1S7WB

Crystal structures of the murine class i major histocompatibility complex h-2db in complex with lcmv-derived gp33 index peptide and three of its escape variants
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 class I histocompatibility antigen, D-B alpha chain
publication title Determination of structural principles underlying three different modes of lymphocytic choriomeningitis virus escape from CTL recognition.
pubmed rcsb
source organism Mus musculus
total genus 13
structure length 98
sequence length 98
chains with identical sequence E, H, K
ec nomenclature
pdb deposition date 2004-01-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1s7wB00
4JFEE 1ERNA 5IBUB 4R8WH 4RGOH 5IQ9A 2AEPH 3S6CA 3KAAA 4PJ8B 1DQJA 5KSBA 2IJ0C 3MRJA 3K7UA 5DFTA 4QRQB 1XGRA 4MJ5B 5LG1A 2DQJL 3HI5L 1WWCA 2DQUH 4OLEA 4QT5B 3DX8A 5D6CB 4AQ1B 3BE1H 5C0AB 4PJBF 1CDGA 1Y0LB 4MMZC 3U4BH 3GJEB 4D0CA 5A40E 1S9VA 2P5EE 1YPZE 5JW4Q 1AP2A 1RUML 5F93C 3KPRE 3U7YH 4KDVA 2PW1A 1NUFA 1RUQL 3HAEB 1V7NL 5J13C 4D3CL 1KULA 2DYPB 4Z78B 5BV7H 4LHUD 4E41D 5L2KE 2HTLD 2KDGA 4PJ5B 5EPMA 4TULL 2ICES 4OGAD 4I18C 2BVQB 5C0BB 2WQ8A 3MUY1 2CDGA 3L7EB 2FIKB 5D2LE 1CFTB 5IVXF 4M7JL 4BFBD 1CFSB 3RVXC 4X9IA 1NFIA 4KHTH 1F6FB 4BH7A 2QEJA 4LPVA 4O02H 2X4QB 3OKMB 3CVIH 4AT6B 4DN4H 2W65A 3HS0B 2BOBB 4P46D 4N0YL 3QNZA 5KVFH 1IGJB 1CGVA 5KVEL 3ULUD 3PGCA 1D5BA 1YNLL 4JO3H 1T20A 3JV4B 2O5YL 1KPVA 1WVZA 4QTHB 2HLAA 5FA3A 4Z7WE 1P4LB 4UINH 3VD5A 2W0LA 3VFVB 3BYTA 5C09B 1NCAH 1P4IH 2CMRL 3GGWB 3ARDC 4X7FC 4F15C 1ONQA 3E6FA 1KJMB 1AQKH 4YZFE 4M48L 1EAPA 4R8WL 2CIKB 4RGOL 2HFFA 1ZA6A 2AEPL 4PGDA 4JKKA 5C6PB 1AGBB 1O7VA 1T89A 3U0PB 4I3SL 3DURA 4N0UA 2DQUL 4S0SD 3O9WA 3BE1L 3SJVE 4BH8A 1XMWA 5DJYB 1Q1JH 5EH1A 1NH6A 4OB5H 4U1NA 3KYMB 3AS2A 4LVNC 3Q5OA 3U4BL 2YUXA 1I4FA 4J6RH 4JZOB 5TDPA 4JGMA 5IHZA 1RZ8A 3FB5A 3UPCA 1Q94A 1VB9A 4L3CB 3U7YL 3GSNA 4WFEE 1WFOA 1G7PA 5KAQF 5ADOL 3KPPA 1FL6A 2X4TB 3D85D 4YHLH 1ETZB 1LO3H 5F7WC 5BV7L 5GGRA 1DQLH 1NGXA 3MCLH 3DRQB 1NL0H 2FLBT 1OP3H 4WVRA 3MV8D 2NW2A 4U7KA 4HUWB 5B39B 1MH5B 1V7MH 4HKBA 4F9PA 3ULVH 1IAII 1S9XB 1QQDB 4KHTL 4O02L 4H5SA 4DN4L 1VGKB 3O41B 2G2RB 5DA4A 1S7QA 5J06A 5KVFL 3NPSB 4WNQA 3RVWD 3QEQE 1WCBA 3NN8B 2HFEA 2ZUSA 5HTSA 1P7KB 1OTTD 4JO3L 5E8NB 3ALPA 5DMGC 2YWZA 3AXLB 1VA9A 3BMVA 3T2QA 1EHXA 1REIA 2XWTB 3BFOA 4G8GB 1UGNA 4UINL 5DD6A 1NCAL 1P4IL 4POUB 1OF2B 3MUGA 5F3HB 1AXSA 1AQKL 1JF6A 3ZLQC 3LEXB 5I30H 4GKZA 5B4MC 5C0IA 1CFVH 4LLVA 5JW5B 3DMMB 2DWDB 2IADA 4LCIH 3S98A 3HNTH 4YHIB 1FSKC 1WFTA 5L0QC 3OMZA 4HWNA 4HPOH 2PYFA 2IF7A 1Z9MA 3TO2A 4G9DA 1OCWL 3QPQC 3QUXD 2OI9B 4OZIA 5HI3D 3V4UH 4UT7H 4WFFE 1Q1JL 4I0KA 4PJBB 3OB8A 3X11A 4X6DF 1MCRA 4OB5L 4DEPB 1U6AH 1WQVT 3MLUH 5HBBA 4ZSOA 3O6FB 4JRXD 2PTUA 4J6RL 1G0YR 4MYWB 5GJSH 1NANH 3UTSA 3P4MA 3PL6C 5F44A 1YNKH 2BCKA 4NYLA 1AXIB 1H8NA 4H0IA 3K8LA 4L8DA 1WZMA 5HHVH 4JLRA 4YHLL 5K59E 5J3HC 1LO3L 4OV5B 3REVA 3JWDH 1DQLL 1MQ8A 3MCLL 1QFWH 1B0RB 1NL0L 5FIEA 4WY7H 3ZSTA 5FXCH 5FYJE 3R8QA 4DZBA 1LO4H 4PJ8A 1LP9E 1P1ZA 2NY3D 4QRQA 3V4VH 5IVXB 1V7ML 3ULVL 4QT5A 3MR9B 5D6CA 2PO6C 1K6QL 4OLYH 5C0AA 3L3JB 5HI4C 1Y0LA 5F7YC 4IOFD 4Y1AD 1W0YT 3V6FB 3GJEA 1OTUC 2P8LA 4M7ZC 1BJ8A 3PWUA 4JEGB 2C5DC 1CFQB 3HAEA 4NCC1 2Y6SC 3QIUC 4OCRH 2DYPA 2XRAH 5FDYA 4Z78A 3RHWK 4KUCD 3OKNB 5SWZD 3D85B 1UACH 2B4CH 4ISVB 3IKKA 3EKCA 3SHSA 3KLHD 3D0LB 2ED8A 5C0BA 2NTFB 3DUSB 3RKPA 3L7EA 2FIKA 3SO3B 2YC1B 5HYEA 1CFSA 4W4NA 1CFVL 3QEUB 2XZQH 4LCIL 4BSJA 1XGYH 1FZJB 5DHXB 2X4QA 3B43A 3VA2C 4F8TA 4HPOL 1I8KB 3HS0A 2BY0A 4MA7H 3C08H 5KOVC 2A6DB 4Y88A 3V4UL 4UT7L 4UOJA 5B3JE 5HDOA 2CRIA 1U6AL 3MLUL 4U3XA 4NQXB 3JV4A 4LCWE 1HI6B 2CDFB 2ATKB 2E7CA 3GSXB 3QEGH 4HKZB 5GJSL 4QTHA 4F7CA 4Y16D 1YNKL 2XY2A 1GC1C 1P4LA 3VFPB 3VFVA 3FRPA 3KLDA 3GGWA 1BD2D 4UAOB 1N4XH 5HHVL 2ZZUT 1E6OH 3Q5YA 4EDXB 1KJMA 2HG5B 5GSVB 3NIGF 1JIBA 1QFWL 5DJ2B 5F6IB 2EZ0D 4WY7L 2FCBA 4HLJA 5CEZL 5E4EC 1AGBA 3T77B 2JIXD 1LO4L 2P45B 3V4VL 4JPVH 4OLYL 4YBQC 3QI9C 3QWRA 4JFDA 3TZVD 3CDCA 2I25N 3VE0B 5I9QB 2CD0A 4KRPC 4Y19E 4JZOA 1O5DT 2J5LB 4FQ2H 2R0WH 2QSQA 1J5OL 4P23C 4L3CA 3CSGA 2WBJD 2ID5A 3EDKA 5JA8B 3HC4H 3MLSH 4HZAA 2X4TA 2VNCA 1ETZA 4OCRL 2XRAL 2VE6B 4PRIE 5CWSB 2W0KA 3WXWH 2CGRH 3DRQA 1UACL 2B4CL 5F70A 1HHIB 4HUWA 5B39A 4X4MA 4QXTB 2EIZB 4PJAE 1S9XA 1KLFA 2XZQL 1T66C 3B2UD 5JW4M 4JFFD 2CO6B 5GXBB 4N9GB 1VGKA 4Q6YA 1WCQA 1U95B 2G2RA 2VTFA 3C08L 3O41A 4MA7L 5IW6B 2R1YB 4KKLD 1L7IH 5FCUH 5D96C 5IBUG 1JCKA 1P7KA 3L1OH 3ZE0F 2B5IB 4X6DB 5INDB 1GCFA 3AXLA 5DMIH 3QDHA 1EBAA 3NZ8B 2YPLB 3QEGL 3BO8A 2XFXB 3W11C 4NNXB 5MEND 4G8GA 4G9FE 2DBLL 3AREB 2V5SA 3I6LE 3QUKA 4JVPA 1N4XL 1MCBA 4PJDE 4YGVB 2ARJA 1OF2A 4K7PH 1E6OL 4WW2C 2AK4D 5F3HA 4NO0B 5DUBB 3NCMA 5ETUB 1NLDH 4O2FB 3TIEA 2ADIA 1IL1B 4TVPD 5JW5A 2DWDA 5DMKB 4U3CA 4YHIA 1M71B 5TF1L 1HOCB 5FUCE 1QHOA 1A1OB 4V2BA 4JPVL 4NQCB 1KTKE 3ZHDA 3I9GH 3Q6FA 3TVMD 4DW2H 4P9MH 5DA0B 2MCG1 2ICWB 5IR1A 4F33B 3PUCA 3MBXH 4RBPH 1S5IH 1U3HD 1JHTB 4EN3D 5C0JB 5IHBA 1S7SB 4LKXA 5HHNB 2CDEB 2B20A 2ZPKH 4FQ2L 2DQFA 1NC4D 2R0WL 3WNNA 4PLNC 