3V95A

Crystal structure of monoclonal human anti-rhesus d fc and igg1 t125(yb2/0) in the presence of edta
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
212
structure length
212
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Effect of zinc on human IgG1 and its Fc gamma R interactions.
pubmed rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
total genus 31
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v95A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v95A01
5DD5H 3GUTA 1GGIL 2GAZA 3N1FC 4L29A 3X17A 3DTXB 1UACL 4DGIH 1QSVA 4NM4L 3MV9D 4LCWB 2EYSA 3BFOA 4BFBD 2UY6A 4YK4C 1WBZB 1B2WL 2VL5A 5I71C 4MNQA 5E08L 3V5HA 2MWCA 2G60H 1MI5D 1NBVH 4Z77A 1EAPA 3UJTL 1I9JL 1L0XA 3SGEH 5CWSB 1F45A 1OVZA 5FHBH 4PR5B 1HHIA 5IMMA 3HR5A 1AP2A 2B2XL 3ILQC 4JCLA 3DI3B 4MAYB 5SX4I 4HGMA 1A9BA 4PTTB 2B0SH 1ZSDB 2C4XA 2NY4D 3SJVE 1MCDA 2FO1A 3MACL 4GFTB 5DEFB 4FFZH 3ZL4L 4ODSL 4QHLB 3WJLC 2VDOL 3AU1B 3EFDL 3UYRH 2X9XA 5FYLE 4PRBB 4Z18A 3ZYIA 5IVNA 1BVKB 4JZJB 4PJ8C 1OHQA 1XF2A 1O7SA 3FB7A 3MJGX 3NIDE 1ZGLA 5DI8B 1XCQA 5E4EC 4PJ7B 4HBCL 4OCXL 4BQ8A 5T1KD 3DO7A 3SGKA 3U0TA 1MVUA 2YUZA 1G84A 3QPQD 4OB5L 3AXLB 4QNPE 5HHXL 1KTKE 4HBQA 5ICZB 5JR1L 5K9KA 4NYLB 1WWAX 4PJFB 1GIGL 3G08A 5JLZA 4R7DA 3QIBC 1QACA 4AT6A 4Z76A 4NRYB 4MNGB 4JPIA 3MBXL 1JK8A 3BMVA 2HLFD 4NCDA 5I76B 4NKQB 1U8LA 3PG2A 3HRZA 3BZEB 4JREC 4FZ8L 1LDSA 3V95A 2ZUXA 1RSFA 1KJ3H 4FOMA 5E5MB 5FCSH 4NUJB 4HUKB 2IGFH 2VB5A 1G6RB 3PWUA 3KR3H 5C08B 4LAJH 1F4YL 3LD8C 5K93A 1OAUH 1WZLA 4JHAL 4WHTA 3V8OA 1E4WH 5EBMB 3UX9B 4F57H 1R5WA 3LH2H 1WTGT 2Y25A 1JZ3A 5C0JA 5IROA 4H1LB 3V4PH 3DIFA 4MXWH 5EORH 3C6LD 3GB7A 4LPVA 1XIWD 1DBJL 4P49A 2ADFL 5C0FB 2ZCLH 3S5LG 1OLZA 4M7LT 3NH7H 3OHXB 2EIBA 4K71C 5IB2A 3IDNB 1H0DB 4I48B 2G9HA 1MCIA 1KT2B 1YEIL 4K55A 1MRDL 4X4ZA 1EEYA 4QWWD 2EDDA 5IVOA 3HAEA 5FUOH 3RHWF 3AM8A 1NBYB 4K94H 3OV6A 4BZ2L 4PRHA 2V5SA 5EU3A 5J1SC 2YN3A 1N64H 4QRRB 4QRUA 5IW6B 1VFOA 4N0RA 2ZUSA 1BVLB 1L6ZA 3PDOA 3AREA 4JFHE 5LG1A 4OIIH 5FO8B 5GGQH 5KSUB 5ENWA 4O02H 4YFLI 3M45A 4XCFH 3SJVD 4LDOB 2YA1A 5EIIB 3TBWA 4GG8A 2GCYA 4DKAA 1VKXB 4OZIB 3PIQA 1AHWB 4UV7H 4DK3A 1RZGB 1A1OB 5I8EA 3ELAT 5CGYD 2FR4A 1WFTA 1RUQH 3IJHA 2C7UA 3IS0X 3SCMB 5IHZA 1A6TA 1UXWA 4G6ML 5DJCB 4C56B 3BW9B 2HVJB 3MLWH 1R5WB 3QDME 4MJID 2EE9A 2WBJB 1RIHL 4HKBB 1X5YA 1P4IH 1NGXA 3DX9B 1IC5H 1FNAA 3T3ME 5JQHC 5GGRY 3PDDA 5CJQL 4K8RC 5C0CE 4CVZA 1ZAGA 3STZA 4QRUB 1Q38A 2VABA 2VQTA 4QRRA 1P7HL 1MFBH 1LD9B 3NH7L 2C3VA 1FSKC 5J6HB 3IFLH 2ZUUA 3AS1A 3E8UL 2BFVL 3NPSB 1YZZA 4WI6A 2NY3C 3WNMA 3ZKMD 1WGOA 5J4MA 5EZIH 4LSRL 2QTEA 3ARTA 4MAYD 3LKNB 2CIIA 1IM9D 3KXFA 4M7LL 1CFBA 2GSGB 4O2EB 4U7KA 3QIWB 4I48A 1MAMH 4YDVB 5D71H 3CVIH 3VD4A 3G04B 3ZT6A 1NMAL 3HG1D 2ITCA 3MRMA 1MWAL 4PJEA 3IJSB 5C0FA 5HVHC 2R1XB 4IRSA 3HLAA 2EH7L 2UWEA 4LSUH 5MHSE 4KHXH 1BD2B 2CKBH 4U1SB 5I18H 3T1WA 4TYUA 3K4DA 4OBRA 5JDSA 1T21B 2H41A 4NKDA 5E8EA 5M95B 4PJGA 2VLRE 5FEBA 3RVVD 3SDAD 2GJ6E 1WZKA 2R9HC 4U49A 5F7DA 1JUFA 1W0WA 5E6ID 3B83A 3CC5B 1NGZB 3RI5F 5HGHB 4ONOA 4WTZA 4QF1B 1HHHA 5I15L 1T4KA 3KYMA 2CLZA 3MJ8A 4HPYL 4XMLL 4LVOB 3HNSL 5KS9A 1AGBB 4PRPA 4P0DA 3OL2A 5LVEA 4XVJH 1YN6B 5FHBL 3RWDB 5CGTA 1A3RH 1JMXA 5HVWA 4WO4B 3VFWA 4Y2DD 1KB5H 4QOKA 2XG5A 1R3KA 1JPFB 5BZWA 1T4KB 4MNGA 4H5SA 4HS8L 1DQQB 4Z7WF 2AEWA 3GM8A 4XPTL 3TJEH 4QRPE 3WD5L 2X89D 2VISA 3QUZD 1NLDH 2R1WA 5A16A 5I74C 4XCCL 2EDFA 4JFEE 3VXUA 4NO0D 2DWEB 1BFVL 1CR9L 4TVPE 1F2QA 3WMSA 4MCZA 4Y19D 4MGXA 2Y5TA 4MQSB 1U8KA 4CRPA 1IAKB 2ZKHH 4KPHL 5IF0B 4ZAKA 1I8KA 1MQKL 5JOPE 4WO4D 2NLJA 3G5XA 3GHEH 3BKYH 1V7NH 4ZO6A 3SDCB 3V0WH 3D69B 3NAAH 2H26B 4KZDH 3KWWA 5D2LE 3X3FL 4A6YL 2A6IB 2JK5A 4PRAB 1CQKA 3VFNB 3ZTJG 4Z95L 4RMVA 2OXGA 4XNMB 2P8LB 1F02I 4NFCA 3NPSC 5LBSH 2Y1VA 4M6AA 3JV0A 4Z78A 4ZTOH 1DBJH 4ERSH 1G6RL 3K0WA 2XN9A 2AEPH 3DBXB 4E9LA 1ETZA 5F3BA 2CLZB 3MJ8B 4XVJL 5I2IB 5FM8A 5C6TH 2VABB 4U1GB 1NGZA 3H2WA 4XNQB 1WFOA 2H1PH 4DGVL 3QA3B 4MA7L 4PJ8B 2D9QB 4Y4FA 5I1EL 2ZG3A 4HPOL 2OJZH 1MCOH 3H0TB 5GJTL 5CZKA 4K9EC 3JVGC 1ZA6A 1Z9OA 5DRXA 5F1OB 3SBWA 4XMPL 3STBA 5D7IE 4H8WL 1QFWL 2DTSA 3S3SA 2R2HB 3TJEL 3OB0K 1FZKA 4JHWL 1JBJA 4NZTH 4G9DB 3IJHB 2UVFA 4S1SL 2ATPB 2MPAL 4XCFL 3WNNA 3HC3H 2YOCA 3ARBB 1FBIL 4Q74A 3RIFF 4Y5YA 1DDHB 1Z0NA 4JHBA 4AEHH 3C5ZD 1UH3A 3CUPB 3EGSA 1WAAE 3W39B 1IKNA 3DX9A 3QUKA 1IAKA 2AV7B 3ALXA 1JHKL 3LN5B 3VG9C 2IG2L 2YD2A 5HDOA 3TBVA 1LO3L 5C0BA 2OBGA 3RUGE 1UJ3C 5CKAA 3WJJA 4QHKI 4M9OA 5HGGS 4BQCA 2BVPA 1JYVA 5D6DA 3ARFC 1HH9B 2R4RH 5JO5B 4V1DE 4ZPVA 3PE9A 5KVFH 2MFNA 5IVXB 4GW1B 4POZD 4ZTOL 4L8DA 5T3ZH 1EEYB 5KSBE 3TA3D 1MCEA 1NANI 1XCTA 1CF8H 2P45B 3VD9A 5C0RH 4Z7WB 1F4WL 1GHFH 4RAVB 1BZ9A 2X4TB 4F7EA 5ERWB 3QFDA 3FFCD 1RZ8B 5I8CA 3PABA 2YWZA 3H3KA 5FKAA 1OWRM 3MYZA 2ED8A 5CILL 4ENED 1F4HA 5JIIA 4XP5H 4GUPA 2YRPA 2B20A 5L2KD 1KG0B 1PZ5A 2YMXH 3CVHH 3ET9F 5GS1A 3TCLA 3DX8A 3SDCC 4G8FB 1J1XL 1TNMA 5DJ2A 4X4MA 4OLVL 2F53E 4P59L 1LEIB 3BKJH 3T2NH 2P7TB 1DANU 2CKBL 3V6OE 3TBTA 4Y5YB 3WLWD 1R3LB 4I3SH 1UT9A 2QJDA 1HSBA 1KLFA 1WCBA 2AQ2A 4WY7L 3PWJA 