4ALAH

Structure of dengue virus diii in complex with fab 2h12
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
217
structure length
208
Chain Sequence
b'DVQLVEPGAELVQPGASVKMSCKASGYTFSSYWINWEKQRPGKGLEWIGNIYPGSGTVNYDDKFKSKATLTIDTSSNTAYMQLSSLTSEDSAVYYCTRGGSHAMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSVTLGCLVKGYFPESVTVTWNSGSLVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENVELOPE PROTEIN
molecule tags Immune system
source organism Dengue virus 3
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
total genus 38
structure length 208
sequence length 217
ec nomenclature
pdb deposition date 2012-03-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4alaH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4alaH02
1NGYB 3D3VD 4WFFD 2CSPA 2NQCA 4QRQA 2EIZB 4YHZL 3UJJH 5KVEH 4TOYH 1I7UA 3SKUD 4LKXA 5CZKA 5L7XL 4LNRA 5JIHA 4JN2B 4ELME 5MHSD 3AGVA 2AXGA 1P7QA 3UBXG 2APXA 5IQ7H 4TVSa 4RFEB 1S8DB 1FC2D 1G6VK 5GQBA 2BDNH 3JV6A 2NY4B 3NMEA 3QIWA 4JQIL 2VZVA 4PJXF 2H8PB 3CFCL 4MCZB 4PRDB 1JPTH 3K1DA 4KMTL 2DF3A 4LGRB 1F11A 4PREB 4X6EA 4PJ5E 4H25A 1XGTA 3MPCA 3L95A 5D70H 1TCMA 3V7AG 3KHOA 2VLRD 5I1LA 5A2FA 3KPNB 1ZK9A 5K9QG 4DK3A 2V5MA 3BQUA 4U1LA 2QKIA 3EO9L 3HFML 3X13A 5JW3H 2XN9A 4V1DD 1IAIM 4DOHB 3FB7A 2P8MB 4EEEA 2W9DH 5I1DB 4KKAD 2QADD 2UWEF 3PHQB 4JO2L 2LV4A 4RFNC 4QRTB 2AK4A 1ZLWK 3LN5B 1IGML 2IANA 4XT1C 4L4VB 5HI4D 4HQQL 3AFLA 5EORL 4MNGE 3JWOC 3NCCB 4G5ZL 5EBMB 2X4QB 1ROWA 4P57A 3RJDA 3U4EA 4DKEH 3S37H 4M7ZC 4XCFH 3G6JB 4XVUC 1ZANL 2WSKA 1MCJA 4FFYL 4N0FA 4ISVA 5F9JA 2E6JA 4KRNA 3UPAA 3MYJA 3MRIA 1B0RB 1CXHA 4R9HA 3K81A 3AB0B 4XC1L 5GZNC 1CLOL 3BP5B 2CQVA 1RHFA 1EEZB 2UYLA 5F70A 2NY5C 4KAQH 5BV7L 5FYJL 5F72S 3QJHB 2V9RA 4XNQB 4OZIB 4ZSOA 4K8RC 1W72B 4KXZH 3EYOB 4DEPB 1BX2A 5E8OB 1P2CB 2AQ1A 3WNOA 4OLYH 2OR7A 3H3BC 4B5EA 4YHLL 1I8KB 1U8NA 4FQ1L 4IJ3B 4MCYA 3MO1A 4PJXB 2H1PH 5TE4L 2YS4A 3X13B 2IQ9H 4WIQA 4OT1H 2Y1VA 3VXMA 2HA1A 2VN7A 1OM3L 1UZ8B 1LEIA 3DGCR 4P2OB 4JFQA 3MBXL 4F7TA 4PY8J 1YJDC 4Q2ZA 5LCVL 3CFCH 5C0DB 4JY4A 2A1WH 1MAML 2ZPKH 4PB9H 4S10A 2HT2C 4ZD3H 1BFOA 1SEQL 4M7LH 3MRJB 1Z0MA 3RVWC 3FO2A 2C1OB 2ZUUA 1QA9A 1NAMB 3ZYOA 4AEHH 4CVZB 5IMOA 2ADFH 1G6RA 1DQDL 1YUHB 2BSTB 5HYQB 5C0AD 1MHPH 4WO4B 2J5LC 1SHMA 1TJHH 4TULL 5CLTA 5CEZD 3TYFA 4F2MB 5L9DH 5KSAC 5I1EH 1G9MC 2Y25A 2DQHH 4M1CD 5FA4A 4WW2F 3L3DA 4FQQB 1HI6B 2EXWC 3P4MA 3T4YA 4YQXL 4QWWD 4FTVB 1AO7D 1G7MB 2W9LA 2XA8H 3IETA 3OR6A 4HJGA 3DUUA 1OGAB 3BEVA 4X4XA 2PO6B 3NA9L 5DVMA 4XPHL 2QQLH 3QIUB 3OJMB 4ODSH 1ZLSL 4ZFZA 2D7QA 2AJ3A 4M61B 5FIEA 3BAEH 2DQIH 3QO0A 1K8DA 1YEHH 1UH4A 2DM7A 3O6KL 2VWEC 1WIOA 3GJFB 1G7PB 3QA3B 5KSUA 5ETUA 4Q9RH 3E0GA 3DO7B 4HWZA 3I2CL 5JIPA 1AC0A 5C0JB 4TNWK 3L3GA 1VACB 3PWNB 1WWBX 4KK9C 3DHMA 3HI6L 5IMOB 1JYXA 5DQJB 1P4LB 1D5MA 4F9LC 3KPSA 2CRZA 3VFGH 1AI1L 3HI5H 1U95A 1WWCA 2HVKB 3TBYB 3U0PB 3IDMB 3GI9H 5D7IB 2IPKA 1EO8H 5HJ3A 5EG6C 4PJ7A 4G7VH 2YZ8A 4EUPH 1I7TB 2XZCL 2ZUYA 4Q2ZB 2OR9H 4FXKA 4QRUA 5D7LD 2CJUL 4X0KB 4UQ3B 4JREC 5IBUG 3OG6B 1QSFD 3N1MC 2DLFH 4R8WH 4MWFB 2Q8AH 2BNRA 1EVTC 4M1CC 4D94A 3MRNB 2YBRA 1W0WA 5CINL 4ZFFA 4LIQH 1ETZB 3LMJL 2CLZB 3T3PF 4D9QD 2HFFB 1C16A 4ZDHA 35C8H 1VESA 3GMQB 32C2B 2NCMA 1YC8A 5HI5D 1JWUB 1TZIA 1IILE 1TENA 4LLMA 1NJ9B 2PW2A 3RFZC 1EZVY 3CFEB 5AG8A 3GNML 2F8XC 1I7ZB 2R0KL 2XRAH 1AIFA 2FYYB 1G7QA 4YUEL 2DQDH 3RWJB 1DQDH 1NGZB 1MFDL 3C5SB 4YDIH 2XWTA 4PLKC 1IM9B 2YMXL 1L0XA 3HZMA 1TJHL 4ISVB 4NKIL 4U1MA 3IF1A 2EIDA 5ICXA 1NCBL 3HMWL 2GAZA 4R26L 1AD0A 3U46A 4P57B 4XGZB 2UZYB 4JY5L 3EOTL 5ESVB 2ZSWB 5TQ0L 5IVXF 1MVFA 4NHCH 1P84J 1G7IA 3ROLB 4HS6B 4Y7MA 4M03A 4MB4A 3ULVD 4PRBA 1UXWA 1YEKH 3JWDC 3RWGA 5D2NC 5HD8C 3KJ4B 1KEGL 2FEEL 5JIIA 2YPVL 3ORJA 1P7KA 5HDOA 4S0TD 1TETL 4MA3B 3T3MF 5D2LB 4S1SL 2DTML 1SYVA 1KB5A 5KVFL 1FBIL 1XGUA 1T1YA 4JG1L 1ZXQA 4ONHA 1EO8L 2X4RA 4YBLB 1CD8A 3D69A 4W70A 1QBAA 2CLZA 5C7XH 4WUKL 4EIZC 1EGJL 4CU8A 1F4WL 1JMZA 1FSKC 3OJDB 5CIPA 3W5NA 4KMTH 1D9KB 1FGNH 4L1DA 3WS6A 2EDRA 4NJ9H 5IM7B 5GHWL 3TO4A 3DX9A 3MJ6A 2NY3D 4XBEL 4PJCB 4LIQL 3RX8A 1EAPB 3BZ4B 1T5XB 3KPOB 3IU4L 3SDDB 8CGTA 2BY0A 4PD4K 3EFDH 5F1KC 3EO9H 4KK6C 5E08H 3BN9C 4NGHH 3PDOB 1FDLL 2BXZA 4GH7B 1WBXA 3D2UA 1OP9A 4JLRB 2AV7A 2VDQL 1T89C 4IRZL 5EZOH 4Z7UA 4GXVH 4U6HB 5DVOA 1KLGB 2Q6WB 1U8KB 2OI9B 4GKOA 1CG9B 1CZ8L 4NZUL 4QGYA 2GYSA 3QI9C 3AMLA 3MJGX 2DM4A 4DKEL 1QSFE 3MYZA 1R5IA 2EYRA 4HJGB 1OF2A 4FFYH 4DK6A 1FL5B 3S7GA 3MBEC 3UDWC 1NMAL 3NN8A 2BNQD 1LEGA 1JF5A 1U8MA 3CSGA 3MJ9H 3NACL 1GL4B 1YNKL 2A83A 2VXQH 4IIQC 4LOUD 2CRIA 3ROLA 4OLEA 3U83A 5SX5H 3IS0X 2FD6L 2QSTA 4NNYA 4J7RA 3F7RA 2E7HA 4K94H 5E9DB 3GFUA 2FATH 3MV7B 4PB0L 2VL5A 2GTZA 1P5UA 4PJGE 5IB1A 3RVUD 2R8SL 1UZ6E 4FOMA 2X4OA 1NDMB 4OUUA 2XFXA 3UAJC 1NCAH 4NZTL 4GSDH 4PJFE 3MNZA 5DC9B 4BZ1L 1WICA 3V5KB 3ZMRA 1FL6B 1KLUA 4Z95H 4I0PC 5MHSE 5EZIL 2AW2A 5J6GB 4MX7A 3FTGB 4AQ1B 1FNGA 3PJSA 2C3VA 4MXVF 3FMGL 3ARZA 2KQMA 1E4WL 1D6VH 3ECBA 3RWFA 2HTKC 1NSNL 3E6FA 3GHBL 2MCG1 3GK8L 2W65B 3EO1A 3MXVL 4GMSH 4N5UA 3MRQB 5FKAB 4KKCD 3QHTC 3DSNA 5F1IB 1UYWH 2E7LC 3NIFF 4FZ8H 2Y5EA 