4MCZB

Immune receptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 45
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mczB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4mczB01
3CFKA 1L6ZA 1OP3H 2J8UE 5H8DA 3GJFA 3PDDA 4PJXB 4NC2B 3IAQA 4HGWA 3GSNA 2Y7QA 2Y23A 5CINH 2HJLA 2BVPA 3DRQA 2NY2D 4I9WE 5TDOB 5DSCA 2CUIA 4NCDA 5GRXG 3SJVD 3MUZ1 4TN9A 2BVTA 4MNHA 4AT6A 1NAKH 2HFFB 2XWBB 2V2TA 3EO1A 2Z35B 4Y5XC 1INDL 5SWSB 1EDQA 3ARRA 3SDXE 4HS6B 1P9MA 4OZFG 2W0PA 4XP4H 4YFLF 4PJGE 2DTSA 3K8MA 4JKLA 5TPWH 4DN3L 3VXSD 3SQBA 3GGWB 3B9KC 3SOBH 5IR1B 1MLCB 3SE9L 5D7IA 3KG5A 1T7ZA 2XWTA 3L3KA 4UT7L 1K4DB 2CDGA 4P23B 4JY6B 1A7NL 4X9FA 4Y16A 1KPUA 5IP4A 4Y5VA 1G6VK 3KPPB 5EU6D 5FUCC 4YDLB 3GMPA 1EFQA 4RAUA 2FDBP 2PXYA 3H9HA 3S88L 4NZJA 5JXAH 1NC4D 3ECBA 5E2UL 5DTFB 1NGYA 1TXKA 3OB0K 4R4FL 1OP5H 1UA6H 2Q6WA 4RCAA 4YQXH 4WW1A 1JWUB 1ZVHA 4NQDE 4HZLB 2LAAA 5HGHA 5EZLB 1Q9LA 2BRQA 3T77B 4NKIH 3WKNA 1NFDE 4RISH 2XTJB 1F6AA 1U8HA 4OQTL 3MREB 2G2RA 1S9YB 3Q5YA 2B39A 1MFDH 3VD7A 4PJ7B 5FECB 1LO3L 1A6ZA 1KB5A 1XGUA 1AO7E 5GS3A 4N0UA 3CFEA 2Q7YA 1EVTC 1I1FB 3P4OB 4YC2C 4OUOA 1N59A 1OTUD 3QG7H 2DMBA 4XZUB 2VXSL 4NDMB 1BBJA 3FZUC 4EVNB 4B5EA 2DJUA 2DKSA 5IVOA 4HJGA 5TE7L 4Y1AA 1AE6L 1MLBB 4FQQA 2O5ZL 1CLOL 4FMKA 4F58H 3DBXB 3RZCA 4HXAH 2MTPA 1LEIB 5BZWA 4NOFA 1KLGB 2R1YB 3WS6A 4JO4H 4EI5B 4PV9A 4YPGA 5E8DL 1Y0LA 5BW7C 4PG9A 2D03H 5TF1H 4L4VE 5JW5A 3P73B 1UCBL 3C9NA 4R97C 5EA0L 4CNIA 3DHMA 3LRGA 2GSGA 4M61B 3WFBL 3C2SA 4ZSOB 3QQ3A 2WK2A 1E4XH 2ZSWB 1IQDB 4OCYL 2VLJD 3L5JA 4KRPD 3RU8H 3GSQB 2BC4A 5HXMA 3O3UN 5KSAA 4PRIA 4ZDHA 3RWHA 1ZLVK 4XPHH 1KJMB 1IVLA 1LO5A 1KBGH 4U2YA 5JIPA 1M4KA 4X6CF 3SDYL 4HD9A 4F3FA 1IAKA 5INCA 4YDKH 3ULVF 3ZKMC 1N0XL 1T2QL 1AXSB 2PO6B 1N7ML 2CDFB 2FL5B 3VXOB 1KXQE 1DLFH 1KYOJ 4LIQL 3EYQC 3TYGL 1I7UA 5HI5C 5ESQB 3I3EA 3D0LA 5F6IB 1ZWIB 2OK0L 3MRLB 1YMMB 3BEWA 4MA3B 5DK0B 1YMHA 1OP9A 4MCZB 4P4KA 1RZ7L 1KN4L 1URLA 4NIKB 4X98A 4ZD3H 4H5SA 3MNWB 4YUEL 1EO8H 1LHZA 5F3HA 2IAMC 1ORSA 4ZS6C 2DQTL 5EZOL 1A6UH 5HHQB 3EO9L 3DX8B 4JPKH 5IVNA 5F8RC 4U1GB 3V9FA 1DQMH 4EDWL 4I2XB 1JHTA 4PGBA 1I9IH 3RAJH 1WF5A 1ZGLM 3W11C 4Z0BH 4D0BA 4AIZB 5D2NC 3BN3B 1FH5L 1Z9OA 2D0HA 4PD4J 4NOBA 1R3LA 1HNGA 3AAZA 4WWKB 3F7QA 2GEEA 5DR5L 4URTB 1FP5A 2EDRA 5DMYA 1AHWC 4Y0GA 2GK0B 1C5DA 2YD4A 3OMZA 3VXNA 1FL3A 1B90A 1INQB 5H94A 3O11A 3O41B 3SDAB 2DS4A 1XGQA 5C6TL 3KHOA 1CLCA 4KKBD 5L8JB 1FL5B 2ZP0T 3MA7A 1NCTA 5MI0B 1GPOL 1UVQB 4LNVA 4QRRB 5CKAA 2VDKH 3VXRE 5ELIA 1X9QA 1CU4H 2W91A 5IEHA 2OQJA 3LDBB 3U9PL 3O6FD 4UT6L 4DUXA 2EDFA 4ZSOE 4XH2B 4FFVC 4NRXA 1A4JA 4K55A 1XZ0B 2XN9A 5F9WC 3D5OF 5E8NA 3ZKXB 4JFXB 4HWZA 5DC4B 1OGTB 3D18B 3PNWA 5LGKA 1K85A 3MBEB 4EIGB 4LLQA 1MHEA 2EC9U 1AC0A 3TPKA 4RFOH 3UTQB 3V8CA 3O2DL 4H8WC 3GMNA 4Z95H 3QHZL 3VG0H 3SDCC 1OB1B 4HK0B 3LN5A 1A0QH 1JF1B 1IAOA 1BZ9A 2V7NB 2W60B 3DV4B 3TV3H 3OF6A 1FZMB 5EB9A 1F6LL 2ADIA 4Y8AA 3RVVC 3B6SA 3K4DA 1D5BA 3EAKA 5DD3L 4WI8A 1ACYH 2MKWA 3KYMA 1DE4B 4JFDD 4ISVA 5IB4A 5JMOC 4XPAH 2ITCB 1T3FB 3LH2L 4J3XA 4WENB 1R6VA 2H9GA 2ZUXA 2O5YL 2Y4SA 1EH9A 3QAZB 1LK2A 4HC1A 5LWYH 2J6EA 4ZO6A 3OR6A 4JKWA 1W0WA 1I3RA 1HILB 3VXUA 4QOKE 4R4BA 4Y16D 3ZDZE 3VCLA 3OKLB 5MERB 1MUJA 4DJMA 2I9TB 2G60L 1XIWC 2QQLH 3AS1A 2DQJH 4LSPL 2VUOA 5C86A 3L9RA 3WS3B 5KVGH 1IGIH 4ZUVA 4OIBA 5D2LA 1LP9B 3HR5A 3SGKA 1QSFE 4MJIE 3K7UA 1U3HA 1N64H 1ZGLP 1MY5A 3PP3H 4RMVA 2NX5E 1PFCA 4UQ3B 5BV7H 1QLFA 3C6SA 2EXWD 5F93C 4OFDA 5C0EB 2X1OA 3TVMC 1JF6A 2OJEA 3PDGA 4NQEB 4GQ9H 2BNQA 4XBGA 4HPOL 3Q5OA 2F19H 4RA0C 5CEZL 3QFJE 2WUCH 4KROC 1A3LH 2C4FU 5JHLL 4HIIB 3D87B 4OF5A 3S3PA 3VMNA 2F5AH 1TVHB 1U95A 1S9VA 1A7QH 5GGTL 1G0DA 2MJWA 3B8SA 2IANE 5DWUH 3BZFA 5IBTL 4Y1AD 2R69L 4BFIA 5A3IC 2X9YA 2PCPB 3D3VA 4FQXA 5IIEA 4LBEA 4V1DB 2E6JA 4B0MM 4KDVA 5DFTA 4N0YL 1L0XA 4FQHB 3TO2B 3RZCD 5EWIL 5DK2A 1DSFH 3Q6GL 4Z7OE 5JOFB 3J8F7 1JGVH 4P2RD 3FOLB 1KGCE 1UB6B 1WCBA 1T0MB 1I4FB 2AEPH 4Y89A 4GG6F 3V4PL 3GHEH 4PJ9B 4M62H 1EX0A 5DJ8A 3RWCB 4DN4L 4HCRA 4J3TA 3PGFH 2HTKC 3TN0D 1BWMA 3NFPA 1MIMH 2D0GA 2G9HB 4G9FE 4LLUB 2JCCA 3HPLB 5C1MB 4X6DE 4XNUL 1SEQH 3KYNA 2QBWA 3BD5A 1QQDA 2M1KA 5FYLD 4YDJB 1QRND 2R2BB 2DIJA 3AU1A 3I3DA 5KSAD 5JMRA 1KG0B 4G6JL 3DYOA 4F9LC 3KLAB 1ZAGA 4JQXA 4ORZC 3C6LC 1JNNL 4YHIB 3JWOC 1KCKA 1U92A 1IGTA 5IHLB 4F15C 4FXKA 5DRNA 2C1OB 5CJQH 4RBPK 3GEWB 4Q7DA 5C07B 4N9GB 2IMNA 1YNTA 5AWNH 4APQC 4MDIB 5J3HC 1J5OL 4UU9A 1HYRC 1TCRB 4P2OC 1L0YA 2AJSL 5A16A 3QDJA 1DBML 4U0QB 2XY2A 1EEQA 3LAFA 1JZ4A 4P4KD 4NWUL 4O2EA 3KPNB 4H20H 1F5WA 5JUEH 5J4MA 1I3GL 4HKXA 2AJUH 4V2BA 4HHAB 3V6OE 3GSOA 4LSVH 4CU8A 5E7FA 3X11A 3EJJX 4FQIH 1V7ML 2GJ6B 3ARFB 2HTLC 2ILLA 4OIIH 5GGVY 3S9DB 1AQDA 1OGAB 4L9LA 4NFDA 4RRPA 2HA1A 4I3RH 12E8L 1NQBA 3MFFA 1HQRA 1UM5H 4ZUSA 1RHHA 5HYQA 1MCWW 2G5RA 1M1SA 1OCWL 5CIPH 1CK0L 4R9HA 4RGND 2EDQA 5CLWA 4JM2F 2A0LC 3MJ9A 4YAQA 3FQWA 1QSEA 2EDEA 4FTVB 4X4YA 4YZFE 2RBLA 4OCWH 4OFPA 1VFMA 5JW4Q 4QXWA 2ESVA 3FRUB 3SKMB 4WRLA 4X5WA 3LIZL 5TDPA 4ORGB 5HHPA 1E6OL 3MJ8B 2VQ1B 3UTSB 