5SWSD 4R4ND 2AXFB 4Z0BL 3OBAA 3OKYA 1CXFA 3T8XB 2YD1A 2R4SH 2H45A 3MROA 2IQAB 5F9WC 2YPVL 5FV2A 2VLJD 5GRXG 4DN4L 3WN5B 3D5OF 5DA4A 1U92B 1RZKC 3OZ9H 5JW5A 1IKFH 1MCCA 4NN7B 4UIMB 5I2IA 1JN6B 4WHDA 5TE4L 1GGCH 3CXDH 3ULUD 4CW1A 3MV9B 4NFDA 4WI7A 4JRXB 4ZUUB 3BH9A 1RMFL 3MJ9L 3HCVA 2DQCL 1NC2D 1TZGH 3GGWB 1KELL 3CVHL 3VCLA 3IRZA 5C2BL 1BECA 3RJQB 3U4BL 2HVJA 3CMOH 5IB4B 3VI3E 4NJ9H 1ITCA 4MNQE 1CDGA 1J0HA 3H7LA 5KSAD 1TJGL 3O2DL 5KVGL 4M5ZL 4CDGC 1MFNA 1YN7A 5DJAB 1NLBH 3LKOB 5GHWH 4HJGA 2CKBA 4CAGA 3ULVF 4YX2H 2VDNH 2OK0H 3LV3B 3M8OH 5BJTB 3IGAB 1JPGA 4N1HB 1DQLH 3X11A 4YHKH 4K3HA 2PR4H 2UZIH 1I1AC 4K9EL 4X6DE 1UQSA 2XWBA 2G75A 5ESQA 4MA3A 2DQUL 3G6JF 4M61A 3RDTB 5L2JA 1YDPB 3MGOA 4HJGB 4HWBA 3GSUB 5GS3A 3ARDA 2B1AL 1LK3L 3JWDL 3REVA 2HKHH 3T3PE 4PRHE 3BGMA 2WUCL 3U7AA 5M7QA 1J12A 5INDA 1YEJL 4OZIF 4PRIE 3PGCB 2D7PA 2ICWI 2WIIB 4ALAH 1RFDL 2YZ8A 9CGTA 3SGDH 3QI9A 3FQRB 3EYOB 4RGNB 4WUUB 2IMMA 4X83A 3BKJL 4ZUUA 3BGMB 3MLPA 3IFOA 5J0BA 5FGCE 5I1JH 4PTUA 4JKPL 5BVPL 2DBLH 2J8UA 1G1YA 3BP4B 2Q6WA 1EA9C 5T3XD 1KPUA 3QQ9D 1CDHA 1FNFA 1RZIA 3QUXC 2OJEB 4PD4K 2P5WB 2YA2A 4L3EB 2R4SL 2AJZB 4DZBB 5ACZB 1N6QL 3EDDA 2ERJC 5GIRA 1D7FA 3MRPB 1FDLL 3C60D 5EU4B 3HE7D 4WVRA 3WS6A 1B88A 1ZVHA 2HFEA 3MZGB 3S88H 1S3KL 1U36A 5IKCA 4IRSC 4YHKL 1Q9OA 2X4OB 3HKFA 4KHTL 2ADIA 1BJ1J 3LEYH 4OGYH 5IVZA 1TJIL 2F19H 3P0VH 4UV4L 1PVHA 1YJDH 3Q3GB 1YEEH 1AC6A 2EEAA 2JB5L 3QYCA 3L95B 4CN1A 1MSPA 3VGAC 2BDNH 3F7PC 1QPXA 2MKLC 1ZLUK 3MLUH 4G8FA 4OLEA 3U30C 3DMMC 3PGFH 3SE4C 5L9DL 4HSQA 4DFHA 3PV7A 2D7QA 5FDWA 2XZAH 1VADA 4NQCA 1NGXB 2KKQA 4IOIA 1ZHKB 2WBKA 3KR3L 3VWKA 2H6PA 3EYQC 5CD3B 5JPNB 4YHOH 4OD2A 1A6TB 1RZ8A 4LARH 4L3CA 1KEML 1FGNL 3RTQC 4LLVB 3SE3A 5BVJA 1VGKB 4RSVA 2IBBA 4FTVE 2AJVH 4RFNC 3SGJC 1T0NB 3BP6A 3HPLA 3IU4L 1TVHA 1YY8A 3P9MB 3VG0H 2OR9H 3R0NA 4KV5E 3QEGH 4S10A 3L5XL 3SJVA 4OZFH 1GAFH 2FATH 4KJWD 5IB3B 1D9KD 3ARXA 3O81A 1LK3H 3KJ4B 4XMLH 3PP3K 3OR6A 4L4JA 3FO1B 4HHAA 3VXRE 2EYRB 1P4BL 3MRLB 1CFNA 3WUWB 1A1MA 4TOYH 5EU6B 1CL7H 3V8CA 3VXME 1NBVL 3ZHDA 1RPQA 3AREC 4V1DB 4G8EB 3MCKB 2XTJB 5E6IA 5EU4A 5E1AA 5JW3H 4DN3H 4Z7NE 3AGVA 1QBAA 3BDYL 4R0LC 2ATPA 2P5WA 4L3EA 3UTPE 4Y19B 4Y4HA 4L3CB 5I73B 3O6LL 4HH9B 4ONFL 5CEZL 4JFEA 3MRJB 4G6FD 4NO0B 4OIIL 1T03H 1Z5LB 1NCWH 2XZAL 1U8MA 4QRRD 3MV7B 1VFMA 4ELMB 3O3DB 5F9JA 3BDBA 5GGTA 3OJDA 2IPTL 4X6FB 3QO0A 3ARUA 3U46A 3BISA 1BWWA 3GRWH 4LNVA 1ZLSH 1KXVC 4XNYL 4O5LH 3LDBB 4GMTL 4HF5H 3MCLL 3N1MC 3DYOA 1H3VA 3C5ZC 5CIPB 2XN9B 4FQLH 4Z9KB 2UYLB 3DRTA 2X10A 5E2VH 4P23C 1CD0A 2MJWA 4X8JB 1RIUL 1NGYB 2YKLH 4WU7A 5EO0A 5E4IA 2CIKB 1I3GH 3MV01 1DFBL 3VH8G 1A6PA 5CJOH 1YNKH 4MJ6A 4DGVH 2GQHA 3CK0L 3OB0H 4DZ8B 3CFKB 3DETD 3QR2A 1B6DA 3DMMB 3HUJF 4L8SC 5ALCL 1LP9E 3ARGA 2VXVL 5F21B 1OQOA 1X7QA 1AO7B 5J9PA 1TZIA 1MF2L 4P4RA 3NIFE 4LHUD 5IQ9B 2HTKC 1ACYL 3VXUB 4ZUWB 4C55A 3WFDH 5K9KB 5E9DD 2PCPA 3C6SA 4NZTL 3QCVL 1U8PB 2C3WA 4PJ7F 2VZTA 4HMCA 4O4YH 1FYHB 1FIGH 5DUBA 2EH7H 4JM4L 3NPZB 4IIQA 5HVFB 5F3BB 2F5BH 4XCNA 3L3HA 4XC1H 3ZDXF 5DRZA 4MD0A 1QFHA 1AI1L 4Q6YA 5K9OA 1CGVA 3T4YA 2BVOB 3FFDB 2B2XH 1NJ9A 4ELMA 2W07A 1SJEB 1YPZA 4LFHG 1AQKH 2F74A 1OM3H 1TCRB 4LRIC 3MNWB 1A6AB 1X6LA 2CLVA 2BNQB 3ORJA 4NKMA 3IFPA 5I9QB 4JFPB 2XWBB 2Z9TA 4MD0B 4HLZG 2DM2A 5SV4A 5D1QC 1QLFB 5JA8B 4KK6C 1A7QH 1ZLVK 4JZOB 2CK0L 3EOTL 1YEDB 4MCYA 3O8XC 2XN9E 2IQ9H 3SPVA 4Y8DC 1NUNB 3WHXA 5DJ6B 3G6JA 1L9MA 4ODWB 3B9VA 1CTNA 3KPLA 4J23A 4R4BB 4QXTB 3WIIL 2JJWA 3I75A 1OAZL 3GJEB 1KIUA 3PGFL 3FO1A 4PLNC 3LPGA 4BK4A 4UILH 4YNYB 1H3PH 1FJ1B 4OLYL 3WS3B 1FG2B 2O5YH 1K6QH 3CFBA 3NOIA 2C4FU 2EH8L 4EI6A 5C7XH 5AUMB 5H35A 4NN5C 4KRPD 1VPOL 4KJQD 1A3LH 2KBGA 3BKMH 4NOBA 4AIXA 4Q6IB 1CN4A 2HFTA 4KQ3H 5E9DB 1EVTC 4J8RB 2ZCKL 2EIZA 1CG9B 2XY1A 3PDGA 3DXAD 1BZ7A 2CRMA 2OTPA 1BFTA 1EV2E 1UM4H 1S9YB 1KGCE 3OR6B 1S8DA 3D3VA 3KYOB 4E41E 1J05B 3V4UL 2X4NA 4Z7WA 4UTAL 4ZQKA 3VXQA 4M6NH 5TQ2H 1YY8B 4H1LG 3VFGL 4OD3H 5IV2B 2O61B 1N6VA 4V1DA 1RULL 1I7RB 2WLYA 3G6AA 3E8UH 1QHPA 5CGYC 3EO9L 2PETA 1I85C 1T3FB 2VOTA 4GG6F 1FFRA 5A2KH 3V79C 2OP4H 4YHYB 1VGEL 1JL8A 1IQWH 1HCFX 3EFFA 3UPRA 4Q6IA 3KXFB 5KVEL 3VH8A 2CMRH 1FYTA 4X9IA 2Z91B 4ZFOA 2DMBA 4G8EA 1MY5A 1CLZH 4R7NA 2P1YA 5FHAL 4DZBA 4WI5A 3FO9B 1BIHA 1JYXA 3MV7E 4UQ3A 4J4PA 4JO3L 3U4EB 4DUXA 4XX1E 4QHUB 5IM7A 5F1IA 3GNMH 3B9KA 4RAUA 5DMJB 4OB5H 3VD3A 1YMMA 4O51A 5CINH 5B8CA 2GFBA 3PQYB 3UJTH 1JGVH 1ZA6B 2NR6D 2PR4L 4YHZH 4QRPA 5HD8D 1YECL 3KPLB 5E2VL 2A83B 4QHMB 5C1MB 1JNLH 1EFXA 1DE4B 2J2ZA 3RU8H 5HI4D 2X44D 5DEGB 2QQNH 1OF2B 4M6NL 1NMBH 2E6QA 5FYJU 2HT2D 3QQ3A 1B0RB 5L8KB 3FQXA 3PL6A 4G6JH 4X9FA 4QYOA 4R90H 2X4RB 4M7JH 2W0PA 4HKXA 1DQMH 3EOBA 2QSCL 4IOIB 4I18A 3FT2A 4JM2A 5JPMB 2WP3T 3HC3L 3G5VB 4HBCH 4RFNB 1JI1A 1U93A 2FIKA 3DGGA 3V0AC 5KS9F 4LF3A 4JQXC 1KV3A 1A5FH 4P2RD 4IEFB 2A6DA 5K9JH 1BBJB 1FVDB 3P73B 4EDWH 2F54E 1UCBL 4KMLB 2D9CA 2FJFB 5C0DA 1U8OA 5GJSL 4YXHL 3DO3A 4GRLA 2X4OA 5FECA 1CDYA 5HYJA 1IL1A 1HZHL 2DQHL 1JK8B 4PJ5E 5D6CB 3HNSH 4OCYL 4PUBL 2HN7B 3TYGH 3U7YH 4BFEA 2FBOJ 4L4TA 2JELL 4XCNB 4WO4C 2VLJB 