2ZOWA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
total genus 38
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2zowA00
1E9OA 1SXBA 4N3TA 1IBDA 1QUPA 2Z7ZA 1F1AA 1OALA 1TO5A 3GQFA 3PU7A 4U4IA 1BZOA 1MFMA 1SXCA 1SXNA 3GZOA 2XJLA 1SXZA 2ZKWA 1U3NA 3QQDB 2R27A 1CB4A 2Z7WA 3MNDA 3ECWA 1CBJA 1B4LA 3GZPA 1YAIA 2GBTA 1KMGA 2E47A 1SDAB 4B3EA 4MCMA 2WYZA 2WWNA 4N3UA 4MCNA 2C9VA 1JCVA 1E9QB 3KM1A 3CE1A 1EQWA 3HW7A 2WZ5A 3ECUA 3CQPA 2AQTA 2Q2LA 2VR6A 2K4WA 1JK9B 1SPDA 1SRDA 3QQDA 1SXAA 2LU5A 5CU9A 3H2QA 4A7VA 2JCWA 1YSOA 3KBFA 2AF2A 2E46A 2V0AA 3K91A 1IBHA 4FF9A 1SOSA 1IBFA 3KM2A 3S0PA 4A7UA 1YAZA 1E9QA 1HL5A 1N19A 2AQQA 2SODB 4OJAA 3KBEA 1HL4A 1Q0EA 2Z7YA 3KH3A 3SODB 2ZKXA 2WZ0A 2XJKA 2AQRA 1PZSA 3HOGA 1JK9A 2AQPA 1Z9PA 3CQQA 4OH2A 1BA9A 2VR8A 4A7GA 3GTVA 1UXLA 3H2PA 1DO5A 5KBLA 2C9SA 2NNXA 3MKGA 2AQSA 1F1DA 1F1GA 3RE0A 4A7QA 1F18A 1COBA 4BCYA 2WKOA 4A7GF 4A7TA 5KBMA 1PTZA 3HFFA 3L9YA 1RK7A 3T5WA 1L3NA 1PU0A 1OZUA 2AQNA 3GTTA 3GZQA 1IBBA 1TO4A 3F7LA 3LTVA 1FUNA 3F7KA 1XTMA 2WWOA 1E9PB 5KBKA 1S4IA 1XTLA 1DSWA 2GBVA 2VR7A 4A7SA 1SXSA 2GBUA 2WZ6A 4BD4A 2WYTA 2APSA 2ZKYA 1EJ8A 3ECVA 2AEOA 1ESOA 2C9UA 1E9OB 3KH4A 1AZVA 1UXMA 1SDYA 1XSOA 1OZTG 1OEZW 1P1VA 4BCZA 1B4TA 1E9PA 1IB5A 1OAJA 2ZOWA 1Z9NA 4L05A 2Z7UA 2JLPA 2WKOF 3L9EA 1N18A
chains in the Genus database with same CATH superfamily
2DLEA 1E9OA 3QI9B 4CN6A 1BVLA 1GTFA 4LSPH 1BECA 2UVEA 5DT1L 4I3RH 2G75A 1BQLL 4U1NA 1U3YA 1U8HA 4JM2B 1S7QB 3LH8A 1QD0A 2X0UA 2XXCB 2FJGA 3AREA 4PRHB 1LXMA 3EW3B 3HMXA 5AVWB 2B1AL 4DPCX 1PKQA 4WSKA 3STBA 4RAUB 5DHVA 1ED3A 1CGUA 3W81A 1OAZH 4ZXBA 4QKXB 4YHKH 5IG7B 2D9QB 1BXAA 3KWUA 5EBLB 1SJHA 3V0WH 3PP4L 