3V95A

Crystal structure of monoclonal human anti-rhesus d fc and igg1 t125(yb2/0) in the presence of edta
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
212
structure length
212
Chain Sequence
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Ig gamma-1 chain C region
publication title Effect of zinc on human IgG1 and its Fc gamma R interactions.
pubmed rcsb
source organism Homo sapiens
total genus 31
structure length 212
sequence length 212
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v95A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3v95A01
4I18A 2WP3T 3U2SB 2WUBH 3QRGH 5C0JA 3P11H 3H9SD 4LHUG 3T3MF 4U1HA 2JCCF 1G9NC 5TDNA 1YJDC 1JHKL 4CVZA 2HN7A 3NFNA 2QSTA 2DKMA 3MV8E 3STBA 5F96L 5EU5B 3V7AG 5D2LF 4OTXH 3VRIB 3P73B 2D31A 2OQJA 4K8RC 5EU4B 5IGXL 4NC0B 4FQIH 5HI4D 4OB5L 3GI9H 4QXUH 1T1YB 5SV4A 3T08A 2R4RH 4HS6A 5L0QC 2DD8H 5F89A 3MODL 3PXHA 3D0VA 2AQ3A 1LE9A 3SCMC 2AK1L 3BD4A 3G04A 4KHXL 3O3AB 1I3GL 1FZKA 1OLZA 2E5EA 3MRGA 4L3AA 1OGAD 2NYYC 2A6IB 4XMLL 1A3LH 4LCUB 4KK8C 4P5TC 5IHBA 3KYOA 4NRYB 2ORBL 5IQ9B 4RZCA 1TJHL 2XN9D 5DC0A 2OJEA 2R56H 3RWHA 4JFXB 4KMQA 3EHBC 2FRGP 1OGTA 4KRPB 4Y1AE 1GGIL 2P45B 5JUEH 4MAYB 4X6DE 1YECL 4AH2A 1JTOA 1NLBH 2R2HA 2ADIA 1F97A 4DGIH 5T1MB 2HFGH 1KTLB 1INQB 3WLBA 5CD5D 3LQZB 1WZ1L 2JB5L 1K8DB 1OAQL 3Q48A 4JN1L 4OT1H 5IHUH 4GG8B 4NZTL 1FL6B 5M94B 3ZKXB 4U49A 2JF1A 1MCQA 4OZGF 5E8PA 4PRBA 4NKIH 2WUCH 4MNHA 4L3CA 3VXRB 3S36H 4LVEA 1A2YB 1LK3H 1JNLL 1W72H 2HT3C 3QWQB 2R23A 5AYUH 1EFXD 4O4YH 5DS8A 2ZCKH 5CFHA 5DMJB 5E9DA 4MXVE 2YD1A 3EOBA 3BDXA 4G8FA 5DVNA 2CKNA 1OY3B 3HLAB 2IFFL 3EKCA 3FOMB 5E56A 1YYLL 4JFHE 5CMAB 2ICWA 2WWMC 5DJZB 1U92A 1RZKL 1WFNA 1I1YA 4PRHE 1MJJB 3V0VA 3R4DA 2Y6SC 4NQDE 3RY6C 4Z78A 4Y4KB 1QKZH 4K3EL 4O5LL 1JGLL 2QV2A 4U4BA 1BBJA 4P23D 5JW4N 5CP7A 1WZLA 2NY6C 3CK0H 2XY1A 3OGCB 5F44A 1MFDL 1ZA6B 4M8QA 4NRXA 4ORZC 1MNUL 1TJIH 4K71C 4KV5E 5I8CB 2EYSA 1UCTA 1I1FB 3QR2A 2FGWH 1QR1B 5FYKE 1Q8MA 1J5OH 3LDBB 5CS7A 4HJJL 3VXUD 3HZVB 4AENB 4JDTL 3L3OB 3BPCA 4NC1C 4XXCC 2YMXL 2ZZUT 3RWIA 3VWJC 5JQ6H 3OXRA 5BV7H 5DTFB 4YHNB 2HFEA 3B2VH 3L5IA 1F00I 3WXVL 3A6BL 3GSNL 5TDOA 3VWKA 5ICXA 1GPOL 2D2OA 3LVEA 3O2DA 4YXKH 2H32A 4KJYA 4WV1A 3KPOB 5ACLA 3UYRL 2MCPH 4OD2A 1BPVA 3LHPL 3NIDE 4X7SH 1VEOA 3HMXL 2OZ4H 2X42A 2D7MA 3S35H 1MF2H 1M7IA 2VMFA 1DBMH 4MA7L 3QRFM 4PJ5A 4MB3A 3C8KB 4Q74A 3MBED 5BQ7A 3FONB 5DJCB 4QXGL 3THML 3L95A 5L0QB 3MV7A 4WTZG 4LSUH 4EUPA 4LCYB 4PJEA 3VFSA 2GI7A 4TVPE 5DC4B 3GIVA 3N1MC 5IBTH 3TBWA 5IW1B 2HVJA 1A14H 3MXWH 4FTVE 4HBCL 2W0LA 1H15B 1IL1B 1S9VA 3X17A 2X4NB 2NY2D 2Z4QA 1RPQA 2DL2A 3MRNA 3OJ2C 5DDHB 2EE9A 3WIFA 4R7NB 4C83B 4MS8D 5B3NA 4N0FA 3IJYA 15C8H 3CH8A 4PJ8B 4Y8DC 4J3TA 1UZ8A 1UWGL 3LQAH 5JPNA 1XF3A 4ZS6C 5E2VH 2R0ZL 2OK0L 2VR5A 3IDYB 2B2XH 5DJ6B 4BZ2L 4QRPE 4XNUL 3LQAC 4EOWL 4BFEA 4LEXL 4U1KA 3CSYA 1NMCB 5J1AA 4WFEE 4GKZA 4UTBL 2DQHL 4K7FA 4MMXC 2A0LC 3JV4A 4OLZH 4MJID 1AHWC 4XWOC 5E2WL 3D25A 5GJTH 4UT9L 1FNHA 5C6PB 3ARZA 1JPSL 4DKEL 3MJ7A 5A43C 1U95A 3IS0X 5GGTH 3MRFB 3DLQR 3SKUD 3BZDA 2FO4A 1EUUA 2V5YA 1TZIB 5HHOD 1QVOA 2R8SH 5ACMA 1DQQB 1CE6B 2AJ3B 4OKVB 4M7LH 3FQUB 4APQD 2P8PA 3T0AA 5ALBL 2R2BA 4C4KO 1FLTX 3IDUA 2P4AB 2ZPKH 1J0JA 4WHTA 5GHWL 4YHOH 5ESVA 1MFNA 3DUUA 2CO7B 1CYGA 3MCLH 4NPYA 1UB5A 4NBZB 4JFFA 3RGVC 2VZOA 1QEWB 1RZFL 3D48R 1AR1D 4H1LH 2ATKA 1HH9A 4IRSB 4JHAL 3ULVC 1NAML 1FNAA 4X4XA 5IB3B 4JKMA 1IC4H 5DLMH 2MJWA 1AP2A 2AJVL 2YUVA 3C6LD 1XIWB 3CAFA 2J8HA 4RAVA 5F9DC 3VFVB 4K7PH 1WTGT 1CVRA 2W60A 1XCTA 2EYTB 1DVFC 3D2UD 5I1HL 3O6FC 3OKMB 5FGBA 4WCYL 4DTGL 4IMKC 2V2WA 4HCRA 5GS1C 3AREB 2C3XA 3QUKB 3HZMB 3NCCB 3BISA 1BJ1H 2PXYD 3QUZB 3C60D 4LLVB 1S7VB 3O2WH 3WNOA 1T89A 4LSDA 2GK2A 3RUGF 4MVBC 4G6KL 3P9WB 4H5SB 4I1NB 3VDCA 1K3IA 3MGAA 2MHAA 1HHGA 4R96A 2AJSL 2R1WA 5F71A 3WDHA 2Y5TB 5IEHA 1TCRA 1TFHA 1QFOA 3KPTA 3DROB 5INCB 3WFHA 5I1DB 1CIDA 1QR4A 5IR1A 2CK0L 3QEHB 4J1UA 5DMIL 2HRPL 4ZOBA 2H2PD 1FCCA 5D72L 5EZIH 3LKQB 4B0MM 1QNZL 5EPMB 2NY4D 4H25A 1KLUB 3FFCA 1CIUA 1Q9OA 3IT8D 1P53A 5D7SH 1JV5A 4GSDL 3LH2L 3MLSL 4JY4B 5KS9E 1MVFA 1FCGA 4BK5A 3Q5OA 4EI5A 3ARDB 5CEZH 1FIEA 3TO4D 1C5DA 2HMIC 1CXLA 1NFDA 4LCCA 1KJ3L 5ACZA 5IKCA 1VFAB 5KAQG 4NN6C 1LO3L 1XT5A 2ATPB 3A67L 3CFCH 1CGVA 5HD8D 5D9SB 4XNMA 1OVZA 3NBNA 3BKJL 5JXED 5KVEH 1J1OL 4LDEB 1W0YT 1IBGL 3X12A 2CGRH 1JNNL 5DJ2B 3OPZH 3ARFB 3P4LA 1CDGA 1U3HA 3HI5H 4JM2B 4U1IB 1GHFL 2VDML 4LU5H 4QRUA 2WINA 2IPKB 1NC2D 3QNZB 4ZUUA 1T7XA 1EH9A 1T4KA 4TPRL 1ORQB 4M6NL 3DGGA 4ZQKB 5HGHB 1XMWA 4PJ7B 1G84A 1F3DH 1EGJA 3UZQA 1YN6B 2YN5A 3WHXA 3JTTA 3MREA 3WXWL 3KPNB 3L7FA 3SE3A 3CFDA 5J9PA 1B4RA 2O5ZL 4XCFH 1T0NA 1MAMH 3KG5A 3QNYA 3QHZH 4LIQH 1KGCE 2Y36H 1JGUL 3IETA 2X4PB 4HK3J 1ADQL 2V2TA 2DQDL 3RU8L 1BOGA 2IF7A 3RGVB 3KR3L 3G5VB 3OAUL 3BEVB 3EYFB 1C12A 1NCDH 5T1LB 4UU9B 5I8EB 1FO0H 2R2CA 2JKXA 1HH6A 4XVSH 2IH3B 4ZG1A 4EN3A 2JIXB 5I15L 4GBXA 5EORH 3MOBH 3SE9L 4PJAB 1RHFA 1NL0H 5F3BB 3OKKA 4Z5RA 1DVFB 4PS4L 3ESVF 3L1OH 3BKYH 5GS1B 3JV5A 1V7NL 1DLFH 2NW2B 5DD5L 4UV7L 1AGFA 1Z9MA 1N8ZB 3U4EA 4Z76A 4KY1L 