MXVL 3RWIB 1FL5B 1GSMA 1KJ2H 5AYQA 2L7JA 5IB4A 2Y25A 3VCLA 5D1ZB 1FZJB 3C5ZC 2BNQB 5D71H 5B21A 1J0ZA 4QYOB 4HD9A 3MRMA 3UAJC 1UB6B 3V6FB 1A1NB 3DETD 5INDA 2J88L 1ZK9A 2LU3A 3MREA 5MEOB 2IH1B 1D6EB 2LAAA 2F5AH 5FYJL 3ZKNC 2NY6D 4MAYA 5I71C 2IQAA 5E8DH 3DX6A 2F53E 2H3NB 1A9BA 5EOTA 3K7UA 4LSRH 4P5MA 4YHOL 2ZG2A 2J6EH 3BP6A 2VXTL 4APQD 3B6SA 5JO5A 3ULUC 3GNML 2NXZC 3BPCB 1PFCA 1G7PA 1UWGL 1RZ8A 2CDEB 1JHKL 5DD5H 5E00B 3SCMB 4GG6A 3KPLB 3HA0A 1PKQB 4CKVX 4EXKA 1JGUL 3WUZA 1YEDA 2YZ1A 4LASL 3UYPA 1AE6L 3HLAA 3I50H 4WJ5A 3PGDA 5BO1H 4R4BA 3WV0A 1NGXB 1RU9H 2ITDB 2NX5D 4EN3D 4X4YB 3RY6A 4AL8L 1PG7H 5GS0D 5J3HD 3JV5A 2JCCE 4WFFD 4ZXBC 1CFVH 5FGCE 5ESAA 1BQHG 2CK0L 4QRPE 4OJFL 1QSEA 4HWEL 2EICA 4JPIA 4P2QE 4LSPH 2DL2A 2B7DT 1AR1C 3KPPA 3OHXB 1YJDL 2IAND 3AROA 1A7PL 3HNTL 1E4JA 1BGXL 4W6YB 3TZVD 1DQLL 1RJCA 1IKFH 4XPBL 1GGUA 5DJ6A 4CRPA 1QHPA 1JI1A 4DK6A 1A4JA 3ZE0E 3SPVA 5SWZA 6CGTA 1HIML 4KKAD 2EH7H 2B8OT 2AJSL 2DLEA 5IKCB 1J7VR 4Z95H 3TPUA 5JHLH 5JOFA 4FFZL 3UPAA 2FYYA 1P5VA 4Y5YB 4Y4HA 5E4EC 4L1DA 3AMKA 4ZO9A 3QZWB 4OCRH 1WIOA 4HKJA 4L4TD 3IDMA 2ICEA 2VNCA 3IDGA 3DUHA 5DA0B 2OR8A 2C1OA 1M05A 1ONQB 1QKZH 4L8CB 5EO1A 4ZS6C 3SKUD 2V9RA 2DD8L 1KTLB 2KZ1B 5FCUH 4PJ8C 3VJ6B 1MRFH 3SDYH 3VXNB 4JO4H 3SO3C 1J18A 1JTPA 2BNQE 5IG7B 4NM4L 3PGFH 4IMKA 3QEGL 1JZ5A 1A1MA 4OCSL 4YZFF 1MHHA 5IB5A 3MZTA 4OFIA 1MY5A 5E6IC 1QR1A 2ICWA 1U8NA 3HI5H 1FFOA 1IKNA 4H88H 4FS0A 4HK3J 4PJ5B 2ZJSL 3RX7A 4NJAH 1I1FA 1VACA 2VXVH 4YR6A 3R06A 5MEQB 1LEKA 1SYVA 2P7TB 3VFSA 1QQDA 3N1MC 4HCRH 4XNXL 5C0AA 5CP3H 3C6LC 1TZGH 4U6YB 5E56A 4HUXA 4OFPA 4L3EE 5IHZB 4I18C 4DVBB 4X6CA 4ORZC 5IR1B 2EYTA 2Y5TA 4NT6A 1XMWA 3AU1A 4GW4B 1A0QL 1L6XA 5JIPA 1KTDA 3V6OA 1HYSD 3VDBA 1EGJL 2PKDA 1LE5B 4KXZI 5FYKH 3FTGA 4JFXA 1IGML 3BWUC 2D4FA 1M7DA 2LABA 1MCPL 3H9YA 4G9DB 1IEBA 5GJTH 2XQBL 1QOKA 5KVGL 1C12A 1F90L 1TZHB 4M7JL 4NNXA 1YPZF 3QXAA 4J3XA 1HH6B 5ANME 4M43H 1J11A 2H1PL 3MV8A 4OIAA 4LQFL 5J8OA 4NQSA 3P9LA 2PW2A 2X4TA 3AC0A 1YN6B 4JDZB 3NA9H 1CGUA 1XGPB 2YBRA 1MWAL 1G1YA 5TQ0H 5JW4Q 1AGBB 2ITCB 3O6LL 1CDYA 3G6JB 1TETL 5F93C 5IHUL 2Z93B 2BHUA 3SDDD 3GHBL 4R7DA 4KGJA 3X11B 2NYYC 1BFVL 2NY0B 4MZ3A 3W2DH 3U6RB 4PJIA 5DS8B 5F9JB 3QUML 4FTVB 2F54B 4NQVA 4C4KT 1FGVH 3EYQD 2VDML 1P4IL 1WTLA 3CZFB 4J4PD 4LP5A 4B7IA 2EIDA 2ZPKL 3V7MA 4Y89A 1DBBH 3EJZC 3QDJA 2EDNA 3FAWA 4V2CB 1IAMA 3D87B 1A7QL 3P30L 4CVXA 1QRND 2OK0H 1K4DA 1AQDB 2ERJC 2VDPL 1MCKA 2GTZB 4QY8A 5BQ7A 3MLXL 4ZXBB 5IM7A 2X1OA 3N85L 3OWEA 3GSWB 4NQCD 3UO1L 3TWCL 2I26N 4HH8A 4TSBL 4HIXH 4AEIL 3VFMB 1OGTB 1HHHA 4DN3H 1G7QB 2NY4D 4NHCL 4R6UA 4WCYL 5JHDA 1RJLB 5I8KL 4XCYB 2BC4B 4F7EA 2P8PB 4XBEH 5EZIL 1QFWM 1NMAH 2E27H 1SVCP 4Y7MA 2F8OA 3BPLB 4Z18A 1TNNA 4P2RA 3W11C 3KLAA 5T3ZD 3FO0L 1AJ7L 4KUZL 5FKAA 2NTSP 3ME0A 5A16A 1FNLA 4UBDC 2Y7QB 1CDGA 3QO0B 5IIEB 2DM4A 2P8LB 4G6ML 4LCYB 3CVHL 3MR9A 4MJIE 2FGWH 3GGWA 5IW6A 4BSVB 5HDOA 1JZ6A 5EZJA 5HI4D 4CU6A 4PJFB 1GVIA 4E5XB 1MRCH 4NCC2 3DVNB 4LIQL 4J6RH 3MRQA 1BOGA 1NCCL 3KPOB 1JYWA 2QADB 3TA3C 3WNNA 2R0ZL 2PO6D 1MIMH 5E6IB 1P6FA 1I1CA 3HAEB 3JTSB 4XP6L 1ZVSA 2GYSA 4P23B 5CAYB 4TPRH 3HS0B 1DBAH 5TH2A 5ERWA 1CZ8L 3LD8B 4JPVH 1MCIA 4MJID 4HKBB 5DHVH 1V05A 5B22A 5CZXD 4GLRI 4E41A 2A77H 4BFIA 3C5ZD 1VA9A 1FSKC 2OL3L 3CSYB 3G6JE 3PV6A 2J3SA 3ALPA 1B0RB 4UQ3B 2P45B 2AJVL 3C6LB 1WBZB 4RGNB 4HIEB 3RKDC 3MXWL 2P5EB 3LEXA 4FXGA 5CEYB 3MRNA 3NVQA 4GBXC 4NN6C 5T1KB 1I8IB 3BHBB 4OM1H 5LGHL 3H9HB 5B4MC 2HVKA 3GDBA 3UYRL 2F54E 4MS8D 4WI7A 5C9JA 4TQEH 1QFUL 3O6ML 1J8HE 3BGFC 3CXHJ 2VWEE 5I1JL 2DAVA 3RVTC 2BX5A 3KJ6H 4X8XA 3OGOE 2R2BA 3BUYA 1V3MA 5D1QC 2M26A 3JV4A 3DROA 2YA0A 3VFVA 5BZDB 1KPUA 1HSBB 3OGCA 3D69A 1V3JA 5F8QC 1OWWA 2APVA 4YE4H 3VXRD 1LDPH 1XF3B 4FQIH 4PY7B 4GMSL 3T0DA 2YZ8A 5IWLA 5F7NC 4JAMA 1LK2B 3FB6A 1U8QA 2B0SH 4M7LH 3RWCA 1NCTA 3IJSB 1PVHA 3ZYZA 4OLEA 4XBGA 3EYSH 1DEDA 3MRLB 1T6WA 1RZIA 4LSSH 4JG0L 5DK0A 5E6ZA 3KYMB 3PQYD 1KCUH 4R3SA 4QCIB 1OARH 3FONA 3VGEA 3VFOA 1U3HB 1AP2A 