2NXYD 4CL7A 1TFHA 3MTRA 4KQ3L 1LEIB 4UIKH 1Q9OB 3ROOB 3OQ3B 2R2HB 1HEZB 3HC4L 2X89A 4M8QA 3MLSL 3E2HC 3F7RA 4X7DC 3P4OB 1BJ1H 4OV5A 2FLRT 3QUYA 1P84J 1EEZB 2CGRL 4OSUH 3DTXB 3D0VB 4PBXA 1CDYA 4U1IB 5HHOD 4PJIE 3R0MA 1G6RH 2FHBA 1T0NB 5GS0D 5GGQH 5IVXA 1J0KA 3MLVH 3MR9A 2ADGB 3LRHA 5CEYA 3L3JA 3K1DA 1S9KC 2Y36H 4U1JA 1OSZB 2NX5D 4CVWA 2Q7NA 3QFJB 1DUYB 1J8HD 3S3JA 2V2WA 3MJ8B 1L7IL 5FCUL 1D3CA 1VFOA 2PN5A 3LS5H 5DGRA 3TO4D 2OR8A 1U93B 1JPST 3L1OL 4OZHA 2EYRA 4NUGH 4Z77B 5DMIL 1HXMA 5IB5B 1LDPH 5K93A 1CFQA 1TIUA 2VL4A 2HN7B 4XWOD 4P9HH 5F7HA 4OF0A 1IKNA 2C3VB 5IBLC 1BFSA 4ZUWA 4XNMB 1NMCB 3QR2A 3MRRB 4ISVA 4K7PL 5C0ND 3S35H 3D0LA 5CS7A 2NTFA 2VZUA 2VZSA 1T5WB 3WJJA 3QNXA 3DUSA 1MAJA 5CGTA 1NLDL 3EYVB 3TLRA 2YC1A 3QEUA 1OY3B 1U8JA 1BJMA 1NCUA 2YD3A 1LHZA 1FZJA 5DD3H 2YZ8A 4M1GH 5B38B 2YSSB 4YJZL 1I8KA 3ARBC 2HKHH 1BVZA 1TZGH 4TTDC 2A6DA 3I9GL 2IAND 1CG9B 4QWWD 4DW2L 3QIWD 4P9ML 2X1PA 4K55A 4LVOB 3MBXL 1DP0A 2F54D 1HH6B 3KHOA 1F42A 1K5NB 1S5IL 4NQXA 1CIUA 1HI6A 2CDFA 2ATKA 3GSXA 4HKZA 5B39G 4UTBH 2ZPKL 5IT2H 5CP7B 3VFPA 2CXGA 2LFGA 3BIBX 3AB0C 3WLWC 3BN3B 4EDXA 3K3QA 1NAKH 1BLNB 2HG5A 5GRVL 1T0PB 4OSUL 4L8SB 1U8IB 2R15A 4NFBA 2C4FT 1G6RL 2NW3B 1UWEH 3ARGC 5ADPH 2FNBA 4CJ1A 4RFNB 4J3OC 5GGQL 3MLVL 3GSQB 2BMKB 1OWRM 2CK0H 1IARB 3VE0A 1N59B 2AV7B 2Y36L 4X8JB 2VR4A 4LHUG 2E8ZA 3KJ4C 4HBCH 4JY5H 2EC8A 3AROA 3FFCE 3LS5L 1FYHB 2FECL 1C5DB 3DVFA 4NUGL 1Q0XH 2MNUA 1JUFB 3W9DB 4OGZA 1LDPL 4F7TA 4Y4KD 3ARFC 4GG6F 4DVRH 4FA8A 4P9HL 3EYQC 5BV7C 1MUJA 1SBBA 3LB6C 5EU4A 5T3XD 3BX7C 5EO0B 5BXFB 2HKFH 5CD5C 2NMSA 3E0GA 4HUMB 2EE2A 5EU7C 5E7FA 4LP4A 2C9AA 1N3NB 5CJXA 5D7IE 1B0GB 1A6PA 2G5RA 5DD3L 4M1GL 5FYLD 2VKWA 1G7LB 4LLUB 1YUHA 1SM3H 2D4DA 1IAIH 3BQUB 2HKHL 4GW5A 5IW6A 1TZGL 4FNLL 2R1YA 1QSFA 3I6KB 3RHWF 3PABB 4EUPH 3BIKB 1I9IH 4UU9B 1N8ZB 4X6DA 3DI2B 3DUUB 4HIEA 5INDA 4WW1A 3I3BA 4Z7VA 2GYSA 2YPLA 1FNLA 4UTBL 2XFXA 1S9YB 5IT2L 4NNXA 5INCB 1J88A 4GUPA 4UBDD 3HI1B 3AREA 4M61B 4O00A 4I13B 3VWJB 1I85A 2ZSWA 4RZCB 4TNVK 2VLME 1PLGH 1ZLWK 1BZ7B 5ANMB 1NAKL 4S10A 5DJXB 4XWGH 5DUBA 1A7QH 2FGWH 3D39B 4JFQB 3LKQB 4O2FA 2C3XA 5DMKA 4QRPE 1UWEL 2FBOJ 5ADPL 3N50A 1NGYB 4RMVA 1HOCA 4RAUB 1A1OA 2D7PA 4NQCA 4CDHA 3Q3GB 2CK0L 1YY9C 3ALWA 1HSAA 1YDPB 4HBCL 3R4DA 4JY5L 5IEHA 3W9EA 4F33A 3BD3A 5IIEB 4FTVB 3LDBB 1JHTA 3HMWH 3DETD 5HHNA 1VHPA 4R97C 3PWNA 3VFNA 1Q0XL 2XTJC 4OCYH 1LEIA 4M1DH 1KIUA 3ROOA 4QRRE 3QXDA 4EBQH 2R2HA 2V5TA 4DVRL 1UH2A 2XXMB 2OL3H 3P4OA 2BJMH 2N4IA 1QRND 2YHGA 3NIDE 5KVDH 3D0VA 4NKDB 4U1IA 5J57B 2HKFL 2F15A 1CD9B 1T0NA 2XY1A 4MQSB 3K1KC 1HILB 4U49A 3MYJB 5FA4B 3OV6A 4JN1H 3TC9A 3ULVC 5DYOB 2N7AA 4QLRA 4EOWL 1SM3L 4YDLC 1DANT 1IAIL 1OSZA 5T3ZE 3S37H 3QFJA 1DUYA 3QXTA 4XX1E 3MJ8A 5C0GA 1EO5A 5ITFB 1S7WB 4OTXH 3O3AB 2CR6A 4Z77A 1YY8A 5IB5A 1B6UA 4MS8C 2R0ZH 4K07A 2HN7A 5T5FH 2C3VA 4MNQE 2XQYG 3MREA 4XNMA 4LGPB 4X9FA 1UXWB 3MRRA 1OLLA 1CD1B 5AG9A 3PWLB 5GIRA 1DBMH 1T5WA 4XWGL 3ZHKA 1A7QL 2FGWL 5J11C 3EYVA 4BELD 2UY7A 3KS0H 5CKAA 4OUUA 4JGUA 5IMOB 5B38A 5K9KA 2YSSA 2AQ2A 4D0BB 4GBXB 3VGHA 3EJJX 4KJPC 3VXSE 3TN0A 1KIRB 2Z4QB 1PJ9A 4HV8A 1WT5A 1AO7B 1CG9A 1MCSA 4ENED 1K4DB 4NBXB 3QXWA 4OLWH 1ACZA 1I7RB 2W9LA 1HH6A 2V9QA 4LPYA 1K5NA 2F9BT 3HMWL 5D8JH 2AXFB 4I0PC 1F45A 3FO9B 2XACC 4HHAB 4ZUVB 2EC9T 3BPLC 5C7XH 4OCYL 1NUGA 4M1DL 3UZQA 5DUPL 1GYAA 1HK6A 2HAZA 2X7LB 3TJHC 2OL3L 1I7ZB 1XAUA 2BJML 3CX2A 3JWDC 5KVDL 1U8IA 4M93B 4JHZA 1RULH 4NFCA 5FB8A 4A6YB 4JN1L 3SE3C 3VG9B 3M1BB 4OLXH 4HK0B 5GRUH 4G6MH 4YK4B 2XV6B 5I16B 4CBPA 1D5MB 1N59A 4N8PA 2AV7A 4X8JA 4J4PD 3S37L 5MEOB 3W0WE 3N1FC 1A22B 5I74B 5ID1A 3EJYC 4BQBA 4X4YA 3RVVC 2IAMC 1C5DA 4P4KD 4D9QD 3FJTA 3BXNB 1JUFA 3W9DA 1JZ4A 2R0ZL 4O58H 4YXHH 2V5MA 3IDYC 3JWOL 2HT4C 2Q8AH 5T5FL 1N6UA 5F9DC 2X4OB 4KI1A 35C8H 1LO5B 4PRDB 2F5BL 1MI5E 2P46B 1AJ7H 3OKOB 4KI5F 5CMAB 2OZ4H 2B4CC 1QRNB 1O0VA 2NY2B 4MGXA 2X4RB 4IOIB 4S1DC 2VERN 3MRCB 3H9SA 4WENB 1JWMA 1N3NA 1TZHB 5CBEA 1B0GA 1N2RB 3DVNB 3W39A 2ILLA 1G7LA 3S5LG 4LLUA 3KPOA 3GSNH 1K9TA 4ACPA 3BQUA 2EXWD 1JRHH 3T0ED 3I6KA 3LH2H 3PABA 4HULB 3VXMB 1OW0A 3L6FA 4OLWL 3BIKA 1N8ZA 5D2NB 2VN4A 3DUUA 3L9RB 4GS7B 2VC2H 5LBSH 5ACLA 5HD8C 4BA8A 5D8JL 4LAJH 5IHUH 1S9YA 1SEQH 5INCA 3HC0B 3HI1A 5C7XL 1A21A 4M61A 1NGWB 3RGVB 3RQ3A 4OF6A 3MRNB 4RZCA 2J6EH 5LAXB 1CFBA 1BF8A 1GH7A 5ANMA 2PYED 1X5YA 5A43C 5H37G 4Y5XA 4DN3H 2DQTH 3LKQA 3WNOA 4MJID 4HX1B 3B5GA 1RULL 4LSRH 5D5ME 1NGYA 4JO1H 2JKXA 4RAUA 5BS0D 5DEGB 2VLKE 4OLXL 4GRMB 5GRUL 2EDHA 3BOVA 4G6ML 2ADFL 3HE7B 3Q3GA 3WDJA 2W9EH 5K9OA 5IIEA 1CDUA 5HPMB 4OI9A 4FTVA 1W0WB 4WWKA 3PG2A 1Q9KB 2X4UB 1D5XA 4I9WE 4YUEH 1C12A 2XKNA 3CH1A 5TFSL 3UYPA 1UH4A 4O58L 4YXHL 3WCYA 4M62H 3WS6A 2Q8AL 4C4KO 5HI5D 5JNYB 1DE4A 3X13A 1T04B 4X5XA 4RA0C 5DUMH 4C56E 2ENYA 3DUHA 1AJ7L 2ICWI 1T2XA 2JF1A 3D9AH 2OZ4L 4NKDA 1FLRH 2YPKA 4TUOB 5F9OH 1MRCH 1SYSB 1HILA 5E99H 5FK9B 1JGDB 3MYJA 4Z5RB 4R7NA 5DYOA 3ZTJG 3D3VA 3ESUF 3K2UH 1QBAA 5D7LD 1PZUB 3GSNL 3B6SA 1JRHL 4PR5A 3WIHA 1FZOB 3LH2L 1VPOH 1DEEB 5GGUB 4D9RE 1FDLH 5D4QA 5ITFA 2JJVA 4ZAKC 3G6JF 4N1CA 1S78C 3O3AA 4N90E 