2A74B 3EOAB 1KN4H 5HVGB 3QHFL 5TE6L 4YFLF 3E8UH 4D9RE 3IGAA 4LBEA 1OM3L 3RVUC 4G8IB 2X9YA 1RZGB 3CC5B 5C0DB 4L8CA 1KJVA 3DX7B 2CJUL 1J7VR 4Y4HD 2YD9A 4N90D 4GXUN 4D9QE 2XQBL 2Z31B 2ZNXA 4M48H 2VO5A 5DVOA 3HE7D 5DJ0A 1L6XA 3HPJA 4ZYKB 3HE6A 2CRZA 1V5JA 3W5MA 1WBYB 1KULA 3MFFA 2WQRA 5F7LB 2G60L 2PN5A 3O9WB 4HAFA 1YNLL 3BH8B 4BSWA 1T22B 1FGVL 2IADA 4XB7A 3AGVA 5IF0A 1BD2B 1CT8B 3WS6C 4KRLB 1KELH 3DV6B 3VFPB 1DL7H 4LKCA 1YEJH 3O3EB 5HHXL 4N0CC 3T4AA 5D1XD 4ODTH 4HKJA 5E4EB 2IBZX 3RTQA 3BW9A 1HHIB 4M6ML 5LGHH 4WUKH 4NRZB 5JZ7C 4POYA 5FK9B 1SYSA 5DJDA 1QBBA 3D3VB 3G6JF 5EBMA 2NZIA 4FQ2L 3EGSB 4Y19B 4ERSL 1QSEE 4A6YB 2W92A 4AEHL 4L29B 2FEDC 1BQHB 1FZOB 4NC1E 2HKHL 4RFEB 3QT2A 1JGVH 5SX5K 4QTHA 3P0VH 3P2TA 4S1RH 3BP5A 1E6JH 4HJGB 4LASL 3K4DA 2FH8A 3RWDB 4F57H 1BREA 1MFBH 4JFEE 3TYFB 3U9PH 4XBGA 4PD4K 3CPLB 4KZDH 1HKLH 4PJHB 3GHEH 2BSRA 4X80L 4MNGA 5CSBA 4AT6B 5BS0B 4FQLH 3N85H 3SE8L 1FPTH 3QEQD 3CDGB 4UI2A 1UG9A 2XTLA 1H8OA 4AYFA 3DSFH 2BNRA 4MNQB 3GK8H 3CDFA 1EA9C 2NY5C 5T1DH 1KNOA 4WW2A 3RWEB 4P5KB 1E27B 1B9ZA 2XG5A 1EO5A 2P43B 1VESA 1YEEH 4MDIB 1AFVL 2GJZA 4LKXA 4PJGB 2VABA 1AXTL 1UH4A 4D0DA 4PLNC 4G8GA 1PD6A 5GZOD 2DAVA 4OCXH 4Q7DA 3VFTA 3UJTL 1I75A 3QUMB 3G6DL 4KTEH 3JWOL 3OSKA 3QG7H 5ALCL 2QR0B 1Q0XH 5F88A 4I5BA 2VH5L 1MCSA 1MREH 4KI5D 5EFIB 4R4BB 1EPFA 1FC1A 4MJ2A 1YEIL 2VTFA 4R97C 1X4XA 4ZUTA 4E41B 1RUPL 1K8IB 5D7IF 1QUNA 1II4E 4WY7L 2XTJC 1YQVH 1RU9L 4TUKH 2CUIA 5C09B 5B21A 3OAZK 5C0GA 1LEKB 2DQCH 4QRSA 4TOYL 3EFDH 2AGJL 1UCBH 4GFTB 4ZSOE 4KHTL 3ZT5A 2I07B 4F33A 5GISL 4YDKH 2EDWA 4PJ7E 2E8YA 4YXLH 2JCCB 3QPQC 3TNNA 4NQSA 3UXFA 2XKSA 4WWKA 3R1GH 2XA8L 2AQ1A 2X4SA 4GMSH 3A0OA 3PNWA 5D2LB 3IDGB 2CR3A 4JR9L 4U6VH 5HTSA 5C08A 3HC3H 2NX5B 3V6FA 1CR9L 3MACH 1FHGA 1F11A 1F4YL 3E2HB 3H7LA 2HFFA 5IFAL 3RGHA 1G7MB 1KN2H 1SMAA 4ZPVB 2AK4B 2IG2L 4M4RA 3FT2A 4PJ9A 2OLDA 3BN9D 4WDIA 1CDYA 1UWXK 3X3FH 1QZ1A 3NCYP 3HMWH 2LU4A 4ODVL 2MTPA 4GW4B 4N0UA 4PJAE 3FB8A 4X8JB 3TNMB 1YYML 3QUXB 2X70B 5LAXA 1I1AB 4J2XA 3GJEB 4HKZA 4U2YA 1EERB 4G6JH 1GZQB 4JRXD 1D5BB 1NGWA 4S2SB 2G5RA 4UMGA 3FT3A 2KZ1B 3V4VL 3UTTE 2AEQL 3KLAA 1OTUD 3ME0A 3MV11 2YUXA 2V2XA 4GLRI 3MA9H 5H2BA 3BDBA 3IJHA 5DD1H 1RURH 3GKZA 5H35A 2CUHA 1SMOA 3RNKA 2I9LB 4JY6A 1FDLH 1MLCB 2DQTL 4EXPX 4P3WA 5E8NB 2ESVA 1Z9SA 3GJFA 3O3UN 2ARWA 4JLRB 1L7IL 1G6RH 4NNPH 4ZFFB 4YGVA 4OUUB 1T1XA 2HT4D 1ADQA 4DGYH 1L0YA 2CKBH 3K2UL 1BD2E 3QWRA 3VXOA 3PP3K 3ZE1E 5HY9B 3MV8A 3BGAA 4UILH 1V05A 5JIPA 5IMLB 3RWFB 3BHBB 2A1WH 3EDEA 1MFCL 2YSSB 3QXWA 5K9JH 4OQ1A 1FFOB 1DBBH 4RWYL 4JZJB 3NACH 4NHCH 2A9NL 3RVXC 1OSPL 1J0ZA 3CIQA 4YR6A 2L7UA 4PJFE 4HQQL 1KXVC 4R97B 4IM8A 3VRLE 4Y19E 3IXTA 3H0TB 2XTJB 4X4YA 4PJCF 3QIWC 3D69A 3I3BA 3VG9C 3K74B 1FZMA 1H9VA 3WMSA 5EBLA 3TBYA 4BSVA 4BH8B 3DJ9A 5F96H 3L5HA 4FQPA 4X5XA 5B3JF 2QHLA 4Q9QL 4YXHL 4F7TB 5BXFA 1ZS8B 4TSBH 5ISZE 1CGWA 5C0RH 1T21B 5IGXH 2R2EB 4OCNC 5C9KA 3FO2B 1K85A 2PO6D 3B6SB 2C4XA 4PJHE 1V7ML 3KPRD 5BS0E 3MODH 4R9HA 4Y16B 2V9TA 1I3GH 3U0PB 2Y7QA 4HPYL 3FFDA 4QOKD 3V5HA 5HPMB 5ID1B 3W5NA 1AXSA 3MMEA 3OJMB 3PF2A 3VI4F 2Q3ZA 1E28A 1JHLL 5IVZB 3FHAA 1ZT7A 4V1DD 3V0WL 2QHRL 4TNVF 5JDSA 4EVNA 5F7HA 4XT1C 1OAXL 3HZKB 1I3UA 5FFLA 4PJGE 5IM7B 2CLZA 5FOBB 2IAND 4LHUA 4HS3A 3RVVD 4NQED 4J8RB 1A9EB 1B2WL 4UUJB 1OAQH 2KKQA 4WO4D 4PRHA 1FLRH 4X6CA 4JAMB 2LFGA 4TNVK 1OAUL 1GJIA 32C2A 5HHPB 3WN5C 2QEJA 2QSVA 4XMKL 3JXAA 3TT1H 4NT6A 4NZJA 1JNLH 2BX5A 3PABB 3MGTB 4E41E 3QDJD 3JTSA 1P4IH 4HC1H 4JKPL 2J5LB 4MWFB 5CWSB 4DEPB 2V7NB 3O8XB 4JVUA 2A38A 2NXZC 2ESVD 2IFFH 4TYUA 5JOPD 4JVPA 5F8RC 1SY6A 1A7NH 5C09E 5IOPA 3SDYL 4MD5B 4NNXB 2VXTL 1BZQK 2NQCA 3ARGA 3U7YL 1NGQH 1N26A 4OGAC 3WS3B 3O11B 4M6OL 2OL3B 5GGRY 3UYPA 5GRJH 1NJ9A 5D6DA 4K3EH 4O5LH 5AWNH 1JGLH 4JPIA 5ICYA 5C0IB 3T0DA 2C7UB 4K3JL 3T3ME 4CVWA 4KKLD 4OF3A 3FO9B 2JCCE 2KZWA 5HJ3A 3GSVA 4OFIA 1CDHA 3ARBA 3PGFH 3O0RH 2ZUWA 3OKOA 5CEYB 3BXNA 2VDOH 4YDJA 5D2LE 5FM8A 3FB6A 4JJ5B 2I25N 2NX5E 5CJXA 4UIMA 2W9DL 3GSOB 4KC3B 3HI6L 3Q1SL 1YEGH 1WCBA 3QUYA 2CIKA 4P3CH 5FYJL 2AK4E 3RAJL 3GGWA 4I9WE 2YMXH 3LSOB 4LHJB 3ILQD 3S3PA 3L5JA 2BVUA 3ROLB 4G42B 4XCEB 3IVKB 4PREA 3G08B 5FA4A 4PV9A 2IQ9L 1R5WB 4GW5A 3A6BH 2VOTA 5I8OH 5DT1L 3KHOA 4OJFL 3C5SB 3ARUA 5E03A 2H6PB 3VH8B 3HMXH 3NFPB 4O2FB 4NWTH 5F7YC 3MJ9L 1F3JB 4L4JA 5K9KA 1X5AA 3C08H 1MCNA 4JEGB 1R3IL 3QCVL 4U3HA 5F6HI 3INUL 1IGIL 3VE0A 1BIHA 1OAKH 3RUGB 1FSKC 5ID0B 1PW3A 1KCRL 4ZS7L 5D71L 1U91B 4OZGE 1EDQA 5DHYB 1B3JA 4DUXA 4P59L 4KVNL 1TVDA 3G6AA 5FYJU 3U2SA 3AUVA 5CINH 4MQXD 3W0WD 4AEEA 1CLZH 3WKMH 4DZBB 4X7DC 1MCIA 4PRDB 1KG0B 2R0ZH 3RKDD 3MUY1 4LOUD 2EDTA 2I5YL 4BZ2H 2K1MA 5SWSA 1XGRA 3IFOB 5EU5A 1QLEH 4GW1B 4EOWH 2J6EL 3PG2A 4LEXH 3VRIA 2WWKO 4C58B 1E4XL 3SDDD 5AG9A 4UTBH 5I73C 2DQHH 4Q9BA 1T1YA 2BSSB 5C7XH 1S5IH 4GLRH 3RL2B 3DARA 4GJTB 5D70L 1JZ5A 3S8WA 1NCAL 3O3AA 4WTZA 3GEWB 2XTJE 4DOHB 5IEKB 2VXSH 2IEPA 4WFFD 3CSBA 3UCRA 4LCUA 1XGPB 4FMFA 5J1TC 3RWCB 5ALBH 3C5ZB 5IQ9A 1NMAL 3DYOA 4JFXA 3ZHKA 5T3XH 5A1AA 2GFBB 2AV7A 3AS3A 4MAYA 1N4XH 3ARBD 3CMOL 3BPLC 3BQUB 2FATH 3LRHA 3O2VL 1CFVH 