2BDNH 3CLFH 4L3EB 4L5FH 4MSWB 1NAMH 1M71A 2XKNA 2EKSB 3NFSL 5ICZB 1WK0A 1OAQH 2JJUA 1JPFB 1GGIL 4KRMB 1DBKL 4P23C 1LDSA 4MCYA 4JJ5B 5CEYB 4NQCE 2HKHH 5ADOH 1I7ZB 1CI5A 4YDLC 2J8UA 4X8JA 4JFED 1L7IL 2O5XL 5A2IH 4OT1L 2D9QB 4V2CB 3FZUD 3RY4A 4PRDB 2NY0B 4GXUM 1JPGA 3JV6A 4D8PB 2E9BA 4HWBH 3OF6D 5CILH 3F7RA 3Q3GA 4C56B 5C0RL 4U7KA 2RCSH 2XFXB 2KL6A 4I13B 4LRIA 5E2TH 1UZ6F 2XTJC 4MD4B 3QUMB 5SWZA 3SDXA 1KCRL 3GSWA 5BO1L 4QXUL 2AI0L 4PJGA 1NBYB 4U1MB 4W4OC 3BKCH 4QHLA 3RHWK 3UTPE 5HHMD 4K8RD 4PJFB 3V0VA 5D72H 3IJSB 1F3DJ 1JGLH 4IEFB 2R1XB 1NLBH 5I1KL 4XB8A 1AKJD 3RUGE 4ALAH 2OZ4H 2YA0A 1XT5A 2GJ6E 5KW9L 4KJQC 5I0ZA 3D39B 3E1F1 4GAJL 5I1LA 4XAKE 4KQ4H 1S7SA 3AREB 3IAGC 3WFCH 4LQ1A 5BCAA 1MJ7H 2EKJA 3UJJL 4EXPX 5F7UA 4G6FD 2DKUA 2WQRA 2ADJB 1OM3H 2CK0H 4EI5C 4NQDA 3WJLA 5KTEH 1IC4H 4WHYH 5GRYA 3MQIA 1F11A 3ARGB 2P8LA 3QP3A 5IB2B 1NFDA 3ZKMD 4NQVB 1T0PB 5B8CB 2EC9T 5L2JB 1U42A 3L7FB 1VGEH 3MROA 4IOSD 1YY8A 4OKVA 1TJGL 2BNQD 3IKCA 1UQSB 4GG8A 1AO7A 2K9UA 1ZVSB 1AGDB 3S97C 4C83A 5EN2A 1NEZB 3IDXH 2YMXL 4PJDF 3UTSE 1GZQB 1P2CA 1A64A 3D3VD 4OFKA 1MIEH 2HT4C 4FQXD 5JDSB 1DBBH 5DK3A 2V2WA 5KS9B 3OG6B 1J11A 3HFML 4M48H 5D6CA 3S36L 4IRZH 1UH3A 3R0MA 2BJML 5DMKA 2PO6C 3VI4F 3VFMA 2Y36H 5F6IC 4L4VA 3QJHB 2DQHH 4N0CC 2XOTA 4O02L 1DUZA 2AGJH 4QRTA 4C56E 5LGHL 2WIMA 1T20A 1DANU 4GOSA 4OZHF 5FYJH 4DFIA 3N85H 1CDGA 4YHPA 4QY8B 4LQFH 5IEKB 1G9NH 4D2NA 4JZOB 4G80A 3MRCA 3CMGA 4U1GC 2FECL 3BZEA 2AJ3B 4H25B 3U1SH 3REWB 1XF3A 3L3IB 5JORA 2RB8A 2HN7B 2X05A 2WIIB 3BKMH 4C4KT 1HH6A 1NFIA 2Z8VC 1ETZB 2KQMA 2DI8A 3QIUA 4OGXL 5C0GB 3LKRA 3VXPB 1VFBB 5A2FA 3QH3A 3U7WH 3QEHA 2R9HC 1T21A 4EIZC 1ZSDB 1RIHL 4I0CC 1CD0A 5GZOC 3GSXA 4WWKC 2MFNA 1ZHBB 5IW6B 5CFHA 3IDJA 1ZA6A 5MEOA 3OPZL 4Q9CA 4F7TB 2C7UB 1HHJB 3D85B 1FZOA 1P6FA 4PBVC 5C0FB 1YECL 4G43A 1ZHKB 1RULL 1MELA 3MV01 4LSQH 5T1KA 3SDAC 4P5KA 5DGRA 5DJ0B 4MDJA 1MCIA 5KSVB 1DVFB 2X4SA 5MI0C 1FNLA 4WV1B 4QHMA 3U79A 4FFYH 5JIHA 1I75A 1CE1H 3LDBC 4FQPA 2BZDA 5JPNB 1A8JH 5E1AA 1IGCL 3FB5A 1RMFH 1ZA3B 2OBGA 4PLNC 3BGMA 3ZKXC 3LSOB 5FA3B 3G6DH 2DI7A 4S1DD 1S9KC 4XHQA 3EYFA 4JO4L 1RURH 3MBEC 1H5BA 1YEFH 2YUWA 3L3DA 4HUWA 4LCIL 1A9EB 1GZPA 1J1OL 1OTTD 1JK8A 2IBGA 5TF1L 1LE5B 2YPVH 4Z7WF 1YJDL 4HW6A 3DTXA 3RVUC 5EBMB 1N4XH 2HWZH 3SE3A 2H2SD 3T2PA 1KF9B 3C60B 3SKUD 2Z4QA 5IGXL 1AD9B 4G3YL 2YUVA 5J1AA 4EEEA 1YEJL 3LV3B 4FFZL 4NZTH 4OCSH 5BXFB 5HI3C 3ZO0A 1RZJC 2ESVD 5IMMB 3DYMA 2DKMA 4IMKC 3HE7A 3BD3A 3EOAB 5T1MB 2P48B 4JFFB 1KCUH 4OFVA 4XMKH 1CE6B 3FT3B 4MX7A 4KPHL 5CSBA 3VXRA 3L95B 3QAZC 3DETD 3TT1L 2BRRL 1VADB 5DGQA 4JVPA 2KDGA 4X80H 1BAFH 2NY4B 4KJYA 3NABL 2VLKB 1M7IA 3IXTA 4XPGH 1AGCB 1FORL 1CXEA 2AV7B 3QRGL 3P9MA 2AS5M 4U6TA 1FSKB 3OL2A 1NGXA 5FB8B 2P46B 1WAAF 3NCFB 4GH7B 2DM3A 1FAIL 5TDNB 1UCTA 1NCCL 1QRKA 4MJ5A 4OZGE 3INUH 3GMMB 3C09B 3WE6A 3ROOB 5IQ9A 4ZD3L 1OD7A 4I9WD 2YS4A 2VE6B 5HGBB 4HULB 2GK2A 4R2GD 4DZ8B 3T3PF 1HXMA 4NBZB 1GGCL 3O6KL 1EJ6A 5DJAB 5KAQF 1U91A 4QHUB 1FGNL 4C4KO 1WT5C 3KPTA 4LLYB 5J12B 4JDVB 1NSNH 1J0IA 6CGTA 5INDA 4KK9C 3MLYH 3W82A 1CL7H 1CFSA 3JBG7 1OLZA 5D2LF 3BEVB 3L3JB 1TMCB 5F7DA 3AVEA 1TZHA 4QOKA 1HCVA 2HLAA 4WI9A 3EJYC 4KZEL 5L2KE 3RJDA 1JFQL 2LVCA 1HZHH 5T3ZL 1U58B 1BFOB 2Q86B 4MNGB 4IOIA 2AABL 2C3HA 2FX7H 5FFLA 1JTOA 2B20A 1QSFA 4MJIA 2ARWA 1JGDB 2AXHA 2Q3AA 3PGDB 4NQDD 3MRQB 2FNBA 1YYLL 4R26L 2NX5A 2X41A 1JV5A 4HK3J 4PJ9C 5I16A 4OV5A 4RWYH 3TNMB 1CGWA 4RMSA 4E41A 2HMID 5DQDH 4JFOB 2HKFH 5K93A 3QNYA 4L3CB 2P8PB 3S35L 4LPWA 1WZ1H 4F2MB 2NR6D 5KSUB 1F58H 5JW4M 4P2OD 5D1QB 3NCMA 2AJZB 4BKLA 4U7SA 5E6ZA 3CDGA 3HMXL 4EN3B 5EUOF 1NGPH 5EOCH 4XT1C 3VI3E 4BSVA 3CFJA 1IGMH 3IKKA 4NRYB 3QYCA 3I3BA 1IEAB 5D5MF 2V17H 2SEBA 2XQBH 2QSCL 3M8OH 4WU7B 1NCAH 1S7TA 1C5BH 4KDTA 5I1GH 3LKOA 1LQSR 5E00B 2IC2A 4GBXB 3TC9A 1PX4A 3HRZB 4KI5C 4ZODA 5B39G 3HAEH 3U83A 5DQ9A 1T2XA 2EYTB 1PVHA 4L4VD 5HTSA 5IUSA 1CXHA 2A0LD 3AS2A 1IM9A 3CCHA 5FOBB 3NZ8B 3C08H 3FB8A 3V0AC 4G9FA 2DYPA 4NO5A 1RZJL 1I8LC 4HJJH 3B9AA 4OD2A 5J7CC 4DW2L 1CLYL 3KWWA 3U4EB 2YEZB 3ARFC 3MYJB 2K7QA 3SO3B 2VLME 2X1WL 3E2HB 5KAQG 4W81A 1T7WA 1WISA 4QGTA 4XAWH 3TP4A 4A6YH 4WO4A 4F9PA 1ZMYA 1VPOL 1D5ZA 5IB5B 1OSZA 3D0VA 2IPKB 5I1EH 4WFGE 4F80A 3B2VH 4PREB 4P46B 4PJAB 3QIUD 2V5SA 4P23D 3DIFA 3GMQB 4Z7NF 1I3UA 2VLRB 1KUMA 3RWDB 2B1HH 1MJUL 3F7PC 1OSPL 2AJXL 2GKIA 5CUSH 4HFUL 5C0AB 3REVB 2VMFA 3TJHC 2A9NH 1Q9OB 3HZYA 1KJ2A 3T65A 1IGFL 4QEGA 4IDJL 2F19L 1Q94A 4Z7VF 3ZTJG 2FO4B 4MNGE 2FSEB 4NRZA 3BW9A 4LAQL 1YYML 5CSGA 2YBRB 5T1KD 5CP3H 2EH8H 5E4IA 2LQRA 1ZEAL 4ZO9A 2HVJB 3UP1A 4XI5C 3TFKC 4H26B 5F9AC 3A6BH 2E27L 3L5HA 3NCYP 3THML 3V6OA 2NY5L 3UZVB 4JVWA 3NPSB 4D3CL 1S7VB 3W5MA 4R90H 5HYSA 4X5XA 3DVNB 2JTDA 1T1YA 4Y8DC 1SJEB 2VDRH 1HHKB 1BOYA 2DD8L 4POUB 1GGBL 4NNYA 4YHML 1ZLWH 5HSFA 3BKJL 3ZE2F 4ZTPL 3PWUB 4L8BA 3CVIL 1AH1A 4Q2ZA 2R0LH 1DANT 1S7QA 2NY0C 3RIAF 4E9LA 3X12A 1E6JL 3V5KA 1D9KB 1X5IA 2EC8A 5DUMH 4CADA 2EDHA 4LASH 1NCDL 5IHUH 1RUML 5IK3A 2E9IA 4QO1A 4OLYH 3O8XA 4JREB 2Z93A 4MYWB 3CXDH 3ILPB 