5LBSL 1I1AC 2VC2L 1KN4H 4GKOA 4NKOB 3RWHB 2QL1A 5IHUL 4R0LC 4P4KB 3BH9B 1SEQL 4NRZB 1BGXH 2JCCE 4BSVB 3MPCA 2PW2B 4P57B 1HNGA 2GT9A 4LCUB 1UXWA 2J6EL 2E27H 4D8PB 1CD1A 4KDWA 3QIBA 5C08A 1IGMH 3QWRD 4YHNA 1LE5B 3G5YB 3VXTA 3PP4H 1DVFD 4DN3L 2DQTL 3QRGH 1G1CA 5E2WH 1ULVA 5CAYB 1FFNB 2D31B 1SJHA 4G80A 2DAVA 2WWKO 4LSRL 5E6ID 1P7HL 5IMOA 15C8H 3WFZA 4JO1L 4D0BA 5IM7B 1RHFA 2YWYA 1GGUA 4GBXA 4GRWF 4NC2B 1KIRA 3HAEH 1AO7A 5A2IH 4FS0A 3DIFB 4YHMH 4EI5B 1UM5H 1UM6H 2W9EL 5T1KA 3VGBA 1I7RA 3BHBB 2NXZB 4TNVF 3VFWB 5FYKD 1CICC 1S8DB 1Y18B 3PQYD 4RGMB 4IJ3B 4HEPG 3BESR 4HGMA 3FO9A 1NCTA 2E6PA 2VDQH 4ZUVA 4HHAA 3ZKQD 3UTTD 3REWB 3CUPB 4K3HA 5KSVB 4JQVA 4M62L 3DHMA 1VEMA 4NHCH 1QD0A 2X7LA 5JW4N 1MEXH 2W07A 1I7ZA 4XPHH 1EJ6A 2NQCA 3RNQA 1FHGA 3P73B 5DJ8A 4LLDB 3VFUB 3D9AL 3T0BA 3UPRB 2R2BB 1FLRL 1DBBH 3G08B 3RTQA 4L4VB 1AQDB 1OARH 4M7LT 1QRKA 3AM8A 5F9OL 1MRCL 4NC1C 5E99L 4MJIB 4Z7QF 3PDOB 5SX5H 1M05B 4POYA 1S7VB 4HK0A 2HJKB 3K2UL 3ME0A 2CH8A 5E5RB 4KTDH 3MV9D 1HDMA 5DD0H 5MEOA 4Y5VC 4HH9B 2FX7H 3DSNA 1VPOL 4KK5D 1FDLL 4LQFH 4FXGA 4P2OD 3PNWA 3S35X 1UJ3B 3BXNA 3CFEB 1KN4L 3RZCC 1VADB 5J6HB 4B7IA 5C6WH 4P9HC 1BGXL 5EO1B 1RVFH 4QRUB 4PRDA 3OR7B 1CXEA 1WZLA 3TBTA 1A3QA 1TQBB 2E27L 4HQQH 5GRYA 4JFXB 1IGML 3V8OA 2QKIB 3ULUE 1XCQB 3PP4L 4IOIA 1A6VH 3MRCA 3NZHH 3QRGL 3MZGB 5E2WL 2Y5TB 1TZHA 2D7TH 3DVNA 4KH2A 15C8L 5J13B 3HE6A 3KYKH 4FQLH 3P11H 1B0WA 1F97A 3VXMA 1T83A 2YD7A 4PBVC 1UM5L 1UM6L 2IMNA 3V8CA 4P49A 3UO1H 3C6LC 1BBJB 3L9RA 3QUYD 4DTGH 1IEHA 2OXGA 2VDQL 3EIFA 3OF6D 5D1XC 3ZHLA 1GGTA 3HC0A 4HS6A 1NGWA 1HYSC 4PG9B 1RIVH 3KLAA 3BDYH 3MRNA 4NHCL 5LAXA 1MEXL 4XPHL 2NYYD 1EUTA 4KK8D 1E6JH 1OHQA 4G7VH 8FABA 1GJIA 3UTZB 4UMGA 1DBBL 3DSFH 3MBED 1OARL 1HHJA 2OP4L 4NRXB 4Q9RH 1A9BB 4XNXH 3H9HB 3GFUA 3QXVA 5DEGA 3S4SB 1NUDA 4NN6C 5D1QC 3HE7A 4QXUH 4RMTA 3ARDB 5JXEA 4JE4B 4KTDL 1R3HA 3SPVB 5DD0L 1W0WA 2FX7L 4RCAA 4HWEH 1Q9KA 4LQFL 3UC0H 3MRHB 1QLFA 2EDRA 2X4UA 1U2HA 4IRJC 3P9WB 3PQYB 1A6ZB 3G6JB 5CEZE 2AVGA 1J11A 2VB5A 3KNBB 4K9EH 4HIHA 1R3JB 5JNYA 2CQVA 5KS9B 1RVFL 3IDIB 4XMKH 4KPHH 2W38A 3HB3C 2AKRB 4HQQL 2E9WA 5D6DC 3O3DB 4FG6C 3UAJC 1LGVA 2J8UF 4FFVD 4XP4H 3WS3B 4YDJB 1A6VL 3NZHL 4G6AD 5FK9A 1JGDA 4Z5RA 4ZO8A 3ZDXE 1NC2B 3HCVB 5JOEA 4Y4FB 3QDAA 1PW3A 1FH5H 4KTYA 1KGCD 1MSPA 1OGAB 2X9WA 1UADC 3GBLA 1A8JH 3ARSA 3KYKL 5E9DD 4FQLL 4GRWB 4YHZH 4I2XE 1ZVHA 3P11L 1DEEA 4GQPH 1YEEH 5M7QA 3GEWB 3FOMB 4AIXA 3UO1L 3FAWA 4DTGL 1MCDA 1MCIA 2P42B 4NKOA 2GTZA 4GRLC 4QOKB 1T7VA 2E7LA 1DR9A 3BH9A 4ZUUB 3TFKC 2R9HC 4NRZA 2YA1A 3O81A 4PJGF 4ODTH 1IFHH 2PW2A 1RIVL 1OP3K 3BDYL 4U1MB 3C5JA 1HE7A 3VXQB 4KZDH 1LE5A 3G5YA 1E6JL 4K3JH 3OGOE 4X9BA 4XCEA 4G7VL 4P3CH 3DSFL 1BQHB 1EGJH 1FFNA 2D31A 4UOW1 3CSYB 1T1WA 4Q9RL 2A1WL 4XNXL 3GMRB 3QDJB 3IJHB 4N5ED 2OR9H 5MEPB 3UYOD 5IM7A 3VXRE 2GITB 4U1HB 3FOLB 3JV6B 4QXUL 5B21A 3DIFA 3PWPE 3BHBA 3VFWA 4HUNB 2X4SA 4EI6B 4OLZL 4Y8DC 2B1HH 1S8DA 1Y18A 4HWEL 3SCMC 3UC0L 5F3BB 1N6VA 5AUMB 3BIAX 1BPVA 1WBZA 4JO4H 3REWA 3CUPA 5KSVA 1FSKB 4IIQC 5L0QB 2NY1B 4K9EL 1KIQA 2Z8VC 4PJ7A 4UNVA 2GTWB 3FQWA 5FHBL 3BPNB 4XMKL 5IESH 1FVCB 4KPHL 3P73A 5EU5A 1LILA 1TITA 4LLDA 3VFUA 4L8CA 5TGBB 4Y1AE 3UPRA 1I3UA 2R2BA 3G08A 5LVEA 4L4VA 1AQDA 3S37X 4XP4L 5L8JB 3OWEA 1QSFD 5HVHC 4HSQA 4PV9B 3HUJA 1NCBL 4L8BB 4YPJA 3PDOA 4HLZG 5ACZB 3PL6B 5TH2B 1KBGL 1FH5L 3B4NA 2HJKA 4MXQD 3HRPA 5D71H 4AMKH 1C8PA 3CFJB 4WW2F 4YHZL 4HH9A 4M6NH 5EBLB 1YEEL 3RWDA 1AD0A 4Y2DC 5HXMA 3T8XB 3UBXB 1A2YA 4L3ED 4GW1B 1MCLA 1UJ3A 4NO5A 2VXVH 4P2QE 2PCPB 3T2NH 1JNJA 1OQOA 3L95A 4LFHD 4QRUA 4ODTL 1IFHL 4PP1D 3OR7A 5KW9H 4E5XB 1NEZB 1G7HB 1UB5B 4YDVB 1MQKH 1DJSA 2WWMC 4FMKA 3BKMH 4KUZH 4KZDL 3IFNH 3FKUS 2QKIA 4ZQKA 3MRFB 4IRSC 1XCQA 4K3JL 4WTZG 3TNNA 5FV1L 1ZGLP 1GSMA 2Y5TA 4KJQC 1PX4A 1YECH 2BNRD 3HG1E 3ROLB 4P5TC 2OR9L 1UZ6F 2X9YA 1OSPH 3K74B 1I3RB 1EFXD 3QIUB 4CW1B 3PV6B 2YZ1A 4NT6B 2Y72A 2DJ4A 5C07D 1YEIH 4OQ1A 2P24B 4KGLA 2B1HL 1KENH 2Z31B 1CXKA 1UM4H 1EO7A 4MQTB 1RK0B 4PJHF 2X1XR 2WINB 4BZ1H 4GLRI 1KACB 5DO2D 4JO4L 2UWEF 3ILQD 4MA1C 4R90H 1ZT4B 4PJEF 3TBWB 3QQ4B 3BPOB 2IPTH 1MWAA 5IESL 4MB5A 1QEWB 1FFOB 1OB1A 3TH2T 3B9KD 3UTZA 1SJEB 3DWTA 3VH8A 2VMFA 1TETH 4R4ND 1EPFA 4JQXC 2J8UB 4NRXA 2EDJA 4OAWB 1VEPA 3H9HA 4HK3J 1QSVA 5I18H 1OTSC 4YLQT 5CJQL 2WZPD 3DGCR 2UVEA 2AEWA 5D71L 4TNWF 4AMKL 3ARDA 5KVGH 3GKWH 3PGDB 2NY4C 4JM2D 3SPVA 3V52H 3C5ZB 1UG9A 4KHXL 4M6NL 2DTSA 5H2BB 1BHGA 5L6YH 3MRHA 4PRAA 4WEBH 1MRFH 5IWLC 5MEQA 5E4EB 1A6ZA 1RJCA 3G6JA 2BVTA 1GGYA 2VXVL 3F12B 2VZTA 5KS9A 1R5IB 2NY6B 3IDIA 1CGXA 4JFFE 4PJGB 5KW9L 3GSUA 2AKRA 3ARXA 1MQKL 3O9WC 3QDGE 3BKML 4KUZL 1WUNT 3IFNL 4N0CC 3WS3A 1LD9B 1UKTA 4YDJA 3C60B 1U36A 3VMPA 4A2LA 3FHQA 1NC2A 1YECL 2V17L 3T3PF 5MENE 4KWUA 3MV01 2FL5A 3O4LB 3GDBA 4TPRH 3SDDD 4LPTA 2ED9A 4X6CE 5TDNB 4PFEA 4WTWA 3SGKC 3BGAA 3QBTB 1YEIL 2AK4E 3FQRB 1A1MB 1KENL 4FXLA 4FQJH 4OI7A 4GKSB 3TPKA 3O3EB 3WFEH 1UM4L 4QOKA 2BZDA 3GJFK 1IGYB 4BZ1L 2V2TA 2E5EA 5T5NF 1YEJH 4R90L 4F9PC 4U1MA 3CDGB 3VXQA 2OTWB 2IPTL 5C2UB 1CWVA 3MGOB 1QKZH 2A74B 5D96B 4XHJD 1T2JA 4YXKH 1BQHA 1TETL 