5E8EB 2FB4L 5T1MA 1KYOJ 1WZMA 3V8CA 1INQA 1RZFH 4JG1H 4KZEL 4X7FC 2XPGA 3P0YH 4JPKL 3GMNB 4YEFA 2WNGA 5KSUB 1ES0B 1NAMH 3CX5J 4GG8A 2I9TB 1FL6A 3GIZH 1VPOL 3H6JA 3SJVD 4U7SA 2YC1B 3QUYD 3SO5A 1JTTA 4RDQG 5B8CA 3VXRA 1PGRB 1E4JA 1A2YA 4RISL 2RFXB 1KC5L 2LVCA 4LEOA 3S98A 1MCOH 3GBMH 3FZUC 4MA3A 3TIEB 2LTQC 3GM0A 1JP5A 3GMOB 4Z77B 1OD9A 1EIBA 1JF6A 3DMMD 3HLAA 2WBJD 3R06B 4NO0B 4X98B 2N7AA 4OD1H 5CJOH 4LGSB 3FOMA 4LP5A 5E1AB 3MLTB 5CMAA 1AKJD 1NGXA 5DJZA 4AZ8A 1T6VN 1MJJA 4G6KH 4AK1A 2E7LC 5LQBL 4FRWA 4JB9H 4YZFF 8FABB 3V7MA 3VXSE 4BJLA 2VUOA 1CLCA 2UUDK 2BVEA 4KJWD 2CK0H 1D5MB 1KCKA 5GRYA 3OGCA 4KK9D 5IMOB 1KF9B 2EICA 4LVNC 1ZA6A 2BRQA 1A4KB 1QNZH 1MCDA 1I1FA 1QR1A 3IFNH 1TIUA 4ZNCD 1L7TL 4XNXL 1FNEA 4OCRL 3MRRB 4ZXBC 4KDTC 4AENA 3L3OA 5C92A 3EYSL 3MLSH 2BNQB 5DTFA 3B9AA 1RZIB 5F70A 5KTEL 2P1YA 3HN3A 4G8EA 3UJIH 1ZA3B 4OLWL 1FYTB 1H3UA 1LO3H 3KPOA 2DM4A 2VE6B 1OARL 1UKQA 4M1DH 4O2CB 3O3BB 2YD4A 1WITA 5EOQL 3BKJH 4LSVL 4YE4L 5HDOA 3TYGH 3DTXA 1FH5L 4HFUL 2W65B 1MRFH 1I7UA 1IBGH 3C8KA 4ZUSB 3FONA 3O4LB 1BAFH 5DJCA 1KPRA 4ODSL 4NKOB 5HGGS 2WW8A 4K07A 1LE5B 2F5AH 3RX5A 5IW1A 1JYVA 3SDAD 1DQML 4R6UA 3DYPA 4RRPG 3MV9A 5I17B 1MELA 4HH8A 1H15A 4TPRH 1IL1A 1M6OB 2X4NA 3IU3A 4R7NA 4C83A 3RDTB 3NCYS 2O5ZH 4FQJL 4PJ8A 3OXSB 3LKNB 3GO1H 3BN3B 2LV4A 3HAEB 5BZWB 3C09C 1JGUH 4PV8B 3MOAL 5MEPB 5DJ6A 3HCVA 3OAUH 5GRUL 1WWAX 1Z3GH 1CWVA 2CQVA 3UPCA 3RUGE 2J88H 4U1JB 1NBZA 2F58L 1O5DT 2GW5A 3PWPA 5MEND 5GJSL 1BBDH 1DBKL 4FFYL 5EOTB 1JBJA 1A0QL 5C2BH 4UT6H 2DLEA 1JFQL 2QQKL 1SEQL 2JJSA 3DVIA 1WICA 3ZTNL 2LU7A 2QADB 2AXGB 2FZ3B 3HTLX 3GNMH 5DD5H 4UV7H 4CVXB 4JO3L 1TZIA 2B20A 3U1SL 1DQQA 4WGVB 1CE6A 4KY1H 1ORSB 5AAMA 2CUMA 4OI9A 2AJ3A 4OKVA 2HTKD 3FQUA 4JFOB 2VLKE 5TE6H 1CN4A 2IBZY 4IEFB 3CVIL 4RNRB 2BFVH 2H1PL 3ZTJG 2YUWA 5D1ZC 4NYLA 3UTQB 3ZLQC 2XQBH 3VDBA 4XVTL 1S3KL 3AMKA 2EECA 5I71C 2GQHA 5E8DH 4XCCH 4S1SL 2FHBA 5TE4L 1QEWA 4I4WB 1FNSH 3ZZ1A 4LVNB 4IRSA 1KEML 3ALPA 2G60H 2R29L 5IB3A 4G3YL 2XT1B 3F7PC 5D7IB 1YNLH 4XX1G 4QTIL 4M1GL 4BFIB 1XIWA 4L3EB 4HUVB 1WWWX 5I18H 1RI8A 1FGVH 5HYFA 4ZXBB 2EYTA 2VKWA 5IUSA 1GIGH 3OKMA 4NFDA 3PIQB 1SYVB 3FHQA 2CH8A 3BMVA 4HMCA 3AREA 3RHWF 5TF1L 3HI1A 1W72B 1KB5L 3HZMA 5FO8B 4FQXA 3QUZA 4Y2DD 4LLVA 3TV3L 4EKXA 1DUZB 3T0VA 2HTLC 1RHHB 2OX5A 3DURA 2FX8H 3EDKA 4H88L 2W1NA 1AC0A 3GSWB 4JRYB 5I1EL 5T33L 5GRVK 4ONFH 3RHWK 4M7KL 5C71A 1RUML 3DROA 5GS3A 5INCA 1MCPH 3DETC 2J6EA 3BZ4B 3QIUD 3QEHA 4JJHA 1DP0A 2HKHH 3ZKMC 1NBQA 2V5RA 4HUUB 3SO3C 5L6YL 2P5EE 1ERNA 1UJTA 3MV9D 4JFDA 3LKQA 5EPMA 3QQ9D 1A3QA 2FYYB 4KKCD 4K3DL 5IB1B 4M03A 4J3VA 4O9HL 1KLUA 4P9HH 1HSBB 3NZ8B 3VFNB 3LS5L 3EYQC 3ZDZF 1MCJA 3C87A 3HAEG 1I8MB 2FHCA 3K81A 1HDMB 3SE8H 3ARDA 3WO4B 1S7UB 4HHAA 4P9HC 3C09B 4LRNH 2EKJA 1A21A 4IRJD 4XNQA 1VFAA 1UVQB 3VGEA 4JO2L 4LPYA 1IFHL 5TE7H 1LWRA 4LMQE 4PJIF 1H3XA 2ATPA 5DQDH 4MQ7B 3PWPD 3TT3H 4D0CB 5J57B 5D9SA 5C8JB 4TRPH 2ADGB 1AXTH 1IC1A 3OX8B 4QT5B 5DJ2A 3ARFA 4HWBL 4R26L 4JM2A 5IMKA 2BNQE 3G6DH 5GPRA 2IPKA 3KGRA 5ALCH 5SV3A 1ULVA 5FYJD 2C3GA 3RPIA 2JJTC 3QNZA 4Q6IA 1TNMA 1I8IB 1ORQA 4ZQKA 5HGHA 2NXYB 2IGFL 2YZ1A 3VXMB 2VAJA 3KLSA 5AYQA 1X6NA 4P46B 3KPNA 3TM6A 1H3PL 3HR5B 5J3HC 4G6FB 1MJ8H 2NY3D 2DQJH 5HYEA 2A6KA 4YHYC 4LSRL 5IV2A 2G2RB 3BWAB 3HNTL 3O4LE 4NQXB 1ZANL 3G5VA 1IM9D 3BEVA 4OSUL 1OF2A 3S4SG 1KOAA 1F4XH 4LSSL 2B39A 4LRIA 4P99A 4KWUA 4UU9A 5I8EA 5T1LA 2AGJH 3G6JE 3WJJC 3DXAB 4XPTL 4RAUB 3MRIB 2IH3A 4G6ML 2H45A 3HC4L 2JIXA 4C54A 4B50A 3O6MH 3BSZL 1MH5A 4Y5YC 4PJCB 3QYCA 4PJAA 1RUKL 4L1DA 3NTCH 1I8KA 2G75B 4X7TB 5B38B 4UNUA 1HHKB 4HIXL 1KBGL 5EDXA 4OFVA 4P2OC 5GS1A 4JR9H 3V52H 2NW2A 4OZHF 4FQXD 1JWSA 2W9EL 1CR9H 1N8ZA 1WK0A 4LPUA 4NHUB 1F4YH 4N8VB 3EOAA 1HXMB 4FZ8H 1PSKL 2DB8A 4P3DB 3CXDH 35C8L 1EBPA 4NKDB 2D9CA 2ITDB 4G8IA 5CJ8A 1RZGA 4YDVB 3T0ED 4EQ3A 5C0DA 1NUNB 3DX7A 3HZYB 1LILA 1I9EA 2Z31A 3I75B 1UFUA 2O5YL 1YYMH 5IW3A 2DM7A 4I0PC 4QF1B 3RA7H 4ZYKA 3VXPA 4JFDD 3SO3B 1ZK9A 4MCZB 3MRPB 4F8TA 4R7DB 5IBLD 5CZXD 4OGYH 1WIPA 3ZDXF 2UVEA 3O9WA 1E4XI 1U8LB 4FFZH 1JPGB 3IRZA 2SEBB 4DN4H 4M1CC 3UTPE 3D9AH 3BH8A 1ACYL 2P5WB 5DR5H 1M7DB 2VLME 4GRLA 2ZG3A 4KI5F 5BOZG 1RULL 1BD2A 1CT8A 4RGMC 3K0WA 1OP5K 2PTTB 3DV6A 1DE4B 3VFPA 2DQIH 2X1QA 4R90L 4DKFH 5T1KB 5ENWB 4F7MA 2Z8WC 1PEZA 3O4OB 2PYED 1P69B 4YBQC 2X4UB 4WEBH 1HHIA 5KSBF 3N1FC 2DQTH 5HHNB 4NGHL 1MRDL 3ISWA 2XZZA 3FQRA 4AIZB 2BK8A 5FK9A 3CVHL 2R4SL 3D3VA 1S7WB 1XR9B 4FG6D 1A5FH 4I18C 2ZG1A 4UDTA 3EGSA 4Y19A 5C0CE 5D7IE 5B4MD 4A6YA 4QNPF 3HA0A 4L3EE 4XPGL 1VDGA 3K2UH 5GRXG 4KPHH 1FORH 1CICD 3FL7A 3H9SB 3MR9B 4A2LA 2ZNWA 1BQHA 2YA0A 1FZOA 3P9MB 1CTOA 4RFEA 2EEBA 1BVZA 5HHQB 4M3JA 4OFDA 3HC0B 4HJGA 5DD6B 1S7QB 3RWDA 1K6QH 5J6GA 4UIKL 3HB3C 1LGVA 2EH8H 1N6UA 5J13C 1N6QL 4XZUB 1X5ZA 1HI6B 1OSPH 4G9FD 4DVBA 4RX4D 2ZG2A 1OPGH 4NZUH 4AT6A 5BS0A 3RKPA 4JRYE 4EDXB 3K2MC 1I85A 4UTAH 3TVMD 4BQ9A 4KDWA 2EXWD 3CDGA 4NQTA 4QCIB 3QQ3B 5I1GL 4MNQA 2WV3A 4L4TA 3BP4B 3RWEA 4Z0BL 4P5KA 2OI9C 4XVUC 1E27A 2KPNA 3DWTA 1QTYT 4NFBA 2XN9B 2I60H 4J4PD 3B8SA 4JKKA 4MDIA 4F7PB 4Y5YB 3JWDH 2YKLH 1NBVH 