4ALAH

Structure of dengue virus diii in complex with fab 2h12
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
208
Chain Sequence
DVQLVEPGAELVQPGASVKMSCKASGYTFSSYWINWEKQRPGKGLEWIGNIYPGSGTVNYDDKFKSKATLTIDTSSNTAYMQLSSLTSEDSAVYYCTRGGSHAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSGSLVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus 3
molecule tags Immune system
total genus 38
structure length 208
sequence length 217
ec nomenclature
pdb deposition date 2012-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4alaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4alaH02
4F15C 4FTVE 2YUXA 4OZIE 1Z2KA 1T2XA 1P7HL 1B2WL 1CFSA 3MREA 5CZXC 1A5FH 3GMNB 1I1FA 5CGTA 3V9FA 2CPCA 3PXJA 4NKOB 2OR9H 4X7EC 1TNMA 2P5WB 3FQNB 1HK6A 4KMQA 4JFED 5KSBE 5M94B 3MJ7A 3AVEA 1BOYA 5J1AA 1KACB 1FN4A 5GJSH 5I16A 3BPCB 5DUPL 4KDTC 5IF0B 1XCQB 3SGKA 1EO8H 2NR6D 2NY1C 4U49A 4NWTL 4JRYD 4NZUH 1JYWA 3IYLW 1LO2L 3KWWA 3BN9D 3LEYL 5B38G 1WITA 2EZ0C 3QSKB 4N0YL 3F65A 4J3VA 3CX5K 4YDLB 4K9EL 3PWPD 3KJ6L 4QHNB 2EDEA 12E8L 2EIEA 3OXSB 1BAFL 3VGAC 3R1GL 5ITFA 2VE6B 4CMHB 3VXQA 3EYQC 3T0WA 3RVVC 1A1NB 1IFHH 2CIIA 4PRHD 1CK0H 2X7LA 1X9QA 4P2OC 3TIDB 1MWAA 5EUKA 4O58L 4NO0A 4L3EA 5ESAA 2FEDC 5DO2D 2OQJB 4R6UA 5SWSA 1YN7A 3TBSB 5JMRA 1U3HD 4QHLA 3HB3D 1AD9A 5DURD 3DO3A 3EOYG 3VFOA 4JFDD 1EAPB 2ENSA 5C07E 3L3OB 3QISA 3I6KB 4QRUB 1IAOA 1SEQL 1PKQA 3C09B 3SKNB 4BSVB 5IV2A 3KJ4B 5TDNB 3B5TA 1CDBA 4NQUA 5INCA 5FO7B 4B41A 2V2WB 2ILLA 1NDGB 1U91A 3D0LB 3EDJA 2BMKB 5LWYH 4L1DA 1ZLVH 2V7HA 5GRVK 1PKOA 3FB5B 1ETZB 1RZJL 4L8CB 3GSUA 4S1DC 1S7SB 4KAQL 3FQTA 3SQBA 1WC7A 4FQ1H 3H9SD 2YD4A 3P9MB 1W2KT 4TVPH 2CK0H 4XMKL 2ZCKH 5I66B 1IAIM 2VN7A 5TE4L 2DQIL 3ULVL 4R4ND 1XF2B 2GJ6E 1BQLL 4L4TE 3PGCA 4U7SA 2J88L 3ZDZE 4BUGA 4Y88A 3U7YL 1ZT4A 3RL2B 2DJUA 3BKJL 1UYWH 5C8JB 1B0RA 4CMMA 1LE9B 2YMXL 4Y89A 4OUUA 3P4NB 5MHSD 3QB7C 4PJCA 4QRRA 4Z78B 1ZE3C 2AJ3A 5LQBL 2LABA 4PV9B 1OSPL 4Y2DB 1I85C 1YQ2A 5GS1B 4TRPH 1ED3A 4QTIH 3V8CA 4EVNA 4PJIA 2PXYA 3RIAK 4F2MA 1F11A 2P8MB 3WIFB 2FBJL 4WUUD 1NDMA 3MNWA 3CFCL 1S5HA 2JB5H 3HPLB 5ITBL 4GG6F 3QCTL 4Y5VC 3IF1B 1I75A 3TVMB 1FAIL 1HHHA 3L7FA 4LCUA 1UZ6F 1FL5A 4JFFD 2W60B 5FYJL 4J8RA 3RY6A 2A1WL 5DJZA 4E5XB 3F12A 3D85B 1LO3H 1UVQA 2X05A 3O4OB 3B9KA 2W0LA 3QWQB 4PTUB 2DBLH 3DROB 5JLZA 2EE6A 3BX7C 1SJHB 1T3FB 1VPOL 4MNGA 1WZMA 4XP9L 25C8H 5D9SA 1CS6A 2DN7A 4M6AA 1FO0A 2HN7A 5EU3A 1CGVA 4FFYL 2EZ0D 5D7JA 4YBHA 3UZEA 4DKAA 4WO4B 3X12B 5HYJE 5J13C 1S9VA 2X1PA 5DEZA 4P48A 3B2UD 2DI8A 4DZ8B 3LKOA 3QEHA 2ARWA 2DQTL 2YA2A 1NMAH 4JPIB 5E8OA 4XPFH 2XV6B 3SPVB 1URLA 4Z7QF 1LEIB 2VDNH 5IEKB 4R96B 2VQTA 4EKXA 1BX2A 5B38A 3FHQA 1MLBB 1QZ1A 4YZFF 3BDXA 2BY1A 2HT4C 3TF7C 1CZ8L 3TPUB 4XNYL 3DSNA 4R4FL 2AGJH 3L3HB 4JLRB 1YEKL 4UI2A 4NM8H 2HP4A 1VEMA 3BAEH 5DS8B 2GEEA 2O93L 1W0VA 1D6EB 3MRCB 3LS4H 1M4KA 5I1IL 4DEPC 2VLJD 3HFML 2H2SC 2MCPL 3SBWA 3SCMB 3V0VB 1JPTL 3C5SA 3MRPB 3P4MA 2WMPA 5E08H 3OB0K 5L8LB 3QHTC 2W9EH 2NX5A 1H5BC 4G7VH 3G9AB 4GG8A 1R5VB 2WBKA 4PTTA 4XNXH 2F19L 1U8HA 3MLXH 4CKVX 2I9LB 5BRZE 4M5YH 1I9JH 3OKOB 4F7TB 3BUTA 3ZL4L 3MBEB 5IESL 3ZTJH 4FZ8H 1ZGLB 3S88H 1HZHH 5F6IB 4YQXH 1VFAB 5AZEH 2IH3A 1OLZA 1K6QH 4FZEH 3DBXA 3OG6B 1WIUA 2EDQA 4PJ9D 3MNZA 4P9MH 1BVKA 1KXQE 4F7MB 4ZAKA 4J3WA 5I74C 3SKOA 3NIGE 1HHKB 1UQSB 3QPQC 2B4CH 3OPZL 3EHBD 1C5DB 4BQ9A 3OKLB 3QBTB 1U8PB 3V4VL 1FGVH 3TP4A 1XAUA 3VFSB 1BIIA 1BP3B 4PJGE 5FUOL 4ZXBB 3T3MF 4B5EA 3O3DB 1U0QA 1CFBA 5GIRB 1J87A 1U3JA 2DJ4A 3BGFB 1RFDL 1L6ZA 5D8JL 4MD5A 3QUXB 4XI5D 3HAEH 1J88A 1OCWL 5CHNA 9CGTA 2DDQL 1MSPA 1DUYA 3E2HB 3UDWA 3V4PL 3IFLH 1JHKH 3B5HA 1A3LH 4LF3A 1EHNA 3LN9A 3KPQB 3TNNB 4OFDA 1DLHA 3IJYB 4R7NB 4Y5XA 4HAFA 4RDQG 4NJAL 4I9WD 4HULB 3TT3L 5DVKA 5IOPA 2R1YB 4M7ZC 5JW3L 3IETB 4MA3A 4HWBL 1S7VB 3BT2H 1S9XA 4X4MA 1KCVH 1ZA3A 4LU5L 5C07D 4X5XA 3G5YA 3MA9H 5EZOH 4QYOB 3NPZB 1GGIL 4ZUWA 3HN3A 1L7IL 1RHHA 4G9DA 5TDPA 3WEXA 1JP5A 2WQ8A 5EZIH 3MV8E 2BJML 5C0AE 4W6WB 4W6YB 3U7WL 1VGKA 2FBOJ 35C8H 4UINH 4GQ9H 1FDLH 1OB1B 1FBIH 4NQDE 4NQEE 5SX5K 3CFDA 2GAZA 4R7DB 4JM4H 4YIQB 3UTTE 4ELKB 4KJYB 3BIBX 4XNZB 2WIIA 2VDKH 3MLTB 5E8DL 4LCCC 5B39A 4P99A 1BQHA 5F1IA 1AP2B 5FGCB 5BVJA 2F53B 3QDHA 5IKCA 3I6LE 4V2BA 4AJ0A 4QOKE 4DVBB 1D5IH 4M48H 2FGWL 1UXSA 4KPHH 1NLBL 3KYOB 3GZKA 5F9WB 4JDTL 4RWYH 3QUYC 1D5ZA 1RUAH 2GJ6D 2OTWA 3RL1A 1AIFA 4Y4HD 4WU7B 4ZFOB 5K9OA 5L2KD 4UTAH 1T2QH 3TCXA 3LB6C 4H25B 4PJ8D 2DICA 4Z7VB 4MX7A 4U3XA 3X3GL 4Y5YA 1OAYL 4I3GA 1OM3L 1WBZA 3BSZL 4OD1H 1NANH 3J7HA 2LTQC 2GY7B 1U58A 3LS5L 1CXFA 3JV4A 4LSQL 2H3NA 4I18A 3CSBA 1UJ3C 3T0EC 1EBPA 1SEBB 5DVNA 2ESVB 4LKXB 2BK8A 5ADPL 1Q9KB 3HRPA 4ZUTB 3GBML 1FPTH 2H2SD 4CADB 1FRGL 1AGEB 1NC2A 3BQUB 2QR0B 4GAJH 3T0VA 4ZPTA 1K3IA 2EEDA 3LEXA 3CX2A 3QFJE 3BGMB 4JVUA 3VGDA 3S7GA 1W72A 1JV5A 2HWZL 1QSEB 5DD0H 1OSZB 1EHLH 1YECL 1JWMB 2F74B 3HTLX 1RVFL 5CD3A 2ZUYA 1BOGA 3NFNB 2BVTA 2B0SH 1AD0A 1XGRA 1G7QB 3MROB 2BVUA 1SBBA 1SMOA 5BOPA 1YC8A 3UZQA 2F58H 2HG5B 4F57L 1MI5B 1QRNE 3J8F7 3ESVF 1IGIL 3VWJA 2Z8SA 3QWOB 3JWDL 5CSZA 4JR9H 4G8EB 1RU9L 4X9BA 