3OR7B 3T0AA 1EAPA 2RAMA 4RQQA 5MEPB 1I8KA 4YGVB 4WWKD 4X83A 2UZXB 5FECB 3HZVA 3LEXA 2VDPH 1IGCH 4AT6A 2RFXB 4PJBF 4OTXH 4QHLB 1XF4A 4XWOC 3ARPA 3IU3A 4O00A 5HHOA 4MSWB 3MA7B 1DR9A 3LKQA 5BS0A 3KYOA 3Q5TA 3B43A 1I3VA 3QXAB 3ZDYE 1GOHA 1FNHA 4ZO6A 5EC2A 2AJSL 5FYKE 2OK0H 5EA0H 1X3DA 4GLRH 2DQTL 2NLJA 5TDPA 4R3SA 3S5LG 1JRHH 3QG7L 4L9LB 4GMTL 3V6ZA 4XNYH 2C3XA 3DO7A 2Z9TA 2ESVD 4XNZB 2X89A 1A5FL 1R3HA 3V4PH 4QRTA 5DK3A 1HHJA 4X6DA 1U93B 2IFGA 3STZB 3REVB 1X5YA 2HN7B 1QBML 2ED8A 4H26B 4EOWL 1B6DA 3BE1L 4NT6A 5C0RL 1W2KT 2DYPA 4LAQH 2ADIA 3IVKB 3MUGB 4NNPH 1U8IA 3ZT5A 5A3IC 4WI2A 4FQJL 1E4KC 3KPNA 1JJUA 5C6WH 4IJ3C 3MRBA 2BCKA 3OKDB 2CIIA 4JRWA 5GRJH 3BHBA 4BKLA 4PJ8B 3L6FB 5K33A 4NWUH 3O0RL 5E8NA 4CU7A 5J06A 1U8JB 3JUZA 3L5XH 4KH2A 1GZPA 2BJMH 5BZWA 1AQDB 1J8HB 5IVXB 4XVTH 4L3CB 1RJLA 2VDRH 3TH3T 5MEOA 2FGZA 2GY7B 4LCIH 2H45A 5FA3B 1A9EB 1AQKL 3PQYA 4JFYA 1A22B 1NGPH 3D1MC 4GMSL 1HQRB 3IYLW 3OX8B 5D1QB 4J4PD 4M48L 5F7KC 4FQHB 4ODHL 4TPRL 1WZMA 2NMSA 3AVEA 1WFOA 5EOQH 3MBEA 4F58L 3SJVE 3S96B 1MFDH 1CTNA 2YPLE 4JJ5B 3FOMA 4UQ3A 3LIZL 3NIDE 3GJFH 1MF2L 3ZO0A 3N85L 4HAGA 2HLAB 2WP3O 1ZHNB 4U31A 4LARH 4WNQB 5E2VH 4P2CG 1BD2E 4URTB 1A6WH 3CFBA 3QIUD 3EAKA 3HG1A 2PO6D 1GGCL 1ORSB 5EA0L 3FQTB 3CLFH 1JGEA 3MLZH 3DVGB 5F7EH 1A7OL 3MQIA 2ENSA 2O5YH 2VERN 3K7UA 3WXWL 1D5IL 4JZNA 2NY1C 2AXFB 3VRLE 3F6LA 2M26A 1P4IL 3GIZH 4L3ED 4NP4L 2WQ8A 3H7BA 1JZ6A 3VFTA 5IOPB 3BN9D 1H3XA 3LPWA 5HPOA 4HT1H 5DS8B 1PFCA 4M8QA 1NUFA 4ETYA 5C86A 2ORBH 2OTUB 5F71A 3HB3D 4JHAH 1X5GA 4H5SB 4N0CD 4YHIA 7FABL 4PLNC 4QCIB 4GG6A 1HKLL 4HLJA 1XH3B 5I1GH 1U8OA 5DJXA 2PO6A 2K7QA 1DBJH 3C08H 3CCHB 1N8ZB 3L3IB 4OZFA 1GSMA 4N8VG 3NCBB 5KVFH 4XB7A 1NAKL 3P4MB 4JEGB 5CSZB 3T4YB 4P23A 5FCSH 2N1KA 4XNZC 2HFGH 2F9BT 2QJDA 1PZUB 1KN4L 1WBZA 2X4PA 4G6AC 3MRLB 4FNLL 1PSKL 3SGJA 3QQ4B 4XPGL 4ZUUA 4OV5B 1P9MC 2OLDA 4JFDB 3O9WD 1RMFH 4RBPK 4OJFH 1SBSL 4V2BA 5MI0C 2FLRT 3ROOB 4WCYL 4ODTH 4RFOL 1OLZA 5E94A 5CZVL 2ESVE 3MRRB 3HNSL 3WS3B 4QYOA 5DEFB 3O4OC 1W0YT 1MEXH 4MHHI 4ODWA 3L6FA 1NDGA 3HCVB 4KZDH 1Q94B 2QSCH 4JM2D 2IMNA 4IOIA 3GMMB 4DFIA 3K8MA 3WXVH 4F58H 4UB0H 1MHPL 4HPOL 4P2RE 3HE6A 4QWWC 1U8NB 4LARL 2HG5B 4FFWD 4EN3C 4DGYH 2ZNWA 2AJXH 4YXHL 1G7HB 2EIZA 1T66C 2XPGA 2AGJL 1NL0H 3KPSE 5H94B 3VMPA 1XCQA 5B21A 1U92A 5D1XC 4KRLB 1UQSB 2AJZA 1AGFA 4P9MH 3L1OH 4MNGB 4P23C 5FM5O 3VFMB 3WO4C 5E24E 3NACH 1WBYB 3BEWB 5E2UL 1XGPB 4P3CH 4MVBC 2ITDA 4ERSH 5BV7C 2EDWA 4ZUVA 2EE9A 2VSDA 2DQJH 1UB5A 2H9GB 2GEEA 5B22A 2A6IA 4G6ML 1N0XH 2OZ4L 4YK4B 2CLRA 4XRCB 4XTRC 4YZFF 4F7PB 4MSWA 2E9WA 1BQLH 3MV9D 1YYML 3VFUB 2FJHB 2JJVA 3PXHA 4Z5RB 3U7WH 3JTSA 4D2NA 3HR6A 1KPRB 4OZIE 1OAXH 1XF3B 4D0BB 1GIGL 4DCQB 4BZ1H 1CGXA 3L3KA 1Y0LA 3P0YL 4I3RL 4N1CA 4ODVH 2VE6A 5I1DA 4HFWA 1WQVT 3TA3D 3MRQA 4P2QA 3VXRB 1E28B 5GGSB 1ZT4B 4W6WB 3REWB 3MLXL 3KR3L 3ECBB 3RWFB 4HWBH 1T1WB 3EZJB 3OL2A 4AYFA 3MBEB 1XR9B 1BMGA 3DOSA 1A0QL 4NC1C 4GRWB 2PXYB 5C09E 5E00A 2VZ1A 1KIQB 4LEOA 3OX8A 5D1QA 2GJ6D 2XTJD 3UPRB 5EWIH 4MCZA 1SEBA 4KJWD 4Y4HC 4LSRH 4UBDC 5HY9A 4D9LL 4Q6YA 1KFAH 3DI3B 3RVVC 3D85D 1J11A 1PLGL 2VLJB 4O5LL 2UY6A 3RTQC 4MQSB 2FNBA 3SGKA 1ACYL 2R1YA 4HFWB 4OGAD 4X5WA 3TZVA 5GS0H 1CN4A 4K8RH 4E5XA 4LU5L 4KQ3H 2BSRA 1RUPL 4N0YL 2PO6C 3WL9B 3RWCA 1Y6MR 4I0PB 1Q9KA 1JNHA 4CVXA 4LSTH 3TN0A 5JHDD 4XP5H 2I60H 2R56H 4NDMB 2NTSP 2XG4A 1AXTL 2P5EB 2HJKB 3VW3H 2BVPB 5FHAL 3ETBF 3QWQB 3HR5A 3BUYB 1FRGL 2EE3A 4F37K 4Z8FH 3ZE1F 3LKNA 2HN7A 4LAQL 1A9BB 3FQUB 1ZA6A 4Y4KA 4IM8A 1VSCA 1BBJA 4F9PC 4LSQL 1F58H 3WE6B 5F9WC 4G6MH 3MV8A 3VFWB 4YHOH 1AHWA 3VXQB 4S1RL 3ZKSD 1F90H 3M1BA 4PJAA 5M7QA 3FB8A 2P24B 5E5RB 2BVQA 2NLJB 5TDPB 3OKLB 4UTAL 1XCQB 3P4OB 5CSGA 5LG1A 3SCMA 3DX8A 3QRGL 4AIOA 1YN7B 2AK4E 5IWLA 3UO1L 3RGVB 5D93C 5H2BA 3V95A 5J12B 4MYWB 1T5XA 3TIDB 3O45B 3LKQB 4PG2A 3T77A 5C7XL 4MQTB 4ORGA 3RWDA 2R2EB 3FQXB 5D5MB 3TH2T 1NGQH 1F8TH 3O3BB 3GI8H 4A6YB 3LDBC 2B4CH 4WHYH 3RX5A 4YFLI 4IOIB 3TESA 5FECA 2YEZB 1S7TB 2K3TA 4KKAC 1FO0L 4NN6B 2R0ZH 4G80A 4YHPB 1QQDA 4EJ1C 3G08A 1DUZA 3BH8A 1KIPA 1AY1L 5DO2C 3WUWA 4HZLA 1HIMH 4GO6B 1MRFL 2PYEE 4PJFF 1FVEB 1FL3B 1AFVL 2DQCH 1LO0H 3JV0A 4LCCB 4KROC 4CJ0A 1X7QB 1PLGH 5F7DB 4OD2B 3S5LB 3ZKND 3SKOA 2Z92A 3X11A 3I3DA 3WE6A 2E7MA 2F15A 4PP1D 3DSFH 5BQ7A 4K07A 4XH2B 1ZA6B 3E1F1 3E8UH 3GSQB 4KDWA 4HUNB 3AU1A 5F7EL 4M6OH 1UEMA 4FP8L 3VRLF 4AENA 4NRZA 5AYQA 1A7QL 1TJGL 2V7NB 3WFBH 3I6LE 4TUOA 5DQ9A 5C0BB 4ELKA 4QRRA 1K4CB 5DSCB 4NO2A 2F54E 2HJKA 1OARL 1KJMB 3U6RA 4MGXA 4GW4B 3C6SB 2XKSA 4ZTOH 3QUMH 1S9VA 3C6LB 5ADOL 1PVHA 4LAJH 5GJTH 3RVTD 5GSVB 3KPLA 1DBAL 1MAKA 4OCWH 5DC0A 5DJZA 4JFFD 2B8OT 5MENB 3V6BR 4NM4L 5I2IA 3F65A 1U8MB 3DPBA 5SWZD 3RIFK 1R3LB 4KDTC 2XTJE 1KG0B 1PD6A 4DN3H 2YA0A 1CLZL 4LASH 3PWPA 3KG5A 1FCCA 5J3HC 3SGEI 3QCUL 2JF1A 1INQA 1S7WB 1S78C 1KLGA 4OLVL 2Q6WA 4WW1B 3LQAC 1PDKA 2G5BA 1KIQA 1NANH 3RPKA 4P3DB 1FPTL 2W9EL 4UAOC 2Q86B 2D9CA 4XAKE 3ARYA 5FO8B 1JTTA 4YPGB 1T1WA 4JO1H 2R2HB 4JANB 5GGSA 3QFJA 4JFZL 3PQYE 4EVNA 2DWEB 2ICEA 1RIHH 1JI1A 2NXYC 2BY1A 2FSEB 4P4RA 4KVNH 3EYVB 3AS1A 4Z6AT 5DC4B 1QRKA 3QG6A 