4HK0B 4LLDA 5BVJB 2XWJB 3QJHB 5IJKA 5C07B 3TBTA 1V7MH 1WFUA 3EOTH 2M2DA 3WD5L 3QUMA 4QHLB 4WFGE 3SDXA 3JWDC 3CX2A 1CG9B 3MGOB 4UDUA 3CFKB 1QSZA 1UM6H 1VENA 4HPYH 1FYHB 3U4BH 4WW2F 3V0AC 3T8XB 4R4BA 5TDPB 5GGQH 4WGWB 1CU4L 2WQ8A 3RRQA 2CDFA 3B2UC 1EFXB 2QHRH 1KB5A 4C57C 2IQAA 3RJQB 4J6RL 3MRDB 2CMRL 1R3HB 2DDQH 1DQDL 3VJ6A 1YEHL 4I0PB 1FNGA 5F1KC 5DGRA 5I1IL 5I75C 3NAAL 3O41B 4APQC 1B2WH 1LEKA 3RBSA 4YHKH 4CAGA 4WENB 4H1LG 2F5BL 1LO2H 4J3XA 5T5NF 1S7RB 2I07A 4GRLD 1E6OH 2XZQH 4XMKH 2JCCA 3VXME 1FO0B 2AABL 1SHMA 4P23B 4NBXB 5IVXB 5H8DA 3H3KA 4MA8H 2ADFL 3P9LB 5H94B 1QRNB 1KENL 3GBLA 3QO1B 4JKPH 5D2LA 3GRWA 1M7XA 3NIFF 1AR1C 4NJAL 1T3FB 2NX5A 5CZVH 1QBML 4D9LH 5CILH 2ZUVA 4TVPL 1G7MA 1IAIL 4NOFA 4ZPVA 1DQLL 2GJ6D 3VXUB 3TIDB 1BF2A 3U46B 3DXAE 4K23L 3O2DH 3OV6A 2H32H 4M6OH 4PRNA 4WNQA 4Y89A 1PZUB 1Q9LA 2NY0D 5JXAL 2OSLA 4DGVL 4K3JH 2VQ1A 4UQ3B 4PJCE 1RK1A 3VWKC 5TDNB 4X8JA 3TNMA 3QUXA 3EYUH 5A16B 2X70A 5EN2B 1I1AA 2AEWA 3GJEA 4WV1C 1YY9C 3C60C 4MSWB 3QULA 3DI3B 5B3JE 4S2SA 4F37F 1ZLVH 3WE6A 2IAMA 2W9DH 1A47A 4YIQA 1IGYB 4LDLB 5J13B 5GSVA 5E5MB 1XGYL 5FYJH 2XZAH 1LDSA 3MCKB 3D0VB 5CSZB 3MBEB 1HIML 4QXWA 1WSST 3MRGB 1N0LA 4XWGH 1I3RB 1RMFL 1E4WL 5TQ0L 1HCFX 4OLXH 3GB7A 4F9PA 3KYOB 5E8NA 3ALXA 3H9YA 5A2JH 2OI9B 4FQCH 4JLRA 3VI4E 2NY2B 3CCHA 4XNYL 1OGTB 4ZFFA 4OUUA 2ED7A 2ZSWB 1S7XB 5DMKA 5DWUH 4GAGL 1R3KB 4JO1L 2P5WE 4R8WL 3QA3A 4GKNB 4QHNB 2R2HB 3H2WA 1ZT1B 1LO4L 2JB6A 1BFVL 2CDEA 4WUUD 4UOJA 3INUH 1IGIH 3WEXA 3OG6B 1BP3B 2FSEA 5HY9A 4U1MB 4XMPL 1BEYL 4BSJA 5IMLA 3RWFA 3BHBA 4F58L 1KCRH 3DVNB 4P0DA 1GGBL 1A7OL 1T1ZB 4YDIL 1VGKB 3O81A 5ICZA 1K2DB 2X89D 4JZJA 2PYFB 3BGMA 2VISA 2FGZA 3MRKB 2VLJE 4MJIB 3VI3F 4MXWH 1A6UL 4JN2B 5L2KD 5E9DB 1VB9A 1JYNA 2DQGH 3LIZL 4R0LA 1UWEL 3H0TA 4DZ8B 1GC1C 1MCEA 4HXAL 2E9JA 1WEJL 1F90L 3H9SE 3ZL4L 1ZOXA 5HHOB 2Z8VC 1UM4L 3NA9L 2I5YH 1QSFE 1U92B 4APQB 4BH8A 2FX9L 2OR9L 3OBAA 5GGSY 4F7TA 1E4XH 1T21A 3V5DA 1BBJB 2R2EA 3AU1A 3I9GL 1H5BB 4CN4A 5CAYB 1BVKB 3FN0H 3QAZC 4ODXB 4NCC2 3B6SA 2WP3O 2FX7L 5D70H 2VDPH 4NRXB 1G9MH 5AD0A 4Y16A 1NCAH 5C86A 5E2TL 4UBDD 3U0PA 3C2AL 4JHBA 4MXQD 5HPMA 5TF0A 12E8L 4K9EC 1G9MC 3C6LB 3CJJA 4Z7OF 3RWIB 1NMAH 2AVGA 5FYLH 5FGBC 4CUCA 3D2UB 4LAQL 4JO4L 2XN9E 1QLFB 2HFEB 3H9HB 4O02L 1D9KD 3HZKA 2EO1A 2GITB 4WHYG 5IM7A 5MEQB 5E6YA 3AFLA 3VFRB 4YHZL 3M1BB 4HK3N 5C07E 4KJYB 2Z93A 1T89C 3C60B 5ADOH 4KZEH 1A9EA 1DCLA 4JDVA 2XQYG 4UUJA 5DEGB 4GAYB 4JAMA 3UJJL 1M7IB 2QSCL 4OLUL 5HDBF 5C3TA 4L5FL 5HHPA 2PNDA 4HUKB 3L95B 1QD0A 3AROA 1J1PH 4EUPB 2FIRT 3VD7A 3VFSB 3MA7B 3MGTA 1UACL 2VR9A 5K9OB 1NAKL 2H26B 3ARTA 1SEBB 5AUMA 5IESL 4OUOA 4OV6F 3TBWB 4MWFA 5CWSA 1TQCC 2V7NA 3M07A 3O8XA 4Z7NF 4RFNC 1S9VB 4MB4A 1ZLWK 2Z4QB 1KLFA 4MD5A 4NNXA 1N5AB 4BQ6A 1G9NL 1N5YL 1RIHH 1ZEAH 4JFPB 4X6CF 1YJDL 3SKJL 3WS3A 2GCYB 5I2IB 2WUBL 3QRGL 5LQBH 3TO2B 1KLGB 2OL3A 4HF5L 4ZO9A 4EEEA 5JPNB 5C0IA 3UDWA 3WYRA 4K8RL 2LABA 3TO4B 2YS4A 3LKSA 1JNHA 4DN3L 1CDIA 4M93C 1QRNE 2PKDA 5CEYA 5M7QA 4OTXL 4U1KB 5DD0L 3BZEA 5ECJE 5IT2L 1I1RA 3WSQH 1O7SA 4JJ5A 4TUJA 4FQIL 2BVOB 3GSOA 3GI9L 3O6LL 5SWZD 3MOQA 4BQBA 3D25B 3MNWB 1L7TH 4XNXH 3STLA 4F3FB 3P3YA 1CCZA 1U3HC 1I7RB 2DD8L 3MJ7B 3VXUE 2C3VB 5EO1B 4MJ5B 3T77A 3LSOA 1EGJH 2VZ3A 5CLTA 3ROLA 1DBJL 4XCEA 1QVOB 2HKFL 3G08A 1A3LL 2P8PB 2R2BB 2EKSA 2CLRB 3C5SA 1G1CA 2QQLH 3SE3C 4WHTB 4BUHA 2D03L 1ZGLB 4MAUL 5A3IC 5B39B 2MSPA 5JPMB 4YE4H 1DN0B 2VNCA 4KGJA 4NPYB 1F3JA 1FH5H 1MI5A 1NLBL 1UB5B 3MTRA 4GT7A 1EFQA 2HFGL 3S9DB 3BH9A 5K9QI 2ZKHH 1HHJB 4Z18A 3RUGA 4L8DB 2CKBB 2Y9RT 4LLWB 5ID0A 2VDRH 4N0YH 1AP2B 3MUJA 4EN3C 2WUCL 1U91A 1X5YA 4GBXC 2Z91B 3S36L 5DHYA 1LK3L 3RZCD 3FQXA 5AYUL 3WNLA 2BVYA 4O4YL 4IOFD 2ZCKL 1HN1A 5HXMA 1TCMA 4ALAH 5JR1H 1W0WB 5GZOC 1GAFH 5JOFA 3KJ6L 4DZBA 1KG0A 4NFCA 2ZCLL 3WO3B 1A6WH 1Q1JH 3MOAH 2X05A 3IFOA 4GW1A 3PHOB 1QKZL 4PLKC 3EO9H 3L3GB 4JANB 4YZFE 3QEGH 1TCRB 4UB0H 3SDCD 4Y4HB 3WFHB 4BH7A 1A0QH 2BSSA 3TJHC 3CK0L 3RL2A 1H0DB 2QQKH 4MD4B 1CL7H 3HE6C 4XI5C 5E9DE 4GKOA 2D4DA 3ZTNH 4OI8A 2DBLL 4PJIB 1TJIL 4OGXH 1TQCB 3RVWD 4YFDB 4RFNB 2FGWL 2F53D 2FEEL 1J5OL 5HHOE 3CGTA 4CJ0A 1XGPA 3EDDA 3S5LB 4F7EB 3RWCA 2OMBA 4RRPA 3BYTA 3C5ZA 1WBXB 5F1IB 2EZ0C 3CVIH 1J8KA 5JQ6L 1KTRL 4EZMA 5EBWA 2GFBA 3TPKA 4FXLA 4QRQB 2IMMA 5ETUA 5GS2D 1ITCA 5ACZB 5IKCB 4XVTH 3BQUA 3RTQC 3ULUF 4YXKL 5D1XB 4M93B 3PP4L 4G6AC 4DCQB 4NQDD 4X7SL 4XNMB 3GMNA 5E5UB 3REVA 5KSUA 1KEMH 1ES0A 3S35L 1PQZA 2I9TA 2R29H 4TN9A 1DBML 2OR7A 4OBSA 2YC1A 4PRID 2OMNA 3BN9C 3TA3D 4I0CC 4NWUH 3X12B 3K7UA 3L6FB 2RFXA 4RIRB 4BFBD 4OZFB 3BDYH 2BVPB 2WSKA 3KWWA 3TIEA 5IBTL 5HI5C 3GMOA 4Z77A 1BFOA 1A14L 3MXWL 3R06A 4HWNA 4X98A 4LVOB 4F9LA 5F1SA 1F3RB 1TPXC 4PY8J 3WHXB 4WHDA 3T1FB 3VRJB 3JTTB 3L7FB 5B39G 5J9PB 1BHGA 15C8L 3R8QA 1MI5D 1NFKA 3QNYB 4H88H 3LQAL 5H37H 4CADB 5T33H 4OZHB 3IETB 4PJ5E 5E2VL 2ED8A 4FOMA 4M7KH 3D5OF 2AI0H 3B5HA 3QEQB 2B2XL 2E8ZA 4NOBA 4WW2C 1D5MA 1C12B 3UBXI 3CLFL 5L6YH 4S1QH 1HE7A 4LCIH 5IHLB 5DEZA 3QWOB 3RVTD 5FIEA 4LLAA 1A4KA 2YK1H 3U30C 2VDNL 2Y07H 4OLZL 5GJTL 5DVMA 5IWLA 2HT4C 3DX6B 5LCVL 1NEZG 3DO7B 