3LEVL 4LNRB 4YO0A 5C0JB 4YHML 1DDHB 4M61B 1MFAL 3W0WA 1S3KL 1OP5H 4U1JB 4L4VA 1QRKA 4CW1B 1K8IA 4QGYA 3F7QA 1KYOK 3CFEB 4GRWB 5EO9B 3DV6A 4ZFOL 2ADGA 2VZ3A 3NFSH 1BEYH 4FG6D 3IXAB 4GMSH 5KN5A 3DVNB 4CNIB 1L0YA 5F70A 3ULUH 3MRRB 5E99L 2A9NH 4D9RE 2VXUH 4XCFH 3DMMC 2C4FU 3P73B 4LVEA 4WWKB 2FD6L 5AZ2L 3L6FB 4YPJA 4POZC 2KBGA 1KGCD 2XRAL 3BPLC 3QCUH 3EO9H 3FAXA 4NNPL 5I1GH 1OP3H 4PGBA 2Q6WA 4UNTA 4HAGA 2Q1EA 3HS0B 5C0ND 3RX8A 3THMH 3KDMB 4L3AA 3PP3K 4PS4L 4RNRA 4TULL 3C08L 4UQ3B 3QNZA 4HIXL 2FATH 4XNQA 3L1OL 1ZTXH 4XVSH 2LAAA 3V5DA 2R23B 5CEXB 3GJFA 3B9VA 4KI5E 3DUSB 5IBLC 3TWCH 3MRKA 2YWZA 3AXLA 1FG9C 2UZIL 2DQHL 3VFRA 5ADOH 5GJSL 3FQUB 4LSSL 1IQDB 3NCYP 5BRZD 4E42B 3OJVC 3QUYD 1Q0XH 1EEZB 1JRHH 4Y1AA 5C0BA 3K1DA 1CTNA 1I3UA 4HS6A 3WNNA 2YD6A 4NZUL 5EOCL 3O41B 1KENL 4Q9QH 1MUJA 2DIJA 5IHZB 4D8PB 1B0GA 3DWTA 4GBXB 5BS0D 3FZUD 1DQDL 5E8EA 2ATKB 2YPKB 3OR6B 2AVGA 3JUYA 4UBDC 2F54A 1J05B 1YPZB 2V5RA 3Q1SH 4ZUVB 2AJSL 4BZ1L 4YC2C 4RX4A 2A83B 3KPTA 4LSUL 4LQ1A 5ISZA 2Q8BH 1QR1B 2BOBA 3LPGA 5CP7B 2NW3B 3C9NB 2XWBB 1XGQB 2GYSA 1BBJA 5F7WC 4BKLB 5I8KH 4ZO8A 3VFGH 2FWOB 2O61A 3FOMA 4XXDB 5FECA 1UA6H 4TSCL 5D72H 3TGXA 5ACZA 5DR5L 4KMTH 2J6EL 2WWMD 1EX0A 1A6PA 5ECJE 4DAGL 1A64A 1BFOB 2FL5A 2HAZA 4O02H 3QG6B 2VDMH 3R4DA 5T3ZH 4ACPA 4YHYC 3I50L 3QZWB 4Z7WE 2IMMA 1KJ3H 1NUDA 8CGTA 4N8CH 4FP8L 4HDIB 2YK1H 3M07A 3MV8D 2AEIT 2RIKA 4JG1H 4KGLA 3D3VB 5KVFH 4BH7A 4FQJL 2AABH 4TVPL 2CK0L 2ZCKL 4NQDD 4KI5C 5KVDL 3WKMH 3UTTD 4XBGB 3GUTA 4G42B 1S7XB 3UBXB 3O6KL 2X4NA 1VACA 4PRDB 4Q6IB 3IJHA 1WBYB 3O6FC 4QOKD 5I76B 1AHWB 5LBSH 4AMKL 43CAB 2FLRT 1AGCB 4R0LB 3PQYB 3SGJA 3V6FA 3DXAE 3VXRA 5DRXA 4ETYA 3L3GB 5F3HA 4HUVA 1NAMH 1T0NB 4UUJA 5DJDB 2ZKHH 4IRJD 3DO7A 5IEHB 5DZNA 5T5FH 5KS9E 1CVRA 3MLYH 1I4FB 2NZ9C 2Z35A 1UWGH 4JVPA 4MCZB 5JOPE 3W39B 1KBGH 4NC0B 1K8DA 1YMMB 4YAQA 1CLCA 1WUNT 2IAMC 5ICZA 2VLME 4LCWA 2Z91B 1I9EA 4MA1C 3OKYA 4OBSA 4LASL 5D1XA 4HGMA 3RWGB 4KHXL 4RFOL 4X0KB 1DEDA 1KSRA 4JFYA 4MB3A 1AO7D 1SJXA 1LHZA 4XBPB 2P5WE 2DIAA 4QWWD 2Y5EA 1E4KA 3BUYA 4XNUL 2GITB 5IWLC 3OL2A 1CICC 4S1QH 1R5IA 5JDJA 3WBDA 4U0RC 5FYKH 4MDJB 3ULVE 4K2UL 3IDIB 3H9ZA 2VZSA 5A2JH 1NBYA 5I19L 5F1NA 1OWRM 2GHWB 4OZHF 2Q86B 3BP6A 3BPOB 2K9UA 2ED7A 2VXSL 2YXFA 2Y06H 4ONGL 1U8JB 3S36X 2H26A 1U8LA 5DDHB 5B8CA 4YNYA 1MCDA 4M5ZH 3IFOA 1HYRC 2HFEA 3FO9B 4RA3A 3GIVA 2HRPH 1A6AA 1IGYA 2R29H 4XPFL 4MAYA 1I1AC 5FGSA 1NQBA 2XN9B 1JI1A 1LQSR 4P3CH 2VDNL 2BCKA 4LQFL 4K9EC 3RZCD 1KB9J 3TBTA 1CWVA 3PWVB 3MUZ1 4OT1L 3X13A 3EOTL 3BP5A 4X5WB 5EN2B 5KSUB 1WFNA 4JFPA 4WW2C 5CP3H 5E2UH 4PJEA 2C3VB 3KAAA 5FYJE 2AGJL 1FG2B 1NAKH 3ARFB 4LLWB 2E9IA 5F88B 1FL3B 3BAEL 2UWEF 4Y8DC 2JCCA 1GJIA 3FCTA 1FYHB 2YUZA 4WTXA 3LS4L 4PJHF 4HKJA 2Y25A 5HVHC 1MCHA 4JN1L 4AH2A 4QRTB 4APQD 5CEZH 3QEUA 5LKNA 3WXWL 2K3TA 5JHDD 3IDGA 1QBBA 2VR9A 4FFWD 1MCPH 4PRID 5GS2D 2DKUA 3TH2T 2AK4D 5IJKC 1EHAA 3PGFL 4K8RL 1UZ8B 1WZ1L 2AJUL 1QA9A 3TYGH 4MNQD 4UIMB 3S36L 1OAZH 4QHUB 4ZDHA 2GTWB 4E41A 2P24A 1P7QB 1RZJC 4FZ8L 4HHAA 4RIRA 5C70A 3GBNL 2CXKA 4PB9H 2EYSB 3VFNB 4J2XA 3MYJB 1GZQA 2EYTB 2VXTH 2YPLA 1G0YR 5ALCL 3KG5A 2FX9H 4ODSH 2R2BB 4M7JH 4Z0XA 2EO1A 4OGAD 5D2NB 3D25B 1SM3L 5D5MA 3RVXD 1R0AH 3C8HA 1ZLVK 3I2CL 5DI8B 5DJAB 3VFUA 4YR6B 2NZ9D 2FIKA 5F8QC 2OMNA 5IMLA 3MGOA 3GSRA 4NQTA 4YDLC 3IGAA 5FF6A 4I0PA 3I75B 1MHHB 1BFSA 5I1HH 4NQCD 2BFVH 3V2AR 3MJ8B 4CMHC 3L7EB 3MRDB 3S35X 1FIGH 4AIZB 2JIXD 4O2CB 1OQOA 1A2YB 4N1EA 2VABB 3DRTB 1DQJB 5F7NC 4P9HH 3RUGB 3VXSE 1CICD 2AEPH 4ELMB 1QFPA 3BRFA 3FO2A 3QRGL 5D6DC 4GRLB 2DM2A 4LAQH 4O4YL 3GSQB 4GW4B 4FNLL 1CIUA 1ZANL 4X80H 3T77A 3HE7D 3C09C 3FOLA 5D7LB 2E9JA 1K9TA 2CLVB 3KJ4C 1N6VA 2WWKO 3QDJA 3O2WL 1ZK9A 2ZUXA 1IARB 3WS3A 3HZVA 1Z9MA 4X8JA 2NY0B 3IT8D 5FKAA 3WJLC 4UINL 1FBIL 5AWNH 3PJSA 1DVFB 3PL6B 3F7YB 1CVSC 1RJCA 3NIFF 2NW2B 4EBQH 3WFHA 2E7LA 4PRNA 1A6ZA 4HEME 3TJHD 4KPHL 3LQAH 1FNEB 1UM5L 3MFGB 4W4NA 4W81A 2ARJB 1G7IB 3KYNA 5F44A 4HS8L 4N5EC 5F7FA 4LMQI 2APBA 2ZCHH 4L8SB 1ZLWH 1R3IH 3DXAD 3S35L 1ZGLP 4I3SH 4F8QA 5I1KL 3ALWA 2ZOKA 1DL7H 3AB0B 1MY5A 1GOGA 3MRFA 5DJ6B 3MTRA 5ENWB 1QQDA 4Z76A 4YHIB 5TE6H 2HVJA 3IU3A 4Y2DC 2HYMA 5GS1C 4JGJA 2ITCA 1EA9C 3NGBB 1G0DA 2IG2L 3KPSB 4Z77A 2G5BA 3PWUB 5JA9A 4PJDA 4D9LL 4DTGL 4FQCL 5GS0H 2QKIA 5DD0L 3MREB 4EDWL 5T1MB 5FA4B 3TVMC 5J89A 1S7QA 1I1FB 3UZVB 2E8ZA 4N0UE 4XRCA 3ETBF 2QQKH 5D1QB 3GEWB 5KJRL 2MQ0A 4GXUM 4TPRH 1KIPA 4XP5H 4Z0BH 3O4OC 2APWA 1IZJA 4CN4A 1K5NA 5J1AB 4W70A 3OR7A 5E9DA 5HHPA 1FN4B 3ULVD 3RGVB 4JR9L 4GMTH 4LARH 5IHLB 2ZJSL 2CRZA 3QDMB 5I1EH 3CVIH 4OLZH 4IOSD 4O9HH 5EORH 3C5ZA 3TZVA 4M3JA 3CSPA 4W68A 3TO4A 2IEPA 3G5ZA 4K3JL 2EDTA 1PG7X 5GRXG 4ZSOA 1KXVC 3KS0H 4P5TA 1T5XA 4WO4C 1ZHLA 1EERB 3BPNB 1JPSL 3BZ4A 2YZ8A 2YRPA 5JZ7C 4M62H 3GM8A 2VXUL 3MR9A 3DNKA 2CIIB 1DBBH 2EXWC 4NO0B 3ULSA 4NKQB 2VLLA 4ZNEA 4L3EB 4OFPA 2UUDK 3WDHA 2CLRA 5SWSB 3RJQB 1YN7B 3JWNC 2DQJL 3KS0J 3ZDZF 3DVIA 1D9KA 4TUKH 2XZQL 4QHLB 1INDH 5D7JD 1WWCA 4U7KA 2FATL 1PGRB 3L95A 2JELH 1PBYA 1T7YA 2VDLL 1IAOB 2JK5A 1PKQB 2Q3AA 5IV2B 1AXIB 5INCB 1GSMA 2BX5A 2FSEA 5F71A 1N6QL 