1UB6A 1O7VA 4CVUA 5DJ6B 5MP6H 4ELMF 4PRAA 1JGDB 1IM9D 4GUPB 3NH7H 5M94B 4RX4D 4UB0L 3SKMB 2QR0A 4IS6B 5IW3A 3A6BH 1FFNB 5EU7E 4UT9H 5CJBA 1C08B 4TSBL 3SDXB 4OQTH 4QRPB 1FH5H 3BP7B 3P9LB 1GZPB 3M8OH 4JO2H 2NY6C 2X4RB 4YEFA 4LSSL 1JZ3A 5HDQL 3IDJB 5JOPD 4B7LA 1UXSA 3DXAE 2KZWA 4RMRA 3VXUE 1C5BH 4HQQH 2X10A 3MLTA 1SM3H 4M43L 4ZFZB 4J3SA 5D7JC 1VDGA 3RWGB 4KHXL 4TNWF 3MRPA 3VFSA 1GGTA 4NQSA 4JFEA 5J56B 3V0VA 1KIRB 1UVQA 5DGRA 1PAMA 3PL6D 4ZTOL 4UDTB 1NPUA 4YDJA 1WJ3A 5I76B 2UWEE 1T21A 3TNMB 1LK2B 5HGAB 4XC3H 1MCNA 2BRQA 4HKBA 4FQJH 1H3GA 2NTFA 2NY3C 1CFQB 4I2XB 2I07A 5EUOE 3F7PC 3S36X 2J8OA 5FGSA 5DRNB 1ZEAH 3RQ3A 3O2WH 3NIGF 1HCFX 3QDAA 4P5MA 1FCGA 4YBHA 3HAEH 5T1MA 2SEBA 5C0EB 4OT1L 5BS0B 3O6LL 1A8JH 1X44A 4OCLC 3F12B 4G8GA 5D1XB 4NQUA 4HWEL 2VDRL 4QXGH 3TT1L 2MCPH 5IB4B 4NRYB 1AGEB 1TVHA 5C2BL 1RJZA 1KB5L 4JFZH 4PG9B 5AD0B 1M7DB 1JWUA 1QNZL 3RKDD 3LB6D 2F8VA 5HHOE 3W82A 3OKEA 2X4PB 2NW2A 2PTUA 3INUL 1XGQA 3IFOA 3J8F7 4YHMH 3WFZA 2J6EL 1RUKL 1W0WB 2ADFL 3MROA 4WO4D 3F5WB 1CLOH 5GIRA 5D71H 4MAYD 5JZ7D 4PRNA 4WW2B 4LSVL 5CGTA 4TSBH 3O6FA 4LHUA 3F12A 2NW3A 3IDYC 1OHQA 5EU3A 4JHZA 3WFDL 3GO1H 3QDGA 3RKDC 1EVUA 2IPKB 4GKSA 2WW8A 4P5MB 3QDMD 2J8UA 2C1PB 1VGEH 5D7KD 2X6MA 5C9JA 3CLFL 4APQA 1SM3L 1FFPB 3HAEA 3C2SA 3LVEA 3RL2A 4Y5YC 4LPTA 1F6AA 4HKBB 4NP4H 2DQIL 2P5WA 5IVZB 4J6RH 5B8CC 3SKNA 1BECA 3BT2H 3GDBA 4P3WA 5JQ6L 4WWID 5ANME 3QO0B 3MGTA 5F7UA 1IVLA 3CMGA 1A7RL 1HH6A 4BJLA 4XCNB 5DGQA 3AY4A 5HHVH 3MLVL 2E9BA 3CD4A 2Y5TA 4GG8B 4LCYA 4ZG1A 4JJ5A 3PHOB 2AEQH 1RULL 5I9QC 3MRFA 4BFEA 2GY5A 5IBUB 5DVNA 2YC1B 2OTWB 3O4LE 1KN4H 5FA4B 3O2WL 4XWGH 1KBGH 2EDBA 3BN3B 2EDTA 3SDXF 5HGHA 5CBEB 4YHYC 3QO1B 1CIDA 3N1PC 1JVKA 4QXTB 2BVEA 4KJPD 2GI7A 2AVGA 2DQGL 3HAEG 2CGRH 4PRAB 4A6YL 1J1PL 5L8LB 1JWSA 3MLRH 1LNUB 1QRND 2DLGA 3O41B 3MA9L 1EFXD 3BGAA 3KPOA 4TRPL 4UT6H 3SDDA 4ACPA 3L7EB 5IEHA 4MJ5B 4XWOD 2EEAA 1S3KL 4MZ3A 3BPOC 1OAKH 4R90H 3P3YA 1D9KA 2F19H 5FDWB 3OAZK 3TH4T 3IDNB 5DMJB 4OSUL 1KTDB 5D71L 4NZRL 4ZFOB 3GHEH 3BSZL 2LU7A 2QLVB 5HGAA 4PJXA 4RAVA 2XA3A 3S4SB 5BW7A 2DIBA 3U82B 4JGJA 3UTQB 5JA8B 2NXYD 4DGYL 3NPSC 2IPTL 5J11C 3DUSB 2EYTA 2YA1A 3LKPA 3O3EA 1HHJB 3STZA 1QSEA 2CKBB 5IR1A 4YHNB 5E0QA 1T4KB 1H15A 5T3XE 3GMNA 5KVMC 4X7SL 1MQKH 3BWAA 5IBTL 5E6IA 3DMMD 4HXAL 5EBLB 1AR2A 3RUGA 5C0AA 1B2WL 5F7YC 3T8XA 5MENA 4G42A 2OMNA 2XICA 5HYJE 2VLJE 1RZJH 3BKMH 5SX4H 1GJIA 2YPVH 3PGCA 4I4WB 4NO2B 1JHLL 3ZYIA 2NNAB 5TDOA 2OSLB 4OAWB 1QFUL 3D3VE 5T5NF 3D3VB 4GKZB 4GRLA 1C8PA 1H3PH 3MROB 3HZVB 4M9PA 2FEDC 4NQCB 3BMWA 3ZT7A 4CN1A 5MERA 4IRJA 3QR2A 2A6DA 3SPVB 4XWGL 1EJOL 5DRWB 5CJOH 1UG9A 1R24B 3FFDB 2XN9B 1IC4H 5I74C 1TTGA 4XMLL 5FYJU 2DICA 2FBJH 3HE6D 4KKBC 3ZE0F 3KYKL 3FQRA 4MD5B 3WUWB 4AIZA 1DBMH 4MX7B 3GSNA 2ZWLT 3BPLB 4JRXB 1J5OH 4H25B 3FAWA 1QYGL 3V5KA 2VMFA 5DMKB 3JUYA 4EI5C 1L7IH 3HE7C 3KWWA 4LCCC 2PYFA 1MIEH 1S7WA 3AS0A 4YNYB 3WKML 1FZMA 4PRPB 3L5JA 1WT5C 4A6YA 2F19L 4MS8D 3GMOA 2D7NA 3CIQA 4GW1A 3V6FB 4P46A 2PYED 1S7XB 2UY7A 3T0WA 4GBXC 1BIHA 2DQUL 2N7AA 5IEKB 5HI4C 4YAQB 5HJ3B 1VHPA 1UH3A 1KPUB 2F53A 3S3PA 1BBDL 4HUUA 3VFOA 3RIFF 4JPIA 3TBYA 5E8DL 1DCLA 3KPSB 1N6QL 5JORB 4I13B 4QRQB 5HHXL 5DD3H 1A64A 3ZYZA 1KIRA 1UVQB 4DAGL 1FHGA 5I1AB 1RPQA 5CP3A 3C6LC 3GMLA 4JQXA 2A77L 4NQSB 2JJSA 4M00A 3ARUA 1AP2B 4HWZB 1N6VA 4TSAL 3AXLB 2IG2H 3W0WB 4Q6IA 5DFTA 2YD1A 1DFBH 2NX5B 5SWZE 3U36A 3LAFA 1XIWC 4TTDD 5GGSY 4KTDH 1X4YA 1KB9K 2EIEA 3O8XA 1CS6A 1GHFH 5ALCH 5JORA 1NBZA 1B3JA 4X4ZA 4E41A 3F7YB 4GSDL 2DQEH 4I0PA 2YUVA 2P8PB 3EYUL 1QQDB 5JNYB 5LWYL 4HWEH 4JPKH 4GXVL 1CDGA 2BHZA 2ICEB 3K2UH 1NLDH 3JWDH 5F44A 3A6CL 3OSKA 3SE3C 3LY6A 5EUOA 4L8CB 4CMHC 4PRPA 3BPNB 3KLHD 3HZKB 3D9AL 4FQLL 5KW9L 3IJYB 1B0GB 4W4OC 1ZE3C 3WN5C 2R0WL 3UDWA 2BNQB 1IGCL 1WZLA 2ATKB 5E2JA 2OL3A 4U1SB 4LSVH 4NKMB 2R29H 3KXFE 1G9NH 1UZ8A 1LEIB 5FB8A 3TFKD 5DD0L 3CZFA 4ZPVB 2ZP0T 2NY4C 5KVEL 4XNUH 3DNKA 3HKFA 4RISH 1MOEA 43C9A 3E8UL 5I1HL 5F89B 5F3BA 3BKYH 3I6GB 4FMKA 1DANU 1LE9A 1NCAL 1WEJH 3RHWF 4Y4FD 3QUYB 5B38G 2BY3A 5T1LA 5IQ7L 1RK0A 2N4IA 3RIAK 2ERJB 8FABB 3LRHA 5LXGL 2UYLB 4XBGA 2NNAA 1FFOA 5FHBL 3BT2L 3TA3C 1ZHBB 4J8RA 2E9IA 3KLSA 4LMQE 1F5WA 3MYJB 4NQDE 2DMCA 4HIXL 3RAJH 2NPLX 1OAYL 4G42B 1NFDA 1UYWL 3C8HA 1IAMA 1JPGA 2B2XL 2NY3B 1U3HA 3MJ7A 5IV2A 2QL1A 4NKDB 5GGRA 4KU1A 3ULSB 3GSXB 3DYMA 5E6IB 4ZPVA 2D7PA 3I85A 2KUTA 1HNGA 5C09A 3JWNC 1TZHB 1S7UB 4LPYA 3UBXI 3KYNB 3VXUB 1AXSA 3QEHB 1NJ9A 2PW2B 4HZLB 4CL7A 5D1ZB 3MOQA 2BNQA 4BK4A 4TUJA 1G7JB 4G80B 4YHPA 1JPSL 1UJ3C 1YYLL 3CDYA 4LCUA 3MLYL 2HRPH 1YQVL 2HFFA 2P8LA 1RHHA 1JGLL 3ARBB 3C8KB 4Z0XB 1OAUH 1UFUA 1IEAA 4NN6C 4MNHB 1GPOH 2EXWD 2D0GA 1F02I 3AM8A 2R2BB 4ZUTB 4TRPH 3B6SA 4L5FL 4LDEB 1CBVL 3K4ZA 1NUGA 1XGTB 2IH1A 1YEFH 3VCLA 4RGNE 1GGIL 3MV7E 3FOLA 1JUFB 2MFNA 2ZUXA 5EIVA 3MGAA 5IJKA 3UTTD 4HULB 3BE1H 4MZ2A 1SMOA 4C56D 4PJ9D 1X5XA 2X4TB 1ZWIB 3ROOA 1WAAA 3S88H 3BSZH 1QFWI 4UDUB 2GCYA 3WFHA 1G9NL 1CL7H 1CT8A 2YD8A 3RRQA 2EICA 2FBOJ 4P2OC 3FO1B 1S7SB 4N0UE 2FO4A 4R4BA 1CGSL 2AXGB 1G9EA 1NGXB 2H6PB 1WBZB 5ID0A 3VXRD 3GSVB 5TE4H 1T7XA 1A7OH 3WXWH 4HGMA 