3J7HA 3B9VA 2NX5A 4P46B 4EN3A 1UCTA 3MODL 4IM8A 3IF1A 5I76B 3GI8H 3DTXA 4EVNA 2VL5A 4KUCD 4Y4FC 1IAKB 4ELKB 4HUUB 5D93C 1VADA 3E6FA 5IUSA 1FP5A 2GCYB 3MNZA 2EKSB 4YNYB 4JFDE 2IANA 3A67L 5INCB 3TZVA 1CGXA 5F6HJ 4J3UA 3GHEH 5J4MA 4N0UB 2H32H 1DL7L 4DAGH 4JFOB 3FRUB 3O3AB 4ISVB 5E2UL 2PYEB 4ZPTB 5FUZL 5CUSH 2A0LD 4ZQKA 3U7YL 2W65A 3ARDD 4D9QE 2R69H 4L4TA 1KBGL 3D0LA 3RWGB 4FABL 1JGVH 1KIRB 35C8H 3X14B 4MAYC 2AQ3A 2ZCHL 5HGBB 4M02A 2RCSH 2BVQB 2DBJA 1CL7L 2OXGA 4LAJH 5AG8A 3MLTB 2EYRA 3AMLA 3ULVL 5D96C 3FOMB 4FZEL 4MJ5A 2X09A 3GIZH 1KEML 3DUUA 1QZ1A 2OQJB 5D7SH 4D9QD 1JZ4A 4OZHA 4N8PA 1XZ0B 3RNQB 1IAOA 4GRLD 3L6FB 3FZUC 1U3ZA 3CXDL 4GRMB 1A2YA 2Q8AL 1FYHB 43C9B 2YWZA 4P4KA 1PG7X 4BH8B 4L29B 4X80L 1D9KC 2EXYD 4XWGL 2FSEB 4J3WA 3D18B 2X4NB 3SEPA 3V4VH 1YEIH 4KK9C 3TP4A 3BSZL 1NUNB 1T1XA 2VTFA 4HUVA 4DEPB 2P5WD 2HRLA 4G8EA 1IZJA 1KUMA 3IXAB 2NY7H 1RV6X 1JPTL 32C2B 4JREB 4EI6B 5K9QG 4QRRB 4HIHB 2V5RA 4R97C 4ONGH 2E9WA 3RY6C 3QNYA 1A6AB 1GPOH 4OTXH 3LCYA 3FCTA 1NGWB 2VXSL 2C3VB 2Z31D 3GJFH 3UTSD 2VR5A 3UBXB 1N5YL 1DQML 5DUPH 5IB2B 1DN2A 1SEBA 5KG9A 1N2RA 4N9GA 3CD4A 4OT1L 3T2NL 3EYUL 4R90H 4XPHH 1UZ8A 4NN6B 4TUKH 3TIEA 1IBGH 2W0LA 1ZEAH 4DKDC 1Y0LB 2EIZB 2AJXH 2BY3A 3O8XD 2QR0B 2OXHA 3LKSA 3RU8H 2IAMD 5I8CB 1CG9B 1B3JA 4IOIB 4YPJA 5ICYA 1KB5H 2GY5A 4WI3A 4HKXA 1VENA 5ALBH 3ULUF 3I9GH 4JM4L 3IDNB 3R0NA 5BJTB 3EOAB 1CVRA 5F6IC 4XAKD 4FNLH 3SDDA 4M62L 2XN9E 3OXSB 5HBBA 1R5IA 4XVUC 1Q0XH 3PWNA 4RX4D 3ARXA 2VH5H 3WXWL 4J4PA 5C0CB 1KCRL 4MXWH 3BD4A 4S1SH 1DFBL 5I75B 1K3IA 1J1XH 2EH8H 2AEQH 3RVXC 3P9MB 2DIBA 4LCWB 4RFOL 3UPRA 2VOTA 1U8OA 3MZGB 3DO3A 2VERN 1QRNA 3S7GA 3S9DB 3STZB 3IFLH 4K2UH 5DEFB 3L5WA 5L8LB 3L5XH 1PBYA 1JNHA 2QHRL 3FFCB 5CIPA 1S7QB 4PJCB 3BKJL 2JK5B 3FQUA 4YX2H 5MI0C 4NQCA 5DJ8B 4HULB 3DSFH 2XXMB 4OBRA 2JIXB 2GJZA 2G2RB 1LEGB 2CLZB 2NXYC 3BEWA 5GS2H 3VXSA 1ZANL 4UUJB 3L1OH 2DIAA 1PEZA 1K8DB 3ZDZE 3TLRA 1KB9J 4G7VL 3IDXL 4OFKA 2VZVA 5IB4B 5E2TL 3VCLB 2HWZH 5F1NA 1OSPH 5IVZB 4QNPE 4HFUL 3MRMB 1RZFH 4I0PD 1NCWL 1F2QA 4OV6F 5INDB 4MA8H 3MREB 5DJXA 1IZKA 3D39D 4JO1L 3SKJL 2AERT 3RA7L 5TE7H 4YFEA 4MAYB 3ZT7A 4X4ZA 2IQAB 3BZFA 4PJFF 3NFNA 1A9BB 4PYHA 4XAWH 5EOTB 3S3SA 4DUWA 4QWWD 1MFBH 4P5MB 1DJSA 1OTUC 4Y19B 1RIUL 1WWCA 5D96B 5GGVL 4MA3A 5JO5B 2PO6A 4XXCA 4OLWL 1L7IH 3RVWC 4OZIA 1G7PB 2VUOA 3B2VH 3L95B 4LEXH 4QEGA 1RZ8B 5HVFB 2P47B 5DVKA 4Z7UA 5MENB 1YEKL 3VXUD 3K1DA 1TJHH 4HS8L 2D7NA 5TDPB 5D7LE 1AKJD 4ZO7A 1EFQA 1Z2KA 3T1FA 1YEDB 1D9KB 2YD2A 4LOUC 1U95A 1UKSA 2J2ZA 1IGIH 5T5FH 5FYKU 1JYVA 3VWKC 3PGDB 2OYPA 4R4BB 2FHCA 1FNSH 4FQCH 5CSGA 3DXAA 1IVLA 1NAMB 3ULSA 4HUWA 4R97B 1M6OA 2N7AA 4JHAL 2EDWA 4JPWL 2DQDL 3MA9H 3U4BH 3OPZH 2BRRH 4J3TA 5D7LD 5ESAB 4PJAF 2ADJA 5TF0A 4LP4A 4X5WA 5C0CE 1QSEB 2UVFA 4JJ5A 3QQ3A 5E2JA 4JHWH 3D3VD 4K7FA 3MLZL 4M6OH 3KPPB 4ZTPH 1H8NA 1OAKL 4OGAC 2EDJA 5D7IE 1T7YA 5HYSB 4ZAKC 3D48R 4M1DL 2GITA 1A4JB 3NPSC 3SPVB 5SWZB 1XEDA 2COQA 3O3BA 5L2KE 3TPUB 5JOFB 5IT2H 2FYYB 4PJCE 4Y4HB 1EA9C 2NY3C 4ODHL 4DW2H 2J8OA 3VXRA 1BPVA 4HKJB 2P1YA 1RZ7L 3IDMB 1DQTA 3IDGB 1Z5LB 4KWUA 2C1OB 1M05B 4C56D 4ZD3H 1QSZA 5EO1B 1EBAA 4FQJL 3KYKL 3PG2A 4CMHC 3D25A 3KYAA 5F6IB 1RIHH 2IF7A 3PQYA 5I6XC 5L2KD 3I6LD 4TRPL 4X9IA 1G7MA 4LU5H 3W82A 3F7VA 1A1MB 5ESVA 2OJZL 1MHHB 5IB5B 5C0EA 3SDCC 2DTSA 1VERA 4WUKH 1WBYA 2NZ9D 2YC1B 1AR2A 2EZ0D 1OT2A 3WJJA 2BOCB 5HI5C 1CBVH 3MRKA 4CW1A 1I1FB 1VACB 4YR6B 2WLYA 3R06B 4R96A 3TT3H 1LEKB 4P9ML 5BRZD 1KJMA 1SYVB 3CMOH 3VFSB 3VRIA 2CD0A 4GRWB 3O2VL 1EAJA 4XCFH 4Y19E 1J87A 5C0AB 3STBA 1VB9A 3ARYA 4HUXB 5F7FA 3RIFF 4I3RH 5FF6A 3BPOC 4S10A 4PJ7B 4X6CB 5DQJA 2EYTB 5MENE 5B39A 2Y5TB 3TF7C 4NT6B 3AU1B 3ARDA 4PRNB 4BFEA 2NXYB 1NCNA 2XZQL 1G0YR 1JGLL 1ODAA 3FTGB 1R3JB 3CFEA 4JFXB 1FCGA 3MX0A 3GSOA 1M7DB 1QG3A 4OB5L 3T3PF 5K9OA 1C12B 3HE7D 4NNXB 4IMLA 5JPMA 4P2OC 5CSBA 3WIHH 2W0KA 2Y23A 4U6VH 4N8VG 3MV8B 2H2PC 3DUSA 4MZ2A 2XA8H 4NQSB 4GRLA 2PW2B 2X4TB 4P5TD 1FFPA 1BVKA 1I8LA 5F7EL 2R56L 