3V95A

Crystal structure of monoclonal human anti-rhesus d fc and igg1 t125(yb2/0) in the presence of edta
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
212
structure length
212
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ig gamma-1 chain C region
publication title Effect of zinc on human IgG1 and its Fc gamma R interactions.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 31
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v95A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v95A01
2AJXL 5FHBL 5LWYL 4XPHL 4Z0XA 2GT9A 1DDHA 2X1PA 1G9EA 4RMTA 1FO0L 3GI9H 4D2NA 1PZ5A 2HTKC 4TN9A 5DDHB 1G9ML 2C5DC 2JJSA 2UV3A 5A2KH 3DUSB 1FE8L 4LEXH 2NQCA 2N1KA 3HAEB 4NO2A 2C4FT 3WIHH 4XMPL 3GB7B 2A83A 2DICA 3EBAA 4O9HL 2C3VA 1MOEA 3T04D 3U9PL 3VFNB 3SDDB 1RI8A 5ESQA 4Z5RA 1RK1B 5DJCA 2VXUL 3TBTA 2A38A 4UT6H 1EVUA 2FZ3B 4M7JL 3MRPB 4CU7A 1IT9H 3HPJA 4C56A 2CSPA 5EUOE 1JFQL 5D2LE 3EHBD 3QEQD 1Z3GL 2I60L 4OZHA 3BX7C 3VDCA 2VXSL 1U9KA 3QJHA 5GGTA 4NQDD 1NLDL 1MCIA 2QV2A 5F7EL 4YXHH 4NOFA 3DXAB 4Y8AA 3MNWA 1G9NH 4L4VB 2ZUSA 4BZ2L 4F8QA 1MRFH 1KBGH 3TH4T 1TJIH 3AS0A 1FJ1A 2FLRT 5JXEA 3MGAA 3OB0H 5DD0H 4HDIB 1LQSR 1DFBL 3QIUC 4NO0B 3OAYH 1T21B 3C2AH 4NNPH 1QHOA 2CO6B 1M1SA 2NY5C 2C3WA 3HE7D 3LPGA 4QOKE 1Z6JT 2VXVL 5E08L 5MEND 3WO4C 3QUXC 1BIIB 1KTLA 1WEJL 2FO4B 5I1AB 2CKNA 5JXAH 4L5FH 5F7HA 3BQUA 1FN4A 3VRIB 3D25A 3FB7A 2WWKO 1QOKA 2X4UA 7FABH 3O2DL 1S7SA 5SWZD 1UVQB 5GPRA 3P11L 1CL7H 2HWZL 1JPST 3DRQA 1BX2B 1EJOH 4H0IA 4JFQA 1U0QA 2YKLL 3F12B 1FL3B 1FZKB 5E2VL 4NHCH 1ADQA 4RAHA 1LGVA 2V9RA 3EKCA 4ZTPL 1ORQB 2A9ML 1CYGA 3UC0L 2EDWA 3RVVC 3LZFL 5F70A 3IETA 4UTBL 4FQXD 3DUUB 4H0GA 4KUCD 2CMRH 5AD0A 2PKDA 3FO2A 5KVMC 4CL7A 5C6TL 1F00I 4G7VH 4YIQA 4OLEA 2HT4C 3BGFB 1AGFB 2Q7YA 5HGHA 2IPUK 3HI6L 4UILL 2P49B 3U0PA 3G6AA 5HYJE 2X1OA 1A7QH 1NMAH 4F2MB 1T5WA 1QBAA 1YN6B 1U3HA 1MCKA 1ONQA 2Z93A 5IB3A 4HUWA 1CE6B 2VUYA 3KJ4B 1F3DJ 4AYFA 2IWGA 2PN5A 4CGTA 4C54A 4MHHG 4P2OC 1R3JB 1WICA 4Y4KB 4JLRB 4M43H 5IMMA 5TE7L 1H5BB 2E8YA 4YWGH 4OD3L 1JBJA 1OLZA 5DRWB 3UTOA 2NY7L 1VACA 1D5BB 2BVUA 1YN7A 4ODTH 1UH3A 4NM4H 5FCUH 3DTXA 1NC2D 3RVTD 1E4WH 1MCWW 1PKOA 2R9HD 4XCCH 4PGCA 3FQXA 2NX5E 3MLSH 3ARDA 5E8DH 3RWIB 3KR3L 3BUYA 4XP6H 3HE6C 4PFEA 3VFMA 5C0BD 4L4TA 3HMXA 3MV7D 2WV3A 3VXRB 4XVTL 4OCRL 4NQEA 4HJJH 1UZ8B 3ILQD 4U1MA 2XKNA 1TVBA 4HMDA 3HC0B 1RZFL 4LP4A 4YDIL 5HHOA 3QDMA 2ZKHH 5CEXB 5INCA 3OKEA 4G3YH 4KJPD 5SX4I 3BZDA 1ZHKB 1VFMA 2H8PA 4HUNB 5J1TC 2KZWA 5DQDH 4R7DA 3FFDA 4WI4A 5T1KB 2N7BA 1AGBA 2R1XB 5F1IB 1GGYA 2FCBA 1A21A 4L1DA 3C6LB 4G9DA 4UAOB 1X4ZA 2R4RL 4MJ6B 5DJDB 3CXDL 1S7XB 1S9VB 1D5XB 3CH8A 3FQUA 4HKJA 4D0BA 2UZIH 2DQGH 1N2RB 3MRKB 1S9WA 5DUBA 5DVMA 4ZTOH 4WO4A 4EJ1C 4F9LA 3N1PC 2X4PA 4XTRC 3GMMB 4PJCF 1FNEB 3T8XB 3BIAX 4JN1H 3QBTB 1KNOA 2E7BA 4H26A 5JHLH 3CFKA 2OJZL 5IB5A 2DM4A 3GSWB 3MBEC 4Z76A 1A8JH 5DT1H 5D1XC 4K9EC 1I7ZA 1HHKA 1ZWIA 3OR6B 4WFHD 3PP3K 5C08D 5DVNA 4Q2ZA 4PRAA 7CGTA 1QFHA 4Z7UF 1JNLH 3PV6A 3JWDH 2XZQH 3QHZH 1IARB 4PJCE 5CJOL 3EOAA 4M1GL 4JPVH 2I25N 4LSTL 1VESA 1MAJA 4F7TA 2Y6SD 5IM7A 1NMBL 5HHNB 3P2TA 1CTOA 3HC4L 1RVFH 1WWAX 4JFFB 4WU7B 5I1CH 3EJZC 4XI5D 3QIWB 3CFCH 3QEUA 4UIKH 2F5BL 1NC4B 4YNYA 4LIQE 4XVSL 5ESVB 4OKVB 3BGAA 5FUCE 3SDAC 3KLDA 4WWKA 5EN2B 4PJEA 4MQ7B 4NNXA 1MCWM 3GRWA 4LRIC 4K07A 3UTSB 1HQ4B 3EW3B 1U2HA 4I0PB 4O2CA 1ZT4B 1YECH 5E8NA 3RX7A 3AM8A 3QA3B 5SV4A 5D72H 1AHWA 4X4XB 5C0RL 4FQ1H 3EOYG 1WCBA 3BVNB 2BDNH 2VB5A 3EOTL 4BZ1L 5HGBB 5EBLA 5FOBB 3L1OL 2DLEA 2ZCLL 4ZS7H 1EZVY 4JHWL 3ARRA 3DO7A 1NGPH 3LV3A 4DWHA 4HLZG 5F97E 4WIQA 4I4WA 2GFBB 5DURB 2VDLH 3MOBL 5EWIL 1RZIB 1RV6X 2K1MA 3BO8A 1G6VK 4Z7VE 4WUUD 1SJEA 3WS3A 4N0UA 4ELMA 4XWGL 5F7LB 3O45B 5FM4A 3V4PL 2F5AH 4LEOA 1A22B 4Y5YC 1LO4H 4L8SC 5EIVA 1GSMA 2GQHA 1U8NB 4H8WC 3O2VL 4GMTL 4KJQD 4JN2B 4LDEB 5FO9A 5IFAH 4CN6A 1OARH 1VFUA 4QXUH 5I8EA 4DEPC 2PYFA 1SY6A 1VFAB 4ACPA 1BJMA 4WW1A 5CBAA 1PD6A 5C92A 3OZ9H 5L6YL 4NUGH 1CICB 3S5LG 4LRNH 2BJML 3FONA 3VXOB 3ZT5A 3GUTA 3KHQA 1YZZA 4U6YB 4PRPD 3WIIL 5IOPA 3CSYB 4F7CA 4E42B 1QFWI 4MAYC 1T5XA 4XT1C 4UV4L 3KPPA 3VGHA 1G7JA 2IANA 3SJVB 1CZ8L 5ISZD 5J7CC 1MEXL 1DANT 1E4JA 1XGYL 3MRLA 5C07A 5D6CA 1CGSL 4KZEH 4KTYA 3SGKA 5IR1A 2F74B 4CVUA 4JQVA 5T5FH 3MV8E 1J12A 2VZ1A 3EOBA 2OX5A 5ID0A 2HKHH 2WUCH 5TDPA 4Y4HB 1A6VH 2D03L 4PJHB 1DSFH 4X7TB 5E94B 5CCKL 4RISH 4HGWA 2P7TB 1FG9C 4HK0B 3TT3H 1U95B 3THML 2Z8SA 5CKAA 3T0DA 5DYOB 4D9QE 5CBEA 5DJ8A 2DLHA 1EHXA 1FNGB 2FX9L 3GKWH 3SGEH 3ZZ1A 5HI4D 2NW3B 3ZYZA 2CIKB 5DD6A 4H25B 5FOJA 2DL9A 4Y19D 2AV7A 4GKNA 5K93A 5D7KE 5JUEH 5K9JL 3RZCD 1LO0L 3L5IA 4LASH 1A7PH 3QO1A 4E5XB 2RGSA 2Y4SA 4KMTH 3OG6B 3ULVL 2DQJL 1BOGA 4LF3A 3TBYB 3QI9B 2FJGA 2EZ0D 2IADA 3MXWH 4U1IA 1TQCC 1NDGA 4ERSH 3IDIB 5L2JA 2LE9A 1IC7H 4UTAH 5ALBH 1YQ2A 2BMKA 4WUKH 2VQ1B 1INQA 3ARED 3MRIB 4QY8A 3HNVL 2CRYA 3HI5H 4LPVA 2LFGA 3P9MB 4KU1A 2YRLA 2OZ4A 4PTUA 5DI8A 5JORB 5D7SL 1VFBB 1YNKH 2ZG3A 4O02H 1P4LB 4F8TA 1U92B 4P48A 4XMLL 1FVEA 3A6CL 4RMRA 2BSSB 4XNXH 1SM3H 3FKUS 4J8RA 3U0WL 1T7ZA 2R2EA 1D6EB 1JWMB 3RBGA 