3MLZL 4K7PY 3PQYE 5ERWA 4I48A 3GI9H 4LSTL 5FUOL 1XCQB 4Y5YA 1NGWA 4DCQA 3JUZA 1G7IB 5BRZE 1SEBB 5E0QA 3RNKA 1MFCL 2BXZA 3KHQA 5DJXB 3S5LB 4U33A 4E0RB 2A6DA 5KJRH 5MEQA 1UXWA 2X4RB 4P2QB 4XNZB 5TJWK 3LEVH 1FL6A 5EU7E 5BMFL 3QDGB 1CIDA 3FB7A 5HY9B 1IMHC 2RAMA 2R1WB 5F9JB 2J88L 3RA7L 1CR9H 4G8FA 4NQCA 3O3AB 5F97E 4XNQA 1WCQA 4BH8A 5LGJA 3QI9B 3P9LB 2GT9A 3MLTA 3UC0H 4JPIA 2V5MA 3JV4A 2YPLB 2RFXA 3MX0A 4KWUA 1HINH 3IU4L 2HJFB 3AREC 2OR7A 3FN0H 4RIRB 5ID0B 5DVLA 2GIYA 3G5XB 4PJGF 4M03A 2BVUA 1EGJH 1HDMA 4M1DH 4BFBD 4BSJA 4NSKB 4FZEH 3PF2A 3BP4B 5C6WH 4GW4B 1BLNA 2C3XA 5KVDL 3ARGC 2IG2L 3RPIB 4HS3A 2VKXA 4U1SB 3MODH 5DFVC 2PO6D 5B8CC 4PRHB 1WLHA 3MNVB 2DBLH 3RY5A 2BCKA 5IM7B 1YMMD 3KPLB 5H35A 4GMSH 1R5IA 3U2SB 2CKBL 5DYOB 4KU1A 3JWDH 1ADQL 3TT3L 4RRPG 2R8SH 2CLRA 4HV8A 5L7XH 2VDNL 5GGRB 4QOKD 4JGJA 4XP6H 3ZE1E 4HDIB 3RUGA 4S2SB 4KVNL 3CX2A 2R0WL 1NFDF 4U3XA 3RWIA 5DD6A 5F1NB 5FO7A 4MMZC 4XP5L 4PB0H 4X99B 5F9DC 3L6FA 4X4ME 1N5AA 5EPMB 3BN9C 3IDYC 2D31B 3GZKA 2BVOA 3MRKB 4J4PD 5JHDB 3HNVL 2CUHA 3VFWA 4RFNB 2BVEA 5IVZA 4PJHB 3MRRA 3T2NH 3KYKH 1GGTA 2IBBA 4WJ5B 3GB7A 3TBVA 2J4WH 1D6EB 2OLDA 3DXAB 5IKCA 3RRQA 2AEIT 5IQ7L 3CSBA 1LE9A 4H1LB 3RX8A 4PJCB 1A9BB 4YO0A 4HKZA 4PRPE 3TA3B 3CH1A 3KDMA 2XZQL 3T4AA 4N8VB 4L8DA 1Z9SA 2FX8L 1OHQA 1BREA 4FQ2H 4XMLL 3IVKA 1T1ZB 2I24N 2X70A 1QSZA 3QFJD 5EORH 3C8KB 4R7NB 3G5ZA 3SDAD 5LCVH 1Z6JT 4GMTH 4LHQB 4WUUB 1E4XI 3OXRB 4ZOAA 3HC3L 4YE4H 2ZSVB 1V3MA 3EO0B 1NCUA 3JSSA 1EUTA 3BOVA 3QZWA 2IAND 4AENA 2D9CA 3MLXL 3AS0A 4PJXF 2JIXA 1TTUA 2GFBA 1QFWH 2CXGA 5F6HI 4BSWB 4KZDH 1WFTA 4HMDA 1KGCD 4MHHI 1SJHB 4ELMB 3BFOA 3KJ6L 3W9DB 2ZUWA 3D2UB 2IJ0C 3DURA 5L8LB 3QWOB 3VFNA 3ZE0F 4NT6A 3IS0X 4CKVX 1JGLL 2X4QA 4G9FD 3IGAB 3U36A 1DVFC 3GIVB 3IS1X 2DYPD 5GGQL 1A02N 2HG5B 5FGSA 4OLXH 4WV1C 1RZKH 5EIIA 2VL5A 3QDMB 5E7BA 4OTXL 5TE6H 3QUML 2Y72A 1RU9H 5H37G 3JTTB 1UJ3A 2UUDH 1Y18B 3K4AA 3WFCL 5MENB 1SBSL 4KMQA 4WO4D 5DDHB 3S4SA 4I3GA 2CR6A 1IJ9A 4LCWE 3SY0A 5LBSH 3MV9A 5FYJU 1K8IB 3KLHD 3GSVB 5B38G 4DOHB 4Y5XA 2EIDA 5K9QI 1LO0L 1Q0XH 7FABL 2MCPH 3O45A 4LNRA 5GGSA 4MXQC 1HEZB 1IAIL 5CP7A 1EHXA 2H1PL 2R4SL 1PDKA 4HKJB 1DUYB 2AK4A 2OL3A 4PJ7F 5JHDE 2IEPA 3B9KA 3MLSH 2XXCB 3HNTL 3HC0A 5GJSH 4PJHE 2OTUA 1XF4A 3OKEB 4FG6C 1TNNA 2ENSA 4PUBL 4HUUA 1IM3A 3FQNA 4OUUA 4K7PL 2AXGA 1ONQB 1MIEL 3TBWB 4LPUA 1XF2B 5MP6H 2G75B 3FMGH 3RZWA 3MCLL 3PWNA 3P77B 1OAZL 2J2ZA 2NY4C 1CFVH 2JB6B 4ZO7A 3UPRA 1FCGA 4HUNB 1ES0A 4JHAL 1FSKC 4G6AD 4PY7A 4TUJB 5SV3A 1AR1C 2EIZA 3KYAA 2B0SH 1KCVH 3CZFB 1F2QA 3VA6A 3O2VH 3OWEA 4MWFB 4BFGA 3MLRL 1CFQA 3C09C 4FP8H 1E28A 4YHZH 4V1DD 1I8MB 2GTWB 5L88L 3OXSB 1FIGH 1RJLA 2RGSA 1CG9B 3OGCB 3O8XD 4NJAL 1AJ7L 3T3MF 1HIMH 3NAAL 3AM8A 3VFPA 4M9OA 3IJHB 1KIPA 4KMLB 1IEBA 1FNEA 2X10A 5J12C 4JRWA 4KKAD 3FO1A 4QXGL 5ACZA 1LO4L 3HUJB 2OS7A 1WVZA 1Z9MA 2V2XB 2XA3A 5DJZB 3F7VB 4H88H 5DJ2A 4P4RB 4U3CA 3JV5A 2VZ3A 3VMPA 2YD5A 3B5GA 3QDME 4NQCD 5K59F 1PBYA 5HPMA 3DUSB 1YPZB 4CUCA 4RGMB 4JZNB 2A77L 4G9DA 2D4FA 1ZTXH 4HT1L 5SX4H 3NTCL 5DZNA 4XMPH 3BRGC 4KK5C 2ICEA 4Q9RH 1JYXA 2IFFH 3NACH 1MHHA 4OZGA 4JRYB 4GLRH 5HVGB 2HT3C 4JO1H 4OSUH 3X14B 2XNAA 1T0NB 4Z0XA 4UT9H 4KKCC 3VGBA 4UIKH 5E95B 4M1GL 5IBLC 2PW1B 4PTUA 4YBHA 1CGSL 1DQDL 1WEJL 1CF8H 5KVMC 4MGXA 3GMLB 4PR5A 3PWPA 1OAKL 4LU5H 4FXLA 4PS4L 3PJSA 1UYWH 5D1QC 2WLZA 2M2DA 4ODSL 3VWKB 1YEFL 2FEDC 4HCRH 3U7YH 1BVZA 3CFDB 1CFTB 4EN3C 3PHOB 5ILTL 2P7TA 3MOBH 1CS6A 1S7XB 3NPZB 3HZVA 5FKPA 1MAJA 3U30B 4Z8FL 5D70L 4GRMB 2GJ6D 5L2KA 1MFBH 1U6AL 3UJIH 4YGVA 1I85A 4I0PB 4JY4B 4XAKD 3CDFA 1VKXA 5DJCB 1WBZA 1C5CH 4XCNB 3EFFA 1B2WH 4ODBD 1YY9D 5EDXA 4R3SA 5GGTA 4M6MH 3FQUB 2XXMB 5E8PB 3GIZL 2CR3A 1OWWA 5I18L 1BM3H 2FJHB 3MRBA 4UTBH 5L9DH 1A6TA 1SBBA 5F6HJ 2NY7H 4NCC2 5KVEH 3RI5F 2OSLA 2H32B 2ZUQB 3D25B 5LXGH 3VD4A 4Z18A 1FFNA 3FFCE 1TVBA 3PWJB 4JO3H 4K2UL 4WY7H 3W9EB 4XPGL 5I8KH 1EHLL 3KNBB 4WEBH 3LHPH 1WZLA 2FYYB 3V52L 1DEEB 4CU7A 5AZEL 2ICES 3EYVB 4J3WA 4E5XA 3KPQA 1WICA 2FH6A 4KUZL 4QRSA 4Z7OF 1DN0B 4LF3B 3SO3C 4NP4L 3E2HC 1KC5L 4TSAH 3BWUC 3P4MA 3UTSD 3ARYA 2DQIH 3Q2CA 4ZUWB 5BJTB 3BWAB 3KPSB 4Q9QH 5JZ7C 3TNNB 3MRIB 1T5WB 3LB6D 2JIXD 5JXEA 4P46C 1G7MB 3G04A 2Q76A 1QYGL 1O7VA 1AC6A 1AXTL 5LQBL 1LGVA 1D7FA 3GMRA 4Y2DB 4PJBB 3HE6B 1EZVY 2BY2A 3GK8L 1UB5A 4X6DF 2B4CH 1G9MH 3LRSA 4M43H 3WKML 3ARDB 1UKSA 1NSNL 3PWVA 1U8KA 4QRPE 2FWOB 5JPMB 2PR4H 2NY0D 3DUUA 4PPTA 3RDTC 4JRYE 4Y4FB 1JMXA 2EECA 3QULA 5D7JC 2FHBA 2EDXA 1P4IH 2IFGA 5DHYA 3L3GB 5D1XA 3KPMA 5DRXB 4MD5B 4O00A 2APFA 1G7HB 2NY3B 4C56D 4LCUA 4OLWH 5JOPE 2FGWH 5TQ0H 4JFYB 3BH8A 3CVHH 1UM6H 1EJOH 1BGXH 1Z5LA 3NPSC 4EQ2A 2R2HB 3EJZC 1J1XL 1IGYA 2ZG3A 3WFZA 4UOW1 4JPVH 3X13A 2P43B 3DYPA 3VFSA 1LP9F 3WXWL 35C8H 5BVPH 5I1CL 2ZPKL 4U1NA 5ALCH 5H2BB 3WJJC 4DKFL 3DLQR 4XP1L 2NXYB 5TQ2H 1D9KC 1DLHA 2XQYG 4JY5H 3H9SA 3SPVB 4JO2L 4ERSH 5IJKC 3WLWD 4HUXA 3FO2B 4ZFOL 2X7LA 2DQFA 4WDIA 1SYVA 4JREC 3VFGH 1T83C 2ARJB 3H42L 5IHBA 4NO3A 2D7OA 3P3YA 3OAYH 2R29L 2IALB 2FJFB 1JYWA 1KLUB 3ALWA 3PWLA 4AZ8A 