4PV9A 3OAUH 1NC4A 3S97C 4EDXA 3BO8B 3MGOA 2OTUA 4AEHL 5HSFA 4Z7NE 3ULVD 1AGFA 4KQ3H 3LKRA 2P5WA 1VKXA 2D2OA 5FGRA 2DQJH 1KTRL 2IFGA 3NABL 5EIIB 1A4KA 4FXKB 4L8SA 1T2JA 4E42A 5HYJD 3WFHB 1RUMH 2Z31A 3UTSA 2Z0BA 1SQ2N 4XVJH 4XMKL 3U2SA 1MJUH 3QDJB 4HX1A 2ORBL 4OIIH 4YDKH 3KWWA 3VWKB 1H9VA 3GKWH 4UB0L 4CVXB 4V2BA 1CE6A 5DHYB 1IM9D 1K4DB 3TJEH 1INEH 1OP9A 2DQUL 4QY8B 5KW9H 1YUHA 5T3XL 5IM7B 3MC0A 4LRNL 1OTSC 4UV4L 5DLMH 3ZKQD 1T0PB 3O8XA 4UQ2B 5J6GA 1EGJA 3CH1A 5T1LD 4K07A 1F4XH 4KKLC 3V4PL 1HHHB 4IRJD 2P46B 5FYLD 2R2HA 3G5ZA 4MLSA 5JHDB 2FEDC 3NPSB 4F7EB 1BJ8A 2DQHL 5C0AE 1FZMA 4MCZA 4PJXA 3RX5A 3C09B 1H5BA 1NGPL 2NY3B 3KLAB 3QG7L 4P2RB 4CAGA 4PJ7E 4AK1A 5E2VL 3HKFA 5FKAB 5F1IA 5A16B 5IB3B 5L7XH 1IGYA 2F5AL 3UJTL 2OLDA 3GGWB 1BQHB 4HGKC 5IW6B 5C0BE 2I5YH 4HXAH 4P4KC 4HSQA 1WBXA 3MRQB 1BOGB 3D5OF 4NHUA 4X7TA 1FQ9C 1GGIL 4ENEC 5AWNH 5EU6E 5C6WH 1BQSA 2DMCA 3QUMA 1TVDA 1ZVSB 3WHE0 4JZOA 4JQXC 4NN5C 3MLVL 4N90D 4TNVF 4KRLB 3UZEA 5ERWB 1WZMA 1A02N 4P9HH 4U1KA 4MNHA 4MDJA 1NAKL 1VFUA 4E41B 1CQKA 4JCLA 2NW3A 4BFIB 1OTTC 1BBDH 4Q6IA 3HB3D 4PS4H 2ID5A 5C92A 3PV6B 4QXGH 3TH4T 4F9PA 3WHE1 4FXGB 3LEXB 4MNQA 5DZNA 2RJMA 5D5ME 2R0WH 3MRNB 5BO1L 4P2YA 1LMKA 1H0DA 1PW3A 5CD5C 2I60H 4M93C 1BHGA 2AK1L 3QIWD 4I0PA 4JO2H 5AZEL 1JF5A 3JWDL 5C9JB 1Q9KA 1B2WH 1CFVL 3D39A 4JHZA 1RVFL 3L3OA 2NY6B 4MNGE 4QXUH 3ZKSD 1UEYA 2R2BB 5H2BA 3BUYB 4PB0L 4X7DC 1X5JA 1MI5B 4QHKJ 1IKFL 3JV4B 1OPGH 2DMBA 3P4NA 1PLGH 4KV5E 4NPYA 3DROB 3VFVB 2XICA 1KPUB 2HT4D 2FD6L 5CD3A 4CVWA 3GJEA 2BY0A 2GJ6E 1MCRA 3D69B 5CLWA 2P4AB 4GG6F 4ESKA 4QHUA 4W4OA 5EO0A 3VXUA 1GYAA 4JAMB 2XTJC 3LVEA 4N5ED 4NC1E 4OFVA 5IQ9A 1TTUA 2BVTA 2DDQH 3FB6B 1U8QB 2VDOL 1FYTE 3IS1X 1AKJA 1S9KC 3RWCB 1FN4A 2VDNL 1T1WA 3CGTA 3R8BB 1MCEA 4XBGB 5I9QB 4ACPA 3DRQA 3VMPA 5DK0B 5GS3A 2C1PA 3UTTD 4R3SB 1JTOA 5IW3A 1F6FB 2GJ6D 2IG2L 3VFOB 1UJ3A 1AP2B 2X70A 2E7LC 2NX5B 2EE9A 4EN3B 3BP5A 3PGFL 3IF1B 1PJ9A 4JY5H 2O61A 4EOWH 4EVNB 2VL5B 3CPLA 4CL7A 1VADB 5HHPA 3HI5L 1FYTD 3BPNC 4DVRH 3IAQA 4U1SA 3PDGA 1CU4H 4I3SH 3MNZB 2CO6B 4IBLT 5I2IA 5CZVH 3D3VA 1AGDA 2OL3A 2IANB 1WIUA 3TZVB 2EYSA 4HLZG 4YHML 2JJWA 3QJHA 3W0WE 1KGCE 5IVXF 5J1TC 3ZT5A 3K8MA 4LDLB 3TYFA 4AIZB 5MEPA 3KLHC 3MV9D 1CGTA 5ICZB 2ZUSA 1I1AD 4MD0A 5C3LD 1A5FH 3A6OA 4ZQKB 2XTLA 3FQRA 4OLXL 3NAAH 5I1CL 4URTB 1FH5L 4L4TB 4NZRH 1EO8L 3D0LB 5D7KE 1LQSR 1MHPH 1FGNH 4J23A 3LB6C 2ZUQB 2Z4QA 4C56A 1WT5A 3W0WD 1KGCD 4RMQA 3EYFA 2GT9B 3LS5H 5JUEH 3TH3T 4NGHH 2L7UA 4LLQA 3UJIH 3S88H 1BQUA 4O9HH 4KVCH 4ZNEE 2EYRB 3QH3A 3WKML 4MJ5B 3MLYL 1H15A 2HFEB 3DUUB 5IFJB 1UACL 1UZ6F 3DECA 4KDTA 4OZHB 4W70A 3DO7A 4GSDH 1IAOB 4DKAA 4H8WC 2YUXA 4B5EA 1DVFD 1A2YB 4D3CH 1T04A 4P4KB 2FEEI 2FEEL 3LQMA 4GRWF 1KPRA 4JFEA 5BRZA 1MI5E 4JRYE 3RHWF 2LFGA 4G8EB 4RMWA 4X6CF 5J9PA 4QRUA 2X9XA 1M1SA 3RX8A 1F5WA 1KCLA 4U3XA 3DMMD 3QNYB 2B1AH 3HZYA 3SE8L 3FCTB 3O4LA 5K9QI 1BWMA 1FGVL 1ORQA 1DUYA 4U7SA 2VXQH 4JANB 4UV7L 4OQ1A 4N0RA 2V6HA 1SEBB 1N2RB 4Y4KC 2OMBA 4X4MA 3OJ2C 4N9GB 3BP7A 1KJVA 3VW3H 3MA7A 2X89D 1Z9OA 3D9AL 1KELH 3HE7A 3C5JA 4ZUUA 4EXPX 1UZ8B 1I9EA 2OK0L 3UYOD 4M93B 4P4RA 3QUZD 4Y2DC 1EX0A 4Q9RL 4LSQL 3LEYH 3BX7C 3FN9A 3FQTB 3IT8D 3MJ9L 4K55A 3BKML 4LVEA 5C0FB 5AAWA 1SJVA 2XZAH 3LKSB 4P5TA 2X44D 4FP8H 1Q38A 2HFFB 1T1YA 1IAIM 4UU9A 5DO2C 5EPMA 3MLUL 5F3HA 4KKCC 4HKXB 1Y6KR 2OMNA 3DYOA 1NC2D 3HG1D 3MRFB 1WSST 2Y06H 3KGRA 1X4ZA 1CIDA 1A64A 4TVPH 1AY1L 1Q0YH 3O2WH 3SDDB 4PJIF 2HRPH 1R5IB 4PG9A 1V8HA 3PWNB 1EK3A 4Q74A 4XP9H 1NFKA 1EFXD 1UH4A 5HYJA 5F1OB 4RBPK 4PLJD 1T5XA 3VH8G 3NTCL 1D7FA 4KJWD 3ROOB 2HT3C 4WO4A 1U8OB 1NCBL 3U0TA 2DS4A 1KJ3H 1QRNB 4ZSOE 1IM9A 1N7ML 4Q58C 2V7HA 4XGZB 3RDTD 3AM8A 1A9EB 3L5WB 1WC7A 4G8IB 1BOYA 2I9TA 1JK8A 2AJUL 4U33A 5CIPB 1JNHB 1VGEH 4OGYL 3BPNB 3NIDF 1YYLH 3P0YH 1IQDA 4NCC1 4NQCB 4V1DE 3CFKA 2GJZB 1DBAL 4M1CC 1N5AB 3BEWB 3PV7A 4RIRA 1WV7T 5T1LA 3VXSB 5IJKC 4B0MM 9CGTA 3U1SH 4IRJA 1A21A 4ODWA 4NQED 5C2UB 1A22B 1WWAX 5JDSA 1ED3A 5T3XD 1Q9OA 4Y8AA 