3C87A 3BUYA 4KKLD 4KHXH 1OM3H 1CR9H 4NKOA 5JUEH 1HWHB 3T0EE 1CFNA 3BGFC 2P5EA 1OPGH 1U92B 2WWKO 5EU6E 1F4WH 2IAND 2R15A 4WUUE 1FIEA 2B5IC 5GPRA 2NY5L 4RGMC 1RAMA 4YE4L 1G7HA 1T0NA 3LS4L 4K8RD 4Z18A 2C3WA 5ISZA 4X4YB 5JQHC 2XI9A 3E6HA 1JGUH 4AEHL 5ABDE 3AM8C 1GAFL 3W2DL 5IP4A 1IFHL 4OV6F 1JNNL 1Z9OA 1AXIB 3D0VB 4EUPA 1ZVYA 3TT3H 4U1JB 2ZCHH 1IKFH 4MA1B 4ZO7A 3QHFL 3W39B 1MQ8A 3ILQC 4PGBA 4Z7OF 1IGFH 4FQ2L 4RDQG 1CK0H 1UM5H 5BOZG 2P5EE 2JJUA 4M6MH 1S78D 1FZOB 4UIKH 4P2OA 2QQLL 2FL5B 2YOCA 5I18H 3QCVH 3HC3L 4NZUH 4H1LB 4P2QB 1BGXL 4IRSA 4NN5B 5C07E 3LN9A 4F7MB 1MCWW 2A2QT 4KZDL 4HT1L 1U58B 3MC0A 2ZUQB 2AQ2A 4R7NB 4NPYA 3T2PA 4MJIB 4ONGH 5E8OA 3NA4A 3Q2CA 2Y23A 5CSZA 5C08A 4WFGE 4JHAL 4JKLA 1S9YA 5DLML 2HWZH 1AKJA 1QZ1A 3T08A 4G8GB 4ZPTA 1U3HC 1NBQA 2Z4QB 5BVPL 4PJDB 5I30L 3ARFD 5DQDH 3A67H 3DV6B 3P0VH 5IHZB 3EHBC 1NAML 3NFSL 2YUZA 4KJYB 2BCKB 2VR9A 3RUGB 4K9EL 4NZTH 2M2DA 4JO4L 3SOBH 2VLLA 2DBLL 5EBGA 2BP3A 4WV1A 5J6HA 1SBSH 4KROD 2DYPB 5HSFA 4TVPE 3D48R 1H15B 3FMGH 2IBZX 4MNQA 2Q7YA 3RDTA 1E4WH 3OKMB 3MUZ1 1MCPH 3PWJA 2ARJA 3NABH 1AJ7H 3QZWB 1FIGH 4M1GL 4M6NH 3HNSH 4WTZA 3RVXC 4HBCH 1J1XH 1LO5B 1ZHNA 3RHWK 4JDVB 4JM2A 2ZCLH 2BMKB 3NCYP 2QSCL 4O2EA 5DK0A 2AEQL 4H1LH 5E9DE 3SCMC 3RU8L 5KS9E 1GAFH 3GJEB 1Q9OA 3W2DH 4X6CB 2OP4L 2HKHH 1YNLH 4GT7A 2ATPA 1LDPH 2QHRH 4NC2B 3UJIH 4XVUD 1MJUL 1MFEL 1XCTA 2MTPA 4P2QD 5JOFB 5IMLB 4YDVA 3VXMD 3GRWA 4F15B 1F3DH 2VQ1B 1FYHB 3FO1A 3RNQB 2FRGP 4JGMA 3ULUE 4CUCA 3RGVC 3ULVF 5HHMB 3QH3B 3SKMA 2X4TA 1Z9SA 2PCPA 3HZYB 3I6KB 3PP3H 3HC3H 2Y36L 1G6RH 1R3JA 4DVBA 3VI3F 1JUFA 3QDME 4LNRB 1KFAL 3VWKB 1HEZB 2DI9A 4U6VH 2DWEA 4O2FB 4I3SH 1N0XL 2DAVA 3GMRB 1AGBA 2AXHA 3BDYH 4WV1C 4GAYA 1IAIL 2FDBP 4ZFGH 25C8H 2L7JA 3EOBA 4JZJA 1OSZA 2YSSB 4GG6E 4JDVA 1ADQH 2IALB 3PV6B 5CJXC 2MMXA 1GC1C 2XY2A 5IK3A 4XCNA 4H26A 4Z7WF 4FZEL 5DD5L 3REVA 4FQ1H 3EYSH 1INQB 1PGRB 2C3HA 4NWUL 3WD5H 2YD7A 1I9RH 1FYTB 5DVLA 2I25N 5GS2H 1S7UA 4U4BA 3VG9B 5FCUH 1YNTB 1FRGH 3Q0HA 4ODUA 4HIXH 1HHGB 3E6HB 1MLBA 2EDQA 2OL3H 4KZEL 1RVFL 3I3EA 5DVKA 5D8JH 3Q3GB 4EUPG 4X9IA 4G6FB 1T0NB 4MDIB 5DD6B 4NSKB 3BKML 4X6CE 4WU7A 4L8SB 4OF6A 4HBCL 3SCMD 5TJWK 4C56B 3O11B 3SDCD 2A74B 4JRYB 5DSCA 1JCKA 1T7ZA 1IAOB 5C08B 2WUBL 4OLZL 3LH2L 3UJIL 3RTQA 3SGJC 4P2RB 2FHCA 4WY7H 5CKGA 4WI5A 2ZOLB 4M5YH 1JV5B 5L88H 1G84A 5B3JE 1V7MH 3GI8L 3P11H 1MCSA 5GS3A 1J8HE 1EUTA 5AD0A 2W65A 2BSSB 1TVHB 1FAIH 4C4KO 5HXMA 2FL5A 3NA9H 4YGAB 3HLAA 3WN5B 2JK5B 5K93A 2OL3B 3ZTNL 6CGTA 3FCTA 3BPOB 3H3PL 5GS0D 3VXUD 3BAEL 4U3CA 3V8OA 2IAMB 5DRZA 2W92A 1KCLA 3GSRA 3U7YL 2A73B 3MV8D 4B0MM 1CE6B 3WNNA 5E6ID 1CL7L 4D8PA 4L3AA 1A1MB 5EU4A 1T20B 4ZUWA 43CAB 2E27L 4HFUL 3VXSB 1I9IL 1ZKAA 3RNKA 4GAGL 2P8LB 1XF1A 3RA7L 5KTEH 4OCRH 3QCTL 2J2ZA 4M6OL 2MWCA 3PWPE 1DSFH 4QRRD 4RGOH 2BERA 4YDJB 1MCQA 4Y1AA 5D2LA 4X6DB 5L6YH 3QNXA 3WMSA 3DX7B 1DVFB 5DD3L 1CGWA 4G8EA 4MDJA 4DAGH 3ZKMC 2OJEA 5EOCL 3CVHA 3WLWC 4L9LA 4ORZC 3V6ZB 4Y16C 1CFNB 5DHYA 4NUJA 4Q7DA 2CLVA 5DHXB 1DBAH 2DLFL 3CFJA 4NKDA 4TSAH 3PNWA 1J18A 3QXUA 4TUKH 1ED3A 2APTA 1B0WA 5D70L 1BFSA 3MV7D 4QGTA 1PG7H 2HT3C 2R0ZL 1ZSDA 5CZVH 3AXLA 5ITFA 2ARJQ 1MCLA 1OTTC 1J0YA 1TLKA 2VAJA 1EHNA 1WZ1H 1GHFL 4XBGB 4PGCA 1C08A 3FQWB 2W9DL 4XPFL 3QUYA 3RUGF 2DJSA 5J57B 1MAJA 3DVNB 4G9DB 3IF1B 4QT5A 4YGVA 5F3BB 4HUUB 3HZMB 4CADA 3OF6A 1OT2A 1KELH 3G04B 4HMEA 4HZAA 4PJIE 4XXDB 1EHLL 1V7ML 4P46D 2XTLA 4JJHA 5HVHC 1MCDA 1AR1C 5LAXA 4QHKI 4PTUB 3PJSB 5H37G 2F53D 4KI5E 2AI0H 2BSED 3GUTA 1MREL 1BHGA 1C1EL 1RZKL 4ZFOL 4ZOAA 2HKFL 5DXWA 2F74A 1KXVC 5E2UH 1MCIA 3LQAL 3VD7A 2D0HA 4WDIA 4LVOB 1RFDH 1BM3H 4MA3A 1FH5L 2V7HB 4G3YL 5F8RC 5DRXB 2OZ4H 3RY4A 3G6AA 3TO4C 4PLJD 3V0AC 2EDDA 5HGDA 5HI5C 1AE6L 4O58H 2X05A 1JN6A 4OLXH 2IBGA 4HFUH 2P7TA 4BH8A 4PJ7B 1MCOH 1NKOA 4KAQL 3G04A 3X3FH 5I1HH 2VE6B 2IQ9L 1NFDB 3L3KB 1DLHB 2BVUA 4AY0A 4X80H 5GRXG 1FPTH 2W9EH 1TFHA 5LXGH 1TCRA 5IG7A 2FWOB 3O8XB 5CP7B 4PGCB 5EOCH 1UEYA 4K23H 1K85A 2F8OA 1OTUD 1AJ7L 1ND0A 3TO4D 5L0QC 2EDHA 4PB9L 4XNXH 5EU6D 1T83C 4I77H 5CUSH 4AENB 4PGEA 1LO3L 3IRZA 3OKNA 3GSUB 4XCYA 5E1AB 1UB5B 4ONOA 4WU5A 1HILB 2GJ6E 5B8CB 2Y6SC 4U1IB 5A16A 4I1NB 5DDHB 2A0LC 3S5LA 4LLDB 1YNLL 3B5GA 4FXLA 1JTPA 1AGFB 5KG9B 4LCCA 2H32B 1BVKB 1PYWB 2CKBH 3DUHA 2OJEB 3HUJF 1T4KA 4Y16B 2VDMH 4HX1B 4WW2C 2R39A 4KRPC 2VXVL 4U1SA 4FQQA 3FT2B 4JRXD 1KIPB 3C5ZD 1EUUA 1JPSH 2JJTA 3N1GC 1I7RA 5IFHL 3MRMB 5F97E 4GS7B 5LVEA 5L9DL 1T80A 2EDNA 2VLRA 3P73A 5CJXA 3TM6A 4AZ8A 1RUPH 4N0YH 4Y8DC 1F6LL 3OGCB 4C57C 4LLWB 3GMOB 4UI2A 3EDKA 1MI5E 4LCWB 4MAUH 2RB8A 2AK1L 5KN5A 4D8PB 3DROA 1ERNA 1F00I 3O2VL 3NCMA 1RV6X 1I7TA 4G8IB 4NQCD 4Q9RL 4AG4H 1RUKH 1XZ0A 5IB5B 1MVUA 4U6XA 3BZFB 1JWSB 1QEWB 5FFLA 3KYMB 4KFZC 5TF0A 3SO3B 3KXFB 3L5WB 1FG2B 1U3ZA 3VGBA 1D5XA 3TCXA 2P24A 5J1TC 2H32A 3O6MH 3QDJD 2FIRT 3LEVL 4FN0A 3GI9L 3KNBA 1IC5L 3MV01 3U2SB 2OJZL 1HQ4B 1ZEAL 2DL9A 2H26A 2XWJB 1FP5A 1RSFA 4BQ9A 4FNLH 1ZMYA 3CK0H 1X5KA 1MCCA 5KVDH 4PGEB 3TJHC 3MOBL 5E2TH 4GG6F 5BVJA 5MEQB 3LV3A 3BYTA 5FM8A 3E3QC 4OFIA 4Y2DA 5D8JL 3UTPE 1TZGL 3GMLB 3N1FC 1LDSA 2NY5H 1FYTE 2ADGB 1A3LH 2B4CL 