1GOHA 3PWNB 4P5KB 3NIFF 1C8PA 4LFHG 2ADJB 4KRPC 2O5YH 1HHJB 2CLRA 3KYAA 4PB0H 4JZNB 3KPRE 1DQLH 2MTPA 4MJ5B 1PX4A 5L88L 3CU7A 4NZRH 2IH3A 3NCJH 1I7UA 1EIBA 3BP7B 3RU8H 1BQSA 4RX4A 2NY1C 4P5TB 3MUGA 1X3DA 1OB1B 4GG6A 4LQ1A 4KAQH 1CU4H 1FYTD 2IQ9L 2D7TL 3NIFE 3F65A 2MKLC 4Z8FH 1T1YA 5BS0E 2G9HA 3DMMD 2F58H 4OZGA 3IDJB 4GUPB 5GS0L 4D0DA 5I73C 3BEWA 3QCVL 2X89A 5DA4A 3MBXL 5HD8D 3G08B 3O3AB 2DQEH 1FIGL 5HGAB 1R3KB 5F7FA 1TJGH 5FHAH 5HHVL 4ZG1A 1QR1A 5CILH 4QRSB 2EIEA 4JY6A 3NIDE 1ND0B 5FECA 1FNFA 1JV5B 5EU3A 2F53D 2W9EL 5EC2A 4PIRF 4E0RA 5K59F 3W5NA 1JHLH 3S5LA 4LHUB 3E3QE 2ZUVA 4FFVD 5FYJL 1T2XA 1FZOB 1L0YA 4TYUA 2JJTC 5BXFB 3ARBC 3FO0H 3G6DL 2X4QA 2VH5L 2ZOLA 3ALWA 4GS7C 4R26H 5I15H 2YN5A 4M62L 1NFIB 4NQCB 2PTTA 1FSKB 5D7IA 3VFWA 4HEPG 4ZO6A 3QIUA 5GS3A 3QUZB 15C8H 2BRQA 3QIBD 1K2DA 1QVOA 2EYSA 4KKAD 1E4XH 1OAZH 1GGIH 3BIBX 3PHSA 4YR6A 1S7WA 2GYSA 2HVKB 5DTFB 5TDOA 1BVKB 2B1HL 4QYOA 3QPXL 1IGTB 4HZLA 5FYKU 3T0XA 3QUXA 1IILE 5F96L 4NQVB 4XPAL 4LNVA 2H32A 4EOWH 5T33H 4M7KH 1IZJA 3FO9B 4WENB 3GO1L 4FFZL 4GJTB 3H0TB 5I0ZA 1P5VA 4XB7A 4PJXA 3AUVA 4Z18A 5IW6A 2FH6A 4NOBA 3VGGA 1OL0A 1T7XA 1IGCH 4RWYH 5E9DA 4PJFF 4UDUA 3B9DA 3EO0A 3K8LA 4Z7WF 4RGNB 4M8QA 2APBA 4WY7L 4ZO9A 5IIEB 4KTEH 4X6CA 4LVEA 3B5TA 4G8GD 1I9JL 1DCLA 4RFEA 5IQ7H 1TTGA 4U1HA 4BFIA 3LQAC 1VPOH 5BO1H 1P4IL 2J12B 3D2UA 3OGOE 4Y2DC 1SJVA 2CXGA 3QXTA 3DURA 2LAAA 1S7UB 3OTTA 4PJFE 5C0FA 5AZ2L 2F8XC 1SEQL 3MUJA 4FS0A 4S1RH 1IL1A 5CD3A 3FB5B 5T1LA 4EKXA 4P2OA 1OOAA 1K4CA 2P5WB 3OKNA 4I5BB 3RPIB 2E27L 3WSQL 3E8UL 2NY3D 3H9SD 5E6IB 2Y5EA 5B39G 1CFNA 1MH5B 5C9KA 1WQVT 2IC2A 5IF0B 1XF5A 4WJ5A 4BSWB 3EYVA 3BH8A 3VXQA 1LEIB 1A14L 3MOQA 5E56A 3M1BB 2IG2H 5DHYB 2BCKA 3HE6A 1OCWH 3PHQB 4KXZI 3CFJA 3DXAE 1DBBH 5INDB 3EGSA 4L4VE 4P59L 5DR5L 2Z91A 3SGJC 4YBQD 1FGVL 2HFGH 2Y23A 1J8KA 4LARL 2YUWA 1GGBL 3JZ7A 3QEHB 4NWUL 4WU5A 3WEXB 5FUOH 4U1NA 4XVJH 4WW2F 2GCYA 1J87A 4NT6A 1X4YA 4PS4L 5FUCC 3NCEB 5ESAA 1FNAA 3IXTB 3LKPB 3JWOH 2VLJE 3VD7A 1U8PB 5EU5A 1W2KT 1EDQA 1CDJA 1YJDH 3PABA 4ODBD 5CZXC 1NFKA 1F58H 3UJTL 4YHOL 2JCCE 2ADIB 4CUCA 5HDQL 2I9TB 4ZUSA 2ORBL 4HKBA 3TH3T 1LK2A 4FQCL 5DZLA 2EE9A 4EN3C 4XAWL 4TRPL 3VH8B 5CP7B 3UTTB 5EIIB 3V95A 1ZHBB 4XCNA 5D5MF 3ZTJH 1MCNA 1MCEA 5DZOA 2GIYA 3EYOB 4YO0A 3S88L 1FFNA 3PDOB 4NZTH 2XG4A 4P3DB 4PREB 2XWTB 1XIWD 5BVPL 5L0QC 1WAAF 1ACZA 4KY1L 3MBEA 5D1XA 4EQ3A 1RUPL 4K55A 2J88H 3CPLA 1AXTH 1DZBA 5IVOA 3UO1H 4MSWA 2HA1A 4LSRL 1MHHA 4YQXL 3MLZH 5EDXA 3WFHB 5AWNH 5ITBH 4RMSA 5IBTH 3IF1B 3LRHA 1P84K 1U8OB 3F7VB 2I24N 5E0QA 4RWHA 1JPSH 5JOPE 5HHQB 2I27N 4GMSL 5HI3D 3ULUH 4DVBA 1R3HB 4L3EB 1EAPA 1H0DB 4OGAD 4KK8D 3ROOB 1YEIL 2CD0A 1WAAE 1ZA3B 3TPUB 3SKUD 3ZTNL 2P47B 1EMTL 3CSGA 2UWEB 2AXHA 3QRFM 3F58H 3SDAA 3BKCL 2PXYC 2OP4L 4KQ3H 1PSKL 1C5CH 4UUJA 3DX7A 3MOAH 1KYOK 4LRIA 5IROC 3F7RA 5EO9B 3RIFF 4JFEA 4Y5XB 5J6GA 3OKMB 1MFAL 3ZT7A 5HHPB 2X4NB 2IBBA 1I85C 3D6GA 4P5MA 1NGQH 2NY2D 2FBJH 3A0OA 4YHIB 5IBLC 1KCLA 2B5IC 5FO7A 2DLIA 1U8MA 2E6QA 4K3EL 2ZUQB 2H1PH 2L7UA 2PTVA 3VFOA 5JR1H 1R3IH 3QSKB 3RY6A 3RGVB 2EDTA 4GW5A 5E99L 5T3ZD 5GXBB 5JIHA 3VXRE 4TTGA 4UV7L 3IDMA 2NY0D 4P4KC 5FUZH 1OTSC 4HIHA 4FP8L 4UIMA 3S96A 4DFIA 4MD0A 4M6MH 4M5YL 4XNQA 4PRBB 2OSLB 2RIKA 2YWYA 3RAJH 2IH1A 5MEQB 3Q5YA 4Y5YA 2P24B 4R3SB 1C16A 3MRGB 3RUGA 4CADA 4L8SA 1YQVH 5I1IH 3UZEA 1IRAY 2PO6D 1NH6A 1HYRC 3MJ7A 3TBVA 1NCDH 3RPKA 2E9BA 3DETD 4YHZH 1RIHH 1YEJL 5B39A 5BMFL 2R2HA 1T0MB 2AABL 4JB9H 4DTGH 1GGUA 4YHYB 4EI6A 1T03L 5BOPA 3U83A 5M7QA 2DQTL 4LCWA 4N1CA 3SOBH 3QXDB 5TPWL 1LK3L 3MA7B 4AG4H 4OSUH 4MDJA 3UYRL 1IKFL 4MCYA 1G7IB 4LSUH 3ULUD 1EHLH 2GUOB 5FCSH 1UM6H 3GMLB 4XP1L 3BEVB 4MAYA 2NTSP 1FL6B 5E8OB 2LABA 2QADC 1PJ9A 5F1OB 2ZSVB 3W11D 2AEPH 3QXAA 3ZSTA 2G60L 3X11B 2IMMA 3D9AH 3LQAH 4NO5A 4NRZA 4MJID 1KSRA 3S4SG 3VJ6A 1I1YB 5DMIL 3EO9H 1I9RH 4MAUH 1IQWL 2ERJC 2HT3D 3BD4A 4X0KB 3NCFB 1HXYA 2E9WA 3PWPA 3CAFA 3SDCB 2DLTA 2VLRA 4LKXA 2YC1B 3IXAB 4FRWA 2UY6A 4LU5L 5FGBC 3DUHA 2GEEA 4K7FA 1VGKB 1ZVSB 4BH7A 2AJVH 2QHRH 4G6MH 1L7TL 5E5RB 1QSZA 2G5BB 3CH1B 4LVOB 1I9IH 2ARJQ 4N0YL 3OXSB 1HI6B 3T65A 2XPGB 4ORGA 3IAQA 2XICA 3SCMC 4U2ZA 3ZYJA 2OLDA 3LMJL 1AE6L 2GAZB 1XGPB 2QQKH 3D39A 2HJLA 4Y1AD 4FQIL 3LAFA 5CS7A 1F4XH 2VDRL 5EU7E 4PV9A 3O4LB 2ARJB 4YDVB 3RIAF 4NPYA 3OJMB 3VRLE 1J05B 1F6AB 2A6JB 4YFDB 3U36B 4Y5VC 1K8IA 2YA0A 3BSZH 4NZUL 5I8KL 4PJGB 1GHFL 1QRND 3RL2B 5EUOA 5D2LA 2BY3A 4DUXA 4EUPB 5I30L 3VXMD 2B0SH 1QSFE 4D0CA 2DDQH 3CDYA 2BVEA 4LCUA 1YC7A 1FVCA 3I6GA 2FECI 3NOIA 1FIEA 5FKAA 4HT1H 1MY7A 3FOMA 1G6RH 1YEFH 4XC3L 4ZYKA 3K46A 4H1LH 4LLWA 4KVNH 4C58B 2ITCA 1OTUC 4PRIB 1WF5A 5MEPB 1JP5A 2G5RA 1LEKB 3WKNA 4ZS6C 2YPLA 4EZMA 4PJBF 4KQ4L 1N0XH 4ZUWB 1NAKH 5JQ6H 1JZ8A 1FC2D 3QEQE 4G6FD 5TH2B 4DK6A 3MPCA 4D8PB 3TA3B 4URTB 2QSVA 4N90D 1A4JA 1GVIA 3LD8B 5DUML 1FORH 1YUHB 2GJZB 3KPNA 4AMKL 3KPOA 2O5ZL 3JTSB 4YHKH 4BH8A 1MWAA 3BKMH 4X8JB 3Q1SL 5KS9E 1FP5A 1I9EA 1VADA 1MIEL 5F1KC 1UWXH 2DQIH 4C56D 1AGEB 3V5HA 5L2KB 1NUFA 1N5AB 4F7MB 3TIDA 5AG8A 2FLBT 5B4MC 2B4CL 5I17B 3QAZC 4B0MM 4NFCA 3REWA 5CEYB 