2W1NA 4DGIL 2R23B 5DYOA 5JTWA 1TFHA 3ARFC 1IT9H 4P57B 1UH3A 2W9LA 4TQEL 1HEZA 1LE9A 4M48H 3BZFB 3RWHA 4BH7A 3NFNB 1FV1A 2UZIH 4UDTA 1I1YA 3I02A 1XGUB 1QO3A 4JZJC 5F9DC 4NBXB 1K8IA 4MA3B 4WVRA 3UTPE 5LQBL 3MJGX 3QFDA 2WV3A 4OZIB 4NQTA 1CFNA 5E8PA 4Z7UB 3X17A 2CJUL 1ZWIA 1FIGL 5I8OL 3JWOH 3HN3A 4UT6H 2C9AA 4NUGH 5DQ9A 1Q1JH 1OHQA 1U8IA 3MMEA 3T1FB 4D2NA 2XY1A 3LS4H 3UTPD 2ZKHL 4OF0A 5GGVY 4NO5A 1KCUL 3ULSB 3DXAB 2N4IA 2XRAH 2R0KL 4HUWB 3ILQC 2AK4B 3HC3L 3DX9A 1M6OB 4MX7A 5JZ7D 2CKBL 3QIWA 1CT8A 4XPTH 3GRWH 3SQOH 4FFYH 2XTJE 3D2UD 4X5WB 4HG4K 4JJ5B 3QQ3B 1MCDA 4K7FB 1VPOH 3SKOA 1RUPL 5TDOA 3SKNA 1PZ5A 1HHKB 2PETA 4D9LL 1TNMA 2DQIH 2YUZA 3DWTA 1MCLA 5CINH 1OLLA 2GITB 5T1MA 3D1MC 4PTTA 3QT2A 3RVVD 3O3BB 3RL2A 2P43B 3PWLA 1T66C 4OD3H 4UT7L 3VXRB 2FCBA 1YQVH 1GC1H 1OF2B 4YWGL 3L3JA 3K2MC 1XGRA 4MXQC 1A3RH 1N4XL 1QFHA 4JR9H 1JGVL 4LMQE 1KNOA 4U3CA 4G9FA 2FDBP 5IGXH 1SM3H 3F8UB 4K3DH 3D25B 5MHSE 1MFAH 4HF5L 3QHFH 3PQYB 3UTTA 2MQ0A 5IB1A 1G7MB 1KIPA 1NCAH 5DT1L 1YMMA 3F7VB 1J10A 3SE9L 1LO3H 5CP7A 5C0EB 3GIZL 3VG0H 1HINH 1F6AA 5I1DA 1WBYB 1Z0MA 3G08B 4WFHE 4WU5A 4X99A 3V79C 1BWWA 2AJYH 3HFMH 3DI2B 2FO4B 1FJ1A 3MRKB 4CW1B 3SDAD 4NRXB 3CNKA 43CAA 4R96B 4PG2A 5ID0A 25C8H 3VRIB 4PRIE 3BE1H 2HJFA 4OD1L 2M8XA 4R0LC 2ZCLL 4HZLA 1H3GA 3MV9A 1GOGA 3SHSA 2X4UA 3V4VL 4F9PC 1I1AA 1WISA 3KS0J 5FF6B 4K3JH 4Z7UE 5DQJB 5KSAD 4RSVA 3NFPA 5B39B 1RUQH 1P7QD 2VLKD 4DOHE 4M00A 1KCKA 3ARDB 4ODXA 4ALAH 1DSFL 3FRPG 4PD4J 2DI9A 5GGRY 4LAQH 3K74B 3O45A 1YMHA 3CFEB 3GSOB 3LQZA 1KENH 5JW4N 5K9OB 5BV7H 5GIRA 4IMLB 2FECI 3HE6C 4R90L 4X6BA 5I1GL 4U7MA 2AK4E 4OGZA 4OZHF 4XRCA 1IBGL 5GRVL 3DUSB 2YXFA 2ZCKH 5J12C 2ZOKA 4GRLB 3WN5A 4M6NL 5F71A 1FFPB 3IXTA 1DVFA 5ESQA 5D72L 4MSWB 4PV9B 4WW2A 3DGCR 1XCQB 5FYKD 1OY3B 1NC4B 4EDXB 1C5BH 4TOYL 4PRAA 3MGOB 4JHBA 2DQGH 2OTUB 3EDDA 2FL5A 3MYZA 1AGFB 3LKRB 5E08H 2P5WB 3B2UD 1VKXB 1OW0A 4YC2B 1I9JH 5KTEH 1T2XA 4LVOC 4X7SH 5D7JA 3DMMA 4OCWL 1QUNA 5FYJE 3V6ZA 1A4KB 4L8SB 5GGRA 2YKLH 4E42B 1CLZH 3UTSB 1KXTB 4XH2B 4I9WE 4HZAA 3U2SB 4HX1B 2EH8L 3KWWB 4GXVL 2X89A 1CE6B 4GUPB 5EC1A 4HC1H 2KPNA 4YAQA 3BJLA 2Y36H 3QUZA 1RURH 1YUHB 3HPJA 1T4KA 4MAUL 4KJYA 3UTZB 3O8XB 2ZG3A 3PWVA 5J6GB 1PQZA 3CDCA 3CH1B 2EDYA 1FZKA 2VIRB 3L1OL 1UVQB 2EDFA 2R2HB 3G5ZB 5SX5H 3HG1A 3ZTJH 1HQ4A 1F11A 5D1XC 5FUCC 2R1WB 5F7MC 1GCFA 2XFXA 1FZMB 4MCZB 4PJXB 4DKFH 3PWJA 3M1BA 3ILPA 1ACYL 4M5ZH 4R4FL 4QGYA 1H5BB 2GUOB 1I3VA 4NZTH 5I73C 3H9SE 1UM6L 1IGYB 1EFXA 1PZUB 1B90A 5EZOH 1AGEA 4LF3B 4HWBH 4W6WB 3VG9C 2G5RA 3VXMD 5TE7L 2YRPA 3HR5A 4J3VA 4RNRA 1UC6A 4XAWL 4XNYL 5AEAA 3Q6GL 4NHUB 3BP4A 4X7TB 3RDTA 4PREA 3QUMB 1L7IL 4YDVA 2A83A 5EIVA 2DJSA 1J05A 4JZOB 2CGRL 4BYHA 1XAUA 4H1LH 5TF1H 5F9OL 4U05A 3BKCH 2AGJH 2X4QB 3S35H 1TJHL 4MNHB 1VFMA 2NW3B 2K1MA 4R0LB 1XT5A 4Q6IB 1I3RA 3NGBB 3QWRD 1DQJA 4NQEA 3C08H 3RJDA 4XMPL 4EI5C 5IBUG 5I1HL 4X5LA 4PJGE 3HNVL 5FK9A 5L6YH 5EA0H 1AC0A 4MNQB 1EHNA 3V5DA 3T0ED 4RMRA 4XHJC 5F9WB 1KULA 2W07A 1H0DB 4BZYA 3QR2A 4I0PB 3RGVC 1X5HA 4LCIH 1S9WA 1Q9KB 5LGKA 1KYOJ 3D39B 1BM3L 3OPZL 4G8GB 1HXYA 3L3OB 3QNZA 4EUPG 4PBXA 1K2DA 5DF0A 4JHWL 4M6OL 3CU1A 5H2BB 4HPYL 3H7BA 1KJ2A 4NPYB 4HJ0C 3E8UH 3KHOA 4OZIF 3EO9L 2ZUUA 5CD3B 3O11A 3LH2H 3GJEB 4H5SB 1X5IA 2DI8A 1S9YA 4DZ8B 1ZLUH 4QHUB 3DX7B 3SGJA 2PW1A 5EO0B 2NY1D 4H20L 2Z92A 1HQRB 4XNMB 1A7NH 1HKFA 3LIZH 5FB8A 1QBMH 5IQ9B 3CVHB 2GJJA 4Z0BL 3V5HB 3WXVL 4LK4A 5C2BL 1T1WB 1JPST 3ARGC 5LCVH 5C7XH 4OSUH 3DRQB 3OKNA 3SJVD 1F6LL 1QLEH 2J6EA 5HD8D 4WO4C 2C1PB 3QYCA 1UA6H 1L7TH 5DFWH 1UJ3B 1INDH 1FL3A 1G9NH 4CADA 2X70B 3MOBH 3FB5A 2VXUH 3BP5B 4LVOB 3B83A 1AHWA 2O61B 2DLHA 1FCCA 4OZGE 3D2UA 1NGYB 4Q2ZA 5HHPB 1UKQA 4XC1L 4U1SB 2ADFL 1CDUA 3F6LA 4N8VB 4NSKA 3HNSH 5I2IB 3D3VB 2IFFL 5IBLD 2WBWB 1CBVL 3O9WA 1J0HA 1DQDL 2OL3B 3KG5A 4NC0B 4OCYL 3ZDXE 2EYSB 3QJHB 4KMQA 5LBSH 4YJZL 5FDWA 1A6WL 1FNAA 3FT3A 1R5VA 3BMWA 1WVZA 3LMJL 5GISH 4MD0B 3GUTB 3FQRB 4KROC 1ZT1A 2IBBA 2VITA 1UYWL 4ZTOH 2CRYA 2N7BA 1IM3A 