4NO0A 1XGRB 5CGYC 4HWUA 3I50L 4EUPA 1XIWA 2A9ML 1H3WM 5DFVD 4U2ZA 1KCSL 2FBJH 4ONHA 3V4UH 3TPUB 4X6BB 4OLUH 2ICWJ 4YDIL 4YXHL 4XNZC 3HG1B 1VFAA 3LKQB 3QQNA 1INEL 5EO1A 5FF6A 4XCFL 4LMQI 1HWHB 2I07B 1W72H 1MH5A 4OGZA 5EOQL 5GGRY 4CW1A 4XCYA 4HX1B 1V3LA 3QI9C 1G6RH 3SE8H 4LRNL 1XR8A 4QHKI 2EE2A 5C9JB 1QTYT 4WTZA 1OAXL 4RMQA 4X7SL 4HMCA 1E4WL 1IBGL 2IBZX 2VXVH 3OKMB 4TVSa 2HFGH 2H2PD 3QG6A 5I8CB 3BP6B 3FQTA 1I7TB 1K4CA 4DGVH 4KTDL 4K7FA 1QKZH 2UWEE 4HKBB 1WITA 3HRPA 1GOGA 2Q87A 5DI8A 43C9A 1IGJB 5ITFA 5LAXB 3PQYA 3R0NA 3BN9D 3BUTA 5IMLA 1A4KB 3ARBA 1NGQL 4C58B 4JDTL 5GRVK 4N5EC 2BSSA 5BRZA 2DQGH 4F7EA 4HG4K 3EDJA 4GXUN 1C12A 1EAJA 3LKSB 2X4NA 4NM8H 5GHWH 4M8QA 4MQ7B 1PW3A 3SCMA 3WO3B 3MCKB 3OAUL 5DS8A 3RIFF 4XHJC 4ZUTB 5IMOA 5TGBB 4ZPVB 1X3DA 5CZKA 3U0PB 2B1AH 3QUKB 4YIQB 3JVGC 2A9NL 5T5FH 1OARL 4GSDL 4KI5F 3K2MC 1OTSD 2E6QA 3WUWB 1JZ2A 4X7FC 4P49A 3BPOB 4X0KA 1JL8A 1KJVB 4LK4A 4HZAA 1T1WB 4KVCL 2ZG1A 5AUMB 1JUFB 3ZSTA 4O5LH 1GGYA 3H3PH 4RFNC 3T0VA 1Q9KB 1RZFL 1EAPA 5DHVB 4MNQB 2N7BA 3LKPB 4QRUB 4M6NL 3C8HA 3OKOB 1EO7A 3TA3C 3IETA 4W4NA 5I6XB 2ZUYA 3WL9A 3D85D 3TZVA 3O3BB 2QADD 4IRSB 5E6IA 3WN5B 1AGBA 2HJKB 1KPRA 3QO1B 4LMQE 1DVFD 1Q72H 4NKMB 2JB5H 1RIUL 2CLZA 4WHTB 5F89B 4HUVB 3VFOB 3QA3B 3V5HB 5I1DA 1KENL 4APQA 3PGCB 4I5BA 4TULL 5L2KD 5I2IB 3VRJA 2EEBA 2PYFB 1TETH 5CBEB 1A6PA 4C59B 2BY0A 1NBQA 1J8HE 2Z91B 5C09B 2UZXB 3TIDA 4JGUA 2O61A 5GGUB 4MB5A 5BZDA 3PP4H 1P4LB 5D1ZA 3BKYL 2CIKB 5DVOA 4ZFZA 3CZJA 3BP5A 5BS0B 2PTUA 3KR3H 4CVUA 4OF3A 4OM1H 5DUBB 4MLSA 1OOAA 3EGSB 1MRDH 3WSQH 2L7JA 3C60D 4PRPA 3LEVL 4MXQD 2F53E 4JQVA 1Z3GH 1NMAL 3GBNH 5IVXE 1JN6B 4TSBH 2QQNL 5JLZB 4QF1A 3P9WB 1IT9L 2AEWA 3X3GL 5IOPB 4LCCA 1IKNC 4RZCA 4JFFD 3FN3A 1SM3L 5IESH 3S37L 2AJYH 3KXFB 5F71A 4UOW0 5E1HB 4Z78A 3EHBD 4MQXC 2BSRA 4HAGA 5KN5B 1V3JA 5AD0A 4CRPA 4U4BA 4XNMA 5FHBH 2NY4D 5EU3A 1IFHL 2VAAB 1BFSA 3ULSB 4NJ9L 4L8SB 5B3JF 3GI8H 5CD3B 1KEGH 1F4XH 1MJ8L 1BX2A 2NNAA 3NGBB 1PYWA 3QQ4B 3QPQC 3UPCA 5C7XH 3CIQA 3ESVF 5EFIA 1XAUA 3HPJB 1J18A 4TPRH 3J7HA 1G0YR 2UZIL 1BECA 3MLPA 1VACB 1BFTA 3SJVB 4MNQE 3MRMB 3ZDXE 4M5YH 4UV4H 1S9XB 3BT2L 4JANA 3Q1SL 4YNYB 2BOCA 3BO8A 3BDYL 1FFPB 4PRNA 2XZAL 15C8L 3E6FA 1TJHL 4WTWA 4RAVA 2VLMD 1EMTH 4P9HC 2W0FB 3UAJC 5GRJL 4LCWA 1A47A 4WFGD 1T89A 3LQAH 4S1SL 2AEQL 2JK5A 1IZKA 5B3NA 4ZYKB 2EZ0C 1K5NB 3LEXB 4MMXC 5EZIH 4YDVB 4GQPH 4WI2A 3BZDA 5EU6B 2LAGB 1P84J 3VXQA 2R0KH 3UDWC 4UDUA 3QCVH 3MLVH 3QIBD 1NC4B 3LOWA 3VRIB 1CIUA 4MVBD 5EUKA 4BQ8A 4OF8A 3T0WA 1K9TA 2WW8A 1WIUA 1J0HA 3TF7C 2HT3D 4YE4L 1S7UA 3F58L 4LLMA 4Z7UB 3MXVH 1C1EL 1QOKA 1ZGLB 3NCJH 4OZIE 3M45A 4LL9A 1MLBA 1FYTE 5DJDA 2ZCLL 4X6EA 4JM4L 4P57B 2V9RA 1R5WB 1P1ZA 5F7NC 5FYJE 2VIRA 1FE8H 1DQQA 1L9NA 1QLEH 2R1YA 2AERT 4EI5A 3OJDA 3RL2A 3VD9A 2P8MA 4RGMC 1OLLA 4D0CB 4BZYA 4G5ZL 3P4NA 1LNUB 5EO9B 5GS0L 1J1PL 3BVNA 3FO9A 4ZTOL 3CDCA 3CPLA 4I77H 4RFEA 5J6HB 1HSBB 3S34H 1EA9C 5C6PB 3HCVB 1JZ3A 2X4TA 1RIVL 3TWCL 4OF0A 5FKAA 1A14H 2GTZB 4P5MB 3W5NA 3O0RL 1EEZB 1RZKL 5C2BH 4EQ3A 1YDPA 4GBXD 4UIMA 2EO9A 3FQXB 1CXKA 3PQYD 2YC1B 3TYFB 2LU7A 3ARBD 5BQ7B 3BGAA 3SQOH 4LAJH 1FV1B 1PJ9A 5BRZD 3UJTH 3WNKA 3TIEB 1N2RA 4J3OC 3VWKC 1EEYA 3DX9A 2XACC 2X40A 2R2EA 3S96A 3CC5B 1U8OA 3WHE0 3FCTB 1CFBA 4JEGB 2VLJB 3HB3C 3MRNB 1CL7I 5J11B 4KMTL 3G6JB 4JQIH 5F7FA 4HLZH 5IW1A 4GG6B 3I6LE 5D9SA 3U30C 2FL5A 1HH9B 3C5ZA 4KDWA 5DZOA 4IHOB 2BFVH 5I30H 4YHOH 5HI4D 3SEPA 5ENWA 3T0DA 1X5XA 3MGOA 3GRWL 5F21B 5A40E 5L6YH 3KPRB 1X5FA 3QXDB 1Y6MR 4JN2B 5DMGC 2IADB 3E8UH 4OAWB 2ZUQC 3HR6A 4GRWE 4XPTL 4JKPL 3WD5L 1S7RA 4WW2C 4RGOL 3DX8A 1JRHH 1YUHA 3K1DA 3U0WL 5A1AA 3LZFH 1RJZB 4I2XA 5CJOL 2VZ1A 4JLRA 5C0CE 1S78C 4GW1A 5E8EB 3VW3H 1T2JA 3TZVD 2YPKA 5ICXA 4MJ2A 5AAWA 1MI5E 3DI2B 5E6ID 1NDGA 1JGEA 5EIVA 5CGMA 1DJSA 2Y6SD 2VDPL 1KNOB 4NQSB 3CFBA 3CH8A 4PJIE 1BBDL 4K94L 4U1LA 3ZTNH 5F88B 1NEZG 3IDGB 1LO2L 3EYOA 1KOAA 5B22A 2DM2A 3T1WA 2WINA 1OF2B 5JW4N 1HHGA 4P9HL 2R23B 4TNVF 2NLJA 2E7LA 1TTGA 4PJEB 4Y2DC 3HE6C 3T0EB 1FBIL 4O51A 3M17B 1RZIA 3WHXB 4XBPA 5D1ZD 4JN1H 3ARDC 6FABL 1HWGB 1OW0C 2ED9A 2ITDB 3B3IA 3NH7L 1MPAL 3VI3F 3KYOA 1ZT7A 4Y4FC 1MQKL 2YZ8A 3UEZA 2XZCL 1IC7L 1MVUA 4KHTL 4OCRH 3FFCA 3S6CA 1L7TH 2F54E 3W0WB 1N6QL 2ICWA 1M05A 5DMIL 2NY3C 2X1PA 3MJ6A 5D7KE 3O6MH 1U8QB 5C8JB 1PSKH 4EJ1C 2ED8A 2HT2C 3O4LB 3VFUB 1VESA 2DIBA 2ATPA 1H15B 3DRTB 2EYSA 3V7AG 1ZLSH 3T1FA 3GMOB 3P0YL 5K9JH 4A6YB 1CDCA 2FH8A 4G42A 1ODAA 5CHNB 3TBYB 1HI6B 5HHVH 4ZPTB 4CVXA 4JB9H 4HIEB 5DD5L 2W0KA 4IS6B 2D7TH 1HHIA 3BYTA 3RX7A 4JRXE 4PP1C 3CFKB 1T03H 1I1AA 2VC2H 2NXYC 5F9OH 4OB5H 3BZ4A 5C0BA 2EDYA 2Q8BL 2QV2A 3GJFB 1OAUH 4LU5L 3L7EA 4I3SH 4HGWB 4QRPA 3LD8B 1G7PA 3GSNB 4NGHH 5HBBA 2Y7QB 1JF5A 2WP3T 2HJLB 2BVPB 3DRQB 4X7CC 5HYIA 3MRPA 3KPRE 1WBYA 5DSCB 4NPYA 2AXJA 4FQCL 1GC1H 3MJGX 4ODXA 3OKLA 4MNHB 1NJ9A 2VXUL 4AT6B 3S36X 2I9TA 4BFEA 1GOHA 1KLFA 2V2TB 3EO1B 3WFDL 2WLYA 2JF1A 4HS8L 1WC7A 3U7AA 4K9EC 3I6KB 5D7IB 3MLWL 2XWTB 3L3KB 2CDGB 1MFEL 4Y16B 1KPUB 4Y5VB 2X9XA 1WIOA 3VXTA 4RAUB 5KSBE 1INDH 