4PJAF 5HHME 4NC1E 2Z0BA 3LHPH 1XZ0B 4JFHD 2P8LB 1FDLL 5ETUA 4APQB 4P57B 4QTHB 3UAJC 5CIPB 3NVQA 5MENE 3HUJF 1E6JH 4PJHE 4HIJB 4KPHL 1KJ3L 5FK9B 1ZA6B 4OIIH 4KUCF 4S1SL 4S0TD 4MB3A 1J8HD 4NJAL 4NP4L 5SWZE 2PYED 1YC8A 5DHVH 1LE5A 1ZLVH 2JJTA 5D7LB 4LCIH 3ARBA 5CSZA 4LQFH 3NN8B 2W38A 2YK1L 3GMRA 2ZCHL 3MRFA 4OF8A 5I1KH 5D8JH 4AT6B 3WL9B 3PGDA 3HUJE 5F6HI 4HV8A 5DO2D 3PQYB 3TNMA 3BQUD 4C57C 1XF4A 1YEDB 3BDXA 1UM5L 5I2IB 1YY8B 2G75A 2JIXA 2LU4A 3S4SA 4MDIB 3SDDC 1T3FA 43C9B 2DLFL 3OL2A 5I19H 5JW4M 4O5LL 3I6LD 4R4FH 4BFGA 4K3JL 5C0IA 4M5ZL 4BQBA 3BP5B 2J1KA 1A7NL 4XBPA 3V52H 2WWMD 1PLGH 1Q1JH 4WTZG 3WBDA 4C83B 1KJMB 3DV6B 1HKLH 5JNYB 1RUAH 1D9KB 3ZE0E 1PDKA 5CGYC 3VXUB 4OUOA 1F5WA 3DRTB 1KYOJ 3V4UL 3DSFH 5FYLL 3QFDA 4F57H 4EDWL 5BQ7A 2EXYC 4UQ2A 2E7CA 2GITB 5TE6L 1YMHA 1A6UL 2I07B 5KZCB 2EH7H 1X5FA 1BREA 4KVCH 3PIQA 3MCKA 1HE7A 1RJYB 4U0RC 2CH8A 4R7NA 5KOVC 5C0BE 1A47A 4I3GA 3MUZ1 4YPJA 1GXEA 3N1GC 3TV3H 2N4IA 4JY5H 4KKLD 4Y2DA 5IESL 5IHLB 2D31B 1I75A 4GRLB 3GI8L 4QHKI 4OM1L 4PJ9D 1C5BH 1EPFA 5FB8A 4JRXB 3CZJA 2ZCKH 4JGJA 5FM8A 3ARDD 4QRTA 5LGJA 3RFZC 3ULVC 1S8DB 4U6HB 4JHZA 3B9KC 2DQDL 4JFYB 1E4KC 5C0JB 3KPLB 4XNZC 4NQED 5GRYA 3TO2A 5I16A 3QQ3B 5ICYA 1D6VL 3W39A 4YGVB 3C60B 1FZJA 4I2XE 3TYFA 1O5DT 3DGGB 3HMWH 3ZMRA 2BX5A 4PJIA 1D7FA 5C6PB 4WHCA 2KUTA 2EEBA 2XQBH 2CDFA 3I2CH 3QDMD 2HG5A 1HHIB 1T0NB 2CGRH 2AK4A 5HYSB 4OT1H 1RUKH 2IPUG 3K8MA 1Q72L 4IMLB 3RY5A 3S34H 1JK8A 3HI1B 1RPQA 3BWAB 3FHAA 2YSSA 4FXLA 3SGJA 3T1FB 5K9OB 1P7QB 2FX7H 3ARQA 1BQLH 5EA0H 1TXKA 2AK1L 1A1MA 2CK0L 4W68A 5KAQF 5J57B 2AAVA 4XB8A 3T0WA 4WFHE 3O2WL 1MLBA 4QWWC 3QUYB 2NY4D 3ZL4H 4Y4KC 5E8EB 1CVRA 3DOSA 1H5BC 4WO4D 2AEQL 1JGUH 3P0YH 1UYWH 4M7LL 1N6VA 4Q7DA 4I3RL 5ERWA 5GSRA 3BAEL 4FQLH 5D71H 4EDXB 3F6LA 4RNRA 3W9DA 1Z9OA 3EZJB 3NPSB 4BA8A 2HFTA 2R0KH 1E0OB 1MHCA 2BY0A 2D7NA 4F58H 3QG6A 4MGXA 4EN3A 1AP2A 1FCCA 1FO0A 1QBLH 5DJ0B 3GSNL 1T2QL 1KTDA 1G7HB 5EFIB 4XWOC 3HNTH 4LDLB 1PFCA 4DAGL 3FQWA 4G6JH 5TE4L 2A0LD 2ZSWB 4X5WA 2OS7A 5E2TL 5IHUL 4CN4A 1A9BB 3CCHA 4HWBL 4WEBH 1UGNA 4FQQA 4CN1A 1G7LA 1RK0A 1H8SA 4JAMB 3IDNB 3G9VA 4K23H 2IBZY 3NFPB 2AV1B 3B9VA 5C0GB 2W92A 1EO7A 2HJFB 3VI3F 4UAOC 1E6OH 1IM9A 3QXVA 4HPYL 4AH2A 2EC9U 4PGZA 1IC5H 4Z78B 1QYGL 2EXWC 4RGOH 1N59A 2XN9B 4WTZA 3GM8A 4G43B 1KEMH 5I0DA 2CLVB 1Z5LB 1NBYA 2ED7A 4NKMB 4RFOH 3WV0A 3QDAA 1Q9WA 3FMGL 4ZSOE 4IDJH 2PXYA 1XGRB 4P2QD 1KCUH 4OAWB 1LO3H 5GS1C 5IROA 4S1QL 4QEGA 3BN9D 3CFEA 4LVNB 2FX8L 1NDMA 4U2YA 3UBXG 1I85A 4BZYA 2AP2A 1R5WA 3GJEA 3VI4E 5KVEL 1TENA 1B0RA 5MI0B 3FRUB 4YDJB 3EZ8A 1J0HA 3EYUH 5T3XH 3IFOA 1HYSD 1S7RA 3FHQA 3O2DA 1FH5L 3TBTB 1BM3H 4P4KA 3H42H 3GSRA 2EIDA 3L9RB 1Z2KA 2J8HA 4Z9KB 1HZHL 5ISZE 1EK3A 1HIML 3QIWC 2NXZD 2P8MA 3GJFB 4LGSB 5HVHB 4MVBC 5KSVA 3HG1B 4MNQE 5LQBL 4TULL 1AIFB 5KANI 1A5FL 5HGDB 4GXUM 3KLHD 1ACYL 1P9MC 4HC1L 1RZKL 4YX2H 5GGUB 3MREA 4AEHH 2IAND 2DLGA 1A1NB 3WLBA 4JGUA 3MLTB 1UEMA 4PRHB 4UT9L 2GTWA 2X1QA 4XAKE 1KPVB 5I9QB 3BKYH 3OKOB 1KELH 3UJJL 4PPTA 2W65A 2D7MA 2VXQL 4LLDA 3T3PE 3VDBA 1DBJH 1BQUA 4MA8H 3BDYH 1ZHLA 3TEUA 1N26A 3OG4B 2BVQA 4Y19E 5DGRA 2HH0L 3EIFA 5FM5O 3TF7C 3HAEG 3HR5A 3LKSA 3FQNA 4TSCH 3I50H 25C8L 3GIZL 2CJUL 3FB7B 1I1FB 3AMLA 4C59B 2FWOB 2Z92A 4X7FC 4L3CA 2C3XA 3QP3A 1IAOA 1CDHA 1TJHL 4JANB 3KPRA 4PLKC 4XXDB 5FGBA 4L3EE 5IK3B 4MCZB 1JN6B 3EJYD 4PJ7F 1OM3L 1QO3B 3DIFA 1JGEA 1X5XA 3IS0X 3MGOA 5L9DL 1NMCB 1VCAA 2W60A 3L3DB 3MODL 4NGHL 2UWEE 3QFJA 5FYLE 5J4MA 5KVGH 2D9QB 3QNYB 3MR9B 1J1PH 4OGYL 4YIQB 3SCMA 2YD7A 2CRZA 2EEAA 4OUUB 3ILPA 2Q7YB 1MJUH 4EI5B 3U82B 3RBSA 4ZUVB 2QSCL 2AQ2A 3DBXA 4PYGA 4BUHA 1T5WB 5IQ9A 2F15A 4Z77B 1U3HB 1ONQB 2PW2B 1F4WL 3MRCA 4MNGB 5I18L 3BUTA 2P1YA 4GFTB 1OAKH 1AQKH 4Y5VA 4Y4HC 4I48B 2X1WL 1TIUA 4XP5H 1TNMA 2VC2L 5F7YC 1YEEH 1INDL 1VACB 3LS5L 2R2BA 2ATKA 2AJUH 3N9GL 3VCLA 3GSOB 4DW2L 3DSNA 3JV6A 3G6JE 4WWID 5C09A 4XNYL 4OFVA 1K5NA 2CO7B 1VERA 4QHLB 2H2SC 3WD5H 4LHJB 5JOFB 1BBDL 3LRGA 1Q0XH 1IQDB 3PL6B 5GZOC 3OWEA 3R06B 1A0QH 2AJ3A 1QNZH 2WNGA 5FFLA 3BIKA 3WJJC 5CP3H 3N85H 3RWGA 2J5LC 4LSVH 4YE4H 3NFSL 1KFAL 1UCBH 3D69B 4WNQB 3PWUA 4U1MB 1UJTA 1IGIH 1MI5E 4J4PC 4KRNA 2VAAA 5C0DA 2R8SL 2X89D 5F9JB 2X70A 3A6OA 1Q9KB 5INCB 3B3IB 5ILTH 3EFDL 1A3RL 1KEGL 4UNUA 2HFFA 2Y07L 3D0LA 4G80B 5DVLA 1V7ML 5DGQA 3KYMA 5DS8A 3HLAB 2FJFA 2EDFA 4R0LB 3PWLA 3NCYP 3T2QA 2YEZA 3CZFB 4KROB 3OMZA 4HKJB 5EZOH 3WIFA 5DUBB 4EVNA 4ELKA 3Q5TA 3WHXB 2BNUB 4JHBA 3F7YB 4YHNA 1MJJA 3M07A 3SQBA 3CVIH 4UINL 4NO3A 1IGJA 4ZDHB 1T83C 3QIUD 4P46D 2Z4QA 5C2BL 1FLRL 4P5TC 4ODSL 1MCQA 3L7FB 1JZ5A 3ARFB 1MCPH 4NJ9L 2H2PC 4PJ5D 3FZUC 2FIKB 5A2FA 1J0JA 4UBDD 5TQ0H 3PV6B 4JVUA 5DQJB 4NM8L 3TWCL 2GSIB 5IFJA 3B43A 3MLWL 4ZD3H 5I71C 2DI9A 2ESVB 3DUSA 4F7TB 3QUXD 3LCYA 2QLVB 1IGYA 1KPUB 4TUOB 3HAEA 1GAFH 5IM7B 3O4LE 5KBNC 3H9YA 4X7CC 3GSVA 1I3RB 1OAQL 4KDWA 4MJ4A 4N0RA 3GB7A 3QCTL 1BPVA 4G8GE 3VFNA 3QEUB 3SDDA 2Y1VA 1J18A 2ZPKL 2R56L 1OWRM 2FZ3A 4WWKB 3MRPA 1BVZA 4PJGE 2AI0H 5E9DD 2JB5L 5CEZL 4O2CB 5E8NB 5IVXF 4PRDB 5GGVL 3RVVD 1SMAA 5J12B 1NCWL 1I8KA 3ZE1F 3I3BA 3IAGC 1J1XL 