2Z4QB 5E94A 1JFQL 4C56B 2C4XA 5C09E 5F1SA 4I13B 3KNBB 3EYFB 5GGTH 5D1XB 5FHBH 1U2HA 3MQIA 2R29H 3UDWA 4LLQB 1FRGL 4KK6D 4DN4L 4YDJA 4G6AD 2FJFA 4PBVC 4MJ2A 3QH3B 1X4XA 1IFHL 3VD3A 4CDHA 3EDFA 4FFWD 1OLZA 1H15B 4X5XA 3WIHL 3IDIA 1JRHL 1JRHI 1J1PH 4K23L 2DQFB 3K2UH 3C5SA 2XA8L 3IVKA 1MCCA 5C09D 3U0WH 4G8GE 5JXAL 4LCCC 1CQYA 3SDAA 1T04B 1QFWL 4U2ZA 4OLZH 4PGDA 1P7HL 1KPRB 4JFEB 1LP9A 5BRZB 2I9LA 3C2AH 1TPXC 4XWOD 4XX1G 5DJAA 1GHFH 1MF2H 4NRYB 2YN5A 3BISA 1U41A 3U46A 5J9PB 3F62A 1JGEA 4WGWB 4QRUB 4N0CD 5E7FA 3NOIA 5LG1A 3F7RA 3T0VA 5KSAA 1P7QA 2F19H 2VLKA 2DQJL 3SDXA 3HZYB 3O4LB 4DFIA 1AQKH 1FFQA 1ORQB 1DUYB 1IC4H 5FGSA 1BEYL 1GZPB 3BP7B 1KJVB 2FX8L 1CR9L 2LVEA 3MA7B 4HCRA 4Q6YA 1U93A 3HE7B 5HYFA 3C5JB 4ZUUB 4WU7A 4P4RB 2VC2L 3T3ME 1H8SA 3INUH 2DL9A 1I7RA 5DHXB 3QUKA 1KPVA 1KC5H 4P5TB 1DBJH 1T1YB 1LO5A 3DV4A 3NIFF 4UU9B 5EPMB 5F3HB 4Z7WA 4N9OB 2D3VA 3HMXH 2Y07L 3MCLH 1CDBA 5JXEA 1JV5A 2O5ZH 4XPFL 3JV6A 4PRPA 4U6TA 5ACZA 3MJ7A 1E6OH 1QHOA 1CICD 5HYQA 1CD8A 2EC8A 3S4SG 3MROA 4KAQL 5MP6L 2GTWA 4AMKH 4E0RA 4PG9B 4G3YH 1AXTL 5JIKA 3KPSD 4YXKL 2JJSA 2OTPA 4GKSA 5HYJB 2FIRT 3W9DA 1MREL 2FLBT 4WFGD 4GQ9H 1T5XB 3BUTA 3NN8B 5FUCE 4CGTA 1TVHA 4KMTL 1UCBH 4UTBL 4YGVA 1K3ZA 2XPGB 4WO4B 2PYFA 4PG2C 4RMSA 2I5YL 3S34H 3U0TB 3TBYB 5EC2A 1IM9B 2WNGA 2V7HB 4XPAL 5L88H 1WC7B 3U0PA 3V8CA 3QI9C 2I9TB 1JK8B 4R4NC 4UIKL 3WFBH 2BXYA 1QLRA 5FM8A 2HKFH 5DUML 1IQDB 3CFKB 1T20A 2AXJA 4RIRB 3AS2A 5T1LB 1CDJA 4POZD 5DUBB 4IRJB 5IK3A 1AXIB 1BBDL 4ODWB 2DLFH 1FLRL 4PJXF 2OZ4H 4WI2A 1T5WB 4O2EA 4PS4L 5DD0H 5C70A 12E8H 1ED3B 3EJYD 1MUJA 5CJOL 2MKWA 5KS9E 4KROB 3AAZA 1GIGL 1IEHA 3QDHA 5EG6C 2ZUTA 5DYOB 2I60L 2YD1A 3X13A 2YEZA 1KV3A 3QCVL 1HEZB 5GS2D 1B2WL 1TJIH 1LE9B 3VI4F 3UJJH 5HY9A 4L8DA 1E27B 1ZA6B 3VXMA 4YH6A 3RWHB 3E2HC 4NCDA 1SYSA 4BH7B 1FV1B 1T2QH 3H8NA 3G5YA 4F7MA 1ZGLP 3SGKC 1QO3B 2XIDA 5F9AC 2VLJD 1K8IB 4OV5B 2VLRD 5CHNB 4ETQA 1HHGA 1GOHA 4TSCH 5I1AB 4PJHE 3OV6A 4P3CL 1CFNB 4I48B 5E8PB 4KI5D 1ZWIB 5HHNB 1BD2B 3GMRA 2YR3A 4FN0A 5D7JC 3QIBD 5DQ9B 4R9HA 1U8IB 3MMEB 4EI5D 5HHXH 1QBAA 2NQCA 4LDOB 2HYMA 3MNWA 5DJCA 1TPXB 3ULUH 3QWRA 3MNVA 3MUZ1 1OM3H 3I6GA 3O2DL 5DZLA 1S78C 2C3GA 4NO5B 3T0EA 3RRQA 4YFDB 2CRZA 2BSRA 1T7WA 2DQEH 2P42B 5K9JH 3DX9B 2P48B 4IRZH 1CT8B 2FHFA 3GSRB 3BW9A 3V0AC 5JA8B 4EOWL 4U0RC 1UQSA 1CK0H 1D3CA 5DHVA 2UVEA 5CGMA 2BVOA 1IGFL 3NCCB 4Z7QF 3P4LA 5TDOB 5JQ6L 3SKNB 1PZ5B 5CZVL 4NP4L 5DXWA 5DC0A 4RCAA 2XWTA 4WHYH 5D6CA 5T1MB 1ZHBA 1JNNH 4PTTB 5CEZL 2H9GA 3HCVA 4PRDA 5EUOA 4OKVA 4FQ2H 3RL2B 3PWLB 4MMXC 2AXGA 5H35A 5GGQL 4HPOH 3EDEA 1N0XH 1A5FL 2CSPA 3FT2A 1SJXA 4K8RL 3MSPA 3ARBD 5FCSH 2CUMA 3L3JB 3QUYC 5A3IC 4NZRL 1XGRB 5DSCA 1AD9A 3EFDH 1KNOB 1UM5L 2H26A 4L3CA 4G9FB 5E2WH 3SJVA 3O6KL 1TLKA 5EBMA 5JUEL 5BMFL 3S88L 4WEBH 3UTTB 5IB1B 2I07A 1KIPB 3FO1A 4G8FB 1YMMB 1SHMA 2B2XH 3LY6A 2VAJA 2CXKA 5C07E 5J57B 2VYRE 5CP7B 2WUCH 1F6AB 3GSQA 4HMCA 1XF1A 5I1DB 1SVZA 1WFUA 3WYRA 4NZUH 4WU5B 4X99B 2WINA 1NEZB 4HH9A 3KPQA 1JZ8A 1FJ1B 3OAZK 43CAB 5ID0B 3RIFK 2W0FA 3CK0L 15C8H 1D5MA 2HJFB 5TFSL 1OAZL 4HZLB 4JFZH 1DBKH 1I8KA 3MV9B 3QUXD 1OP3K 2X4UB 3QI9B 2BCKB 1I1AB 4U31A 1P69B 2CIKA 5GS1C 3NFPB 4LKXB 1BD2E 4ODXB 1TZIA 3QQ4A 2B1AL 5J06A 3DSNA 4KJQD 3S37H 3PWPE 3E1F1 4QOKE 3O45B 4J3OC 1YMHB 3G6DH 4M7KL 1UWXK 3LQZB 2H32A 1RJYB 5GIRB 4U6XA 4X6BB 5K59E 3FN0L 4QTHA 5FA4A 5HHVL 4S1DD 4ZFGH 4OQTL 1QBLH 3BQUD 2ZOKB 5KVDL 3VXOA 5D2NC 3WN5B 3ALWA 3IXTB 1DVFB 5ESQB 4FQHA 1F3JA 4WW2B 3U48A 1CE1L 1QR4A 1WWWX 3RZCC 4AG4H 1JUFA 3S36H 4G6FD 4PGCB 4PRAB 2VDRH 4KHXL 5DD1L 1MAKA 1JCKA 2WBJC 1TVBA 2Y06L 2EECA 1YEEL 2HH0L 3QZWG 1RUAH 1QTYT 3QRGH 3ZL4H 2BDNH 4KKBD 5I0ZA 1JPSH 1F13A 4HQQL 2YA2A 2PTVA 3DMMB 5D7JB 5EFIA 5GGUA 3BZ4B 3B5HA 5GGRB 4XP9L 3QNXA 2W92A 4OZFH 3VFRA 4H25A 2GK2A 5EOCH 3REVA 3WSQL 3O9WC 1QYGL 2YD3A 3WBDA 2IADA 4LPCA 2DWEA 4X7FC 5EC1B 5D8JH 1YMME 1ULVA 3QUZB 1BZQK 4OLVL 3HPJB 1T4KB 4HJJL 5ISZB 4WI8A 3TO2A 4KJYB 3JWDC 4PJEE 3GSVA 4FQQA 1RZKC 