5HHMB 3SCMC 4RMRA 3OGCA 4X6FA 4DGIL 3EFFA 5DVLA 2V7HB 3OG4B 1JFQH 4WEBL 3VGFA 3CIQA 4RMWA 5CWSA 5EWIH 3RKDC 5FGCE 1IAII 3GSXA 2F53E 2DLIA 1T7WA 1PG7L 1WC7B 3B9DA 4KFZC 1T7XA 4QRPB 2IJ0C 3W5MA 3HUJF 1S5IH 1AXSA 1CDGA 1LDPL 4IEFB 4L5FL 3QEQD 1I7ZA 3MBEC 4XC1L 5EOQL 5I1AA 5SV3A 5DQJB 3AS2A 5F6IC 3H7BB 2QSCL 2FZ3B 4Z7VE 3O11B 1A21A 1QYGH 3JTSA 1NJ9A 1MCFA 3F6LA 1NCAH 1B0RB 4J3XA 4W4OC 3GMPB 2P5EA 5CUSH 4OUUB 3EOBA 1CD0A 1OF2A 4PJCB 2X6MA 4QRRB 1ZGLM 2AV1B 2ESVE 5E8NA 4Y2DD 5JXAL 4R9HA 5E6IA 1CR9L 3IKCA 4PLKD 2O26U 3ARPA 4NCC2 1JF5A 1ZEAH 4FQHA 4LIQH 4ZXBC 1GC1C 5FO9A 4PJIB 2PXYB 1R3LA 1EGJH 3BGFC 5LGJA 1KIUA 4ETQA 3MNWB 2HTLC 1OAXH 2DL9A 1S5HB 4C56A 3QUXC 1EK3A 1BPVA 3CZFA 1U93B 3E2HC 3MODH 1QSEE 2V17L 1K4DB 3DETD 4EN3A 1HHHB 3L7FB 4LCUB 5JW4R 3AAZB 3D2UB 1CE6A 4X9HA 2P4AB 3UC0L 4J8RB 1S78C 5HDOA 3VXSD 1XIWB 3TYFB 4EI5A 5DJZB 5AD0A 1WWAX 3F12B 3IAGC 1UVQB 1YA5A 1F4WH 1E0OB 4POYA 3AM8C 1MI5E 4OLWH 4EQ3A 2M2DA 4XPBH 5T5NG 2NY2B 4DN3H 4C4KT 1P7KA 1KULA 4MNGB 3QXVA 1J12A 3DHMA 3MOAH 3UO1H 3BEWB 5AAWA 2IADA 2YZ1A 4P0DA 3UYRL 1FVCA 2HN7B 5EU3B 4JVWA 4G80A 3VXPA 1P4IH 1UFUA 3WKML 3JWDC 4TSBH 5D7IA 1B6UA 5GGRY 2XPGA 4XNZC 3L5HA 5E2VH 3OXRA 4HLJA 3SOBL 4KK6C 5L6YL 4NC1C 4G43A 4NO2A 3LIZH 3EOAA 5EUOE 5T1KA 3QEHB 5F9WC 2NY6D 3CDGB 3T3PF 4MJIE 5D7SL 1YNLH 3GNMH 3HI5H 2A77L 3QPXH 4NQVB 4EUPG 4YFLF 1IEAA 2BY3A 3BH9B 4C83A 2ZG3A 1F5WA 3G6AB 2LU7A 3I9GH 5ICXA 2DF3A 5IFAH 3FMGL 3X17A 3NIGF 4JG0L 4A6YB 1NMCB 1TZHA 1LEGA 1RJYB 1YY8B 2D03H 2VMFA 3K2UH 1TVDA 1IGTB 5ILTH 4XXCA 1W0VB 4XP6L 1TJIH 3N1GC 1MCJA 1P1ZB 3BQUC 3IVKA 3P4MB 1FH5H 4HIIA 4P2YA 3ZHLA 1HSBB 3RVWD 4NWUH 2WUCH 2APVA 3ZYZA 4AEIH 2NX5B 2R4SH 4TVPE 1QKZL 1BJ1H 3ZKMC 1QSFA 4YHKH 3MBED 2A6KA 1XR8A 4IJ3B 5DEGA 1OGAB 1WZLA 2Z31A 3L5JA 2IH3B 1IKFH 4OKVB 3DBXB 5K9JH 4WFHD 3MNZB 1H3TA 1ERNA 1NC2D 3B8YA 4M5ZL 2XA8L 4ZAKB 3NH7H 3SKOB 3SE8H 1BVLA 4L29A 3SDAA 4HCRH 1BZ9B 3GSNH 2R29L 5KTEH 1RJLB 1YPZE 3ARBD 3PF2A 1BJ1J 5I8EB 3KR3H 3R8QA 3H42L 3EYUL 3QUMA 1FHGA 1XGYH 1LVEA 5EC1B 3QUXD 4JZOA 1GGTA 2YBRA 3EDFA 4V1DB 3ESUF 4RZCA 4XWOC 2UYLA 5CHNB 3NN8A 3JTTA 1I8LA 4NNXA 3DX6A 4WWKC 4LOUC 1Z9OA 4ODBD 2H2PC 1CIDA 2P44B 3I02A 1WLHA 4NT6A 4PJAE 4R26H 1JYNA 5D7KE 1DLHB 2OBGA 4HLZG 3SN6N 1U8KA 4A6YL 4JZJA 1EEYB 4B7LA 3DVGA 3UXFA 4MA3B 1CF8L 2YRZA 2DTMH 1S9XB 5A3ID 1ZA3B 4X5XB 4HWUA 2LV4A 4FQQA 4ZUWB 4LBEA 2OK0H 4F58L 3MJGX 4ZFZB 5TDPB 3OSKA 1SY6A 5FM4A 3RWFA 3KPRE 4LHUG 1MCSA 4QT5A 4WJ5A 1CDJA 2JB6B 1NCWL 1VGKB 4HUUA 4RMSA 3CDFA 1NEUA 4U6VH 3ZKNC 1JF1A 2HKHH 4NOFA 1HIMH 2GAZB 3M17A 4EDXA 2WIIB 1DTUA 2ZWLT 3QIWB 1X4ZA 3GHEH 3WUWG 2NYYC 3KLSA 5BVJB 1JL8A 4XNMA 2R4RL 5IGXH 2X4OA 5EPMA 3WIIL 4OLEA 2ZG1A 3VD9A 2FX9L 4JO4H 1XT5A 3D39B 4QHKI 1D6VL 2OTWB 5HI5C 5EO1A 3RFZC 2JLLA 1LO0L 4JZNA 2P49B 3GMRA 3QO1B 5HYQA 4HXAH 5KSAA 4MX7B 4GBXC 4ENED 3FFDB 1HDMB 4UQ2A 4YBQC 1U58B 5E4IA 2H3NB 1YMME 2E7CA 4PGJA 3OGOE 3BP7B 1QFWI 3O6LL 1YYMH 2HH0H 5C0GA 1CGUA 4X6BB 1XH3A 3MJ9H 4KV5F 1TZGL 2R0KL 1KC5L 4NZTL 3WO3B 4D94A 4EUPA 1CD1A 3BMWA 4P9HL 2OJEA 3I85A 4G6AD 4QXUL 4WY7L 1S8DB 4G8GA 3ALPA 4L8BA 3RI5F 1IC7H 3U2SA 1QSED 5A2KH 1CFNB 2E3VA 4LAQL 5DD5H 2YD3A 1HINL 1MLCA 2EE9A 4J4PA 1MJ7H 3QFDA 3MACL 5CD3B 2FJFB 3C2AH 1J1XL 3UX9B 3V7AE 3EJJX 5J56B 5ETUA 1AD0B 2CRIA 4FQXA 3TFKD 3JVGA 2F54D 1CQYA 4HF5H 1T83C 2VLRA 3VWJB 2BDNH 5C6TL 4UB0L 4RX4D 3NCYS 3REVB 1LILA 3P11H 4YO0B 2DLGA 3W0WB 1WZKA 5MI0B 1DLFH 1MPAH 4L4VB 3RVUC 1K8IB 4NQSA 2YD5A 4Q6YA 3ROLA 3UTZB 2MQCA 4XTRC 4OZFG 2C1PA 4XPHH 4R90H 4OV5A 4Q6IC 1WJ3A 3NTCH 2WLYA 5IBUG 2H9GA 2EO9A 3RIAF 1OGTB 1AHWC 3P9LB 1XGTA 4R0LC 4FQLL 3VD7A 1V3JA 4YUEL 5I8OH 4IOIB 4X98A 4MJID 4UDUA 2DD8L 3V0WH 2CDFA 4LHQB 1T4KB 2BVEA 4KRNA 4U1NB 2CGRL 1QO3A 4MVBC 2W0KA 3VG0H 4KU1A 3DV4A 3LN4A 4PGBB 3HC4L 2Q6WB 5LCVH 3JV0A 3S37X 2EIDA 2QV2A 4N0RA 1WK0A 2F5AH 4X6EA 5C0IA 1FNFA 3DURB 1I9IL 2FRGP 3WNLA 3MQIA 3QNZB 1TTFA 2QADD 4BSWA 1BFVH 3H9HA 1LEKA 4PJFA 1MFCH 2PO6D 1NPUA 3LMJH 3G6JA 2B5IB 3V5DB 4U1KA 3ZKND 2YSSA 4MD0A 3GJFB 3KYKL 5SX4I 2ADJB 4F9PC 4NCDA 3WHXB 2Z92A 3GI9H 2QBWA 4LEOA 4WTWA 1ZMYA 4K8RC 1KPVA 4TVPD 3O45A 1OD9A 4HS3A 3STLA 3VFRB 2LFGA 4KK9D 1M1SA 1RV6X 4U1LA 1CYGA 2X1WL 4PUBH 1O7VA 1EVUA 4LHUA 5C0BB 2CD0A 4HS6B 5EORL 3VA6A 4MXWL 3MV9A 2HKFH 1QLEL 4GFTB 3R8BB 1MUJB 3WHE1 3BPOC 3BWUC 2MPAH 1B0GB 4NOBA 4PJ5A 1V7NL 1IM9B 3N1PC 4WNQA 5TFSL 4KK5D 4Z7WF 2IBZX 2EDLA 3DUUA 5E7FA 5DMGC 4DUVA 1I3GL 2NXZB 2XTJB 3OJDA 3LH2L 1BQSA 3VW3H 1ZXQA 3WIHH 1DBJL 1Y18A 1KN2L 3S37L 5E03A 4DW2H 1QR4A 4NHUA 1TPXB 2VN4A 3ME0A 2GT9A 1ACYL 4NRXA 5ISZB 1NKRA 4N8PA 3D87B 2BOBB 3FKUS 1KPUA 3W2DH 3RUGE 2BY0A 2IPUK 3VXOA 4YX2H 4TUKL 4PG2C 4AZ8A 2O61B 1E27A 43C9A 5AUMB 5J11B 4XX1E 2JELL 5BO1H 3ARFC 4QXWA 3S3JA 1F42A 4KMLB 4D3CH 3WFBH 5D7LE 3U9PL 2FL5B 1YEFL 1T22A 3SJVE 1AGBA 3E0GA 4BELD 3BJ91 1X3DA 3I84A 5CILH 5KS9F 2W0PA 5K9QI 3SQOH 3H7LA 2XXCB 1Z5LA 2Q7YB 5EWIL 2QSQA 1TXKA 3KPRD 5F1KC 4Y4KA 4JJ5B 1KELH 4G7YL 1HHJA 4JAMB 4BH7B 5EBWA 4P57A 1L9NA 3FFCA 5F9OH 1MFNA 1V3KA 2AJYH 1MF2H 4PG9B 3LSOB 2YWYA 1REIA 1VACB 2DM3A 4YHLL 4G3YH 5DUML 