4OZHB 1CN4A 4MQ7A 4ECNA 4NSKA 2C4XA 1E27B 1OW0A 3VI3F 5ES4B 1UJ3A 1FNAA 3VGHA 4AJ0A 4LIQE 2M26A 3SCMC 3S3BB 2MPVA 3MUHL 4H44C 1U8KB 2YC1B 1G43A 4IW4C 1MLBA 5CF3A 2VDKL 3MGTA 3MV8D 4TQ8A 1LMKA 3NZHL 3G6AA 3UP6A 1E28B 3KLAB 1CIDA 3AB0B 1WC7A 4ALAL 5DI8A 3MNVB 4X6FB 1DE4A 1OVZA 2ITFA 5L9DH 1R3LB 3UG5A 4FHJA 1M9SA 2QSCH 4K7FA 1ZS8A 5CR8A 1BGXL 5DEFB 2ZUVA 2WD0A 4HBCL 2Z92B 4ODSL 2FECI 3DETD 1URLA 2BNQD 5TD4A 4XHJC 1QA9B 1L9TA 4MSWA 4PLKD 1S9YA 2XQBH 4ZS6C 4NO5A 3UEQA 1KIRA 3NPZB 3LH2H 1CLZL 5SX5K 1T6BX 4EN3A 5HXMA 4PGDA 3AAZB 3O6KL 4ZW5A 2HWZL 4APQD 3Q8EA 3C75A 3FCGA 1VLXA 3MLTA 1RIHH 3DX8A 3ZSTA 5KSAB 4JFED 2VR4A 1UYWL 1PYWB 4WHCA 1CR9H 2D7TH 5FYJD 2WUBH 1T3FB 4NUPA 3MGAA 4YWGL 3N42B 1FL5B 4LKCA 1ITCA 1KG0A 3PCYA 2C9QA 1T22A 4GKZA 1BD2D 2DI9A 2A1WH 1OGAA 1QUNA 1MW2A 3EJRA 4BQ8A 4ZDHA 5JDJA 2ED7A 4JCLA 5ICXA 3G6JB 3DRQB 1U8CB 4BFEA 3BAEH 3LZNA 5FHAH 4EUPA 2CKBA 1KJMA 3PGFL 5KBDA 2J1KA 1QWUA 3MLSH 3SDCD 2CE6A 3RWDB 1KFGA 1OP5K 3NAAH 4XBPA 4NT6B 1E8YA 4MDJA 2ATPB 1QHOA 1MJJA 4FI6A 1KEGH 4DHLA 3W82A 2J1ZA 5I0DA 3GBML 3C08L 3VXSE 3MBEC 3CU1A 3D87B 3WDIA 1SXZA 2DQFB 4P59L 3CHSA 1B0RA 3X1GA 1OOWA 2IG2H 2RB8A 4LPUA 5E2JA 1U8OA 5IROC 5C0EA 3N85L 1TJGL 1TU2A 2J7LA 2B5IC 3NZ8B 4TUUA 4ZRGA 1XIWB 3SE9L 4L23A 4ABWA 4B3EA 4PGEA 1KWGA 3HC2A 4Q6KA 1FJ1A 1BG1A 4CMMA 4NC1C 4M3JA 1F0LA 4S10A 3KM1A 1TMQA 3NCYP 3OLEA 2DLTA 5F3HB 1KCUL 4Y5XA 2UWEB 4G9FD 3RBGA 3L5HA 3QORD 4DGVH 1KGIA 3ILEA 4BKLB 3T2PA 1O6SB 3MJ9A 4OZIB 5JNYA 3GI9H 2XQYA 3IXTB 4Z3GA 4P3DB 3M1BA 4OVVA 2O26U 4OGYL 5DFVD 3S4SB 1AC0A 7PCYA 1GJIA 3R1GL 1QTYT 2A74B 2D7PA 5I0XA 1MCFA 4B9FA 3MLWL 2COVD 2R29L 1LK2A 3GMOA 2E9BA 4PJHE 2AV1B 4LSRL 5E4IA 3G5ZB 