2XKNA 3GJFA 1PQZB 5CS7A 5F7YC 5IQ7H 2VDQH 3TFKC 1KEGH 3CDYA 1C16A 3ORJA 3VXPA 1FZKB 3LDBC 5I1EL 2YMXL 5D2LE 1R5WB 3DGGA 4UILL 4O58L 5DJYA 2YD8A 3HG1B 3ARZA 3KVQA 1HQ4B 3ULVF 1F11B 8CGTA 4Z7OE 5BS0E 2XFXB 4GOSA 1SMAA 3PWJB 1CICA 3M1BB 2C5DC 3ILPB 4XZUA 2BY2A 3OZ9H 4BZ2L 1E4XH 3N06B 1QSFE 1V7NH 3MO1A 5C6PB 3KPSA 3RFZC 4M3KB 1EFXB 1KACB 1GGCL 1IT9L 2ESVB 4NRZA 1KB5A 2VUYA 4KQ4H 1MVFA 1D6VL 1P1ZA 3OG4B 4M48L 3HR5B 2HFTA 4BA8A 3T0AA 4TTDC 1ZHLA 3KLDA 3ZYIA 4MD4A 3BP4B 3RDTB 4PREB 3WUWA 3KPMB 3TN0D 2A83B 2Y6SC 3QXDA 2OR9H 3MRGA 2DM3A 3I3DA 2YPLE 1MPAL 3OKDA 1LO0L 4UT6L 4L9DA 4ZPVA 2X4RA 4XP4H 4Z7VA 5BOPA 3C60C 1Q1JL 4XNZB 3W81A 1EEZA 3ZDYE 1QACA 4X6DB 1DQJB 4MVBD 4NQEB 3MBED 1U92A 3LS4L 5FK9B 2V5SA 3AS1A 3QO1A 3TBVA 2YSSA 4G6KH 3V5DB 5I1KH 5HVGB 5CILH 2D7QA 1V5JA 5CMAB 3O81A 4WRLA 4ODTL 2BERA 3SQOL 1OCWL 1S9WB 5F7UA 4FQXD 5I1IH 2GSIA 5F7KC 1HXYB 3QNZB 3X3GH 5I19H 3JWOC 5EU5B 5TDNA 5IV2B 4RDQF 5JQHC 3H7BB 1KJ2B 5JPNA 4F57L 5JXEC 2DQIL 1YNKH 2XV6B 2VLJA 3QHZH 1U8KB 5I16A 2VLRA 3SE4C 1LD9A 3O11B 4KVNH 3F7QA 1OGAE 4Y5XC 5D2NB 5ISZE 4ODUA 1OAYH 2PW1B 2Z92B 1UADC 1FZOA 5FB8B 4IJ3C 3QIBA 1YQVL 1GC1L 4CJ0A 2R9HD 3IDYC 4WWKC 1A3RL 4Y1AB 3NH7L 5BCAA 2NNAB 1A6VH 2EDKA 1YEHL 4POUB 4K3DL 1M71A 4L4VD 4CADB 1FL3B 2WQRA 4ELMB 3HI1A 3FB5B 4C55A 4X6FA 1LO2H 5ABDE 2BXZA 1RJZA 2E9IA 1AHWB 1T1ZB 1WZLA 4F15B 3L9RA 4NN7B 1MRDH 3D2UB 3VG0L 2BFVL 1HINL 4JDTH 4Q2ZB 4YHPB 4KRPD 2GFBA 1F4AA 2ESVE 6FABH 4NSKB 2HTLD 3KPNA 2M2DA 3O9WB 1I3GH 4NKOA 25C8L 3HAEG 5FDWB 5B3JE 3FT3B 2DBLH 3SGEH 4L5FL 2HT2D 3BKYH 1VEMA 4JM2D 1FC1A 4K3JL 4LKCB 4IOFD 1ZT1B 2VITB 3QEQE 4HBCH 3JUZA 5T33H 5M94B 2APBA 1IM3B 1V7MH 1IGCH 3ARBA 3QB7C 1DLHB 2MPAL 3S3PA 5E94B 3LDBB 2ZUXA 3B9KD 4GAJL 1KCSH 3E6HB 2V2TA 4X6DE 1AIFB 4K94C 3H3BC 3SN6N 4YDJB 4KTEH 1B6DA 3MLSH 1ADQH 3HUJB 2FJFB 1BVLA 1BECA 1MVUB 1H3PL 2Z8RA 3T04D 3PGCA 3IDIB 4IDJL 2X7LA 1Z9SA 4NJ9L 3CIQA 3MRIB 4S2SA 1U6AH 3C5SB 3IVKB 4JVUA 4YDIH 3RHWK 1Q9LA 3HC0B 3VWJD 4YBLB 3SDAB 2BSTA 1OAUH 3U7WL 4PGDB 1X5XA 1LP9B 1PG7W 5E70A 1C5BL 2I9LB 3WLBB 3BAEH 5DJAB 1NLBH 4XI5C 5IFHL 1S9XA 3ZYJA 3U46B 2XKSA 4JB9H 1JGEB 1NCDH 1I9JL 5D2NE 4JO3L 5KSAB 4PP1C 2VLKB 4ZFFA 4PTUA 4POYA 3SDXB 4G43A 5I74C 5DJ0A 3WDJA 2EDHA 4LARH 3VXTA 4ODVH 4MQXC 4MA7H 4QGTA 5IESH 4Y1AE 5IMMA 1C1EL 1JIBA 1J88A 4LHQB 2AABL 2AEPH 3M8OH 1J86A 1X5YA 1UKTA 1NAMH 1U93B 2GK0A 4GAFB 4ELME 4WU7B 2Y36L 1K6QH 1HOCA 1FO0H 3BQUA 3QUKB 1KPVB 3QEUA 3GBMH 4WW2F 5DVMA 2RGSA 1LO5B 3DV4B 1A3LH 1QPXA 1F58H 4Z7WB 1YY8A 2NY2C 4PJBA 2IALA 1JV5B 2DQTH 4PRPB 5ACZB 1Z3GH 4HJGB 3V52H 4DKFL 1ORSA 3WIHA 4TVPE 3MROB 2GTWB 4GKZA 1T7ZA 4E0RB 3OKKA 3A6BL 4KFZC 4NZTL 3BVNA 1OOAA 5KOMC 1HN1A 5D9SA 4GKSB 3W9DB 3ISWA 3IDYB 1FG9C 3TVMD 2HLFC 1EO7A 4HWBL 2QEJA 3TJHD 3OX8A 5J89A 1WAAE 4YGVB 5DD3L 2PYFB 4EUPB 2ENSA 2VAAA 1X5GA 4TVPD 3HUJE 1FHGA 2VQ1A 4HXBL 1N0LA 3ARED 1CYGA 4WDIA 5F96L 3S37X 3QQ9D 3U0PB 1NDGA 4R26H 1UENA 1U8HA 5IFAL 3K46A 2E5EA 3MOAH 1QLRB 4M6AA 4YK4C 1II4E 4TUJA 4JQVA 1NBQA 1T20B 5TF1L 1GAFL 2QSVA 3U36A 3HHRB 2PXYC 4PLKC 1NFDE 2JELL 4R2GC 1FDLH 5IK3B 1I8MA 2MMXA 3VGBA 3NZHL 1F45A 3KPRE 4KC3B 4O2EB 4O4YL 3C08L 2XI9A 3QDMD 1CLYH 2X9WA 1MUJB 5EA0L 3EYVB 2UWEE 3BDYL 1IC7H 3MRRA 4LFHG 1HILA 2OSLA 1NSNL 3PABA 5FHAL 1JPFA 3HR6A 3AAZB 3UBXG 2B1HL 2V7NA 2PTTA 2CQVA 1MCOH 3X13B 2YEZB 4K3EL 2VDKH 5HY9B 4JQIH 4L8DB 3VXMB 3DVGA 4NQDD 1SYSB 3FMGH 2W60A 4Q0XH 3MBXL 3G5YB 4F7MB 3FQXA 2F9BT 3RY5A 2BNRD 2QJDA 3NIGE 4WUUE 4ETQB 2FJGA 1HHGB 1YECH 1MCQA 2WANA 5HXMA 1LNUA 3TN0A 1AFVL 4ZFZA 3LH2L 2NW2A 4O5LL 3MTRA 4U1HA 5JLZA 5GS0L 3GMRB 5CCKH 1H3TA 1YY9C 3G5XA 2YPVL 1P4BH 4HKZA 5F88A 1G7LA 2AXHA 4ZUSB 5AUMA 5LXGL 4NNPL 2FZ3A 3MNWB 3HC4H 4P49A 5DJCB 2D7OA 4FQ1H 4OSUL 3MBEA 1F4YH 4WUUD 3I6GB 3LZFL 4WV1A 1MQKL 1L7TL 2BSRB 4YUEH 3BIBX 4KHTH 4YHZL 2VXUL 3BW9B 2NPLX 1UQSB 4RISL 1A47A 5DHVB 2X42A 3HNSL 5J0BA 4ONOA 3O3DA 2IJ0C 4KZEL 2B4CL 2XWTB 3R8QA 4X98A 4G80A 3RAJH 2DWDA 1ZHBB 3HCVB 1F97A 5EUOB 4OKVB 4F3FB 