1XGQA 5EH1A 1B4JH 3WNOA 2ORBH 4NO3B 5TFSL 3FB6A 2PYEB 3DX7A 4Z7VA 1KJ2H 1M71A 3QT2A 4W81A 1HEZB 5JXED 4TVPH 3B6SA 4FQ2H 2X9YA 3DVNA 2CKBB 4RIRA 4EDXB 2YSSA 1E6JH 1E4XL 4EVNA 1NAMH 3OKLB 4M02A 2Q8AH 2K1MA 1BJ1H 1I8LC 2YN5A 1D9KB 3DX7B 3LH2L 4WEBH 5H2BA 1I7TB 2XWTA 4Z0XA 1CLZL 1QP1A 4HUVB 3LEXB 2DQTL 1P4LA 4XXDA 4B5EA 3AFLA 3P4OB 1KCUL 3IU3B 4FQIL 4BUGA 3ZE0E 5BZDA 3BPOB 4PJIF 4RGMC 3EYUL 1ZEAL 1C5BH 5DURD 1A3LL 1NSNL 2KQNA 5INCB 4Y16D 2BXYA 3EW3B 4ZXBA 5FK9B 4PJ9B 5SWZB 3DRTB 4NQDD 1NC4D 3CFDA 4YO0B 4K3GA 5DFVC 3VE0B 5IEKA 2EC9T 5F7NC 5SX4H 3BIAX 5F6HI 3GSNA 4F33B 4JFQA 3O4LB 1A6ZB 3O6ML 1JF1A 3SY0B 2KZ1B 2A2QT 1TPXB 5DD3H 2P8PB 4OSUH 3RWCB 3GJFK 3OX8A 3CJJA 5KVDL 4ZYKB 2I5YH 4K8RH 4LIQL 1DBML 5ECJE 4ODXB 3NIDF 1FFNA 1JRHL 5T1LB 4GQ9H 1UWEL 3I3DA 1K4CA 1ZHLB 4CVXA 5EO9B 1MHPL 1DLFL 5DJXA 2CRIA 4N0FA 5GGTH 2B5IB 3HPLB 3W9DB 4LL9A 4KVNL 1AY1L 4FQCL 3FRPA 4ALAL 3O9WD 4KJYA 2VWEE 3D85A 1TJHL 1WBYB 4TSAH 2VQ1A 3O6FC 4NQCE 1SY6L 5E2UL 2VNCA 1V3MA 5TPWH 4ZUVB 5EUOE 4KTEH 2EKSB 1Z6JT 4G5ZL 2VL5B 2B4CC 3QIWA 3IDGB 5DMKA 3U48A 4XPHH 5F7LB 3KPOB 4OFYD 1Q72H 5IVXF 5L6YL 2NXYC 3P30L 4GRWH 1A6WH 2GITA 2PO6C 4PRHB 1BZQK 5D1ZB 3E2HC 3WFEL 3QAZB 1HH9A 1ZANH 4U0QB 4IDLA 4HS3A 1TTUA 4M1CD 1KNOB 1DUYA 1K8IB 2C3HA 4E0RB 4MQ7A 3ZHKA 5HVHB 3KLHC 1H3XA 1PX4A 1WTLA 4MNGE 3KPNA 4KAQH 4LKXB 5IFHH 2A74B 2J1KA 4WUUE 3F7VB 1UVQA 1ZLWH 3MV8D 1DSFH 2XA8H 1KLUB 1UM5H 3QWOB 3U36B 1RI8A 2L4OA 4NC1E 1OSZB 4RDQF 5BS0A 5EC2B 2BP3A 3QNXA 4JFFD 1BQHA 3IETA 3PNWA 3LSOA 3V4VL 3NGBC 2AV7A 5B3JE 3IDYC 5C9JB 3BESR 5HHVH 3HMXH 1LHZA 4CU7A 1LEKB 2ZKHL 4KPHH 5T3ZE 4NWTH 2BSTB 3U9PH 4LHUA 4O00A 4YHPB 3EYOA 2VXTL 1FDLH 2EC8A 2BZDA 4Z7UF 3L95A 5HYFA 2R1YB 4ELMF 4L8CA 2EXWD 4NZUL 3UTTA 4PJAA 3BPCA 5SWQA 4JVUA 3T4AA 1Q0YL 3VXMD 1YJDL 4NN7C 4U7SA 4Z78B 1S7WB 4YDKL 4LPXA 2WW8A 3IJYB 1TXKA 1RZJC 4JZNB 3ZDYF 5BRZD 3WHXB 4E5XB 4LU5L 5DZLA 1XGTA 2D0FA 2VC2L 1DQQA 2G75B 3ZYZA 3MREA 3WO3B 1QSFE 3QI9B 3BGFC 4K2UH 3QUML 1KJ2B 5IR1B 2IAMD 4ZG1A 5IBLD 3D2UA 5DLMH 3T0EB 3TPUA 3P40A 3O8XD 3RWDA 4LIQE 4LOUD 1T0PB 3ILQD 2WUCH 2F74B 5F6IC 5EOQH 4WEBL 1PKQA 2GTZA 1R24B 2AJVL 4M6MH 3RP1A 3O4OB 2V2TA 1EBPA 3SE9H 4WCYH 3HNTH 3K74B 4NKMB 3DV4A 5DRZB 1S7SB 1F58L 2XQBH 3CIQA 3ULSB 3OJVC 4LKCB 3VGGA 3AU1A 3HI6H 4U1HB 4FQQA 1JF1B 3UJIH 3TC9A 5D7JA 4UT7H 4JFQB 3BZFA 3WE6A 3LRSA 2A6JA 3BRFA 3MGTA 1XGQB 4IRJC 2Q76A 1BM3L 3UTSD 3LPFA 1KYOJ 4NRYA 5DR5H 4GBXD 5D7SH 3MRQA 5ADPL 2C1PB 4PG9B 5C0GB 4HK0B 2J8UF 1C8PA 3I02A 1QFWM 5C2BH 4IM8A 4P9HL 2J7LA 5AD0A 4OGYL 3GSNL 2WBJD 4S2SA 4OZHF 2R2BA 2NY0D 1JWMB 3NFSL 1AXSB 5B38B 1OGAB 3D48R 4X5XB 2CGRL 4Z7UB 2HJFA 1G7QA 3X3GL 3HNVH 5GHWL 2UVEA 2Y23A 4OF5A 2YD4A 4QF1A 5GXBB 5EIQA 1GZQA 5DJ8B 5IMKA 4F57L 2AI0H 5TF0A 3B3IA 3OAZK 4HIJA 3A6BL 4NSKB 3TV3L 1IAOA 1NL0L 1B0GB 2QQKL 2RHEA 2FIRT 1IEHA 2N56A 4OBSA 4UTBH 4AH2B 2EDNA 5MEOA 1BQHB 3PHOA 3VFMB 4RX4A 2GSIB 2X4UA 3C08H 2DQJL 2LAAA 1S7QA 4I1NB 1G7IB 5C0AB 5A40E 5KSVA 4GUPB 1HH6A 4IRSB 3FO2A 3H9ZA 3LKQA 2DQGL 3JWDC 1J88A 3LN4B 1LP9B 4BH7A 2YXFA 3QFDB 2WBJC 2GJJA 4RAHA 3VFVA 3BSZH 4YK4B 4ZS6D 4AQOA 4EN3C 5HHPA 2IPKB 4G8GA 2Z92A 1A2YA 1IZJA 4XP4H 3KNBB 1FZMA 5DQJB 4WW2A 5E56A 3CXHK 1PZ5B 5DR5L 3P3YA 3VMPA 4QRPD 5C09A 3DVIA 3UC0L 4G6KL 1PEZA 3WNLA 3DGGB 1R5IA 3BZ4A 4XP6L 3CPLB 4HHAB 3UBXI 1W8OA 3QG7L 4G8GE 2DQCH 4Y5YC 1HINL 1FYTB 3C8DA 4MS8C 1W0VA 1IKNC 2NY5L 4CMMB 1JRHI 5KSBA 5GPRA 4PRPE 4F7PA 3LKQB 3VA6A 3FFCB 3ZT7A 3U2SB 5JO5A 4S0SD 5CGMA 1NGPL 3WKML 5JZ7D 3S4SA 2XTJE 1QYGH 3QWOA 3U36A 1GC1H 4GG6B 4RWYL 3L7FA 1RZGA 3CLEL 4XT1C 5IV2A 2MQ0A 2FX8L 5F7YC 3RUGA 3SKOB 1FE8H 5DRXB 1I9RH 1FFPB 2OMNA 4R3SA 5FM5M 3QUZA 2DIAA 3RGVB 4NHCL 4C57C 2IADA 3PWVB 1IAIM 3QXWA 5L8LB 2H32B 3WNKA 1DP0A 5C07E 1DUYB 4LSPL 2SEBB 3BZ4B 1GC1C 1T1ZA 5HYJD 4HLJA 2DQDL 3QEQB 5DDHB 4UAOB 1HYSC 1QSZA 4ZPTB 5J7CC 1NCUA 4N5ED 4NM8L 3GMLA 1WK0A 3UAJD 4HWBH 1YMMD 4GAJH 1KACB 2JCCB 3GK8L 5BV7L 3D0VA 4FTVB 3Q5OA 3QHZL 3CFDB 3GMQA 4U1LA 3O6KH 5TE7L 2AJUL 2J88H 4X7EC 3QXDB 5GGUA 5DJYB 5HHVL 2LU4A 2E27H 5DD1H 5LQBL 3QAZC 1OAYL 4EIGB 1H8SA 1HXMB 1F58H 2CJUL 1OAQH 3FB8A 5HHOE 4U1HA 3QRFM 1D5ZA 5DGQA 2ZPKL 3H9SD 3IXAB 1MCQA 1VEOA 1X5HA 1H5BC 2ESVD 3DV4B 3KHOA 4YO0A 3WO4C 1GZQB 4X80H 3PWLB 4ODHL 1EIBA 2LVEA 1X44A 2ILLA 3DECA 5HBBA 3NN8A 1QBML 1ZHBA 3BO8B 3O4LE 5CCKL 4L1HA 3FO2B 1AH1A 4I2XB 4P2RA 1SJEA 4MSWA 1O0VA 3VDBA 4JY6B 4U6HA 2W1NA 2C26A 1E6OL 4LQFH 3WXVH 1T2QL 5FUCC 3SDCD 4S2SB 3QJHA 2AEQH 3QHFH 1QO3A 1ZMYA 5CEYA 4RISL 1WWWX 4WHTB 2IEPA 2WQRA 2C3XA 3FB7B 2DS4A 3SGJA 2RAMA 5I1IH 5D8JH 4RZCB 4KROD 3QZWG 5FUCE 5GRJL 3T08A 5DC4B 3GRWL 4R4BA 3OG6B 5DJ6A 4S1QL 2YSSB 1AXSA 2FEDD 5B38A 3QRGH 1SY6H 5E2UH 4ODUA 5GS2D 5DD5L 2ZSWA 2R2BB 4PB0L 2DM3A 4U6VH 5D96B 4D0BA 1JTOA 1QLFA 1HHIB 1HHHB 3H9SB 3HLAB 1WEJL 4BSVA 1ZWIA 2DF3A 1NCNA 1A7RL 1FAIL 4XVUD 2XTJD 5IMLB 5CJOL 1Y18B 4JDZA 5IEHA 3CFJA 1T83C 3UDWC 2G5RA 1FO0H 4KKCC 1CTOA 5D1QB 1XR8B 5C9JA 1A6WL 4PJGB 5DMYA 4P5MA 3D85D 3HCVB 3ALPA 1ADQH 1DBAL 2V5YA 3S98A 2B1HL 1U3HB 2QKIA 4HKJB 5I1EH 1A9BB 4PTTA 1MELA 5D4QA 1PX3A 4MWFB 3TH3T 