2PXYB 2VXQL 3H9HB 1WT5A 3ECBB 1NGYB 2W59A 2FIRT 4P5TA 4PJEE 4DN3H 1GYAA 4UV7L 4WW1B 4XWOD 3R8QA 5JHDD 2WAHA 1V8HA 5HGHB 1A6AA 3P2TA 3SE9H 4UT7H 1Q9LB 5F1OB 1A7NH 1PG7W 4RA3A 2YD8A 4MQSB 1RD6A 4M5ZL 1F6AB 1U8HB 3OGOE 2G2RB 2LV4A 2Q8AL 4YH6A 2IQ9L 4M7KL 5I1JL 3S88H 5E2UH 1A6ZB 1KB5B 1XGUB 4R4FH 2D4DA 4N0UB 4JCLA 4U0RB 2Q7YB 3P30L 1N59B 1G9ML 1Q9WA 4Q0XL 4NKDA 1BBJB 4WFFE 3MZGB 2NY1D 2MOVA 3BPOC 3KLSA 4HJGB 5EU4A 4Y1AB 5F96L 2CIIA 2G5BA 3CGTA 4OQTH 1BMGA 1MRFL 3RZCB 4NO2A 3VA2C 1LO3H 5BZWB 2NZIA 4CAGA 1WWCA 4G7YL 4PV9B 4YPGB 1BGXL 2VXSH 4PG9B 3IXAA 3QISA 5I6XC 1UWGL 2ATKA 3WXVL 5JW5B 3ULUC 3H2WA 3KLAA 1OAYL 3OX8A 2E6PA 5I1AA 4WU5B 5TE7H 3C9NB 3G6AA 4CNIB 1AE6H 2K1MA 2GSGB 3QFDA 4IRSC 1FFOA 3QQ3B 5GRVL 2O5ZH 1CLOH 3ULVC 1H3PL 2EEAA 3E6HA 3QXVA 4PJAF 3VWJA 3QDMD 2VITA 2BC4B 5GRZA 5KSAB 4PRIB 4ZDHB 3RWHB 3L5WA 3BJLA 4TQEL 1LO5B 1UCBH 5KANI 1BOGA 5EOCJ 1FVDA 3QHFL 5EA0H 2E7BA 1QVOA 2CKBA 5CIPA 5C3TA 5D7IE 4F3FB 3NMEA 4OCYH 1IAKB 5INCB 5DEGA 3ESUF 2F8OA 2X89A 5IT2H 1RK0A 3B2UC 1KN2L 1KPVA 3BDXA 1F4YL 1I7UB 1G7JA 3ZE1F 2BNRE 5ISZE 1NLDL 1OGAA 3MOAL 1HQ4A 3D0LB 4EUPG 5CMAA 2DQDL 5HHOE 3BEWB 1YMHB 3PL6A 1HXYA 1F02I 4P4KB 4L4TE 1PQZA 5EO0A 2CUMA 2WNGA 3L3OA 3SDYH 3MUGA 4X98B 4H5SB 3WLBA 3C5JA 1MCCA 5F3HB 5J9PA 1NAMA 2V9QA 1ORSB 5D8JL 5DEFA 2NYYD 3L3HA 1N0XH 1T2QH 3PHQA 1N7MH 4LIQH 3TYGH 5A2JH 4WTZG 2JJSA 2BVQA 4TUOA 1J8HA 2OK0H 2NPLX 1JHTB 4PGBB 3EW3B 3I2CL 4PRAA 4QKXB 4ORGA 4L8SC 4K9EL 1ZS8B 2X6MA 1S5IL 1U8NA 2J1KA 2HLFD 4RMRA 1QFWI 2OR8A 3NGBC 1RZ7H 1KN4H 4IDLA 4D0BB 4RGNB 3RP1A 2VQ1A 2VDOL 4YUEH 3QXWA 3K4ZA 3QUXA 1R3LB 4P9ML 2V5YA 4Z6AT 5ICZA 3AAZB 4KJPC 1HE7A 2DQTH 2YK1L 3F6LA 5EZOH 1C7SA 3EO9H 2F53A 1DCLA 4WWID 2XG5A 3JTSA 1N6UA 1C5DB 3VXNB 1FL3B 3RY6C 4EDWH 2FEEL 3O11B 3TBTA 3OBAA 5IVXA 4DKAA 1XGQB 4PIRF 2AV1A 5JW4R 3ZT5A 4F57L 3MA7B 4XCEA 1BFVL 3SN6N 1FH5H 2FCBA 2FATL 4I18A 1QHPA 5IEHB 2OQJB 3ZL4L 3EZ8A 4ELKA 4CL7A 3FTGA 1A4JB 1NDMA 2APTA 4NRXB 3S35X 3AXLA 3L5XL 2VABA 5DR5H 4HQQL 2XTLA 4WHCA 4HWZB 2XFXA 3T0AA 4FFWC 3PNWB 1I1AD 1T22A 4LLQB 1AGEA 1MHEB 1IZJA 4F7MA 3NIDE 3KAAA 4NZDA 5C6TH 5JQHC 3GMNB 5IV2A 4QRPD 1GPOH 4D9QE 1NBVL 2BMKA 4WHDA 1VCAA 3LN5B 1NL0H 4JRYD 3U4AA 4Z76A 1IAOB 4W68A 3U9PH 1KELL 4UT6H 1CTOA 1FVCA 1D5MA 4CN1A 2ADIB 3HMWL 2YA2A 1QBLL 5D71L 5E5UB 5CKGA 5JOPD 3B6SB 1D5BB 4G8IA 1ITCA 2KBGA 4RSVA 1NH6A 3KYMB 1SYSA 3GO1L 5KBNC 4ISVB 1QA9A 5IB4B 1TETL 3OQ3B 4QCIA 3O2DH 5HYJE 2H9GB 3QHZH 1J0ZA 3VWKD 1LMKA 1UT9A 1OTUC 1MY7A 3D9AL 3GKZA 5HHMB 3OR6B 1W0WB 3ULVL 1I3RB 2L7UA 3MRGA 2E9WA 3VXUB 1TQBB 4R4BB 3VCLB 1MUJB 4PJHF 5DD3H 3RKDD 5B8CA 4F7PA 5L2JA 2C9AA 3L7FA 4NHCL 2CDEA 4I0PD 5CZXC 3L9RB 3VXME 1R5VA 1XCTA 3LH2H 4ZUVB 5D2LB 4G6FB 2O5YH 3DVGA 3HR5B 1U3HB 4R6UA 4O9HL 4DZBA 5IFHL 4OZIA 1TDQA 4UTAL 5E2WL 1QLFB 1FYTA 1Z0NA 3WNMA 3C6SB 3IFPA 2G60H 8FABA 2OJEB 1M6OA 2DF3A 4LSPH 1VSCA 1W8NA 2BNQB 1DDHA 2VNCA 4XBGB 1X7QA 4LVNC 3CSGA 3T2OA 5J11C 5EBLA 5HVFB 3QO0A 3OKNA 1U95B 1S9VB 1RAMA 3I9GL 2FB4L 2GQHA 3BDBA 4UB0L 2QHRL 3BAEL 3BZFB 4DKDC 1WFUA 4BFIB 3D3VB 3ZTJH 1IKFL 1JZ5A 3EUUA 4FQXB 5IIEB 4LBEB 1PG7L 4WFHE 2XN9E 4ZAKD 2W65A 3JWNC 5DK2B 4HPOH 3TO4A 3CXHK 5CEZH 1S7WA 1NMBL 4QY8A 1FC1A 1WCBB 4Y2DD 1Z2KA 5JHLH 1SY6H 4HFWA 2F74A 3MJ7A 5GGTH 2WANA 2ZOKA 3ARDD 3F62A 2AW2A 1UEMA 4U05A 5DJ8B 5IB1A 4KJWD 5IBTH 1KXVC 3NFPB 2JLLA 2H26B 1V3KA 4N0FA 2FJGA 2JCCB 5DFWH 3DOSA 1GAFL 4N0YH 4UINL 3EDEA 5EWIH 4DGIL 1CBVH 1NBZA 1WQVT 2HT2D 3KYNB 3Q6GH 3VWJD 1QQDB 1CLZL 1JIBA 1K8DA 3AU1B 5E8OB 3V4PH 2Z8RA 4QXTA 5SWQA 4ETYA 4L8CA 3MMEA 4N8PA 4DN4H 3VJ6B 1WJ3A 5DC0A 3T0EC 1U92B 1IGTB 2ID5A 4FXKB 3ROLA 3UX9B 3VXUE 5DRNB 3ZHKA 4P3DA 1U0QA 4MAUL 5FGBC 3MLUL 4XNUH 4M00A 1H9VA 1YNTB 1BD2E 4ONGL 1JPSL 5C0DA 3BPNB 5T5NF 4PTTA 4UU9B 4MJ6A 5K33A 4G6JH 2VISA 5A16B 3QDJB 5C0CA 4YPJA 4YHNA 4PGCA 5T1DL 4LLAA 3UXFA 4XVUD 4O2EB 4N8VG 1JNNH 4KKBC 1A2YA 4Y4HD 2WWKT 1MI5A 5CBAA 4HKXB 2JJTA 3GSOB 1H3GA 4PJIA 1YEHH 3MZTA 5IMKA 5LKNA 3X11B 5FAAA 3HG1D 1J5OH 4L9LB 3LV3A 3P11H 1HQRB 1J8HD 3ELAT 4ZUSB 2AJSH 1RHHB 1DBMH 4MHHG 4NWUH 4CDGC 2OI9B 1E4JA 1I3GH 2LABA 2DMCA 5K9OA 5HHXL 1G84A 4XPFL 4YAQB 3LD8C 3FQWB 3QUXD 3LY6A 5IJVA 1QSEB 2WBWB 1CICA 1CGYA 4X4YB 5FGCE 1V7MH 3ET9F 2F54A 3CUPA 2EE3A 3STZA 1T04A 2MQCA 1VEMA 3V4VL 12E8H 2ESVB 3G5VB 3H3KA 3VFVA 5TDPB 5HHPB 5GRUL 3SGJA 1LVEA 1OCWH 2AXFA 2VZTA 3T4YA 1CK0H 1P9MC 4Z9KB 1TITA 2RJMA 2GY5A 1M71B 2XKNB 3DJ9A 2QKIA 3WIIL 4WIQA 4Y16C 4MCYB 4JRXA 4Y5VC 5K9QG 4FS0A 4JKKA 3LIZH 5GIRB 1H0DA 2J8UB 4X8JB 3EYSL 3VGGA 1E6OH 3UYRL 1UC6A 3BXNA 4KI1A 2BVYA 1ZANL 4PJ5A 4ZS7L 2AQ3A 1JPGB 3QXAA 1YNKL 4MS8D 1B4JL 3MGAA 2F9BT 1JNHA 1DBAL 2CLVB 3JV6B 2OR9L 3Q3GB 2RQ8A 1GGIH 4BYHA 1BIIA 4MNQD 3BPCA 4R2GB 5DZLA 5DF0A 1EV2E 2EXWC 3EZJB 5SWZB 1L7IH 1Q8MA 2O5XH 1K3ZA 1NCWL 3SDXB 4OT1H 4ZFOA 3GSWB 5T5NG 3QDJE 4PJGB 4N9OB 4U0RC 2IPTL 4QHLB 2XY1A 1TPXB 3MRQA 4JN1L 3SKOA 3H7BA 1YEIL 2IWGA 5C0RH 1RJYA 4YXKL 3TNMA 2EO1A 5FCSH 1C08A 3DUHA 3QCTL 4NQUA 5KSBA 4POZC 5LVEA 5I1LB 3RZCC 1KCRH 1S7SB 3HZMA 3V7MA 5BO1H 