4JO2L 2EH8L 4RNRB 3VTTA 3IWVA 3I6KA 3AREC 4MKMA 5LHDA 1X44A 2DQ6A 3GI8H 4FTVD 4KO6A 3ZZLA 3S8FB 1Y0LB 3SGEI 4ZXBC 2QVFB 4X5QA 5JXAH 3GPSA 1Q0YL 2UZXB 4YSSA 1LEKA 4U49A 3IDXH 2PMZA 1XB3A 1OW0C 1NCDL 1LGVA 5I6XC 1UJ3C 4BQ6A 4XNXL 5I8KL 3DHUA 1PFCA 5CSZA 5ID0B 1YY8B 5GS2H 4PQXA 5KVGE 3OKNB 3FO0H 1F6LL 5MEOA 5I71C 3BIAX 4AE1A 3AMLA 5JQ6L 3WV0A 4YFLF 1FBIL 2KI6A 4GSUA 4Z7NB 4HXAL 5L0QC 1W2KT 3DX7A 1R5IB 3FZUC 4FFZL 4N2BA 4KQ3H 1EFXD 2KHAA 2R0ZL 1OGSA 5I1GL 4L3CB 4N86A 3CVHL 1E2ZA 2FK9A 3N41B 5DEFA 1J0IA 5D2LE 2VZSA 3VFWB 1JV5B 1S46A 2UXTA 4JO1L 3TH2T 4EF3A 2Z4QA 4Y4HB 1XGUB 2JLPA 1QA9A 4G1EA 3B7YA 4KH2A 5D7KE 5IBLC 4ZFFB 2ICEB 3V4VA 3N40P 1B2WH 5IJCC 1A6VH 3RZCB 4XCYB 1A47A 4NCC2 5KSBA 3FUNA 4R4ND 2FE0A 4PAZA 2CK2A 1N70A 3VRJB 3QNZA 4UTBL 5CCJA 3R06A 5IBUG 1IQWH 3OG6B 3L1OH 5HVWA 4LOUC 3ULAB 1B4LA 3BZEA 2WVUA 3GMRA 1FNSL 8FABB 2ODHA 2FT6A 2OJ1A 4LLQA 4XNBA 4QHLA 1HEZA 5EIIG 5F71A 2E59A 1GGCL 3VCLA 4XC1L 4V2BA 3PWPD 3OAZK 4WTZG 1AQHA 1BM3L 2JKJA 2R1XB 3QEHB 2CH8A 3BJLA 5I19L 3CK0H 1J7VR 1AS7A 2GY7B 3MQIA 1T6WA 3PS6A 2D0FA 1PIGA 1YJDH 3LKQA 3MFFA 1AP2B 4QRSA 4QR7A 4LOEA 1L6ZA 4FI8A 4HJGA 3B1TA 3V5KB 3ZYIA 4YXHH 3C60A 5C0AB 3REWA 3DRQA 4MS8C 3KPLA 4NBZB 5B3JE 2J72A 4KJPD 4PYHA 4JMXA 3RVVD 4QRFA 3T9WA 4RMQA 1KC5L 4QF1A 5HDBF 5FUCC 4U6XB 4WJG3 3SODB 2YPVH 4X4ME 2OXGB 5KBNC 2Z93B 5DJ0A 3FUFA 1RU9L 3D18B 2V7NA 3B2XA 4ODHH 1AHWB 4G42B 1EAJA 4OTXL 1ZLSL 3UYRH 5FKAA 5DR5H 5TE6L 4Q6IB 1WEJL 4J3OD 1J1PH 4WAFA 3H3KA 3LRLA 1FRGL 1NCNA 3R4DA 4P99A 1V7MH 4PJFB 3MRLB 4KTEH 1PZ5B 3PV6B 4QPEA 5CINL 3WY3A 1X5KA 2Z4TA 4PGCA 5JLZB 4KY2A 4KZ0A 4L1HA 3VXQB 4IRSD 4UAOB 2IWEA 3V4LA 3FUHA 3U4EA 5C92A 1AMYA 2PP9A 1JXJA 