4YAQB 2OYPA 2KZ1B 4Z95H 3LEYL 4QGYA 3KJ6L 1EFQA 2CR3A 2BVTA 4PRIE 4X9IA 2HT4D 4HDIA 3D2UD 3QUZC 5J1AB 2VL5A 4NO0A 3HKFA 3HHRB 2Z8VC 1T7VA 4JPKL 3WS3B 1LE9B 4N0UB 4K94C 3GMPB 1AO7B 3RVUC 3O3UN 4IIQB 2HVJA 2C1OB 5T1LD 5CD5D 4TVPH 4GQPH 5K9KA 4P2OD 4ZNCD 4MQSB 4LFHD 5FO9B 4FTVE 2FO4A 4BSVA 5I1AA 1T22A 5DJXB 1AI1L 1WBZA 5HVFB 1YMMD 4WFEE 3VXTA 3VRIA 3SO3B 2OTPA 1OT1A 2DYPA 3LOWA 3P0VH 4I9WD 3LIZH 1UVQA 5L2KE 1MY5A 3GJFK 1CL7I 4F9PC 1VGEL 1C1EH 1UKTA 4NKOB 2BSTB 1L7IL 4OD1L 4Y16B 1OT2A 3F12A 3U2SB 5JW4Q 1FZKA 2DBLL 4P9ML 3FB8B 5FYKH 2DKMA 1OVZA 3RDTB 4BSJA 5IOPB 4PRNB 1MCDA 3G5VB 5GGTL 3UX9B 4NQUA 3QH3B 4HS3A 4RGNC 2D3VA 3B9KA 4JHAH 1QFWH 1E4KA 4JO1H 4UOW0 1H15A 1TETL 3MLVH 3DUUA 4KI1A 1G7JB 1GCFA 3ZKSD 3ELAT 4ALAL 4MA7L 4PGEB 3CLFL 5F71A 4ZFGL 3RWDB 4FMKA 4MA3B 4JCLA 4JKMA 1CR9H 5C07B 1TQBB 5CFHA 2FR4A 1NAMH 1AGFA 1CLYH 5F6HJ 4F7EB 1OGTB 5CWSB 3KPQB 2VLKD 2XWJA 3GGWB 2L7JA 2X4TB 4F2MA 1YN6A 4JO4H 5JPNB 1TDQA 4FZ8H 4Q9QH 4L29B 4JG1H 1N5YL 3QXWA 1CE6A 3G5ZB 1SBSH 2L0DA 5J56B 5FV1L 3PQYE 1BAFH 1QA9B 4JFDA 4X6DF 5GJTL 1R3JA 1TZIB 4Y4KA 2D7QA 1GC1L 1H5BA 4XTRD 1G7MA 5DRWA 4PYHA 5C7XL 1D5BA 3DYOA 5ADPH 5E6IC 1GH7A 2CUMA 3PDDA 4H88L 4N8CH 2AV7B 2Q8BH 4OKDA 3MBED 5D1XD 2O26U 5L7XL 1RJLB 3QO1B 4Q0XL 2VR4A 4GKSB 3OJDA 4LF3B 4PGDA 1KC5H 2N56A 2IADB 4U1IB 3P77B 3RI5F 1NDGB 1G84A 2K7QA 3G5XB 1A4KB 3VXUE 4XNUH 5C0CA 5ANMB 4XP9L 5DSCA 1A7OL 2WBKA 1UZ8A 5KSBF 2V2XA 2FJHB 2EE3A 5DI8B 2B4CC 2ENSA 3O6MH 4K2UL 3WFCH 3HC0A 2NYYC 4OLUL 1JRHH 5BVJA 3FFCD 4NN6B 5CEXA 3U7YL 2X5PA 1NGWB 4LBEB 1Z0NA 1ZHKA 2WBJB 5DEGB 4OQTH 3OAUL 1U58A 1NGYA 4QHKJ 5T1DL 5E6YA 5T1KA 5I1HL 3SDAD 1ZGLM 4MJ6A 5T3ZE 1MJ7H 5DJDA 5E6ZA 1S7XA 1S9VA 5DEZA 2H3NB 3PXHA 4JFED 3DWTA 3RIAK 2F19L 3ALXA 4YHMH 1N2RA 3MRKA 4LMQE 5IKCA 4BFBD 1FNEA 2MOVA 2IH3B 3T8XA 2R0LH 4B5EA 3ULUF 4M6NH 1WZ1L 4POUB 4FN0A 4X4YB 1V7NH 5GS1A 3OR6A 1HK6A 1KJVB 3HMXL 1T1YB 1U8IB 3BD3A 4XP4H 2D7OA 5FO8B 4FZEL 5IT2H 4KDVA 3MACH 2J8OA 4YZFE 4OV5A 1K4DB 4R9HA 3B5GA 4JRYD 4XX1G 4D3CL 4P9HL 32C2B 4OFIA 1QRKA 4PD4K 1DQMH 1REIA 5GGRB 1EO5A 1HQRA 4WCYL 2A74B 4TNWF 5KVDL 5HHNA 3GHEH 3DI3B 1QR1B 4IRJD 2VDOH 4JY6B 4JFFA 4AM0B 3QIWA 3WXWH 4MQXC 5EC2B 5ESVA 4OKVA 4LCWD 3H7LA 5EN2A 4MQ7A 3V5KB 1ETZA 2JKXA 3UTSA 2PNDA 4I0PA 3RVXD 1ZT4A 3MCLH 4Y5XC 3QA3A 4UMGA 3TGXA 5HVWA 1P9MA 4X4XA 4EBQL 4MAYD 3BVNA 5I1LB 5HGBA 5H2BA 2PTTB 5FOBA 5D7IB 2ZUQC 1TPXB 3GI9L 3IDYB 2BVOB 1QVOB 4UU9B 2CLZB 2XTJB 2EYSB 3RGVC 3U4AA 2AXJA 3R8BB 4D9LH 2D0FA 2A6IB 1S7WB 2GFBA 4YR6B 3PWPD 3U4EB 1RZIA 1UXWA 4CAGA 2VLRD 4C4KT 3RKDC 4QYOB 2Y5TA 1RMFH 4RDQF 4HZLB 5AZEH 4Y1AE 1U8LB 3WO4B 3O45A 1B90A 3QT2A 4X7EC 1PKQB 3C6SA 1KCSH 3K81A 2XA8L 3HN3A 3VA6A 4UT6L 4JFPB 3DROA 1IT9L 1KN2H 2VJXA 3QDGB 2A6KB 4PP1C 5CEZE 1FAIL 3QCUH 1KB9K 1PZUB 3MX0A 4UDUB 3B6SA 1KLFA 3MLRH 1PQZB 3KG5A 4XNMA 4LHUG 4YXHL 3VXOA 1G9NL 4ODHH 3CSYA 1MRFL 4BQ8A 3OB0K 4K8RC 2MQ3A 1MELA 1TJIL 2X6MA 1DQJA 2BXZA 5DD0L 4JM2D 1A3QA 2R23A 3OAYK 3O8XB 3SJVA 1N7MH 3D3VA 1XGUA 3BT2H 3BPCA 3C2AL 4OZHF 5ITFB 4NNPL 4KGLA 3KLSA 2DRUA 2D9CA 1SYSB 2F74A 3UPRB 3HRZB 1IL1B 4YUEH 2ICES 5EU6A 3MYJB 4Y4HA 1EGJH 1K4CB 3OKNB 1U8QB 2W0FA 5AEAA 5JXAL 5IVNA 4L5FL 2MCPL 4RGMB 5E94A 4K3GA 2F54B 7FABL 2P7TA 5E5UB 1WTLA 4HK0A 1U95A 3REVA 4OLVH 3RHWF 4UOW1 4YXKH 5DYOA 2VKWA 1XF5B 4WJ5B 1CFVH 5AUMB 5EIQA 1SJXA 3K4ZA 4DOHB 1FNGA 4KKBC 2NW3A 2ID5A 2CIKA 3KS0J 3I84A 4YHPB 1PY9A 4KXZH 2F53B 3HE6B 3T4YA 4Q9RH 1RUMH 3WJJA 1XR9A 2Z91B 4XCYA 3TBYA 3AS2A 3QI9A 3O41B 2CMRL 3IDIA 4PRHE 3BISA 2DQHL 4J4PA 2VQ1A 3M45A 1N64H 3P9MA 2BERA 2O61A 1A7QL 1NMAL 5JORA 5EU5B 1P4LA 3QIBB 4CU6A 3BZEB 1BD2B 4WVRA 1SYVB 2R4SH 3WDJA 1I4FB 1U3ZA 4PTTA 5GRJH 1D6EA 4DGVH 1JWMA 4M43L 2ZNWA 3PWNA 4P5KA 4HG4K 1OP5H 1F4YH 2HT2C 4ODTL 3UDWC 4NM4L 1HHJA 1RJZB 1H3GA 3BN3B 4NRXB 3I6LE 4JZNA 5HYJD 1M05B 4XCCL 4MJ5A 1W8OA 3MLSL 1MVFA 5E8DL 2OXHA 2PCPB 3WUWB 3TA3C 1XFPA 4XP6L 4YH6A 3W2DH 1T83A 3CXHK 4DQOH 4P5TA 1MHHB 1OB1A 1FCGA 3VGFA 2VIRB 2JIXD 3QO0A 1LEGB 4M6AA 2A77H 2Z8RA 5I1JH 5F9OH 2GY5A 2X4OB 3T08A 3IDJA 1WZKA 3RQ3A 2ZKHL 2V2TB 5TGBA 3TO4D 4HJGA 3B9EA 2NX5D 5ICXB 3V8OA 3G08A 4LIQH 4LHQB 4X5XB 2R69H 1RZKC 1YPZB 4MXVF 5HGAA 4APQC 4EXKA 3S7GA 4QRSA 4HUVB 1ND0A 2UZIL 1JV5A 2DQGL 2ENYA 4FXKA 4ZTOL 3VH8G 4IOFC 4P4RB 5JW4N 2NTFA 5LWYH 4XPHH 4LHUA 4W4OC 4JN1L 1TVDA 1FZOA 4LLUB 5JHLL 5BXFA 5E2WL 1JIBA 5DT1L 1BEYL 1G9MH 5F72S 1E28B 5CINH 5LBSH 4L4TE 2R29H 4WTWA 1NFIA 4NQCA 3SGDH 1FE8H 3QUZA 3IDMB 4PP2B 2AGJH 2N7AA 1JNLL 1U8HB 4MD0B 3QHZL 1J5OH 1AGCA 3V6BR 4JPVL 2HVKA 1ODAA 3V0AC 5DTFA 3I3DA 5HHOE 4Y5YB 3QDME 4WHTB 1C16B 1BVKA 4CADB 2VXUH 4L8SB 4O51A 1IGTA 2VLLA 5GGSY 4XPGH 2DQUH 2SEBB 3K2UL 4TQEH 1RVFL 4YBLB 3E0GA 3RTQC 5I1CL 4NQVA 2EDYA 3TBVB 1HSBA 3CFCL 4MXQC 1AC6A 2YBRA 3VFRB 4F9PA 4N68A 3MTRA 12E8L 5D7JD 3VWKB 1YECL 1KULA 3SE8L 4BZ2H 3C8KB 5D72L 2AK4D 3U9UB 4FQ1L 2QJDA 4Y89A 2BDNL 1DR9A 4JFZH 4DUVA 4P23B 1A7RL 5IIEA 2MQ0A 3FT4A 4ZS7L 4M1DH 4K8RH 1NEZB 1NGPL 5GIRB 1SMOA 4Q9CA 4NRZB 2VDLL 2Q1EA 2EDEA 1NGXB 4PJEF 4NCDA 3VJ6B 1ZGLP 5E08H 1T0PB 1RZGB 1WZLA 3VFVB 1S7UA 4LKXB 