4QXUH 2AI0H 3HAEA 3WS6C 1H3XA 4K3DL 1QFUL 4B41A 4UAOB 4NQDB 3TJEL 2X4UA 1F11B 4OBSA 2P47B 2P8LB 3VRLE 3U0TA 1NFDB 4N8CL 5I1KH 1QSEE 5TFSL 1FYTD 3TN0C 1QACA 1X4ZA 3E3QE 1JNLL 3MCG1 4WI6A 3T08A 5KW9H 4XX1G 32C2A 3RIAK 1VGKA 4JR9L 3MROB 4GAJH 4JGMA 4L1DA 4OKVB 3IKCB 5FYJD 3RKPA 4GG8B 3I84A 1T03L 1AO7B 3P4LA 2UWEF 5C0NC 4EZMA 3UJJH 4LLWA 3DNKA 4G8GE 4C83B 4HIHA 2VDQL 3VGAB 5KSAC 2PYEE 4GAGL 3DVFA 2VWEC 4TYUA 3OB0H 4NZRL 1P2CB 3S8WA 1WWAX 2BOBA 4JHZA 4XVJL 1YEKH 2NY6B 1YEEL 2V2WB 4XVSL 1RPQA 1FYHB 3EYUL 1NCBL 3IU3A 1UZ8A 3KGRA 5C0JA 3B5TA 1TJGH 5D6CB 2DMKA 5DMKB 3DX7A 4HH9A 3FQRA 3VFMB 2I5YL 4L3AA 2YMXH 4L4VB 2P5EE 3GSNL 5CP3A 4DK3A 1DUZB 4P4KC 2ZG2A 2COQA 3G9AB 1FLTX 4KJPD 4GKZA 3U4BL 4MQTB 1UWEL 4QRTB 1T20B 3HFMH 4ODTL 4YHPB 3S36H 2OP4L 4H0IA 3I6LD 5SWZE 2BJMH 4XNXL 1LD9A 3VFRA 1J05A 1MAKA 3WFHA 4G80B 3MRCB 5DRWA 1CZ8L 3BZEB 1GJIA 1XF3B 3RDTA 5JORB 1KTLA 4J3SA 5D7JA 1HH6B 4O02H 4X9HA 1NFIB 2BNUA 3FFDA 2IGFL 2PNDA 4HBQA 1KYOK 2YD1A 3QIUB 4RGNC 5D7LA 2IH1A 4TTDD 5LGHH 1EHAA 1I8KA 3QH3B 4G6ML 4FFWD 3QEHB 1T21B 1IAIM 2A1WL 4QTIL 2GCYA 3GSXB 1R0AL 2HH0L 1MVFA 2MKLC 3H9YA 1PKQE 1ZA6B 2BNRA 4KK8D 5ISZA 5MEOB 5T33L 5I75B 1FZOB 2ZWLT 5E08L 4G43B 5HHOA 5C0CD 1FO0L 4LHUA 3HI6L 5CLTA 5T1KB 4L4TA 4P5KB 2CSPA 4YXLL 4MDJB 4X9BA 1MI5D 3BH9A 4OGXH 2X4SB 1ZLVH 3X3FL 3WJJA 4QHMB 1FLRL 1I9JL 3LS4L 1MNUL 1TVDA 1RIHH 5IJKA 5E1AB 1HOCA 3FB5B 4MAYA 3Q5TA 3OPZH 3BGMB 4JHBA 2H45A 3IDIB 1DQLL 5GZND 1KB5L 2CK2A 1YECH 3GFUA 1RULH 3EYFB 4G6KL 2APXA 4AL8L 1H5BB 4OM0L 3L3DB 4HUWB 4HK3N 1GZPB 2BHZA 4LSUL 4BQ6A 4N5UA 1T7YA 1JK8B 1A7RL 3IDMA 3UZEA 5ID1A 3DTXB 4NQXA 5C2UB 4LKCA 3UPAA 1G9EA 2K3TA 1CICD 4JHWL 1EGJA 2Z4QB 1H8OA 2F54D 3QDGA 1IGCH 5J1AB 4C54A 5CZXD 4KY1L 2P44B 5F9JA 5L0QB 5D7KD 2WZPD 3QEGH 3ME0A 4CN4A 3Q6FA 4HSQA 5CWSA 3HE7B 4LCIH 1J1OH 3N1QC 2D0FA 1YJDH 3RWEA 4MX7B 2MSPA 2CXKA 3VXRB 1WV7T 5ID0A 2P5WE 4K8RC 4R0LA 3CLEL 5I1HL 5IGXH 4G3YH 4KJYB 1M7IB 3IXTB 3RTQA 1YEJH 1ZLUH 1TQBC 4FFZH 1ED3A 5IT2L 2OMBA 3N9GL 3P9MB 4JDZA 2BERA 3AUVA 1NGXB 3ZDXF 4Z7QF 5FYLL 5J0BA 2YXMA 1U8LA 4X6CE 5HGAA 1NGZA 3LQMA 5E99L 1XR9A 3NCCB 4LPYA 4MJ5B 5DD1L 4KPHH 5JW3L 3ULUF 2QTEA 3SGKC 3WE6B 3QCUL 5IQ9B 3TT1H 1U3HC 2BRRH 3GSRA 3KPRD 1T1XB 4GUPA 1G7QA 3NABH 4FZ8L 1FORH 1HXMB 3QRGH 1B0WA 1MCQA 1U91B 1IL1A 5GXBB 1FAIH 1GHFL 5HYJA 1MCPL 5INDB 2DTML 1NCCH 4X99A 2Y25A 1FZJB 4GW5A 2ADGA 3VH8G 5CJXA 4NYLA 4Q9BA 5F7DB 2ZCKL 1TZHB 4QOKB 1D3CA 2HLAB 3AMKA 1GGCH 4FQXC 3O6KH 3TH2T 1FGNH 1P7KA 2AQ2A 3VXMA 1T1ZA 4BQ9A 1MWAL 4IOIB 2VYRE 3GUTA 5GSVA 1QSFB 4MJIB 3T0ED 4GAFB 5GS2H 1QBML 2EIEA 3C5SA 2NX5B 1JV5B 4RDQF 1ZLUK 1NANH 5I76A 4NC1C 5I16B 4OV5B 4E41B 4FN0A 1BVLA 3QNYB 4KZEH 1J10A 3W0WD 1JFQH 2V9TA 3IJYA 1OY3B 4AEHL 5T3ZH 3QFJB 2PUQT 4P0DA 4EI6B 4BKLB 3O4LD 2AABH 3CDGB 2OCFD 1OVZA 4BSVB 3CFJB 4M7JL 4JVUA 1YYLH 2IANB 5DA0B 4R26H 1RUAL 2GJZA 3RWGA 4WFFD 1NL0L 4JQXC 1T66D 4JAMA 4XCCL 4YWGL 3WUWG 3S35H 1S7TB 1B6UA 3LKOB 4UUJB 2H8PA 4MA7L 2FHFA 3WFEL 1HKLL 3FONA 4WHYG 3QR2A 2ZNWA 3ZYOA 5EC1A 3HMXH 4PJ8A 3BPNC 3BHBA 4K3EL 4LFHD 5DQ9B 2GSIA 3QUYA 1NKOA 3F12A 3GRWA 3VXSE 3A67L 1PLGL 1IM9B 3CCHB 1JRHI 2QSCH 4ODUA 3DX6A 1A21A 4G9FB 4NC0B 3HN3A 4DGYL 5IROA 4JG0L 2DYPB 4KGJA 3BE1L 3F7YA 3DO3A 3K2UL 4NO5B 1VEOA 1T5XA 4X6DB 4QNPE 4OD2B 2ZUTA 4PV8A 3KWWB 1CFNA 5F8QC 4L9LC 4U49A 4WO4B 3ZHDA 1D5XA 4S1DC 1R3HA 1D5ZB 3D0VB 4HC1L 2B4CC 2J6EL 1KIRA 2P24A 1OTTC 2BHYA 2OMNA 2OI9C 1UKTA 4TNWK 1F4WL 3DIFB 2IPUG 3SDDA 4QTHA 1S8DA 3QEUA 4Z7UF 1LK3L 3RWJA 1RZJH 2H2SC 4DW2H 1MF2L 4OGAD 1BD2A 1CLYH 2PXYD 3HZYB 1KJ2B 3T65B 2BNRD 5ISZD 2NW2A 2MWCA 3OAZK 1Q94B 2BXYA 4NM4L 4LEOA 4NRZB 1E27A 1VPOH 3BW9B 4LHUD 2YKLH 4L4TD 4YBLB 5GS1A 4O4YH 1MFAL 5D93B 1U2CA 1MREL 5MEPA 1F3JA 4HLJA 3W2DL 4E41E 4RDQG 1W2KT 3DETC 1MJUH 1OSPH 2AJXH 4HFUH 1WFNA 3OXSA 3RI5K 2N56A 1R3JA 1D6VL 1IGFH 4I8DA 4IDJH 4X5XB 1T1YB 1ULVA 3O9WA 4RBPH 1SY6L 4LAQH 1YYMH 4NNYB 3LKNA 5GSRA 2ZJSL 1ZEAH 3QB7C 3UTTA 4L8BB 2EE9A 4Q2ZB 2E27H 3THMH 3X12B 3V5KB 2KUTA 2NY5H 5EBWA 5EU5A 3B9EA 3MRHA 2V2XA 3KVQA 4POZD 5IWLC 5IK3B 4D3CH 2GUOA 1CN4A 4AQOA 3O8XB 1CBVL 1ORQA 4R2GC 1LEKB 4XC3L 2Z93B 5DQJA 4DUWA 4LRIC 5ERWB 4I48B 1XGTA 4K3GA 2DD8H 1GGBH 2VH5L 4Y5YB 1NGWB 4YHMH 4DCQB 3G6JF 4M6OL 3BKJH 2HRPH 5GISL 3RNKB 4ZTPH 4DFHA 5CSZA 4ZFGL 3CVIH 3FRPG 1E6JH 3VDCA 4TOYL 2PW2A 2A6DB 2UYLB 1EZVX 4CBPA 5MEQB 3X14A 1UXWB 1NCDH 43CAA 1TPXC 5FK9A 1F4AA 1ACZA 4KUCD 1FL6B 1RUMH 1BJMA 3FB7B 4XC1L 3DI3B 5FDWB 4PGEA 4LSRL 1J9CT 4TRPL 4G8FB 2X4OA 4NQCB 5C0ND 1UM4L 2RIKA 4XNQB 3MLZH 4BH8B 5LGJB 5CEXA 2GT9B 3MLTB 4K3JL 4LSTH 4JPIB 3RGVA 5FUOH 3JV4B 4UQ2A 4ENED 4PRID 2RFXB 4BELD 3WNLA 5TH2B 3S37X 4D9QD 1KTDA 1MFCH 5ICYA 5AZ2L 3RJQB 3H8NA 1D5IL 4UAOC 3FKUS 3WJLC 1XEDA 1HDMB 3RL1A 5BMFH 3IRZA 4ZNEE 4R7DA 4OZFA 1BLNB 1JHKL 1YEHL 2J88H 3RA7H 2HMIC 4HS3B 1LDPL 4ZOEA 3GJEA 5ESVA 2NR6C 4H8WL 3P11L 4PGJA 1MFNA 2BCKB 4LVOB 3IU4H 4F37F 2Q20A 1MCRA 4I0KA 5H35B 2E5EA 1R5IB 5IFJA 5IG7A 4M1CC 3VGAC 1X5GA 2CLRB 4HV8B 4PJEF 5I0DA 1N5YL 3O3EA 1JNJA 4JZJA 2Z31A 