2J2ZA 3G5YB 4TVPD 4PB0L 5GGTL 2HJLA 1P7KB 3WBDA 1U2HA 4R4NC 1CE1L 5I30H 3BKML 1RZIA 4FTVD 4Z76B 2R8SL 1T7ZA 5CIPA 2CO6B 2OXHA 4ODUB 3U7WL 3EZ8A 2DTSA 5D7KD 4GRWF 4JGUA 1K5NB 4HMEA 1ZA3A 2E9WA 3GKWH 4NNYB 2Y06L 1IFHH 1FYTA 2ZPKL 1AC6A 2VE6A 1KJ2L 1KJVB 3AVEA 4Z8FH 3IDXH 3O3BA 4JGMA 5ILTH 4WI2A 1RQ5A 3SKNB 3GSNB 2X4TB 3ULVL 3HKFA 3MCLL 4RMTA 1FP5A 2W65A 4NZRL 2OM5A 2AJYL 3QXVA 4ZUSA 4QRPD 3LKPB 3J7HA 2EC8A 3FKUS 3CFIC 5KSBB 4NKOA 1B90A 3WFZA 3VD9A 4WFED 3PL6D 3D87B 1D5IH 4K7PL 4X4ZA 3Q0HA 4ENEC 2IGFH 3DHJA 1X7QA 3G5ZA 1V3MA 1Y18A 4XBPB 2HLFC 5IP4A 4WWKC 5LBSL 3RDTA 4YQXH 1MCFA 1LDPL 3LKNA 5GQBA 5JNYB 2MMXA 3HAEA 3VXQB 3BI9X 3T4AB 5MI0B 3E3QC 5EG6C 4LSRH 1CQYA 3O2WL 4D0BB 1TJGH 2YRZA 5MEPA 3MLRH 4ZNEE 2VZ1A 4PJ9C 4JCLA 1YUHA 5EBMB 4LSSH 5LKNA 3RFZC 3K8LA 4U1JA 3QCUH 4X7EC 5F7KC 1BQLH 4XH2B 4KK6D 5EOTA 4OZFG 1RUKH 4Q6YA 3U48A 4WU7A 3QFDA 1RUAH 3FB5B 3W9DB 3CXHK 4HIXH 5FUZL 4GRMB 3RVVC 3MPCA 2AXGA 4JRXB 4CVXA 4P4RB 2W9EH 2WIIA 3BWUC 4WO4C 3BRDA 3T2NH 3J8F7 4PTUB 1ORSA 1TPXB 4IRZH 2F19L 2MOVA 4JFOA 3RP1A 1J12A 5KAQF 1F5WA 2BHYA 35C8H 4PRAA 4U0RC 3IDMB 5FO9B 4MNGB 3ZDZE 2E7LA 5EZJA 4RNRA 3IU4L 2Q8BL 2QKIB 5CEZL 5TH2B 5EZLB 3GJFH 4FABH 3T4YB 4QRRD 4N90E 1AJ7H 2YHGA 5FUCE 1KNOB 4BM7A 4WW2B 1CFSB 3L3KA 3S88H 4HH9B 5D1QD 2NY7H 1U93A 3CFCL 4PJIE 4MQSB 5KVEL 3S4SA 3K1KC 5JHLH 5KVGH 5D7IA 2GJZB 3FFCE 4D0DB 4BFIA 2CGRL 3OPZL 4NQUA 5D96C 3HI5L 1NAMB 2FBOJ 4LU5L 4P4KD 3VFTB 3EFFB 4S1DD 2JJVA 2X4OB 1WIUA 3PIQA 5DUPH 5L8KB 3PDOB 2AAVA 1W72A 2MNUA 2Z35B 2R1XB 4TTDD 5KN5B 5IROA 1MRDH 5C0FB 3SKOB 2GSIB 1CFTB 1DUZA 4XCFL 1HYSD 3RNQA 1RHHA 4FFVD 4B41A 3GSWA 2Y36L 3EZJB 3UTSD 3U9UB 3FQWA 5INDA 3V6OA 5DRNB 1NCDL 5GSRA 4QRSB 3SGDI 3RPKA 1AGCB 4XVSL 4XPAH 2UZYB 5J0BA 4B5EA 1CDBA 3U0TA 4OI7A 3JV6B 5EORL 4S0TD 3MOBL 2FYYA 3NPSB 1P84K 1Q94B 1NL0L 4ZAKD 3BKYL 4WWKB 1HSBA 3NZ8A 2BXYA 1W0VA 4XB8A 1I9RL 3PHQB 3TFKC 3QZWB 3WFBH 1I8MA 2V9RA 2PO6B 3RWGA 3LB6C 1DLFL 1HDMA 1YMHA 1MCWM 1OTTC 3KPRB 2P48B 4XRCB 4OZHE 1S7UA 2PR4H 3N9GL 2HFFB 5D7LD 2X7LB 5FCSH 1F42A 1N7ML 4QOKB 5IQ7H 4L9DA 3NGBC 3DHMA 3DYMA 2FWOB 1UEMA 4K8RD 2Q7YB 5GS2H 4MQ7A 4WDIB 4D0CA 5AZ2L 4JPVL 4PB9H 4V1DB 4M48L 2ADGA 3FB8B 2GEEA 3PWJB 4ZFOL 3OX8A 3SCMD 4QT5A 2EIDA 2OZ4A 2VAAB 2NW3B 4WVRA 2IANB 5SX4H 1V3JA 5HVHC 4U6HB 4LOUC 4NQEB 3FB7A 1VHPA 2Y72A 2NYYD 3ZDXE 1X5XA 3MRBA 4WO4B 4KK8D 4P5TD 2OBGA 3LD8C 3SN6N 4CDHA 1I8IA 1HXYB 3OWEA 5H2BB 3VXMA 3Q5TA 4KI5E 2YRLA 4BKLB 1XF2B 4P46A 1CU4H 3BP6A 1KELL 5FYKH 3JUZA 7FABL 4ZOAA 3BUYB 1DL7L 1MJUH 3EYVB 2FO1A 3QDJB 2F54D 4J6RH 4JY6B 1FFPB 1T7VA 2G2RA 3BWAA 4MLSA 4NQXA 1A3RH 5LGHL 1F4WL 2ESVB 5KSBE 3ARGC 1MEXL 3TCXA 1T1XB 3DXAA 2PETA 1ED3B 4RAUA 2F5BH 3MRIA 4D9QD 1EO7A 1NANH 2HT3D 5EA0H 5J89A 2V7HB 1C7SA 4QNPE 1HOCB 4PJCA 4JGJA 2BNUA 3ARBC 3O45B 2G75A 1HHKA 1JGVL 4E5XA 2ADFH 1KENH 4S1RL 2AEPH 1E6JL 1ODAA 1MCHA 1WGOA 4Y88A 5CJXC 4YHIB 4CN6A 1GL4B 4F57L 1ZGLP 5TJWK 1MFBL 1QBMH 2C4FT 4NHUA 3MLZH 4KK5C 2WWMD 5J11C 3U9PL 2BOBA 4TVPH 2VZUA 4N8VA 3VXTA 1HXMA 3QUYC 4KZDL 2YPLD 3PWVB 1MIML 4JQVA 3GHEL 4NKDA 2ITDA 2NY5L 4YDVA 4FQLL 5CUSH 5J6HB 3N85L 5LWYH 4K23H 1ZHKB 3MJ8A 4YHMH 3HZYA 1Q72H 4FQ1H 1KFAL 1I1CA 1YEFH 2NY6D 3DSFL 4DGVH 3D69B 3GK8L 3I75A 3TCLA 5JA8B 2WBJC 2A6JA 2M26A 1IT9H 4QF1A 2W07A 1JIBA 1ZVHA 4X5XB 4MCZA 4M7ZC 3MRPA 1EX0A 3AXLB 3ALWA 4R7DA 1QSED 5L2JB 1U8LA 1JPGA 2WZPD 5DMYA 4U1SB 5K93A 3PV6B 1CFQB 4JFYA 3V6ZB 2VKXA 5F9JA 3QZWG 4OFYD 1M7DA 5DFVC 3VWJD 2RHEA 4G9DB 4MNGE 1WISA 3QG7L 1Q0XL 2XA3A 2PTTA 3QH3A 1DE4A 4KI1A 2ZUQB 3GMLA 4JFED 5T1KA 5ENWA 2FEEI 1MREL 1RMFH 5TQ0H 1C5CH 2DQEH 2XICA 1AXSB 3MMEB 1BVLB 3EBAA 3OAYK 4DFIA 3FO0L 3LEYH 3PE9A 5TQ2L 1S7WA 3TLRA 1XR9A 5JDSB 2OTPA 5JW4R 2FDBP 1P4LB 1B0GB 1R5VB 2CLZB 4K3GA 4R8WH 5FHAH 1YQVL 3H9SA 4KXZI 4FP8L 3MR9A 1EUTA 4TUKL 1LO4H 4XAKD 1BFVH 4JKLA 3P9MA 3CSPA 2DQCL 3CZJA 4L9LB 4LLUA 3EFDL 2AJUL 3RY4A 5HHQA 5A40E 3T2QA 3HC0A 3MNZB 4TSCH 1S7QA 1UXWA 2QJDA 4F58H 2APXA 4YXLL 3SDDB 1R3JB 3R1GL 1HI6A 3I02B 2D4FA 4GMSL 3ULUC 2FJHB 2YR3A 3JTSB 4NM8H 2FJGB 2O93L 1YMMD 3BJ91 4U6VL 2R9HD 4ZS6D 3HC3L 1OTSD 3NIFE 3LIZH 3MACL 4L8BB 4QCIA 5EBGA 3QQ3A 1ZVYA 1LO0L 1O7VA 4IDJH 3ZL4H 5IOPB 3WIHH 1OGAA 1B6UA 3BP4A 3ARGB 1UM4H 5K59F 1CDCA 3ZKSD 4YBLC 3DX9B 3RIFF 4L4VD 4KRPC 3HMWL 5ICYB 4XWOD 4MAYC 5IB2B 1SJHB 4F7PA 2GUOA 2C3WA 4HK0A 5BVJA 3C6SB 5F21B 3GSVB 2XWJA 3ARBB 4JG0H 2BVQB 2DLFH 4G6JL 3MCG1 4YDJB 1EEYB 5JMOC 4Y7MA 1CG9A 3KPRE 3RIFK 1Q0YL 3HUJA 1QA9B 1HWGB 1QBAA 5JW5B 1HKFA 3E3QE 5KOVC 5J11B 1WCBB 4QOKE 3WJLA 5B8CC 3SJVB 4KKBC 3QUYB 4B7LA 1ZHBB 3GGWB 3WFDL 2AV1A 4HX1B 5DD1L 1PLGL 4BFGA 1EFXA 3F58L 4PREB 4LLQA 4LCWA 4O02H 1X5KA 3ET9F 1S9YB 3MRDA 3WNPA 4AL8H 4GW5B 1R3HA 2YD5A 5IG7B 3N1PC 2EC9T 2WBJB 5BJTB 4YHZH 3ULVD 3LKOB 2IANE 1G6RL 3BOVA 3SDXF 3TEUA 3O41A 3SGDH 1EJOH 1AKJB 1S7SA 4NQEE 1IILE 2H8PB 4PD4J 4N68A 2FHFA 3FCTB 4CGTA 1NGZB 4DGYL 4XVJL 2P44B 1S7RA 1NFIB 4X83A 2X1WL 5DZNA 4OLUH 4L5FH 3ARVA 1H3WM 5CJQL 2UYLB 3O6FD 1FO0A 4P23A 5IVXA 5F1NB 5H94A 4HS8H 4UILL 4ONHB 5IESH 3UTTD 2A1WL 4NO3B 5K9JL 1T3FA 3RBGA 1DBBL 4WEUD 1CGYA 1TMCB 3NACL 