4MCZB

Immune receptor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
189
structure length
189
Chain Sequence
DTRPRFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAVTELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRRVYPEVTVYPAKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKTGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSLTSPLTVEWRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords HLA class II histocompatibility antigen, DR alpha chain
publication title A molecular basis for the association of the HLA-DRB1 locus, citrullination, and rheumatoid arthritis.
pubmed doi rcsb
source organism Homo sapiens
total genus 45
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2013-08-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00969 MHC_II_beta Class II histocompatibility antigen, beta domain
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4mczB02
3.10.320.10 Alpha Beta Roll Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 Class II Histocompatibility Antigen, M Beta Chain; Chain B, domain 1 4mczB01
5D72H 5DLMH 4ZXBD 3QO0B 1RU9L 5IJVA 1ZLWH 3UDWA 5GZNC 4LVNB 4TUJB 3OAUL 1OT2A 1AD9A 3NCJL 3D0VB 3O2WL 1HILA 5GHWL 5JR1H 2CRMA 2DOCA 5FGBC 1KELL 3MLVH 1DE4A 3V6ZA 3ZT5A 2P49B 4LSQH 1FNHA 4K2UH 2IPUK 3ZO0A 1IT9H 1EJOH 4G8FB 4AEHL 5TE7L 4EDWH 5IM7A 4LLDB 3KYNB 4PR5B 1IAIL 1BLNA 3UPCA 5ESAB 2BVYA 1H5BA 3KPMA 4PG9B 2C5DC 3VH8G 3TZVD 1F58H 2DYPD 4RZCB 3MLZL 1T2QH 3V52H 1JNLH 1GVIA 2CXGA 2WBJA 1JPSH 2APTA 3BHBB 4MJ5A 4BH7A 5LJYH 1AQKH 1GZPA 1CFSA 4HG4K 5IF0A 3EGSA 5HSFA 2Y7QB 1MCOH 4KKAC 2X41A 3L3JB 3S96B 4D0BA 1LO0L 5ACMA 4HJ0D 4XTRD 3AU1A 3RUGB 2PW1A 2YD4A 1X5HA 4H5SA 2X70A 1U8QB 4PJAF 2AK4A 2R29H 1P4BL 4N5EC 1T5WB 1TNMA 3MV8A 3A67L 1ACYL 3O45A 5TF0A 4OCLC 5E2TL 4C56D 3E1F1 2YSSA 4I18C 4K7PY 3QIUB 5JXEA 3BJLA 2NZIA 5I0ZA 1BF2A 1PVHA 3T2QA 2BMKA 4UV4L 1GHFL 3ULUC 4LCWB 5IVXF 1OGTB 5I1CL 4W4OA 5LQBL 4KGLA 1QFWH 2AQ3A 2DD8H 1J05A 5EO0B 2UWEE 3H9SE 3WS3B 4PGDA 4LPUA 1AXIB 4U6VL 1K4DA 4XXCC 2I9LB 4KK8D 4UT6L 1X5YA 4ZD3H 4OIAA 3IJSA 5T1MA 1R3IH 1MCPH 4L3CB 3IU3B 3TIEA 2YA1A 2J1KA 4BFIB 1JZ3A 5D7LB 1A6WH 2Z0BA 3FQNA 3U9PH 3FOMA 3JWOH 2AJUH 3MUGA 3IKKA 4XCNB 1QVOA 4NJ9H 1U9KA 4QOKE 4DN3L 1KCVL 1AKJD 3CPLB 4LHUB 4HXAL 3UROR 5D1XA 1U3ZA 5I75B 4ZO8A 4QKXB 4F7CA 3RZWA 3CFEB 2JKXA 5D7IF 1BBDL 5DMJB 1TCRA 3P9MB 3FT3A 3RDTC 3F7QA 2YUXA 4LSVH 2VE6B 3MJGX 4V2BA 4DOHE 3W0WA 2IFGA 1NBYB 3S4SG 1NGQH 3WDJA 1HK6A 4GKNB 1OQXA 1ZGLA 3ZYJA 2W60A 4OD1L 5DD1H 3Q2CA 1NAML 5JHLL 5I8KL 4OF6A 1S9VB 1KJ2A 1ZS8B 4W6YB 2QQLL 1IGYB 2BSTA 3WCYA 1IC4H 4F7PA 4ERSL 3W5MA 4JHWH 3MUHL 4J3VA 4HKJA 1IEHA 3MROA 1NEZB 2JJTC 2FIRT 4ZS7H 1YEDA 5TQ2L 3BKCH 4Y88A 1U95A 5EG6C 4JO1H 5AD0A 4H20H 2A6JB 4JM4H 1XH3B 2F8VA 1ZKAA 4WHCA 1ZT7B 4X7SH 1FNSL 12E8H 1QBAA 1OGAA 3TBTB 2LE9A 4M6OL 2J8UF 2CRIA 5MEND 1LO4H 3GSUB 4G6AD 1DQTA 3QHFL 5C0BA 4WEMB 1KYOK 1CLCA 4DKFH 3MRFA 5D2NA 2DMCA 4JHBA 1J87A 1YDPA 2MKWA 5D9SB 3I50L 1ZLVH 3DVNB 1XFPA 2BXYA 5T3XH 4IMLA 3UO1H 4UB0L 5ERWB 2QSCL 4HF5H 4ZUVA 5T1KD 3SDDD 2EDQA 5LKNA 1RJLA 5I15H 3EYUL 3WFHB 3BIKB 4LIQE 4P2OC 5DMKA 4ETYA 4DQOH 3IXAA 3MCKB 4J1UB 15C8H 4NKIL 3B4NA 4ISVB 3IFLL 1GPOH 2D4DA 4B53A 1I8LA 2VLKE 3HI5L 2YUWA 5ABDE 2F53A 2X44D 1EGJL 4JFEB 1S7RA 4ZSOA 3QI9C 3BIBX 1NCCH 4WFED 3V6BR 2M2DA 1NC2B 2V17L 2Q1EA 3H2WA 3KYOB 2H26B 2GTZB 1QO3A 4RFEB 1K4CB 5JIKA 4NQEA 3MXWH 3MCLH 3VWKC 2ITCA 1RJCA 1A1NB 1BBJA 3EFDH 4PRIA 3BVNB 4KXZH 5BRZA 1KN2H 1T1WA 4WUKL 5MERB 3MV7B 2I5YL 5HYSA 5HHXH 4DN4H 3V5KB 2BK8A 4P9HL 4YDJA 3V4VH 3O3EB 3DIFB 2DS4A 4XCCH 4K07A 3QULA 3S37H 25C8H 4OUOA 5DC9B 4EN3B 4X4MA 4ONFH 4HCRH 4PGEA 3C5JB 2WWKO 2Z8WC 3C5SA 4LAQH 4DZ8B 1BFVL 2NY3C 5C8JA 3N1GC 3RX7A 1JTTA 4U1IA 3MREB 2X4QB 4N8VG 1JYVA 1YYML 1WBZB 3EIFA 4ZS6C 4HUWB 2ORBL 4QHUB 4LSDA 4UV7L 5TQ0L 4Y4FB 3VXOA 3ARXA 1FPTL 4KPHL 4MA8H 3K1DA 3Q5YA 1MWAL 4OV5A 2R56L 4C55A 4NRXB 2XA3A 1NLDH 1ITCA 3E6FB 4NQCB 4O2FA 1PG7W 3QYCA 3F7VA 3L5XL 3KJ4C 2D7MA 2PYEE 4YFLI 2EE9A 43CAA 3HG1E 3MGTA 1U58A 3D9AL 2BVPB 1LEKB 4JO4H 1M7DA 4XP6H 4O5LH 3MBXL 1OP5H 4BQ9A 1N64H 3MA9L 3MRJA 3NTCH 4HIHB 4JN2A 2VDRL 1CG9B 1C12B 4X5WB 2FEEL 1NAMB 1OWRM 5IB2B 5IB5B 3ARFD 3L7EB 1I1YA 1BIIB 3MOBL 1T7WA 5CP7A 3C8HA 2F54A 2IBZX 4HMCA 5K9JH 4OFDA 1SEBB 3S35H 1KT2B 2QEJA 3HUJE 2VXUH 1T04A 3WFDL 1KEML 4MB4A 2V7HA 3OXSB 4M9OA 1F00I 4UDUB 4P99A 3VGDA 3MLWL 3D1MC 1AD0A 5C6WH 4MNGB 3PP4H 3VWJA 4XNQB 2FL5B 1L0XA 1R3LA 3NZHH 1YECL 3GUTA 4MNQB 5IB3B 3BPLB 1UXSB 3V6OA 3PUCA 4YDKH 2E6JA 2W9DL 3BH8A 2Z4QA 1TZHB 4OZIE 4P2QA 2OK0H 2RCSL 2VLJA 4Z7WF 4GRLD 1IFHH 4ZUUA 4YDIH 3ZHDA 2VITB 3QZWA 5E8NB 1HSBA 2ZJSL 2J8OA 4Y0GA 1CF8L 2EH8L 4OZFB 3BWAA 3QPQC 3VE0B 5FO9B 2ZG3A 5ELIA 3OAYK 1DUYB 3SBWA 3RVVC 4HULB 2A2QT 2I9TB 3PGDB 5JW4M 1JUFB 3P30L 1I7RA 2D03L 3QFJE 3L5IA 4OFYA 3SDCC 3MGOA 4G6AC 3IFPB 4CDHA 3UAJC 3ZKND 3BGFC 4OIIL 3D0LA 2YD5A 1TTFA 3QO1A 4OFIA 4CMMB 4CVXA 4M5YH 4QRPB 1MNUL 3F7YB 2IQAA 5FUZH 3KPPA 2A6DA 1AC6A 3DSFL 1KTKE 4D8PB 2G60H 3NA9L 4J23A 1LGVA 1ZT1B 3HHRB 2ARJB 3QO0A 4BM7A 1WTGT 3K0WA 4XNXL 1K6QL 1NUNB 4TUJA 4K8RC 4JVPA 3GSRB 3QQNA 