1FN4A 3W81A 5KVDH 4W6XB 3RUGB 1IC1A 2IG2H 4LCYA 1ZK9A 4WW2A 5E2VL 1B88A 2NY6C 3H0TA 2VDML 2NTFA 3RWIB 5DD6B 5FO7B 4HXBL 2CMRH 4XXCA 3EYVA 3L6FB 2QR0A 2QQKL 1N5AB 4F7CA 2BVOB 4ZXBA 2CKBH 3VFWB 5IVZB 1ADQH 1M7XA 3TT3H 3MRRB 1MCOL 3GB7B 3TBVB 1ERNA 5IKCB 1BHGA 1CD8A 3MJ9L 2VDNH 5BJTA 5IFAL 2EYRA 4A2LA 1LE9B 3WEXA 5I17A 4KVNH 4YO0B 3CH1B 3H7LA 3KDMB 4FXGA 3T4AB 4L8DB 2R0WH 5I73B 2VDLL 3TBSA 2H3NA 4KRNA 1U8JA 3IVKB 1KTKE 1X6NA 2X70B 3CVHA 3RWFA 4GJTB 1CDHA 1UWXK 3G5ZB 4XP5H 5FYKH 4G8GA 1RZGA 3DO7A 3HNVH 3QBTB 2DL9A 1OW0A 3OKKA 1I9RL 2PYEA 3O3DA 3QZWB 5EC2A 4AENB 4XXDA 1E4KA 4PLJD 5IQ7H 1A5FL 3EBAA 4GKNA 1EO5A 2JIXB 5D6DA 3LCYA 1XGYL 2ED7A 4L1HA 2GFBB 2XZQH 4WFHD 4YHYB 2XN9D 1HHHA 3QIUC 2FX8H 4XRCA 2EDTA 3DHJA 4XMLH 1SQ2N 3K0WA 3F5WA 3AB0B 4JFDE 3U48A 3MO1A 3RIFK 1FPTL 3FO0L 4PJ8D 5C0IA 4XNYL 1UH4A 3HC3H 4OD1L 3SE4C 4K23L 3S98A 3AMLA 3QUYD 5I75C 1U93A 2P5EA 3DURB 2DN7A 2GYSA 5C9KA 3MLXH 3CK0L 4AH2A 3VFNB 4NT6B 4Z77A 3NCYS 1CD1B 1X6LA 2X4QB 1QP1A 3QIWA 3U36B 3UO1L 1OPGL 1QFHA 2CD0A 5D7IF 5EIIB 2VL5B 3DVIA 3SPVA 3QEQE 4R96A 3KJ6H 4D9LL 1UJ3B 1W72A 4OLZL 2YD2A 3S4SB 2ARJA 2LU4A 1H5BC 2C1PA 3SY0B 1G6RA 2IALA 3C2AL 3MV9B 2H41A 1TJIL 2DWEA 3M07A 1MEXL 3VXUD 4NNXB 3SDDD 3PUCA 5GGQH 1BVKA 4Y5XB 3SE3C 1RUPL 4M8VA 4NUGL 3O45B 4OTXH 4LNRB 1BD2D 1RVFH 3JXAA 3QUMH 5GGSB 4L9DA 1PKQA 5CP7B 5L0QC 1QZ1A 1SBSH 1CVSC 4OIAA 2AK4B 2OL3B 3JWOL 4FNLH 3B9KB 3HE7C 4HIXL 1GGUA 4R8WL 1U3HD 4OBRA 1JHLL 4XBEL 2OTUB 3DSNA 1XF4B 1XMWA 4OCNC 7CGTA 3ARVA 4HUUB 1QFWM 3GBML 3FQNB 3LMJL 4OUUB 2AXGB 4JCMA 4XP9L 1YEKL 1LO0H 2B8OT 5ACMA 7FABH 1QR1A 1YQ2A 2EDBA 3PWNB 4XPBL 2Y06L 3LQZA 2VXTL 1M7DA 1HYSD 1IAIH 4OGYL 3UPRB 1A1OA 2EXYC 2BSTA 1ES0B 2H1PH 2R4SH 4FRWA 4MXVE 4PY7B 3HNTH 5M94B 2N1KA 1IILE 4F33A 2EIZB 1DTUA 3WYRA 1AGFA 1YN6A 4PUBH 4X7EC 5ETUA 5I1IL 3LKSA 2X1QA 1CFQB 2FGZA 4K7PH 5DT1L 1ZT1A 1E28B 3KPOA 4LFHG 4J6RL 4TUKL 5EOTA 1RJLB 3MCLH 1OAZH 4X83A 1A1NA 2A6IA 4N68A 4CMMA 4KUCF 4OF7A 4YIQA 2OYPA 4JHAH 3VFPB 1KIPB 1PEZA 1IEBB 4U6YA 1FNEB 1P7QA 1U9KA 2DLFL 3NIDF 2WWMC 4KHXL 1S3KL 2HVKA 3FO1B 5ACZB 2XPGA 3WDJA 4GKOA 2P5WA 5JR1L 3MLRH 3QUZA 4OZHE 3RNQA 5L88H 2NZ9D 5DJ2B 2CRZA 1WZKA 4NJAH 2Q1EA 1AJ7H 4HGKC 3NAAH 1S5HA 5HPMB 4LIQE 2YN5A 3DECA 3N1GC 4G9DB 3RGVD 3PDOA 4GRLA 4X6CA 2ICEB 5DC9B 1SVZA 1MHHB 4OZGB 4U1IA 4QXGH 1BF8A 3BP7A 1LO4H 3DMMA 4J4PC 3MV9E 3WIFA 3DROA 3PXJA 1U36A 5GGVL 1A6VL 2XNAB 4Q74A 2DQCL 3MACL 4Z0XB 4HUVA 4GKSA 4PTUB 3SKNA 4KTYA 2C4FT 5HHNA 4DEPB 2A77H 4HT1H 4PR5B 3NTCH 3MXWL 1KIQA 2XA8L 4OI9A 3PJSB 2C3VA 3QDJD 3BJ91 2AK4E 3F65A 2QADB 3L5IA 3CFIC 2OXGA 3E0GA 4NZUL 3NN8A 3BQUA 2P7TB 3LN4A 1I3VA 1OT2A 3HZVB 2Z31D 4M1GH 5FUCE 5FKPB 3OJ2C 3PABA 1CGSH 1DQDH 1WEJH 5L2KB 4YGVB 3BUYB 1VKXB 3QEGL 3B9DA 3OTTA 4KDTC 4Y19E 1OAKH 4PS4H 3W39A 1WBZB 2JELL 3EFFB 2ZUVA 5DD0H 2WQ8A 4ODSH 4Z7WE 3ZT7A 4R3SB 4ZXBD 1RUQL 1YC7A 2XKUA 5IOPA 5CCKL 5ILTH 3WIHL 3T2QA 3MRBB 4IRJA 1F97A 2CRIA 3D69A 2OSLB 4KK6C 1QBAA 1QSED 1FFNB 3ZYJA 4Z8FH 4GRWH 1TVBB 5D70H 1S9WA 1P7HL 3RVTD 1U6AH 3PIQA 2GI7A 4KKLD 5ALBH 4DQOL 4WTXA 1FFQA 1TIUA 5D7SL 3NIFE 3ULSA 4JFEE 4E5XB 4G8GD 2Y07L 3KPQB 4QRSB 4BZ1L 1GOFA 3GIZH 2PYED 1MCFA 2QL1A 1YC8A 5I18H 3P4MB 3OZ9L 4WO4C 5KANG 3IFOA 4F9PC 4UZGA 3ORJA 1TQCB 4YHKH 3UYPA 1VEPA 1RJCA 1X4YA 3G04B 4K2UH 2Q76B 3KLHC 3MRMA 5E56A 1WAAE 1EHLH 2QSTA 4MXWL 1N8ZA 3V52H 3GMRB 1A6WL 5AZEH 4U1KA 1UB5B 4KV5F 2C5DC 4KUZH 1X5YA 2DM4A 3T0BA 1MCHA 2I9LA 3PWVB 1U8KB 4NP4H 1KC5H 1MCNA 1ND0A 2JJVA 3JV0A 2VLLA 3DUUB 1F8TL 2P5ED 5KZCD 3VXSA 3QULB 1RUKL 1IQWL 1QEWB 5DHYB 5D1XB 4Y4KA 4YBLC 4HIJA 5D93C 1UXSB 4LCUB 1QYGH 3QIWD 1AXTH 1HCFX 4EBQL 5LQBH 3V6OC 3N06B 3BH8B 5SWZD 1B6DA 1DBJL 3GK8H 1Z5LB 5EZJA 3PWPE 3WKMH 4BZ2L 1NCNA 1IGYB 1T7XA 3X13B 1GCFA 1G7LA 3VFSB 4G6AC 3SBWC 4U6VL 4U6XA 2VQTA 3V8OA 1I9EA 4U1NB 2QEJA 3MYZA 4WI7A 4LPTA 1C16A 4LLVA 3QXTA 4YK4B 1DLHB 3GDBA 3MGTB 3QIBB 4HUXB 1KT2A 4RNRA 1GC1C 3MA9L 3NZHL 3MC0A 5CEZE 1BQLL 2DQFB 3O8XC 1WBXA 3HA0A 4WDIB 1XF5A 1SYVB 1J1XH 4MA8L 3CFCL 4NO3B 3GSUA 4NNPL 1B0GA 2ZCHL 4Y5YC 4TNVK 3PWLB 2MHAA 1AIFA 3WXWH 4NO0B 1HSAA 1AP2A 5I1CH 2ZPKH 1CDIA 4EUPB 4KKAC 1XIWB 4BUGA 4DKFH 3VE0A 4XP1H 3BSZL 2E7HA 2APVA 4ONHB 4JO2H 3AY4A 1VFAB 5FF6B 2GTZA 5EO1B 5HGDA 4P59L 4W70A 5EUOE 2A83A 1E0OB 4J8RA 1MH5B 5I74B 4CW1B 4E42A 1AO7D 2ZUUA 2O93L 3ZKND 4NHUA 5DO2C 3H42H 4AM0B 2NMSA 5D5ME 2R29H 5D2NE 4M1CD 1TZIA 1XR8B 1SJVA 1TFHA 2E8ZA 3I50H 2LVEA 4ZOCA 2A9MH 4WNQA 3U6RA 3QG6B 1KCSH 3FQTB 1K4CB 3C87A 4K7FB 2NY6D 4YDIH 4YXHH 2R4RL 4Z5RB 1INEH 4XCFH 1FNSL 2DWDA 4NBXB 5DI8B 43C9B 2J8OA 5I9QB 3NIGF 1RFDL 2JCCF 5EOQH 5ITFB 3PQYB 5IMLB 3ARBB 2BSSB 3BRFA 4LRNH 5BRZB 1P7QD 3STLA 1BJ8A 4F7EB 5GJTL 1C12B 1OAXH 4X7SH 4LVOC 1E4WH 1IBGH 2P5WD 1DQTA 2A73A 2YUXA 1F42A 4IIQA 4KTDH 3SCMB 1HKFA 3MV8E 5DS8B 2DDQL 1RI8A 5IMOB 5F1IA 2N7AA 3TCLA 1FGVL 1MJJA 1NGQH 4JDTH 4GRLD 4S1QL 4X0KB 2DM7A 4XVTL 2YKLL 1YY9C 1MAML 3DMMD 2WMPA 4O4YL 3MV7E 1RK1A 4N90E 2MPAL 1EAPB 3OAUH 4PBXA 4ZNEA 4PG2A 3NFNA 4Q58C 5JTWA 3H9SE 3OR7A 3PV6A 3P0VL 1U8PA 