1V3MA 5FM5M 2YWYA 5DWUL 2EEBA 1MJ8L 3SQOH 2XACC 1ORQB 3VFVB 3X17A 3OPZL 1F2QA 2XRAL 3S3JA 1FFQA 4G9FE 1MLBB 5AG9A 3G5YA 4N0UA 4Z77A 1RD6A 3RY5A 5I66A 1JGEB 5DRXA 4BQBA 1C7TA 1DQLL 3F7QA 2VTFA 2HRLA 1FLTX 4JZOA 3MMEB 2DQDL 3UTTA 4WEMB 3EFFA 1KACB 5IW6A 4YPJA 1OGTB 1CK0L 1FAIL 4PJIA 1X6LA 3JSSA 1VFAB 3FQRB 1WF5A 1K6QH 3C9NA 2IBBA 1EFXA 5FDWA 4WHTA 1MRDL 1SJVA 4P4KD 1JRHL 2XXCB 1L0QA 3ZKXC 3GBMH 2XKNA 2NW2B 1A5FH 1MHHB 3I84A 1E4XL 4OIAA 4TYUA 2A6DB 1G9ML 2W0LA 1BJ8A 5FK9B 1TDQA 3CC5B 4LKCB 1BQLL 1BOYA 2BZDA 1I3GL 4FRWA 1F45A 2OSLA 2OZ4A 5D1XA 4ZYKB 5T33H 3MRDA 5IVXA 4K3HA 3V5HB 1TPXC 5FF6A 4B7IA 2A6IB 2SEBB 5C0EA 1SQ2N 2MPAH 2COQA 1GC1L 2I5YL 2IF7A 3VG9C 4N0FB 1XCTB 1GCFA 3T8XB 1D5BA 4LLVB 3AREB 4LBEA 4HG4J 5CKAA 3VJ6A 3DX6B 1YC7A 3MRFB 3SOBL 5GISL 4MNGA 1A4JA 4XBEH 2IFFL 3BEVB 4WUKH 2VAAA 1A3RH 1D7FA 5FGCE 5DMGC 1X5AA 3MUY1 1HH6B 1RUQL 3SE9L 5D9SB 3G9VA 3K4AA 1JZ8A 1QO3A 1J1XL 2ARJB 4M48H 3QDGD 3ZLQC 4KVNL 5C6PB 5ISZE 3V4VH 1FDLH 1NMCC 4LPXA 3H9SB 3K8KA 3IDGA 3UC0L 2ZOKB 1MRCH 1ITCA 3ULUL 3BQUB 5HYJB 4YWGH 1QLRB 3BXNB 3MLTB 5EZOL 3VJ6B 4NZRH 1CICD 4V1DE 5CJOL 5GS0L 1MF2H 2P5WD 3Q48A 3QUXB 3DGGA 4UINL 4U6XB 5K59E 3BDXA 3V6OE 1U8LB 2GK2A 4IRZH 3BP7A 3P9LA 1K3ZA 4ZYKA 4ELMA 2Z31D 1PW3A 3NCJL 4X98A 3N9GH 4GKNB 1AGDB 1OQXA 3CC5A 5IJVA 4LLWA 4GUPA 3FHQA 2VXQL 2BSSA 5H35A 3NAAL 5IB2B 3QIWC 4RAHA 5DJ6A 5A2JH 5TE7H 5DTFA 5IQ9A 4NNXB 4GRMA 3RTQD 4P9HC 4PP2B 3HUJB 3MACH 1MCBA 5DUML 2IWGA 1OAZH 2NY2D 3BDYL 5DHVB 1BX2B 3V0WL 4LOUC 5D2LF 3GGWA 2ZUSA 5LGHL 4Z7VE 5CCKL 4OZFB 4M3JA 1I8LA 4RWHA 4K9EC 1U8OB 2EYSB 3ARXA 2A74A 2C4XA 1SY6L 4HG4K 3GSNH 1HHKA 2GSIB 3FONA 3UO1H 3ZE0E 3MRIB 1MCRA 4M8QB 5GGVL 1FJ1B 4HCRH 3FQNA 5FEBA 4K23L 1PSKH 4GQ9H 3GRWH 5I15L 1ZOXA 2VXTL 1CQKA 4Z95L 1RUAL 1QG3A 4ZS7H 1C5CL 1N7MH 4M7ZB 4WFED 3BIKA 3SDYH 4N68A 1GOFA 3SBWC 4TSCH 3UTZB 2NZ9D 1CXIA 2MCPL 5ISZB 1A3RL 2H2SC 3ARBD 2XZAH 3WNLA 4CN4A 3HPLB 3VI4F 4OI7A 5IFJA 1QNZH 2D03H 3DYPA 1S9VB 4ZOBA 2JLLA 5DEGB 1JGVH 4O9HL 4BH8B 4WRLA 1QSED 5IW1A 4DEPC 3VFSB 3C09C 2J6EH 1A47A 1PX4A 1CG9A 4QXUL 1QBLH 1JWMB 3I02A 4JPKL 2DQUH 3NFPB 4OTXL 1LWRA 4GBXA 4EDXB 5CP3H 5DUBA 3R1GH 3VWKA 4PJFB 3LRSB 4PREA 1P84K 3KLAA 1DEEB 1KJVA 2V5SA 2CD0A 1NCUA 1VGKA 2N56A 4XNYL 2GUOA 3LN4A 1NQBA 2WINB 3TBSA 5FUZL 5HHME 2LVCA 5IFAH 1OGAE 4YHYB 1ES0A 3EOTH 5IB4A 1JTOA 1T66D 1JFQL 1YMHB 3QUZD 4M93B 4RA3A 1YA5A 3VDCA 4EOWH 3MOAL 4EN3B 3QUYD 3OZ9H 3ULVC 1EK3A 2J1KA 4OKVA 1XZ0B 4PGJA 4JFFA 5D6DC 1N0LA 4HBQA 4G8IA 3TO4B 4EVNB 5JQ6H 1ADQA 4UQ2A 4HPYL 4JANA 4DUXA 3CLEL 5ESAA 4KTDL 1MUJB 3O8XD 4NUGH 3IT8D 1XIWA 5CCKH 1I9IH 2WIIB 2KH2B 1LGVA 1MIML 5T1LD 3B3IB 1LK2A 4RGOL 3MOBH 2OQJA 2P47B 1HHIA 1KOAA 1ZA3B 2WBJD 3L7FB 3MLSL 3PWUA 3P77B 3QUZC 2Y72A 4MNQB 3RDTB 1SJXA 4X7FC 4OZ4B 1YMME 4JFEB 4EI6B 1R5WB 4PY8I 1HINH 2VLLB 3MLXH 4RWYL 3SE3A 4Y4KD 1KCVL 5EB9A 4OLUH 1I1AC 3WHE0 1T5WB 5KW9H 2NY6B 1UACL 1KCSL 1KEML 5I1JH 5E5MB 3A6BL 3PE9A 4LPUA 4RX4A 1BREA 4R4ND 4L4JA 2BVPA 4TVPL 4Z7VA 5KVGH 2HVJA 4JVUA 5DJ0B 3VE0A 1FFRA 2VDQH 1A1OB 3H9ZA 2W07A 4FG6D 3WL9A 3WEXB 3OXSB 4OZGE 4ESKA 2V9TA 2X1QA 4LRNH 4Y4HB 4YC2C 3X11B 4KY1H 3CMOH 4P9HH 4OFDA 1MRDH 1A6WL 3EO1B 4GLRI 5EPMA 3RWJA 4NZDA 1U91B 4DKDC 3E6FB 2R2HA 3H2WA 2IAMC 5DJAA 1PY9A 4JN1L 5FHBH 5FO8A 2XN9E 1XT5A 3FTGA 5LQBH 3RZWA 5SV4A 4JFDE 2ZSVB 4HW6A 1IEBB 1KJ2L 4LLYB 3GIZL 3HE7A 4Z8FL 4NRXB 4CW1A 2XFXB 3IFNH 5TH2B 1ZGLM 1E6JH 4OUUB 4QOKD 3BVNA 4HSQA 2FX9H 2B7DT 5INDB 2MOVA 5D2LE 3WIFA 3FAXA 2V2XA 4OGYH 1EH9A 3O3AB 5SWSE 4XP1L 2AV1A 5K9OA 3S34H 3KJ6H 4PRPD 1BD2B 5EO9B 3QIWD 3DJ9A 4UUJB 5DD6A 1R0AH 3V52L 2HTKD 1EHXA 4QRSB 3ARVA 1LD9B 5DQJA 1YQVH 1GH7A 2IGFL 3C5JB 3K8LA 4NBZB 12E8H 3JZ7A 1J1OL 1EEYA 1VACA 5D7IF 1F8TL 1OWWA 1BOGB 4EI6A 3VGDA 4LGPB 5E1HB 4XCEA 4ELKB 4XMLH 3NCFB 3OF6D 1S9WB 4NRZB 1OB1A 4Z78A 4DZBA 1FJ1A 4RGND 3NOIA 3MUHL 4JO3L 1NH6A 1GGIH 1KCUH 5IHUL 1F4YH 1XGYL 2OQJB 5SWQA 3QEQE 4G7YH 4UTBL 3SKOB 1S7SA 4Y4FA 4AEEA 5I1CL 5IT2L 5I0ZA 4NUJB 1CT8B 5IJKC 2CKBL 5ERWA 2CUIA 1MIEL 4XBPB 5TPWH 5ESAB 1H5BA 5D6DA 2JE8A 4I48A 3U30C 1AGBB 2BHUA 3N0PB 1H3UA 5D96B 4O2CA 2BSRB 2EEDA 3HUJA 4KQ4L 5HYIA 1BZ7A 1KPUA 5ADPH 4HIIB 3EGSA 2ZKHH 2MHAA 2MSPA 3EYQD 3ULUF 3I6KA 1J12A 1QLEH 5HGBB 1Q1JL 2C3GA 3FFCE 5HHNB 3ZKXB 2FHFA 3DMMB 3TJHD 3VFPA 2ENYA 3NZ8A 4YNYA 3TLRA 2VISA 3BUTA 4LF3A 2VDKH 3SE8L 5JW4M 1G0DA 3QIBC 4LCUB 5CMAB 3KLAB 5GJTL 4G43A 1P9MA 2CXKA 3MV9B 4JHWL 3ALPA 2AS5M 4N9GA 4PRHE 4NNPL 1S5IL 3U4BH 1RIUL 4ETQB 1F42A 2DMKA 5ICZA 4KV5F 3KGRA 1ZHLA 1IGJA 2YK1H 3GJEA 2EDYA 3KPRE 4LFHD 2HT4D 3BKJH 4P4KA 3GSXA 5T1KD 2QSQA 3VFWA 1X5HA 1RZIB 4HCRL 4O02H 1Q0YL 4JPWL 4Y4KB 3B2VH 4IRJB 3WEXA 1PX3A 4H1LG 1E6OL 5DJ2B 1QR1B 4P23B 5IMMB 2EO1A 1Y18A 1HSBA 3UCRA 1V3KA 3B9KD 3ARDC 3D25A 5KSAB 1BVLB 3CFIC 1ZT1A 2W60B 2F54B 2ICCA 4LCIL 4TNVF 3MRKB 4QCIA 2J6EA 2MQ3A 5D72H 1NC4A 5GSRB 3KR3H 2CMRL 3AREA 5E2WL 3QB7C 3VD5A 4HUXB 1SYSA 4OBRA 2H9GA 2ZCLL 4GFTB 1TVDA 4FQIH 1KNOB 3FT4B 4TQEL 2X89D 3V5HA 5EBMA 3W5MA 1QBLL 3QUKA 3T04D 4CDGC 5GGUB 1DQLH 4LSRL 4PUBL 2I9LA 1I7ZA 1CFTA 4K8RL 1HSBB 3SDAC 3P40A 1DTUA 1SEBB 4Q0XH 2GJZA 