3D0VA 3AREC 3ILQC 2D3VA 2X6MA 4FQ1H 5E94B 2XPGB 3GZKA 2VC2H 4OLWL 1XGYH 4YXKL 2YZ1A 4GQ9L 5EZIH 4LLDA 1T1ZB 5TPWH 4PR5A 5ITBH 1ZV5A 5J06A 3BRDA 4KK9C 1YYLL 4X9BA 5ESAA 1FZMB 1U8OB 2CDGB 2ICES 4N0YL 4PG9A 1T2JA 3T2NL 3VCLB 3TYGL 4RZCA 3QHTC 5J89A 3W39B 4OLEA 4YH6A 1RZFH 1PEWA 2EDJA 2O5XH 3BHBA 1FL5B 4EJ1C 3CU1A 1E4XI 2JB5L 2EDHA 3CXDH 4IMKA 5BMFH 2D2OA 1KTRL 2Y7QA 1HYRC 3L3JA 1ZHBA 3S96A 3GSOB 3UTTB 4XMKL 4NZUL 3RUGA 3AY4C 1U8QA 5I19L 3KLSA 1T5WA 1KJ3L 4X6BA 1KN4L 2QQKH 4QNPE 2VDOL 4ORZC 1J18A 5JO5B 1HE7A 3GMOB 4M6NH 3SN6N 5E6ID 3KR3L 2BNRE 1MWAB 4O9HL 5F96H 1PGRB 3EDDA 5J13C 3QIUA 5HHMD 4PJDB 1ITBB 3QXWA 4LCWA 5T1DL 2DDQH 2BVUA 1OGTA 3WXWL 5IG7B 5C9KA 4C4KO 5EO0A 3QXUA 4MZ3A 3WS3A 3QPXH 4TYUA 1T6WA 2XXMB 3TP4A 2ED9A 1KIPB 3CVHH 2I9LA 4JB9H 4P59L 1NCUA 2OJZL 4MVBC 2GK0A 1R3HB 1NUGA 4Q6IB 5IEKB 3PABB 2X1QA 2O61B 4L3CA 3IU3A 3OHXA 1VGKB 4EDXB 5EIIB 5FYKE 5D7LA 1MI5B 1EERB 4XCNA 4GAJL 1F6AB 4RDQG 4EBQH 3G6DH 3GMPB 4S1DC 1KB9J 3LMJH 5I30L 1CWVA 3RIAF 4LHUA 5IEHB 1IQWH 4L4VD 4XVUD 4N0CD 5T3ZL 5KSUB 5I8EB 3CFEA 1XF1A 1R6VA 3E8UL 5ALCL 4M43L 2AXJA 3P9MA 1YEGL 3VH8B 3O3AB 1DQML 2HMIC 2VE6A 5FYLL 1NBYA 1SY6H 2VQTA 2ZCHH 1LHZA 4GKNA 2Y9RT 4GG6F 3GJFK 3B2VL 4WCYH 5HHQB 5F21B 3RNKB 1KOAA 1FAIH 2EO1A 3ULVH 4IOSD 5I1IL 1S9VA 4IRSD 4WDIB 1LE5B 1ZS8A 4R4FL 5DJ0B 1S7UB 1J0IA 1IGYA 4FABH 1QBML 2FATH 5INDB 5JOPD 1GGCH 1JZ7A 2YUVA 4YHIB 4NO5B 2KQNA 4J8RB 1IC7L 1NEZA 1A7NH 1YEJH 1DBMH 3C60C 1GAFH 2CGRL 3NCYS 1KENH 2BRQA 4QWWC 2A6JA 2EXWC 4NP4H 1XH3A 2QKIB 3MJ6A 4D94A 4PJ8D 1AI1L 5AYUL 3SE8L 3I02B 4P2RE 1ZT7A 1ORQB 1H15B 3TBTA 1QHOA 2ZCKL 2AABL 2Y6SC 5FM4A 1HQ4B 5BOZG 1MREH 1OARL 3GSUA 3TJHC 3MLSH 4O51B 1WAAF 5J1TC 5HDBE 2R4SL 3QUML 2PKDA 4MJIA 5D9SA 4KJWD 3DVNA 3BAEL 2J8HA 3GBNL 4P2OB 4FFYH 4UOW0 3ME0A 5GGRY 3VFNB 3BDXA 3UJIL 5HYEA 5DEFB 2O5YL 5FKPB 5ERWA 3K2UL 4PJHB 3P0YH 3DRQB 1H8OA 5SX5K 3QI9B 1VERA 4V1DB 4YBLC 5GRUL 3WFHA 4K8RL 2Z8RA 3QISA 5ADPL 2IFFH 4XCFL 1RHHB 2GITB 1U8MB 3MCKA 4J1UA 1QG3A 1Q72H 1EBAA 4ISVA 4U0RC 1WTLA 4X4ZA 3WFCH 2C4FT 3T4AB 3C08H 3KYKH 1X6LA 5KJRL 5FGRA 3VWKB 1KCSL 3HC3H 4JFEA 4ODXB 5DT1L 5IFAL 3A6BL 3S4SB 5ITFB 1S3KL 4ETQB 1JPFB 1FVEB 4M7JH 3N85H 2BFVL 4WFGD 1NGYB 1NC2A 1G9ML 1A0QL 2A74B 4QXUL 1S7WB 3KLHD 1M71B 3KYOA 3X14B 2H26A 2GTZA 2E7LC 4RFEA 1K4CA 1MIEL 3GMMB 2NY7H 2R0WH 4L9DA 4DKEH 1CI5A 3BPOC 1A1NA 5FCSH 1PSKH 3BVNA 1BEYL 1FSKB 5IGXL 2Y06H 5MERA 1T22B 2NY3B 5SWZE 3MV7A 3KPSE 3UZEA 3KDMB 4GKOA 3MPCA 4M3KB 3V5KA 3HNSL 1UQSB 3QEQD 3WJLA 3N1QC 1ED3B 3THMH 3O3EA 3DIFA 2XA8L 1WLHA 4PJBB 1LVEA 4EN3A 3MV9B 1ZLWK 1EH9A 3C5JA 4OJFH 2HFFB 5I6XC 1U2CA 1ZHNB 2N7AA 3MYJB 4DZ8A 3OB0H 1KCRL 3S88L 2O26U 5EUKB 4OZHF 4I0PD 4KUZL 3VXMB 4AMKH 4KY1H 1DL7H 2NY5L 3QDJB 3KJ4B 3MREA 2X4QA 4OCYH 4MA3B 4B0MM 1LK3L 1WBZA 5I1EH 1RV6X 1T83A 4HUWA 1IAII 3MOAL 4QHUA 4QT5B 2M8XA 1IARB 4UU9B 4Y4FA 5EB9A 1IGIH 5A2IH 3OGOE 4QXTA 1L4IA 3BD3A 5TDNB 3HI1B 3UBXG 3X3FH 2EIEA 1FAKT 2FEDD 4NRXA 4QRSB 3V2AR 3E6FA 2IMNA 4NQCA 3FAXA 3L6FB 3ARBD 4XPAH 4BSWB 1WIUA 3QNZB 4GOSA 1HKLH 1CFNB 2VDPL 4AT6B 2BCKB 2BVPA 5HGBB 3NPZB 3N9GL 2DL2A 1EBPA 4HIHA 3T0ED 1CG9A 1VA9A 1C12A 4FZEL 1G6RB 4LGPB 4X5WA 1NAMA 2YXFA 5IB2A 1U3HD 2UUDH 5IB5A 3L7EA 4TSBH 1CR9H 4LLVB 1BIIA 5E1AB 1RUMH 2EICA 4LAJH 3FFDB 1CBVL 1SEBA 3DV6B 1KJ2H 1WBYB 2FD6H 4Z5RA 4UTAL 1KT2A 1IM9D 2Z35B 1JMZA 1KC5L 3OXSA 1MHPL 4UDUA 1G0YR 1MRDH 2NY4C 3X3GL 3A6CL 3TT3H 4PJ9D 4MNGA 4D9LH 2VQ1B 4XNQA 2FL5A 2Q3AA 2IMMA 5D7IE 4MNQA 5IB3A 4POUB 1UXSA 3BJ91 4LVHC 2OMBA 1TZHA 1PAMA 3U83A 1MJUL 5I8OH 1OP9A 4FQIH 3WLWC 3I3BA 5FOBB 3SDCB 4XP9H 3O9WC 4XPBL 3BGFB 2VITA 4QYOB 5E8NA 4U6YB 1EFXD 4OZFA 3VE0A 4DJMA 2EIZB 4BUHA 3RTQC 1DEDA 2I9TA 3PGDA 5FV1L 1JUFA 3OGCB 4K9EH 1B2WH 1NFDB 3W2DL 4N8VB 1MAMH 5LWYH 3IFPA 4NWUH 4YHLL 3IKCB 3OSKA 4CMMA 4QRPA 1SYSB 1AY1L 3O6MH 4NOBA 3F7YA 3JWDC 3VGEA 3AREB 5CEZL 5IBLC 2WUBL 1IC5H 1HINL 5FGBA 2D31A 1H3UA 4D8PA 2J8UE 3ZT6A 2YPLD 1ZT1A 1OTTC 1L6ZA 4L4TD 3D3VE 5CSZB 2ARJA 1EGJA 3N0PB 2DQIL 3OX8B 1CVRA 3BP6B 3DXAD 4OM0L 1VFMA 3GSRA 5IOPB 1B9ZA 4KVNL 4KK5D 4PJIB 5E94A 2F5AH 3H42L 2XPGA 3VXSD 3NIGF 3EBAA 3K1KC 4LMQI 4NQDD 5DDHB 1T1ZA 2WV3A 3QUXC 3NABL 1FZMA 1U8OA 2CDGA 5F3BB 1E6OL 2I26N 4QRRD 3VCLA 1SVCP 5L6YH 1R5VB 5DR5H 3W39A 1PZ5B 1MLCB 2P46B 2YWYA 1FL5A 1B88A 3HE6D 1CGXA 3NBNA 1KTDB 4ZTPL 1AH1A 2AXHA 3HZMB 5MEOB 1AR1D 5DK3A 4AY0A 1H9VA 1IAKA 1BD2D 4OZ4B 5J13B 3GSOA 3UTTA 4NKMB 2F8XC 1YPZB 2VERN 4FQCH 2C3HA 1MFEL 1G7MB 1VGEL 5L2KD 3S3PA 1JPTL 4GS7C 2MMXA 1OAXL 2EDFA 4GXVL 5JO5A 3GMOA 3MODH 1FO0L 4NC1E 1MWAA 3PJSB 5H2BB 5F8QC 3N1PC 2IGFL 4PRPD 2AJSH 4XXCA 5EU5B 3KPRE 1UJTA 1Z3GL 4PJDA 2PR4L 3G6AB 4GRWB 5K9QG 1MELA 5INCB 2JK5B 1IVLA 5IG7A 4JM2F 4X9GA 5IBTL 1I8IB 4ZOAA 2AW2A 4WUUA 4G6JH 2WK2A 1JIBA 3L7FB 3ZTJH 1KIPA 2ZSWB 2OTWB 2DQFB 1LD9B 4C58B 3ZE2E 1R3HA 4YGVB 4Q6IA 2W92A 3PABA 3WFZA 2RJMA 5IEKA 2FO1A 2OZ4L 4WHYH 1VGKA 4EDXA 5EIIA 5EA0H 1MI5A 1FZOB 2MCPH 2H45A 2X4TB 5FO7B 3VFSB 2EDTA 4I5BB 2X9WA 1F6AA 3QEGH 4TPRL 3L1OL 5TDOB 5HDLA 1E27B 4NRYB 4Y19E 2XG4A 4Z78A 4EQ2A 5I8EA 3DX8B 2FSEB 4XP5L 4H88H 5CCKL 4H8WL 2DAVA 1VEMA 3EYVB 2W0PA 3O3AA 3STZB 1B4RA 5CP3A 