3IJHB 3ULUE 2CJUH 2NTFA 2PYED 1A1OA 4XH2A 4PJCF 5EU5A 4PBXA 1C5CH 2GI7A 2MMXA 4JEGB 8FABA 3V6FB 4MQTB 3VXRB 1IAIH 4FXGA 3RNQA 5DRXB 1KIQA 5D2NC 3OAYK 4NN5B 4P5MB 4KKBD 2IC2A 3QXTA 3O3UN 4OF8A 3UCRA 3W82A 1VSCA 3DO7B 1LP9B 2FX8L 4AG4H 1AQKL 1T1ZA 1CE1H 4GXVH 4LIQL 4HMEA 1MIEL 1NCUA 3BOVA 1KCLA 2DWEA 3AY4C 3KPSE 3U4BH 3WN5A 1ZA6B 3MCKA 4KXZI 4R3SB 3TCLB 5E70A 4HFUH 4P46A 1ZKAA 3NIDE 1R24A 4JRXD 1FFRA 5D1XB 3KLHD 1RUQH 4XPAH 2DQFB 2DM4A 4JFYB 1EPFA 3BUYB 3ZE0F 3QIBA 2XXMB 1A9EA 4TNVF 4HKBB 3K4AA 3QDGA 1EGJA 1AE6L 1MREH 3B3IB 4GRLC 2G75B 4Z95H 4WTZG 5C09A 5A1AA 1A8JH 1CXKA 3MV7B 4ZUUA 4M7KL 5ESQA 3DTXA 4Z5RA 1OP9A 1EVTC 3SDXE 3QDME 1NBYB 3DX7B 5I9QB 1JNLH 5F1NB 4DUXA 2HVKA 4NKMA 2NY0C 3BP6B 5I1JH 2YD9A 1MCCA 4RAVB 1DVFC 3PL6C 4BFGA 5B8CB 1ORSB 3WFCL 5E2VL 3BDYH 1YUHA 4YNYB 1AC0A 1IVLA 3D9AH 3Q5YA 3IFOB 1VESA 4QRSA 3KPOB 2HFEB 1YQVH 1JNJA 1A6AB 1G6VK 1RZ7H 4NDMA 4U6HA 3QH3A 2GSGA 3HCVA 4NO5B 4MAYB 3SE9H 1F13A 1J5OH 4ZS7H 2AV7A 3NCFB 5J7CC 3VFTB 2BCKB 4P2RA 3VRLF 2EXYD 1XF5A 5HHVL 3X13B 1MIML 1T03H 3BP5B 4UT9L 4N1CA 4L8SC 3QDJD 4WWID 4BFEA 3UAJD 3P3YA 2G9HA 1NCBL 4GW1B 3WFDH 3AB0C 4GAGH 2YD2A 3HMXL 4L3CA 3RZWA 3QHZH 4NUJB 1KT2B 1MNUL 2JCCB 5ILTL 5HGGS 1A7PH 5BW7C 4HKJB 1CQKA 5IMOA 1QNZH 4U1GB 1PZ5A 4OCRH 2BSTA 1PAMA 5HHME 3NGBC 5IVZA 3QNYA 2X44D 3CFBA 1FH5L 1GVIA 4ONOA 4DKFH 1ES0A 1MAML 1AJ7H 1NFDB 3VFPA 2R4SL 4HEPG 1F4XL 4JM2D 2BVPA 1CBVH 3H9YA 1QA9B 2NZIA 4QRPE 4JJHA 3WLBA 4MCYA 4GAYB 2H8PB 1NGZA 3B2VH 5D1QC 5DQDH 4E41B 1NGPH 2P24B 4OGYL 1PD6A 5SWZA 3W81A 1Q1JH 3EDEA 1OOAA 4JQXA 5DT1H 1A7QH 4OB5L 2I26N 3ARRA 4RIRB 3NCMA 5K9JL 1GZQB 4HKZB 4JO3L 2YPLB 3BIKA 3RGVC 5CEYA 3HG1B 1VGEL 2OTPA 5D1ZD 4Z0XB 3NH7L 4WV1A 3W9EA 4O2EA 5LVEA 2FYYB 5JW4M 1HYSC 1A6WH 4QRRE 3RBSA 3W11C 3D69A 3CXHJ 4DFIA 4PJ7E 2V5SA 3VFUB 3IFNL 3V6OE 2VZOA 2YUVA 2ZUUA 3QI9B 3UTQA 4HG4K 3TNMB 5IMLB 3MGOB 3VE0B 1GAFH 2V5MA 4PJIE 5F6HI 4WIQA 1XGYL 2W1NA 3IGAB 1W8OA 4G6KH 1DQLL 4I0PB 1D5XB 5F72S 5C0CA 4U6XB 1JPFB 3Q6FA 4HJ0D 4ISVB 2VXQL 1KTDA 4RGOH 4PJXB 2J3SA 3EBAA 2Z8RA 5AG9A 1HXMA 4HCRA 3GSNA 1RIVL 3LOWA 3AMKA 3HPJA 2YPVH 4KRLB 4PV8A 4AT6B 3OF6D 1L7TH 2VDRH 2F8VA 4MQXD 4U1SB 2RCSH 5I8CA 3KLAA 3C5ZD 4GUPA 3U0TB 2DTML 3FO2B 1AI1L 1L4IA 1AGFA 4YFEA 2WNGA 3HMWL 1SHMA 4MNGE 4XVUC 2BNQA 5D7LD 4UV7L 4XB8A 3SJVD 4ZFGL 1SVZA 3FOLB 2HLAB 3GMLB 1FL6A 4JO1H 5HDQH 1T7ZA 2IWGA 4ZFFB 2WBJA 4G5ZH 4X8JB 4OSUL 5FKAB 3KPMA 3QQNA 3FN9A 3AUVA 4Q9RL 4GQPH 3F6IA 3GB7B 2XFXA 3ARGA 1YJDL 1B4JL 2WW8A 4M6OL 5F1OB 1FSKB 2LQRA 3TN0A 3OQ3B 1KCSL 2LU4A 2GTZB 2A6DA 3AFLA 1A6VH 1JJUA 1TQCB 3BZEA 1JYVA 5IM7A 1A6ZB 2VQ1B 4WTZA 1HSAB 3I3BA 1TVBB 1NL0H 1D9KD 1FYTA 4WGVB 4WFFD 4ODWB 3VI3F 2DLEA 4RAUA 3ULUD 1G7JB 3C60A 2B1HH 4XAKE 1QVOB 3UJTH 1CGTA 4Y16D 5FHAH 4GKSA 1A14H 4JANB 4ZMAT 3G08A 2CDGA 2IQ9H 2AXFA 4KJWD 2MHAA 2F5BH 3CSGA 2YKLL 4PLJC 3MRFB 4DQOL 4P3WA 1JWSB 1MEXH 2HVJB 3IU3B 5CD5C 3V6OC 3O9WA 2QEJA 1QBML 5I1DA 1CDIA 2ITCB 4IIQA 3NCBB 1QACA 3BE1H 2PXYC 3MOBH 4UIKL 1EV2E 3GSOA 4NBXB 1KPRB 2G5BB 3AU1A 4KY1H 3L3DA 1UWEL 2NNAB 4PB0H 4RGNE 2ICWI 1NGWA 2NX5E 4JFXB 2E27L 3B9EA 1BZ7B 4KJPC 5KZCB 4XRCB 1QFWH 5D1QD 4IHOA 4RRPG 3RRQA 5IVOA 4JFZH 4I13B 1XIWC 4QHKJ 3VI4F 4QKXB 5DK0A 3RY6C 4XMLH 1IGMH 3MJ9A 4HH9A 2JKXA 1KIPB 1OGAE 1RUPH 4H1LB 4HF5L 4OD3H 3GGWA 1EXUB 3EYSH 5MENB 3RX5A 7FABH 1CLZH 4IRZH 5HHPB 2NY2C 5C7XL 3QUZB 4WDIB 1MJUL 3NACH 1FNGA 2PCPB 4LHJB 1JPST 2VAAA 3TZVB 5J1TC 3TO4B 2HFFA 3G5ZB 3MCLH 2HJLA 3ET9F 5DYOA 3NMEA 3PWPA 4EN3D 2DMCA 3JBG7 4LLYB 2GKIA 3U83A 5H37H 4JHZA 4V1DE 2ZSVB 2PR4L 3MGAA 2GJJA 4PRHA 5I8OL 2VXVH 1K4CA 1NH6A 1NMBH 1F2XK 3CLEL 4TUOA 1KLUA 2DWDA 4ZTPH 4DGYH 4K7PH 5I15L 2LE9A 4XBEH 1J0YA 5FGBA 1JZ2A 1HQ4B 5HGAB 4AENB 2K7PA 2VLLB 1I8IB 4AQOA 4UV4L 5F96H 2VWEE 5IVXF 4LCYA 2CLRB 3L9RA 1J0KA 4GW5B 4JFDA 1QBLL 1TCRA 1JHTA 3T4AB 1E6OH 2JJVA 1JZ7A 1T04B 3L95B 1RPQA 2BNRB 2XQYG 5T3ZD 2OP4H 1U8QA 1GHFL 5LG1A 5FDWB 1NMCC 4OM0L 1EUUA 5IQ9A 2V5TA 5E2JA 1H3GA 5HHMD 4DUWA 4LVOB 5T1KD 1GGBH 2NY7H 2VDPL 3OGCB 2FNBA 1FORL 4FHBD 4X6FB 2YN3A 3AMLA 1CDYA 3H9SA 5CWSB 2VLKA 2VC2H 2C4FT 1MFEL 1T66C 5DD1L 5BVPL 3LKPA 4QRPD 1DBML 4EI6B 2EDHA 2Y6SC 3IDJB 3D39E 5BOZG 5EZJB 1M7DB 4XP1L 4O2FA 1JZ3A 1FZMA 4OJFL 4YXKL 4IJ3C 2M26A 5DQ9A 5SV4A 3QWRA 1L0QA 5CMAA 4F9LA 4NGHH 1JTTA 3JTSB 4F3FA 4R8WH 1WAAE 4PJHA 2P5EB 5MEPA 3F5WA 2ZOLA 2OZ4L 1AFVL 3EOBB 4KTEL 3VW3L 4KUZH 2CDEA 1YC7A 5E8NB 5CD5D 1MHCB 5E6IB 5MERB 1A6UH 2OJZH 3IKCB 2BSRA 1FLTX 2CRYA 4S1RH 1P53A 1B9ZA 3ARTA 4FQHB 2EEBA 3C6LC 3ZE2F 4FA8A 1CG9A 4JHWH 1R3LB 2R0LH 3LKNA 2DQGH 4L8DA 1DQMH 4ETQB 4C56B 2MKLC 1N5AA 3CZFB 3D5OF 5C6PB 4X6DA 1D5MB 4ZODA 4JFFA 3ARDD 3O6MH 4X6CB 3T65B 1XIWD 3CX5J 3P4OB 5TPWH 2A6IA 3C8KA 4ESKA 1T5WA 5F89B 2VWEC 1A7NL 1C1EH 1HKFA 3SDAD 1UM6H 2D9QB 2HFTA 5BV7B 3P2TA 4NRYA 1RMFH 3LRSB 4TN9A 2X5PA 4QHMA 5K59E 1UCBL 5JW4N 3MRJA 1P7KB 4HH8A 2OLDA 5IBTL 2HTKD 3EJYC 4KTDH 1J8HD 2IADB 2C7UB 1M6OA 4RRPA 1AQDA 3HNVH 1CU4L 5JR1H 1GGCH 2CLZA 2I25N 3I6GA 3NABL 5D7IB 3HZMA 4ODTH 1ZAGA 3BKML 2I24N 2RFXA 3QIWC 2IALA 4JPWL 5DHVH 2PTTA 4WI2A 1JNNL 4V2CB 2NLJB 