3CFBB 4U0RB 4JDTL 1B0GA 3BPCA 3P0VL 3ARED 3O9WB 4U33A 1J05A 1CLYL 5HDBF 3I75A 1P4BL 5IB2A 2AAVA 1WWWX 1V8HA 3BKYL 1KTDA 2BNRB 2WIIA 3LEYL 5F7LB 2FEDD 2VJXA 5B39A 4HXAH 5KS9F 4HKZB 3L3HB 5JMRA 3PL6A 3O81A 4NQXA 1B2WH 1WUNT 4PRHB 3K4DA 4P5TB 4X6EB 4Y19E 3CX5K 5DEFA 2P4AB 3AROA 3L7EA 2W59A 4OZFH 4HPYH 5CMAA 2XWBA 4M6NL 3EJYC 1IAIH 1FE8L 4ZFGL 5J9PA 5DD1H 2H8PA 4PRDA 3THML 4K3DH 3G5VA 2V17L 5FA3A 3G5ZA 4Y88A 2B2XH 2R1WA 4OZHF 1I1AD 5FYLL 3AMKA 1MIMH 1S8DA 2I24N 2WINA 2YK1L 1NAKH 3ZSSA 2X1WL 4F7PA 4NQEB 5GRZA 1JZ7A 3ILPA 1N26A 4W81A 4DW2L 3C60A 3SGEH 2ICWB 2E6QA 3Q6GH 4F33B 3O6LH 4G8GD 1CF8H 4L9LC 3T1FB 2WBJC 4NJAL 4UV4L 1H5BB 4OJFL 1WIUA 4M7LT 4BH7B 4HKJB 1HDMB 3BOVA 5H94A 2ED7A 5CGYC 3QWRA 1B4RA 1HI6A 4HUVA 1AY1H 4Z7WE 2JTDA 3PP4H 1PKQA 4H20H 5DT1H 1NUDA 2BRRH 1TQBB 4WO4A 2X9XA 4XTRD 2F53E 3F6IA 3MXWL 5K9KB 5FV1L 1JHKH 3L5WA 1WITA 3LKSA 4NYLA 3EZ8A 4Y1AE 2OBGA 5CGYD 4N90E 2XWBB 3ES6A 3WFBL 4I0CC 1MHHA 3UJJL 3PGFL 4OZHA 3RI5F 4QLRA 3EYSL 4PJIF 5E4EB 1TXKA 3VMNA 2R2BA 4ZUTA 2MJWA 1J8HD 2A77H 2WLZA 4YR6B 5KN5B 5GIRB 2RFXA 1M05B 4MNHA 4Y4FC 1VFUA 2K1MA 3T3PE 4KI5F 3WLBB 4XAWH 3U0WL 4LGSB 3SDAB 2BDNL 1OCWH 3UEZA 4JCLA 1R24A 4YBQC 3HB3C 3MJ8B 3CUPA 2B1AL 5DTFB 5ADOH 5HYJD 1T0MA 3H7LA 4JFXB 3SGDH 2CO7B 4X4ME 2VL4A 1TPXB 4KK8D 2J8UF 1T04A 5A43C 5FYLH 3FJTA 3GSNL 2VXSL 1KJ3H 3BP5A 4CKVX 1OVZA 4N0UB 4EDWL 1AQDA 1J8HA 4M6AA 1VEOA 3W81A 1NCDH 2OTUA 2W0PA 4JR9L 1KNOA 1RZ7L 4QHMA 1JPGB 1KN2L 2W0KA 3OKDA 3DETC 3D0VA 3V2AR 5IOPA 2ADGA 5DHVH 4PJHB 1RUAH 4NQDB 4ZS7L 3KLDA 1ZHBA 4HS8H 3IFLL 4F3FB 3VH8B 4I18C 1YMMD 2BC4B 2ADIB 5FUCE 5J4MA 5E5MA 3EKCA 3WFEH 3O8XC 2XZAL 3DYOA 3VU2A 1T21B 1EEUA 4KK8C 4YDKL 5DJ2A 4Y5YA 4JM4L 5JW5B 1G1YA 1WAAF 2PTTB 4OIIL 4UT9L 1A7PL 5JLZB 4RAVB 4LVOC 5H37H 1F4AA 1QSFA 3QUYC 1DQJA 2CRYA 5B4MD 3G6AB 4OM1H 4XC1H 1V7NH 2G60L 5HDQH 3OAUH 1ULVA 3TYGL 3GHEL 3AY4C 3X14B 3M17B 1D6EB 1Z9LA 3SE4A 1D5BB 4LLVA 5KTEL 4QY8A 2ATKA 3MV9A 2EKJA 4UV7L 4Y1AD 5IB5A 4KMLB 3FO9A 1HQRA 2FZ3A 1FNSH 2X4UB 4JM2F 5HDBE 1INDH 3NZ8B 3B2UD 4J3VA 4Z7WA 2H1PL 4KTYA 4X7SH 1NFIB 4RSVA 2B20A 3QEQA 5GRUL 3V4UH 3QIUC 1ZS8B 3NPSB 3WS6C 4XXDA 4KUCD 4X9GA 1RFDL 1RU9H 2BXYA 4NO0D 3RBSA 4NOBA 4DGVH 3GSOB 4HIJA 3HMXL 1MAMH 1F3JB 1VENA 2V2TA 1A1NA 4TN9A 4HHAB 4WI3A 5ANMA 5C8JB 3BKJL 2CDFB 2GJ6A 2NZ9C 3PHSA 1QFPA 5GJSL 3U9PH 1VFAA 2HT2D 4Y4FB 3MJ9A 3LZFH 4U1HB 3FRUB 3FO9B 5FO9A 1I9EA 3LRSA 1REIA 4LSPH 1CXEA 3GHBH 5AUMA 1EHLH 4QOKA 5C2BH 1J0IA 3MXVH 4ODXA 2AJUH 3TWCH 2N7BA 2J4WL 3MNWB 1LO3H 2FBJL 3G5YB 5CHNB 3TT1H 1S7RB 1CGVA 3MRHB 2RCSL 5HHOD 2R2CA 3O2DA 2HKFH 2QQQA 3KPLB 5B38A 1G7IB 3QDJB 1MFCL 5FKPB 4XHJC 5CHNA 4MJ4A 5F6IC 2V5YA 1NUNB 3SO3C 4WFGD 4YHML 3O3AA 3MCG1 1AD9B 1QFWM 1BQSA 5A40E 3WFDH 4PJHA 2V2XB 2F5AL 4XX1G 4X6DF 5CZXD 1RK0B 3P4NA 4JDTH 4H8WH 3CSBA 1B90A 5ACMA 2A73A 2B5IB 1E0OB 3EDJA 4K71C 1UCTA 4HUMB 2Z8WC 3OXRB 4WJ5B 5FUOL 4LCWD 4LVEA 3S3SA 3VXME 3QHZH 1FV1B 4FFZH 1HHKB 3I6LD 1WBXB 1DLFL 3QJFA 5IROA 4G8FB 3QIBB 1NMBH 5I0DA 3OMZA 3NIDF 3GGWB 2V2TB 2Q7NA 4WUUB 2WBJA 5F7WC 4HIEA 2PW1B 3LD8B 4JFXA 1YEJH 4BQ8A 5DR5L 4R8WL 3QZWG 5C0RH 2OL3L 4KZEH 4NQTA 1T83A 3S4SG 1TMCB 1T03L 5E99L 4G9DA 4QT5B 2D7TH 4POZC 4WI9A 5JXEC 5JR1L 3O2DL 4GKZA 4GRLB 5DJ0A 2VR4A 3O3BA 5DMYA 4ELMB 5D2NB 4J3OC 1CFVL 4QNPE 5GJSH 2EH8L 4K3EH 1S9XB 3BW9A 3Q6GL 5JNYA 2VOTA 4OD3H 3QDGE 1X4XA 1FVCB 5B38B 1T2XA 4B53A 1DN2A 1IGFL 1D5MB 2DLTA 4UIMA 5F9AC 12E8L 4OZFG 5FYJD 2EYRB 3ESVF 2HLFD 4XMPL 3ZSTA 2Y06L 4MAUL 1R3KA 4G8EB 4MDJB 5IR1B 2R23B 1YQ2A 1UCBL 3RVVD 1X5JA 4EQ3A 2PNDA 1FNAA 4AIXA 4Z7UB 2C9AA 4FMFA 3H42H 4PJGB 5KOVC 2ILLA 3KYAA 2APVA 5DLMH 2DN7A 4UU9B 1I75A 4BH7A 4WEBL 4BUHA 1S3KH 5FYJH 2F5BL 5E8PA 1A1MA 3ALWA 5E56A 2IPTH 4M3KB 4YC2B 3T0EC 3M8OL 2ZUWA 3TEUA 4OSUH 4WHDA 3MRGB 3B9VA 3PWPD 4CGTA 1U0QA 3QG6B 1G1CA 4DVBB 1IQDB 5KVDL 3MODL 4U1NB 1WEJL 1UGNA 1RUML 1R3IL 5HGDB 4P46B 4LL9A 3WN5A 1YMHA 5J8OA 4KRPD 3DETD 3ME0A 3Q6FA 4LLAA 1WISA 1OP5K 5HD8D 4PYGA 1RZJL 3H9YA 1JV5A 2ZUTA 1U3HD 2GK0B 1A4KA 1NEZB 2CDEB 4NQXB 3UTSE 1LP9F 1S5IH 1S9KC 4RMWA 1MPAH 1M05A 4GAJH 2BOCB 2ESVA 1T3FB 3H9HB 4PGZA 5SWSB 1OTUC 3FB5B 3QULA 1R5VA 5KSBB 4MCYB 1FORL 3NZHL 3VXRE 1LO5A 4RRPG 2ZG2A 2ZJSL 4MDIA 4J2XA 4OD3L 1T1XA 3U0PA 2C5DC 1Y0LB 2VDOL 1CDYA 5JDSB 1UA6L 2YN5A 1KPRA 4R6UA 4FFWC 4EN3D 5EFIB 5T3XH 4Q6IC 2IQAB 2V9QA 4OAWA 1HHGA 3PWNA 3BESR 4WV1B 4UT7H 4F3FA 5I16B 3RL2B 4X9BA 2A9MH 2GJJA 2VZSA 4XPAL 1FYTA 5ETUB 1L7IL 4P2QE 5ITFB 3VFVA 3ISWA 1YEFL 1CDBA 3PABB 1MREH 1E4XH 4LRIC 3RI5K 5B4MC 1F3RB 3IXAB 4MQXC 4ZPTB 4I3GA 3GKWL 4U2YA 4ZAKD 5DHYB 4JFPA 2WUCL 3C8DA 4PRNB 4HPOH 4U7KA 5D2NE 1AIFB 1WAAE 2FYYA 5EU5B 1B4JH 3EW3B 2FATL 5JO5A 3CFEA 4F33A 4P5TD 5T33L 4D3CL 4NQCE 2HFEA 4J3TA 1YN6A 2EECA 4I0KA 2H2SD 5I74B 4GQPH 4PJBB 3S4SA 1P4BH 1C16B 1J88A 3JVGC 1YEIL 3MRNA 1BQUA 2H2PD 4XNMA 1BJ1J 4OB5H 4HXBL 4DQOL 3GMMA 1BLNB 5HHXH 1P6AB 1Z6JT 2C1OA 1TJIH 4HV8A 4KHTH 2BFVL 2QSVA 4KGJA 4OZHB 1BF2A 5IEHB 2D7MA 1RUQH 4QYOB 3SE9H 2LVEA 3WDHA 4P5TA 5EIQA 5AWNH 1MCKA 2Z0BA 3G6JE 5I8KL 3WIHH 3OWEA 3W9DA 1A6AB 4DKAA 2DMBA 4BSVB 4AEFA 3WV0A 2A9NL 3FZUC 