2LFGA 1KIRB 3GM0A 4HUVA 4PR5A 3UTOA 5HVGB 2EDWA 2R8SH 3KGRA 5E2WH 1E4KA 4NZJA 4HD9A 3BX7C 3PWLA 3OGOE 3BIBX 1DVFC 1ITBB 1NC4A 3I84A 2A74A 2BSSB 4JZNA 1WBZA 5IBUB 1YNLL 3FTGB 4KI5D 4N8PA 2GYSA 4LLAA 1NEUA 5BS0E 4JFEB 3V4VH 1KB9K 3U4EA 5LKNA 1G7MB 2R23B 3V6OC 3LY6A 1KCUH 2IPTH 3EYVA 1KPVB 4WI2A 1JNNL 4R9HA 5E6IB 3TBYB 3VH8B 2DQIH 5ILTH 3BAEH 3EFFB 1P4BH 3O2WL 4G9FB 3SDXA 4PJ5D 5FYJL 4B0MM 4N8VG 4PLJD 3BW9A 3TVMA 1UZ6E 1GIGH 1ZGLM 1A8JH 1KG0A 3A67L 1PEWA 2GUOB 2XXMB 3K4ZA 1FV1A 4K7PY 2VC2H 1T04B 5HDQH 3GUTB 3BP6B 4CVZB 1A2YB 3UPCA 5H94A 1QSEB 4IIQC 1L7TH 2WQ8A 1LDPH 5EB9A 3MSPA 4PRID 3C09B 1CDUA 4LSUL 1Z5LA 4I0PC 2CXKA 5I1KL 5IHZB 1QA9B 3W0WD 5ID0A 5IBLC 3NTCH 4P2QB 1WIOA 1G7PA 1P6AB 2X4UB 1DUZB 3ULVC 4RGNE 3F7VA 4X6DA 2FJHB 3M17B 3V6ZB 3ARDD 4LLYA 3IDNA 4OV5A 5J1AB 1I3RA 5T33H 2VUYA 4OI9A 2GEEA 3WIHA 3W81A 4FZ8H 5LCVH 1I85A 1YPZE 4UNUA 1TQBC 3WNPA 1OP3K 4Z8FH 4Z7VF 3RVVC 5J12B 4U3XA 4DQOH 4DN4H 1EH9A 2YC1A 3BPNC 3KNBA 4RBPK 1KPVA 5DQJA 1T1WA 2XKNA 1CD8A 1D3CA 1LP9F 4G8IA 3LD8B 4TUKL 4JY4B 4F2MB 1QBMH 3VI3F 4ZSOA 4KI5C 3VE0A 2OR8A 3PWUB 1TVBA 5F1SA 5C08A 3IKCA 4JFDB 4JY5L 4EN3D 2ZUVA 5F7MC 4F15C 1FVEA 2Q7YA 4BUHA 3KPRA 3OKOA 5EDXA 2VSCA 3H0TA 4XNZC 3L3IB 4QRSA 3V52L 4CVWA 4CN4A 3T3MF 3GMOB 1QFWH 3FN0H 1MCHA 3RWHB 1JV5A 5FYKL 4X7SL 4XZUB 3HPJA 1K2DB 5F7EH 5FKPA 5IP4A 5CP7B 1AO7D 2P8LA 3SQOH 4I3GA 1U9KA 3W11C 4PJHB 2ED9A 2VXUL 1Y18A 3T2OA 5IEHB 4YAQB 3U7WH 1MCLA 1NGWB 3MUZ1 4I77L 4U0RC 4DUWA 4NYLA 2DBLL 5EBWB 3PP4L 3NZHH 1A6VH 5FDYA 1KCVL 4HZLA 2P8PA 3MZTA 1KJVB 4XC3H 2XFXB 5DJZA 2BVQB 3CFCL 2XKSA 4LCCA 3K80A 2YEZB 3PGDA 3D69A 3VFOA 4ZFFA 1FNHA 4PJ7A 4JFOB 1ZT7A 1IT9H 5HTSA 4M8QB 4Q0XH 1I7TA 4OD1L 2FHCA 1O5DT 1DQML 2DL9A 4LASL 4TOYL 1OARL 3FCTB 3RNKA 2D0GA 3LRHA 4D9LL 4X7TA 1CGSH 5C86A 2VH5H 5DJZB 5JLZB 1C08A 3RVWC 2GIYA 5LGHH 2F9BT 3AXLA 5ICZA 1T7ZA 3HFML 4PJDB 2W65B 5D1XB 4F3FB 2AVGA 5ISZE 3KPQB 4JANB 5MI0C 5FO7B 4LCWE 3U1SL 1MRFH 1NUDA 2OQJB 5IMMB 2A6DB 1MHHB 3DSNA 5MERB 4JB9H 4M3JA 1NLDL 1A9EA 3OKKA 43CAB 4W68A 1NCDL 3MRFB 4PGBA 1NSNH 4ZNCD 3IVKB 2X4QB 2NXZC 3RVTD 2NY4B 2DDQH 5AWNH 4JM2B 5JPMA 4APQD 2BVQA 4LCCB 25C8H 1WSST 1RURH 1X5FA 3G9VA 4MJ6B 3SKJH 1X4YA 2KZWA 3QUMB 5CLWA 3MRCB 4Y5VA 2NY1D 3DTXA 4ZOBA 5IB5A 4GKOA 4TRPH 3RNKB 1Q0YH 1TPXC 5EU5A 4XVSL 3T0EA 4E41D 4NO3A 1EX0A 2ARJQ 1G0YR 4OAWB 2A6KA 1MFCL 5C0IB 4J2XA 1XH3A 1E4XH 2NCMA 3FB8B 5E8EB 2AXFA 4QHMA 4XBEL 5C3LD 1L6XA 5E7FA 1TJIH 5C07B 3KPSE 2YD7A 1JNLL 5IK3A 4LSQL 2OTUB 3BQUC 4XNZB 3B2UD 1DCLA 1KF9B 5I16A 1OTUC 1NAKL 4MZ2A 4ZOCA 4MHHG 3EYUH 2VIRB 3G6JE 3QDGE 5E99H 4YDIH 4HV8A 3ZDZF 4V2CB 4MA1B 5I1AB 5ITFA 1R3IL 2XKNB 1WZ1L 2A83A 4KMQA 2VXUH 3GMRA 4WWKB 3RGVA 4H8WC 3O0RH 2PKDA 3BUYB 2FWOB 1GPOH 1KEGH 2GFBB 3PQYA 4NO2A 1U41A 5AWNL 1DTUA 2Y07L 5CKGA 4KVCL 4YE4L 1OP5K 5C92A 2VZ3A 4NP4L 5BS0B 1T66D 5LAXA 5ITBL 1HIMH 1OW0A 4MS8D 4NQXB 3SDAC 4F8TA 2IH1B 35C8H 4KHTH 4WWKA 2BNUA 1TVHB 3P9MA 2HT4C 1T1WB 2O61A 2OSLA 2C9AA 2ORBL 4I13B 4ORGB 4HXBL 3BN3B 2AXGB 4U1MB 2B0SL 5KSUA 4YNYA 1U8MB 2EIDA 1FFNB 5IIEA 5F1IB 1JGEB 3LVEA 4JRYE 5EFIB 4PJDF 1U8IA 2X05A 1AHWA 3BSZL 1CFVH 3G5ZB 5L2KB 4WFFE 4X6BB 3OAYK 1IAIH 2FL5B 4GKSA 2H2SC 1HHGA 1BPVA 5J13B 2VLRB 3D39A 4YBHA 2W0KA 3QIUB 1MEXL 2NY2D 5AYQA 1VFBA 5GGSB 5CFHA 4M5ZH 1S9YA 3MA9L 4BH7B 4ELME 3QUYD 4XXCC 4MDJB 1HINH 4K7PL 4WDIA 1YY9C 1F3JB 1JFQL 1MH5B 4UT6H 5SWSE 2M1KA 4ZUTA 5E70A 3RWIA 3EOAA 2FX9H 4PTUB 5BZDB 3H42H 3G6JB 4ORGA 4BZ2H 3QDGB 5T5NF 1Z0MA 2X5PA 4U1GC 1MCPL 2WWKT 5EPMB 4LSDA 4PJHF 2M26A 4P3DA 4MD4B 5BW7A 1AJ7L 4IIQB 1FV1B 4GMSH 3EYSL 4WUKL 5HHOA 2ERJB 3R8QA 4OM0H 1HHKB 1LO2L 1GL4B 3F7RA 3DRQB 2F8OA 3QSKB 3S88L 3PHOB 3LOWA 4MJ4A 3QDHA 5AZEH 1ZLUH 3SDXB 3QUMA 1YPZB 4MB4A 4HJJL 1NANH 3RWCA 4OZHA 3QNYA 3ZZ1A 3BD5A 1FORH 3OKMB 4MA3B 4R26H 3TFKC 3HRZB 1QBLH 2R23A 3H9SA 1P2CA 2YD8A 3GBNL 3FHQA 4W4NA 3WFHB 1EFQA 4LVNB 1OAUL 2P43B 4JPWL 1U8NA 5A43C 2O5ZL 1H3UA 2V2XB 5KVEH 4JM4H 1QNZL 2WUBH 4M5YL 3C6SB 1FSKB 4IRJD 2NYYC 3T65B 1DBKL 3VW3H 1QSED 4NQUA 4JB9L 1NCCL 4JZJC 4OLWL 4RCAA 1EGJA 2DTML 4OFPA 4RGOL 1IGCH 4LCYB 3CLFH 4OCWH 4KROB 3FT4A 2BOCB 1CZ8H 1UEMA 4KJQC 3FQNA 1Q0XH 2JF1A 2BC4A 3BP4A 3RPIB 3UTQA 5FYKD 3QEQE 1CLYH 4NCC2 4JKWA 3EOTH 3B8YA 2A6IA 4YR6B 2ICEA 3RI5K 1AGFA 3X12A 1I9JH 1DLFH 5JMOC 3IKCB 5HGHA 1U3YA 5JW5B 2LVCA 4BSVB 4MB5A 5IUSA 4X4ME 3QIUC 3ETBF 1NKRA 4L4TE 4LSQH 1U8KB 3TA3C 4E41B 4P59H 2Z35B 4GT7A 1GGUA 3MFGB 4F3FA 2BSED 1U8PA 4U3CA 3UP1A 4HIEB 4MQXD 4P5TD 3W0WB 3F12B 2YPLD 3TYFA 3RRQA 1RU9H 1OTSC 5SV3A 2HMID 4KMTL 4DKFH 1I8IA 3NN8B 5F3HB 3MLXH 5GQBA 1N2RB 5IB4A 3MRJA 3B8SA 4GSDH 4L29B 4R96B 2Z8VC 2VITA 4NFBA 5CUSH 4G42B 3SJVB 3BJLA 5L7XH 1RJYB 5I66A 1UWXK 3UMTA 3UDWA 2FGWH 2X1XR 3QO0B 3U46B 3HZYA 3MA7B 1S9VB 2H32H 1JZ2A 5DSCA 2APFA 3KYMB 5EG6C 2ADFH 2FDBP 4FNLL 4H1LH 5L88H 5CINL 1NGWA 3VU2A 1XGRA 1I4FA 5TQ2L 4HX1A 1UKSA 4WHYG 1I9RL 2QL1A 1CLYL 3CVIL 2X4TA 4JN2A 2HKHL 1BQHG 2K3TA 2Q8AL 1U0QA 4XPBL 2OSLB 5JW4Q 4KI5E 5IW1B 3RU8L 4YHIA 3GMOA 1MVFA 4UMGA 5FYKU 4YUEL 1J05A 5HGBB 5JNYB 5D7KE 1RURL 4ZS6C 1ONQA 1JZ5A 4N68A 