4LRIA 2WLHA 2AAVA 1ADQH 4OZIA 2D9CA 4J28A 1H9DA 4HDIB 1KB5H 4K94H 2G5UA 3IU3A 2EDHA 3O4LB 4N8CL 1JYWA 4NBXB 3BYYA 4W9DC 2OZ4H 3A0OA 4UNVA 1FAIH 2B14A 3ARWA 3GSXA 2UUDK 4FNSA 4M3KB 3RP1A 4BZ1A 4K8RC 3KZ8A 1SYSB 2WLIA 2P5WD 5E4AA 2XA3A 1AKPA 4GAGL 3AC0A 2J8UE 4JM2C 3KLDA 4PJ8D 4MA8H 2NY1B 3MOBH 3H6JA 2FHBA 5AG9A 1MUJA 2CPUA 3O2WH 2XWJA 1NANI 3NJXA 3TNNA 3HFML 2ZPKH 4HUCA 2C9AA 4LEEA 1Z66A 2EE0A 3DJTA 1TCRB 5EC1B 3EJQA 4N4YB 2F53E 5C09E 1TFHA 3MN8A 4OGXH 1Y6MR 4LLDA 1Q4NX 4HUUA 3FDWA 5E08H 2QTEA 2Y9RT 4YGVA 1CMOA 4LFHD 3RWEA 3O11A 1NC4A 4HCRH 4OY9A 2MCMA 5B8CB 5ERWA 3OL2A 1ZTXH 2WYZA 4ZTOL 3Q8CA 3T4YA 4D8PA 2ZF8A 5I23A 3J07A 4X5XA 4XMTA 2G60H 3U4AA 3BKCH 1GHFL 5ANHA 3VW3H 2Z3FA 1GYWA 1R5IA 4Z0XB 4QRPD 4AYBA 4KTDH 2OL3L 4E9TA 1B4JL 2IIJA 2PO6D 3H2QA 4LSDA 1DLHB 1YSOA 2E46A 4PJ5B 1MCPL 1KLUB 1BEXA 1K5NB 5GSVB 3OQ3B 3Q6FB 4WGWB 4RIRA 3V4PB 2CWRA 4A2DA 1MNUH 4PP1D 3K5SA 3LOWA 2ERJC 1A9EA 4P57A 4ZQTA 5B39A 4NOBA 4ZFFA 4F8QA 4U0RB 4PWJA 4E41A 4Y19B 4PRNA 5DZJA 3CFEA 35C8L 5K9KB 1RZQA 1ZGLB 3VSTA 5EUOB 4XZUB 2AI0L 3MV8E 2Z31B 4AEFA 4JHVA 5DGRA 1B9KA 3I6GB 4GQ9L 5C3IA 4FCHA 2OZNA 4Z7UF 3ZKMD 4S0SD 3CLFH 3CXDL 4BFRA 4G6MH 4HFUL 5BS0B 1ZHKA 4J12A 4UANA 8FABA 2VSMB 4PJEF 1HX0A 4H40A 5I1HH 3GKWH 2B2XH 4QRTB 3RZWA 1H5BA 3LNDA 2DAVA 4WI0B 3CZFB 3MV01 2BNQE 3N0PB 1IM3D 1OGPA 4S2SB 2GYSA 3DROA 3FH7A 3RU8L 2R1XA 4M00A 1FVDA 1YUHA 3C60C 4UDTB 5HYFA 3HI1B 1G7QA 3LRSB 4N90D 1P2CA 1AD9A 3UJIL 1RZ8A 1AP2A 4FQIL 1SEQH 4HLEA 1A7QL 1MI5B 3FO9B 3ZSSA 3MV7A 2MCAA 4MB4A 4TQEH 4OFVA 4C83B 2J4WL 2BIPA 4X6BB 1IVLA 4PVLA 4RGOL 3M1CA 4JFEE 4JM4L 3ZHDA 2DQDH 1T0NA 4IJ3B 1SGKA 3BAKA 2KZKA 4YSPA 5JXEC 1AR1B 1TEFA 5FYJE 2XIDA 