4G43B 4NO2B 4P2OA 5FA3A 1XGUA 3CVHB 5C0DB 4RBPK 2DBJA 3S5LG 3T2NH 5I17A 1LNUA 1OARH 4KKAC 1ZLUH 3P0YL 2D7PA 1R3KB 1CE1L 5M7QA 2W91A 1AGDA 2X4RA 4C83B 3IRZA 1Q72L 5FUZH 5GRUL 1KNOA 5D93C 1RUMH 3MLVL 5F97E 1IEBA 3OJ2C 3GM0A 4MMZC 4HFUL 1LEGB 5CEZD 4KWUA 3MZGB 3TV3H 3M1BA 4HKXA 5DJCB 3P40A 1RUQL 4LP4A 3K3QA 1FNSH 3N9GL 2CKBB 2D7OA 4FTVA 4ZOBA 5TGBA 3ARZA 4MGXA 4OZIA 2DLFL 1T89C 4PP2B 4RGND 4HQQL 4HIIB 3KNBB 1LK3H 4CAGA 1JWUA 5BV7L 4KXZH 5KSAD 2HFGH 5INDA 3VD3A 2XWJA 1GIGL 4OM1H 1CLYL 4X5LA 5DRZA 1QSFB 1ACZA 4IRSD 5C0BE 4LSRH 4PJAF 4BZ2H 4F8TA 3BRDA 1XR8B 2AJZB 2C9AA 4QO1A 4YK4B 4QCIA 4PJ9A 1HH6A 2Z31B 3U0PB 4K3EH 4Z6AT 4Y19E 3VWJC 4Z7UE 3L3KA 3IU4L 5JIHA 5DC9B 4G8FB 5CZKA 5GZOD 3D9AL 3R0NA 3LD8B 3NFPA 4M6ML 2XTJE 5JQ6L 1BVLB 4L29B 1A3QA 3GJEA 5HI4C 1DN0A 5MI0C 4G8GD 2CO6B 1B2WH 4LIQE 3SE9L 4X4XB 3CVHL 2X4PA 3C6LD 3GIZL 5I1LB 3UPRB 4HX1A 1XEDA 4J4PD 4JDVA 3QUMB 3LQMA 3MYZA 5IR1B 4PJEF 2QHRL 4JZOB 4Y5VA 3U6RB 2YBRB 4MJ2A 3VFMA 3KPPB 4FQXD 4KROB 3NN8B 3JTTB 3LPFA 5DA0B 5GJTH 5DUPH 3KPLB 3QIUB 4RGMB 5FAAA 5HD8D 3I02B 1KV3A 1BF2A 1NBVL 1JNHA 4NWTH 2NY4D 5FCUL 4CN6A 1A7PL 1U8KB 2DYPA 1LO2H 5FB8A 4RAHA 4QTHA 3LEYH 2ZP0T 4P23B 5HHOE 5C07A 2VR4A 3BJLA 1TJGH 4X99B 2CKBL 2ZUVA 3C6SA 5HVGB 3WE6A 3IFPA 4K9EH 3KJ6H 1LDSA 12E8H 3GHBL 1BAFH 3LRHA 1T1WA 3FO0H 2H32B 5GGQL 4ODVL 4YBLB 3RWFB 4MXQD 3OB0H 2B5IC 1UM4H 1U6AL 4HUUB 1LO4L 2I27N 2V5YA 1JF1B 3PXHA 2R69L 2H1PL 3T08A 4O58H 1YEGL 4EDXB 2E8YA 1FCCA 1S7UA 5KVGL 1I3VA 2AKRA 3RPIA 5D5MF 1GPOL 1X4XA 3D39D 2GJ6A 4L4TA 5I1CL 4Y4HA 3B6SB 5L2KA 3VXME 4HBCL 3QCVL 1SEQH 4PJ8A 5EO1B 1LP9E 5HYQB 3GMRB 4WI6A 3RU8H 4QF1A 1H3VA 5GGVL 1FJ1A 1RIUL 4POUB 2R2CA 1ZV5A 2NXZC 3QUML 1RZJH 2XTJC 5HJ3B 3U1SL 1YY9D 4M6NL 4KAQH 5FYJU 4WI5A 2WINB 4ZYKA 4LCIL 5IMKA 3S5LA 2FCBA 3VCLB 1Z0MA 3O4LB 4FFVC 3VJ6A 1TPXC 4XMKH 4F7PA 1OT2A 5EFIA 4EUPB 5EZLB 1CD1B 3FTGA 5GS0D 1JCKA 1BQLH 4FFZL 2OJEB 4HIHA 2J88H 5CBAA 3PV6A 4L8BB 5EA0L 1I3RA 2E7BA 1G7PB 1TDQA 1RAMA 4ZS6D 1MLCB 3BKJH 5J11C 3MV7E 5DHYA 1YNKL 2YMXH 3OJMB 3U30B 4FQ2L 2ZUQB 5LQBH 1SY6L 3TA3D 1OSPH 5E2WH 5GGUA 2VLRB 5L2JA 4Y2OA 3H0TB 1N5YL 3QA3B 4K71B 2FBJH 1OL0A 3CFCH 4HZLB 5SX5H 1N59B 2FX7L 3NPSB 4PY8I 5ITBH 1LE5B 1OW0A 3FQXA 4NJ9L 4JM2F 2HJKA 1P4LA 4KRPB 1FAIH 3ROLB 4K23L 5EU6D 1IAMA 4NIKB 5FYJH 5L7XL 1I8KA 1QD0A 32C2A 4OV5B 4S2SA 2A1WH 2H9GB 1YEIL 1G7HA 2FR4A 1MRFL 5FHAL 2DLTA 5IIEA 1XGTB 3RTQD 5H35B 5L8KB 2IQ9L 3FT4A 1ZSDA 1NLDL 1ZVSA 5T1LB 3VA2C 2P46B 4UDUB 2F5BL 1VPOH 4NN5C 3F62A 2CDFB 2APTA 4XP9H 4PBVC 2MTPA 1WICA 5M95B 5DRWA 2R1XA 3RWDB 2ZUSA 4Y4KD 1LK2A 4PJDF 3DV4B 4FFYH 2XNAA 1EO5A 3BE1L 1NSNL 4NFBA 2PTUA 3MOBL 4PRPD 4X6EB 5C0IB 4NKDA 1M05A 4F33B 3GI8H 4JB9L 1VKXA 3WYRA 1ZS8A 1NFDE 1LEKB 3LAFA 3L3JB 4I4WA 5EU4A 5D6CA 4LLVA 4M02A 2WM0A 4QXTA 5D1XC 3Q0HA 1MCLA 4AL8H 4YFLI 2DQTH 5FO8B 1UCTA 4GLRH 3WHE0 1IGFH 3DARA 3X11A 3TM6A 5CJQL 5KAQF 3FAWA 4CVXA 1VFBA 4MZ2A 4NP4H 1KPVB 1FZKB 5BRZA 5LGHL 4HS3B 7FABL 4LLUA 3QUYA 4PD4K 4QEGA 2P8LB 1CLZL 2ADIB 4XHJD 1T21A 1CZ8H 3LQZA 1N3NB 3HG1E 4U1LB 3NACL 1IC5L 5EBMA 3SDCB 4XNYH 3RIFF 1NC4B 2RAMA 4R4FH 1BVZA 1YEKH 4NYLB 4X9GA 5I9QC 1DFBH 5F7YC 3K1KC 3T0BA 3MLPA 4HUXB 4ZUSA 4TNWK 4Y19D 1NCCL 4YPGB 4XAWL 5JPMA 4PJ5B 5I1IH 5L8JB 3HFMH 2L7JA 1JPTH 5B8CC 2NXZD 3WUWB 1ZT7B 2XTJD 3DUUB 3GDBA 3UJJL 3CXHK 1MELA 3QIBD 5IB1A 2VXVL 4PJGA 1NMBL 4BFIB 1Y18B 2ZNWA 5JXED 2F19H 4MAYC 5GRZA 4PJXE 5K93A 4C4KO 4NHUB 4LPXA 1QFUL 2QQLH 1V3MA 2GT9B 4NRXB 3ZL4H 2COQA 5IESH 2D31A 4BK5A 4ZO9A 3ULUF 4TTDC 2LVCA 5DRNA 4OFIA 4OD2B 3OKKA 4M03A 4MJ6B 5L88H 5TH2A 1N8ZA 3VGBA 2OP4L 5CGYC 3UTSB 3VMPA 2X1QA 2AJVL 4M7LL 4PGDA 5F9AC 5FYLL 5CCKL 5HHOD 3OPZH 1T22B 1AGBB 2N56A 4ODUA 1HILA 1RK1B 4U1GC 3V4VH 3UJIL 5FUOH 4FMKA 1R3HA 4H0IA 3MV8A 1KB5A 5C0AA 4M1DH 3VWKD 2BC4A 2EICA 1RFDH 4XCNA 5D8JH 3BH8A 3PWLA 2ZPKL 4WHYH 1U3ZA 5H94B 1OCWH 4NQEA 4NQDA 1O7SA 5GGRA 2DDQH 3WFEL 1BHGA 5EBWB 3UTTA 3V4PH 5HGDA 4P57B 1S7RB 5HVFB 3EFDL 5CJ5A 1YJDC 4WRLA 4QOKA 1S7TB 2A74A 2ICEA 2MCG1 3HI6L 4LKCB 3PGDA 3VXTA 4NJAH 1I8MA 4J23A 3TT3H 2NTFB 4AM0B 1T6WA 1A1OB 5JW3H 3TH4T 4M43H 4FMFA 4HWBH 5EBGA 4KDVA 3MRMA 3AS1A 3VXMD 4HV8A 1KIQB 3AS3A 2VOTA 3BISA 4IRJA 1UKSA 2Z8WC 1F3RB 1L7IH 4KJQC 1EH9A 3SDXF 1A6UL 2BJMH 1A3RL 4WW1A 3QQ9D 4LMQE 2V2TB 4OZFB 3QI9C 5GISL 3HR5A 2KH2B 1JGEA 4JHWL 2R0LL 3WFZA 2W07A 2AK1L 3WN5B 5HYFA 4I0PC 1M71A 3MCKB 3VRJA 1RY7B 3FB6A 3F7VA 4TUJA 2EDKA 1IAKB 4P46B 4WHTA 3O6ML 1R24B 2FGWH 2IF7A 5F93C 3DHJA 4B0MM 5GRJL 1NLBH 1BD2B 1HKLL 4ORGB 3HZYA 3QFJA 3MRIA 1IKNC 3PWJB 4OF7A 3E3QE 2ZUWA 4HSQA 3CFKA 1UM6L 4N0FA 1X5HA 1FLRL 3QDGB 3X3GH 4M3KB 5MENE 3RNKA 1UB6A 3MV7D 4S0SD 1GC1H 4LSQH 4ZUUB 5ESQB 3IJSA 1CXLA 1IGJA 4OCSL 5FOJA 4IM8A 1RURL 5ADPH 2HVKB 5C0CD 5HPMA 2GCYA 3GBMH 2AXGA 3G9VA 4YWGH 2JJSC 1FRGH 4HGKC 5DEFB 1AKJD 4FN0A 2F8XC 1FSKC 1MHEB 2IQAB 3Q6GH 2ZSWB 4HK3N 1TQCC 4QRSB 3FT2A 4DKEL 5HPOA 2VISB 1JK8A 3C8DA 4FABL 5A43C 3QH3B 1BMGA 1YECH 2DIBA 3FN0H 3R06B 3ZDYF 3RZCA 4NN7B 1RVFH 1BGXL 4HWZB 4P2RB 3L5IA 4HK0A 1ZHKB 4H8WL 1XF5B 3D0VB 4ZNEE 2R9HC 3OX8A 5IQ7L 3ZDXE 2APXA 4F57H 3DGCR 