1YN7B 2MTPA 2UZXB 4NUJA 3AUVA 3SOBL 4LNRA 4GS7C 2AXGB 2R1XB 3ZLQC 3U30B 5GISL 4JDVB 1I7TA 5ENWA 2NY1B 5CEXA 1EHLH 2V9TA 5TPWH 5TQ2H 4YHKL 1G1CA 1AD9B 2NR6C 4F33A 1KG0B 2H26B 5C08E 4BQ8A 1S8DA 3SJVB 2UV3A 5FHBL 5EBMB 3B8YA 1ETZA 2I07B 3FO1B 2J4WH 4L4VA 5GGSY 4I77L 1IAIL 1KFAH 3QULA 4XCCH 3WNOA 3V5KA 3HI6L 1QNZL 3LN4A 2IMMA 3GSQB 3OKOA 5KSBA 4D8PA 1A7RL 1P4LA 4DGYL 1W0VB 1ZSDA 3TIDA 2UUDK 2WINB 2VKXA 3PWUA 4PJDA 4HH9B 2MCPL 2FX7H 5C08D 4NFDA 4Z76A 2XZCL 3IGAA 1MFEH 1TENA 2EE3A 4YBQD 3L7FA 1D5MB 4OLZL 3O2DA 1LK3L 3WIIH 3TO4D 2XG5A 3C2AL 4L8BA 1I8KB 2G5BB 1YEGH 2F5BL 1X6NA 1GHFL 1ZTXL 4KPHL 5D1ZC 4JM2A 1A14H 4HGWB 5GPRA 1OSZB 4PRHE 1AI1H 2CIKB 4Y16D 3GMPA 3QDGD 2WUBL 3QQ4B 4N0YH 3B9KA 2J8UA 4R2GB 5LJYH 4M5YH 1HH9A 1C5CH 3CFCH 4ONFL 4KDVA 4YQXH 2H32B 1OQOA 4HMEA 1FAKT 5GGSA 1RQ5A 1U8PB 2V17L 3FKUS 2A6JA 4AJ0A 5GHWL 1K85A 4U6XB 5CGYC 1YPZB 4QTHB 3F7PC 5FA4B 5A2IH 1S5IH 4F7CA 4TUOA 2OTWA 3SE3C 5KJRH 4OCLC 3INUL 3VXOB 3R1GH 4C4KO 2ZZUT 4XMLH 4FQHB 1F3JB 3VWJA 5E99L 4MXVF 1N59A 3VDAA 1IC1A 1LP9F 2YUWA 4PPTA 3S6CA 1L6ZA 1I9IH 3VI3F 5ADPH 1TVBB 5LWYH 5DRWA 1YEJH 3LRSA 3WS6A 4U0QB 4WHTB 4XX1E 4IRSD 1F4WH 3KR3L 2DRUA 4MQXD 3SDXF 1GZQA 5GGUB 5EFIB 1I1RA 5DRZA 1TJGL 3OR6A 3QNXB 2DKSA 3VFRB 4H25B 5I8EB 5EU3A 4DGVL 3REVB 3WLWD 5BVPL 4PUBH 4YDLB 3MV7D 4NZDA 1BIIA 1R6VA 2D7TH 1U3YA 2IADB 5L0QB 1D5IH 5ADOL 5SX4H 3IU3A 1CXFA 2GAZA 3S8WA 5DA4A 4YZFE 1RMFL 2EXWD 5T3ZL 3TO2B 2HKHL 4J8RA 3GSVB 2XKNB 3GJFB 2H41A 1FAIH 5T5NF 4Z7WF 1C16B 3O0RH 1HKLH 2VZTA 3VXPB 5EWIH 1KB9K 3DGGB 5A43C 5DJYB 4K9EC 5SWSD 4AQ1B 4EIGB 2UUDH 3BN3B 5IJVA 2DLFL 2NY5L 3LN5A 3P9WB 5IVOA 1G6VK 4M7LT 2OZ4L 2GY7B 1CICB 2RBLA 1Z0NA 4OQTA 2ZP0T 1S3KL 3MCG1 1NQBA 2CRIA 4QF1A 1EIBA 1MHEB 4PJ9D 3GIVA 4M6MH 1T0MA 2MJWA 5KN5A 1HK6A 3MO1B 3KPSB 5JW3H 5DC9B 4JFFA 1RK0B 3T77B 2F74B 3KXFD 3LV3A 4A6YH 4NRZB 3TVMA 1KB5B 2IPTL 1VEPA 2CDGA 1RD6A 2CH8A 1ZHLB 3OXRA 4D9RE 4QRQA 1I85C 1REIA 4MD4B 3CSPA 2PNDA 1YPZE 4FZ8H 3UX9B 3M17A 3QXDB 3GSNH 2R39A 3MRGB 4ZO8A 2PXYD 3OKDB 1ROWA 2WW8A 3QWQB 5DMGD 5JR1H 5DTFA 1VDGA 5DWUH 1BZ7A 4Z7VB 4FQLH 3V2AR 1EEZB 2QQKL 5HHXL 5GZOC 2WWMC 1W0WA 4JFHD 2OCFD 4PP2A 1U92B 5ALCL 3QO1B 3EKCA 3PL6D 3QDMA 4I2XB 1DE4A 2YSSB 2DICA 3TBVB 3D0VA 4XNUH 5IBTL 3VXQA 1L4IA 4M1GL 3QIUD 1F02I 4YXLL 1B4JH 3VRLE 2C3WA 4N1CA 1ZV5A 2DTML 3RVUC 3SQBA 2FJHA 3MLWH 2GSIB 3WFDL 1CK0L 3H0TA 1S7XA 5GRUL 4CMMA 4WY7L 1AO7A 4U1LA 2O26U 5JPNB 5DFVD 2BNRA 5IOPA 2VLJB 3RNKA 5I16B 2VLRB 3JTTA 1JNNL 1LD9B 4UINH 2NY0C 1UM4H 4ODUB 3PP3K 4YXHH 1FZOB 5F7LB 3HRPA 3W39A 3EO0A 2F53D 3FHAA 3VFGL 4HT1H 1JWSA 3L5IA 2IQ9H 4KK8D 3AB0B 4JG1L 4JRXE 3HZMB 3G5VA 1I9RH 1V3LA 3BT2L 4W4NA 1JBJA 4F7TA 2HMID 1M71B 4YHIA 1JHLH 5CGTA 5B8CA 3HI1B 1NFIA 4GMTL 3O6FA 3OJMB 4X6FB 5A2LH 1RJZB 5FUOH 4WNQA 3L9RB 3TBTA 2EKJA 2OBGA 5IEKA 3BH9A 4JQVC 1B0GA 3KPNB 5I66B 4KJPC 5C0NC 4JRXD 3QPQC 5E9DE 2D0HA 4IDLA 5E5MA 3V4UH 5EUOF 5C0DA 5IVXA 3CUPB 4JFZL 1NL0L 2CO7B 4HHAA 5CJBA 3WJLC 5CLTA 2BVPA 1KT2A 3BPLC 4ZUWA 3GRWA 3SBWA 2EDXA 4QRPD 1KCVH 2HTKD 3C8KA 3ESVF 4P0DA 2OM5A 5ITBL 3QFJA 4P2QD 5K9KA 2LVCA 5HDQL 3BFOA 3OQ3B 4OF5A 3EDJA 3ARBB 4YLQT 1GGBL 4JRWA 4PFEA 3S37L 5IF0B 5F72S 4KGLA 3HTLX 3EOYG 3EHBC 4KK5C 4I2XE 2QADC 5KANG 1BVLB 3NCJL 1NMCB 3GSXA 4ZNCD 4X9FA 3PGCB 4LSVL 2X7LB 3IU4H 2WP3T 4P23C 2YD7A 5D6DC 1QBLL 3ZKMD 4GW1A 1RIVH 3NACH 1E6JL 1Q9LB 1ZA3B 3VFPA 3LD8C 4GW5B 1OAQH 2EIEA 2BSTB 2NCMA 1A7BA 3LRHA 3HPLA 1IE5A 5D1ZD 3U9PH 1A6UH 2BNQD 2W9DH 2WMPA 3TO4A 1Q72L 3TV3H 4P2CG 4RGNC 1NBVH 5HHOA 2ZUVA 1S9XB 4Y5VA 2WQ8A 1IC5L 4H8WH 1L0XA 3QRGL 2BDNL 2LTQB 4Y16A 3QDGA 4ZFFB 4DQOH 4PTUB 4TSAL 1DLFL 4G43B 5KVEH 1R3IL 4WFEE 3BMVA 1PKQE 4QT5A 3VXTB 5EBLA 4OFDA 3GI9L 3PP3H 1TCRA 3QCTL 5IMMB 4FG6D 4NNYA 5T1DL 2JB6A 1TQBC 2ICWJ 3PNWA 5DEGB 5EN2A 4LEOB 5IMOA 5AD0A 2GK0B 1FNEA 4L3ED 3JVGC 1HI6A 3VMOA 5D8JL 3SCMD 3THMH 3ELAT 1DTUA 1HOCB 2C4FU 3BQUB 4UOJA 3RUGA 4TULL 3CCHA 3A6CH 4ORGA 1KEGL 1CI5A 3P4OA 4PJBB 2IALB 2R4SL 3CDFA 4AM0A 5C6TL 