2ESVE 4MVBD 3DNKA 1CLOL 2KL6A 1NDGB 4AMKH 3G6AB 3VI3E 1IQDB 3VXUA 1YJDH 3SKJH 3BUTA 3TIDA 3U46A 5BZDB 4PP1C 4CW1B 4HF5H 4WW1A 3MYZA 3E6FB 3T04D 2B8OT 1AGEB 4UQ3A 4K8RH 4AM0A 3QJFB 1ZLUK 2D7TL 4DN3H 2UZIH 5A16A 4FXGA 5EN2A 5CGTA 1XGRB 5SWSB 3VXNB 2BC4A 2Z0BA 1EHAA 3QDHA 4MSWA 2EDBA 5DD0H 2X9WA 5IT2H 1GGYA 4TSBL 1D6EA 5C0RL 1WCQA 2Z9TA 4ZFOA 3MRQA 1CD1B 3O6LH 4KJPC 2COQA 1IGYA 1B4JH 2UV3A 2XRAH 4OLVH 3VGDA 4HWEH 1RUQH 5E5MA 3LOWA 3MRMB 3MLYH 3BZFB 1WC7A 1JK8B 1X5JA 3MCKA 1HQRB 5CSZA 3MBEA 3OB0H 1HZHL 3V2AR 3CFEB 2HMID 4BA8A 2RAMA 5AG8A 3RJDA 3HPLB 1DBJH 1I3RA 2Y1VA 2HKFH 5D7JD 3F8UB 5CEZD 1ONQA 3T2OA 3S96B 3SDAB 2GT9A 3QQ9C 4GAJH 4LF3B 4KKCC 3ECBB 1VCAA 4Z7OE 3WHE1 1DDHA 3F12B 4YBLB 1MRCH 2VLRD 2AV7B 2ZSWA 4PJ8C 1P2CB 1S7XA 2D03H 2XFXA 2VDQL 4MAUH 1R3KA 3QIBA 5DQJB 1FE8H 4GKNA 4QHNA 1ZT1A 5HDQL 1CXKA 3IDYC 2X1OA 1Z5LB 5IW6B 2XPGB 5KBNC 3QI9A 1FLRL 4U1MA 5ISZD 1NMCC 1KEGH 3DVNA 5B8CB 5HDBE 4K94H 1T1ZA 1VGKA 5HYSG 3TT1L 5MENB 1K2DA 2PYFA 1YEDB 4LEOB 1J11A 1VFBB 2JJSC 2O5XH 3MRKA 4LPCA 4MJIA 5I1JH 1WVZA 5T5FH 1P4IL 4MA3B 4LCWD 2G9HA 3L5WB 4JN2A 4PRPA 4HC1L 3PWUA 3CDCA 4K94C 1CK0H 1EEZB 1YDPA 5IFJB 3JV0A 2BOCB 4DZ8A 1PX4A 3KJ6H 3U36B 3QDGD 4P2RD 4GS7C 4Z7NE 3P4NB 4JZOB 1A7NL 2OYPA 5HHOA 1NGXB 2IH1B 2ZCLH 4H8WH 4PG2A 1LO5A 3S3SA 4HGMA 1NGQL 4E42B 5I76B 4APQA 2J8UF 1FAKT 4X6CE 4UQ2A 5GRJL 3V7AE 5LVEA 5AWNL 1UZ6F 2HFTA 4H8WC 3B9DA 4PLJD 4BZYA 1H5BA 1BVKA 3PGFL 4GRWB 3O0RL 4ODXA 4EDWL 1LHZA 2VDOL 5GZND 4YUEH 1OB1B 2I27N 4IRSC 4Z7VF 2NPLX 2DBLH 4S10A 2W0FB 5EH1A 2WBKA 1S9WB 2VC2L 4GKSA 1TXKA 2YZ8A 3X11B 1YEGL 1XIWC 3BEWB 3RVUD 1QPPA 4WFFE 4P3CL 1FNEB 4NP4H 3C6LA 2VL5B 4E41D 4FQHA 5HYIA 3D2UA 1LQSR 5EIIB 1QLFA 3AREC 3H9HA 1EZVX 5HYJA 2X44D 3CUPA 5IFHL 2GITA 4G8EB 5C09D 5C70A 5MEQA 5I8OL 4FQXC 3QUZC 3VFRA 4PTTB 3M1BA 4KXZH 3NOIA 2YD2A 1X5HA 3MRCB 3W2DH 2J1KA 1L9NA 2PXYA 3PP4H 4Y2DB 3C60A 4YEEA 5DRWB 5JORA 4KAQH 5DEGA 2DLIA 1S5HA 2DM3A 4NWTL 1RZ8B 3QB7C 4OAWB 4GAYA 2ILLA 3DTXB 1F6AB 4V2CB 3C08L 1A1MB 1I7UB 3SJVE 4N1EA 4KGLA 1IEBA 1ZHLA 4PY8I 3V79C 3MJ6A 1KPRB 2OTUA 2IWGA 3VDAA 4LSPL 5EOCJ 3MA7A 1OAKL 5K9OA 4Y5VA 2H26A 1SEBA 3QIUB 2CRYA 4A2MA 4ZO8A 3OR7B 3AY4A 4TQEH 4RGNC 4PPTA 3MV9B 1CD9B 2DI9A 2NCMA 3VFMA 5JZ7D 1OT2A 4LVHC 1N5AA 3IU3B 2EE3A 4JFPA 2YA2A 3QIBD 2GCYA 5I2IA 3NZHL 5CINL 3TO2A 1KLGA 2ID5A 3ARDC 4IMLA 1RVFH 1CLZL 2DWEB 3WKML 3QO0A 5SWQB 2FEDD 1ZAGA 3TO4A 3QI9D 3EO1B 2B4CH 5DJXA 4H26A 3HCVB 4IRJB 1P1ZB 3NVQA 3SGEI 4JCMA 1QLEL 3OR6B 1CXEA 3CLFH 3OL2A 4Z0XA 1NBZB 2KDGA 4JVWA 2DTMH 1AD0A 3DX8A 1MFEH 4OM0H 5MHSE 3PWPB 2B4CC 5F9OH 4XGZA 2BVOA 3W11C 2VDNH 1RJYA 4Y0GA 5JXEA 5C7XL 1S5IL 1BOYA 3MNWA 4PRPD 3MUZ1 1INDH 2PW1B 3ARFC 4F3FA 5LCVH 4JM2C 1I7RA 3VGGA 2C3VA 2HYMA 5EO1A 4MJ4A 1TVBA 4MJ5A 4PB0H 4YPGB 1IGFL 2P24B 3X3GH 1CE1H 3BKMH 2VXSL 3OJVC 4KQ4L 4HKXB 2B5IC 2ZUTA 3IAPA 4GS7B 4Q6IC 2QL1A 3EYOB 1NC2A 3O3DA 3U7WH 3KNBB 5GGSB 5SWSE 2F8XC 3SQOL 2Y06H 2Y4SA 3GUTB 1ZE3C 2CLRA 3LV3B 5T3XL 1KJ2H 1G1YA 2DQUH 4X5LA 4F15C 2EDLA 1ZGLA 3PHSA 2ZP0T 5B39A 1N4XL 4AEFA 4NYLB 5JPMA 1RK0A 4F2MB 1DN0A 3ULVH 4NC2B 3IFPB 2FATL 1CBVL 1XR8B 4RDQF 4NZRH 1CFVL 2AJYH 2RCSH 5DYOA 4Z6AT 3ULUE 4JG1L 4X9BA 3P0YL 3MXVL 4ZNEA 1HHJA 4LRIC 1HEZB 2DYPD 1IM9B 2VJXA 3FOLA 1QLRB 3GIZL 2CKBA 4L8DA 4LLWA 4MJ6B 1EVUA 5ITFA 5FUOL 2UY7A 3LN5B 2Z91A 4LDOB 4L8SA 3UZVB 2JLLA 4ZDHB 3SBWA 3OJDB 3KYNB 1MCOL 5MP6H 2BERA 3GBML 4P9MH 5LBSH 2LAGB 1W0WA 4OZIF 5HYJD 2XTJD 1G7QA 1KV3A 1NEZA 4HIHA 1IGJB 2ZWLT 1LDPH 1WLHA 3HI1B 4OD1L 2Q1EA 5CJOL 3DV4A 2R0WH 5C0ND 4FQXB 4ZFGL 4HD9A 1ZT4B 1KUMA 1RFDH 5A2KH 1MHCB 2DMCA 1JE6A 1DFBH 4OD3L 2D0GA 3DURB 3PHOA 4JB9L 1ETZB 4NM4H 1IGMH 3T0EB 3L3GA 4JANA 3BKCH 1SVCP 3QPQD 3VXRE 2Z31C 3AC0A 4Y4HA 5DI8B 1PVHA 1M71B 3RWJB 1PAMA 1IZJA 3MRJB 1WQVT 3QCTL 1U8KA 3BP7B 1H0DA 4MD4A 3HE7A 1BM3L 4IJ3B 5FUZH 4HZLB 4PJIA 4JFDB 3O9WC 4RGNB 3KPPA 1RD6A 3LRSA 1EXUB 2DMBA 3IFNL 4LVHB 2F19H 3VW3H 4GRLC 3S5LA 4F7EA 3A6CH 1DBAH 1NDMB 1WBXA 5F1IA 5T3ZL 5ITBH 3WLWD 3IU4H 1C1EL 4Y4FD 2Q8BH 3UO1L 2VXQH 1JMZA 4HHAB 4QRQA 2UY6A 5KVMC 1M1SA 2H41A 4XNQB 3V9FA 2AKRB 2KQNA 3UJIL 2BP3A 5E4EC 2IALB 5FDYA 4GRWE 4K7PY 2LQRA 5F7WC 5KANI 5D1XA 2PYEB 3VFWA 4B7IA 4M1DL 4DCQA 4OFKA 4OCYH 3B3IB 4OCWH 3WL9B 3VXSD 3TYGL 5FEBA 3AM8A 3IDIB 1MRFL 2DKUA 1MWAL 3BT2H 3L6FA 1RIVL 1BAFL 1HCVA 4PGBB 3ILPB 2VSDA 4RIRA 4BZ1L 5IMKB 1CICB 4OZFA 1JVKA 4TNWF 1MHPL 2BVPA 2VXUH 3RPIB 2F5AL 4BK4A 4TVSa 2B5IB 1G9EA 4Q6IB 1R3LB 1J0KA 5FM4A 2A9ML 4FHBD 3VRJA 4HC1A 3T1FA 1G7JB 3TH4T 1AQDB 5E2JA 4TNWK 4G9FB 1EJ6A 4F15B 1QFUH 3GO1L 1N64H 1I85C 4CADA 2A6KB 4OZHA 1R5IB 4MD0B 2APBA 1P5UA 5IV2B 3TVMB 2F74A 3NCMA 2DM2A 3QEQA 4RMQA 3C8HA 4WI9A 1Z3GL 3E6HB 1OF2B 4GQPH 3ARQA 3FMGL 4X5WA 1FFQA 5BO1H 2J88L 1I9JL 3QWOA 1LMKA 1T80A 1A1NB 1BBDL 3MV9E 3QUMH 1MH5B 3RVXD 5C2BL 4UT6L 2J4WH 1ZVSB 1I8KB 5IJKC 3DX6A 3DO7A 3I3DA 1I9RH 1RY7B 3KAAA 5EUOF 3G5YA 1P7KA 3GNML 3OF6D 4LNRB 3QIWD 3LKRB 1JWSB 4JHWH 3D85D 3N9GH 5EU3B 4ODUA 1UM5H 3SGKA 3MLVH 1N7MH 1K5NA 3H42H 4NNYA 3LN4B 1JZ6A 3MUHL 5LGKA 2DOCA 2BFVL 3UTOA 4KJQD 1VFMA 1JUFB 2UWEA 5AZ2H 4Z9KB 