1YYMH 4LBEA 1WICA 5D7JC 3NABL 2SEBA 1DBKH 3VW3L 2XZZA 3MUJA 2F54D 3OKDB 1LEIA 1J1OL 2VDKH 5FO9B 4G9FA 5I1CH 4LKXA 4FQIH 2D0HA 4KXZH 4ZO8A 4I4WB 4KKLC 4OGZA 3P9LB 1RZKL 1LNUA 3S37H 4D3CH 3QISA 3OAUH 4LLVA 4UT6L 2RCSH 1H3WM 3ISWA 4OZGF 1UCBH 3O11B 5I8KL 3ULUH 3VJ6A 3RAJL 1CFNB 1MJ7L 4KDWA 3M07A 4PD4J 3HAEB 5IFJA 3BRGC 2ZOLB 3DURB 3EIFA 1YY9D 3F7QA 4YZFF 1IM9A 5JW4N 2D7TL 4AYFA 1AIFB 4XCEB 1SHMA 4UINL 4I2XE 2G9HB 2B1HH 3CSGA 4MXQD 4GH7B 5FYLH 5BV7C 4U31A 5I1DB 3JTTB 2FGZA 4RGNC 5D93B 1ZVYA 1CDJA 3AUVA 3GKWL 3OXSB 2H2PC 5DJCA 5A2FA 5JIHA 5GS1B 3AVEA 4OAWA 5ADPH 5D2NC 3LHPH 3Q3GA 4XPBH 5FCUL 3QEUA 1JNHB 3C6LA 3O3UN 4BSWA 1XGRB 3Q6FB 2WAHA 5EZOL 4M6OH 3CAFA 2P5WE 4L3EE 5C6PB 3F62A 4JFYB 3BUYA 1FRGL 4J6RL 3FQWA 4IMLA 1D5BB 3EO0B 3P0YL 3WYRA 4DAGH 4ZOAA 5K9OB 3HZKA 3O3EA 4ZDHA 4PS4H 5IESL 1AXIB 2AJZA 4X5LA 1HE7A 5I71B 4XB7A 2Y5TB 4HGWA 4JHZA 2E6PA 4RMWA 5ADOH 1BD2E 3QQ9C 3PL6C 4HJ0D 4UT9H 4WW2C 3UXFA 1AFVH 2XICA 3UYOD 2J4WH 5D72L 1KT2A 1J0ZA 1E4XI 4QOKD 3IDXL 1FCGA 2VAJA 1FNSH 2R69L 4OF8A 1AE6L 1Q0XL 1WVZA 4DW2H 5CEXB 4P4RB 4JDTH 1ZWIB 4HJJH 4JZOA 2EXYC 2VE6B 1CFQB 1PKQE 1PY9A 3ARBA 5JOFA 3VFWB 1XZ0B 2AJ3B 3VXUD 3GIZL 2Z31B 3IU3A 2OCFD 4I9WE 5B39B 5D7JB 5B3JF 5C0AE 2XPGB 1A6AA 1J0YA 1DEEB 2IAMB 4CJ0A 3ULUC 3QXUA 3ROOA 2R1WB 4FABH 1F90H 5FM5O 5ISZD 1UB6A 5I19L 1ERNA 5JQ6L 5DD1L 2D7MA 1JPTL 1X6NA 3BGAA 1QNZH 2WUBL 4HWUA 3MRQB 4TULL 5DJ8A 5DVNA 1E27A 2WZPD 4YAQA 4OFYA 5IMLA 3MJ9A 3LB6C 3O0RL 2APXA 1D6VH 4PJGE 3MX0A 3MBEC 4M7ZB 1MFEL 2E9JA 3MOAH 1LO5A 3VXSA 1V3KA 1BFVH 1F42A 4IJ3B 3JWOH 2V17H 3BDXA 1INDL 4FQXD 2ARJA 3QQNA 2VDRH 4BQBA 2W65A 5T33L 4X6EB 1FIGL 3BVNB 3ESVF 4MAYA 3QPXH 2OL3L 3ARYA 1ED3B 1NDGB 1S7VB 5IBUG 4JREB 2XZQL 3CXDL 5T3ZL 4TVPL 1RK0A 2BJML 1G7HB 1I7UA 3RGVD 2HJKA 2LQRA 4J3UA 4YDKH 2GTWA 4UDTA 4TUOA 5HDBE 2HTKD 5ALBH 2CH8A 1NDMB 2DQEH 1AE6H 5TH2B 4HUUA 2QQNL 3QB7C 4APQA 5F44A 4JO1L 1JN6A 3QUMH 1HWGB 4Q9QL 1A4KA 1S7SA 4NOFA 1SQ2N 1YMHB 3QQ3B 3GSQB 1FPTH 1XF5B 2A0LC 2ITCB 4FQCH 1MCWM 3D39E 1WT5A 3T2NL 3CCHA 3KPMA 4LLMA 3ME0A 5CEYB 5F9OL 2UUDH 5HI3C 3I2CH 1F8TH 1ES0A 1JJUA 4I0CC 4NQVA 1TIUA 3DGCR 3UTTE 3QDGA 1KXTB 5DC0A 1BD2A 4M43L 4I77H 4QRPB 2NY6B 5ID0B 2V2WA 1KJ2A 4O58H 2Q7YB 5IR1A 32C2A 2YRLA 4UOW0 4RAUB 1NCBH 4OZGE 2NXZB 1KCRL 4HC1H 1F97A 4W4OA 4KDTA 1QRND 3LQAH 1W0VB 4NBXB 1AGCA 1QSFA 4XX1G 3KPSD 3FN3A 5E8DH 3QEGL 3G6DH 4C59B 2FZ3B 1U95A 4LASH 3QNXB 5CIPH 4HS8H 2WV3A 4GAYB 3VJ6B 4PJDE 3CH8A 2GUOA 1G9MC 4WI8A 5HD8C 5EBLB 4X9GA 3RZCC 5HYEA 5E8NB 1K4DA 4AK1A 2W60A 2FJGA 1FVCA 1PSKL 2ARJB 4KFZC 4JQVC 4MHHI 5DMKB 5T5NG 1P5UA 3IXTB 3Q6GH 1ORSA 5CD5C 4M7ZC 4OTXH 5KG9A 1TJHH 2WNGA 5CBAA 2DD8L 1L7IH 4X5WA 1YNTA 1S5HB 1CE1H 5J6GB 1HH6B 3SDYH 2BHZA 3HMXL 2FLRT 5A2IH 3RJDA 2VO5A 1HWHB 3D3VB 3KYOA 25C8L 3I2CL 1PW3A 5C0JB 1NBYA 4CN6A 5F7WC 2QLVB 2P8MB 3PABB 4OZ4B 4J8RA 5HHPB 4JJHA 5LWYH 1S7XA 3MBED 4HCRH 3STLB 2EC9U 1FL6A 4M6ML 3NIFF 1MFBL 5GGSY 2DLEA 1KJ2L 4Y4FD 4HFWA 5MENB 4KY1L 3BE1L 5TFSH 5IB2B 1DDHA 4I3RH 3F58L 1G6RA 4HS3B 5IVXA 1FG2A 2V2WB 1AKJB 2ZNWA 1HHJA 4HIXL 4HWZA 4X7DC 3DPBA 2EDHA 4MDIA 2V9QA 3TCXA 5AZ2L 5DHVA 2XI9A 1WQVT 2W59A 4TUOB 1NAKH 4QXTA 1AGCB 1QSFB 1YYLL 1XGYL 3KLHD 5FO8A 4JDVA 3KS0J 1EUUA 4ODXA 1XH3B 5GS0H 1IGTB 2NY5H 2AJXL 3MRDA 4YWGH 4XHJC 2HH0L 3FRPG 4EI5A 4DAGL 4WHCA 4NUJA 3RVWD 1GAFL 2FATL 1NDMA 4FG6C 4ODUB 3MTRA 4PP1D 5L0QC 3MRCA 4Y5VB 5FF6B 4KKBC 1KJMB 3MMEB 3QZWB 3ZHLA 1NEZB 4PRAA 3I02B 2DWDA 3HHRB 3IFOB 5ADOL 3T4YB 2C1PA 5DMIL 5FGBA 5D93C 1P9MC 3IVKA 4JKMA 5E8OB 3O6FB 4N8VA 1BF2A 2YD3A 2GHWB 1GHFL 2ZUTA 2D2OA 2L7JA 1TCRA 2OS7A 1NQBA 3BWAB 4QOKB 4WEUD 4ZOEA 5ID1B 1CF8L 4Z7UA 5JZ7C 3RPIA 4EDXA 3S35H 1L4IA 3MXWL 1JWMA 1I1RA 4K23L 2MHAA 5DHYB 4N0YH 4MZ3A 4RMRA 3GI9L 5FYKE 4IS6B 4P2OD 4LIQH 1A7NL 4FQPA 3FB6B 1U91B 5JHDE 1XFPA 3O11A 3LRGA 4ZUWA 5IEKB 1JNJA 1H3GA 4NDMA 3B3IB 4D94A 4JFDA 2DI9A 3TPKA 1ROWA 2ZOKA 4BFGA 4WFHE 1I1YB 1S7VA 4WRLA 4EJ1C 5HI5C 5CSGA 5JHDA 2VDLH 3PHQB 2F58H 4LPTA 5FO9A 4NGHH 1D5ZB 1BLNA 2BNRE 3CFKA 4IBLT 4EQ2A 5HPOA 1CGXA 5SWSA 1E4JA 5KSAA 4LCCC 4U1SA 2ZUYA 3IDUA 1TZIB 4XPHL 4WI3A 2R0WH 5F8QC 4KTYA 4LSSL 4P4KD 2FO4B 4MVBD 4N0CD 3MV8B 2X70B 4KZEH 4PJEB 4OF7A 4JG1L 4IOSD 5BZWB 2LTQC 3VCLB 2EDJA 4ODTL 3EZ8A 4ZO7A 1YEHH 2VXVH 1IQDB 4PFEA 5HYSA 3VFTA 3FKUS 4Z7VB 5DHXB 2JB6A 4N8CL 2VXSH 1UM4L 1KENH 1OF2A 3SGDI 2P24B 4LPYA 3RY4A 1I1AB 1GGCL 5CWSA 5FYLL 2I27N 3BP7A 3RA7H 4Z77B 1DVFA 3MRMB 3EO9H 1EGJH 1S3KH 2DKSA 3S4SG 3EO0A 3FT2B 4WIQA 4F2MA 4XI5D 1KB5B 1V7NL 1UB5A 1VENA 3V0WL 5DEFA 1MY7A 4HG4J 1A14L 2WLZA 4PJBF 1CIDA 4NJ9L 2XQYK 5EN2B 4CGTA 4OUOA 4AG4L 5D7LE 3GSVA 4ZDHB 3T0EC 2H8PA 1Q94A 4B41A 4F9LC 2W92A 3BMWA 3VGFA 2HP4A 5DFVD 3S36H 5F7EL 4S1QH 3NZ8B 3TNMA 3TO4D 2Q86B 4NZDA 4HEPG 5CBAB 2R0WL 4KVNH 4ZFZB 3SDAB 4LP5A 2DN7A 1ZXQA 3ZKNC 3HE6B 4F7MB 4YHOL 1ZHNB 5B8CB 4PP1C 5IIEB 2R0KL 1OSZA 4DKDC 5E8PA 1XIWC 1RVFH 3GI8H 3QEQA 5DDHA 4L8CB 1YEHL 4QHNA 4GRWF 4JJ5A 1RJZA 1R0AH 5FGCB 3OJ2C 1OAZH 1U95B 5DD3L 1X5XA 1LE5B 4FFWC 4Z0BH 1J7VR 5CILH 1PJ9A 5FUOL 4F8QA 1NMBL 1TQCB 3VWJC 2A73A 3V9FA 4X6DF 1T5WB 