2F5AL 4X4ZA 3ZHLA 4K7FB 5ABDE 3HR6A 1KXQE 1LO4L 3WXVH 2HWZH 1W72A 1R5VB 3FB5A 3GDBA 3VD5A 4F15B 4EN3D 3MUY1 2DWEB 2P5WA 4OCNC 3RPIA 4Q58C 2VLMD 5KJRH 3T0AA 1OARL 4QXUL 5EZIH 4N9OB 2QEJA 4GBXB 3UC0H 1KB9J 5E6IA 4PJEE 4OF0A 1MH5A 4I8DA 4RFNB 3S9DB 4NUGL 3C60C 1G0DA 3CNKA 3D39B 4UTBH 5IF0A 4BSWA 1S7TB 4ELMF 5E1AB 3FT3B 3UPCA 5IV2A 1S5HB 4PV9B 1LEIA 2XTLA 2WQ8A 3M1BA 3HZVB 5C6TH 1TQCB 3PHQA 1DVFB 5INDA 5ADOH 1QG3A 5I74B 4UILH 1IEAB 1I1RA 2IQAB 3ALPA 1AR1D 1IM9D 3QEHA 5DJ6B 3WEXA 2BVYA 3GSQB 2JJWA 1DBAH 4OI9A 3NA4A 1PBYA 1CFTB 3IXTA 3LKPA 4N0UE 4ELME 1Y18A 1FVCB 2OTUA 5TE7H 1U8PA 5FKAB 2HKHL 4OD3H 1WIPA 5I1GL 1K6QH 2IALB 3T2NH 2E7LC 4B50A 1DSFL 3U6RB 4RISL 2PXYD 4IEFB 3TT3L 2ADIA 1ZS8B 4TTDC 2I9TA 3GK8H 3D0VA 4KRPB 4G7YL 3IGAB 2LTQB 2YPLB 4LMQI 3VH8A 5CP7A 1CFQB 4IMKC 3UTTA 5EIIA 1ZHBA 2HAZA 4OCYH 4HBCH 1MAKA 5IBLD 3GKWL 3EYOA 4OJFL 1QLFB 3MV8D 4JDVB 4P0DA 5JUEL 2XWTA 4LASL 1A4JB 4KMTL 4HK3J 4DKDC 1JPTH 2VWEE 3MXWL 3TIEB 4ERSL 4P4KD 3FO1A 4OFPA 3QR2A 4UTAL 1OTSD 2V7HA 4MD4A 4WUKL 1AY1H 1OW0C 3WFHA 3V5HB 3VDAA 4D9QD 1U8OA 3B5HA 3F7VA 2V7NB 4Z0BH 4TSBL 5C07E 5MP6H 1YNKL 3H3KA 4O02L 1JTTA 1M4KA 1R3HA 2DJUA 5D7KD 5C86A 4PJ8C 2KDGA 1BZ9B 1H0DA 3B8YA 3TZVC 1OD7A 3ROOA 1ZA3A 3TPUA 1RSFA 2CKBH 5CGMA 5J8OA 1RFDL 4HJ0C 1UENA 4Z7QE 1CFSB 4D94A 3BH9A 1BLNB 1MF2H 5DJYB 4QNPF 4J6RL 5F7MC 4HG4J 2DIBA 5IJKC 1XGQA 2O5YL 4WHYH 4PB0L 3ZDZF 3O9WB 5DMGC 3OF6A 5EO9A 4LVNC 4Y5XA 2YD8A 3U7WH 1DQLL 3ARBB 3OKMA 4H5SB 5HHPA 2X4NA 4WI5A 4NZRL 3NCJL 4BQ9A 1J86A 4YHIA 4GS7B 3C9NA 4GXUN 3RU8L 2QADD 3CXHJ 5MI0C 1CK0H 4OF6A 4HV8B 5D2NB 3TNMB 1ZGLB 1XF4B 1PAMA 2HRLA 4Z8FL 1JWSA 2R15A 4OZFG 3RGVA 3Q6FB 4OCSH 3MMEA 3S3JA 5ANME 1R0AL 1T3FB 5JMRA 4JDTH 3QNXB 5C0IB 3KPRD 2VNCA 1L4IA 1QFUH 5HVHC 4GXVH 4PRBA 5K9QG 4JO2H 5MEQA 5SWQB 2F5BH 3ZDXF 2DQEL 3MRGA 1QRNB 3SEPA 2FGWH 1TJGL 2BOCB 5FHAL 4MD5B 5CILL 2LQRA 9CGTA 4P2CG 4RBPH 2AKRB 1BBJB 3LN4B 2A1WH 5BS0D 1T0MA 5DJ2B 1Y6KR 4ZFZB 3L5XH 4OZGF 4MZ3A 3QXDA 2RCSH 3MA7A 1I1CA 3TCXA 1KLUB 3FO0L 3DHMA 4P99A 1G7IA 1OPGH 2GUOA 3GMLA 3RJQB 5I15L 3BXNB 3BEVA 1CXFA 3OGCB 1FL6A 1BWWA 5E8OA 4GG6E 15C8L 4I18C 5JA8B 1EERB 2ZSVA 3SPVB 1GC1C 3TN0C 3X11A 1KXVC 3QQ4B 4PUBL 1E4XL 4Z7OF 4R8WL 1GGIL 1CLZH 4OZGE 1I1YA 3HC3H 5C09D 4LK4A 4G5ZH 4X0KA 1NSNH 1IZKA 3GFUA 3IXAA 1JCKA 5EB9A 4BQ6A 5T33L 4M7KL 2C4FU 3WJLC 1IEHA 1UEYA 1UKQA 2XZCL 4ZS6D 3TO2B 5CKGA 2BJMH 1NMCC 3QWRA 2G5BA 3CH1A 1FZJB 4JJHA 3WFDL 4Z7OE 5ACZB 5M94B 1HI6A 4RWYL 4HEME 2XPGA 4PJIB 5C1MB 2CDFB 3H8NA 4I77L 2HG5B 3T4AB 4EI5C 2GAZA 3IAPA 4R90H 4HWBA 2EICA 2DM3A 2PYEB 3LKNB 1TCRB 2PR4H 2YSSB 3O4LA 3VMPA 1AGDB 2ARJA 1JI2A 1YEHH 4UI2A 1CGSH 2VDQL 4OD2B 5D7IE 5A2JH 4OLYL 1J05A 4CVWA 1MLBB 3U36A 4PJXF 5B4MD 4BKLB 5IB1A 4PJGA 4XHJC 3V5DB 3RL2A 5ERWB 5JHDA 1TTFA 1AKJB 1G6RB 3T0EB 4S1RL 4FFWD 3UAJD 4UNTA 5GQBA 1D5IH 4OFYA 4W6XB 4X6CF 2C1PB 1VHPA 4WI8A 1S7VA 4X5LA 1OQOA 1FGNL 2FX9H 3PL6C 1KTDB 2QKIB 3FCTB 3UDWA 1FVDB 5KTEH 5MEPA 1DUYB 5E9DE 2HKFL 5L0QB 4XCFH 1HXMA 5TH2A 4CVZA 2DIJA 2RHEA 3SKJH 2IG2L 4D8PA 3TA3A 2EDKA 3CCHB 1DBBL 4X6CE 5HYSG 3BRFA 2GJZA 3HTLX 3DVFA 3JTSA 1RK0B 3ARUA 3PJSB 2EKSB 2HFGL 4OZFA 3SDDD 2BNQB 5D7SH 1F6LL 5FUOL 4XVJL 4WI2A 3X3GH 1AGEA 2BSED 4R0LC 1A02N 4KV5E 1LO5B 1I8LC 1H8OA 4KROC 1M71B 5GGVY 3RI5K 3U0WH 1QBBA 2R0WH 4F7MA 4HCRH 2WUBH 4PV8B 5I1EH 5IMKB 5I17A 1OTTC 4IJ3B 1H3PH 1YJDL 1NBYB 3C8DA 4OZIB 2B2XL 3DXAD 4HC1A 2AS5M 1F58L 2DTML 4L4VD 1XZ0A 2P8LA 5E03A 4APQA 4P57A 4QTHA 5CIPA 5F7DB 4HIJA 2F54E 2DKSA 5DHVB 5FK9A 1ZA6A 5L88H 4JO3L 3CFEB 4NO0D 1FNSH 2EXYD 4UT7L 3RWJB 3Q3GB 3W9EB 3ARFC 4NZTL 4W4OA 3K74B 1QSEB 3GJEB 5D7LA 3LPFA 2BHYA 2IQ9H 2BHUA 4QXTB 3NN8A 1WV7T 2EO1A 1HH6B 2J88L 2XWBA 3V6ZA 1QFWM 4OBRA 5FM5M 5F8QC 3IT8D 4AT6A 3WL9A 1EBPA 2Z31B 3MLZL 5AWNL 2MWCA 3PQYA 5IBTL 3QCVH 1YEDA 1RAMA 4HFUH 1JPSL 5I2IA 1YY8A 1I1AB 5GHWH 4MDIA 1PYWB 4NUJB 4RA3A 43C9A 3U30B 2MPAH 3VFGH 5HHVH 1QUNA 2DOCA 3BP5A 3RRQA 3ULVD 2MKWA 4ONGH 4MLIA 2NY4B 1KUMA 3RTQA 1G9NC 3DHJA 5J12C 4M61B 1KJMA 3BW9B 5J0BA 4OB5H 4M7LT 3MREB 4IBLT 1YYMH 5JNYA 3F58L 3VXSB 4PLJC 1XF1A 3MLXL 4KQ3L 1C5CL 3MOAL 1TVHB 3VXUA 1NJ9B 1NFDF 3DRTA 2VR9A 4TNWK 1TITA 3UTQB 1UJ3B 1KG0B 1HN1A 4UNVA 1NUNB 1NGQL 2KKQA 4KH2A 4XBEH 5JZ7C 4G6AC 4WTXA 2GITA 4QHUA 2BVQB 2I07A 2FATH 1TZGH 1Q94A 2H1PL 1MAMH 3HR5B 3I6KB 4IIQC 5JR1L 2XRAH 4PBWD 1R3IL 3LKSB 1RJYA 1N8ZB 3ILQC 5B3JE 1IKNC 4Y4KD 2B1HH 2WQRA 3QPXH 2Z92B 3ZE2F 5FUZL 4YC2B 4PBVC 3WNOA 3TJEL 3SO3C 2D31A 4GRWF 4XPAH 4M6ML 3UP1A 2H45A 4NBYB 3RAJL 5I76B 4QRRB 2JF1A 4Y16C 4HFWA 4H0HB 4JRXA 1UB5A 1YQVL 1LWRA 5I1IL 4DGYL 5A16A 3RDTC 1P7KA 4JM4L 1NCDL 1XR8B 1RIHL 4ZO8A 3QFJB 4XWOD 1QBMH 4CW1B 4JFYA 1JNNL 3KPLA 4JB9L 2J7LA 3VXRD 5C0JA 5C70A 1RJCA 2ZUYA 5GS0D 3QQ3A 1Q9OB 4YGVA 3C60A 3ILPB 2W9LA 3SOBL 4JFEE 4AG4L 1I9JH 3IJHB 3BJ91 5FGCB 4HIXH 1TQBC 4LSUL 1EHLL 1HHIA 5D1ZB 1T0NA 1UM6L 3RUGF 5HYSA 1PVHA 4MA1C 4IMLA 1CGXA 3BWAA 3PE9A 5T1KD 5C6WH 3T1FA 5K9OA 4Y5VB 2AEPL 4U1GC 3C6LD 4WFGE 3LQAL 3W0WB 2HJKB 3K1DA 2EXWD 4KK9D 1HSAB 5FYJD 4MX7B 4KHTH 3EO9L 4JKPH 5CJ5A 5E8EA 2Y6SC 4J3SA 2KL6A 