3PWPE 3SKNA 3GSNA 4JPVH 2X4TA 3WIIH 5GS0H 1VGEL 4N8CL 5DC9B 2VERN 5E8DL 4XCCL 4GO6B 2EH7H 4U6YB 3LKPA 5DUMH 3HMXA 1FNSL 3VXPB 1BQSA 5KSBA 1HWHB 5GS0C 4Q58C 3KXFD 1CFNB 4KTYA 5KVDL 3L3DA 5F1OB 1FAIH 5I18L 2ICEB 4RSVA 5HHVL 3GRWH 2Y5EA 1P4BH 4GRLB 2BY1A 2C3HA 4XBPA 1GIGL 3GFUA 1XGQA 3HS0A 3IRPX 7FABH 1JPST 1ZTXH 1A6TA 4F7MB 5JNYA 3VXQA 1A1OB 2CK2A 5CP3H 3E2HC 3UYOD 2VLKD 4UBDC 2DWDA 4D0BA 1F4WH 3SE4A 3FQRB 4MXQC 4M62H 1UYWL 1MEXH 3SGEH 2PCPA 1ZGLM 2FX8L 2DJ4A 3DUHA 3BRGC 4UDTB 4LLYB 1S7TA 4EIGB 4ONFL 1A6ZA 1FVCB 4PGCB 4XH2A 4CMHC 4H0HB 5E00A 2R0LH 3U83A 1MCPL 2XWBA 2NY0B 1B0RA 1D9KC 3QUXC 1I1AC 1YC8A 5CKAA 3FB5A 1GGCH 3W9DA 2ICWJ 4GRMA 4UAOC 2NXZD 1F4AA 3OQ3B 4PUBL 5HVWA 4JRXA 3I50H 1UENA 2IAMC 4P4RA 5J6GB 2APVA 4WI7A 4PTUA 4EQ2A 4P9HL 4OGAD 3S37L 1U41A 1OP3K 5DD3H 5D2NB 3I2CH 1XCQB 3W9EB 3MLPA 1MIMH 4DVBB 5FO9A 3IDMA 2NY5H 3REWB 1VEPA 1RJCA 2FR4B 2QKIA 5TH2A 5EZLA 4GQ9H 2EDHA 3T4YA 1KFAH 3L3IA 4LRNL 1VFOA 3D39D 3KLDA 1A7RH 5JO5A 1MPAH 1P5VA 4LQ1A 4L4TB 2AJXL 4F9PC 1CFSA 5TE7L 3V5KB 1REIA 3L9RB 4HH9A 4U0QB 3QDMD 5DQDL 3TT3L 3U4AA 4JFDE 3JBG7 4TRPL 4RGNE 1PYWB 2RR3A 4LLDB 3U82B 4N1CA 1CXIA 2BY2A 5IK3A 3TBTB 1NAMA 2V5MA 2P5ED 3EFFA 2LE9A 3FO1B 3ZHLA 2X4OA 3SDXB 1MJ7H 4WUUB 4UDUB 1XF5A 3PDOA 1ND0A 1X5GA 1UXSA 1AXIB 2Z35A 4PGDB 2C4FU 2R1XA 3MFGB 4JZJC 4OLYH 2PYEE 5KN5A 4R4FL 5C0FA 3SKOA 1NEUA 2GSIA 1CFTA 4ELMB 4N5EC 2CDFB 2C26A 3FO0H 5GIRB 5TQ2H 2BCKA 1MJ8L 4JZNB 1KB5B 2DQJL 4R0LC 2IQAB 1VKXB 1DLHB 3SPVB 5C9JB 5L2KB 3WFCH 4AG4L 3U9UA 3VJ6B 5KJRH 4MB5A 3X13B 4FP8H 1FNGB 5DRNA 1K4CA 3OZ9H 4PR5B 1F4XL 1AGCA 2AJUH 2NNAB 1JWUA 1C16B 3JV6A 3O6ML 4JFZH 1MHHA 2KH2B 4G80B 4AJ0A 1H3VA 1EMTL 5EIVA 1Q94A 5DA0B 3NTCL 4AY0A 2H3NB 2BNQD 3PHQA 3QZWA 4G9FE 4KMTH 4O58H 4AQ1B 2PO6A 3BE1H 1D5XB 4Y16C 3V52L 2DI8A 3KPRA 3KYAA 4XRCA 4I3SL 1LO0H 2X7LA 4FZ8L 5DMGC 1JI1A 4QOKA 3CXDL 4XHJC 3KPSD 3PDGA 1GXEA 4Y5XA 4OQTL 2FWOA 4ZPTB 2Q7YA 3MLUL 3GHBH 5C0EB 4PRNB 3S97C 1BJ8A 4WNQB 1NCBH 1Q9LB 4CMHB 4Z7UB 4NQCD 2OSLB 2VQ1B 4V1DA 4UV4L 1F8TL 1RK1B 3O4LD 3PWJA 1D9KB 3S37X 3V8OA 3RA7L 2A77H 3LMJH 2YPVH 2VAAA 2NW3A 2IANA 3QULB 5C3LD 4UAOB 2ZUSA 3B9KA 4OGYL 4U6HA 3WE6B 4NQEA 4PYGA 4FFZL 1Q0YH 2IAMB 4DN4L 4QKXB 5EU6D 4WO4A 3D9AL 1YN7B 4YIQB 1IE5A 5DR5L 5GSVB 1HXYA 3O6KH 3ELAT 3WFDH 3IAQA 3WCYA 4BKLA 1N3NB 1XF2A 5J12B 1PY4A 1PLGH 2DQIL 3BUYA 2J5LC 4DKFL 3EYVA 4DEPC 5IHZB 3F58H 3QDJA 4RMRA 5T3XD 3O8XC 4QHMA 2GTZA 1FFPA 4ODHH 4X8XA 4WEBL 1IVLA 2C9AA 2OL3H 2ZOKB 3G9AB 3GB7B 4RMUA 1U6AL 3QFJD 1BF8A 4W4NA 3CCHB 4G7YL 1JZ7A 5JW3H 1A5FL 4FZEH 1MCKA 1OW0C 5DMKB 2OTWB 1ED3A 1B6DA 4XVJH 3QNXB 3QA3B 3UDWC 2NY1D 4KPHL 1FORL 2V7HA 5CJQH 1A64A 1HOCA 2YRPA 2JB6B 1CGUA 5F7FA 3FZUD 2CDEB 4HUWB 3O45A 3WEXB 4JM4H 1IJ9A 2FSEB 5IMMB 3ZKND 4ISVB 1TITA 2J8UB 1FV1B 4YHIA 1K6QL 2ZSVB 4LPVA 1MCWW 3I6LD 4P2YA 2VLMD 2HWZL 3ZYIA 5ICZB 2EH8L 5KVFH 1AGDB 3BGMB 2VISB 2XWTB 3PWVA 5SWZB 1TZHA 1CLOH 3D3VE 1OPGL 4NZUL 5DFWH 5J6HA 4L1HA 4Z7VB 1VA9A 4R0LB 4UTAL 1ZHKA 2DN7A 4HKBB 3HG1D 4PG9B 4ZTOH 1T03H 3DRTB 5H37G 4U33A 2D7TH 5HGAB 2EC9U 3ZYOA 5K59E 4HULB 3AXLA 2I60L 5C0CD 3QQ4A 4HG4K 3M45A 4QRTB 5L2JA 2E27L 3UC0L 3V5DB 4M43L 4L3ED 5CGYC 4U1SA 3AU1B 3JWDL 3PV6A 1CFQA 2YKLL 1NBVL 3V6ZA 2K7QA 4MCYA 1QO3B 4HUNB 4HBQA 3EOTL 4G9DA 1ZLSH 3MLXL 1AH1A 5AD0B 1HZHH 4X4ME 3ZSTA 3EJJX 4P57A 2MKWA 3IXAA 4IIQB 1UM6L 2IPUK 2A83B 2Q7NA 3U4BL 5T3ZD 4MNQE 1L9MA 4L4TE 3TN0A 3UROR 4RAHA 4ONOA 2YXMA 1BVLA 3MYJA 5GGQL 3MLWL 2DL9A 3WKNA 2K3TA 5E2UH 4DK6A 1U8QA 3ULVF 3RZCB 3G5XB 3IKCA 4ESKA 1G7PB 6CGTA 2VDQH 1P4LA 1B0GA 1R5VA 2DDQL 4POZD 5FF6B 1WT5A 3W0WA 3CVHB 4HUMB 4GUPA 2Z93B 5HDQH 3B9KD 3RL1B 3SDXE 4JDVB 4L9LA 4YHKL 3A6OA 5CGMA 5EUKB 1LO2L 1NCCH 3NH7H 1ROWA 4CMMA 3MNZA 1E6OL 1NKRA 4ETQA 2YD3A 4IOIB 1KT2A 4X6DB 2XZQL 3KLHC 3SDDA 2M8XA 3MQIA 5EC1B 3SDCB 1R3JA 4MA8L 3I02A 4WFGD 2FJHA 4FS0A 4NCDA 5AUMB 2FJGA 4NUGH 4WI4A 1MFAH 4Y2OA 5CZVL 4D9LL 1FN4B 1P7QD 4PJXB 4L8BA 5CILL 5D93C 1EZVY 2HLAA 2CR6A 3F6LA 1E4KA 2F53B 3D0LB 4WI6A 3C5ZC 1YA5A 2MQ0A 3HR6A 5GXBB 1P7HL 3DX9A 3O2DL 4I2XB 3UAJD 5IB2A 1SJHA 4XPHH 3LKSB 3BQUC 1JNHB 1NMBH 2P42B 3C6SA 3EYUL 4MHHI 5JQHC 3BX7C 3IYLW 2BVQA 3QSKB 4EDWH 5IB5B 1S9XB 3BZEB 5ABDE 1EEYA 3H9ZA 1BECA 1QQDB 4W6WB 3NABL 2VC2H 2Y25A 4NQDB 4TUJB 1QA9A 2P7TB 5JW5A 4NO5A 3KPLA 5GGUA 3SJVA 1NGYA 2E6PA 3HNSL 4PRIB 4XTRC 3TA3B 3STLB 1GVIA 1SM3H 5GGVH 2XZAL 1ZHBA 5BW7A 1TTUA 4HX1A 2QLVB 5HYSA 3T77B 5D1ZD 1X6LA 5I0ZA 1NKOA 4XWGL 1EAPB 4R2GC 4OLXL 4F9LC 1S9YA 5IFHH 5IG7A 2ZOLB 3DMMA 2WBJA 4J3WA 5BJTA 1YNKH 2EKSB 2BXZA 4FQCL 3LKOA 5ESAA 3ZTJH 4AQOA 3HUJF 1AKJA 2H8PA 4DAGH 1AO7A 3FCTA 3TJEH 5DWUL 4OZIB 1NGZA 5K9QG 3I6KB 4LL9A 1MI5B 1NFIA 5EULV 3EJYD 5DFTA 2NMSA 5GRWA 2UYLA 3K80A 3BH9B 4GOSA 5DURD 4LSPH 4OCSH 2CSPA 4RBPH 5F1NA 2KUTA 4ONHA 3MUGA 1OD7A 4OGZA 5I1CH 3TN0D 2GYSA 4NO3A 4TSAH 5E1HB 3D6GA 4KKAC 2J8OA 5IWLC 1MAJA 4WI8A 4YX2H 3FQXB 1GC1L 5FKAB 4MXWL 4M9OA 1A6AB 1NDGA 4KROD 1IQDA 5TFSL 2DQGL 1KCUL 1BWWA 3NZHH 5BZDA 4CW1A 4S1DC 5JOFB 1HILB 3E6FA 2QQNH 3DETD 1ZHNA 1AGEA 2D3VA 2VWEC 3QJFA 1L4IA 5IVXF 3ZKMD 3P77A 1HNGA 1ZSDA 