4I77H 2GK2A 4YWGH 4M62L 4WUUD 1MPAH 3C5ZA 2JJTA 4HEME 4WO4A 5HHQA 4EUPG 2X4RB 4PJCF 3C60B 3RNKA 1C5CH 3S34H 4FFVC 1E4XH 4WDIA 4UMGA 1LE5A 3EYQD 5DJ0A 1S7UA 3SHSA 4DAGL 5INDA 3L3IB 3RGVD 2R2CA 2XZQH 1FYTB 3RWCB 4LOUC 4NO5A 3LN9A 5T33L 4J8RA 5CZXD 3VD5A 4Q2ZB 1P7QD 3GM8A 2NQCA 2FH6A 2QKIA 1JGUL 4ZYKB 5FM5O 2VABB 4IDJH 5E2WL 4CMHB 1H15A 5LXGL 3BOVA 3UPAA 4YQXL 3SKJH 1MLBB 2E8YA 3MRBB 2FEEI 1HQ4A 3VXUD 5JW3L 5HBBA 3K4DA 3IDJB 3C5ZD 4FA8A 3TT1L 3OG4B 3GBML 2G5RA 4O51A 2BP3A 4Z7WE 2ZOLA 4HGWB 4RGNC 1DQDH 4YBLB 4QXGH 1RUPH 3NAAH 1WEJL 1CDGA 3JWDL 3V0WL 2EXYC 5DGRA 4U1KB 2P5WD 3VFNA 4U0RB 2PF6A 1R3KB 5DEFA 5FKPA 3WUZA 3SGJC 4Z7NF 5DF0A 5GJTH 4PJHA 3O2DA 1AC0A 3DRQA 4HLZG 3VFWB 4MCZB 4LLWB 5C0GB 3QI9A 4V1DA 4PJ5D 4Y4HC 3D39B 1RHHA 2GITA 1U8MA 1I8KB 1QSEE 4K23L 5IHLB 4JPVL 5JQHC 2BNQD 1HWGB 1A3RL 4XPHH 9CGTA 3T4AA 4WEBL 4LCUB 3VWKA 4M1CD 3BPOB 1P9MC 4WI8A 3WSQL 3PWJB 3S4SA 5ITFA 4ETQA 1JPFA 1FVEA 5GGVL 3CFBB 1NGYA 1JZ8A 4R3SB 2A74A 5JTWA 2AEQL 1S7WA 3BD5A 3QUYC 4Z0BL 4Z8FL 1NBVH 3X14A 5C09B 3RU8L 1FO0B 4KHTH 2YD1A 2HAZA 3GMMA 1ULVA 4WFHD 3HAEB 5MI0C 1KIUA 1XF2B 4FMFA 1FBIL 5I6XB 4LEXH 1N2RB 4Z7UB 4HS8H 3KDMA 2ICCA 3SKMB 1EVTC 1D6VL 4LKXB 3GB7B 1UQSA 3RL1A 1SVZA 4X4XB 1EO7A 3UYRL 1ED3A 1HHIB 1KJMB 4OGYH 4EOWH 3M07A 4PJBA 2HKFH 3MV9A 2HFFA 4PRNB 4R26H 3MYJA 2OJEB 1UB6B 5EUKA 3NFSH 4NHUB 5AZEH 4M5ZH 3VXMA 3JBG7 3QDJA 1DVFC 4LIQL 1XGPB 4MA3A 2R0KL 3V4PL 5EN2B 3TBVB 5JNYB 3GRWH 1G7HB 1PLGH 4UU9A 1CD0A 2NXYC 3JZ7A 2GJJA 3WFBH 4S1SL 4XNUH 5IESH 5TDNA 3HI1A 3IYLW 1KTLB 1TJGH 4QRSA 4DUXA 4PRAB 2Y36H 5FUOL 3L6FA 1GJIA 3PF2A 3NCCB 3QNZA 3BW9B 5BV7C 1FC2D 1CFNA 3LDBC 5ID1B 4AT6A 1U8JB 1ZTXH 1FCCA 2BCKA 4MAYD 5HGBA 3SQOH 1IKFH 3S5LB 4R4NC 3JWNC 1N0XH 3GO1H 1FRGH 4MJ4A 1FNAA 1PX4A 3IJYB 2NY4B 5CIPB 1TQBC 1YA5A 4L3AA 1TTGA 1WGOA 2ZG1A 2NCMA 1G6RA 5F44A 4O58H 3MNZB 3BP5A 5ACZB 4LLVA 3GIZH 5E1AA 4XB7A 3FFDA 4UT7H 2FX9L 3DV6A 3UMTA 1WBYA 4CADB 2NXZC 3MJ8B 4RIRB 4LVHB 2WUCH 2Z35A 1UH2A 4YDLC 2UWEB 3H9SB 4IRJB 4HH9A 4LP4A 5T3ZD 3BKYH 1MRFH 4TSCL 3O9WB 5L9DH 5BS0A 1FP5A 3WN5C 5F70A 3KLDA 1LO3H 2VQ1A 5DJ8B 3VXRB 4NYLA 2MWCA 3MRKB 5KVEH 3HZYB 3RTQB 4JPKL 1YEKH 1KPVB 5IVNA 5C92A 4QOKB 1UZ8B 4KH2A 3D6GA 5FOBA 3EOBB 3SDCA 5FYJD 2EZ0C 4MXQD 4ZFGL 4HQQL 3DV4B 1RU9H 3VI4F 4QYOA 2OR7A 4U6YA 1OP3K 3OAUH 1TVDA 2EIZA 1UCBL 1Z9SA 3NCJH 1KPUB 3O2WH 5GHWH 5TFSL 2UVFA 3OGCA 1KELH 1P6FA 1NFDA 4N8VA 1J0JA 4XAWL 1CGSL 4XBEL 1YNLL 4AEHH 5BS0D 5TE7H 3IKCA 4M00A 4KI5D 4G8GB 3SCMD 1BQSA 1IAIH 1SYSA 2WMPA 1RZKC 3PP3H 3AREA 5K33A 3FMGL 5HVGB 3MLZH 5FHBL 2ADGB 4MNHA 5J9PB 2LV4A 3G5VA 2Q76B 5CSZA 1DFBL 1WAAE 3OX8A 3BWUC 3QUXB 3BP6A 2WP3T 2H2PC 2AK4E 3DJ9A 1G0XA 1LO0H 3FTGB 5D70L 5A43C 3NMEA 3MV8E 5IOPA 1Q38A 3ARWA 5B39G 4PJIA 1E6JL 4GAYB 1P4BH 3ZSTA 4TQEL 2PO6D 2CDFB 4M48L 3A67H 1ACYH 2NMSA 5D5MF 5DDHA 5DVKA 1DDHB 5B21A 5E2TH 3TC9A 1CXEA 1W0WB 1UH4A 4FOMA 2WBKA 4XRCB 5H94B 1WFOA 4S1QL 4FZ8L 4YE4L 5C0ND 4JO3L 1MAKA 1R5VA 5F72S 4UV4H 1YEHL 1GHFH 1PZ5A 1MLCA 3DNKA 4GS7B 3VFGL 4NNXA 1WIOA 3QSKB 3MLYL 4ZAKA 2IBBA 3IDUA 5I1CH 5LQBH 2AS5M 4Y4KD 1KTDA 4JJ5B 3R06A 3HZMA 5MEOA 3ISWA 3ALXA 4RA3A 4U1MB 4OZ4A 3FL7A 4U6VH 4NKMA 5I9QC 1BZ7B 3QDGE 4UT6H 1YPZA 3EDKA 4P49A 1G7MA 2VXQL 1PD6A 1ERNA 4JPWL 1QRND 4DCQB 3WIHL 4MSWB 3BZFB 5E08L 5H2BA 3PJSA 4DN3H 1HSAB 1KCVH 5EU5A 5K9OB 1NMCC 4TVSa 4EXPX 4HXAH 3VGHA 1NGPL 5KSBF 1TXKA 1CICD 3G6AA 1I3GL 4EI5B 1BBDH 5INCA 4ZAKD 4Y1AD 2JK5A 1JYWA 2P5EB 1I8IA 3FFCD 4NZJA 2NTSP 2AP2A 3KHOA 1XF5B 2VO5A 3L7FA 1QA9B 3JTSB 4HD9A 2ZSWA 2OTWA 2DLHA 2DQFA 1IEBB 1OAQL 4QRQB 3CSGA 4YGVA 4OD1H 4PJXB 4OZHE 1NAMH 5JHLH 5I8KH 2W0FB 4IS6B 3EFFB 1FZOA 2X4TA 5FO7A 1FV1B 3VFSA 2QQLH 1JK8B 2HT4D 5L8JB 4I5BA 4MAYC 4ERSH 3QWRA 5TDOA 1UT9A 2A83B 4YPGB 5I1DB 5J8OA 1E27A 1H3GA 5I1KL 1J8HB 1XF3B 4OCWL 5TQ2H 4JDVB 3RJQB 5EU7C 2FSEA 2NPLX 3CLFL 4JY5L 1FHGA 1OGAE 5DFVC 1FNFA 3BPNB 1PY4A 4S1RL 2H6PB 3EYVA 1DSFL 1CT8B 1FNSH 3STZA 1UACL 1FZJB 4M7KL 3RWDB 4N0RA 2FX7L 4JFOB 2YBRB 1QACA 4M6OH 3WS6C 4RMVA 5EU6B 1MCNA 1RK0B 2X4RA 3QHFH 3C60A 3F5WB 1I3RB 5CZVL 3O8XC 2XT1B 1VEOA 4POZD 2OCFD 4LLMB 3VMNA 3I50H 3L3IA 4OZFH 1FYTA 3RWCA 2P24B 3QQ9C 2PXYC 2FDBP 4PRDB 2P7TB 4UB0H 3UYPA 5HI4D 3T3ME 2QSCH 1OD7A 4Q2ZA 3LY6A 4CJ1A 3UJJL 4RGNB 5JMOC 2GUOB 4NO0D 4ZYKA 1AO7D 2VABA 2IALB 3EYUH 5FYKL 3D2UB 3QG7L 4XNYL 4QHKJ 1N6QL 1MLBA 1MCFA 2PTTB 3MRBA 2NY0D 4Q6YA 4NKIH 2F53E 4NC2B 3MRMB 3IFLH 3IDJA 3MR9A 4RFNC 4MMXC 3RHWK 1QSFD 3HI5H 1RIVL 1WZMA 4HGWA 4TVPE 4HWEL 2BX5A 1EGJH 2UUDK 1KUMA 4XCEB 2ZSVB 1RZKL 4Y4HB 2XY2A 3GKWL 3D87B 5HDOA 4GMSL 5DMGC 3ZYOA 4NQEE 4U1KA 1MJ8L 2V17H 3ZKSD 1S8DA 1R3KA 4PJEB 4OZIB 1DBKL 2NY2D 4Q9QL 1ZSDB 3OXRB 3UTSB 3VFWA 5BRZE 4MCZA 4LLWA 1J5OL 5C0GA 3OKDB 4QHMB 4AEFA 3O3BB 3LOWA 3VG9C 5CEZD 4OT1L 4WUKH 2NZ9D 2Z8VC 3D39A 3T0WA 2IANE 2I5YH 5EZLB 3QUYB 5KVDL 1I8KA 4BUGA 2Z93B 1J1PL 2E7LA 2H8PB 4P9HH 4JFZL 4X4ME 1GOHA 4LCUA 5MI0B 1G9NC 2CK0L 3JV6B 4FQQB 4WGVB 3PWJA 4XNMB 2FECL 1I9JL 1JNNL 1UA6L 4PRHB 4EUPB 2YKLL 1BFVH 4HXBL 3CFJB 3EOYG 4IRZL 3IAPA 3U4BL 5B3JF 5E8DL 5C09A 1TZIB 4JKKA 1YYMH 5F6IC 3WBDA 2FZ3B 1FO0A 2ORBH 3HAEA 4UV7H 5TH2B 5TQ0H 1YEIH 