1S9KC 1WCBA 1WWWX 5DHVA 1IGIH 1IJ9A 3JWDH 4KZDL 1RUML 2Y23A 5C08B 2HLFD 5DWUH 1RU9H 2BNRE 4U4BA 3KXFB 4L3CB 3O3AB 4TYUA 1WTLA 4YHMH 1MFAH 4N0CD 1S3KH 1HWHB 4APQA 1U8MA 1JGVH 4WFEE 2HT2D 1PQZB 1FGNL 1PZ5B 2BSTB 4RQQB 1FV1A 4PRIA 5DJ0A 5IVZB 3QNYB 5F3BB 1ONQA 3A6OA 3CFBB 3MZTA 3N0PB 2ZCLL 1ES0B 4N1HB 1OTSD 3C60D 3LV3B 4ZO7A 3BKCL 5BCAA 3ZZ1A 1FVEB 1OAKL 4KRMB 1RZIB 5E99H 1N2RB 1KJ2B 1J8KA 4OIIL 3MA7B 4PJBE 3WD5L 1EO7A 2Q3ZA 2FD6H 5AZ2H 3U0WL 4Z7NE 3O8XD 3GSVA 3E3QC 3EO0A 5GGTL 2XRAH 4NNPH 3E6FB 3JXAA 1MH5B 3DUHA 2G2RB 1TCMA 3BIKB 4PS4H 3QUZC 4TULH 3C08H 2VERN 4HIXH 3W9EB 1IE5A 4WV1B 2BOCA 3FRUB 5FM8A 3L1OH 3TZVC 3TO4C 3D69B 4WI3A 2ARJQ 4DFHA 4AEFA 1HHIA 2ZNXA 4JQVC 4G9FB 2IAMA 3CDCA 1P6FA 5I30L 5IHBA 5J9PA 4P4RA 3L3IA 5ESVA 4NQCA 1NBZA 1NGYA 4A2LA 2EH7H 3NZ8A 1YZZA 4C56E 4D0BA 2UZIH 3BKYL 2DQHH 3MXWH 3SDDD 3O2DH 2JIXA 3IS0X 3Q6FB 4LSSH 3QYCA 4MLIA 1G6RB 5GJTL 1EFXD 1KTDB 4QY8A 4MJ5A 1DBAL 1MJJB 2DQCL 4PGCA 4X6CE 5IWLA 1HXMB 5E5RB 3AREB 1CICA 3HPJB 1NGXA 2DMKA 4PV8B 5EOCH 1QLFA 4D0CB 1UC6A 1KENH 2J8UE 4UDTA 3PUCA 4WFGD 5I8CB 4GUPB 4U1MA 1PVHA 1TJGL 5JHLL 2H6PA 4NZJA 3VRIA 1DQDH 1VEOA 3HE7A 4MS8C 2HJFA 4GRWH 2BNQB 5KG9B 3FO0L 4Z7WA 2I9TB 1FL6B 4NFCA 1XCTB 3ABZA 5FK9B 2WBJB 3RDTB 1UM4L 4N9GB 1VDGA 1Q9WB 2IAND 2B2XL 3GK8H 4LVOC 3KPMB 1ZLSL 5JW4Q 1KJ2L 4IMKC 5T5NF 2AJSH 4BZ1H 5BZDA 1IL1A 4LSUH 5D7IE 5EOCJ 2IH1A 3ARGB 3TN0B 3DX8A 5IHUL 3O3BA 1I1AA 3U7AA 1N26A 3BZEB 1AR1C 2BRQA 4HC1H 1JUFB 2BXYA 3VXUE 5KOVC 1Y0LA 4TSCH 5IFHH 2VYRE 3QQ3A 1QBAA 5DR5H 5HDBF 2E6JA 5J06A 2J6EH 4RAUB 4WW2A 4DAGH 3DXAA 3OKEA 2RGSA 5HGBA 3RU8L 5IJVA 3I50H 4GKSB 5I75B 3ES6A 4BUHA 1KFAH 3ARUA 5HHXL 1RK0B 3EYVA 5IFJA 2EDBA 3JV6B 3KPNB 2AXFB 2MHAB 3EJZC 4FP8H 5D4QA 5E7BA 5KS9A 1OPGL 1CFQA 1NCDL 2X4UA 4XVJH 2VLKD 5E6IC 1GGUA 4H5SA 4FQJH 4OAWA 1YMHA 3O9WB 1G6RL 5L9DL 5KVDH 1PLGL 4NM4H 5ACLA 5AYUL 3TBVB 3HE6D 1L9MA 4AEHH 3O6KH 5IJKA 4W6XB 3AU1B 3L3DB 5IB4B 3TJEL 2OL3A 3GMNA 2HMID 1F6AA 3RVTC 4AMKH 5DC4B 3QWRD 3BN3B 1ZLUK 3V5KB 1X5KA 3D6GA 3TO2B 4XCYA 4IHOB 2IPTL 4JFEB 2DQEL 2ZG2A 1WFTA 2X09A 5CSGA 4OI9A 4HH9B 4P4KB 5BV7C 4KZEL 4KVNH 5DZOA 5E2WL 2KDGA 1XCQA 2ICWB 2I07A 5HI3C 5HYSG 3L5XL 1GZPB 2IPKA 1Q9OB 3SE4A 2DMBA 3E6HB 4JRYB 5CZXD 3EDDA 1L0XA 4LGSB 5JOEA 3ZKXB 3B9AA 4LASH 5E5MA 4LPUA 5B21A 4KHXH 4RFOH 3VFWA 3WNOA 3V5HA 3OXSA 3PWPB 2AAVA 3RA7H 2VE6A 3P4LA 3WLWC 4OQTL 5TQ0L 4XNUH 1IBGL 2XZCL 4K94L 4OZGE 3ARVA 5CS7A 1JTPA 5B39G 4M1CC 4E0RA 1BQHG 4PRHB 2Z9TA 3TIDA 4QGTA 3MLSL 1KLUB 2Z93A 2DWDB 2NY1D 3IRPX 1U8NB 4K2UH 4LGPB 3TBSA 2R1WB 5I19H 5JIIA 4MNHA 1YYLL 3BVNA 5D6DA 1U3HB 4LCYB 5DURB 2OSLA 1EAPA 2B39A 2O5ZL 2VXSH 2EH8L 4PJFF 4ONGH 1YN6A 4JFDB 1INEL 4QRUA 4N68A 1TCRB 2J8OA 1KEGL 3REWA 3GI8L 4OZHB 3G6JF 5TDNA 2JJWA 4X8XA 5FO7A 3WJLA 3EYQD 3RVVD 2WSKA 1MCBA 5A16A 3D0LA 5IQ9B 4AL8L 2BMKA 1SMAA 2E9BA 2EIBA 4P2OD 4XXCC 1ETZA 3FRPG 4L8CA 4OV6F 1S7SA 4BK4A 1IGFL 2O5YL 4LQFH 4C59B 5BJTA 2FEDD 4PY7A 4OI8A 4OT1H 3HLAB 4NP4L 5CJXC 3EOTH 3H9SB 1CLOL 5I66A 4HUWB 3LKPB 4K55A 1E4XI 3QEQA 2E6QA 2IBZY 1MQKL 2CR3A 1DFBL 3NZHL 1T2JA 1FZMB 3BZFA 3RL2A 2X10A 2A6JA 4YK4C 5DLML 1KXTB 4M8QA 2Z31C 4PREA 1LE9A 1BIHA 3P4NA 2DQUL 1II4E 4JN1H 2UWEB 3WXWH 5J57B 4FTVD 4S1DD 4PJHB 3LD8C 4G8IA 4Y2DA 2ZOLB 1H8OA 3OHXB 4FOMA 5GPRA 4O51B 1Z3GL 4K8RH 3PGFH 4XMPL 1WZ1H 2AJUH 2IFFL 1I1RA 5HHQB 2VZTA 5A2IH 3O4LE 3WIFA 1FFOB 3S36H 1I7TA 2BERA 5HXMA 2QQLL 3HA0A 5GGSB 4B53A 4WUUB 3HPLA 2Q8AL 3LKNB 4L8DB 5JUEL 3RWCA 5GZNC 1HH9A 1UH2A 3GBNH 1KIRA 3ALXA 4KROC 4QNPF 1N5AB 2W60A 1I8LC 5L88L 2UUDH 4JFFB 5ALCH 1C7TA 2A2QT 3QIUC 4RGMC 3VXSA 4KUCF 1UJTA 3D85A 3N06B 3T0EE 1SM3H 2A6IB 4R4BB 1T5WB 4PTUA 1QHOA 5A2LH 3DROA 1SJHA 3I2CH 4ORZC 4P23C 4NRYB 1RZKC 4OF0A 2YXMA 4QHMB 5C1MB 4M1DL 1U92A 3H8NA 2Q87A 4LDOB 2C1OB 4YBLC 2FLBT 1M6OB 4XGZB 4WEMB 3N85L 3TBWA 3I6GB 4XPTL 5I6XB 4Y4FB 4GG6E 1R3JB 1QP1A 2RFXB 2IALB 4KKNA 2G60L 3MRLB 3VXNA 5HYSA 3VXUD 2D9CA 1UZ6E 2DYPD 4M43L 4DGVL 2BSSB 5FA3B 1XGUB 3QRGH 3BYYA 4R96A 4EIZC 2XG4A 5EO0A 4O4YH 1TJHL 4FNLH 5J8OA 1MLBA 5I17B 1ZANH 3RWEA 1CFVH 2VITB 4WEUD 2EDJA 5EIIA 2FB4L 5EH1A 1BWMA 3U9UA 3TT1L 1E4WL 3O2WH 3TPUA 1XGPB 5ACMA 5IUSA 3L3HA 4JLRA 1AGDB 4Z7UF 5AEAA 1K85A 3S8WA 2I60L 4WI9A 1P6AB 3PDOB 3GRWA 3OV6A 2WQRA 3MRCA 4HWBA 5FYLE 1WQVT 4LRIA 1U95A 5HYIA 3V0VA 3M1BB 5JORB 1MAJA 2VLJB 1UM5H 1KJVB 4GRMB 5LXGL 2NCMA 4L4TD 4HS8H 5TGBB 3B5GA 3K8MA 4OZIB 4KGJA 4MDIB 5KANG 4N0UA 2HT4D 1UADC 2GJZA 4Z7QE 5IG7B 3S35H 3OKOA 4AY0A 3MBEA 5INDB 5DFVC 3CPLB 1ZOXA 2XWJB 1GC1L 1ZGLA 5I1KH 5DK2A 1V7ML 2GK0A 3U30C 1HNGA 4LAJH 5HGHA 2ZUQC 4BH8A 4P2QB 4OLVL 3FRPA 3JVGC 3RWIB 4QCIB 4F7MA 3PNWA 4PJ9B 4W4OA 4YWGL 1BF8A 4WI4A 1QFWM 4PJ5E 2VDOL 1HHKA 2ID5A 3L3KB 4ALAL 4CU8A 2IG2H 4K71C 1FVDA 2B7DT 3Q6GL 3OKLA 3ARBA 1U8PA 4D9LH 4DTGH 2AW2A 5E56A 3NPSC 4FQCH 3VFSA 1DN0B 3O3DA 4EDWH 3FN0L 4KRPC 3SEPA 3S3PA 4UTBL 4HX1B 3QUXA 4RMTA 3VMNA 5KJRH 4AQ1B 4AYFA 5GZND 3T1FA 5IROA 1JVKA 2V9QA 4NQXB 3VFMB 5FFLA 2VL5B 3KPQA 3MO1A 3S98A 3QIUD 2X1OA 3IJYA 4R7NA 5DWUL 2YN5A 3CDYA 3QPQD 2ZJSH 3UTSE 3RX7A 3K8KA 5D2LF 3MFFB 3AM8A 