3I50L 1C5DA 4FP8H 3QA3A 4JAMA 4C54A 1KLGB 4QHUA 2D31B 4I0PA 5DC9B 3RL2B 1QLEH 3RA7L 3VXRB 4WFHD 3RWGB 4M62L 3B4NA 5DUML 4NQCD 4GO6B 3IF1B 1PAMA 5E5MA 3RIAK 4LQ1A 4MAYC 5T5FL 3ROLA 3DI2B 1KFAL 1C5BL 1A6ZA 2DB8A 4NQVB 4RGND 3RWEA 4D9RE 3LKRB 4OLUH 4YHNA 4B50A 2XT1B 5J3HD 3D0LB 3UZVB 1S9KC 3HG1E 3QQ4A 1Q9LA 3I6KA 3CDFA 3QCUH 4LCIL 4ODTH 4EBQL 4JDZB 4GS7B 4WFGE 5GJSH 5T1LA 1PZUB 1QLRA 1HI6A 1UENA 6FABH 1TLKA 1A7PL 1C16A 4X6CB 2ZSVB 2KH2B 4H1LA 2HFEB 5C08E 3MUGA 3SY0A 1TITA 4LEOB 3SDDA 2EDTA 3LEYL 1HDMA 1IGYA 2G5BA 5GIRB 2DAVA 1UWEH 3P30H 1MFDH 3TN0A 2VITB 1CFVL 3R0MA 4RNRB 4LVEA 2ZOKB 2VQ1B 3MACH 4HC1A 5MI0B 5LXGL 3LN4A 4U1NA 4AM0B 1HQRB 3JWDH 4Y4HC 3QULA 4PLKC 5E9DA 1KTLB 3LKPA 4U33A 3GBLA 4FFVC 1P53A 3DIFB 4HW6A 3WE6B 5F9DC 3CK0H 2D7OA 4OI7A 2DLHA 5T1DL 4XWOC 4M48H 5KZCB 3I85A 2VZSA 1IJ9A 5IGXL 2WWKO 3MRFA 4GKZB 3O45B 4LNRA 3U4AA 3LEXA 4KJPD 1H5BA 1N5AB 5MERA 1VFBB 5F72S 4LCYA 1BFSA 4P3WA 3SKJL 3WKNA 2FH6A 5DVMA 1OAQL 5DRNA 2AGJL 2VN7A 4XVTH 1EHXA 5F9OH 2VLKB 4PLOB 5FGRA 1S5IH 1J11A 3QZWA 4XAKE 4JN1H 3BPLC 2BVEA 3JWNC 2RCSL 2IH3A 4PYGA 3ULVD 4LCIH 1SVCP 3CFEB 1JGUL 2D4FA 1MCBA 4KZEL 3OPZL 4ODVL 2X1PA 4HK0A 2A38A 2NR6C 3ZDZE 4L8SA 4PGEA 3AMLA 5ELIA 5IWLC 4KV5F 4HXBH 3OKLA 4PJ9A 5SWZA 1AGDA 1ODAA 5BQ7B 1MFDL 4Q7DA 5IB1A 1FFQA 4F58L 4OLZH 3BVNA 4DCQA 1IGJB 2FCBA 5TF1H 1MFAH 3FO0L 5DJDB 5GS2H 1BFOA 4JPWH 2P46B 1GVIA 1QRNA 1K3IA 2J3SA 4DVBB 2NY2B 1LO5B 1T1ZB 3BO8A 3Q6GL 3VG9B 5DK0A 5FFLA 4MMZC 1GPOL 1KEGL 4MJ2A 1T83A 4PB0H 2NX5A 5E2TL 2EDBA 3QUXB 1ZE3C 3WKMH 4WV1A 2EE3A 2IQAA 4OZFB 3SN6N 3VGBA 4TULH 5CZXC 5IQ9A 1SEBB 2X1WL 4FQLL 1B3JA 1TENA 1FGNH 4XVTL 1FVDA 3P73A 5ANME 2Y9RT 4LRIA 3FONA 3MBEB 3RTQA 3IFNH 3ARGD 4Z7QE 5HHMB 5BQ7A 4WW1B 2VDRL 5MEQB 4XAWH 4NPYA 3I9GL 4OUUB 2EDEA 4GKSB 3CGTA 5CSBA 5I1DA 4AMKL 5KG9B 1Z9MA 3NFNB 3T0EE 3IXTA 4OFKA 1A1MB 2W9EH 4FRWA 4K3JH 3QJFB 1NGYA 3PXJA 5DLML 1T5XB 3PDOB 5C0DB 4S1RL 5B4MC 2F15A 1S9XA 4WFEE 4NM8H 4QT5B 3HRPA 3IB4A 3M17A 5AZEL 1FYTD 1MFAL 1Q8MA 1HXYB 1YQVL 3FO0H 5IFAH 1JZ8A 4OLZL 1CVRA 1QLEL 2HVKA 4NQEA 3WXWH 2PW2B 4DVRL 1J10A 3MRKA 4PREB 3PWVA 2G2RB 2E8YA 4HFWB 3O3AB 4OZGA 4YQXH 4HKZB 4Q9QH 5IHUH 1WWCA 4PBVC 4XP1H 1ZA3A 1UACH 3ARPA 3LMJL 3HMWL 2X4RA 3OKNA 3O45A 4LNRB 4K8RD 3B9KD 3Q6FA 4GG6A 4MYWB 2I07A 4OIBA 4F7EB 1MJJB 4LPWA 3TT3H 4QXGL 5IB3A 1OW0C 1GGBH 3ARFA 2N1KA 4PGZA 3GFUA 2NXZD 3N0PB 3RVTC 4OLWH 1EFXD 3DXAA 4L4VA 3G9AB 1HQ4B 1YEEL 2CUHA 4N0CC 3WS3A 4PV8B 4PS4L 4X0KB 1LGVA 2PUQT 3IFLL 2E5EA 3AREB 1MHPH 2XTJC 1JGEA 2W60B 1I4FB 1R3JA 4G7VL 3C60C 3W2DL 5IKCB 4JRWA 3DX6B 3QHFL 5D2NB 4HEME 3JUZA 4JM2D 4LVNC 2AXHA 5EC1B 3AY4A 4OGAC 5I73C 4JQVA 3ABZA 1WFUA 1AGEA 2Z92B 1FP5A 1KN4L 1CT8A 5DT1H 4PJHA 4Y4FB 3FONB 1KFAH 4LLUA 5EU5B 3HA0A 3NA9L 3WL9B 5CEZE 3L3KA 3MRHB 2CD0A 3GJFA 4YXKH 3NIGF 2CRYA 2Q76B 3LEVH 1Q9OB 4J4PC 4LSSH 2PO6B 4ZUSA 4MXVF 1C12A 2YD6A 4X6EA 4KWUA 3QULB 3R4DA 4OLVH 5D5MA 2C5DC 1CU4L 2ESVE 3RDTC 3FQRA 1P4LB 3BI9X 5ETUB 3ZT5A 4V1DD 5D2LF 1TQCC 3VGHA 2DI7A 1QOKA 3IDXH 1XF5A 4ZODA 3C9NA 3MOAL 4OD3L 2UV3A 4HUNB 2OZ4L 4K3EH 1E27B 3C2AL 2L7UA 3ZDYE 5JXEA 2AQ3A 1WV7T 5IT2H 2WBWB 2QADB 2YK1H 4QTIL 1V5JA 1A7OL 3MV9E 4HIIB 1OP5H 4EI5D 1M05A 2A1WH 3C2SA 4OQ1A 4R8WL 1QRKA 3OGCA 1EGJL 4PRNB 3FZUD 4RQQB 1UQSB 1M71B 3LB6D 4Z7UE 4F9LA 5J1AA 4OCSL 1A9EB 5H35B 43CAA 4GQ9L 3MRIB 5A16B 4EI6B 2R0ZH 2Q3ZA 4KGJA 3ZE1E 5I75B 2HJKB 1SJVA 2J6EA 3L6FB 5TGBA 4ELKB 5AZ2H 3WUZA 5M94B 4XBEH 4M93C 15C8L 3DXAB 4XNYH 1VACA 4JG0L 3V5HB 1IGIH 3SBWC 4HZLB 2DQEL 1CXHA 4RBPH 3TYFB 1QUNA 1D5IH 3UTZB 2A6JB 3MRNB 4GG6E 2J6EL 3BQUB 4BH8A 1EK3A 1XIWA 5HYIA 1AHWC 2F5BL 3MGOB 1XF3B 4I0PB 3K2UL 2AKRB 5T1MB 2ATKB 5KS9B 3T77A 4WTWA 1G0XA 3TO2B 4POUB 4JN1L 2I9TB 4P2CG 1MWAA 3DWTA 3S8WA 3S3PA 5EWIL 2CR6A 1CK0H 3K8MA 4MA1C 3KPQA 4JANA 4X4YA 4JFPA 1GYAA 1VPOH 5HGAB 5L0QB 2GW5A 1EJ6A 1CXIA 3QNYB 3REWA 4RGMB 5DD6A 3ARDC 3T1FB 4HFUL 4IDJH 1DLHA 4PJIA 4JR9H 4K94C 2RBLA 4WW2F 3TO4A 4PBXA 1V8HA 1EEQA 3FCTA 5C8JA 1F6AA 2YUWA 4OLXL 4QKXB 2BNRA 1KIPA 3F5WA 1IM3B 5BMFH 4HWBL 2VKWA 3IGAA 4XP4L 3DMMA 1DE4A 4M4PA 5BW7C 2Q86A 1G9EA 5D9SB 3X14B 2IFGA 1XGTB 3IKKA 1CGUA 1FLRH 1PKOA 2XFXA 1DBAH 1OGTA 3JV4A 1KJ3L 3ARVA 1OSPH 4JFZH 4ZFGH 4S1DD 4NZRH 1I9IH 2VLJE 4HS6A 3CSYB 4DGYL 3GEWB 2MPAH 4JGMA 4K7PX 1INQB 1BIIB 4YGVA 3TFKD 1QFUL 1BQLL 3C5JA 1HYSD 5CZVL 2UY7A 4KHXL 3G04A 1LD9A 1RIHH 4UB0L 1LO4L 5F6HJ 2FIKB 1UJTA 2B5IC 4NUGH 4QWWC 4IHOA 4LDLB 2Z4QA 2ICWJ 3LZFL 4LVHB 4O2FB 1NGPH 4KK5C 4K7FA 2P24A 2GY5A 4XAWL 4KKBD 2E9IA 4WU7B 3IDMA 4GOSA 4DOHB 2IQ9L 2IALB 3RDTD 1A21A 2IFFH 3FOLA 4J1UA 1DFBH 4NN6B 5JW3L 2LTQB 1AKJD 1BZ9B 3NFSH 4LU5H 5ANMB 5KVMC 5H94B 4QLRA 1I3VA 5IW1A 1X4XA 5HGAA 1OAXH 1UXSA 2CDGB 1QEWB 1XF4B 4PRIB 1MHCA 4YHYC 1VGKA 1MF2H 5D7KD 5E2TH 3OR7B 4P99A 1MWAB 5GRYA 2YPKA 3CVHA 4RFOH 1EUTA 2C3GA 2P5EE 4NHUB 4TUJB 5D7LD 5IFJB 3MRGA 2R8SL 1UJ3A 2P5ED 4AEIH 1UA6H 5E00B 2IH3B 4ZFZA 3RVXD 3FO9A 3SDAA 5I30L 1FHGA 2ZCKH 5I74B 4X6DB 1C1EL 1FH5H 3TT1H 1XGYH 1F00I 1JHTA 3QIBB 4JDVB 4RA0C 5IW6A 4KRMB 4GW1A 3NCJL 1FO0L 4X6BA 1FGVL 1KB9J 3EYFA 1SBSL 