1FPTH 4KPHH 1MWAH 4XBGB 1BP3B 3P40A 2R56H 1A64A 3TA3A 3E6HB 1N2RA 4Z7UA 1QLFB 3NPSB 1F4YL 3SKMA 3B5TA 3C6LC 1DVFB 3L5XH 3TNNB 5ALBL 1CDYA 4LKXA 3GB7A 2HTLD 4K94C 4X4XA 1Y6MR 3D9AH 1HHIA 1KJMA 1YMMD 2NXYB 2D7TL 1KPRB 3MBXH 2IAMC 5HHOD 4BQCA 3RVUD 3MA9H 3SEPA 4PRNA 3QRGL 2VDRH 2OJEA 2OZ4A 1UB6A 3IDNB 4NHUA 4D9QD 5BV7B 4MJ6B 4CAGA 1XGPA 3MOBH 3LDBB 5HVFB 1HI6B 5EN2A 4KUCF 3TBVA 5JNYA 4L1DA 5SWSD 1G7HA 3TVMD 3WFDH 1KEMH 2XWJB 4WTWA 1TQBB 1KTLA 2YC1B 3DETD 1MFBL 3TA3D 4PRAA 1XAUA 3MLWH 4P23C 3FQTB 3BW9A 4XVJL 5ID1A 4FMKA 4XWOD 1U8JA 4FTVD 1YECH 2NXZB 3CK0L 4P2QE 1EJ6A 3S5LA 2VLJE 2W9DH 4YDLB 5CP3H 3M1BB 3IJYA 5CIPA 3VD7A 4MLIA 4D9RE 2RCSH 3NFPB 3WN5B 5F71A 1ADQA 3VGGA 4CDGC 3MNZA 1Z6JT 4MX7B 5EOQL 5ACZA 5F7MC 1PZUB 4WWID 1QFWL 2DD8L 5F88B 2ZJSH 1CF8H 2EH8H 4CADA 2G5BB 3MJ8A 4RIRA 4E41B 4QF1B 3U2SB 2B1HL 3P30H 2UWEA 2D03H 3H9SA 4IRJA 4X6DB 3G9AB 5LGKA 4OGXL 2J3SA 3HB3D 3O9WA 4YBHA 2HFTA 1A6ZA 4CKVX 6FABL 4OIIH 5DJ8A 3RVXD 3VXRA 4WHTB 1D7FA 2KKQA 4OQ1A 1MNUH 3MRKA 5DJAB 4LSRL 5E9DD 3RTQA 1KPVA 3PQYD 3DSFH 3LKNA 4QOKA 1UZ8A 3NA9H 3BMVA 4P4KD 5HI4C 5JHDB 3EOBA 1NJ9B 1FNLA 3AB0C 3DV4A 4GJTB 1M1SA 2ZUQC 4XNXH 1K6QH 3NVQA 5BCAA 3SPVB 1J88A 4X80L 1KPUA 4YXHL 1MFAL 2R9HD 3U46B 4OLWH 3BEWB 2OR9L 2VUYA 4YXKH 3WXVL 2Z9TA 4G8GA 1YYLH 5D6CA 4N0YH 4UUJA 3S36X 3BKJL 4YHNB 3T2NH 3TYGH 1J0HA 2C1PB 3EHBC 3ORJA 3QG6B 1EEZB 2ADGA 4KRNA 5J9PA 2CIIB 5DQDL 3T2OA 1DQJB 3LH2L 2Q76A 3CSPA 2JB5H 2HWZL 4K3EL 2FYYB 4NNYB 3QUXA 3K3QA 4H0HB 4X8XA 4IEFB 2V5TA 1SMAA 3FTGA 4XMKH 4NZUH 4P2RB 2NZ9C 4ZPTB 4M6ML 5I19H 3VI3E 1L9NA 1V7NL 3WLBB 1H0DB 3GSQB 3L3GB 2CDFA 1KJ3H 3O81A 3BDBA 5HJ3A 2JJVA 1KN4H 1C16B 2VDOH 1P69B 4JHZA 1C8PA 3ZDZF 1DDHA 1UYWH 3FAWA 1G9NL 1W0WA 4O9HH 3TFKD 4F7EB 3SE3C 4XRCA 5H94A 5I9QB 4YUEL 4E42B 2ATPB 2GT9B 3CLEL 4R6UA 3CSYB 5C0IB 5T1DH 3HNTL 3U30C 3WXWH 3IFOB 4JJ5A 4MHHG 4U1MA 4YNYB 1JJUA 2NY6D 3OR6B 2N56A 1NMCB 3RWFB 1MJ7L 4P59H 5D7LE 1BZ7A 2OJZH 2X05A 2ZUUA 3ESVF 3CAFA 5A3IC 3GM0A 3QWOB 5ICZB 1KIQB 4XHJC 3EJZC 4DCQA 5F7UA 4GAJH 4MSWA 3BZFA 4XPGL 2IQ9L 5E4EC 3B3IB 2YWZA 3ARGD 1HSAA 1T66C 3ROOB 2WNGA 4NQVA 5I30H 5K9OA 2Z31C 5C6TL 1OTUC 1AGEB 1RIHL 1S78D 2N7BA 4PJ7F 1X7QB 4EI5A 3E8UH 3WV0A 2XXCB 4M43H 3RHWF 2P5EA 5EU3B 3QQ4B 1YEGH 1DQMH 2EE6A 5FYLH 3BH9B 2R2EB 4Q74A 5CGTA 1XF5A 1IAOB 3KYMB 1QA9A 5D93C 3JTSA 3DX7B 4JAMB 4QRQA 3B2VH 1IEBA 5HYJE 3LS4L 3OV6A 4PJXA 3UZQA 3RZCD 2R15A 4DK6A 1G84A 3KPSB 2H32H 5I1IH 5C08B 2W0FA 4IS6A 3EFFA 3QJHB 2DQCL 4R4FH 4HZLB 1FV1A 1NLBL 2MFNA 1JK8A 3MLUL 1ES0B 5IP4A 1QBMH 2VLKD 2Q8BL 4PFEA 4KJQD 5B39B 1MCDA 5F1SA 2A83A 3BX7C 2VLRB 2P1YA 4YPGA 3T3PF 5I1DA 1TJIL 2IJ0C 1IC7H 2GSIB 2KBGA 4K3DL 1J8HA 1XF3A 4JDVA 3O8XB 3WKNA 4JQIL 2CGRH 4Y2DC 4PJAB 2B0SL 3QB7C 1YY8B 4YHZL 1AI1H 5AYUH 3SE8H 2H6PA 5EIVA 2C1OB 1CT8A 4DTGL 1DBJL 1FZJA 3RWDA 3DVIA 4JFOA 2ZCKH 2AABH 2PXYB 2YBRA 2Q6WB 1NLDL 3WNPA 3CX5K 5EU6A 1OARH 1RK0A 2APVA 1QOKA 3F5WA 1I3RA 1GXEA 2R4SH 3RP1A 3QUMH 1JZ5A 4JO4L 2A0LD 4O5LL 2XNAB 5IVXB 2M26A 1R3JA 4LLMA 3MACL 5JOEA 5K93A 1CGUA 3BISA 3BAEH 1AGFB 3GBNH 4TUOB 1CDUA 4WU5B 3CIQA 3W5NA 1CD1B 2P24A 3RRQA 4PRDA 3IF1B 2P7TA 3UJIH 1IGFL 1NBZB 3RY5A 4RFNB 4P4KC 2O5YH 3K2UH 2XICA 4S10A 3BE1L 4R2GC 1S9KC 3CDGB 3RVWD 2GUOA 5TDPB 1J8KA 2J6EA 2IALA 4LGRB 5GRUH 5A40E 4K8RH 4JFDD 2VZVA 5ADPH 3KPOA 4XCFH 3MRMA 2WWMD 2R9HC 4TTDD 4JFEE 3SGJA 3W11D 1UC6A 3PP4L 3X13B 4G9DB 5KJRH 3E2HC 1KCSH 1PQZA 5DT1H 4HDIB 3L3KB 1AJ7L 5IFAH 3A6BH 4XCEA 1S3KH 2NR6D 3VG9B 3ZE1F 2V5YA 2PYED 2ZSVA 2R8SL 5D7IB 2BFVH 2HJFB 3HG1D 4M93C 5CAYB 2DQHL 1G9MH 1A0QH 4QXUH 2YOCA 5C0AD 4JFPB 1XIWD 2AQ2A 2FH8A 4HKBB 4PJEA 1NCNA 3CGTA 5DRZB 4OZIA 5IQ7L 1ZSDA 3UTPE 1MIEH 3OXRA 2GTWB 1P9MA 1P6AB 3UTSA 3OF6A 3C2SA 3OKDA 4QHMA 2AXFB 5T5FL 3O3BA 5KW9L 1IKNC 2OX5A 2EC9T 5FDWB 1BOGB 1BEYH 5IGXH 3V7MA 2ADIB 3QXVA 3QUYA 5EZLA 4PV8B 2Z93A 3B43A 2COQA 2H8PA 5F6IB 3HNSH 4NN6C 2VDML 3TN0B 1TVHB 2CUHA 2XA8H 4FQQA 3PXHA 2QV2A 5HXMA 1R5WB 4XNMA 5K59F 3EO1B 4LFHD 4KMTL 4LASL 1YJDC 4PRHA 3IT8D 4L3EB 4PJFF 1VADB 2BY3A 1MCCA 1KCRH 3O4LB 4HIEB 3V8CA 3VXPB 4I4WB 1ONQB 1Q1JL 3JUYA 3S88H 4KUZH 3CFJA 3C6LB 2NY5H 4NO3B 1U91B 3SQBA 1TZIA 2ZCLL 1LK3H 3GI9L 2J8UB 2FZ3A 3BP4B 4OFPA 1KLGB 3MOAH 1JZ6A 4PY8J 3D3VB 2OI9C 2MPAH 4KROC 5D5ME 5TH2A 5JW4Q 4NQCE 2IAMB 4XBGA 5GISL 3L3HB 4RWHA 4HGMA 5AZ2L 1IILE 3KVQA 4MXVE 1N8ZB 3E6HA 1BHGA 3D5OF 1QLFA 3M8OL 3PP3K 3QNXB 3VXNB 3TESA 2NY1D 1DVFA 3TNNA 1Z0MA 5EZIL 5B3NA 3VGFA 5EULV 3QFJD 2VDPH 3GSNL 1RQ5A 2VUOA 3HRZB 4LK4A 5CEXB 1KPRA 4OFVA 4HZAA 1HHGB 5CJQL 4P5KB 4I3GA 5DJDB 3F6IA 4FZEH 3IDNA 1OCWH 1MCIA 2BRRL 4P23B 4MJ6A 4WV1C 3HLAB 5BMFL 2BHUA 4L9LB 5EZOL 2NX5D 4PGBB 1HI6A 1CBVH 3RQ3A 1I7TB 4UTAH 2LAAA 5HGHB 3DI3B 4HH8A 1JF1B 2XWJA 1KC5H 1OTSD 3SKNB 1MHPH 4MNGE 2YC1A 1NCDL 4KQ3L 2O93L 3DX9B 3X3GH 1FIGL 3A6CH 1CFTB 2QBWA 3R4DA 4XCYB 3FQTA 1T4KB 1ZLUK 4NT6B 3QIBD 4X7CC 4ENED 1VSCA 1MCWW 1Q0YL 3P2TA 1F4XL 2E6PA 5E8OB 3M1BA 5KBNC 5HI3D 1MJUH 4YHML 3NFPA 3WN5A 4MX7A 4XPBH 3L3DB 4HUNB 5F88A 2CKBL 2D7NA 3REWB 4UINL 2WLZA 2G5BA 3U82B 4RRPG 4E41A 3E3QC 4QF1A 3O6LL 3U2SA 1OLLA 3RA7L 3A6OA 4X6DA 3W2DH 1AHWB 2LU7A 3AB0B 3ZHKA 