3IETA 1JNHB 1S7VA 5IK3A 4FQIH 1JGVL 5FB8B 4K3JH 4QTHB 2XKNB 5C07B 5HYJD 1YEEL 5KW9L 3NAAL 3EYFA 1HXYA 2APFA 3C6SB 3QXUA 2Y9RT 5T1DL 5EC2B 2FJGB 3WE6B 5F9DC 3SO3B 1JPSH 2ADFL 5L0QB 3P9WB 3TIEB 4MWFA 3V8OA 1OB1A 1T1WB 3T3ME 1F3JA 4R7DA 4YIQA 4KJYA 4Q9CA 2AEWA 2JJUA 2VDQL 1ADQA 4LSPH 3EO1A 5DFWH 1OTUC 1OTTC 4MXVF 1S7UB 2AKRB 2DQJH 2X4TB 4YE4L 3RPIB 4EEEA 4CGTA 2XZQH 2KL6A 4YHOL 3P30L 4ZFOA 2GJ6B 5C2BL 5IVXA 4Y4HB 3SDCC 4YDJB 1DSFL 5L2KB 4PYHA 4H25A 4KHTL 2VDLH 3S34L 4PJ8B 3ZHDA 3HZKA 4LPTA 4ONFL 1U2CA 3WXVL 2Y4SA 1N6QH 1EJOL 4H0GA 3T2QA 2ESVA 4DGIH 3MV11 4DZBB 1FJ1B 1Q9KA 4WEBH 3OAZK 2EH7L 2VIRB 4K3DL 4R2GB 4CADA 3MXWL 3O2DL 5AAMA 1BQUA 4DEPB 3O4LD 1PG7H 5IMKB 2QR0A 4LSVL 5BZWB 2KUTA 3KYMB 2RB8A 3GBLA 3VJ6B 1BD2E 1SQ2N 1UENA 5CBEB 4F7PB 1LDPH 4L5FH 4Q2ZA 5EFIB 3DIFB 3FTGB 3CK0L 3MGTB 3LB6D 5E4EB 2AXJA 4XC1H 5SWQA 5EOQH 3SKMA 1QSEA 1CI5A 1GRWA 4HIHB 3IDMA 3HUJB 1JWMA 5CBAB 3PV6B 2E9WA 2QSCH 3EKCA 3NCJL 3NFNA 2EKSB 2WBWB 2YA1A 4WUKL 1ULVA 3T0ED 3UBXG 5DHYB 1G7QA 3WO4B 1MI5A 5E24E 4OKDA 1CT8A 4LLAA 3ZT6A 1U2HA 1V3LA 3O3EB 5JXAH 1CR9H 1RZGB 1A4KA 3GK8L 4G8EA 2VRAA 4JY4A 1FZJA 4MHHG 1LD9A 1HNFA 2F15A 5L2JB 3ILQC 4B7IA 3ZYIA 4CW1A 3CC5A 3DECA 3PDDA 3WS6C 1QPPA 4HC1L 3V0AC 3OKNB 1QTYT 4KRPD 3CFEA 5F7MC 5IFHL 2V17H 2HJKB 3MMEB 3DVNA 3UC0H 4P2RE 5FKPA 3B4NA 5EUOA 4S2SB 1MRDL 3P73A 4WWKA 2FR4B 4XC3L 3L6FA 4OCWL 4MJIA 3ORJA 1KFAL 4IMLA 4PGEA 5DD3L 1ZSDB 5C08E 3EYOA 4H8WC 5C0AD 3KXFE 3DSFL 3HS0A 4XVJL 3ILPB 2ATPA 4JQIL 3KDMA 2V7NA 3UYRH 4LGRB 4NQED 5F9JB 4NM4L 2JJTA 4P5KB 4AEHL 2X4SB 5I18L 2NY5L 4NKDB 3ZTJG 3PHQA 3SKUD 3V52L 3V7AG 5ID1B 3WN5C 3I6LD 2PO6A 1VKXB 4LSDA 2R23A 1ZS8B 4TQEL 2BRRL 2VSDA 3SOBH 4CU7A 5L6YH 4I4WB 1P4BH 2F9BT 5J6HA 5D6CB 3DMMD 3DUSA 4P46C 4RMVA 4E9LA 1B0WA 4POZD 3FJTA 3HR6A 5D71L 2R0ZL 5D7SH 2W9DL 4JGMA 3U48A 3S96A 1RULL 5FOBB 4UU9B 3KHOA 3FQUA 1IQDA 2A77H 2ED9A 3CCHB 4OQ1A 4KVNL 5MP6H 3OKMB 5BRZB 1F58L 1EEZA 3ZSSA 1TNNA 3SDCD 1NC4D 4JKPL 5EBMB 5GXBB 2ZZUT 3ECBA 4YEFA 4D8PA 3FMGH 3HAEG 4JG0H 4ODXB 3T09A 1CL7L 4OTXL 5BS0B 1JGDB 4ONHA 5B3JF 3MNVB 4O00A 3CH1A 2ATKA 4X7TA 3NVQA 4XP6H 3MRBB 4ZUSB 3UMTA 5IBLD 5JPMB 2NY3B 4G9FE 1F02I 2A38A 3RA7L 5FGRA 3QFJD 1YPZA 5FM5M 5D96B 1H15A 4ZUVA 1T1YA 2MOVA 5IB1B 4Z8FL 3W9DA 1BBDH 1QR1A 1QKZH 3AROA 4CDGC 4NN7C 5CP7A 1MCRA 1SYVA 2NW3A 1XGQA 1EEUA 3FB8A 3HI1A 4BKLA 4BSJA 1BM3L 3WUZA 2D31B 1QFHA 2FWOA 2UY7A 3M8OL 4X7SL 1QRND 1WBXA 3G04A 2DS4A 3ROOA 4YEEA 1U8OA 4PJAA 3KLDA 1BFOA 5TH2B 1N8ZB 1BLNA 2XA8H 4UBDD 2BNQE 4QXGH 4PGDB 4Z7OF 1WT5A 2Y36L 2IGFH 3LRGA 1RZFL 5J3HC 4IOFC 4HDIA 3ILQD 1FNLA 3H42H 4BQ8A 3EYUH 4KKCC 1R3HB 3KPRA 1KB5B 3K0WA 1ZHBA 4KKLC 4G6MH 2BC4B 4XCNB 2EE3A 4I0CC 4D9RD 4YDKL 4NQDB 4G42A 5GGRB 1S7XA 3UBXA 1G7MB 3UTTB 2P8PA 1X4YA 5HGDB 4PRDA 4Q6IA 3VH8B 3LKRB 1WBYA 1DEEA 1AHWA 2E7HA 43CAA 4QOKB 2PYEA 4JQXC 4A6YH 1A9BB 3PGDB 3VXTB 1I8MB 1RIHL 3SDYL 3VD5A 1T0NA 1CF8H 3T0XA 3MRMB 5K9KA 4HV8B 5KAQG 4WV1C 5IEHA 4IRJB 3H3BC 3ZTNL 4F58H 5DMKB 1EZVX 1I4FA 3NOIA 4KI5D 4MCZA 3W39A 1NCWH 1JHLH 3L5WA 1JGEB 3K7UA 4XX1G 2Z91A 4X6DF 5C3LD 3O6FD 1ODAA 4WHCA 1F8TL 1JPGA 2FH6A 3CMOH 4JRXA 3VRJB 3FB6B 1NFIA 3F7VB 4TUJB 2R4RH 2C4XA 4MQ7A 3QXAB 3WIIH 4F9PA 1BD2D 4XBPA 4YDVA 5GSRB 1AO7B 3VGHA 3WDJA 3DVFA 4PRAA 1D6VH 5F7UA 3HZYB 4NZRL 2CUMA 3AREC 3PIQA 4HWNA 2XZZA 4JFEE 3CFKB 1LO0H 5ICYB 1F4HA 3RNKB 5A40E 4JPKL 4Q0XL 5DMIL 2IAMD 2Q86A 2VB5A 2BHZA 5C92A 1KB5L 4JRYE 1IGJB 1I1YA 3O6LH 2WBJC 3RDTC 5HYEA 2N1KA 4G6FD 2GCYB 3QG7L 4JDZB 5ID0B 2AXGB 4RFEA 2EEAA 1TZGH 4NKIL 2R0KH 1KC5H 4NZTH 2WAHA 4XZUA 5F8RC 3ARGC 3HKFA 3OZ9H 3TN0C 4QXUH 4WY7H 3U4EA 2MNUA 3PE9A 4JN2B 3FT2B 2VL4A 3O81A 1JK8B 4LSTL 5DK3A 2EDNA 1J0HA 1HINH 3IKKA 4XVTL 2BVYA 2AI0L 3HAEA 3RZCB 4PJBF 1CFVL 3MACH 4X5WA 3K80A 5EN2A 1J1XH 4K94C 4HK0B 4WHDA 3EZJB 3OAYH 1DE4A 2C3VA 3OX8B 5DJ8A 3ARFA 3T8XB 5I75C 1U8IA 3LKSA 1A1MA 5C6TH 4OZHE 3F8UB 4LLDA 4UB0H 3HC3L 1VB9A 1ZHNA 4CVZA 2Z4QA 2LVEA 4OZIF 1I1AD 4X7CC 1P2CA 3RQ3A 3CXDL 4APQB 2CR6A 4IOFD 1U8MB 4ZOAA 3O9WC 5JHDB 1P5VA 4PRIB 5DJ0B 3HNTL 1ONQB 1UZ8A 2AK4B 4U1IB 4JM2A 4NFDA 5KSBF 1GYAA 4CUCA 4MNQB 4FQLH 4YUEH 3BDBA 5CIPB 5JW5A 3CSYA 1MHPL 3CFIC 2DD8H 4XCCL 4HFWA 1PY4A 4JE4B 3GSVB 2EYSA 3EO0B 1X5YA 2CGRH 1YEHH 2EYTA 1HWGB 4MAUL 4JY5L 4P4KC 4LPYA 3HC4H 2R2BA 3V95A 4B50A 2BZDA 5JOPD 5ANMB 3D25A 3BO8A 4NPYA 2AEQL 5D1ZA 1UXWA 1YDPA 1WFOA 2UWEE 1I9IH 3VGEA 5MHSE 2VLMD 3CH8A 3QXDA 2UV3A 2D4FA 5DI8A 1P84K 4U3HA 1XFPA 1C8PA 4KQ4L 1CFSB 1UGNA 3ZKXC 3AY4A 4YGVA 3IDXL 15C8L 5J1SC 2P5WD 1F4AA 3I75A 3KYKH 4KVCL 5DVMA 3RKPA 4G6JL 4WUUE 5GGVY 3L7EA 3L3IB 4KQ3L 4P4RB 1BFTA 5H2BA 4HJJL 4NQCB 1NBZB 1NGYB 3MJ7B 4AIZA 1A0QL 2XI9A 4O2CA 4D0BB 3QRFM 3WMSA 1A2YA 1FC1A 5I16B 3DRTA 3RUGA 3QJHA 4MJ5B 3OF6A 4XCEA 5ABDE 2Y07L 4MXWH 4GRLA 1U3HC 2JF1A 1HEZA 3KWWB 1QLFB 4FQIL 1QLEH 4N5UA 3HB3C 4GW4A 4UDTB 5FHBL 3X14A 3FONA 4U1MB 3UTPE 1V7NH 5CKGA 5TFSH 4L9LA 5D7LA 1Y6NR 3SJVA 3HE7B 2FH8A 1KLFA 1I3GH 1H3PL 2C5DC 4UT7L 3LH2H 5ITFB 5LJYH 4Z7WB 1DVFA 3VXQB 4N9OB 1DBJH 2CRMA 4BM7A 1KN2H 3HNSL 3S37H 3BP4A 2D0HA 2X7LB 1MCOL 2VH5L 1MWAB 5EUKB 