4LSTH 3RUGF 4KROD 4U0QB 5H37H 1FLTX 3CSYA 3U30C 3GMRA 5MEPA 5I18L 1FNSH 1AGDA 2DM2A 2GITA 4U1HA 3FOLA 3JV6A 2F53A 2CLRA 5AZ2H 2ED7A 1FYTB 5EZIH 4HT1H 3GKWL 4ZNEE 3FQTB 1IAOB 3JBG7 2D0HA 4WW2B 3V52L 4YHPB 4EI6A 4ZUSA 5C07B 4U7MA 1CE6B 5F3BA 4DWHA 2V7HB 4WEBL 5AUMA 3VRJA 5HHOE 1MRFL 1T7ZA 1INDH 3RWEB 4GG8B 3CU7A 5DD1H 3GMOB 3QYCA 5KOMC 4WGWB 3MO1B 2GTWA 4FFYL 4WV1C 2Q6WB 3CZFA 1FVCA 2ZCLH 2C4XA 4ZO7A 3RX5A 3CMGA 4NDMB 1VFMA 2H3NB 3OJDB 1KIPB 2DIBA 2WQRA 4XT1C 1NLBH 4PV9A 3THMH 3SDAB 1A7PH 4L8BA 2DJSA 3K8MA 4Y4HB 5F89B 3PL6A 4U6VL 5ACZA 2DS4A 4ZPVB 5TH2A 3D6GA 1HCFX 3VRLF 1U58B 4J1UB 3ZTJH 5JOPE 3CFJA 4GKNB 1RSFA 4TPRL 1EJOH 3MV7B 4G5ZH 4RBPK 5EBLA 5CD3B 3D2UD 5F96H 1EBPA 4O51A 2YD1A 4KKNA 3RX7A 4AIZB 4GW1A 3LZFH 1OT1A 4FQJL 5T1DH 3WFEL 1XF5B 4PJHB 5F88B 2PCPA 3UYRH 2MQCA 3S4SG 4KRLB 1LNUB 4KJWD 3OHXA 1YEJL 2UWEB 4R2GC 4TVPH 2WSKA 2W9DH 1LO0H 2ZG3A 1NEZA 1G7HA 3F7QA 3O8XD 4PJEB 1MCJA 2ZJSH 4KKBD 3MRFA 2RR3A 1QKZL 4NKMB 3CIQA 3WHE1 1XF1A 5EU3B 4YXKL 2PNDA 5HHMB 4LSTL 5E2JA 4WWKD 1YPZF 4NQEE 2CIIB 1TTFA 2H2SD 3ROLA 3RL1B 5GRJH 3OJMB 4JFOB 1FNSL 1MLBB 2EDKA 3QIUA 2W0FB 4RMRA 5I1KH 5AZ2L 4P59H 5CBAB 4HUXB 5EZIL 1IM3B 4HT1L 1XF3B 1NEUA 2JJSC 2P24A 1R3LA 2DQGH 2M2DA 1V5JA 2PF6A 2Z31A 4JFED 1RK0A 4OUOA 2WINA 1WICA 1INDL 4JRWA 4KY1L 1J05B 5EU6B 2UY6A 1NBZB 1ZT4A 2H45A 5BRZB 1FN4B 3TBWA 3ARBB 1CLCA 5TDOB 1QEWA 1ZTXH 2ZCLL 3D3VD 3RWGB 3OKDA 1RZ7H 1SJEA 2JK5B 1CT8B 3QUZC 2J8UA 2X4NB 4J3WA 1NLBL 3KPLB 3THML 4OAWA 1AH1A 1A7PL 1NGZB 3OKKB 5M95B 1AKJD 1ADQH 3VFSB 2H32A 2HFGH 1R3KB 5I8KH 1DN0B 1WZ1H 3KPRD 2Q7YB 1LK2A 4K7PY 3D48R 1X4ZA 1X4XA 4Z7WF 4QXGH 3PGDA 1EJOL 4G5ZL 4RGNE 3SDXE 2X10A 3C5ZA 3E8UH 2J1KA 5H2BA 2V2XB 2Y25A 3DX7A 2PXYC 4YZFF 2X44D 5F96L 1CGTA 3QIBD 5SWSD 5C08D 1A6TB 3MJ6A 3LZFL 1FZMB 2YOCA 5T1DL 2Y4SA 5IB3B 3ARGB 2F19H 2EO1A 5DEFB 5J0BA 4RIRB 3CAFA 3F12A 2A77H 3UYRL 1D9KB 3VW3H 1R5IA 3IDJB 5FYLE 4TVPL 4PJGA 2W9DL 1LO0L 2UZXB 4BQCA 1CU4H 1UZ8B 3DXAB 5GS2H 3KJ4B 2ZJSL 1YN7B 3SOBH 4Q2ZB 1LD9A 3ZKSD 3C60A 4QHKJ 5T1KD 1EUUA 5CEXA 2EO9A 4PLOB 1IC4H 2QADD 3RUGB 1VGEL 3MRBB 1UB6B 5GRJL 1KCRH 3ARFB 4ZFOL 3O4LA 1NKOA 5KSBE 5BV7B 5I1KL 2HTKC 4WWID 5JORA 3UTQB 4P59L 1HH9B 4B7LA 2BC4B 3OL2A 3TESA 4FXKA 6CGTA 3FQRA 1E4XI 1HNFA 4UB0H 1RJLA 1A1NB 1WF5A 2DQGL 1JWSB 2DOCA 3N9GH 1A1MA 3CSPA 3WL9A 4XPTH 4GKSA 3RIAK 2QV2A 2EEDA 4RDQF 1XGPA 5GGSY 3WUWB 3RTQD 5D7KE 4U31A 4H8WH 1H3TA 3CDGA 4ZXBD 5DS8B 3SJVD 2VDOH 1W2KT 1ZTXL 3QCTH 3MGOA 2A74A 3LY6A 3ZKND 5C2BH 1RZ7L 3UBXG 2HLFD 5DRWB 2AGJH 4ZODA 2BY3A 4YH6A 2EE6A 3RL2A 1ADQL 2HFGL 3WV0A 5I8KL 1WZ1L 5ACMA 5C0DB 4WFED 2BNQB 5D9SB 1LO2H 1FYTA 4QXGL 5FM4A 5IROC 3FQTA 1IAOA 3BZ4A 4WW2A 4YHPA 3E8UL 4S2SB 1ZVSB 1NGQH 1F5WA 3RDTD 2V7HA 1QFWM 3NA4A 4PG2C 4PJ9B 3RWEA 4GG8A 4OGAC 5T3XH 2A77L 3PHOA 3DMMC 2CK2A 4K9EC 3MO1A 1DLFH 3VW3L 1A5FH 1IE5A 2Q6WA 4OKDA 1RZGB 4CKVX 1CU4L 3R06B 3CGTA 2H3NA 3HE6D 1KOAA 3OJDA 4M3JA 1TDQA 5F9WB 2OI9C 2DTMH 3OXRA 3SOBL 3FAXA 2VR5A 3QEQD 3SDAA 4DEPC 3SKOB 4R97B 5A2LH 1IC4L 4ZPVA 2GW5A 3O6FC 2P5EB 3RX8A 1YPZB 1U58A 2XG4A 1KCRL 2ZOKB 3BEVB 3MROB 4J1UA 4JJHA 4GKNA 1F4WH 3MV7A 4XNQB 3OX8B 1MFCH 5CSBA 5K59F 1LVEA 2NZ9C 5CIPA 1L7TH 3WLBB 4UB0L 3UXFA 5L2KB 3N9GL 5D1ZD 3E1F1 5B8CC 4AIZA 4FQXB 4XPTL 4YFLF 4ONOA 4HAFA 1XF5A 4EXKA 4PJHA 4MQXD 2IH3B 5F88A 4Y89A 4A6YH 4Z7UF 4QHNB 3GBML 2UWEA 5DJ6B 1KLGB 4H8WL 5DDHA 5ICZB 4JHWH 1QSEB 4NZRH 4OZFA 4PJEA 5DJZB 2HT3D 2VDOL 3EYSH 1EX0A 3O11B 3QCTL 1U91B 4WFFD 5KJRH 4NKMA 4APQB 3UBXI 5C2BL 2A0LD 3QJHB 1NDMB 3VGGA 1XR8B 2AGJL 4HWZB 2CIIA 4XP6H 3RL1A 3OTTA 1FC1A 5ENWA 2QADB 4OCSH 5C1MB 2WAHA 1LO2L 4HUXA 5ILTH 1XF3A 2LU4A 4NZUH 3VXOB 2FSEA 1ZGLA 1NGQL 2GHWB 3EAKA 1H0DA 2BVEA 5T3XL 5GJTH 3SO3C 1J05A 3H42L 5EU6A 3T1WA 5E7BA 5BRZA 1FN4A 4GLRH 1DLFL 3ARBA 1A5FL 4KTEH 5TDOA 3RWGA 2FJHA 1Q9LB 2JK5A 5T1LB 2DTML 5B3JF 4HWUA 4OCNC 2X4NA 4H25A 4F7EB 3P30H 2X4PB 4I0PB 3OKKA 1CF8H 3EZJB 3VFSA 1DN0A 4DAGH 1OTTC 3EOTH 4HLZH 4LNVA 4ZOAA 3PWVB 5EUKB 4LFHG 1F4WL 1U8QA 5EC2B 4NM8H 3E3QC 1MFCL 2IFFH 4UAOC 4PD4K 1JTOA 2V2XA 1L7TL 4CN6A 4AZ8A 3IFPB 3O2DH 4XPBH 4OZIE 1FZMA 5F6IC 5IB3A 3ARGA 3IRZA 3MODH 4G8EA 4YAQB 5DEFA 1FNHA 4RIRA 5I1HH 2K9UA 1D9KA 4A6YL 4C59B 3I85A 3IDJA 2ZSVB 3H3KA 4R4BB 3UTSE 1PG7H 1DBKL 3GSOB 1UZ8A 3K2MC 3KR3H 4JHWL 4NZRL 3DXAA 5IW1B 4WDIA 5MI0B 2QR0B 4YX2H 3V79C 3EYSL 1YN7A 1MJUH 2H26B 3WFBH 1NGPH 4Q2ZA 5LKNA 1YJDH 5KJRL 3QUXC 1ZANH 2DICA 5JW3H 2E7MA 4ZD3H 4WU7B 1F3DH 3RUGA 3V95A 1QR1B 4LCWD 4DVBB 4XP6L 3MRBA 3ARFA 2IFGA 4OCSL 3TCLB 5HGDB 2VIRA 1HH9A 5ILTL 2BC4A 3S3SA 1F6LL 4NZUL 5E4IA 4E0RA 1A1NA 3BYYA 1HQRB 3GHBH 3MA9H 1BWMA 5CSGA 1FVEA 3WUWA 4LLQB 5GJTL 4LPXA 4PJAF 4YHYB 3MRGA 2NY3C 1JYXA 5GRWA 5J9PB 1I7TA 2DMKA 4LCCC 5GSRB 3EOBB 4NGHH 2GJZB 1VFBB 2L7UA 4TOYH 4UTAH 3EO1B 5JUEH 5DRWA 1QSZA 4Y19D 4Z95H 5E2UH 3P30L 1LDSA 3HR5B 3DV6A 2RQ8A 5C0BE 1RU9H 5E1AA 3VU2A 4DAGL 2X42A 5LWYH 5C0DA 2BNQA 2H9GB 1J0HA 3EOTL 2VL5B 2F8XC 4YXLL 1K4CB 2FH6A 3AREC 2IALB 1QA9B 4NM8L 1I85C 4PRID 4S2SA 2IFFL 1ZVSA 4PJDF 4YDIH 3WHXB 3X17A 3A6OA 3RZWA 3K81A 3O2DL 5SV3A 3FO2B 1Q0YH 2R23A 4XPBL 