3TVMB 3HRPA 1KXTB 3FTGB 4TNVF 4EDXA 2E27H 3WLWC 4XI5C 3P73A 5EUKA 1J9CT 3E8UH 4AIZA 2E7LA 1OY3B 2AJVL 2FEEL 3QHTC 5IBUG 3UMTA 4EIGB 4G6ML 4QRPB 3BIKB 5HDLA 3QQNA 3RWGB 4I13B 3FRPG 1I9IL 1FRGH 5DJ0A 4IMKA 3X3FH 1G7HA 5EFIA 5DC4B 4LCWE 1CT8B 2V2WB 5GSVB 1SVCP 2QQKL 2ZSWA 4GAGH 3P3YA 4FQ2L 1F4XL 2CRMA 3RHWK 4O2EB 4N0CD 4RAVA 4RAUA 1LDSA 3P4NB 1A9BA 4NN6C 3PF2A 5EH1A 2MMXA 4JFFD 5DFVC 1OW0A 2WBJC 4JAMA 3QIWD 3PWLB 4X99B 1MHPH 3BSZL 1NC4D 1IGFH 1B88A 2AV1A 3NFPA 5F6IB 1UQSA 2HJFA 4EVNB 3QNZB 2W0PA 3QAZB 3UTSD 1CGWA 1OGAB 2B0SL 4I0PD 2Y06H 1DANU 4Z78A 2DDQL 3PWPE 4PJ8A 2VLRE 4Y88A 3TZVA 4AIXA 4YGAB 4HHAB 2XN9A 4KJQC 3KXFB 5LVEA 2CLVA 4OI8A 1Z5LA 3BMVA 4NKMA 4JVWA 2X1XR 3NIGE 3V6FB 2Z4QB 2HRPH 1N4XL 4ESKA 5IJKA 1XGRA 4OCXH 1EFXA 1SQ2N 4JM2F 4OAWA 5IJVB 2IAMB 1N0XL 5DURD 2Q7NA 5EUOF 3JWDC 5KN5B 4V1DB 2CR6A 5D2LF 1F2XK 4U7SA 2OL3H 5IFJB 4MMXC 1QSFD 5HY9A 3D39E 2WAHA 4YQXH 1KJ2H 1IGYB 3PHOB 5DJAB 1FORL 4KI5E 4F37F 3GSVB 4YHKL 3FRUA 1UWXK 4YDJA 3Q6GH 2VL4A 4LLQA 2DQIL 2HLFD 2NXYB 1FPTL 3F7PC 5HI5C 1U93B 4BFEA 3L9RA 3MRMB 3B83A 3GNML 3HB3D 2ED8A 2HP4A 3IJYB 3GJFA 4S11A 4KK6D 4JR9H 4QO1A 3HG1A 1CICD 2OJEB 4WI6A 4HD9A 4QGTA 4WV1B 1V8HA 4XHQA 4YDLB 1AIFA 1I8KB 1JZ7A 5HGDA 3SQOH 2OP4H 1VKXB 3UXFA 4Y2OA 1E6JL 2NY6B 4OIIL 4FQJH 1J0YA 5GGUA 4Y0GA 2ZP0T 4P3CH 2BP3A 1A1NA 2APXA 3MLTA 3OB8A 1ZLVK 4PRHA 1DEEB 5HI4C 1GL4B 2VL5B 2YPLE 3CC5A 1KPVA 1TPXC 3IDYC 4U1KA 2XTJC 4U1JB 3OKOA 5HYEA 4LCIL 4X4MA 1KB5H 4LQFL 2RJMA 1F3JB 2NZ9C 1T7WA 5DLML 5HHMD 5I1KL 2EZ0C 2HVJB 1RZ7H 4U0RB 4UV7H 5K9KB 2I9LB 5D8JL 2VZ3A 1JGDB 4HQQH 5CHNB 4I18A 3AREC 1B4RA 4BSVB 4M5YH 3KYOA 1T22B 2DBJA 1HDMB 1LO2H 1WBZB 4S10A 3TN0A 3VXTB 1I1FA 4XPFL 2DYPB 3BKJH 2FWOA 4BUGA 2ICWB 5I19L 1TNNA 3P30H 1U3JA 2EYRB 1UM4H 3V52L 4JANA 4XXDA 1PLGL 3HCVB 2DWDB 2ICWI 5IK3A 3VD9A 1Q1JL 4XPBH 4MCZA 1INEL 1JN6A 3T1WA 5CAYB 3WJLA 4HS3B 2EIBA 5C0AB 1T03H 1QO3A 3B9KB 1WWBX 1HKLL 1C7TA 2GK2A 1H15B 3AB0B 3BZFA 3FRPA 3QI9D 4XNZB 3WHE0 5A43C 5ICZA 3L3DA 3DSFL 2X4RB 4J4PD 4HSQA 4F57L 2GJ6B 3RGHA 3QNYA 3MR9A 4AQ1B 2WINA 4XP1H 3NCMA 2FR4B 1J0ZA 3O8XC 4RMVA 4EI5A 4OUUA 2JK5A 4O58H 1Z9LA 2WLZA 4ZUVA 4KVCL 5IMLB 2XWJB 3TT1H 2GK0A 2IPKB 1NANI 1IC4L 4Z77A 2YA2A 2PW2A 3VWJB 4MNGA 4HW6A 5CLTA 3V6OE 1IAKA 5D2NE 4RIRB 3DMMC 4JFDB 1X6LA 4I48A 4JY5L 1MQKH 4RGMC 1G7MB 3F6IA 4GAJH 2YD1A 4GRMB 1C5BL 3SDXB 5HD8C 3GSOA 2J4WH 4L8CB 4QHLA 3OJDB 2HTLC 4PGDB 5FKPA 3HZYB 3ZKMC 5JOFA 4P5TD 5HYQB 5F44A 1IQDA 3PL6A 3R06A 3FZUD 3LMJH 1AE6H 5J89A 1RIVH 2R0ZL 4NQDA 5C0CB 5DSCB 3HMWL 2V2XB 3D69A 4WNQA 1F11B 1R3LB 2XQBL 3I2CL 2FO1A 2P5EB 4JG0H 1RUKL 5F9JA 5BVJB 4ZUUB 1Q9KA 3B3IA 5LAXB 3KPSB 5IEHB 3PG2A 4G9FB 1WFNA 2FX7L 1BQLL 1U58B 1NGYB 3GSUA 3QIBC 1W0WB 1KCKA 1VB9A 4G80A 3HLAA 4LAQH 3ETBF 3HPLB 4R0LA 3STBA 1X5KA 5SX5H 3ZL4L 3CZFA 1I8LA 1QEWB 1R5IB 1JGUL 3P0YL 4M1CC 1CDUA 3CUPB 2V5RA 1MCBA 4LHUD 1DJSA 5D71L 5IKCB 3WHXA 2BNUA 3D48R 4LOUC 3ZDYE 3F7YA 3H6JA 1AD9A 3C5SB 4MJ2A 4OIAA 4POZD 2R0KL 1JTPA 3DGCR 3E1F1 1B0GB 4F58L 1UH4A 1E27B 1CLCA 4NQCD 1V3MA 4ZDHA 5GS1B 3QUZD 1WT5C 1MFCL 3F5WA 3FN0L 2OL3A 3L7FA 2HMID 3ARFA 5DUMH 5JQHC 2FIKA 3O11A 3LVEA 3RVUD 1X5GA 5DQJA 1X7QB 4PJIE 4OV5B 3WIHA 2GSIA 3N1MC 2BNRB 2WIIB 5F7WC 3IDGA 1MIEH 2AK4E 4NKQB 1HINH 2ESVA 2P43B 1HQRB 1KPUA 4TUOA 4WEBL 5GGRY 1H3WM 1I3RA 1GZQB 4K23L 35C8H 3S35X 3U4BH 5E2UH 4NQSB 3TJHD 3CFDA 4A6YH 3CFBA 1RHFA 3O4OC 1B6UA 5FAAA 1H3TA 1ETZB 1CE1H 4JJ5B 4Z7VF 2YRZA 1I7RB 2EDLA 4PRDA 1EEZB 3QDJB 1KEML 2D0GA 2G2RB 2F8VA 2J6EH 3KNBB 4Y4FB 3IRZA 5H2BB 4IDJL 3AY4C 4YAQA 4QKXB 1CG9B 1M7IB 2H6PB 5EC1B 2VYRE 1NC2A 3AS1A 2VLME 2ZCHH 1MRCH 1KB5A 5J1AA 4L8BA 1UXWB 1RZJH 2Y5TB 1WWWX 5GGQH 3Q2CA 5E1HB 1LE9A 2XV6B 3GMPA 1IFHH 1AO7A 1UFUA 4IIQA 3EYUL 5T3XL 2C1OA 3C6SB 1JF5A 1KCVH 3RVWC 1LD9B 1IKNA 2P5WD 4O5LH 5JPMB 4YBLC 1QFOA 2ZUTA 3H42L 2BNQE 3DROB 3QQ9C 3OQ3B 1NBVH 3DNKA 4LSPL 3FFCB 5DJXA 4LLAA 5E6ID 1FYHB 3NPZB 1C5DB 4ZUTB 3FQRB 4R2GB 2J8UB 1BJ8A 1S7QB 3B6SB 1XT5A 4NKOA 2BSTA 4XH2B 4Y16A 3NZ8B 4JKLA 1S5IH 4XNMB 3U2SA 3VWKC 3FB8A 3RDTA 2XQYK 5HYFA 1QPXA 4LCCB 4PRNA 4OZIE 5FYLH 3G5VA 3QH3A 4AEHL 1OP9A 3NCYS 4P23C 1DQJB 2R23B 5TE6H 1A6UH 1MFDH 3D3VB 4UQ3B 3BKYL 1NAMB 5EO0A 4PGEA 5IB2B 1XGUB 3RWDA 1QKZH 3BPCB 5C9JA 3MRBB 4MA3A 4MNQD 5J6HB 1DBJL 1QLEL 1QFPA 3BDYL 3R1GH 4F7EA 1OGTA 4KDTC 4KTDL 4XZUB 5CWSA 5E4EB 3KPQA 1C08A 1JPGB 3GGWA 1S3KH 2X4TA 4R4ND 5EU6B 2ZOKB 1JF1B 3D85B 3GI8H 2VISB 5JPNA 2W0FB 4QCIB 1LP9B 4L29A 4TSCL 3I50L 3G5ZA 4NC2B 4U7KA 4F15C 1A6TB 1QA9A 3S37H 1WSST 3OPZH 4XAKD 3REVB 1TZIA 3UTTD 4PBXA 4OGAC 3WHE1 3O0RH 5I8OH 2VXTL 4GBXC 4IRJB 3O3DB 1GJIA 4RFNC 5E8PA 1EEQA 3RWHB 2BOBB 5MHSE 3QEGH 3T4YB 1PX3A 1RJLA 3BZ4B 1NUGA 3CDGA 4GKSA 4KI5C 1XR9B 4PLOB 4W81A 4U7MA 3WFEH 3CK0H 3EFFA 2J5LB 4N9GA 4X7SH 3QDHA 4HIEA 4XCYB 3P77A 3NABL 2P42B 2ITDB 5KVGL 1DVFC 2YUZA 3G5XA 1A9EB 5I74C 1A4KA 2BRRH 3BPLB 4GW4A 3MFGB 5ANMA 4P2RB 1MJUL 4KMQA 4OFKA 4D9RD 3JWOC 1NCCH 2FJHA 2O61B 4L3ED 2AK1H 3MV9B 2PW1B 1YJDC 4LSSL 3OR7A 1JRHI 3KGRA 4ODVH 1NGWA 4WFFD 4LBEA 2DD8H 4PTTB 1OAKL 2WBJA 5DEGA 1A1OB 5FYLD 4MWFB 