1ACYH 2R56L 4LSPL 4HMDA 5HDLA 5TQ2L 2DQDH 5CINL 5ESAB 1FNEA 4QLRA 2UVEA 1WISA 5DD6A 5MEOA 3LDBB 4LEXL 2ARJA 5C6WH 1G7IA 2CH8A 3CNKA 2XG5A 1AD9B 5FYJD 2CKNA 2HRLA 2FEEI 2Y7QA 4OCYL 1Y0LB 4R4NC 1INQA 3VFOB 3RBGA 5EOTA 4L8SA 4JGUA 3U9PH 3DXAB 1YEFH 4Y16A 4OCMC 1MRCL 3S3SA 4JKWA 2FJHA 1U91B 1C7SA 4I5BA 5TE7L 2PTVA 5DJ6A 3GJFH 5ENWA 4GS7B 3EYVB 4YHIA 1I1CA 3GSUB 5BW7A 3FQTB 4NC1E 4Y0GA 5KS9B 2ZUTA 3ARWA 1CFQB 4G7YH 2X4UB 3CJJA 3U36A 4H5SB 3PWUA 3NIFE 2VLJE 4N5ED 5DFTA 2BY2A 3WNKA 4A2MA 1DBKH 2RQ8A 2EDRA 3PGCB 4H88H 2Y5TA 4YHLH 5T1MA 5DUMH 1JRHI 5FA4A 2OL3B 4OZGF 1F6AB 1CGWA 1QLRA 2AJXL 1ZT4B 5D1QA 4ZO6A 3A6BL 5F7EL 4AK1A 4CMMB 4HG4J 4XCYB 3CLFL 5GRYA 1GXEA 1NKOA 2AJ3B 4P4KD 5HBBA 4P2QE 3RGVA 1QSZA 4OCNC 2FX8H 1AQKH 4J7RA 1N4XL 1ED3B 5IB2A 4EVNB 2I07B 2D3VA 3SDXA 1MIEH 3QDMA 4F2MB 1F11B 2IPKB 2OX5A 1MWAL 4L4JA 1NDMB 4HK3J 1VCAA 2BVQA 4M4PA 3TVMD 5IW6A 3MLWL 4GT7A 5E5MB 1B4RA 3VFWB 2XQBL 1FL5B 3MUGA 3V5HB 5I6XC 3BWAA 2C26A 4Y4FC 1OAUL 3B2UC 3D85D 3VMOA 1FAKT 1PX3A 4XWGL 4I3RL 2D4DA 4HPOL 4GKZA 4HPYL 4WVRA 3B9KB 4E0RB 1AE6H 5JLZB 1NUFA 2Z93B 4K7PY 4M7KH 5D9SB 2O5XH 4I9WE 4MNHB 1FO0B 3BVNB 4OBRA 3CD4A 2GFBA 1XF1A 5CJOL 5D7JB 1EMTL 2OSLB 4WO4D 3PDGA 1YN6B 3DYOA 3REWB 3WFCH 3MBXL 4GRWE 4D9QE 1S9VB 5JZ7D 1DUZA 4NN6B 5IT2L 1P4BL 2BXZA 2OL3L 5A16B 3LKOB 3PHOA 5FV1L 5E8OB 2IPUG 1CXIA 3RI5K 2EXWD 3BD5A 3QNXA 4HD9A 1PEWA 3V6ZA 3SKJH 5BJTB 4PY7B 3D1MC 1BX2B 5B38B 5HHVH 4QRPA 1MIMH 5MP6L 1UACL 2X40A 4UT9H 4J3UA 4XPGL 1JIBA 2J8HA 1JGUL 1NCBH 3QEQB 4JCMA 5DQJA 5L2KE 3HMXH 3H7BA 2FZ3A 3O11A 3BZFB 1MNUH 1NAMA 3F7PC 1F90L 2ICES 2A6JB 3DPBA 2DKSA 4M8QB 2ERJB 4PJ9C 3SCMD 4PREB 3GMPA 1WEJH 2XOTA 3WJJC 1P9MA 4PJGF 1RI8A 3C5SB 3PWNA 4C55A 2OCFD 2DB8A 2AV1A 5F7KC 5HSFA 3RKDD 1JN6A 3IDNA 1MAMH 4PJ7A 4G8IB 3V6OA 3EHBC 1N6UA 3O2VL 1F4XH 2X9XA 1BBDL 3JWOL 4ZNCD 4GG8B 4C57C 4PTTB 2XT1B 1U8HB 1F4YL 1OAQL 1I7TB 1Z0NA 2EDYA 1GCFA 3AC0A 3T2PA 3DLQR 4OGYH 4GSDH 1U93A 2R8SL 4XI5C 3B8SA 3RWCB 1K4DA 3HUJE 1FO0L 2I5YL 4OB5H 1HH9B 4P59H 3ARDA 2YUWA 1KIRB 5GHWL 3AAZA 3D2UA 4JO3H 2D7TL 1BVKB 1XIWA 3TYFA 1VGEH 5BMFL 3VXSB 1H3UA 2N7AA 4QXGL 3E8UL 3F58L 4DCQA 2IGFL 4QRQA 3UTPD 2BSED 4ZXBD 4F37F 1BJ8A 3IFNH 1BIIB 1G84A 4YHZL 3BEWA 1E28A 2HTLD 2KKQA 1U92B 4G6ML 4RCAA 1J8HA 3SO3C 1DQLH 1OT1A 4MD5B 5L0QC 5DJXA 2PETA 2FHBA 1DUYB 1EIBA 2VXQH 4LF3B 3SY0A 3TBWB 1S78D 1WSST 3ZT7A 4Y4FD 5H8DA 5DMYA 3NA4A 4PFEA 1RIVH 4NRZA 1WVZA 1J7VR 3QDAA 4Y5XB 1WWBX 1RJZA 3LHPL 1KCRL 5IOPB 1UT9A 3CDGA 3VXNB 5HYSB 2NY6B 4J12A 1AI1H 3S97C 1YEJL 5EO0B 3G5YB 4Y4HC 3V7MA 1KGCE 4NQVA 4F80A 1E4XL 3HMWH 4S1SL 5CP3A 1RHHB 3RWEB 2GSIA 4G9DB 3WEXB 1X5ZA 4UV7H 3BH9A 4ZFGH 3D3VE 2NXYB 4PJ8C 2AQ1A 5EIIB 4TOYH 3G6AA 3U9UB 4D0DA 2HA1A 4ZPVA 1JHLL 1EHXA 3MLUL 4OSUH 1UKTA 3JV5A 3TC9A 2WV3A 3CFDB 1CN4A 4A6YA 4Q9RH 1ITCA 1RJYA 1YY8A 3GO1L 4KK6D 1MVFA 5B39B 3NA9H 1YJDH 1B4JH 2F53D 2XKUA 2BNUA 1IGTA 3CMOL 1BQHB 4M6OH 4XHQA 1KCSH 4R2GC 5F1IB 1PEZA 4U3CA 5IKCB 1U95B 1ORQA 4MA8L 4WGWB 3GMQA 1P1ZA 3PQYE 1UXSB 3LN5A 1AY1L 3QHFL 1QFOA 4HWEH 2L4OA 2NY5C 1D5ZB 3RL1B 1IQWL 1HSBA 1AIFB 2VKXA 1C12A 5K9OB 3LKQA 2EC9U 5E4EC 4OCXL 4N0UB 3T3PE 1KCUH 2GJZB 3OAUL 4Y5YB 2BVOA 1WBZB 2PF6A 2VZVA 1I9RL 1IMHC 3JV4B 5JPNA 4IRSA 1T6VN 3PABA 1OGAA 2C3WA 4I18B 5DK2B 2ESVD 2GK0B 3WO4C 2YKLH 4P2QD 5I73B 4OKVA 4DQOH 5HGHB 3BW9A 4BH8B 2V9TA 5BS0E 2DKMA 3PNWB 3BQUD 1QBMH 3K74B 5B22A 1NC2B 4UIKH 2B1AL 4ZPTB 1BZ9A 1J1OL 3OZ9L 5EB9A 1RJLA 3QP3A 2QQNL 3RAJL 1FVDB 3R0MA 3LEXB 5I8EA 1UWEH 3ARBB 4NCC1 1W72B 1JV5B 3ZKMD 1N7ML 3C6LA 5DC0A 5CGMA 1OW0C 2E27H 3FT3A 4UOW0 5EC1A 1BOGB 4LLMA 4V1DA 1F97A 4DJMA 3VDAA 4FG6C 4KI1A 1G9NL 4RBPH 5E2TH 1XGRB 4ERSH 2FECI 4YDIL 1MI5D 1AXTL 2E7MA 2D2OA 3T1FB 3MO1B 5CSZB 1PW3A 5C7XH 1MJUH 4JPVL 1EEYA 4OLUL 2NMSA 3GRWL 3RWHA 4BYHA 5C0NC 5IK3B 5KVMC 2XN9E 1MJ8L 4KI5F 3PG2A 4ZFZA 4D9QD 4HJGA 4YXHL 3EYFB 3DV6B 1HXYB 2ADGB 2JB6A 4XWOD 4D2NA 4DVRL 5KN5B 2PW1A 4MWFB 2PR4H 4WWKD 4LOUD 1F3JB 2H2PD 3CLEH 4TNVK 4JCLA 3QIWA 2XIDA 5I15H 1YEHL 3P0GB 2CMRH 3EO1B 4UV4H 2J4WL 1RUKL 3D39A 1CD9B 1QBLH 4BZYA 4RNRB 3MRGA 1GH7A 1SYSA 5IVXB 3V6BR 4XNQB 3QO1A 1GHFH 2YHGA 4HXBL 1A7OL 3MLZH 1JI2A 4OM0H 2Q20A 3FFDA 1HDMA 3HZKB 1W72L 3FZUC 2XTLA 1WAAA 2R2HA 3W5NA 2NY3C 4JFQA 2VDPH 3BD3A 1FORH 3BP7A 3WSQL 1J0JA 4X83A 4R2GD 2NYYD 5D96C 4NSKA 3MRKB 3AXLB 3MRHA 1GOHA 4X6BA 5DD1H 1MFEH 5BVPH 3D48R 1DBMH 4H1LH 4UT6L 1WTGT 4AIOA 1T89A 1AO7E 5D2NE 5HI5D 1S8DA 4Y1AB 4Q2ZB 4XP1H 1CFNA 4OJFH 4YXKH 3SKMB 5SWQB 4GBXD 3IDMB 1PY9A 4U6TA 4PPTA 3PP4L 4KTYA 2QLVB 4YBQD 2FJFA 3RWJA 3RPKA 5E8EB 2WWMC 2MSPA 4IDJL 5DJYA 3EGSA 2OZ4H 1AFVH 5F7LB 5MEQA 4KTEH 3TA3A 1IT9L 1CT8B 2F54B 1PSKL 2P1YA 2N4IA 1A4KB 1N64L 4J6RL 4JY4B 1FZJB 1LD9B 3REVA 2DQDL 2X4QA 1ADQL 4ZTOL 4O5LL 1HCFX 4LL9A 1BBJB 3CC5B 4KV5E 4ELME 3UTZA 1OD7A 3V4UL 3FOMB 3VG9B 4WW2F 1TETL 1F6LL 5FECB 5EU6A 2KZWA 1JMXA 5T33L 5ACZB 1W0YT 5D7KD 1OGTA 5DVOA 3P9LA 2MQ3A 5FKPB 5EUOB 4IOIA 1A7NH 3RTQA 1A7RL 1JGLL 4MJIB 3P0VL 1T4KA 4IMLB 3TBYA 4PGEB 4U1NA 4X7DC 3G5XA 1HI6A 1UCBH 1G9ML 4J3TA 4IRJC 2FHFA 3D3VD 3EYOB 5IBTH 2YD7A 3RVUD 1J18A