4FZEH 4YR6B 4PTTB 3MODL 2QQLH 3IDUA 5I1HL 2CRZA 4WEMB 4CAGA 4Z7UB 1RZGA 2FEEL 4LLYB 2KPNA 1PG7L 4R3SB 3R06A 2Z8RA 2I07B 2I24N 1MJUL 3WFBL 1NGPL 1YJDL 2WW8A 3SKOA 5GGTA 1ZANL 3CK0H 5CFHA 2R2CA 1X5ZA 2R0LH 5JW3L 4ORGB 3B5HA 4ZD3L 1WGOA 4M6MH 4WI7A 2P5EA 2R4SH 1OM3H 3ARYA 1UT9A 3P9LB 2YMXH 3BEVA 4U1SB 3RVXD 3OJ2C 4G9FD 3GJFB 4XNQA 2CXKA 3IS0X 2VWEC 3L3IA 3OX8A 3I6LD 2FWOB 5ISZA 2IG2H 3L3KB 1S7RB 2MJWA 3FT4A 1BVLB 4LVEA 3WLBA 2BVPB 4JFDE 4UUJB 4BQ8A 1PZ5B 3EFFB 3MA9L 4PJIF 5EN2A 1I3GH 1KN2H 2IH3A 1DZBA 3TT1H 1KELH 1RPQA 1MCWW 5ID0B 4QHNA 4XBPA 5EC1A 5DJ6A 3P9MB 5ICZA 1VFUA 1QSEA 5DJZA 1KYOK 2HMID 1QPXA 3O11A 4NGHL 4XMLH 1UENA 4KVNH 4UTAL 4TOYL 4APQA 1MHHB 3TZVC 1G0XA 5FYKE 2BOCB 3QJHA 4ZAKB 3SKJH 3CLFL 1XR8A 4HWZA 1AGCB 3J7HA 3MLYL 4MD0B 3IDXH 4Z95L 1NPUA 3P4LA 5E2UL 1TQCC 3RIAF 2AW2A 3UTTE 3UROR 3WHE0 1RU9L 3TF7C 5LWYL 4MJ6A 4X4ME 3TH4T 4Q74A 1IM9D 3SO5A 2X6MA 3VXOA 1NMCC 2AAVA 4LP5A 4YDIL 1WEJH 3UP1A 3W81A 1Q0YL 4MX7B 2KZWA 2QQLL 1K8IB 2XN9A 1HXYB 5KSAD 2RCSH 1R5VA 5JHLH 1OAXL 1MCKA 3T65B 3MV9E 4G8GE 5H35B 1Q9LA 3ZT5A 1YC8A 4FRWA 1CI5A 4I0PA 2X4PA 3CK0L 4Q6IB 2R0LL 5AWNH 3P0GB 4M6ML 5C0FB 2KQNA 2R4SL 4PRHA 1OM3L 1QFOA 2YMXL 3PWVA 5EUKA 1FAKT 3WNMA 3BZFB 4GW4B 2IG2L 4DGIH 4NKQB 3IFPA 4PRIB 3TH3T 3IJSB 5HYSB 4OD3H 2FH8A 4ERSH 4JDTH 4L8SC 3NGBC 5GGVH 1UKQA 1I3GL 1KN2L 3SE3A 3TT1L 1KELL 5DMGD 1OPGL 3BDXA 2ZSVA 4RFNC 4R4BA 1SYVB 2IBBA 4PJAB 3MMEA 1YEHH 2F53D 4Y5VB 1A3RH 2H26A 4FFZH 4XMLL 2EEAA 5SX5K 1JF1B 3SKJL 1KCUH 3VWKB 2MCPH 2VZVA 3IT8D 1Q72H 3MLWH 4QKXB 4KXZI 2NY0B 3GIZH 4WU7A 5J1AB 4HXAH 1QR1A 2YK1L 3IDXL 4I4WB 4DVBA 3NCBB 3RZCB 5HYJD 5B4MD 1U3HC 2DM3A 4EN3C 3GSRB 1BJ1J 3GO1H 4HFWB 3TCLA 5HGDA 1WITA 1K8DB 5IVXE 4IS6B 1OVZA 4G9FB 4RWHA 1C5BH 3BPCB 1MNUH 4W6WB 4YHOH 3HTLX 1X5AA 4X9GA 1M7DB 3U1SH 4F8QA 3KWWA 3QPQD 4PJDB 1WEJL 3MNVA 3Q6GH 5GISH 5E08H 4QNPE 1YEGH 3DX9B 1E4XH 3MNWB 1WBYB 4FQCH 1YMMD 2AEIT 3RFZC 4XTRC 1IGTB 4I3RH 4OZHE 1XCTB 2RCSL 5JHLL 1OD7A 3NIFE 5ABDE 5J7CC 5F7MC 3EOBA 2GJZA 3GMLA 4XCNB 1VFBA 3FMGH 1T1YA 3BQUC 2ITDB 3EO1A 3NABH 4GRWH 3WKMH 1B4RA 5J3HD 3C6LB 1A7BA 1AFVH 3IJYB 3FFCD 3FN9A 4NWTH 4DUXA 3HR5A 3V4PL 5D1XB 3TO4C 1FCCA 2R1WB 4Z7NE 3R1GH 5AWNL 5T33H 4KMLB 4W70A 3ZE2F 2H9GA 5CKGA 3O2WH 3LEYH 1K4CA 4AH2B 1CYGA 4XVUC 2IALA 1QA9A 2PO6D 4Q0XH 3VWJC 4P0DA 3WHXA 4DGIL 1YYLH 4OD3L 4PTTA 4YR6A 3S8WA 4ERSL 4JDTL 5C0NC 5GGVL 5HHXH 3DO7B 4PJIB 3AU1B 4OFIA 3RIFK 4Z7UA 1DQDH 1KGCE 2V6HA 4LLYA 5DURD 1II4E 4R3SA 2I07A 4OKVB 2Y6SD 5L8KB 1YEHL 2QQNH 3GHEH 1A3RL 4FFZL 1LEKA 2J4WH 4IRJB 4LIQE 1KCUL 2ERJB 3OXSB 2MCPL 1X6NA 4ORGA 3W5NA 1Q72L 3MLWL 2AJUH 3GIZL 4XXCC 4HXAL 2ZUXA 2RGSA 3P9LA 1JPTH 3IGAA 4U1SA 4WI9A 3GJFA 4U1GC 2OM5A 1FZKA 1S7RA 3PGFH 1C5BL 2VLMD 5I66A 1MNUL 2BVPA 4YHOL 3NIDF 3U1SL 5IQ7H 1PZ5A 4O5LL 5C0RH 5M94B 5H8DA 4OF5A 3EFFA 3Q6GL 5GISL 2UV3A 5I19H 5E08L 4OZ4B 4F7PB 1YEGL 1E4XL 2ICEB 4FQCL 4QRPD 2P5WA 3UJTH 2D7OA 3QSKB 5CZVH 4I3RL 3P9MA 4H8WC 5AZEH 4I48B 1RUKH 4ODXB 3WSQL 4G6FB 1X5HA 4NNYB 2VLJA 2MKLC 4U0RB 1JGUH 3FMGL 2Y07H 3C8DA 3NABL 4O9HH 4ZAKA 4U2ZA 3T4YB 3WKML 5F7EL 2B0SL 1AFVL 1I1AA 4NUJA 4CU7A 1AGCA 4MD0A 3VGAC 3G04B 4NWTL 1AR1D 4RDQG 3R1GL 5BO1H 4P99A 1PQZB 5EOQH 2Z8SA 4QRRD 3LEYL 3BZEB 5LCVH 4Y4KC 3S9DB 4YBQD 1BQLH 3QI9D 1HHKB 2WV3A 4EIGB 1F4YH 1IGCL 1QSFE 1Z9SA 4MX7A 1YYLL 5JTWA 3OKLB 1K8IA 2XIDA 1MJJB 2GFBB 1HXYA 4QF1B 5HHXL 2H2PD 4Z7VE 4P23D 5DFVC 2YPLE 1DQDL 4L9LB 4V1DB 3T65A 2DL2A 4GBXC 2VRAA 5EZOH 5H35A 5T3ZD 1ZSDA 1CICA 2QQNL 3GHEL 5DRZB 5JA9A 2J4WL 4JAMA 2QHRH 4Q6IA 1I7UB 4L3EE 3FFCB 2AJUL 1T5XA 1TVBA 4WHCA 5C0FA 1IAKA 3B2VH 1JPTL 2NLJB 1RQ5A 1FFRA 2YPVH 1T66D 5AD0B 3BZFA 4MA3B 1SY6H 4GW4A 5T1MA 4UBDC 2XXCB 3LQMA 1HWHB 3PGFL 4NQCE 3L5WB 5L8LB 4OBRA 5IQ7L 5HYSA 4B0MM 5EIIB 5C0RL 2FYYB 3SGDI 5I19L 1KEGH 5I1LB 4M93C 1MCHA 3AM8C 1AHWB 5IEKA 3UJTL 2BNRE 5GGSA 2L0DA 5AZEL 1MELA 4QCIB 1MFNA 1RUKL 5CJ5A 5L7XH 3I02B 4LSVH 4UIMA 4OIAA 2C7UB 2LAAA 4Y5VA 4C83B 1JGUL 2YD2A 4H26A 3T08A 2Y07L 1JF1A 4O9HL 5DZOA 5J1AA 5I74C 4R96A 5JO5B 3RZCA 2GIYA 3QNYB 3OAUH 3GSRA 5BO1L 3DETC 2ADJB 4CJ0A 4MDJA 3VG0H 1BECA 1K8DA 4IS6A 3GI9H 4WO4D 2R1XB 3MOBH 4ZDHB 2V7NB 5LCVL 4GAYB 3BPCA 2IC2A 4RRPA 1M7DA 1BQLL 5TQ0H 4IRSB 3G6AB 5J6GB 5IKCB 3TP4A 3MNWA 1F4YL 3DX9A 2NY2C 4CNIA 4J3TA 4LNRA 4MAUL 1WBYA 4DUVA 3OGCB 1IGTA 1XCTA 2XQYK 4P5TB 4L4TA 4P2RD 4I8DA 1QO3B 4LHQB 4IM8A 4XCNA 4MDIA 4XPFH 2GSGA 4MSWA 3RVTC 1ZAGA 4ELME 5EZOL 4MAYB 3C6LA 3W0WD 5D2NC 2QHRL 5D1XA 4H88H 4GS7C 2HVKB 4PB9H 3VFOB 1ZLVK 3IDMB 3IDNA 3TYGH 2NNAB 1PYWB 1YQVH 4WUUD 3B2VL 5EFIB 2Z8WC 4AH2A 2YPVL 4OQTH 5C0EB 2APTA 3RGVC 5MP6H 2NZIA 5HHPA 1SY6L 1MI5D 1PG7X 2YD8A 3JVGC 4I1NB 3KS0J 3D87B 5ICYA 2VSCA 4OD2B 2NPLX 5C6TH 4X5WB 1G7MB 1KEGL 1WWWX 4Y7MA 5D5MF 2LQRA 1DQQB 5D1QA 5DVMA 3TYFB 3EJZC 5L7XL 4OKVA 1X5GA 2LVCA 2NY4B 3BUYB 4LSVL 4YBHA 3LKOB 1JBJA 5GPRA 4DJMA 4GAGH 4IRJA 5EOCH 4B53A 3OXSA 2DKUA 3CFKB 4LOUC 4NFDA 4RFEB 2O61B 2I9LB 5BQ7B 4NOFA 2DLEA 2OS7A 3WJLC 1W8NA 3OAUL 1O7SA 3OPZH 4UDUB 3VG0L 3GI9L 4PUBH 3MOBL 1OD9A 5D6DA 2MTPA 3GK8H 4UT6H 1SQ2N 4MNQB 1J7VR 1L6XA 2Y23A 5TQ0L 