2XN9B 4EIZC 4YHLH 4NCC1 5CGYD 3V95A 4WHTA 5DJAA 4HK3N 1AY1H 3FJTA 3OKYA 5FECB 4L8SC 2HT3D 2I60L 3LVEA 2WUBH 2R69L 5DJZB 1HINH 2BNRD 2YA0A 5IBUG 1L0YA 4J3WA 5GSRB 5JHDA 4FXLA 3VD9A 3LIZL 1NJ9A 3BP7B 3GMRA 1A6UL 2DQIH 1EDQA 5CKGA 4Y7MA 5E6ZA 2OTUB 3TEUA 3HE7C 3NIDF 4OM0H 4KVNH 2DJUA 1ZHLB 2Y23A 3CDFA 3MZGB 1JGLL 1G6VK 3H42H 4V2CB 1A7RH 4BSVB 4H1LG 3DBXB 1MOEA 3BEWA 4P2YA 4BZYA 4F7MB 2R2BB 5EUOF 1NL0L 3NABH 1QTYT 5FYKD 3O2VH 1YEEL 4YHNA 4BH8B 1E6OH 1GL4B 2AQ1A 1CU4L 4Z18A 3TO4C 4F37K 3PHQB 5CJ8A 2C1PA 3QG6A 1EEZA 3UTZB 2CIIA 2E7CA 1RK1A 1DQJA 5HI5C 4J3UA 4QRUB 1YC7A 3LS5L 1WQVT 4U2YA 5E8PB 3QIWD 4ZTPH 2B4CL 1YUHB 4NNYA 4X6FB 3VGAC 2UZXB 1OSPL 5DC4B 3P0GB 3ULUE 5AG8A 3LRGA 3V5HB 4P2RA 3QNYB 4ZPTA 1MFEH 1VGEH 1JYXA 3WLBA 1H0DA 3GSQA 3L3GA 5F7DB 1JPTH 3H9ZA 2XTJE 4GXVH 4N8PA 3U30B 1C16A 1V3JA 1IGJB 4JFHE 1FO0H 5E4IA 1YC8A 4Z7WB 4NFBA 4M02A 4PJDE 4Y8DC 3HAEH 2IGFH 4F7EA 4QLRA 3LQZB 3W81A 4E42A 1YJDL 3RPIB 1Z3GH 1WT5C 4HMEA 4OGZA 2ATPA 2GT9A 2PR4H 1BVKB 5C0IA 1KG0B 4NJAL 5IHBA 3IFOA 4P5TD 3PDGA 5AYQA 3JV0A 5IBTH 5E4EB 2BVTA 4KKLC 5D2LF 4YNYA 4G80A 4WTZA 3OR6A 2IFFL 1V7ML 1FCGA 2Z31B 3RWFA 5FB8B 1MI5E 4E5XB 1HYSD 3NCYP 3U0PA 5CJBA 1T03L 3KYAA 2IPKB 2OZ4H 4MQTB 5FKAB 1B90A 3QWOA 5ICZA 1KIQA 1NCBL 2PYFB 3QFDB 2AEPL 3B3IA 4J6RL 4TPRH 5DZLA 4MLSA 3L1OH 5T1LD 3ROOA 5D93B 1AGEA 2BDNL 4HKZB 1X7QA 4XP5H 5CCKH 5EU3A 2AKRB 5EO1A 3QQ4A 3BT2L 4HS6B 5HGGS 2FECI 3TWCL 3BH9A 3QUZC 2R2EA 4M62H 2DLIA 2B7DT 1IAOA 3KYMA 4G5ZL 1BVLA 3CFKB 3DX7A 4GW1B 4JAMA 5CIPH 3K8KA 1R5IB 3KPSA 2CKBB 4Y2DB 5DURD 5C08A 1F90L 3QJHA 3JXAA 1IAMA 4HZLA 3UCRA 1WJ3A 2JJSC 4DAGH 1ES0A 3B9AA 2DLFH 5B39A 3VXQB 3MLXH 3WS6A 3KJ6L 5D1QB 5T33H 2VLRA 2FBJL 3ZE0F 4LL9A 2GSIA 2VZOA 4Y16C 2ED7A 2LQRA 1U36A 2VR4A 3O8XA 3O11B 3FRUB 4PJAA 1YY8A 1X5KA 1JGUH 2W0KA 2C1OA 5CZKA 1OSZB 3P4LA 5E2WH 5LXGH 5J1SC 4WWKD 4Q0XL 4YQXH 1OAZL 2PXYA 2Q6WA 1IEAB 1K3ZA 5FYKU 5JW3H 1P4IL 3TT1H 3GBMH 4WI9A 4R2GB 4KDTA 2APFA 5SWZD 4MQ7B 5IHUL 1Z0NA 4S11A 2XNAA 1EAPB 1KLUB 4OGAC 5CUSL 3S7GA 3QHZL 1FFOB 2RB8A 4X0KB 1WEJH 1AGFA 3JWDH 4TUOA 3V0WH 3QP3A 1A1MB 1CD1A 3P77B 4UQ2B 3IF1A 4U1NB 5IT2L 3T0AA 1NBZA 4LCYB 2ENSA 5DWUL 3E2HB 5F1NB 1NCAL 1QFWM 3CDGA 3B83A 5DEGB 1GC1C 1IBGL 5TDPA 4I2XB 1RZ8B 2Q20A 4M93B 4LNVA 2ZNWA 3K4AA 4JM2C 4MS8D 4K23H 3O6FD 4JPVH 1FIEA 1A3RH 5GGUB 3X13A 1BJ1J 4G9DA 4WEBH 2QADC 3SDAC 1G9EA 4HDIA 3L3KA 3EDEA 2DIJA 4H0IA 5GGVH 5D7IA 2HJFA 3EYOB 2AEQH 1HKFA 3PV6B 4JFPA 3BIAX 4Z0BH 4Z8FH 4HKBA 4C56E 5DRZA 3RU8H 2YUZA 1N26A 4NN6B 1CGYA 3LQAC 3QDMD 1AXTL 4ELKB 2GTWA 4GG6B 1J9CT 2AXFA 2X89D 1FBIH 5FDWA 1BOGA 4ZMAT 5HHNB 2ADIA 4U0QB 2YD3A 3U0WL 1WITA 5GRXG 4XP1L 1HXYB 4FQXD 3VDAA 1D6VH 5D71L 4ODUB 1YN7B 3IAQA 3MV9E 2DI7A 3UYRH 3TN0A 1TVHA 2OI9B 35C8L 4JO2L 4KROB 1BM3H 1A47A 4YDVB 2DQGL 1I1AD 3EO1A 3VXME 4JDTL 3QDJE 4L3EA 4P46B 1VADA 4HIEA 3O4LA 4KV5E 3VXPA 1ONQA 1BZQK 1B0GB 1VFOA 3C6LA 4NO3A 1U91A 5CKAA 2ZUWA 4LIQH 1MCKA 2R0KH 3PIQB 1CE1L 2J8UA 3DGGB 3V4PH 2YN3A 3BP4A 1KLGA 3D3VA 2IAMA 4C54A 2R1XB 4CU7A 4S1SH 4MQSB 3L3HA 5T3XD 4TVPL 2UZIL 3BI9X 1FL3B 3L5WB 1N8ZA 5GS0C 2R0ZL 5FUOH 3VXNA 3QNXA 1ZEAL 1FG9C 5EFIB 4WV1B 1FN4B 3PWLB 4RCAA 1VCAA 3U0TB 4JRXB 3HRZA 5CEXA 1TQCC 1HHGA 5DJDA 3LEYL 3NCMA 5HDQL 2PETA 5I18L 4P23A 2EKSB 4JN1H 2AEWA 3HLAA 4L9LA 1O5DT 4PGBA 5H35A 5BJTA 2GAZB 2FX9H 1I7TA 1F11B 3IRPX 5HGHA 3DHMA 4PG2A 5JIHA 1H3WM 3G08B 1JF1A 5J0BA 3MRGB 4WJ5A 3T1FB 5MP6L 5H37H 4ONOA 2XWTB 4LRNL 3DX9A 4M1DL 4OCRL 4TSCH 3O0RL 1CFTA 3QDGB 4XCYA 1T4KA 2HN7B 3GHEL 3OJ2C 4NT6A 4OD3L 4ZNEA 2V2WB 3BRFA 1J12A 4JJHA 5MENE 4JPKH 1GGBL 4ZDHB 2X4OB 3K46A 5E2VL 1JWSB 4NN5C 3P0VL 5DHVB 3S98A 1FLRL 4J3SA 1SJHB 1JZ4A 1TIUA 3ET9F 3KXFD 4ZFGH 4HQQH 3L3DA 4IOIB 3EUUA 1TLKA 4OTXL 3REWA 2PUQT 1NFDE 4L8SB 2VRAA 1UCBH 5TFSH 5I76B 1MEXL 4XAWH 1CGSH 3BUYB 1AHWA 4XBEH 1YNLH 2UYLB 1RURL 2XN9A 4LVOC 3X12B 5C0EB 1QQDB 4OZHB 3H8NA 3WFEL 4ZOEA 3HE7B 3MGAA 3ZKMC 5FECA 4PBWD 4RNRB 1B4JL 3FMGH 5DJZA 5FHBH 4UIKL 4AEEA 1WZLA 4UIMB 5GSRA 3K8MA 4XI5C 3KPRD 1RIUL 4WFEE 3BP7A 1DFBH 1U6AL 2OTUA 1HZHL 1LO2L 1EEYB 1PEZA 1BREA 4BFBD 4S0TD 2O61A 3TO4B 3H9YA 5F1KC 3OKKB 1ZHLA 2GJ6D 2C9AA 1E6JH 4TQEH 3CVIL 1HHJB 4MS8C 4M48H 4BSVA 3DBXA 1E4KC 1J86A 1C5DB 1KB5L 3BPCB 4F7MA 3VGAB 3BD4A 2YMXL 4LQ1A 2R2BA 3FB8B 2H2SC 3VRJB 3QCVL 1REIA 4BH8A 4S1QH 4FZ8H 4YE4H 4JO3H 3BN3B 3PHQA 3DHJA 2OL3B 1YEHH 3DYPA 3UTZA 5GIRB 3VFGH 2WAHA 3MLYH 3MRDB 2R2HB 4OKVB 4QRUA 1YN6B 4KKBC 1OT1A 3OG6B 5E8PA 4KAQL 1YUHA 2DQUL 4X6FA 4Y19D 3ARDB 2EEDA 2AJXL 2JIXB 3FQXB 2FIKB 5JA8B 1N6UA 5C1MB 4KKCD 3V5HA 2H3NB 5GZOD 5D1ZC 3QNYA 4EUPH 1JRHL 2VXQH 2VR9A 4JPWH 2ESVD 1QLRB 5JPNB 3DPBA 5C0JA 1IGJA 5MHSD 1NKOA 3WIHH 2CO7B 1SQ2N 5E08H 4Z7WA 3LQZA 4GRWE 4CVUA 1DZBA 3RPIA 5KAQF 1NGPH 3VMOA 1VDGA 1BVKA 1SJXA 1KG0A 5HVWA 1E4JA 1LWRA 2HLFD 1I3GH 3PL6D 3OB8A 3SJVB 5D7JA 3GSNA 1BPVA 2L0DA 2DKUA 4TSAL 4G6FB 1LP9F 1AR2A 2Z31A 2LU4A 5FB8A 5K59E 2P43B 3FT2B 4E5XA 1OAQH 4JRWA 3SDXF 2IPKA 1QR1B 2IANB 1I9EA 5FKAA 1QSEA 1QD0A 4OB5L 1F45A 2PYFA 3QFDA 1NKRA 2JCCF 3QUZB 3GMQA 5I2IB 2E9WA 3KPQB 4AM0B 3LB6D 5E70A 2A6KB 5ANMB 5I1KH 4HKZA 1CLZL 4OCWH 2Y25A 4GSDL 2RGSA 2GFBB 