4TSCL 5HHQB 5I1GH 3RWFA 4YGVB 1VA9A 2ADJA 4K3JL 1GGTA 1UZ8B 2Q6WB 3JWOL 5TPWL 3O6FD 4PJIE 4QNPF 4Y16C 1AI1H 3K8KA 2AEIT 2VAAB 2F8XC 1NH6A 2AK4E 4OCRH 3DJ9A 4N90E 4N5EC 1ACZA 1T04A 1MCJA 2AEPL 3BXNB 2ZNXA 2X4NB 4ODHH 3C9NB 1FN4B 3D2UD 1IAII 1UGNA 5GSVB 4PJ8D 3WFDL 3GO1L 3LS5L 3PHSA 3GMNA 4JFFE 2PW1B 4PY7B 43C9A 3DLQR 4IRZH 2EIZB 3MNWA 3VWKB 1AD9A 4IRSD 1MCOL 4KRNA 5GJTH 4ZYKA 3RKDD 4XNUH 3WEXB 2EO9A 4IJ3C 5GGUB 1IEAA 3THMH 3QIUD 4AEIL 4JFFA 4PJEF 4WUUA 2FO4A 5DQ9B 3CLEH 4K71B 5DK0B 2FX9L 5I66B 1L0YA 1MLBA 3C5SA 2VIRA 3DBXA 3S9DB 1FNEB 5EIVA 1R3IH 2ZSWB 4O2CA 4AEHL 1P7QB 1RUKH 1ZOXA 2PXYD 4RGOH 4A6YB 5I1JL 3T65A 5E9DE 5L6YH 3BKML 4WUKH 2Y7QA 1NBZA 1JWSB 5MEND 1J0JA 1ZEAH 3KLSA 2NY5C 4HUWB 1G9NC 5IG7B 2FYYB 4PV9B 4XNQA 1WEJH 2NY0B 2Z35A 5CUSL 3MRPA 4U2ZA 3TBSA 3TN0C 4EUPH 3VA2C 1VFAB 4IMKC 3IDJA 5F8RC 5E03A 4Y4FC 3DYMA 2BNRB 1AR1D 5T3XL 1JGLL 2PF6A 2Q3AA 2QKIB 3I50H 1ND0B 3P4LA 3VXNA 5SX5H 3KS0H 3L3JB 3LQMA 2QQLL 5DYOB 3S4SB 4QHKJ 4LKCA 1ZGLB 1CBVL 2APWA 3PWPE 5C0ND 4XPTH 4QYOB 1RUQL 5IOPA 5GGRB 1ZSDA 3DNKA 1HHKA 3RZCD 4PGBB 5CP3H 4MNHB 4KRPB 1JRHH 4JO2L 5HHNB 3VI4E 2KQMA 3MROB 4XI5C 1U8QA 4QHLA 3GGWA 1JZ4A 4WO4A 2XRAL 3CMGA 4KVCH 2ZWLT 3EDFA 4Z5RB 2VLKD 2JLLA 2X1OA 3DV6A 2EDOA 3CPLA 2VLLB 4PJ9D 4JEGB 5SWZD 3OJDB 1MRFL 5EUKA 5D6DC 5DJYA 1OGAE 2R15A 1IGTA 1HKLL 1CGWA 1U8OB 2CQVA 1YDPA 3T0DA 5D7JD 1U8NB 3W11D 3MXVL 4UT9L 4KKLD 3ZE2E 5AG8A 2COQA 3RBGA 3IJYA 3MLVH 5BRZE 4Y4KA 4RQQA 1PQZB 3JUYA 3GKZA 3O8XA 1K5NB 4QRTB 1MPAH 3P77A 2DLIA 5L2KA 1IT9L 1IAIL 4BKLA 1K9TA 2M8XA 1U8IB 4KQ4H 5TQ0L 1F6FB 3VDCA 4GBXC 2DD8H 1W0WB 3KYNA 4QRRE 3S6CA 4YHMH 2JIXB 3QH3A 3I6GA 4I5BA 4RFOL 5J11B 3STLA 5JQ6H 1FORL 2FD6H 1FZOB 5FHAH 4Z7OF 1QFUH 2W0FB 4EXPX 1EHAA 2GK2A 2PNDA 1N59B 3VRLF 3SCMA 1D5XB 1EPFA 4EDWL 4FFYL 2V5RA 1EEZB 4HCRL 4LVOC 1A5FL 3T3PF 4S1SH 5B8CC 1MIML 2D31A 3MQIA 1NCDH 3RFZC 1BP3B 2D4DA 2DKUA 5B39A 4TNVK 5I1HL 1DBBH 3WN5A 3VRLE 5FA4A 5D2LA 3GHBH 5JMRA 2V5MA 4QCIB 1NC2B 5IHLB 3H3BC 2WBJA 4AL8L 3D9AL 4FQXC 3L5WA 4TRPL 2B39A 5JHLL 4MLIA 2OZ4H 3EJYD 1WCBB 1RUML 2ADGB 1X4ZA 1PG7H 4QHNB 2M2DA 4OZHE 1YJDC 1UWGL 3STZB 5ISZA 3I3EA 4WNQB 4DQOL 4YH6A 5IVZB 5DHYA 3BDYH 2NTFB 1E6JL 1I3GL 3CU7A 2WANA 4OCSH 3QDJD 4Z7WE 1J18A 3S36L 4XCYA 3GO1H 3LS5H 4BZ1H 1UXWB 4R6UA 3N1GC 3ZE1F 4C56A 2A77L 1S7TB 3DXAE 3MR9B 2VLMD 3L9RB 5LAXB 1PKQB 2GTZB 1KJMA 3MMEA 4WI9A 4MA8L 1AD9B 5FYJH 1KBGL 4D3CL 5IBTL 2H6PB 5JPNA 1UB5B 3EJJX 3ES6A 1A4JB 2DTMH 4Y1AD 5SWZE 4M43H 5EO9A 1DQLL 2H26A 3IFNL 5JOEA 1AXTH 1DN2A 1NC4B 2K7QA 3HUJA 1A4KB 5K59F 1MIMH 5IG7A 5CZXD 3VMOA 4RDQG 4YE4H 5FOBB 4JVWA 1SJHB 1MAKA 1I7ZA 3OMZA 5ICXA 1EERB 4F7CB 2R29H 4WV1C 3NZHL 1YEFL 1HNGA 4LMQI 3MLYL 5DHVB 1YEJH 3TVMB 1IGJA 5DZNA 3V5DA 4G6KH 4GQPH 2ID5A 4OF3A 2ZJSL 3QUKB 1AQDB 4NQEE 3KDMA 4HDIB 2OZ4A 4XNUL 1R3KB 1LEKA 1ETZB 1TZHB 5TF1L 1BJ8A 4NWTL 1INEL 1IBGL 4EI5C 4JFYA 4NWUL 4FFYH 4UAOC 4NZRL 4F58H 1S7UA 1ZKAA 3LKRA 3U83A 5J57B 4O4YL 4LHUG 4Y16B 4UU9A 5EBMA 1YPZF 1EO8H 5TDOA 2XIDA 1IAOB 3INUH 5AG9A 4P5KA 3GHEL 5GS0C 3DUUB 4OZFG 3RWGA 4X8JA 1ZVSA 1H3PL 4G43A 5DZOA 1I8MB 2AJUH 2J88L 4Q2ZB 2V17L 2A9NH 5KAQF 4EVNB 3IRPX 3SKNB 3LZFH 3KLDA 4FNLH 5J8OA 1MREL 4YBLC 3TIEA 2XPGA 4JFDE 4KUCD 4G3YH 3GSXB 4ZNEA 3RWHA 1FL3A 3P4NB 2VR5A 5D1XA 4X9HA 1VCAA 5TDPA 3BZEA 5ICYA 1JHLL 1IVLA 4YFEA 4P9ML 4P2RB 5DWUL 5E7BA 4PLKD 5DI8A 4HAFA 1MJUH 1RZ7H 2AK1H 4DKEL 3P77B 3QCTH 5C0BE 4JRYD 3VFPA 1SYSA 4NNXB 3MA7A 3WDHA 2VERN 4PRBA 3FN9A 5D6CA 3RPKA 2HWZH 3NACL 1CL7L 5IGXH 2YZ1A 4FFZL 3ARGB 3ZL4H 2NY6D 4F37F 1JPGB 1WJ3A 3QI9D 3VFGH 4R97C 5BV7B 3VFOB 4J3WA 4U2YA 1TFHA 4QTHB 5CBEA 2H2PD 2KPNA 4DEPB 4TQEL 4M1DL 2HH0H 2Z8WC 32C2B 4TSAL 3TPUB 1ONQB 5EU6A 1T7YA 5GS0L 3S96B 4XNXL 1KXQE 2XRAH 3Q5YA 3S35X 5HY9B 1N6UA 2MOVA 4R4FH 1U93B 1Y0LB 4EOWL 4M93B 2GI7A 4PYHA 5IHBA 3O41A 1X5KA 1R24A 1X5AA 3D18A 1KB5A 5CP7A 4PJ5B 4F9PA 5F96L 4X4XB 4XZUA 2QHLA 4ONHA 5DQDH 4FG6D 5JDSB 2Z0BA 4MLSA 1ZLSL 1B0RA 1AR2A 5DMIH 1LO3H 4CMHC 2X6MA 5BVJB 3MV9A 5IT2L 4I2XA 3P4MB 3E6HA 4P46B 2VXTH 4AZ8A 3R06B 5JHLH 1IEBA 3VRJA 4QXGH 4LQFL 3WXVL 2LU7A 1I1FA 4OCWL 2B7DT 2DYPB 4HH9A 2BSTA 2B1AH 3H8NA 3MLZL 1E4KC 4HWEL 1M7DB 3H3PL 2ENYA 2IMNA 5DURB 4JFXA 2ZP0T 1MCWW 1OL0A 2F53D 3HMXA 5D8JL 1LEGA 2HWZL 1N2RA 4G43B 5KOMC 3S97C 1RJZB 2F58L 1R5VB 5TDNA 5DUPH 2B4CL 1BOGA 2FECI 5I18L 5C0BB 5T1DH 4QTHA 4O2CB 5AYUL 5F71A 4XBPB 3ZYOA 4RFEB 2XWTB 5BOZG 3EJYC 4F37K 5ENWB 3MRIA 5IWLA 4H26A 5D72H 1FVCB 4NO5A 2XOTA 4KK9D 2NY3D 1RZJL 2Q1EA 2PYFA 5E5UB 2YUVA 4UB0H 3UZEA 4XBGB 2HFFA 2WSKA 3O3BA 2CUMA 1DR9A 2DQFB 5LWYL 4PY8J 1MCKA 3OB8A 1MJUL 1RZ7L 5IQ7H 3L5HA 4IS6A 5I8CB 1OAYH 4JFDD 1AXTL 3P11L 1VESA 1W2KT 2MCPH 4FZEL 2JE8A 3KJ6L 3OXRB 3O9WB 1T5WA 2VRAA 2H3NB 2MNUA 3ARGC 3SE8L 4NKIL 1K4CB 1ZHLA 1CICA 3OAYH 4K8RL 1U42A 3ZDXE 4CVXB 4AJ0A 2I9TA 1FLRL 3CX5J 1KTRL 1JE6A 3OZ9L 5E8OA 2PXYB 1MI5A 3TH4T 1OTTC 5D70H 5HGDA 5FYJE 2FR4B 3HZYB 1CXKA 1F90L 1IRAY 2DYPD 4OGXH 1OP9A 1J8HD 3TO4C 3ARSA 4MDJA 5E0QA 3HE6A 3UCRA 3HTLX 4EKXA 4LGRB 4J3VA 4AIZB 3MO1A 3L9RA 3DVGB 4GRMB 4RISH 1HIML 3BN9D 4YPGA 