4XP5H 3B83A 3TEUA 1NAMH 2ZNXA 1XF2B 4OZ4A 4F7PA 2ICEA 2F8VA 4ODWB 4HAGA 4FMFA 3QDMD 2IQ9H 2ESVA 4XVSH 3ZE0E 1FG2A 4I48A 1RJYB 2VLKD 5DI8A 1A6AB 5D7JB 2R69L 1IC5H 4NNYA 4HJ0D 3UTPE 5E2TH 2DDQH 3EDJA 4NN5B 4XPFL 2X1WL 2FIRT 3VXSB 3HHRB 5C9JB 1EMTH 3T4YA 5HGAA 3VGEA 3CFIC 2CRYA 2QSCH 3VXUA 2J7LA 3U46B 1EEUA 4JRYD 5EIQA 3QCVH 4H88L 5JIHA 4PB9L 1I9JH 3TYGL 1PQZA 1PD6A 2JE8A 3Q5TA 4WFGD 1YQVL 3H9SE 4O2EB 5BZWB 4P4KC 4HF5H 3KXFA 2JCCF 3WO4B 1GZPB 5DFWH 3IKCB 4OQTL 4HXBH 5MP6L 1MFAH 5DTFB 4Z18A 4X4ZA 1PX3A 1VSCA 3G9VA 1T22A 2BVUA 4LRNH 3CVHB 1RJZB 2Z93B 3V5DB 5C6TL 1ZEAH 3MOAH 3OKLA 3U30B 4H0GA 2GFBA 2BHYA 1EHLH 1EXUB 5JDSB 4V1DA 1KJ3H 3ZKMC 2VDRH 3V7AE 3PHQA 4NQSB 2MMXA 3U4AA 4NQDA 3LN5B 4EI5C 3BI9X 2EXWC 1VACA 3T0EC 3TM6A 4GAGL 3SKNB 4ELKB 1YEDB 2AV1B 4IMLB 5EOCL 4RGMC 1URLA 1Z3GL 1NMAH 1MCPH 2EYSB 2L7JA 3OPZL 2R39A 4WV1B 3ZT7A 4MA3A 4PUBL 1TCRA 4NPYB 4UT6L 3GK8L 3L5WA 2WBKA 1TTUA 4PJXE 3BWAB 3SDCD 3T04D 5EIIA 2FYYA 3S97C 2RBLA 4XP5L 1C5CH 4KI5C 3CMOH 1RZJH 2IQ9L 5C8JB 4XVSL 5CSZB 2GJ6A 2VDPH 3U7WH 4QCIA 3DV4A 3X3GH 1IC5L 5E2TL 4ZS7H 2DDQL 2E6JA 4Y2DA 3SQBA 1TXKA 1EMTL 2VLRB 2QSCL 2AJZB 1X5FA 3RJQB 1FNAA 1PAMA 5AAMA 3QCVL 5DC9B 5H94B 1UJ3C 1I9JL 3BEWB 3AMKA 4F3FB 2ADJA 4OF7A 4R2GB 2E9JA 4HF5L 2CLVB 1KYOJ 4HXBL 3VFRB 1MFAL 1HKLH 3D3VE 1TQBC 4IRSA 3G6AA 5IKCA 3MRDA 3H3PH 3ULUF 4LRNL 5IVNA 2XQBH 3CXDH 2VXTH 3MUZ1 1ZEAL 5HYIA 1KUMA 3MOAL 1DL7H 2GCYB 1XIWB 4P5TA 1FFPB 2E6QA 5D5MB 5JHDA 2VH5H 3F5WB 1LE9B 2XTJD 1QO3A 1KJ3L 2BERA 5I2IB 1MCOH 2VDRL 2Q3ZA 5CGMA 2EKJA 4GQ9H 4PY7A 4OBSA 5JZ7C 5SWSE 5C08E 2J12B 2HVKA 4EIZC 3VFOA 3IDMA 2PKDA 2APBA 2NNAA 1NMAL 1PYWA 5EFIA 1MCPL 3GM8A 1B4JH 2YA2A 3ULVD 1CXLA 2FX9H 1BP3B 5C0EA 5IV2B 2XWJB 1U41A 2X1QA 3SKMA 2OLDA 4JGJA 3VJ6B 4C56B 3DRTB 1AO7E 4JQXA 1RD6A 3QUZB 4OD2A 4X5WA 4PP2B 4BFIB 1C5CL 1G7MA 5E00B 3CMOL 1DQQA 1DVFC 1RZJL 3S96B 4YBLC 3TYFA 4X6EA 1SBSH 3U7WL 2VDPL 4XNUH 2QQQA 3X3GL 2P7TB 4WIQA 2IWGA 1J0YA 1JJUA 1NSNH 4JDZB 4ZS7L 4OD1H 2EIBA 4JCLA 2PXYB 5IWLA 2HYMA 3U48A 1KTDB 5D72H 3TJEH 2XTLA 2O61A 2I9LA 2NR6D 3O0RH 5BQ7A 3A0OA 3M8OH 1TCMA 1WK0A 1P7QB 3G9AB 5A16A 2BSRA 4UILH 4AIOA 5C70A 4AEFA 2JCCB 5I17B 2OZ4A 4MNQA 4KJPD 1HKLL 3B3IB 5HGHA 4HUUA 2VDMH 4TUKH 3TBVB 3ILPB 1XF2A 1ORQB 3AUVA 3H3PL 4N8CH 2XICA 2XQBL 3CXDL 4ODWA 5ALCH 3ZDXF 1QUNA 4LBEB 5GGTH 1LMKA 4DKAA 1H15B 4G6KH 1F13A 1DL7L 2HRPH 5DQ9A 3V7MA 4Y4FC 5BVJA 1RJYA 3CPLA 4PY8J 3GSWA 2VH5L 4KMTH 2BXZA 1MIMH 1L9NA 4PRHD 1AY1H 2BSTB 1NQBA 3SGKA 1MCOL 5DJCB 3TJHD 3VXSA 5DRXA 1RY7B 5CJ8A 1KCLA 2PR4H 3BH8B 4TUJB 1J1OH 4GQ9L 3U46A 1JZ2A 4XP9H 4N8VB 4HMCA 1FE8H 4KK5C 5JLZA 2R4RH 5CEZD 5K33A 4AQOA 3GIVB 1RMFH 3U79A 4IMKC 5A2FA 1E28A 3DVIA 1GZPA 5IFHH 2ZOLB 1FJ1B 2J6EA 1B4JL 1AIFB 3F6IA 3IKCA 1VKXB 2FX9L 4AENB 5DTFA 2YN3A 3VRIB 3CVIL 3O3BB 2ZUUA 3CVHA 4N0FB 1RJZA 1I1FB 3ES6A 2Z93A 3VXME 1BFOA 4OFYA 1XF4B 3QZWB 4HJJH 1YQ2A 2IAMD 3CU1A 2LU7A 1EXUA 5JDSA 3GSVA 1SBSL 4XNUL 2HT4D 4RQQB 5IGXH 4JO2H 3IAGC 2HJFB 1NSNL 3LN5A 4OD1L 2G9HB 4LHUB 4E41B 3SKNA 1YEDA 2AV1A 5D72L 3TJEL 5HY9A 3ZE1F 4S1DD 1XGUB 1ZHNB 3O0RL 2EYSA 3M8OL 1QP1A 1FL5B 1XEDA 5J56B 4WV1A 2NY1C 3JTSB 4UILL 2FRGP 4QHUB 1CL7I 3BPNC 5IK3B 3BW9B 3PHSA 3WFCH 2VDML 4XBGA 4P46B 3KPNB 4TUKL 1M4KA 3KPQB 3Q0HA 4KK8C 4FZ8H 4LSDA 5ALCL 5HD8D 5GGTL 2ZUVA 5C8JA 5CSZA 4G6KL 4GJTB 4XPAH 2HRPL 3EOAB 1K3ZA 5I6XC 3H7LA 3V6ZB 3VXRD 4KMTL 1Y6NR 1MIML 1INQB 1AY1L 5C3TA 2ZG1A 4OM1H 5E95B 3KPSA 4KUCF 1E4KC 3PWPD 4U1LB 2VLRA 1PG7W 5B8CB 2DLIA 2PR4L 2Y7QB 2AJZA 1J1OL 3MXVH 4XP9L 4JPKH 2MQ3A 5EBMB 1FE8L 1OQXA 4BUGA 5H94A 3BEWA 3PV7A 4F3FA 1RMFL 2EDWA 3HMXH 2WK2A 4KV5E 4MJ5A 5IFHL 1H5BB 2G5BB 2CLVA 2GK2A 3NCYS 3OZ9H 1U8PB 1A7RH 2WUCH 4G43B 5C92A 4XX1G 1QTYT 2LAGB 3LD8C 1F8TH 3RPKA 4Z7OE 2GCYA 1XIWA 4FHBD 4HJJL 5KANG 4YDKH 3V0WH 1FFPA 5D5MA 5BJTB 1F00I 3F5WA 1JZ5A 2Q86B 4LGRB 2JJSA 3I2CH 3INUH 4JO2L 3H7BB 4PJ5A 4K8RH 3OG4B 2BHUA 3GMQB 4G7YH 4JG0H 2BVQA 2AJVH 5I30L 4PLJC 2Z31C 3SGEI 1CFTA 3MV8B 4P2QD 3MV11 1WAAE 3HNTL 4YE4H 2OCFD 2P5WD 3CLEH 4KC3B 2D2OA 5IV2A 2XWJA 3EHBC 1C16B 4M7KH 3OKMA 4XB7A 1TMCB 4AT6A 3LS4H 2BOBA 3BPOC 1NBQA 3DRTA 1IGJA 3QUZA 3N1QC 2VLJD 3PWJB 1FGNH 3WFCL 2DQEH 2FATH 4PP2A 4BFIA 5E00A 2E7HA 1DDHB 4FZ8L 1S78D 5CCKH 4HC1H 25C8H 1I1AD 5I1JH 1HZHH 3S96A 2AXHA 3HG1D 3BMWA 4XPAL 1ORSB 1U9KA 1V3KA 3IDGB 2GAZB 3QRFM 1D6EB 4XI5C 5IMLB 2P7TA 2R2EB 5C09A 4IDLA 5DK0B 3QJFB 4JDZA 4OM1L 4PJ7E 4X8XA 2PXYA 2JJUA 2AQ3A 3C5ZC 3JWDL 1KTDA 4I2XB 5J4MA 5FHAH 4ZFZB 4WI8A 4HEME 2CIKA 4Q7DA 3MXVL 4JPKL 4L4VE 4N1EA 3UCRA 2XA3A 3U0PA 2ZNWA 1WIPA 2D0GA 1TJGH 3HMXL 3HUJE 1P7QA 5DWUH 3C5SB 2E3VA 5FYJH 2RJMA 2Z35B 2NY6C 5DJYA 3OZ9L 3WIFB 3B3IA 1A7RL 3GKZA 4HG4K 2P47B 3HZKB 2WUCL 3TBVA 1WTGT 3ILPA 5IG7B 3QUXB 1ORQA 3KYMA 3WUZA 3C9NB 1JK8B 1CICD 2C4FU 3C60C 4LBEA 5KANI 1RV6X 3SEPA 1H15A 4YDKL 4JRXB 3V0WL 4Z0BH 1OAQH 2W59A 2GKIA 1KB5B 2DQIH 3O6KH 5JIPA 4JCMA 3GJFH 4P5MB 5DJCA 4Y5YC 2CPCA 4X6CF 3I2CL 3INUL 4KQ4H 5DK3A 3KG5A 2DIJA 3BH8A 3BP4B 4K8RL 3MLPA 4G7YL 4JG0L 3GRWA 2AJVL 3G5ZB 3GIVA 1OP5K 1MHPH 4QRTB 1MH5A 2ZOLA 1FJ1A 1AIFA 2NY3B 4PYHA 