4PJDB 5T5NG 3O6KH 2WK2A 2AJUL 4JEGB 4YFLF 2H3NA 1AQDB 3OF6D 1UKSA 1GGCL 2LTQC 4RZCB 3OKLB 1FFOA 4ZAKB 2Q3ZA 4QRRE 3HFMH 3WD5L 2YUXA 3GSNH 1K85A 1P5UA 3DETC 1Q0XL 4NQXB 2FB4L 1QNZL 4JY4B 3N85L 3GMQB 1H9VA 2JTDA 2VQUA 3RGVD 4X4YA 3QFJE 4YE4L 3QO0B 3NIDF 3WO3B 2Q86A 1ZANH 1UCBL 3QWQB 1SJHB 2PUQT 3NFNB 1KJVA 4PRPA 3ARZA 1U8IA 1IGIL 1FV1B 5BZWB 2GSGA 1IAII 4OGXH 5FO8A 3ULUC 5I71B 1J0IA 3MLPA 1PG7H 2FHCA 4TOYH 5FGCE 5ILTL 5TGBB 1K4DA 4QF1B 4HJGB 3L3KA 3W11C 32C2A 2XZAH 5JDSB 2DQCL 5GGRA 3GSXB 2QQQA 4OV6F 2A74A 4DN4H 4CU8A 4S1DD 4PP1D 4LVHC 4AM0A 5FDYA 2BK8A 4ZOEA 4EUPH 3W0WE 4FXKB 3TFKC 1MI5D 3IB4A 1JGLH 5HPMB 2NTFB 3FMGH 3V5KA 5C09E 4KKCC 3HS0B 3O9WC 2AEWA 1U6AH 4LKCB 3CVIL 3R0NA 3CX5K 2XFXB 3QUMH 2VDPH 4OF3A 3MLYH 1XF2B 5I1LA 3WUWG 4JFOA 1GZPB 3WFBH 2MJWA 3MNVB 3ZSSA 3V6OC 1MCPL 5D2NC 5C0EB 5KVEH 1CTNA 4QOKB 1MPAH 2BVOA 4UU9A 4QHMB 2CLZA 5TQ0L 5E5MB 3FAXA 4FNLL 1AGCB 2A6IA 4HUXB 3U4EA 5DRZA 4ZD3L 3SDCD 1BF8A 4O51B 1ZXQA 2VLLB 1GAFL 1U8LA 1B4JL 1T80A 2EE6A 5CJXC 3AREA 4E9LA 1PKQA 1HSBB 1BMGA 2QQNH 4M4PA 4P49A 1UA6L 3L3HA 2Q8AL 5H37H 2YBRB 4JFPA 1OAXH 3RNQB 4AL8L 1EAJA 2RR3A 2AI0L 1ACYH 2A6KA 2B1AH 3QDGA 1XCQB 1ORSB 1FNLA 1X5JA 2A2QT 1PQZA 1B0WA 1VEMA 3MJ8A 3O4LD 2FSEB 2Y7QA 4ZMAT 3FT4B 4Z95L 1T20B 3UJJH 2VZVA 2VXQH 4C55A 3U46B 1JI1A 3VGAB 5DD5H 3H3BC 2CK2A 2JELH 3EUUA 2C3HA 4PJ7A 3GZKA 3D5OF 1S9YA 3CVHH 3O8XA 4LPXA 4FG6D 2HH0H 1QR4A 4V1DE 5ITFA 2UVEA 2UUDH 25C8H 4GKZB 2YZ1A 4OFYD 4TVPL 1SYSA 5CJBA 3UPRA 3HRZA 1W72B 1ZLSL 4JKKA 4I0CC 3DMMA 1OAUH 3MYJA 5F7NC 1IM3A 3MNZA 1TJHH 1U8QA 3CLEH 2F54A 4PRID 1BIHA 3BGMB 3P0VL 3LIZL 2NX5B 5EO1A 4K7PX 3QJFB 1UB6B 1C1EL 3IFNH 4NYLA 4HKXB 5AUMA 3NACH 3LKRB 5FYKL 1U8KB 3TA3D 3MODH 5IV2B 4MS8C 2L4OA 4YHPA 1FFPB 3WNNA 2F53A 1QFWL 3UZQA 1FZMB 4JO1L 3J7HA 3MLVL 3T0BA 4R96B 3ESVF 1F4AA 3MROB 2JCCF 3PXJA 4FTVD 3UYOD 2AJZB 2KBGA 1HEZB 4WFED 3O41A 2JLLA 2KQNA 4JPWH 5L2KD 3GIVB 1A6WH 1CR9L 1NEZG 2C26A 1NAML 3AMKA 4CMHB 5I18H 1NL0L 5L8KB 1Y18B 1DE4B 1OHQA 2OTUB 5DO2C 3K1KC 1R6VA 2YXFA 3ULVF 1YEKH 4JO4L 4U0QB 3QIBA 4FZ8L 4JG1L 1BD2A 5LGKA 3BZEA 3T0EC 5HSFA 4APQD 3LS5H 1SBSL 5T3ZH 1SYVA 1U42A 3N9GH 1JGVH 1I4FA 4B7IA 4NBXB 2VUOA 3TYGH 3D0VB 3DARA 5C3TA 3P4MB 1KN4H 4W4NA 3EYSL 2ICWJ 1ZVYA 2P46B 4HMEA 2MNUA 2IJ0C 2WWMC 5ADPL 1WJ3A 4N8CL 5D7LD 4LPWA 1RJZA 2Q8BL 2ILLA 4NRXA 5I66B 1M05A 2IFFL 2FEDC 3ULVE 1KFAH 5BOZG 4CJ0A 1KC5L 5C0AE 3WUWA 2PCPA 3UROR 5D7JB 2Q6WA 1WT5A 3PQYD 1YDPB 4PJCB 4M7ZC 3FO1B 1MUJA 2V7HB 4HF5H 4MD4B 4XNUL 2MQCA 2VIRA 4G6KH 1LEGA 1L9MA 1X9QA 4JDZB 2X4OA 2CPCA 1JRHL 4OCLC 4RMWA 2V2TA 3IKCA 3VFTA 4Z7UB 1OP3K 4MXQD 4IJ3C 2AW2A 4X9GA 4YDKH 5ICXA 5JMOC 3BH9B 1D9KD 4X5XA 4EXPX 1X5HA 1YPZA 4JFDE 2EDQA 3C5ZB 1WBYB 4V2CB 3VXUD 4PJ9C 5IW1B 4HUVA 1XGQB 3ZTJG 4F33B 3LEVH 4YHML 5JA9A 4KJYA 4UINH 4NBZB 3ARDC 3SDXE 3CIQA 4P4RA 2E7MA 2JB6B 1EO8H 2GY7B 4DVRH 5KZCD 2R0LL 3GBNH 5C8JB 3VGBA 1DBML 3C9NB 4LLUA 5KSAB 3H9ZA 4NJ9H 4PGBB 3AY4A 3H9SA 4M6NL 4YPGB 1ZT7B 3L3OA 2XOTA 1KV3A 5IVXA 1V7NL 1E28A 1U36A 1JWSB 5F1SA 5J3HC 4XP4L 2Z31C 3B2VL 3MMEB 3SGDI 5C0CE 2X4SB 5IT2L 2FDBP 4PP2A 4GRLD 2EDDA 1ZMYA 1CDCA 1F97A 1U8HA 1I1AC 4H20H 5F9WB 4DFHA 4JRXD 1XCTB 1TTUA 3C08L 1DQML 4E41B 3U30C 4WHTA 5I1DB 1SHMA 2R56H 4Z7NF 3STLA 4GQ9H 2SEBA 4G9FE 4HULB 1KLGB 2VDOL 2NY4C 2LU7A 2QHLA 4MXWH 5CEZH 1O0VA 3MJ9H 4F37K 1NCWH 2GTZB 3C60D 3VFRA 4XCEB 1SEBB 4R6UA 5FYJE 4F3FB 4Q6YA 3VWKA 1UJ3C 3MCLL 1P69B 3C8KA 4HX1B 3U9UA 2WMPA 4HPOL 3CX5J 1BOYA 4Z7NE 2YS4A 4W6YB 3G5YB 4P23A 3BP6A 1P7QD 1B6DA 2Z35B 4OLWH 4LSQH 3MRQB 5IB4A 4HS6A 1F8TL 4N5ED 1PY4A 1U2CA 1NEZA 1MRDH 1EEYB 5GIRA 3QUYD 3O6LH 2K9UA 4D9LL 1NGXA 4HWUA 1RZGA 4YC2C 2EC8A 3KWWA 3VD4A 3VFVA 1RMFL 3EDKA 4KDTA 2VN7A 4LLMB 3V7AG 4K94L 2VITB 1AI1H 1QZ1A 2VN4A 1KCSL 5EBWA 1R5VA 1BFSA 2A73B 1L7IH 4DGIH 3VRLF 4JFFE 1DEDA 2DWEA 1AC0A 1KN2L 1FG2B 3U7AA 3SKNB 1CXHA 4OF5A 1MFNA 4RDQG 3RA7H 4R4BB 2YPKA 4NKIH 4GBXA 1A6AB 5GGTH 1AD0B 2DB8A 3MLRL 3MRDA 1QP1A 3UTSE 1TETH 1CDBA 2WANA 4IRZH 4X6DA 1T4KA 3QDJE 1S7TA 1CBVH 4JCMA 5E1AA 2ZJSL 3VFSA 3CLFH 3FT3A 4ODHL 1S5HA 5D1ZC 3NTCL 3HZVA 3MJGX 1DVFA 4KK5D 3OKKA 1IEAA 5LGHH 1RIUH 1N7ML 2E3VA 2QSQA 5CEZD 4M93B 3BT2L 2IQAA 3PGFH 5DJ6A 5IB1B 3W81A 4TPRL 3IU4L 2NLJB 3GSQA 5JHDB 1EHNA 1FC1A 3MRHA 1CFTA 2XN9D 5D6DC 5GJTH 2CDEB 4HJ0D 3LDBB 3TVMC 1DQQB 1ED3B 3TBSB 1EGJL 2IALA 1WISA 1S7VB 3LRSB 5BRZB 3U6RA 4M3KB 3H9HA 1W72L 4DKFH 3VU2A 5KS9F 2VRAA 5FV2A 1BHGA 1ZS8A 1JZ3A 4OLVL 5DMGD 1ADQH 3IGAA 4M00A 4Q0XH 4YXKL 4FA8A 1CFQA 3ARSA 3KLHC 4I1NB 2J8UE 2QQLH 4CVZB 1HXMB 4HKZA 1QLFA 4ODWA 4U31A 4JDVA 4XC1H 3ESUF 3SDYH 2NR6D 2E7HA 3MFFB 2DN7A 4OZFB 4PJHF 2DI8A 3TIEA 1C12B 4K2UH 4YFLI 4L8DB 2ZUWA 2BSRB 3K3QA 3SJVE 3D3VE 3U7YH 4ETYA 1N64L 5GZNC 5DF0A 2V7NA 5GJSH 3HG1D 5F6IC 3ZKNC 3AXLB 1U41A 3BRDA 5BV7H 2CKBB 5GS2D 3ORJA 1WC7B 5EZLB 1F90H 2EKJA 4QHNA 3BP4B 1CXIA 1BZ9A 3IFPA 4G8FA 2R4SL 1LNUB 2BXYA 2UZXB 3P0GB 3PP4L 5EU6E 3GHBH 4DCQA 4L3AA 2W59A 5GRJL 2K3TA 4H1LG 1OP5K 4DGVL 1OLLA 1CFSA 5JXED 4GSDH 1BLNA 5DJYA 4PRHD 1AXSB 4LGRB 1F4YL 4O00A 1JUFB 3AVEA 5HXMA 2WP3T 3EJYC 2IAMC 