5GRVL 1RZ7H 3CU7A 5GGVY 3VXNA 4DK3A 2BSTB 2J8UE 3IDJB 1UZ6E 3LEVL 1CD1A 5SX5H 5JIIA 5FAAA 4BH7B 3PWNB 3EYQD 3PQYD 3FN0L 4LP4A 1I4FB 4F80A 3MRMA 5HGDB 3BZFA 1JK8A 1NCWL 5FDWB 2VDPL 1HQRA 4K9EL 5FHBL 1G9ML 4Z7VE 3CFEA 1IGFH 3V4UH 1PKOA 1G0XA 3FRPG 3HPLA 4KQ4H 2OJZL 5D93B 3PL6B 4HCRL 5DHVH 3S96A 3SDAA 1EHLH 5JHDD 4LF3A 2VLJD 3SQOH 2DRUA 5E7BA 5FYLL 3E0GA 3ECBA 3SOBH 1CZ8H 3F12A 5EBWB 3RDTC 1P2CA 2VQTA 5FCUL 5ETUB 2HJKB 3NCJH 3EO0A 3F7QA 5DQJA 4NN5C 1R24B 4JY5H 4G7VH 1UQSB 1CBVH 4YGAB 1QSFD 5F72S 5E0QA 3CZFB 3F5WB 1Z5LA 2E7HA 3VFGH 5ADOL 5IW6A 2VN7A 4KUZH 3MXVH 2EXYC 3REVB 4PBVC 1PQZB 4Q9RH 3DRQB 3MX0A 2XQYK 2NLJB 5FUOH 2FD6H 4U1NB 5D5MF 2EDJA 1EV2E 5MENA 1J1PL 2RBLA 1HSAA 4EI6B 1PZ5A 1YEDA 1UJ3B 1CF8H 1VFBA 5J3HD 3KWWB 1GH7A 3L5WA 4CRPA 3VGHA 2QADC 1BFOB 1EEZA 1QYGH 4R2GB 5IFJA 3GMRB 5EB9A 2BOCA 3U36A 3GSUB 3P4NA 1U8IB 4ZFGH 4JZOA 1X5LA 4UT7H 2IH1A 4OD3H 1AO7D 3IFLH 1N2RB 4E42A 1RIHL 1ZEAL 2Q86B 5I76A 6FABH 4LSTL 4H0GA 3AB0B 1MHEB 5EUOB 3UBXG 4HUXB 3OAZH 1XGTB 1CXFA 3OKDB 4K2UH 4HLZH 1P6AB 3RY5A 1KPVB 5C07D 1UB6B 4QRRB 3QCTH 3L7EA 4P2OD 1L6ZA 1J8HA 3D18B 4DKAA 4AIOA 1OB1A 1BM3H 5D1QB 2V5TA 3WSQL 2W0FA 5DRXB 1S9WA 1SBBA 4PJXE 2W91A 5DA4A 4E0RB 1P9MA 3X11A 4ZTPH 3BEWA 1G7LA 5EZOL 2F53E 4P2QA 4MA1B 2VL5A 1JZ4A 1YPZF 2HJLB 5T3ZH 1EGJL 1NC4D 1MLBB 2CXKA 1JGDB 4P4KB 1C1EH 1JGEA 5EIIA 3UO1H 3V4PL 3PWLB 1IGCL 4I2XE 4QWWC 5CIPB 2VSCA 1T5WB 1PY9A 2B1HH 4I0PD 4K55A 1UWXH 5F9WB 5E08H 2NTFA 4PTTA 2RQ8A 5IROC 3PJSA 3MRCA 1KIPB 5BRZD 3LZFH 2QQLL 4Y2DA 5DRWA 1F13A 4M1CD 5KS9B 2CLVB 1T2XA 1RZ8A 3PGDA 3TZVA 1S8DB 2XG4A 4OAWA 5I1LB 4IHOB 3W39B 1F6AA 2FBJH 5KZCD 4CVUA 1A1MA 5CBAB 2ARJB 1MWAH 1MQKH 4PRIE 2ZCHL 4K3HA 3UTSB 1RIVH 1KIRA 1UADC 3EOYG 3V6OC 1QRND 1U42A 5DSCA 4BZ1H 3M17B 2ZKHL 1MHPH 3QIUA 5JIKA 2VDRL 4N0YL 2NZ9D 3OR7A 3NN8B 4YBQD 3BGFB 4I3RH 4HJ0D 2OS7A 1UT9A 1X7QB 3AS1A 3G5ZB 1Y18B 3ZHDA 2A9MH 3PDDA 5A2LH 4UOW1 3ZKQD 4ALAL 5JR1L 1XAUA 4ZAKB 3JWNC 3GSXA 1GAFL 1MIEL 4OZIE 4X7CC 1UEYA 3ARXA 3L5XH 3WO4C 4C59B 1VFUA 1MI5E 2DWEA 2FNBA 5SWQA 5C0AA 4NN5B 4OF0A 1A6WL 1Q1JL 3EO1A 1T7WA 1JHTB 2DS4A 5D7LB 5BV7C 4IRJA 1CGSH 1P1ZA 3OR6A 1YUHB 3FMGH 1FL5A 3OHXA 1VACB 4C56A 1I9JH 3EJZD 3EO9L 3QEGL 3HB3D 3PP3H 5CCKH 4UB0L 1A4JB 1A7QH 3B43A 1CL7L 1YEKH 3QFDB 2PW1A 4WU7B 3TC9A 1NLDH 3KDMB 4FN0A 4N0RA 2C1PA 2ZJSH 3SCMB 2MKLC 4YPGA 4OGXL 2P24A 4HZAA 1BX2A 3ZSSA 1DSFH 3QPXL 4QHUB 4TTGA 3TBSA 3P0GB 2WIIB 4HKXA 2CIIA 1FVEB 1GGTA 5DVKA 3EYOA 3KNBA 4XVUD 4P5TB 2NXYC 5GGSA 1EEUA 4PRAB 3PV7A 5D7KE 3GUTA 4PFEA 5F6HJ 1TTFA 3LV3A 4P46C 5EOCH 5EZJB 1A9BB 1Z0MA 3MNVB 5ANMA 2HP4A 5F7DB 2X09A 1F6FB 1XF4A 3C8DA 3STZA 4F2MA 4NZDA 1VGEH 4HIEB 4N8CH 3IFPA 2R9HC 3GBNH 1J8HD 4U1LB 3EW3B 1GGUA 1OTSC 1XR8A 3QISA 4J12A 2F54B 3L3KB 3H8NA 4WRLA 3OB8A 5HHMD 1U93B 2DBJA 3NCBB 3GI8L 3MJ9A 1HEZA 3LN9A 1IM9A 1QLRA 4DOHE 3T1WA 4MJ6A 3S4SB 3F6IA 1MCBA 3NCFB 4P2QD 5KVDH 3LN5A 4NWUL 1CFBA 5HHVH 1X4ZA 5E94B 5E6IA 4ZDHA 3OJDA 2DQFB 3KYNA 5HI3C 3FTGA 3BDYL 3B2UD 5E9DD 3Q3GB 2BDNH 4NQVB 1YC7A 1IGJA 4ELKB 4CNIB 2A73B 2VDKL 1KIQB 4WIQA 5DVLA 2XKUA 4I13B 1ZT4A 3OMZA 1H3GA 1MHCA 3H3PH 5EWIL 1OWRM 3B5GA 4JQVC 3TZVD 1UYWH 3RNQB 2YPLB 2ICWI 2YPKB 3B9EA 1ETZA 4UNVA 3T0EA 5EC2B 5KSAA 3FQWB 4BUGA 2AI0L 1BWMA 4RQQA 1X3DA 1SVZA 5DI8A 1V8HA 1M71A 3RWJA 5INDB 2NY6B 3AAZB 2IMNA 3MRJA 1BQUA 3BP7A 5GSRB 1LP9A 4QY8B 4S1QL 5DJAA 4LCIL 3FAXA 4H20H 4HZLA 1K4DB 4K71B 3U0TB 4PUBH 3H7BB 2YK1L 3BAEH 2QTEA 2Y07L 4HGWA 1QSEB 1T2JA 1EXUA 1PBYA 2D7NA 2Q6WB 5KOMC 4H0IA 3S37H 1W0VB 4RWHA 1BFSA 1IQWL 4KU1A 3RX8A 1NDMA 3ORJA 4GMTH 5EUOE 3RWGB 3VWJB 2Q8AH 4QGTA 4YFEA 5C0AD 5I30L 1YMHB 5JW4Q 3VWKD 4KVCH 3I6GA 4YH6A 1KCLA 2AKRA 3O4OC 1YY9D 1UC6A 4QRRE 3GKWL 2IALA 4JFEB 2AJXH 5BV7B 1UGNA 5M95B 3FT4B 4C56D 3RIAF 2PYEA 1AQKL 4Z8FL 3IDXL 5ILTL 3B3IA 3WL9A 4PJ5D 3KS0J 3IDIA 3MV7D 2XV6B 1EK3A 4XX1E 4PGBA 2FL5B 3ILPA 3CDYA 4J3UA 2EYRB 1LEGB 1BFTA 1CICA 2VZVA 3RIAK 3ES6A 4XP4L 4NIKB 1NQBA 1A6PA 3FB7B 5DRZB 3MRBB 1D5IL 3LEXB 1J0HA 2VWEE 2M1KA 4I77H 1R3LA 1O0VA 1J05B 2QBWA 2R69H 1FYTE 3W82A 3NIGF 3OKNA 5HI4C 3B8YA 4R4FH 3BP6B 3TP4A 1JF5A 4NN7C 4EBQH 3LS4L 1G7JA 4YQXL 1BZ9A 1AQDA 1BIIB 4G9FA 2D9QB 4RX4A 1YMMB 3C5JB 1R5IA 4MD0A 4AG4H 4XP5H 1I9IH 4HWZB 3TVMA 4NO2B 1TJGL 3UTSE 1D7FA 3MLRL 1U8HB 3E6HA 5D7JC 1KTDB 5KW9H 4QHKJ 1RIUH 3QCUL 2IC2A 1BQLL 5E6ID 4XP9H 1A1NA 5F8QC 4L4VB 3U0WL 1T2QL 4J4PA 4NSKB 1AHWB 1EMTH 3LAFA 2BNUB 1JCKA 1ZVSA 3BESR 5F7MC 2FH6A 5AZEL 4E5XB 1RUAL 2E7MA 1IEHA 1MAKA 4WJ5B 5C6WH 4LNRA 1WWBX 5CD5C 2V17H 3LKRA 4ZSOB 4Q0XH 5EU3A 4I3SH 3T2NL 2BOBB 4IRZL 3VXTB 3WJLC 4WFHD 4KFZC 1RAMA 5D7LE 3VMNA 4OQTH 3LN4A 4O00A 3PGCA 3MLUH 5KSAD 5I66B 1JUFA 3MJ8B 3CNKA 4FABL 4Z7QF 1U0QA 2F15A 4ZD3L 1INEH 4JFFD 3WFEH 4JQIH 1MCRA 5BMFH 1AJ7L 4UV4H 1F8TH 4M3KB 3TCLB 1XZ0B 1KJ2B 3S88L 2A6JB 4U6YA 1FZJA 2NY7L 1QHOA 2JTDA 4NJ9H 4LQFL 1EHXA 2E3VA 1CFNA 1IM3A 2R15A 5JHLL 2ZUUA 5KVGL 2AXJA 4JFYB 1CVSC 4H1LB 2ICEA 5F7EL 5F9JB 2X41A 2BY3A 4PLJC 4P23C 5F6IC 4DJMA 5I19H 2UWEF 3JVGC 1FBIH 3O6FB 5DUPL 3QH3B 1Z9LA 2FJFB 3GMLB 5FYLD 5GZNC 1A1OA 2ICES 3UTTB 3IKKA 3MO1A