4YE4L 4HH8A 1VKXA 1XGYL 1QQDA 3CLEL 4LCCB 2RAMA 4M7KL 4AENA 3VRIA 3JV5A 5DD5H 3LS4L 1RUPH 3O3BA 3QDGD 3QQ9D 3FTGB 4HS3B 4N0FA 1I1FA 3IETB 3NN8A 1WJ3A 1FGNL 4Y1AB 2DQEL 2FATL 5KZCD 1XF4A 3QPXH 5E8NA 3EFDH 5CCKL 25C8L 3FFDB 1AGEB 5I1JL 1HZHL 2BVOB 4U1KB 3AGVA 3X12B 1PKQE 1CGWA 2XWTA 4RQQA 5IROA 1IEBB 3VD7A 1BFTA 5HDBE 2HJFA 2CSPA 1XZ0B 3VFTB 4LHUA 4E41A 3FT2B 4PG2A 4WHDA 5SWZB 3LEXA 5FHAL 1K85A 5F7KC 1DTUA 1ZHNA 4ETYA 3V0VB 1FVDB 3DMMA 4LMQE 1R3IH 1OL0A 3TA3D 4R7DB 1TJGL 3P77B 5DWUL 3U7AA 1T7WA 5FYJL 3JTSA 2N1KA 4QHUA 5ECJE 4L4TD 1CN4A 2N56A 3MLXH 3F58H 1N7MH 1RFDH 5IK3A 3BW9A 4PJBA 1J18A 4JPWH 1INEH 4JR9H 3KYNB 4DQOH 3B9KC 5EO9B 3O6FA 3SDAC 2P8PB 1VENA 4R4NC 3EOAA 4Y4HC 5I8CB 4JZNB 3G6JE 3V6ZA 4Z0BL 4GSDH 1OAQL 2P48B 2DQIL 2D0FA 5TE7H 4Y16B 3O6KL 4RNRB 1BIHA 3S5LB 5KS9E 4U1LA 3T09A 4KQ4L 3WXWL 1BD2B 3H0TB 4MJ2A 5B8CA 2Y7QA 1B0RA 2ZUQC 4JM2C 3F7YB 1ROWA 2O5ZH 5GRZA 5EBMA 1CLYH 5DRNB 5E8OB 3MRKB 1MHPL 1F90H 2JIXB 5K9JH 3PE9A 4PGBB 2BDNH 1B2WH 4LDEB 1KB9J 2ICWJ 5DVOA 4CU8A 5DD5L 1RUPL 4G43A 2BY1A 4I5BB 3TZVB 3I75B 3V6FA 2DIAA 4M6OH 2Y06H 1EO8H 5CJBA 5E6ZA 1LK3H 3X14B 1EGJA 3FQXB 3QPXL 5IW3A 1TQCB 5E03A 2CKNA 3EFDL 4LPUA 4DOHE 5CINH 2Q86A 4M4PA 5F1NB 2YD6A 5JOPD 4XCCH 5HJ3B 2K7QA 2WBJB 3DROB 3H7BA 3OKNA 4ETQB 3DECA 1NCCH 3D85A 3SDDC 5I71C 3BRFA 3GMQA 5E8DH 1MHEB 4FG6D 4HIIB 1CBVH 4WI4A 3MV8A 2D7QA 1S9WB 5DQJB 1R3IL 3O6MH 4QHKI 4F37K 2ESVD 2XI9A 1C16A 1E27B 4O2CB 3F6LA 4XMPH 3KJ6H 4JFFB 3MLXL 2F53E 1N7ML 3F58L 1RFDL 3OBAA 1R5WB 2JTDA 1W0VB 3PWJA 2X05A 4RSVA 5I1GH 2IQAB 1INEL 4N8VG 4JR9L 3WD5H 4DQOL 4XHJC 3E6HB 1RZJC 4NQED 5HYJE 4JKLA 4GRLD 1ORSA 2GAZA 4KROC 3K4DA 5IMLA 3TFKD 1PGRB 1UCTA 4FP8H 4GSDL 4UIKL 5TE7L 3LKRB 3VCLB 2R8SH 5MENB 5DK0A 3QJFA 3B8YA 3KXFD 4E42B 5F7NC 3SDXF 3K0WA 4QYOB 4X6FB 5GSVA 4TQEH 1BIIB 1LQSR 5DJ2A 1GHFH 2AK4B 3NGBB 1CLYL 1YMME 3T77A 3QZWG 2EC9U 4KU1A 1F90L 1D9KC 1F3RB 1I1CA 2Z35A 3TA3B 5FFLA 3RWIB 5K9JL 2BDNL 3MJ7B 1B2WL 5C0CD 3LKSB 4HMDA 4LPWA 2L4OA 3QUMH 4JANB 5IG7A 4YO0B 3QUXA 1FAIH 4M6OL 2Y06L 3C9NA 1LK3L 1JK8A 3TVMB 4NQDD 3SCMD 5J8OA 3QWQB 3TT3H 4GXUM 1U3HB 4EN3B 4JRXA 4ZFOB 1KB5A 4OGYH 1NC4B 4PBWD 2NXYB 4PRPD 4P5MA 2VE6A 5CWSA 4RGND 1OGTB 4XXDB 5E8DL 1Z9LA 3HZVB 1HHIA 3S35L 3LN4B 3G5ZA 1CBVL 4K94H 4HKJB 4LU5H 3O45B 4QRTA 4QXTA 3T1FB 5HHOB 3TBSB 2EIZA 4I77H 3ZDZE 4PJCF 1BVKB 3O6ML 4LCCA 2KH2B 3PDDA 1RZIB 4S11A 4KJWC 2GJ6D 4KZEH 4N9GA 5BCAA 4XMPL 1U95A 3KJ6L 1NFDE 4HS3A 3FTGA 3X3FH 4AL8H 5DR5H 3U82B 3O8XC 1A4JB 4P3WA 4Y1AA 2NX5B 3WEXB 5I1GL 1H8SA 4KKBC 4Y2DD 1J8HB 3TO4B 3SN6N 3WD5L 3FFDA 3NZ8A 1AGEA 2BVOA 4U1KA 4LL9A 4YGAB 1UYWH 2H2SC 2FBJH 5C86A 4FP8L 1IEBA 2R8SL 4UNTA 5E24E 4YGVA 1XZ0A 2FJGB 2Y9RT 3NOIA 3HZMB 3FT2A 4TQEL 5SWZA 4U7SA 4NO0A 5ETUA 1GHFL 5IHLB 2N7BA 3IYLW 3V0VA 4PJ9C 1TJIH 5FM5O 1FVDA 1IL1A 1M71A 5D7KD 5DJDB 5CP3A 3P77A 2YEZB 4XZUB 1PKOA 5JMRA 1GXEA 5JHDD 5F6HJ 3MRQB 3WFDH 2EDDA 1XGQB 3QUML 2ICWA 1CL7H 5F9WC 4RMUA 1FAIL 2IANB 4OCXH 3KYNA 5C0JA 1S7SA 3QIWB 2P8PA 2CDEA 1KPUB 3TT3L 2F54B 4H20H 3HA0A 5I8CA 4JZNA 1OAKH 4PTUB 4C57C 2QQKH 4U1GB 1Q9OA 4OGYL 1HEZA 3S5LA 2ENSA 5CUSH 4KKCD 3HNSH 3LCYA 5GGVY 4CMMB 1BD2A 3H0TA 1EEZA 3DTXA 1W72B 2DI7A 3MLZH 5IB1B 2R29H 4PB0H 5DRNA 4FQXC 4K3EH 4K94L 3MRKA 2DM7A 2IBZX 4LU5L 3SE4C 3ZDYE 3BDBA 1S7XB 4I77L 4NZTH 2VXSH 3DJ9A 2A6IB 2ADGA 5L2JB 4PGBA 1OTSD 3IU3B 5I1DB 5DHVB 4KZEL 1YEKH 3TZVA 1SEBB 3X3FL 3I75A 4AL8L 4LLMB 5DR5L 4ZUTB 3JTTB 3FQXA 4APQC 2A38A 1U93A 1I9IL 3VGAB 1DSFH 1YMHB 1LEGB 4NO3B 4MNGB 3TPUB 4XVTH 1N64H 4Z8FH 5F1NA 2QADC 1UYWL 4CADB 5HJ3A 2FBJL 1P69B 2WBJA 3DROA 4Y4KB 4Q9CA 4KRNA 4ETQA 4DKFH 1PLGL 3O9WD 1MHEA 3WNLA 4HIIA 3N06B 3UX9B 4M02A 3ZYZA 3QQ3B 1AI1H 2I27N 1UKSA 5DQJA 4PLKD 4OFPA 2AEQH 4S0TD 3SGEH 3C6SB 1E27A 4O2CA 2VJXA 1BAFH 4NN7B 4JFFA 4PRNB 5E1HB 1R5WA 1J8KA 1FYTE 2HVJB 3WFDL 1PY9A 2IQAA 1CL7L 4ZTOH 3L3DB 4OCXL 1QFWI 1K3IA 2XZCH 1B9ZA 4G42B 2DLFH 2HLFC 3B9EA 4HWBH 4H20L 5CP7A 1OAKL 1M6OB 2QQKL 3IXTB 3ARTA 4EBQL 4E42A 1PFCA 3TCXA 4GG6B 5CUSL 4QYOA 3HNSL 1XGRB 4X6FA 1BLNA 2W92A 1HN1A 4X83A 4MZ2A 4X99B 1P5UA 1JZ6A 4L8SA 4OZIF 2PETA 4XCFH 4PB0L 1RHHB 2C1OB 4Y2OA 4WFHE 2NW3A 3RDTC 4K3EL 3MLTB 4GXVH 1YN6B 2H8PB 3GSQA 2VXSL 4D0CB 4P2RE 1BWWA 4PJCB 2BMKA 3MJ7A 1RK1B 1NJ9B 3DX6B 3LKSA 4KAQH 2APFA 4L1DA 1YEKL 5MI0C 3MV7E 4JANA 4YO0A 1B6DA 3Q1SH 3ELAT 3TVMA 5T3ZH 2EEBA 4RAVB 1D5IH 1DSFL 4OTXL 1U3HA 4EN3A 3A67H 4ZFOA 4OZGE 4WUUE 3VA6A 2XKUA 1N64L 4XVTL 4PJHE 1UXSB 4KK6D 5IFJB 1KTRL 3MLRH 2UWEE 3G5VB 4XXDA 4DKFL 4K8RC 4PJEE 5F9AC 3RY5A 1NFIB 3HZVA 5EO0A 3KYAA 5BXFA 1J0IA 3LN4A 3CFDB 1DBML 3NFPB 4HKJA 5HHOA 3TBSA 3QNZB 5FGSA 2ITCB 1BVKA 3PGCB 4YHYC 1RZIA 2EKSB 3UTSD 1BAFL 1KPVB 3GB7B 1UCBH 1A4JA 2HLAB 2W1NA 5FA3B 2NX5A 3WEXA 3KPSD 4UU9A 5FEBA 4ZTOL 1J8HA 3FN3A 3TO4A 2XZCL 1ADQA 9CGTA 4GMTH 2A0LC 3MGAA 2CR3A 2DLFL 4HWBL 4AEEA 4YQXH 1EAPB 4PJ8D 1KCVH 2IEPA 1GVIA 1KFAH 1ZA6B 1JZ7A 3CX5K 4KK9D 4LRIC 4R9HA 3VWJA 4F37F 5BRZE 1U42A 2FJGA 1QLEH 5C0AD 1BZ7A 3HZMA 4BK4A 5DJXA 3FONB 3D39A 4JFQA 3CVHH 4KVCH 4TSAH 1P84K 1RAMA 4XCFL 1DUZB 1OWWA 3QDME 4GXVL 5DJDA 4XZUA 4OIIH 