2F0CA 3TPUB 3VD4A 3PHOB 2X42A 1G0DA 4YHOH 2Z93A 2PETA 2ZAGA 4O02B 2DQGH 4XXDA 4E42A 1KTBA 1WDAA 1BVZA 3WIHA 1M2VB 2V9TA 3ASNB 2YXFA 3I2CL 2SEBB 5BJTB 3AS1A 3V7AG 5C1MB 3PY9A 1Q9OA 3DRTB 3MNZA 5HVGB 2YPKA 3SGDH 2C1PA 4FXLA 5KVEL 3UTTB 4YFEA 3D2UB 3NGBB 4M1CD 4Y4KB 2WYIA 4G1MA 4XCCH 3QHZH 2DI8A 2ARJB 1NTDA 5DJ6B 4LRIC 3WEMA 5I30L 2RQ8A 4BCXA 5JLZA 1CIUA 4J3VA 5I15L 3IB4A 2COQA 2WSDA 1XEUA 3TWCL 1M56B 1ZHBA 4WHYH 1TVHB 1VACB 3QWNA 4FQCL 4NQED 4PYGA 3J27A 1NGQL 3APCA 3DX6B 3BKYH 5E70A 3T1WA 2R15A 4I77H 1OAQL 3O9WD 1S7RA 4Y16B 1HYSC 1DQQB 1JXGA 2ESVA 2RIKA 3KPTA 2WCPA 5IMOB 1AXTL 1BWWA 4YDVB 2QQNH 5IHHA 5J4MA 1XBDA 3I74A 2NY5C 2WLLA 1NICA 4UQ2B 1EIBA 2OMZB 4A7UA 2QQLH 4YBHA 5DO8A 1EANA 2XUWA 5FO8B 3PFQA 5J1SC 4C4BA 4X0KB 2IFFH 3MLZH 5DVOA 5E2TL 4KZCA 3QFJB 4G9FE 2R8SH 1G7LB 43C9B 2Y4SA 1UZ8A 2HRPL 1J1OH 3LKPA 3Q2NA 1C5BL 4MYPA 1QBBA 3AZUA 4HZAA 3ZMNA 4Z76A 1R5VB 4C56D 1ZEAH 5D7JD 3IN2A 2Q0ZX 4W9KC 5HGAB 3C2SA 1NC2D 4WJKB 5EF3A 1S7UA 3LQAC 3UG3A 3IJHB 3X14A 3IMSA 4NKIL 3CNKA 4DCQB 1B0IA 3O3DB 1F11A 1VPOH 2ZCHH 4WWNA 1NBYB 4JJ5B 1RXLA 3T3PF 1BF5A 1IGYA 3K80A 3D39A 4FTVE 5JOPE 1T1ZA 3RJQB 4DGIL 3BZFB 1GGTA 3WXWL 5JUEH 2HLFC 1KGCD 1DL7L 2JV6A 2J57A 3LRHA 3QIBD 4NPKA 1FNEB 5D70L 2EJ1A 3ZDYF 2AEOA 4YSRA 2AJXL 1I3RA 1K5NA 3JWNH 5FV1L 3TASA 4DP8X 4GH7B 2IANA 2OP4L 1V3LA 2APXA 2PABA 3OAWA 5E8NB 2EVHA 2P8PA 4AITA 2BIHA 1JPGA 2E86A 1GMIA 4M1DL 3FHEA 3GGWB 5T1LD 1YQVH 1IL1A 1NKGA 2ZOWA 1LK3L 3QEQB 1YMHA 2CDFA 1MFCL 3DIFA 3F58L 4I7ZC 3G04B 1ZMYA 4OJDH 5AL0A 2HRGA 4M5YL 4N0FA 4PW3A 4UOJA 5FA3B 5MP6H 3TP4A 1QOKA 2W0FB 5ETUB 2Y6SC 3L7FB 3WS3B 2KYIA 3DC0A 4HUMB 2D2OA 3B8YA 2Z7WA 3L5XL 4QRTA 2N7SA 5LLIC 3BUYB 5D7EA 