3IETB 1OARH 1KJ2L 3QQ9C 3V6ZA 4GSDH 3LEYL 3WL9B 5J57B 2CGRL 3UZQA 1IC5L 2A6KA 3N50A 4ODVL 4WVRA 1UADC 2WBJA 4KVCH 3TZVB 1Q1JL 2FZ3A 1FJ1A 5E6IB 1AGBB 3BQUD 1KPRB 2XRAL 1RZFH 2DQUL 3HLAA 2CLZB 5ESAA 1JGUL 4S0TD 4M6NH 5I1DB 1B9ZA 3LB6C 4I5BB 4PLOB 3JUYA 3VRJB 3VRLF 3SKJL 2Z92B 4YHYC 2CJUL 1ZT4A 1FRGL 1FNGA 3CJJA 2IBZY 1DFBL 3RVXD 3ZE2E 4X7TA 3TIDB 1NC2A 2O61B 3AB0C 4JM2A 5BZDB 3GMOA 2HRPL 4TSCL 5GGSY 5D1ZB 3BP5B 4IRJD 1RIUH 5E9DE 2XWJA 1HI6A 4EOWL 3O6FA 4YHLL 1QLRA 1KENH 4PRPB 4TULH 4HBCL 1O5DT 3EFDL 4LKXA 4PLKD 5FHAH 4DVBA 2VERN 1KEML 3RX5A 4QF1B 3HE7D 4KKNA 1NPUA 4UBDD 1KULA 2R56L 4LCCB 4XWGL 3BKYH 1UJ3C 4RZCB 2J8UF 2YR3A 2Q7NA 1QHOA 4JFPB 4F8TA 3VXRD 4Z78B 5JNYA 3I75A 4JFHE 2BSRB 1P69B 5HVWA 2V5RA 5AD0B 4O58L 4XNMB 1MSPA 3HI5L 5F3BA 1X44A 8CGTA 1A7PL 5FYKU 5EU3B 2EH7L 2EXYD 2F58L 1NMAH 1U8IA 3MR9A 4YR6A 4JFDA 2QQNH 1BX2B 2NNAB 2D2OA 3WLWC 1IT9H 1PYWB 5CD5C 3X3GH 5EFIB 3LPFA 5I8EA 4O2CA 1SM3H 3S37H 3SDXF 2VRAA 2YRPA 4U3HA 3I6KA 2JJWA 4FQJL 3MPCA 1OQXA 1R3KB 1YEGL 4QLRA 4Y4KD 1PG7X 3V95A 2FECI 2FO1A 2AKRA 1IFHH 1TTFA 3WNOA 4JANB 2BOCB 3BO8B 4NJ9H 4ZG1A 3QEQA 4PRNB 1MJ8H 3E6FB 1A1MA 2W9DL 4RAVB 2WWMD 1PZ5A 2CMRL 1ZHNA 1FO0A 1FG2A 3HC4L 1MCBA 4P3CL 4ZFFA 2UZIH 3GNML 4LCWB 3VFTB 2JK5B 2PN5A 1U2HA 4OD3H 3BT2H 1OP3K 1MCDA 3VXQB 3UROR 1C7TA 2H2PC 3Q1SH 4OQTA 4UDUB 3BDYH 2XZAH 15C8H 3U9UA 1TJHH 5EUKB 2H6PA 4OKDA 4LSSL 2ZZUT 5FYKL 4ETQA 3AM8C 1QSFD 4MJID 1S7UB 5GRJH 4LLMB 1J0YA 5B4MC 4S1SH 2AEQH 1TNMA 2NX5D 5C08E 2YSSA 4E41D 5DJDB 3A0OA 3GKWL 4X6EB 1KJ3L 2R0ZL 5F7KC 1CGTA 1P1ZB 3QPXL 1WSST 2NW3A 2VIRB 5DJ6A 1W0VA 1DQQB 1IEHA 2NCMA 4P2RA 5K9KA 1GIGL 5FO8A 5BVJA 3OJDB 4PJDA 1GSMA 4LHJB 3RL2B 2P8MB 4ZOBA 1OTSC 3F58H 3P4NB 5IBUB 3MUY1 4PJXE 1C1EH 1I8IA 3BVNB 1T4KA 2NY1B 4WGVB 3FO9B 4WU5A 5F7MC 3CPLB 2EE6A 3TN0A 4RFEB 2KQNA 3FHQA 3UTZA 4X4XA 5FCUL 4H1LH 2ZCLH 4OFYA 4NQTA 1R3IL 4JM4H 2X4TB 5FKAB 3K1KC 1OP5K 1YDPB 4UIMB 2AVGA 4FABL 4JFZL 5SWSE 1QRNA 4KFZC 2HFEA 4DEPC 3DV6A 4G5ZH 5GS0H 1J1PH 3ZE0E 2DBJA 5KG9A 4KK6D 1U3JA 1N2RB 2ZOLA 1B3JA 3PE9A 4ZTOH 1EEYB 4LEXL 1IM9D 1LEGA 2QADC 4AMKL 3DX9B 4OZHA 4FQLL 2R2EB 4Q6IA 3CX5K 1RIVH 3S96B 3TWCH 1U8OB 1P6AB 1AY1L 2XI9A 3O0RH 5F7HA 2I60L 3WO4B 5IW1B 5D9SB 3PG2A 3C5ZB 3O2WL 1RVFL 4P2CG 3DGGB 1YQVL 5FDYA 2OTWA 5I71B 1I85C 4XTRC 5ENWB 1A7OL 1P5VA 4AYFA 4LP5A 3MGOB 3VDBA 4FNLL 4GAYA 4AQ1B 4U1HA 2ERJB 3TCXA 2W38A 4NFBA 2XTJE 4KMTH 2HAZA 3IF1A 1S7RB 2OTPA 3C60C 3QJFA 1YUHB 3RQ3A 4G7VL 1JTPA 4HF5L 1NANI 4PJ7E 1WGOA 4JLRB 4X8XA 1MWAA 3MNZA 4GW1B 4P48A 1JJUA 5DRZA 2OL3L 1R24A 3GRWH 1ZS8A 2R2CA 2WBJD 2YPKB 4L29A 4M4PA 3K81A 5ICXB 3OKDA 1NDGB 1JGEB 2CPCA 1BZ7A 2EDJA 5E2JA 3CFBB 4M02A 4U1LB 3EHBC 1TQCC 4D9RE 4XPTH 4JKPH 3WD5H 3EYOB 4WCYL 4DAGH 5JXEC 4RGOH 4CVZA 5AG9A 1J88A 2WINB 3U0WH 1HHGB 4QHNA 4Y19A 2ZNXA 5CJOH 5HGGS 2NLJB 3M1BA 4HGMA 4Z7WA 1NC2D 4JM2D 5F7WC 4O51B 4MZ3A 3R8BB 3DSFL 4AIXA 1RZIB 4XBPB 3V5DA 25C8L 3B3IB 3MRFA 4NWTL 2VDPH 3KYOB 4QWWC 5IF0A 4HEME 1ZT7B 5IHZA 1BBDH 4LPXA 4K94H 1CT8A 1MVUB 1OT1A 3FFCB 4BQBA 5HJ3A 1LO2H 3T3ME 5D1XC 4M7LL 2ICWB 3MTRA 1M05B 3HI1A 3HNSL 1AI1L 3V2AR 4B50A 4P9HH 2ATPB 3KLDA 5GRWA 4PYHA 2EYSB 5I8OL 4HPYL 4JFEA 2B2XL 1FBIH 1RSFA 3T1FB 2ICWI 2W1NA 3O2DA 2APBA 6FABH 4JPWL 4G42B 5HDQL 3NH7H 1MPAH 4CDHA 1MQKH 1A3RL 5B39A 2XZCH 1IC7H 4CVXB 4KHTH 5K59E 2X2YA 2FBOJ 4ODHL 1N6QH 1HHIB 5DMIH 4LDEB 2YD7A 1SMOA 1WAAA 1BEYL 1TZGL 1I1AB 3ARWA 4NKQB 4KTEL 5DO2D 4YK4C 3BZ4B 5C0BB 2ADFH 3CAFA 5BW7A 5JQ6L 3QIBC 4QNPF 5JIIA 5IB3A 3L7EB 3P0YH 4MVBC 1YMME 4QRPB 4D0DA 1J12A 4ZQKA 1G7PB 4GFTB 4LOUC 4AEIL 1F90L 4O2FA 3MRPB 1WBYB 5BV7B 5DD5H 4NPYB 1QNZL 1MCEA 4HWEL 4ODXB 1AKJA 1NJ9B 2E3VA 5LG1A 1KFAL 3EIFA 3ZDZF 3QEQD 2Q8BH 5E5MA 1X5LA 3GHBL 5T3ZE 5I66A 4I2XE 4N1HB 5DD0L 2Z9TA 5I74C 4TNWF 1WC7B 2V7HA 4WUKL 3L1OH 3IDNA 3UTPD 2KZ1B 4ONFL 5ANMA 3I02A 5I15L 3NA9L 2ZKHL 1AFVL 3ARTA 3FB6A 4FQCH 2VXUH 1K2DA 3VXTB 4QT5A 1I1YB 3O6LL 1H8NA 5ALBL 3WFDH 4EDXA 2GAZA 4PRBA 5T1LA 2W9LA 1JPTL 4P5TB 4GBXC 5I9QC 1C8PA 1SY6A 4HS8H 4B7IA 4IOFD 4X4ZA 3ARBC 3V0WL 1A6AB 3MLWH 2IAMA 4QRRE 3CDYA 5HDLA 1B0RA 1MFEH 5J06A 4OZFH 4S1RL 4YHKL 1NMCB 2C4XA 4ACPA 4NKOA 3T8XA 4NN6B 2IQAA 4OZ4A 2VZOA 3QQ9D 4QRQB 2VXQH 4JG1L 3SCMC 3N1MC 3EOTL 5EU7C 4FQ1L 5F7YC 5EUOA 5T3XH 1Q0YL 1Q9WB 4UV7H 1WUNT 2KZWA 5D5MA 5D2NA 4NKDB 1REIA 5HI4C 4BH7A 5EU4B 4U6HA 1JWMA 2H32H 2VO5A 2CIIB 2G5BB 1EFXA 2H26A 4J1UA 1FIEA 4M5ZH 1DQJA 4OFYD 5HDOA 4ZAKB 3ZT6A 4ODWA 2UWEB 1AHWA 2Q8AH 2IQ9H 4M7KH 5I1JH 4NO2B 1EXUA 2VSCA 3UBXA 5DURB 3V6FA 4KH2A 5ITBL 2CH8A 3U46A 1UH2A 3B5HA 3P30H 5C0BE 4M3JA 3ES6A 1K3IA 3PP3K 4Q0XH 3TEUA 3IXAB 3IFLL 4OCMC 2V5TA 1XH3A 5E8OA 2ATKB 3WCYA 1ZHLA 4LDLB 1DEDA 3OX8B 5I1AB 4AG4L 3VJ6A 3G6AB 5FV1L 3TZVC 4I4WA 3HS0A 3QFDB 2M8XA 5F96H 1FFOB 5E6IC 4KXZH 2PTTA 2Y6SC 1AQKL 1MRFH 3MV8A 1P4BL 3E6HB 2WUBL 2A74A 2AQ1A 2XZZA 3VWJB 1U8MA 2GITB 2VITB 5DJYA 3LS5L 2ORBL 4G7YH 4X6FA 3I6GA 5DUPL 4ZUUB 3SDCA 3L5WB 1J8KA 1UWGH 3MBXL 3WXVH 1LP9E 2FIKA 2NXZB 1OAYH 1BOGB 1FVDB 1YNLL 3HZKB 1QVOB 2CKBB 5CIPB