3NVQA 3IRPX 5DJAB 3QHTC 5TDPB 5DQDH 2EECA 1JMZA 1IILE 3MRQA 4KAQL 4FQPA 1Q94B 1XGQA 1IGFH 1YDPA 2DYPD 3ZYJA 2IANA 3Q1SL 4U4BA 5HSFA 1QACA 3BVNB 4YEFA 3CFCH 4XXCA 4JRYE 5T3ZL 1KPUA 1D5IL 1KJ2H 3FT3B 2F54A 5C0BD 4PTUA 4NCDA 2IPUG 4WFGE 3WXVH 2AXJA 3MLRL 35C8L 4HKBB 3C09B 5SX4I 4CN4A 5E5MB 4YFDB 5IB1A 5F7LB 3N0PB 5IJKA 1MCNA 1GGCH 1M7XA 1FO0B 5FA4A 1S7XA 1S7QB 1A02N 4WNQB 2A6IA 1PBYA 3EOYG 3RUGE 5L2JA 1CGSH 4X98B 5JIKA 1GL4B 3BGFC 5DHVA 1SEBA 5DVLA 1N5YH 4LLMA 5C09D 2Q20A 1F3DJ 4ZUTA 1UCBL 2FEDC 5CZXC 2VITB 1S7WA 3OAZH 3MJ9A 1YMHA 2LV4A 5DD6B 1LEGA 5I8OH 4MNGA 1QBMH 3TPUA 4GMTL 4LSUH 5EU7E 1N0LA 2CUIA 3V6OE 3EGSB 1JHKH 4LGSB 4CADA 4YQXL 1WISA 3BRDA 4GKZB 4Y4KA 1KCVL 4LCYB 1EHAA 1KFAL 1BBDH 1H8OA 2A9NH 2ZWLT 1WIOA 4KKAD 2P43B 3PWLA 1QLEL 1FBIH 4JFDD 4PJFE 3VMNA 2I26N 2MSPA 3QQ3A 4N0YH 4G9DB 3CVHL 4KVCL 4TSAL 4OZIB 5FKAB 4UQ3B 4LSPH 4ALAH 4MVBD 1U2CA 5GZND 1Q8MA 1G84A 3MRPB 4OIIL 5I15H 3WKNA 5LQBH 4L3AA 3CDYA 5DQDL 4PRNA 2Z4QA 5F1IB 2HVJA 1D6VH 1Y6MR 1K4DA 3T0EB 1IGFL 5I76B 5IB4B 5CGYC 1ZKAA 4L8DB 2PUQT 1MFEH 4DK6A 3CFCL 4G42A 2AXFA 4UV7H 4W68A 4YUEL 1KJ2L 4Q6IC 3REVB 1C7TA 3QISA 3PJSB 1IVLA 1M6OA 3IXTA 3MXWH 2GI7A 3WXVL 4TNWK 1KXQE 4UZGA 3T0VA 4DZBB 2CO7B 4GG6A 1P1ZB 3K4ZA 4I3SH 3ZTNH 5DUML 1AC0A 4X99A 1JPSH 2PYEB 1U0QA 1B90A 1RHHA 2C1OA 1GGCL 4A6YA 2FECI 3MLTA 1YN6A 2H8PA 3M1BA 2E9BA 2XTJE 4PJCA 1CGSL 2P8LB 5BS0B 5DMYA 3LRGA 4JZJB 1D7FA 1RK1A 5SWQB 1NJ9A 3DX6A 5I16A 1ZLUH 1D5MA 3PWUB 5F7FA 4G8GD 4FFWC 1N5YL 4J3SA 5ADOH 4K3GA 5ISZE 2V9TA 1R0AH 4O4YH 4RAVA 3LPWA 3VWKC 5JPMB 5I8OL 2NY0C 1FC2D 1QBML 1KEMH 4LSUL 4FN0A 1G9MH 3P40A 7CGTA 1UXSA 1JHKL 3ULVE 3DMMD 5IFJA 1MVUB 3Q48A 2X4OA 1LO5A 1BBDL 3G5VA 4HD9A 2A9NL 1WSST 3OKOA 1QSEE 5CMAA 1QRNA 4CMHC 2UZIH 1FBIL 2X4RA 3CFDA 3NFPA 1J87A 2WLZA 4QNPF 4EUPG 1MFBH 2DMBA 1KNOB 5D93B 4EJ1C 2EXYC 1J12A 2ITCA 4HUVB 1UQSB 4D94A 4LSPL 4ALAL 1N2RA 4P48A 4C54A 4OZHF 3O6FD 4LLAA 2EKSA 3NIFF 5I15L 5LQBL 4L5FH 5FUCC 3OKEB 1JPGB 3GB7A 4X7TB 5D7LB 4F7CB 1AE6H 1D6VL 4YHML 2X89D 3V6BR 5EZLB 2HMIC 2NZ9D 5D2NA 4X7CC 4CU6A 1MCQA 1MFEL 4JREB 4X7EC 5HPOA 4UV7L 4XNZC 4Z7NF 3GRWH 4HKXB 5DLMH 1JL8A 3MXWL 5TF0A 1YZZA 1T6VN 2XN9E 4PV8B 3RGVA 1L9MA 4URTB 3JVGA 4OFKA 3ZTNL 3KYOB 3O2DA 5EDXA 5MHSE 2AQ1A 3FONA 1JPSL 1G1YA 4M00A 4JFDB 1OCWH 4HX1A 1DUZA 1DVFB 3RKDC 4YBLB 5DJAA 4GRMA 5E6IB 4OT1H 4PRHE 4NRYB 5KSAC 3EO9H 5KTEH 2GK0B 2C3HA 4HPYH 5HPMA 3DI3B 4WTZA 2APXA 3BVNA 2X9XA 1R0AL 4O4YL 2G60H 2ERJC 3FT3A 3WJLA 2YRLA 2EYTB 2P4AB 1KEML 2X1OA 1G9ML 3UTTB 1DN2A 1X44A 1T04A 3NPZB 5DXWA 3ZYOA 5E5MA 1K6QH 1FP5A 2CKBH 2UZIL 4TUOA 2EICA 1FO0A 1SYSA 2OTPA 1MFBL 3CNKA 4K94C 4OF8A 3ULUH 2RB8A 4AY0A 4ZOEA 2D7TL 1DBJH 4BKLB 4X98A 2BNUB 3NCCB 1EH9A 4TVSa 3HPLB 4L5FL 2YD4A 3LPFA 4YC2C 3BO8B 1FZOA 1AE6L 4U0RC 3MV9B 5GGUA 4J4PA 2VITA 4NSKB 3QUKB 4DFIA 4ZG1A 1EERB 3RWHA 2ARJB 2KUTA 4P2OB 3C8HA 3GRWL 2YKLH 4P4KA 3EGSA 4FQQB 1HIMH 5DLML 2ZKHH 5EORH 1CDBA 4BSVA 4LCYA 3TIEB 2ADIB 4P57A 4LCUA 4D8PA 5TE4H 2CUHA 3N85H 3BN9D 2FGZA 2DI8A 1J86A 2BSSB 5FKAA 3Q6FB 4UQ3A 3FB6B 3QFDB 4GXUN 4HW6A 3ISWA 5IR1B 4JFYB 4EXPX 3MRPA 3QWOB 2OR7A 4Z7VF 4OT1L 4LKXB 5F1IA 4L9LC 3EO9L 2DQFB 5KTEL 1WFNA 4EI5A 3PIQB 3T0EA 2AI0H 4HPYL 5IB4A 5I76A 3HPJB 4M8QB 4BFEA 2G60L 3VD4A 3QUYB 3PJSA 3NACH 1CXHA 5EWIH 3D69B 5CEZH 1HWGB 3AS0A 4Z7UE 2RIKA 3MQIA 2IPKB 2ATPB 2VKXA 2OJZH 4XP1H 2CKBL 2PYEA 5CEYB 1HQ4B 1NCWH 1I8IB 1OAYH 4U1JB 1T7XA 4MJIA 3MBEB 1M05A 3ULUL 1AHWC 2V2WB 2MHAB 1DBJL 1S7VA 3NCJH 4JDVB 5I6XB 5BS0A 4JZJA 2YPLD 5SWQA 1GZQB 4OZHB 2EYRB 3EW3B 1J5OH 1HXMB 4RMSA 3ARED 3JZ7A 4NM4H 4JHBA 2R0KH 1I1RA 3SY0B 3OB0H 4ZUWB 43CAB 2XYCA 4I3GA 5JPMA 4ORZC 4DKEH 3CFEA 4NO0D 4JB9H 1T2QH 1VADA 2GY5A 2YKLL 4PGCB 1I75A 5J6HA 1HIML 1MVUA 2ZKHL 2P5WE 3QNXB 5EORL 5EO1A 1ZVYA 5TE4L 1U8JB 4JFXA 5IJVB 3N85L 1SJXA 4KMQA 1T6WA 4NQCD 1PEWA 2AP2A 3LKNB 2VLJE 2UUDH 3IAQA 5TQ2H 3LD8B 4P3CL 3W82A 1KNOA 3RAJH 3DVGB 1EGJL 5ESVB 4HUVA 1UQSA 3LOWA 3D25B 5HYFA 2E7BA 1KB5H 1ZLVH 3OKEA 1JPGA 4X7TA 5D7LA 4LK4A 4JM2F 1T4KB 4ELMF 3OG6B 1TVDA 2E8YA 2DBLH 4ZFGH 5EZLA 2AI0L 2EH7H 5E9DB 4MAYC 1CVRA 3WBDA 1BBJA 3ZO0A 5JXAH 4J23A 2HT2D 2MFNA 3T3ME 4HKXA 1CK0H 2V5YA 1MY5A 3NACL 1AR1C 4PV8A 5EWIL 3VI3E 4PG9A 4M9PA 2WNGA 5TF1H 2IBZY 1W8OA 2QHLA 3FQNB 3UTOA 3KYOA 4F57H 4HDIB 2OJZL 4XP1L 3VXNB 5F8QC 1NCWL 3QFJD 4OV6F 1OAYL 3RA7H 1DVFA 1A9BA 3LMJH 5FYKU 3S4SA 2EE3A 3LHPH 5E6IA 3NCJL 4F58H 4LVHB 4NRYA 2H2PC 2PTVA 2GK0A 4KQ3H 2EIDA 3UJIH 4F7TB 1CDJA 4NM4L 1IJ9A 2E9IA 2R0KL 2ICCA 1MUJB 3VD3A 3PQYA 4DKEL 1X3DA 2EYTA 1CLZH 5EU4B 4CN1A 4JB9L 4NC1E 5F97E 5EUOF 1T2QL 3KNBA 3UTTA 3T2NL 3QHFH 1R3JA 1TTGA 5CP3H 1WWAX 2DD8H 1JRHI 3O3DA 4ESKA 3JUYA 4X6BB 3TN0D 5TQ2L 1YUHB 4G6JH 5SX4H 1TZIB 3MRLB 4GW5B 3RAJL 1QSFB 3HCVA 4Y4FA 1F3JB 1GGIH 4BKLA 5IFAH 1Z0NA 2BNUA 1J0ZA 1OGAA 1OSPL 4HIEB 4WW1B 3HPLA 3TIDB 4Z7VB 1KB5L 3L3OB 4Y5YB 5D7JC 4XAKE 3MV9A 4NN5C 5I1EH 4OI8A 4GUPB 4L29B 4ZFGL 4M1CC 2EH7L 4NSKA 1ZS8B 3FOMA 5I1IH 4FOMA 2ZSWB 5FOJA 2VISB 5JXAL 4QGYA 1ZGLM 4IMKA 4P2OA 5J12C 4L3EB 4FQQA 4ZUUA 3RNKB 1CK0L 3JV0A 2K7PA 3WO4C 2Z9TA 3ARWA 4L4TE 1BQSA