1IBGH 2X41A 2LE9A 3DUHA 4G7YL 4MJIB 2EZ0D 4A6YH 1QKZH 4NQTA 3OKMA 1D5BA 5FIEA 4LRNH 1MIEH 4CL7A 1CGYA 1OGAA 2JIXD 1CLOH 4D0DB 2GK0B 1P69B 4LP4A 5T1KA 2YR3A 2OM5A 3IS1X 1T1XA 5GSVA 4X0KA 1RVFL 3GI8L 3QBTB 1I7ZB 5ICXB 1N8ZB 4PRDB 4N0UE 5JIKA 3RL1B 4PGCB 2YRZA 2CK0H 2FEEL 1F4XH 2C1OB 4NBYB 2JCCF 1CXLA 1G9MH 1XMWA 1OPGL 2H3NA 4YUEH 2XXCB 1NAMA 1S7XB 2I24N 5J12C 1RULH 1SY6A 4X9BA 3FAWA 4UOJA 5KVDH 2FD6L 1NFDE 3VFNA 1VB9A 3GSUA 5BMFL 4ETQA 4TQEH 5E99L 3MLWL 5FCUH 4U1JB 5C71A 4NQEB 1NCAL 2V7HB 1P84J 2NLJB 1V3JA 3S37L 2Y36H 2OYPA 3IU4H 3DROA 3X11B 1CE6B 5TDOB 2CMRL 1OD7A 3V7MA 3BHBB 5DK2A 2YD9A 4X7SH 4EUPG 2GT9A 4HUMB 2NZ9D 2ZG2A 5IESH 4HUXA 5CJQH 4NHUA 2C4FT 1XCQB 3AB0B 3WFHA 4NP4H 4DOHE 4BKLB 1NPUA 4TTDD 3TBTB 3MPCA 4GJTB 3BEVB 3P9WB 2HN7A 4QEGA 5D9SA 1M4KA 5C08D 4Y4KB 4TSBH 4BFIB 1T89A 1FZOA 4PJFA 4EN3A 4QCIA 2HKFL 5H37H 1MWAH 5EO0B 4LLWB 5B21A 1BF8A 4L8BA 4N90D 5DS8B 1IFHH 2R0KH 3BH9B 3I6LE 1MOEA 5GRJH 5ESAA 3TO4B 3VRJB 3P0VL 2RFXA 3PWNA 5CLTA 5D7IF 3E2HB 3CSPA 3L7EB 1TTFA 2APVA 2W91A 3NCFB 5FYJD 1I9IL 3ZTNH 3NA4A 4PREA 5HDQL 5B38G 4IHOB 4R2GC 2W0FA 3K2UH 1H8NA 5EULV 1IE5A 3CZFB 2GJ6B 1CBVH 1ZS8A 4FP8L 3KPSB 3WSQL 1U58A 3MFFB 4PJXA 3V4PL 5CJXA 5DTFB 3T8XA 1TCMA 1K85A 1QR1B 5IM7B 3PL6B 1MQKH 5HDLA 4GRWE 2Y5EA 4KTEL 1INQA 4P23B 1D5MB 2VDQL 5I17A 2Z93B 5AAWA 3HZVA 1UKTA 3H42L 3SO3C 3QDJA 1GH7A 3K3QA 1M1SA 5DJ0B 2R1XA 4PJXE 3FOMB 1AC0A 1AGDB 4ZS7L 1A1OA 3BEWA 4C56D 1K5NA 4AENB 2WMPA 2BNQD 4WU5A 5CMAB 2EYSB 2VLRD 3QPXL 3MRLA 2GJ6D 3GIVA 4PRPD 4O51B 5HJ3B 1MJ7H 3TCLB 6FABL 3T4AB 3SGKC 3SKMA 1RK0B 2VR4A 1D6EB 1YNLH 4JRXD 4MX7A 1XEDA 1KJVA 3LIZH 5I1LB 5I6XB 4Y1AA 1N5YL 1FZKB 4OIAA 3DROB 1E6OH 3CZFA 2VDML 2BC4B 5ACLA 3P9LA 1JPTH 3L5IA 5D70L 1S7RA 4U6TA 4EUPA 3U0PA 2DIJA 2XWJB 1BQLH 3BQUD 4WTXA 2AJXH 1H3TA 5TQ0H 2CGRH 1RIVL 3LKSA 2OQJA 3T2PA 3RUGB 3HZMA 1OP3H 2HT2C 5ESAB 1E28A 1NFDF 2HG5B 2N4IA 4GRLD 1F11A 1RHHA 4JRYB 4JY5H 3ULUE 1JWUB 2CO6B 3GMMA 4P46C 5FDWB 3X3FH 4YDLB 2NPLX 3GMRB 2O93L 4UUJB 4YHIB 1OM3L 1NLBL 1NKOA 1A7PH 4OCYH 4PUBH 4WWKC 3KVQA 3RVXC 4YC2B 1FC2D 2OLDA 2CDEB 3R1GL 2J4WL 3BPNB 1QHOA 2O5XL 3KDMB 4K23H 2YEZA 3PGDB 4F7TA 1OB1B 3OGCB 2OTUA 3OX8B 1M05B 3ARZA 5DD0H 5DSCB 3L1OH 5C07A 1YEKL 1F4WH 4M1GH 3JV6A 1S9VA 3N1QC 4A6YA 5KS9E 4PJGF 5DFWH 2KL6A 1FQ9C 5K33A 5A2JH 2Z31D 4NGHL 1IAMA 3C5SB 2I5YL 2VZOA 1RZIB 1LK2B 2QQQA 2FSEA 3O4LD 5D1XD 1JV5B 1LE9B 1F5WA 1S9WA 3MLTA 3D85B 4HT1L 1BREA 4OKVA 3UBXB 2FHBA 5D96C 1MJ8L 1C12B 2NY6C 3WEXA 2VLLA 1X5ZA 1QKZL 1QA9A 1F3JA 5F7HA 3FFCE 5FOJA 5JORA 4NO0A 3L3HB 1RZFL 4JO4H 4JLRA 4RNRA 3D25A 2HLFC 3VFUB 3WIHL 4ZAKD 4XC3L 3EYQD 3G5XB 1JUFB 2AW2A 1FIEA 1CVSC 1IGFL 4DGIL 2CLVB 1OTSD 5EC1A 1YMME 3RZCB 3WDJA 3PUCA 1T21A 2MSPA 4R4NC 2VWEC 5T3XH 4PGJA 1EMTL 3RWFB 1I9EA 1JYWA 4UDTB 5EZOH 3KYKH 3LQAC 3RKDC 4ZNEE 3T04D 4UQ2A 3HC4L 3CXHJ 4NT6A 5BJTA 1M7XA 2FJHA 2IANB 3FN0L 2UUDK 2BOBB 2VYRE 4BA8A 3LV3A 1WISA 5ALBL 4Z76B 1MEXH 5MEPB 1JPFA 1OAXL 4KRPC 2YPLE 3VWJD 3L3GB 3V0VA 3GSVB 4D2NA 5GRVK 3BP5A 4LLQB 4XMKL 3SDYL 5IROC 4G6FB 1MI5B 3BWUC 4FQHB 2X4PB 1BIIA 1QR1A 4XPAH 4L9LB 3QIWD 1HILA 3MNZA 2W0LA 3QPQC 4IRJA 3TLRA 3WFBL 4LF3B 1MJ8H 3SDXE 4M7KL 4ZXBD 1QSEA 3LS4L 1BVKA 4JZJA 1P7QD 2PW2A 3OAUL 2V2TB 1IEAB 2IAND 1AD0B 2W9LA 1F4AA 1ZANL 2WINA 5ESVB 3IDYB 3MLYH 3F6LA 3I9GH 1FVEB 2CRZA 3AM8C 1S9XB 1IGFH 2Q20A 4Z7VE 3TF7C 5KZCD 1MCRA 2F54B 1RUPH 5C0BD 5ITBH 1Q1JH 2JCCE 2XA3A 2V6HA 4GAGH 1N0XH 2VLJA 2QR0B 3GZKA 4Z7OE 4QXUH 4WFFD 1FLTX 4JPKL 4OCRL 1EMTH 4PJCB 5CSZA 3UC0H 1QFOA 1LVEA 3TA3A 1J8KA 4NHCH 1NCAH 5J11C 2GSGA 2EE2A 5EN2A 1MAML 5D71L 2ATKA 4JG0H 5E2WL 3EUUA 4OLUL 5HSFA 1OY3B 1RUAL 4YXHH 4CNIA 3TA3B 2V7NA 4XMKH 1NFIB 1ZT4A 3MODH 4UIKL 5GGVH 4GW5A 4Y4KC 4OV6F 5F97E 4CJ1A 4ZD3H 3K2MC 1H0DA 4I18B 5F93C 4HZAA 3MLVL 4WTZG 3U6RA 1MUJB 4H25A 1FAIH 4WCYL 4PJXF 4FQHA 4PY8I 4OZIE 2PTTA 4P4KC 1RY7B 1JI2A 3HE6D 1OAKH 4N5UA 4NQCB 1VSCA 3BE1H 3L3GA 1EJOL 4JR9L 5ESVA 1FL5B 3HE7B 1IGMH 1M6OB 1UXSB 3TIDA 4U1NB 5CJBA 5EBGA 1FG9C 2GCYB 2YWYA 4MMXC 1BEYH 2BOCA 4Q9BA 2F19L 4K2UL 3K8LA 2OR7A 2I25N 4P5TA 4IRJB 3G5YA 4OD1H 5EU7E 4DVRH 2O26U 2BCKA 5GGQL 1MCSA 3MUGB 4RMUA 4Y8AA 1S7UB 4HIIA 4BH8B 4R8WH 5I0ZA 4M7JL 1NBZB 1EEUA 5BS0D 3S5LA 5C0CD 5IFHL 2LABA 1PYWB 3N06B 3QFJE 1ORQA 2HRPH 4HDIA 5C0NC 3RVUC 1YA5A 4F33A 3U7WL 4B7LA 4PJCE 1RJYA 2FBJL 3QUZC 1R3HA 2B4CH 5KANG 4W6YB 1S78C 1T89C 2R2HA 3OKDA 1G0DA 1JNNH 4U4BA 4AT6B 2AABH 3GHBL 1T7VA 3HI6L 4TVSa 4UUJA 3NFPA 1DQDH 3S5LB 5I1CL 3GSXA 4HK3N 2DMCA 2DDQL 2K7PA 5JNYA 2APTA 4CADA 3QO1A 1KPRA 3BT2H 5C3TA 2JELH 4C83B 1JTTA 3W9DA 3AROA 1A7OH 2EZ0C 3HUJB 1ZVSB 1EJOH 3GSNH 1G7JB 1MREH 4P5KB 5BRZA 4KJWC 1FFPA 4R3SB 5INDB 3JTSA 3D25B 4W6XB 4LAQL 4KDVA 3WIFA 1BZ7B 3B9AA 4XCCH 2PYEE 5DT1L 2GK0A 1KPRB 4R26L 5GISH 3QUYB 2D03H 1QTYT 5DD6B 2A77H 3ARDB 1W72B 3Q1SL 3VXOB 5GRZA 4LPCA 3SOBL 3K81A 3GKWH 1U3JA 5ESQB 2AP2A 4J3SA 4NC2B 2PYEA 4M62H 1AR1C 3ALWA 2HTLD 5IF0A 1TTGA 4P2QD 4BSJA 3PGCA 3HS0A 4ESKA 4OGXL 1KTDB 1UYWL 3AS0A 2UZXB 2DQJH 2QV2A 1M6OA 5F3HA 1ORQB 1OCWH 4ZXBB 4K3DH 3FOMA 3QHTC 1XIWB 1BGXH 3MXVH