4WTZA 2J88H 1ORSB 3OMZA 3P4MA 2X2YA 1U3HC 1ZS8B 2UYLB 5GSRA 5FYJH 4GKZB 4P46C 4IRSA 3OKKB 3LSOA 5ECJE 3VA6A 1E4XI 2A9NL 3BVNB 5GRXG 1V7NL 1RI8A 1SBSL 3EOTL 4YHOH 2VXTH 4FFVC 3TYGL 3OX8B 3GNMH 5HGDA 3MV7A 1JL8A 1UWGH 2VN7A 4WI6A 2VAAB 2J5LC 1VFOA 2VQ1B 4WDIB 3T8XA 1NDGB 2EO1A 1U8HB 1JGUH 3U9UA 4TUJB 2FATL 2OR9L 4LASH 4PJ5E 4RGOH 3U36B 1AE6H 1UGNA 2G9HA 1G7HB 2W38A 2R15A 3D85B 5IROA 1I8MB 3MACL 5SWSA 3VFTB 5DURB 3MRBA 3DURA 3T3MF 4RMVA 1NGZB 3MRRB 2CK0H 4NBZB 1HILB 3PABB 5I1KL 4OJFH 5CSZA 5DD6A 5CILL 4HWEH 4N1HB 1JPFB 4PJ9A 2PTTB 2A73B 4QXWA 4K8RC 1A7PH 1BGXH 1DQLH 4XPBH 3KXFA 1AD0A 4JN2A 3UBXI 5I1IL 4PGEA 1TXKA 1V3KA 3Q5TA 3DVGB 2H2SC 1XIWA 2FR4A 1HIMH 2FH8A 3EOBB 4S1QH 2AJSH 4QRSA 4FFZH 2ADIA 3DHJA 1QLFA 2XZZA 5DJZA 1VFAA 4KZDL 3BI9X 2JF1A 4O02L 5C0JA 4NDMB 3DLQR 4L1HA 3RTQD 1SBBA 3W9EA 4ERSL 1BJMA 4DEPC 5I30L 1LNUB 3TN0B 4ZFZB 1ZLWK 1FG2A 3VGAB 3CSGA 3WS6C 4JREC 4HIIB 3OSKA 3PHQA 5E0QA 3V0WL 2DD8H 3G5XB 4HKZB 5F88B 1G7LB 3LKQB 4Z7VF 4HWBA 5A2KH 4LLUA 5AUMB 2FZ3B 3QCUH 1KLUA 4LPYA 4NM4H 4G42A 3IFNH 3MGAA 2BOBA 4OCSH 3ULUE 2WBKA 3UAJD 1A6VL 4ODSL 2Q7YA 3PL6A 4WV1B 5DFTA 3TT1L 3RVUD 3J8F7 3ZKND 2W59A 4FTVE 5KBNC 4H1LA 1Z9MA 3QIUA 1FVEA 1XGTA 1U8MA 3PDOA 1MIEL 4PJAB 4NWUH 1IQWL 2DQCL 1OP5K 4XNXH 3RWJA 1TQBB 2RR3A 2X1PA 2ICCA 3ULUD 5SV3A 2NXZD 4HEME 4CNIB 1I3GL 4APQA 4G80B 1HZHL 2DWDB 4N0FA 5J6HA 1WCBA 1P84J 3SGEI 1A0QH 3CLEL 4NUJB 1BAFL 2F54D 4KI5F 4LNRB 4JZNA 1EGJH 4RAUA 1J8HD 1HDMA 1I7TB 4KXZH 4LSTL 5CEXB 2EDBA 4LLWA 1IGMH 4IEFB 2Y4SA 3GBNL 1IGCL 2F53A 4GAGL 2XQBH 3C8DA 4F33B 4M7JH 3DV6B 3WHXA 5I75C 4QLRA 5EZLA 1CGSH 4PRBA 4N68A 3WD5L 4JN1L 3FB7A 2ED8A 2H1PH 4JFPA 2UY6A 4N5UA 1ETZB 4PIRF 4JKPL 2Q8BL 4LQFH 4ZXBD 5GRZA 3MRPA 1VEOA 2V2XB 3QULB 1PGRB 2ATKA 3V5KB 5HHMB 3QSKB 3TESA 3ARVA 4XC3H 1CXIA 1AR1D 4JKWA 1IL1A 3OKOB 4X4XA 5KSBB 1MWAH 5EOQL 3H3PL 3L3KA 4D8PB 1P4LB 2APWA 4C58B 1ZSDB 4KRPB 3TIDB 1U6AL 3O6LH 3PWUB 3CH8A 3TM6A 1EHAA 1WEJL 1TETH 5MERB 5IHUH 4Z76B 4XPGH 3IGAB 4PJFE 2A38A 2H6PA 1KN2H 2EEAA 5EB9A 1BFVH 2J5LB 4C59B 3C8HA 1R24A 5TE6L 3BAEL 2VDMH 1P4IH 5F89A 2JCCA 4JM2B 4L9LA 2BVUA 2ZPKH 3PDDA 4QRPA 1NBZA 3GMPB 3OR7A 1FVCB 3EO1A 4P2QA 4ZS6D 3V0VA 1QVOA 5KVFL 1J5OL 2Z91A 2DKMA 3ZT6A 4JFDD 4PJ8D 4OD2A 5DJ2A 2CK2A 1A7QH 1ZLWH 3B9KB 2J8UB 3P30H 5HI3C 3OKLA 1JNLH 2RFXA 1HH9B 2O5XL 3CDGA 5IESL 5E8OA 3MLXH 1U8JA 4RGNE 1T7VA 5GGSB 3PHOA 2P5EE 5E6ID 1R0AL 2OS7A 3N85H 2A6JB 2R0LL 3LQAC 1HNFA 4XP1L 4RFNB 3MRDA 1P53A 3BN9C 3UO1H 4F7CB 2OTWB 1BQLL 3MLRH 4BQ9A 4I0CC 3UC0L 1FO0L 2LAGB 5DMIH 1JZ3A 2O5YH 4PJAE 4NHCH 3VWJB 1QBBA 5I8KH 4OM0L 1N59B 1EJOL 5EZIH 2CR3A 4NWTL 3C6LD 3P11H 4RGND 5GJSL 3WEXA 2P5ED 1MEXH 4BZ1H 2BNQA 3FO0H 3L3DA 1AJ7H 4KUZH 1OP5H 5T1KD 2CLRA 5I17A 2DQTL 1GGTA 3MUGA 5AZ2L 1P7KA 5DRWB 1FBIH 4RA0C 5IHLB 1MFDL 2QV2A 3V6FA 3LRSB 3ZTNL 3WDIA 4OLUH 2JB5L 1JPGA 4G6MH 1GZQB 3CVHH 5DRZB 3M45A 3OR6B 3VD5A 5KZCD 2D03L 5DQDL 2H3NA 4LIQH 4AEEA 2VABB 1BIIB 3FJTA 5KAQF 5FYLL 4XP6H 5DRNA 2W9EL 4L4JA 1FLTX 4L3EA 5E00A 4NO3A 3L3HA 2GAZB 1CZ8H 3SCMA 1PX3A 5HHME 5C0GA 3KPLA 4YIQA 4GLRH 4I8DA 4Y4HC 4EBQL 1NEUA 3B9AA 1NMBL 2OL3H 4P59L 4XBPA 2AJVH 1CLOL 2EDOA 4PJBF 1BFSA 2NYYD 2ZUYA 1HNGA 1OAXL 4N0UE 1FDLL 4N1EA 3RJQB 5IJVB 5LGHH 5ANMA 5CJQL 3LN5B 2DIJA 5B39G 2AJ3A 1BFTA 3SKMA 2WSKA 2PYEE 4LVHB 3O6MH 4W6XB 4IMKC 3DOSA 5AYUL 3LHPL 1N64H 3GIVB 4XTRC 5I1JH 1T0MB 5KN5B 4FFVD 3EJZD 3B4NA 1IKNC 3BXNA 4JFFB 3LV3B 4RZCA 3TVMB 1G9MC 4WIQA 2CDGB 3HMXA 5HJ3A 3F7YA 4K71B 4J7RA 5CEZE 3OXRB 4ZODA 4QRQB 2XN9D 5ILTL 1HCVA 4ZOAA 4Y5YA 5GZNC 3H9ZA 4GMSH 3K3QA 1YECL 5HPOA 3M17B 4ZDHA 3WFZA 5E8NA 4KY1H 2YS4A 2D4DA 5EU4A 5CCKL 1JF1A 3V6OC 1BZ7B 1E4WL 1HWGB 4KTYA 2GSGA 4R8WH 1YDPA 3CLFL 1YNLL 1W0WB 3MODH 3W11D 4PP2B 1YEFL 4FQ1L 3QDMB 1DE4B 2PR4H 4UBDD 3D0VB 3VXQB 4QRRE 3MJ8A 4YUEL 4KHTL 2DB8A 4JGUA 4Z5RA 1J0YA 3A67H 5EORL 2FJHB 2YRZA 2BSED 4OLYL 4RWYL 2X4SA 3H0TB 1DL7H 1S7XB 3BJ91 4CMMB 3F58L 3DX6B 3TA3D 3WFCL 1AO7B 2BVEA 5E2UH 2OZ4A 3O41A <