3CLFH 4JY5H 4HLZH 5EIQA 1CN4A 2RFXB 5D7JD 4S1RH 2AKRA 5L0QC 1NMAL 1DSFH 3ALPA 4HS6A 1K85A 3MNWB 3Q1SL 1UACH 3IXTB 4M7KH 5HD8C 4RAUB 2FX7H 5DYOB 1AQDB 1T80A 4YHYC 4UAOC 3RKDC 3V8OA 2XKUA 3ABZA 3CFKA 5DHYB 4Y16B 1EEUA 3PWPB 1R5IA 5CZVH 2QQNL 2CKBA 4Y2DA 5BZDA 1U8PB 3BQUD 1QSED 1TMCB 4UNUA 1UKTA 4FNLL 3QXTA 3MFFB 4PLKD 3FONB 5C0RL 3VXQA 1X5FA 5D1QA 3LN5B 2Z91B 3HC4L 4LLQB 4RBPH 3MBED 1MVUB 3UJJH 2N1KA 3O11A 2C3XA 5CJXC 5FYKH 1OSZA 5HYFA 2QL1A 3PWUB 2YPVL 5FA3B 3QG7H 4KZEL 4XNYH 1N6QH 5IW3A 3DGCR 5IMLB 4APQC 4JFFB 4OI8A 1OB1B 5E8EB 2OP4L 1CDJA 2A77L 4WENB 1UKSA 1VB9A 1F13A 2EDXA 1RIVH 5DO2D 4F57H 1QEWB 4HWEH 4MQ7A 5I1AB 1EAPA 1KLUA 2DJSA 2HFEB 3DMMA 1UH3A 1EZVX 1FFOA 1RZKH 3GKWH 1J0YA 3G9VA 4GMSH 1A1MA 3CX2A 1JZ2A 3TF7C 4JM2B 5I1GL 3P77A 4UQ2A 1YQVL 1MJ8H 4YR6B 4U1NA 4XXDB 4LCYA 1KB5B 1DBKH 3VFPB 4Q9QH 8FABB 5F1NA 1U42A 1JGVL 3W9DA 2QADB 1RI8A 3SDAB 4GBXD 3FQWB 1OD9A 5L8LB 5DEGA 3GNML 1J5OH 5M94B 3D39E 2ICWB 2A73B 4I2XA 1JP5A 1N7MH 1RZ8A 4YX2L 4WI4A 5DRNB 4OT1H 5CSBA 3H0TB 2DMBA 2YHGA 1RJYB 4WW2F 5KVDH 5EU4B 1CVSC 4JR9H 1J1PH 4NZTH 1OOAA 1L7TL 5GGUA 3M17B 1LO3L 2E7HA 4MB3A 3B2UD 4JFZH 2AI0L 2CUMA 5D96C 4LU5L 1KLFA 3ARUA 2CK0H 4G3YL 1IQDB 5JQ6L 2W1NA 2XACC 4BQ6A 1IMHC 5DJXB 3ZKQD 1XR9B 4KDVA 4OUUB 1IKNA 5J12C 5L7XL 1I9JH 1OAUL 1JNNH 3OL2A 1UA6H 1D9KD 2C3VB 2EIBA 3S36L 2YKLH 4ZG1A 3EYOA 4HXBH 4JGMA 3PV6A 1N6VA 3CXHJ 3B9KD 4IRZH 3VRLF 4G9FD 1N3NB 5F7EL 3U4BH 5EO9B 3ULVD 5E8DH 3O41A 3D18A 3T0VA 1DUZB 4ELKA 1AIFB 4ZFOL 4PB0L 1DANT 4YHKL 1C7TA 4PJCB 4Z7UE 4FFZL 4J4PD 3T0XA 5FHAL 2YXMA 1FVCB 4N0UB 5HHNA 2RHEA 2Q86B 1F4YH 3MMEB 3MA7B 2HJKB 5ALBH 5J11C 5FIEA 2BJML 3FO0L 4PBVC 4ODUA 1YN7A 2J2ZA 2D7TH 1ZAGA 4ESKA 4YDVA 1GZQA 5GGVY 4R9HA 3DX6B 3QRGH 4P46A 3QUKB 1A2YB 5GGTL 1B0GA 4JKLA 5EBMB 3PL6C 3PIQA 3DGGA 3QEHB 4L4VE 1M05B 1TQCB 5CILL 1WAAA 2R1XA 4TRPL 4HT1L 1SBSL 1CFBA 1FL3A 3L5WA 1MFBH 8CGTA 3VRIB 5J4MA 1JYNA 2KPNA 4QGYA 4Z7QE 5EFIA 4UNVA 5F1IA 4WV1A 1FN4A 4XVJH 3PWLA 1MH5B 3H9HB 2WIIB 3ALWA 4HKXB 4L8BB 4MMZC 3U0TA 1MUJB 3CK0H 3LV3B 4JRXA 4JY4B 4Y5XC 4OF5A 5ETUB 1CGVA 4JDZB 5AG9A 1CDBA 2HT2C 5IMMB 3HZKB 1U41A 3RY4A 2WBJD 2EKSA 1DP0A 5EOQH 4P3CL 5JOPE 2PN5A 3ECBB 2GAZA 2XTJC 1F11A 1I7UB 1IM3B 1OAKL 3G08A 3STLB 3MRGA 4N1EA 2B1HH 3T1FA 5E24E 1B0RB 3MUY1 1U93B 2XWTA 4KI5F 4NN5B 1I9RL 1MY5A 2DQJL 4HV8B 5E2JA 4ZUSB 3VXRE 2AK4D 4OGXH 3WNMA 3ZLQC 1X4XA 2CRZA 4Y2OA 1FDLL 3MV8D 3QDGA 2E6QA 3UX9B 6FABH 3IRZA 2NW3B 2HN7A 5AUMA 5JZ7C 2V2WA 4LSRH 4TNWF 1Z2KA 1A7BA 3L3OB 2ID5A 4ZDHA 5JXED 5DA4A 3P11L 2X4OA 3FHAA 4CVZB 1JWSA 5DHVA 2L7UA 1SJHA 3F62A 4MD4B 4IOIA 4L4JA 4G8IB 3ES6B 1X5JA 1CDCA 4I0CC 4KU1A 4KRMB 4L8SA 4JG0L 1JN6B 4X80H 1TPXB 4FQ2L 5I76A 1DLHB 1T5XB 4NQXB 4YXHH 1MFAH 1LK2B 1NMBL 2IWGA 3D48R 4G8GE 3ZE0E 2OR9H 3BUYA 4YJZL 3LAFA 3WXVH 1WFTA 3X12A 4JGJA 5HYJB 3PNWB 5C0EA 1QQDA 5DO2C 3C09B 4OZHA 2CMRL 2YEZB 1YY9C 2DLTA 3DI2B 5FEBA 3BKJH 1FZKB 4LPCA 5IIEB 3ZHLA 3LKRB 4RNRA 1NUDA 4P2CG 4BFEA 5KSAC 4UIMA 4MWFA 5DQDH 5D1XD 1JTOA 2X4NB 1KFAL 3LH2H 4HIJB 2HWZH 4K3EH 4JQVC 7CGTA 1EEYA 2FB4L 3FZUD 3H3BC 3W0WD 2ENYA 1RZJL 1HNFA 3TO4A 4MDIB 1CTNA 3I2CL 1JF5A 3OKKA 4M6MH 4M61A 1I3VA 1V7NH 1HHJA 5F8RC 1CZ8L 4NGHL 5DSCB 3QA3B 4LPVA 4ZFOB 1C5DA 2J4WL 3BPCA 5DK2B 3AVEA 1G9NH 4A2LA 3FB8A 3VRJA 4NKOB 2DIBA 5IJKC 1A1OB 4YUEH 2WIMA 2A9ML 5D1ZB 3QEQE 4MQXC 3CLEH 1ZGLM 2OL3A 2DJ4A 5GIRA 1BOYA 1A7OL 5IK3B 2E5EA 4GH7B 3HNTH 3MRDA 4ZXBC 4OKVA 1YN6A 4AENA 3OWEA 4JFXB 3U9UB 3ARDA 2JIXA 3FQXA 3OKNB 2FIKA 4NC0B 3RIAK 1OGAD 5D7KD 3P4NB 1MJ7H 5E00B 1WT5A 1ZOXA 2H3NA 5CHNB 3B8SA 3ARYA 1JNJA 3LRHA 1QLRA 4P5MB 5JPNA 5C0BD 2BERA 1JMXA 4KRPD 4RRPA 2XRAL 4XPGH 1K8IB 2IQ9H 3TZVC 1UVQB 4OCXL 4Y8AA 5A2KH 1SBBA 1TJHL 5C6TH 5AWNL 2P5EE 1RIHH 1DBBH 4F7TB 3QEUA 1GGIL 3SJVA 5IMOB 3LPWA 2GY7B 3T0EE 1P53A 3DUHA 1EVUA 1J11A 5F9JB 1RUQL 5GRJL 4PJXE 4HJ0C 4XTRC 4OF0A 4K7FB 2ICEB 3FT2A 3LS4H 5C2UB 1QR1A 3PDOB 2IANA 1S7QB 4J3XA 1LEIB 2DQCH 2F53D 5L0QB 1NLBH 4LARL 3MLUH 3EOAB 2Q8BH 2DQTH 3EJJX 1J8HE 1H5BC 3QUZA 5I2IA 1GCFA 4YHYB 4UAOB 3KPQA 4POYA 4IHOB 4AM0A 4HJJL 1TJIH 4AL8L 4K3DH 3QAZC 2A6KA 5ANMA 2FWOB 5LAXB 1JHLL 3ULUL 3AC0A 4W6XB 2GFBA 4JQIH 3OAZH 3EW3B 1NC4B 2RFXA 4NQED 2B0SH 1YEIL 1VPOL 2BVOB 4YHZH 5ISZB 4DTGH 1DBJH 5EU6E 5IW1B 4PGJA 5CEYB 3IXTA 4PRID 5GRVK 4RAUA 3B5GA 5D5MB 5DYOA 4DVBB 5BRZD 1AQDA 3DURB 4KK8C 1MQKL 1NQBA 1NGXB 3FHQA 5DHYA 2V2TB 4Y16A 5JDSB 3KXFB 3PWPA 4YO0B 1NGWB 4H0GA 3KS0H 3TV3L 5ENWB 1U8PA 3MRNA 5C0CB 3QQ3B 4YHPB 2ZWLT 4EXKA 2EH7L 3MACH 3D85B 3GJFA 4FFWD 3MFFA 3FONA 5JXEC 4APQB 3OPZL 1IGFH 3LN5A 5E5UB 2Z91A 3KHQA 4RGNE 5KS9F 4LLQA 1FLTX 1OF2A 1QFPA 1BQLL 3BE1H 1MVUA 3CC5B 2BHYA 1IZJA 3X11B 4F2MB 2IBZY 3PWUA 4JFYB 1Q9KB 4RAVB 4MA7L 1FORL 5IMLA 2MSPA 4JFFA 1RULL 1OB1A 1VHPA 5E8EA 5KVGL 3DXAE 4JY6B 1QEWA 2QR0B 4D0CB 5KSBB 3WDHA 3IDGB 1AJ7H 1MCWM 2EDKA 2HFEA 2R8SH 3CNKA 3VXSE 4FG6D 4PJEE 2DQHH 5GGSY 1T1XB 4JM2A 4YR6A 4XXDA 3UTSE 3B9VA 4BZ1L 4LDLB 1KB5A 3VFPA 2MQ0A 4XWGL 8FABA 5IQ7H 5D96B 4HBCL 3SDAA 2F54D 1U0QA 2EYSB 3FQWA 5JPMB 5J12B 2A73A 5T5FH 5KW9H 3MRHB 3FZUC 5ADOL 3VW3L 5DRNA 4KKNA 3H0TA 1RJYA 4HC1A 4JLRB 5D8JL 4L8CB 2HTKD 