4ZUUB 2YD6A 4OV5A 1CGYA 1KB9J 4JN2A 1M7XA 1P2CA 3GBNL 2DKSA 3IDXL 1G7LA 1N7ML 4M7KL 3OKMA 3MV8E 3SDYL 5KSAD 4K94C 2Z31C 4E42A 3NCJH 2DQGH 1GRWA 5LBSL 3IXAA 1L9NA 3N9GL 5IKCA 3CX5J 4L8SA 1L0YA 3MR9A 4ZSOE 3MGTB 1CICC 5ID0B 4DZBB 3C60B 2BRRL 5DJ8B 3U4EB 3H7BB 3ILPB 3E3QE 2P5WB 2AXFA 3MRCB 4ODUB 4X5LA 5KBNC 3TN0D 5JHDA 4L4VA 4U0RC 5HI3C 1FZKA 1SY6H 2JJWA 5DMIL 2Z91A 3LEVH 2FX8H 4GKSB 3VI4E 4ZO9A 1LK3L 3FOLB 2R56L 5L6YL 3H0TB 3IKCA 5GGVH 3EOAB 2BOBB 2IH1B 2R4SH 4ZOCA 3NFSH 2ITCA 4P59L 2ESVB 1Z5LB 2FR4B 5DZOA 1D3CA 1T1ZA 2BJML 3REWA 2DBLH 4XNMB 4Y5XC 4ETQA 4WGWB 1GZQB 4MJ6B 4GW5B 4G9FA 3MV9E 2DTSA 4HH9B 5DI8B 3ARBA 3EYFB 1UENA 4KHTL 1PG7L 4N8VA 5C0FA 4N0CC 1WCBB 1MH5B 4U05A 5JR1H 1N5AA 1IGIH 2ZPKL 4S11A 4ZD3L 4H88L 2PCPB 3HZYA 3EYOA 4EUPB 3ULVE 2CKNA 3Q6FB 3VXUA 4C56E 2EH8H 4Z9KB 1N64H 4Z77B 4UILH 4DWHA 4GRLD 1BFVH 3ULSA 4KJQC 4PJHF 4XVJL 2HRPL 4WWKB 3DARA 4LFHG 4KROB 3SGKC 4N8PA 1Y6NR 1UM4L 1UKSA 3BHBB 1N2RA 4XMPH 1NC4B 1XGPA 4YQXH 4R7DB 2VSCA 5JHLH 3EYQC 1CFQA 4I2XA 4Y0GA 5C0GA 2VR5A 1ZT1B 2W60A 1IGYB 3KYKH 5CS7A 4E41D 2O5XH 2XV6B 4JRXE 5C0BE 4PJGA 5TE6H 3CAFA 3LQAH 2YUWA 3Q5OA 1U8PB 5E6IC 2AKRA 4ZTPL 4D0CB 1Q9WA 3G5XB 1H0DA 3QPQD 4HC1A 1A7PH 1QVOB 2ADJB 3EJZD 1R3KB 4XP4H 3QULB 2X1OA 1XIWD 3TNNA 4OM1L 2QKIB 5IF0B 3BIBX 2EE2A 2YPLB 1PZ5B 4RIRB 1WIPA 1J0HA 3CVHL 2V2WA 1OP3H 4PS4L 2MQ0A 3DV6A 1NEZA 2CDEA 1A7QH 3G08B 5E8DH 4YHZH 1RZKC 4PJBE 3M07A 1A14L 3C60C 1OPGL 3SDXA 4JFEE 4GXUM 3CH1B 1UJTA 1S9YB 1JPTL 2NR6C 3IJHB 5HGBA 3RVUC 4F7CA 3TZVD 5D5MA 5FDYA 4NM4H 1ZLWH 5CINH 4U1NA 1I7RB 1PKQE 5F9OL 5E8EA 2UUDH 2VC2H 5T5FL 4GBXD 1QUNA 1U42A 5D1ZA 1CLZH 1KEMH 1CE1L 1TQCC 2F54D 3VD4A 1PG7X 3KJ6L 2VDLL 4IDJL 2QEJA 4PBWD 1IKFL 1U91A 2LABA 2R4RH 4Y5VA 2XTJC 2YD3A 3HN3A 1MJ7H 2FECL 1QP1A 5M95B 1CFSB 5BRZA 1R0AL 4QTHA 3U30B 2WUBH 4OZGB 3UROR 4LSUH 4N90D 4HGWB 4OCMC 3U0TB 2YMXH 4QRPE 1UM5L 4U1JA 3WJLC 4R4FH 3K2UL 3ARFC 3BO8A 2VLKA 5IB1B 3PWPB 1BOGA 4MXQC 3HNVH 4NNYB 3C5JA 3CH8A 4UIMB 1KENL 5TQ0H 5MP6L 3L1OL 4QRSA 3BD4A 2HMIC 5IIEA 1Q9KB 2R0WH 5TFSH 5JDSA 2WWKT 3CDFA 4Y19A 3TZVB 1ZANH 4QHNB 3BJLA 3QWOB 4DOHE 2MNUA 3QEQD 3BKCL 1YNTA 4ONGL 2F5AH 5J13B 4Q9QH 2OJZH 2E6PA 4A2MA 2DJ4A 4XNUL 3BO8B 5ADPL 5JA9A 1URLA 3CDGA 1L9MA 3JTTB 3CVHH 3UTOA 4WI4A 5I1KH 2YD9A 4OFPA 3TPKA 2R0LL 1GIGH 5FO9B 4PV8B 4O51A 4JLRA 3BRDA 2FO4B 2VIRB 2YSSA 5I30H 2EH7H 3A67L 3WDIA 1EGJH 4IOFD 1MNUL 3QNZB 1AH1A 1YMMB 4S1QL 3CXHK 5ANMB 3VXPA 5EBWA 4CNIA 3WNKA 1HWGB 2ZUQC 2VXTH 2Q3ZA 1FIGL 5DR5H 4JZJC 2OMBA 1HEZA 5T1DL 4PP2A 1IQDA 3MBXH 4ZXBD 4OF7A 2FB4H 4AEIH 4XP6H 4CADB 3B4NA 1T03H 3MZGB 2VC2L 5T5FH 1HZHH 4HJJL 4Q58C 4NQCA 1A1OA 3MRBB 2P5ED 4Z7VB 4XB8A 3VXNB 5J89A 1DQTA 4LIQE 5ECJE 2QBWA 4Z0XA 4JKWA 2R2EA 3FQXA 2PN5A 1EMTH 2EC9T 2O5ZL 3VFNA 3RX7A 1NBYA 3T77B 4Z7QE 2NX5A 3U36B 5GS2D 3EO0A 5EZJB 1HYSD 1VPOL 1MFNA 1W0VB 3X12B 4N8CH 3V7AE 4NBYB 3DGGB 5CLWA 4NCC2 4X6CF 5J7CC 1MCHA 2X70A 2DRUA 4RIRA 1QPXA 2LAAA 4LLQA 5F7NC 1JRHI 4XXCC 1KB5H 3D85B 2KDGA 3M1BB 5ELIA 5E2WH 1QSFB 3VXOB 5DEGA 5BZDA 3DIFB 4G6AD 2XTJB 3U79A 1BF8A 2JJSC 3WDJA 1KENH 4HWNA 2KL6A 3F7VA 1DANT 4Y2DD 4RMTA 4Y5YB 2FIKB 5F6IB 3OG4B 1CU4H 1FVCA 3W11D 3DRTA 1G6RL 5D7LE 2VUOA 1QFWL 1S9XA 3B3IA 1YEHL 3O6KH 1OWRM 2VAAB 2NY2B 1ZVSB 3QFJD 3HI5L 4U1KA 4R97C 3HMXA 5F88B 1M6OB 5I8EA 4IRSD 3LEXB 5TGBA 1FZMB 5SV3A 1LK3H 4UQ2B 4OFYA 5C09D 1PQZB 1VGEL 4Y2OA 5I19L 5L2JB 1AI1H 4MMZC 5GRVK 4N9OB 4X7DC 5C92A 3MLSH 3HRPA 4PGDA 5EZIH 2JK5A 3RWHB 3H8NA 3RWIB 2D4FA 4J6RL 4XAKD 3HC0A 5EO0B 4HIHA 1I1FB 2XZCH 3IXTA 3DHJA 2ICWI 1BIIA 1OGAD 4MD0A 2C7UA 3HUJE 5HTSA 3BMVA 2X4UA 4BSWB 3GK8H 4P49A 3ARFA 1YPZF 4HK0B 4XNXL 5HHVL 3MJ8A 4HDIB 1KCVH 1XF5B 4F7MA 2HJFA 4JY6B 2JB6A 2PKDA 4H1LA 4ZFFB 4G9FB 2X4OB 3QEGL 4NQED 3SDDC 3ULUH 4JB9H 5FGRA 4JFED 5I1JL 4YJZL 1FZOA 3C9NB 1IKNA 4XPTL 4MNQD 3RDTD 4C56A 1VCAA 2WWMC 2R0KH 3BJ91 4Z7NF 5BV7B 5C0AE 1OGTA 4ZXBC 3BD5A 3CJJA 2AJXL 4C55A 4YXHH 4YDIL 2D7OA 2VABB 3MMEA 5IIEB 3F7YA 4J4PA 1EIBA 3SKNB 4M5YL 5DJCA 4KY1L 3MNWA 4Y8AA 2DQTH 3LEYH 5I18L 4P2OD 4DGIL 3GB7A 4DN4H 4ODXB 1CD0A 3VGGA 4ERSL 3P4LA 4KV5E 5FOBA 4OF5A 4AG4L 4IEFB 3IAGC 2LTQB 3B9DA 1DQQA 1JK8B 4HC1H 4R96B 2GSIA 1CXLA 3WJLA 4JRYE 3NFNB 1K4DA 3RZCC 4OCRL 5D1ZC 4Q9CA 1I3UA 3WIIH 3MLUH 2VRAA 1G7LB 1IC5H 4LASL 3WHE1 3DTXA 2HMID 4MJ5A 3ZYJA 1XF5A 5HYSA 1V05A 4JREB 3NCEB 2P42B 4S1SH 3U4AA 2CK0H 3FHAA 4PG9A 3ARGA 1G6RB 4XZUB 3VWJA 4F7CB 5I6XB 5HDLA 4FQCL 4TSCL 1XR8A 4L4VD 5C0NC 2FZ3B 2VQ1A 4M1GH 2AK4D 1Z3GH 1CE1H 1KTLB 2Y9RT 1BWWA 4JY4B 1RZ8A 2YZ1A 4M7LL 2X41A 4L3EB 4I8DA 3ABZA 3T0XA 1QFUH 3P0GB 1RK1A 1KCUL 4U6YB 4JFQB 3HG1E 4WTXA 3RU8H 4JFDA 1ZVSA 5KSVB 3VA6A 4LSDA 4UNTA 3TJEL 3ET9F 4KQ3L 3NGBB 5GS1C 3B9KC 2I27N 3PDGA 4JKKA 3VWKD 5BW7C 1P6FA 1CZ8H 1YN6B 4ZAKA 4NC0B 3KYNA 1J86A 5F7MC 4WFHE 1PYWA 2IADA 2FLBT 3IDUA 5C09B 2NY4D 1JFQH 5JPNB 3C2AH 5KG9A 2HT4C 5F3HA 3EUUA 5DDHA 4AH2A 1JPST 4R0LB 1IAKB 2B4CC 3CVIL 4LBEB 2XT1B 2C1PA 3D39B 3ZL4L 3QRFM 1FAKT 2X42A 2OXGA 3SE8H 4C54A 1RZKH 1F58L 4YFLF 4X6BB 1ND0B 4HH8A 3GEWB 4X7CC 4AH2B 4D9RE 2G60H 3KXFD 25C8L 1HHHA 4QTIH 3ARTA 5I16A 3MTRA 4Y2DB 