3O9WA 5ALCL 3MSPA 2APFA 5EPMA 4H5SA 1F2QA 1MIMH 2VR5A 1N6QH 5D1QB 2XWBB 1BQHG 1NCTA 2W91A 3V6ZB 5A3IC 3W2DL 4DQOL 2I5YH 3V6OA 3UBXI 5D2NA 1ZGLA 3ZE0F 1BFVH 2P45B 4P9HH 2NXYC 3Q6FA 2A77L 3VG0L 5I1JL 4RQQB 5F9OL 4A2MA 5DRNA 1JE6A 5KVDH 4NRYA 1MFEH 4XX1E 3QNXA 3TNNA 1J1OH 4DKEH 1KGCE 2UYLB 5CJXA 3RTQB 1PW3A 4WV1C 5SWQA 4YDLC 4LIQL 3DJ9A 2NCMA 1QRNA 1ZHNB 2K7PA 2R69L 5SWSB 3OAZK 3S36H 1DUZB 2BOCA 3S37X 1XGTB 4MD5A 2P48B 3VXMA 2NY6C 1HOCB 2AKRA 2HLAA 1BBJA 3LN4A 4PJDE 4PB9H 1OSPH 1X5IA 2FIRT 3VGDA 5DJ2A 4EI5D 3IYLW 5JO5A 4ZFZA 1YNLH 2WIMA 4QHUB 3X13B 2O93L 1U3HD 1KLUA 5H35A 5J13B 3FOLB 1Q94B 4W6WB 4YHLH 5ECJE 3IKKA 5CINL 5LBSL 1NKOA 4PJFB 3BXNA 2R29L 3RKPA 4FOMA 2ADGB 3OGCA 4Z7WB 5E00B 5CJQH 5D93B 4XHJD 1MFBL 3QISA 2AGJL 2ZG1A 5MEOB 3RNKA 3PWJB 5GRUH 3SPVA 1CD1B 1KF9B 5DK0B 3EDJA 3QQ4A 4XPTL 3L3IB 1J5OL 2XA8H 1QHPA 1A3LL 4HFWB 2W1NA 3EDEA 1UB5B 4XPGL 2QL1A 2DQUL 4DZ8B 8CGTA 2NNAB 3WN5B 5DD1L 4TQEL 5A16B 4CDHA 1FAIH 2Q3AA 3KHOA 1P7KB 3PL6D 4L4TD 1MHEB 2VDKL 3VW3H 3GBMH 1JYNA 3GRWH 4KGJA 3AB0C 4K3DH 4QTIH 3LQZB 3WNMA 2EDOA 5ACZA 1TMCB 3OBAA 1IEBB 4S2SA 3S97C 3DVNA 3MA9L 5HHOD 1ZAGA 2OI9B 2CXKA 3T4AA 4JFZL 4U1LB 5HDBF 1Q8MA 1UC6A 4ZXBB 4P46C 1KIPB 3RP1A 4G8IA 1J8HA 1W0VA 1WTGT 2PYEA 3LKNA 1TCRA 3WNLA 3ARGB 4M1DL 4K8RL 5I8CB 3H7BA 1AGDA 3WKML 1WIUA 4UBDC 4NQCE 2VLJB 3VWJC 4OD2A 4BYHA 1Y6NR 4KROD 3L6FB 4OCMC 4OM0H 3KLAA 1MVUB 4L1HA 1PG7X 3QPQC 4JZJB 2XYCA 4BKLA 3I9GH 3V5DA 1OTTD 2JCCB 3BE1H 3FN3A 3GMNB 2MCPH 3MLUL 3PWVB 3EYQC 5HDBE 1HHGB 5DWUL 1AKJA 1CIDA 1ZEAH 3P73B 5EUKB 4WW2B 1G6RA 3WXVL 4AIZB 3T0EA 3IVKB 4TSAH 3RL1B 4H1LA 3T0VA 4CVXB 2C1PA 5CSBA 4M8VA 4HH9A 1HCVA 4DN3H 1SY6H 5KJRL 4AEFA 5EZIL 5TQ2L 4OLXH 3ARFD 2QKIA 3FCTA 3UEZA 5LXGH 1FVDA 1F42A 1DUYA 4NN7C 2YD2A 1K3IA 1BQHA 2ESVD 3GKZA 5F89A 4RGNE 5D5MB 4RAUB 4RAVB 2DQHH 3E6FB 5ADOL 1CDYA 1RU9H 4ZO7A 2X05A 2R1WB 3PJSA 2EKSA 2V17H 1NLBL 2BNQA 4Z6AT 1UQSB 3A6BH 4WWKD 1HILB 4UB0H 1DBAL 2VABB 4V2BA 3CU1A 1ZLWH 1LO5A 5CD5C 1M71A 2OR7A 4PJ8B 1P6FA 3TZVB 5EOCH 3V4VL 1T1XB 4PV8A 2OTWB 2FECL 4NIKB 5IMKA 3TCLB 3V0WH 3VI4F 1K6QL 5DJZB 1ERNA 3T2NL 1X4XA 3SE9L 1A2YB 4PLJD 4OZIA 1RHHB 3A67H 1CF8H 3RJDA 4PJ9A 2AEIT 2P5WE 3GK8L 5F7DA 1EFXB 4LGPB 4TUJA 2DQFB 5DHVA 4OCYL 4HBCL 4ODXB 4IRSB 5JZ7D 2O5XH 3RWJA 4OCWH 3Q3GA 4G6AD 3W9EA 1G7PB 2AJSH 4YXLL 3H3PH 5HY9B 5IG7B 1QSEA 1AO7D 4QXTA 5BCAA 3ARTA 1CD9B 1JPTL 1HH6A 3K4AA 4LLQB 4ZPTB 6CGTA 4PG2C 2Z31A 1AY1L 1EXUB 2HN7B 4JFXB 3DI2B 4J1UA 1G7QB 2OZ4H 3O6FB 1HNFA 3O3BB 4Z0BL 1X5AA 5DUPH 3M17B 4CJ1A 2CRIA 1I1AA 5MP6L 2Y36H 1PYWA 4Y16D 4NUJA 3T3PF 1RURH 1G0YR 3QULB 3MRRA 1G0XA 5DD3H 4X98B 4JE4B 3NH7H 3RDTD 1PG7W 3DX9B 2CKBL 2XG5A 1RZ8B 1NCBH 4M61A 1MF2L 3BW9A 4AEIH 4OGZA 4Y4FC 3JVGC 3VXSA 2VDNH 2GI7A 5E70A 4MB5A 3MQIA 1TVHA 3CC5B 2A6DB 5E2WH 1NJ9A 4U1KB 3UTTE 5TFSL 5JLZB 5C07D 3UTQA 3M8OH 1LHZA 1UJ3A 1BEYH 3L3GB 4WDIB 3U7WL 1KG0A 1Q0YH 1Z9SA 1FBIH 5DRXB 4KHXH 4OLZH 2BVPA 1CK0L 4HLZH 4ZOAA 4I18B 3I6KA 3P4OB 4HIIB 2OR9H 3KYOB 1ZSDB 2LV4A 1N8ZA 3TN0B 2EDRA 2UWEF 3X14B 4OCSL 4X6EB 2C9AA 5F3BA 2FL5B 5LCVL 5HBBA 1RULL 4JDTL 4YJZL 3K2UH 1KIQA 2W9DL 3ISWA 4XRCB 1QFUL 3WLWD 4GXVL 4D9RE 4R2GC 3JV5A 4JO2L 5I76A 5IBUB 4QRRA 3S98A 2FGWL 4RBPK 1KCRH 4Z7UE 1CI5A 12E8H 2OM5A 3BZFB 3JBG7 2XQYG 4M02A 4WFFE 4LCCC 3SE8H 3QUKB 5ICZB 2A1WL 1XR8A 4KZDH 1V3JA 4CW1A 4X83A 2VDMH 1NBZB 1EHAA 4NWTH 5GISL 1BECA 2WP3O 2WINB 1HHHB 3L5XL 1A7RH 1Q9OA 2JK5B 2RCSL 1AJ7H 5KVFL 5A2LH 3QWOB 4JZOA 3G6JF 1KIRB 3IJHA 3RY6C 1NANH 2GK0B 5J1SC 4OI7A 4P2QA 1OPGL 5D1ZA 3WMSA 2BY1A 3K7UA 1UG9A 5DFVD 2WBJD 3WE6B 5E4EC 1IAKB 3N0PB 1QSFB 2X7LA 5TF1H 4I3SH 3LN5B 2R2CA 3S35L 3R8QA 4ONOA 2ATPB 2NY5H 3W0WA 2HJKA 4LAJH 5IUSA 1CLZL 1CIUA 4TUKH 1HSAA 3HC3L 4MX7A 2YD6A 4G5ZL 4YEEA 1NSNL 5D6DA 4KFZC 2H32H 3TVMA 1JTOA 3NA9H 4IRJC 4E41E 3FTGA 2A9NH 3IDXH 5E7FA 5FKPB 1NCUA 2DMKA 4RX4D 3QEQB 4X6FB 1JZ4A 2AQ3A 1RUQH 2HTKD 4QRPA 4U1SA 3RWFB 4NQDB 4WEUD 3ZKXB 3RVXC 3OXRA 1JYXA 1B2WH 1QQDB 1WFTA 1CT8A 2V2WA 4ZNEA 3BPLC 5GSVA 5KS9B 5ELIA 1T04B 4ISVB 4R90L 3LSOB 1SBBA 5IWLC 3WNPA 2PR4L 1G1CA 1II4E 3T3MF 4M48H 4O2EA 4PJBB 4NKDB 1YEHL 3GSUB 4HS8H 3P4NA 1DLFH 1ZT1B 1UWEH 1KPRA 5HI5D 2EE2A 4HGKC 5HHMB 1L0XA 1OAYH 4X99A 5IHZB 3HE7B 3SY0B 3FQTB 5I1GH 5MENB 4NZDA 1X6NA 5F88A 3QNZA 4B41A 2DM7A 4N8VB 1OGAA 4GW1B 1SVZA 1AD9B 1LDPL 1D5IL 3DVGB 5SWZB 3T3ME 4HHAA 4G7YH 4QT5A 4ZAKC 3KXFA 3ARPA 4RA0C 4U05A 1BGXH 1IMHC 4OJFH 3V6FA 5EG6C 2ICEB 3BDBA 4PJAB 3ROLA 2IPTH 1WK0A 3ME0A 2XTJD 3F5WB 2OL3B 4OTXL 3T09A 5KTEL 2XY1A 4FFYH 5IJVA 3O11B 2IAMA 3NZHH 4PJGF 2NZ9D 1V3LA 1KJ2B 3DX8A 3HUJB 5KN5A 4FQXB 4V1DA 4XCFL 5EU4A 1QACA 4ZQKA 1P2CB 3IDGB 3G04B 3SKJL 2IGFH 3PHOA 5DJAA 4A2LA 4OIBA 4JM2C 3AU1A 2QR0A 5BJTA 1CQKA 4TSBH 4FABH 3VG9B 1MCOH 3CFDB 3LKOB 4GLRH 4HXAH 4M6OH 5FYJU 3X3GL 3CFBB 3QDGD 3QG7L 5JW5B 1P4BH 1U93A 3MRMA 2R0WL 4HCRL 2WUBL 3IJYA 5I1EL 1RFDH 5JHDE 3SHSA 3V8CA 1T1WA 1M6OB 4PY8I 3KYNB 2OJEA 1H3PL 4WV1A 5B22A 4J6RH 1IAMA 1VKXA 2DS4A 1JNJA 4HGMA 3NMEA 4PR5A 4HXBL 5BRZE 4KUZH 3LS4H 1NC2B 3C09B 1JNHA 2AXFB 1FNSL 3O8XD 1KB5B 1DEEA 1I7TA 5DVKA