2UV3A 2ZUXA 3FCTA 4ODHL 5EU4A 5AAMA 1J1OL 1RMFL 2UY7A 2D9QB 3M17A 4IBLT 1BD2E 3IDXL 3VWJD 2VDMH 4QHKI 3BSZL 4PRHE 1IQDA 5DK0B 2DWDB 5DJXA 2IPTL 1XR9A 3OQ3B 4OUUA 4L8DB 4ORGB 3VFRB 4KMTH 4LASH 1CXFA 4HUXB 2C3VA 5I1HL 1GRWA 4P2QD 1Q1JH 3GKZA 1XGUB 2VLJD 1N3NA 4HPOL 5J11B 5EO9A 2ZCLH 3GI9H 4PRPE 3SDDC 4MAUL 1DUZA 4L29B 3P9WB 1AIFA 4LKCB 4PJCA 5DUML 5GISH 2CQVA 1FVCA 4N0UA 5AZ2H 5F7LB 2Q86A 2XQBL 3M8OH 3MMEA 5IUSA 4OFYD 3MA7A 4G8FA 2HJKA 4OM1L 1T7YA 3O2DL 3KYNA 3GSNH 5BW7C 4BZ2L 5D2NC 3LKPB 3K2MC 4JRYB 5CJQH 3DX6A 4K9EC 3MNVB 5J56B 3QUKA 1A2YA 4U6TA 3EJYD 4HPYL 1QNZL 2BRRH 1YQ2A 5EBMA 4R8WL 4NM4L 5EZOH 1FG2B 4N5UA 5CMAB 3QEHA 1Q9OB 1T0PB 5E7FA 4I18B 1RFDL 5DUPL 4Y5XB 1M05A 3DWTA 3UYOD 4WU7B 4LBEB 5I0DA 1NCDH 3BN9D 4KQ3H 1F3JB 1DBAL 1N5AB 3VRIA 1FIGH 4PP1D 2P8MB 2C4FU 4X8JB 2AV1B 3ZKXC 3PWNB 1UYWL 1MH5A 3H9HA 4HKXA 2XTJB 4L8BA 1MUJA 1V5JA 2CXKA 2VSDA 3LV3A 4JY4A 1Q0YH 3BEVB 1DJSA 5ETUA 1F4XH 3MO1B 5C07B 3HI6L 4JDZA 2E9IA 1LP9E 1JRHI 3HZKA 4YHMH 3GEWB 3R0NA 5IB4B 1T7XA 4E41E 2CKBH 3ECBA 4UINH 1NPUA 4OSUL 5DMIL 1I7UA 4X6DE 1IM3A 4DK3A 1X9QA 4LNRB 3STLA 3O6LH 2JCCE 1B0RA 2J5LC 3RA7H 1U93A 4HV8A 4FQJL 5CWSB 4ZUSA 4BFIA 4F3FB 4PLJD 4U1LB 3RDTB 2W0LA 2ZUYA 4DW2L 4PRBB 2WZPD 3L3OA 3QIUD 5JHDE 2I60H 1Z9OA 3CPLA 1XGRB 5C0FB 2R69H 4HEPG 1H3XA 4CVZA 4EEEA 3LIZH 4LCWD 2D0HA 3ARFC 4MD4A 4LDOB 2R1YB 5KZCB 4Z77B 1A6UH 4G8IA 3ES6A 2IH3B 1BWWA 1RZIB 3SO3C 2X4PB 3H3PL 4NHCL 1BGXL 2P5WE 4YPJA 1JN6A 3CVHB 1DLHA 1T5XA 3HTLX 4NQXA 3WIIL 1JGLH 1LK2A 5KSAB 1NANI 1G6RL 3SKUD 1P5VA 3GSWB 3WEXB 2W9EL 5D7LD 4LVEA 3CJJA 5HYJA 3P3YA 3PNWA 2YEZA 1N59B 1NL0H 1QLEL 4AJ0A 5C71A 3DECA 1YEEH 1FZKA 5IIEA 2BNQE 1CU4H 3LKRA 4LHUD 4KC3B 4P48A 4NKDB 1E4KA 4GRLC 2X4NA 2I24N 4HIJA 2FHFA 3C2AL 3LS5H 5C9JB 2B4CH 4NQTA 1UM5L 1OSPH 1DLFL 1XCQB 4R7DB 2N4IA 1T2XA 4MDIA 5DZNA 4P0DA 4X7FC 2QHLA 4OLZL 2XIDA 3NH7L 4WFHE 1KXVC 5DSCA 5FUCC 4ZXBB 3QA3A 3DRTB 3ZKNC 5HY9B 4ZFOA 1P2CB 3ARQA 5DK2A 1WFNA 1VFBB 4XPFL 4NKOA 4ZFFB 1QYGL 3FB5B 4Y5VC 4DGYL 2NNAB 1A1OA 1FGNL 4KVCL 1YJDH 5D1ZA 1SHMA 1EEQA 5IK3A 4NJAH 1K9TA 5IMKB 1KXQE 5EDXA 3AAZB 3ZZ1A 4KTDL 4JFXA 4ODVL 2X4SB 3OKNA 3TZVB 3BIKA 2DYPB 5DJ2B 3P4NA 1V7MH 2X1PA 5E00A 5J1AB 5CHNA 3CFIC 5GGTA 4OD2B 1T03H 2FJFB 3ZDYE 1X5ZA 1T89C 2YA2A 2CJUL 3LKQB 4P5MA 3FN0L 4GO6B 1NCBH 4KQ4L 1IGCL 1K8IA 4MJID 4FXGB 2AEPH 4J6RH 1UVQA 4HUUB 5CD5D 5GJSL 4D0DB 2A1WL 4F8QA 1HN1A 2NYYD 3MRRB 2BDNH 4LP5A 4F7TA 3KPTA 3IU4L 4J3TA 4C56B 1JGEB 3BT2H 5F9JA 3O3DB 1H5BB 4WI2A 3TWCH 3G04B 5EU7E 4RFOL 3SE4C 3VFMB 43C9B 4G5ZH 2ICEA 3QAZB 5C08E 5C7XH 1INQB 1WBXB 5E99L 1EPFA 3PDOA 4MJ5B 1S7QA 2VXTL 1F90H 2YD6A 5L88L 1IAIM 4XPTL 5E6IC 2X2YA 4JFED 4XH2B 2VLRE 3EOAA 2EKJA 4PTUB 3RAJL 2Z92B 3KJ6H 1NC2D 3AU1B 3K7UA 4IHOA 2FBJH 2BNUB 2FWOA 4PJAE 5LAXA 1I7ZB 1NEZG 1FJ1B 1MVFA 2K7QA 2MPAL 2BVOA 5ISZA 4FRWA 3RWIB 1TFHA 3TPUB 5IW1A 1KB9K 5IWLC 5CEYA 3UTPD 2DWEB 1AKJB 2VDLL 5GGQL 4Q0XH 3G6JF 5D5MA 5FYJE 4DVBA 1OAZH 2OQJB 3DURA 3T2PA 1LDPL 3MV7D 4WEUD 2V2TA 3TCLB 5JDSA 1P4IH 3DOSA 5IVXE 4KJYB 4PLJC 4ZOCA 4YO0A 1NGWA 1G1YA 1UGNA 5ENWA 2DL9A 3MSPA 5IHUH 1LEKA 5C0CA 4YHPA 4F15C 1J05B 3LEVL 5CJXA 4HCRA 3D85A 5CUSH 3QHZH 4EN3D 5LGHL 4NM8L 1UWGL 1PG7X 5CJOL 1DEEB 3HFML 4XVUC 4APQA 1OCWL 4N0CC 3QXAB 5IT2H 3Q6GL 4H25B 2EDOA 1FFPB 4OAWB 1FNGB 3NA4A 5DWUH 1ZT4B 2ZNXA 1EUUA 1NCAH 5H8DA 3FQNB 5EWIL 3CC5A 3OAYH 4ZTOL 5BVPL 4WW1B 1IBGH 3HUJF 3X11A 4F2MA 4LPYA 4Y4FD 1F42A 4OI7A 1PJ9A 4TNVF 2EE2A 1Q9KA 2W07A 4JFYA 4RAVA 3VFUB 1JL8A 5KG9B 4NQCD 3HR5B 4H26B 3LHPL 1FFNB 4IRSC 4LSTL 4PIRF 2VDQL 4JY6A 4D0CA 2QR0A 5KSBA 4KZDL 1TCRB 1W72L 3IDGA 5B4MD 4PJ7B 3WKML 3I9GL 1JVKA 1JV5B 2QHRL 1T1XA 5MENB 3BO8B 4FP8H 2E7MA 2CLZB 2VSCA 5HPOA 1C08B 1NFKA 2P45B 4ODTL 1AXTH 5ESVB 2EYSA 4PJ8C 5FO9A 3DUSB 4M4PA 5JPMA 3CZJA 1DUYA 3FN3A 4FQHB 5BXFB 2DKMA 1UM4L 3MRHA 1V8HA 4JLRA 3HMWL 3U0WH 4W81A 4L8CA 4XP1H 3ZMRA 5GRWA 1YEDB 1A3QA 2B39A 4KJPD 1A14L 5T1KB 5D71H 3SDDB 1S5IL 4CGTA 3AS1A 1KCKA 5DK0A 35C8H 2DWDA 4JO2H 4L3EE 3RJDA 1C1EL 3O4LE 3OKMB 4MNQD 3KS0J 1QUNA 2DQGH 4KJWC 4L8DA 4ORGA 3VFRA 3LD8C 4JDTH 2X7LB 2BZDA 4HUXA 5C70A 2SEBB 1XGUA 3DTXB 2GI7A 3OTTA 5EOTB 4PYGA 1CE1H 3LZFH 3MCG1 4JKPH 4LKCA 2V6HA 3GBLA 3PDDA 1CDHA 1YDPB 2BC4B 2DTMH 2VQUA 4TVPH 2UZIH 2O5ZL 4UBDD 3RVTD 3VFOB 4CJ0A 3UTOA 1SMOA 2F74B 2R0ZH 1A7RL 4LLYB 4Y1AE 1ZEAH 2QQQA 3FFCE 4RGOL 1JPST 5F7YC 5GZND 4QRPD 3O2VL 1MY7A 2W38A 3LKPA 2ZZUT 4XT1C 1RUAL 3MNVA 3LEYH 2VZ1A 1UFUA 3KLHC 5HDQH 1WCQA 2ATKB 3U79A 4ODSL 5I18H 4OZGF 1ZVSB 4X7DC 2CLVB 1FG2A 5CMAA 1Q9OA 2MQ3A 1QSZA 4I18A 3F58L 4Y5XA 4P3DB 4LBEA 4GXUM 4WY7L 5MP6H 2Q8AL 1ZLVK 5IQ9B 4GKSB 4LRNH 1F3JA 1N5AA 4M1DH 4OCRH 4PY8I 3O0RH 4ZNEE 3QH3B 2P8MA 4U7MA 4F8TA 1YNKL 2AV1A 3LPGA 3GHEH 4ZFZB 3PWNA 4BQ8A 4OD3H 2ITCB 4KKAD 5C3LD 4AEIL 4A6YL 4Q9RL 1VFUA 3BEVA 1GGBH 3MLTB 3MO1A 2J5LB 5E2VH 3IS0X 5TE6L 4I0PC 4I13B 3P0VH 1FLRH 4N5ED 2WP3O 1PY9A 3P4MB 3V7AG 4OTXH 4HG4J 5C86A 4P57B 2EDBA 4NSKB 1LNUB 1S5HB 4LNRA 3GJFH 4G6ML 3UTTD 4OZFG 2FEDC 2XN9E 4D3CL 1P4LB 1MEXH 3ARBC 4Z7VF 3ULUD 3ARFB 1F6LL 1BIHA 4F3FA 1AO7E 4U1IB 2MHAB 2V5RA 4G7VL 1RURH 4U1LA 4PD4K 4PJFB 3RDTA 4PRBA 3SO3B 