1AKJB 3OHXA 5DA0B 1DBJL 2HAZA 2QR0B 4IS6A 2AK4B 2R0LH 3G5ZB 4MB5A 2DS4A 4IMKC 4OLWH 1JP5A 4NBXB 3WD5L 2AJYL 3O3UN 1J0KA 2CJUH 3FB5A 1NGQL 4ZFOA 4U2ZA 1U8QB 1FNLA 2FH8A 3KPPB 3IFLH 1RK1B 3LMJH 4QHUB 1KGCD 1WK0A 1FO0H 1KCRL 3KYMA 5KJRL 4WDIB 2GK0A 3I9GH 5IBLC 5AEAA 5CWSA 1X9QA 2EC8A 1LNUA 1AO7A 4KK5C 4UNVA 4H88H 4A2LA 1HSAB 2EDKA 3WKNA 1A9EA 1K9TA 2VLRE 4EI5A 2DJUA 1EMTL 3DMMA 5K9KA 5IB3B 3QNYA 2CUMA 5GGUA 1BFTA 2GTZB 2I07B 3ARGB 4XZUA 3VWJB 4KVCL 1U6AL 1QFOA 2AEPL 1EGJA 2P8PA 2GW5A 5T3ZD 4PY7B 4LMQI 2AJUL 4OM0L 2AK1H 3C6SA 9CGTA 5IGXL 1L6XA 4IHOA 4NCDA 2AJSH 1E4JA 2XZQL 1S5HB 1NGYA 5JXAH 4LCYB 4JN1H 4XMKH 2NY0D 4IIQB 4FTVA 3O3DB 2ID5A 4MS8C 5TE6L 3CVIH 2NY1B 4Y4HD 5FYKL 3HE7D 4L1HA 2EKSA 4WGVB 3U1SH 1UC6A 4MAYB 4PYHA 4YFDB 1YECL 3VD9A 2VQTA 2CLVB 4G9FD 3U2SA 1O0VA 2XNAB 5C0ND 1FFPA 3HAEB 1ZHLB 3WFCH 1QR4A 1KEGH 5J0BA 4KKBD 4UDUA 3MZTA 1FO0B 1M7IA 1NAMA 3QCTH 4J12A 1LO2L 3S37X 4J1UA 2BK8A 3ARQA 3OJ2C 3QHZL 1DUZB 5JOPE 3P0YH 1IKNC 4I3RH 2DD8L 3LS5L 4PRHA 5IM7A 3DRQA 4FG6C 4HKZA 4WFHD 4D0DB 3AB0C 2J88L 1MI5A 5E9DD 2VQUA 1EZVX 5B39B 5T1KB 1A6VL 4UV4H 3QQ3B 3VWKC 2LE9A 3RZCD 1TNMA 1BEYH 4S1DD 5HHQB 2VZ3A 4L4TE 2D7TL 2CGRL 1F4YL 1XGYH 3QEGH 1A3LL 3FCTB 3EFDL 3MFFA 4WHYG 5KAQF 5DWUH 3MLWL 4NM8H 4UT6L 2C7UB 4GRWH 1A7NL 3PP4L 4OQTL 4DKFH 3RWHA 1FNGB 1Z9MA 3FRPA 5F6HI 1I9JL 1F4XL 3TBVA 3BDBA 3OXRA 4WJ5A 4HS6A 5TDNA 3ZDZE 1U8PA 2YD4A 4FFZL 3U6RB 3CXDH 2JCCA 1OTSC 3MRKA 2P48B 2VL5B 4OGXH 1FFOB 1GGCH 1QLFA 1JNLL 1MWAL 2QHLA 2RGSA 2I9TA 4QRRB 5DQ9B 4NDMA 8FABA 3BRFA 3ARGC 3VWJC 5EFIA 4JPVL 5GXBB 2CPCA 1G9MH 4MQ7A 4WO4C 5ICXB 4I18B 4YH6A 3FN0H 1EBAA 4QRPD 4UUJA 2HH0L 3WHXB 3OKKB 2MKWA 2H32H 4ZAKC 1MELA 4RGNB 1R5IB 5K9OB 1R5WA 2A0LD 1T7YA 1EHAA 3I2CH 4PJ8C 4U1LB 2R8SH 3OB8A 2Y6SD 5AUMB 5I1LB 1WGOA 1NFKA 4ZXBB 1IL1A 4Y1AB 3P77A 1NANI 5I1KL 4Y5VC 2APBA 4N8VB 5C0FB 4FQCH 3R8QA 1X4ZA 1GYAA 4Y16D 5LGJB 2DD8H 4HH9A 4QXGL 2VH5L 3D2UD 3KPQA 1MNUH 4RMUA 1MUJA 1IT9H 2X44D 3ZE2F 1T1ZB 1TNNA 3SJVA 4OFVA 1Z3GL 1CE6A 4P2RD 1XF2B 1MFBH 2E9JA 2YN3A 5EU6A 4LDOB 4LQFH 3UP1A 1JF1A 1WWAX 1BZ7B 3OXSA 4HJJH 5EDXA 5C3LD 1NBZB 3RJQB 5JW3L 3G6JF 5MENE 1FC1A 1J0ZA 3OKLA 1K8IB 2V5RA 2IANE 2O5ZH 4YUEH 2QQKH 2CLRB 3GO1L 4XRCA 4O51B 5C9KA 4N8CL 2XQBH 3BP6A 3DSFL 1JE6A 3RTQB 1G0XA 3D87B 3CDGB 3T65B 4BUGA 1IAOA 3O3DA 5DFVD 4X6CA 1P53A 1YEDB 5ICYB 3S37L 4NFDA 4IHOB 1IJ9A 2DQJL 3D18B 3WHXA 2Z31B 3TN0B 3TPUA 4YHKH 4Y19B 5B3NA 5JW5A 4JPVH 3G5XA 2VB5A 4CMMB 4PY7A 3IJSA 4JPIB 4PJAF 1KJ2H 3SDAD 4X7EC 4I5BB 4Z7NE 3BW9B 2R1YB 1I3RB 4POYA 2IG2L 1CICB 5ID1A 3LB6C 1S7XA 3K74B 3QDJE 5D7IE 3W9DB 3V0WH 5BVPH 5F9WB 1YEKL 4TUOB 5C0BA 2GT9A 3H9SD 1I4FA 5HPMB 4MB3A 3GSQA 1IGTA 5D7JA 4HGWA 3U0TA 4NRXA 2IAMA 5DRZB 1UZ6F 2VUYA 2ZCKL 2IALA 3PV6A 4NO5B 2NY1D 3KS0J 3SO5A 3V52H 3LKOB 1UWXH 2XG5A 3P9MA 4F7TB 1ZTXL 2LQRA 4NC1E 1TZGH 1NCCL 2RQ8A 5KJRH 2D3VA 4LPWA 3GMRA 2QADC 4OF8A 3MFFB 4RMQA 5F93C 4NPYB 1RIHL 1WCBA 2DKUA 5T3ZE 5GZOC 5IWLC 3BRGC 5T5NG 5JXEA 1JI2A 4DZ8B 5JMOC 1P7QD 3VE0B 1JWMA 5T1KA 3QJHA 4XNQA 2ZG3A 1U6AH 5I1CH 4UOJA 5IT2H 3ARGD 3GMPB 3VWJD 1NFDF 4NGHL 2FX7H 1DVFD 1A6UH 2Q1EA 3LKOA 5I1EL 4G6JL 4H5SA 4YHIB 5E2VL 5IUSA 3CPLB 3IDXH 4Z0BH 2L0DA 4QXUH 3QDJA 5F9JB 3DECA 2XQBL 1RZGB 2HVKA 2VZUA 15C8L 4ZNEA 5DS8A 1A6TA 2ZKHL 2GT9B 2CDGB 1U8HB 4PP1C 1Q9OB 3N1QC 4UOW0 1RJCA 3QFJE 3ZDYF 2WLYA 4Z76A 1FQ9C 1UWEL 4O2EB 5DK0B 1UQSA 2AJZB 1CICA 3IDGB 3DVGA 5ID1B 3UBXB 2VO5A 5GRWA 4Y5XB 3MV8B 1I3RA 3ARRA 1QVOA 4L4VE 4MAYA 5KANG 1G7PA 3QA3A 1QO3B 2B1AH 1T1XB 2NY2C 4CMMA 3T0BA 3MOAH 3EJYD 1OAYH 3B5HA 3ELAT 7FABH 5I71B 3VRJA 4UTAH 3QRGH 4F57H 2IH3B 3QQNA 3T1FA 1X5IA 4KJYA 3RWCB 4QO1A 1CFVH 5GGTL 3MBED 4RRPA 3O4LA 3GKZA 1NGXA 5IQ9B 5C08D 2H3NB 3T2NL 5H35B 4BSVA 5T3XD 1CXFA 2CIKB 4JRYD 1T89A 4NOFA 1AGDA 1S7VA 1K8IA 5IJVB 2DIJA 4EZMA 2OTPA 1N59A 5ACZA 4QXTA 3DV4B 3G5VB 2GUOB 3LN4B 4MJIA 5BZWB 1J87A 1HOCA 3STLB 1Q0XL 4KPHL 1UB6B 4MA7L 1EFQA 2PXYA 3MFGB 3QUXA 4HEME 3MUJA 2CIIB 3UC0H 3L3HA 4GW5A 1TTFA 5I1IH 1CDUA 1BFVL 2FR4A 3ZDZF 2DDQL 3TYGH 3S88L 4FABL 1U2HA 3IVKA 1MRFH 1J05B 2BY2A 4C58B 3MGOA 3ULVH 5HYEA 2QADB 2ED9A 5CBAB 4PJBA 3P11L 5HBBA 3QFDB 3S35X 1AHWC 1CGSH 4HK3J 3PWVB 2AGJH 2IPUG 1XF3A 3KHQA 4PV9A 2ZG1A 1IEHA 1CLYH 5GGTA 2FJHA 2YA2A 1TZHA 2EC9U 4FP8H 3QUXD 3VH8A 4MA8H 1UWGL 3ZHLA 4LP4A 4YX2L 3FQTA 3OKKA 1GOGA 1QACA 4NN5C 1X5FA 4PG2C 4NO0A 4DN3L 2VZOA 3NCYS 5BO1L 2I9TB 2AEIT 3MA7A 3VFMA 5HHMD 3QCUH 5C71A 4LHJB 2VKXA 5BVJB 5MEQA 5GGQH 4XHQA 3UMTA 2X4NB 4JG1H 1QR1A 1I1RA 3I6GA 3VMOA 1A14H 3R0NA 3EYUH 3HFMH 5LWYH 3V7MA 5GGTH 3LDBB 4GQ9L 1TITA 1UM4H 1YZZA 4HIEB 3C5ZC 4OCXH 3DO3A 2P45B 1BIIB 1UWXK 4P2YA 5FB8B 2J4WH 4G8FA 2BNUB 4N5ED 4NKMA 5F9OH 1Q94A 1FNFA 4FQLH 2YD5A 4U0QB 4RGMB 1YJDL 5EC1B 1AQKH 4ODWB 4BFGA 1RZ8B 1A4KB 3HS0B 5CD3A 1I1YB 4PGBB 3ES6B 2KPNA 3ZDXF 2AQ3A 3MRRA 3QPQC 1JGVL 4O9HH 3UTSA 4K2UL 4RGNC 5E94B 3PXJA 2EZ0D 5DD0H 1WZKA 5L2KA 4O5LH 4BK5A 1YPZA 4XCCH 4EQ2A 1W72H 4PJXE 1FGVH 2CH8A 1V5JA 5BV7H 1G7JA 4PJ5A 4JKMA 4I5BA 3RL1B 3RGVA 1BD2D 2A83B 5FXCH 1Q1JH 3F7VB 3TPUB 5F9DC 4PJ7F 4LEXH 1FSKB 5IFAL 5EUKA 2AI0L 4GRLC 4YHKL