2WINB 3WFEH 3LKSB 3GMPA 3U7AA 3ARVA 2DTSA 1XGRA 1B4JH 4JFHD 5C0FA 3T0EC 5IEHA 4JG1L 5DD6B 4UIKH 1TETL 5KSUA 2AJYL 1U3HC 1RIUH 4ZO6A 2DN7A 1W72B 4Z77A 1HXMB 3VH8A 2E7BA 3HZVB 2IH3A 1RZIA 1U6AH 2X4PA 1HZHH 1LO2H 4OF3A 1U92B 4CNIB 4Y4FC 1I1FB 3CVHA 3GSVB 2EEAA 3U7WL 5KOVC 5KSAA 3CVIH 4GRLB 3GSWA 1WWAX 4PJ9C 3WEXA 1ADQL 5KS9E 1KB5H 1MI5D 3WUWG 4U2ZA 4CW1B 2YMXH 4JQVA 1T0NB 1N59A 2DLFL 4HS3B 2B8OT 4K3HA 3QCVH 1KEGL 3MLXL 4BSJA 1A6TB 4YHIA 4Q9BA 2FBOJ 3OJDB 1D5BB 4PBXA 4NKDA 2GYSA 5SX5H 3F65A 4UOJA 5C9JA 3ILPB 1MF2L 1WC7B 4KAQH 2DQUH 3I02A 2AJXH 1ORQA 1XCQA 1MHCB 4R7DA 4Y5VB 5IJKA 2VL5B 4PJGF 1OP5K 3U4AA 4OCSL 3WMSA 4ELMF 1JRHH 4PGCB 4WFFE 4LPXA 4WO4D 5HDBF 4ZXBA 1UJ3C 3DRTA 4C83B 5HY9A 1P2CA 3J7HA 1VFBA 2XV6B 3BPLC 4P2OA 4ZFFA 3FB5A 1OW0C 3ARPA 2NNAA 3HNVL 1GGYA 1OQOA 1INDL 2AGJL 5IMKA 4RMQA 3AAZA 3LEXB 3D0LB 5TF1L 2X4SA 1I85C 2E27L 4TSAH 5KAQG 3TZVA 4OQTL 2DYPA 5DJ2A 2IQAB 4Z76B 1BZ9B 1OPGL 4D9QE 4KK5C 5J1AA 4UBDC 1XF4B 2BVQB 4OD2A 5ICXB 2FJFA 5SWSE 2B2XL 3LKQA 2OBGA 5J6GB 1JGDB 4OB5H 1KYOJ 4ODXA 3EO9L 2LFGA 3AUVA 4FXGA 5KN5B 2W9LA 3I6LD 1MHEB 4HUUA 4P2OD 1X4YA 4D0DA 3V9FA 2ADJB 5C6PB 2AJVL 1M71A 2YRZA 3MRRA 1BWMA 4X5XB 1CLZH 1NANH 4GSDH 4FTVE 4PLOB 5DHXB 3HE6C 2YPKB 5CBEB 5E6IB 4C56A 1JGEA 1M7XA 4A6YB 1AR1C 3QI9D 1NMAH 4OLVH 1Q0XL 4NBZB 2CD0A 4JGUA 3Q1SH 3AM8C 3O3DA 2OS7A 4V1DD 3G04A 5HHMB 3VFMA 1T22A 43C9A 5EUOB 5J7CC 1INQA 1WBXA 3V6FB 3IJHB 2QQNH 2VZUA 2AXGB 1MFDL 1JTPA 3A0OA 3VWKD 1BM3L 2HKHL 4R90L 4XH2A 2NLJB 4MD0B 1RUKL 2ZG2A 1ZHBB 4FNLH 4LEOB 1ZHNA 5C0RH 4PTUA 1IL1B 3BGMB 2Z92A 3VJ6B 1IRAY 2BNUA 4JKWA 3HC4H 2AJZB 5E9DE 4P9HC 4X6BB 1I7ZA 3KAAA 1FJ1A 4K7PX 4F15B 4OI9A 4QT5A 3PQYE 1CXIA 2VB5A 1F8TL 1AFVL 3RWIA 4X83A 3TPUA 2VL4A 1A6PA 2DWEA 1AKJA 1P5UA 2YPVH 3IS1X 3VA2C 5I1JL 4KZEH 4L4VB 2OQJA 1UXWB 2NY3D 5IROC 3EZJB 4BSWA 2OP4H 3TCLA 2A77H 5KVFL 5C3TA 4KJYA 1X5AA 3QR2A 4G42B 1S9XB 4PYHA 3DYMA 4ZS6D 4X9HA 5T5NF 4U1SB 1Y0LB 3MYZA 2CLRB 5CFHA 3MV9D 5I1GH 1DEEA 1YQVH 2IEPA 1QRKA 3QXAA 4P9ML 5D2LB 5DJCB 2GK0B 4H25A 2GQHA 2DQEL 4JN1L 3VXMD 1FFPA 1WISA 4OAWA 1FNGA 3QDJD 4I2XE 3JUZA 1UWXH 1ZT4A 1JGVH 3OHXB 4IRSB 2KZ1B 4MB5A 1YEFL 3GNMH 2HA1A 1F4WL 4WW1A 3R8QA 1JE6A 1W0YT 4YX2H 5ESQB 4K3JL 4NO2B 3VFUA 5KG9A 3HR5A 1FGVL 3HN3A 4Q6IC 1L7TH 1RZ7L 4H26A 2AI0H 2Q7YB 1FFNA 5DVOA 2DLGA 4LU5H 4PJ8B 3WNOA 1F4HA 5JQ6H 3EYQC 4G3YH 4KGJA 4PJ7A 5FYLD 5MEQB 3VXTB 5L7XH 3RGVC 1OAUH 5HGAB 3S36H 1JV5A 5B22A 5MENA 3BO8A 5CZXC 4GG6E 2V5MA 5F7EH 4DWHA 2VLME 2CLZA 1HCVA 1C08A 4J12A 1MRCH 1CXKA 4JQXC 4BQBA 5ESVA 4PB0H 4YHKH 3DUSA 1ORSB 4FQHA 2R1WB 4IDLA 5BXFA 4FFZH 3LD8B 5FHAH 3DO7B 1KGCD 5BO1H 3C5ZC 4LCIL 4WO4C 5T1KA 2BJMH 3FO0H 3SDDA 1WUNT 4RSVA 4DUVA 4UT9L 3UBXB 3QPQD 3OKMA 2J6EL 4PB9L 3RVVD 3IAGC 2X7LA 1A6AB 5SWQB 4QTHB 2SEBA 5GGTH 3DTXA 5HHVL 3SDCD 3TBYB 5EOTA 2OLDA 3UAJD 2X5PA 5BW7A 2EYRB 4O4YL 1AGBB 3DROB 3N06B 3UTQB 4MJIB 2BC4A 5CILH 2OM5A 4TRPH 4HT1H 1SBSH 4HBQA 3VFOA 2F74A 4LLYA 4A2MA 5E6YA 4JRXE 2CIKB 4M1CC 1KIRB 3O4OC 1CK0L 5F3BA 4K8RD 2RIKA 3AY4A 3ARED 4I9WE 3ILQD 2P8PB 5DD3L 2ATKA 2DM3A 1PBYA 5I73C 2KDGA 3QEQB 3BMWA 4P3CH 1ZVSA 1QBBA 2CLVA 4UZGA 4M7ZC 2JE8A 3BYTA 4FQLL 4KK9D 1FE8L 1OAKH 1JHTB 1MFCL 4P3DA 1TVBB 5IQ9A 2VIRB 4GKSA 4I0PB 3S9DB 5GRYA 1I9RH 4X6CF 2DQJH 2YK1L 1N5YL 2XKSA 3AXLB 1FDLH 3QH3A 1XCTB 3E3QE 1LO5B 4WW2C 4ZFZA 1ZXQA 5ILTL 4NPYB 2W65B 2R4RL 4HSQA 3MLTA 4XAKD 3P11H 1A5FL 3ARBB 1QPPA 4U4BA 4DEPC 1C7SA 1F3DJ 3P4MA 4PTTB 5DVLA 1MAJA 4P57A 4NSKA 2HJLB 4JG0H 1LNUA 1S5HA 4CRPA 4Z7OF 4FQ2H 1EV2E 3T0EB 2YZ8A 4K3GA 1QFUL 5FGCB 1LD9A 1FSKC 3ZE2F 2BHZA 4DGIL 4X6EB 1NMBH 1P4LA 2DB8A 2PNDA 1PFCA 4IM8A 1U3HB 3ARFA 2MHAA 2EDYA 2NW2B 5BV7L 2NTFB 4QRTB 4PJFA 1LDSA 4JFDE 3RPKA 4XC1L 3ZTNL 2WINA 1RAMA 2CMRH 3LKSA 2IC2A 1IM9B 1DN2A 5IFJB 2HLAB 2ITDB 4QXTB 4YEEA 2BOBB 4NRYA 3S6CA 4MVBD 3G6JE 5DD6A 2CR3A 3DX8A 4PJ9B 4Y5YC 1KFAH 3PE9A 3FO1B 1W72A 1H3PL 4M7LL 1ODAA 1HXMA 3HZVA 5F89B 5I71C 4KFZC 1U92A 2FB4H 4RGMC 3TIDB 4CNIA 5C0AE 4S1DD 4RWYL 1I1FA 1RZJH 3SOBL 1HH6B 4YK4C 3I2CH 3KWWB 1G1CA 5JXAH 3GSVA 2EIDA 2LU3A 4LHJB 4GRLA 3OB0K 3ARTA 1CZ8H 4NGHH 1IGML 2VWEE 1BFSA 2J4WH 4XBPB 3RBSA 2ZKHL 1VFAB 1EFXB 4CW1A 1T0NA 4Z5RB 2ED8A 2YD8A 4HS3A 2HMID 4LRIC 1QPXA 3UEZA 1A6TA 3QWRD 5EPMB 1QFOA 2C3GA 2A9MH 3OJDA 2YD7A 1D5BA 1K2DB 1A7OH 3K81A 1ZLSL 1UJ3B 4MXQC 2DF3A 3C8KB 3C8DA 3ILPA 1WC7A 1I9IL 3LRSB 3ZYIA 3TO2B 1MHCA 4Y5VA 1ETZB 2VL5A 2VXSL 3CFDB 3I75B 3RWJB 4QXWA 3WHE1 1NDMB 4PGCA 2YPLB 4L4TB 3C60D 4XB8A 3B6SB 4F57L 4C83A 5IFHL 2XFXB 1RPQA 4QWWD 1PDKA 1X5LA 2EXWD 4KI5C 4X5LA 2IBGA 3SCMC 2XRAH 3HKFA 3DXAB 4LLUB 2VN4A 4JVUA 4OCXH 4FN0A 1FYTD 5IVOA 2Y6SD 3SJVE 1TJHH 5AWNH 2JB6B 3VXSB 1R0AL 4CU6A 1T89A 3TJHD 2A6IB 4NQDB 1GGIH 3LEXA 3NCEB 5HPMB 4YZFF 1IJ9A 5E03A 1N7ML 1RUQH 3TBWB 5GRJH 4QRRB 4Z76A 1BZ9A 3B9DA 2V5SA 4PV9B 4XNZC 2HH0L 1EO5A 1XF4A 2BVQA 2D31B 4JR9L 5ICXA 4NZTL 2NX5E 5JW5B 2PO6C 3HE6B 3VD4A 4GT7A 5J6GA 1JGDA 4LARH 1BD2B 5KN5A 2F5BL 1CCZA 5ANME 3CFBA 5SV3A 1MHEA 3SE4A 5C0NC 2P48B 1SEQL 4R3SA 3GHBL 2VAAB 4HJJH 1TZGL 4AL8H 2ADJA 5L2KB 2ICWJ 1FC1A 3ULUH 1JHLH 3IETB 4X5XA 3WUWB 3NIGE 2LTQC 2YPKA 4Y4KC 5CBEA 5E6IA 1XF2A