1CICD 2IDCA 3CZFA 4HS8H 4OCSL 3JV4B 2YFOA 3NMEA 3POCA 1BVNP 3IJYB 4POUB 5DK3A 5DRWA 3MRJB 1RZJL 1QR1A 4EMZA 3QJSB 4FAAB 3LXCA 4UDTA 2VUYA 3THMH 3CXHJ 3QEUA 4QRUA 1CDJA 5MENB 3HZYA 4JE0A 2LTQB 3IGUA 4QHUA 4CBPA 4OLZH 3MAWA 3H3PH 2VDML 5KYNA 1TZGL 3FQXB 3V6FA 3ZKSD 4A7VA 3MRPA 4Y9GA 1I1YA 1SOSA 2JNZA 1IFHH 4M02A 1X7QB 2SODB 1UTDA 4NM4H 3PWPE 4UNIA 2JB6B 3OZLA 3AXHA 3BSZA 4IOFC 2FZ3B 3BGAA 5EULV 1SM3L 4X98A 1UXSA 2GCYA 1CQYA 5C08B 1NLDL 4LCIH 3PP3H 2VE6B 5I18L 5E8OB 5EO1A 3T0EA 1FFQA 2ARJA 3GBNL 1GMEA 1RIVH 4DH2A 4WIQA 3P2BA 4H8PA 2GJ6D 1IBYA 4X8JB 4ZMLA 1NOLA 2EUVA 4JKMA 5AW2B 5GS0H 4PJ9D 2NY7H 1ND0B 1OWWA 3EJCA 2RTTA 1CFVH 3T77B 3DX6A 3UACA 4UU9B 4F7MB 1IBBA 1LE5A 3K7UA 4MLIA 5J9PB 3QWRD 1CYGA 1LQBC 1GOHA 2MPAL 3P3UA 3MRKA 1F6AB 1ZGLM 1WG3A 2EECA 3S3DB 3CPLB 5I1KL 4NDMA 1DQQA 1WYJA 5DJXB 5L8JB 1G4MA 3HNVL 4TLTA 4WKZA 1DCLA 2AQ3A 4OT1H 4P04A 4RFOH 4WHTB 5CD5C 1ILSA 3Q8BA 3AU1A 3QQ3A 5C0ND 3HVDA 1GGBL 3BPCB 4EQ2A 2BWDA 1CZ8H 1P4LB 2OMZA 2X7LA 5F1NB 2A9NL 3ARDA 3MXWL 3MVSA 3X3GL 1VKXB 3BFOA 5FA4B 2A9DA 2IWGA 3GMLB 1LMIA 1NCHA 3SPVA 3VE0A 4CC4A 1DEEB 1PJ9A 3ESNA 3N43B 2QQQA 2G9HB 1UOWA 3A6BL 4G2AA 4OM0H 1BZ7B 4YC2B 3P9MA 2NX5E 4MD5B 2OXHA 2X12A 1TZHB 2G0LA 4JQIL 2J1XA 3ZT7A 2IV8A 2XACC 1F3DJ 4OLYH 5JW4M 4GT7A 4MB3A 5F9OH 2ATAA 1IFGA 4O9HH 3EYQD 1JWUB 3IDIA 4JY6A 3Q2CA 4P46B 5F89A 3BP6A 1CG9B 4ZFOB 1VFAA 2A3TA 3MV9D 3PQYB 1X6LA 1JPST 2XJLA 3L6FA 3O3DA 4IRJA 2WLMA 2RCSH 3BI9X 4N9OB 3TOPA 2BVQB 5IB1A 1NBYA 5FUZL 1R33A 4H5SA 2FB4H 2TRHA 4OLWL 4XOCA 3HCVA 1VGKB 1QNZL 4M62H 4Z7WF 4PJCB 5BW7C 3A23A 1LO0H 2DEYX 1WBYA 1MFDL 4Z95H 4LGRB 1N6QH 3BC9A 5EU5B 2EXSA 3VI4B 3E80A 5FR3A 4A2MA 5JPMB 5IB2A 4NIYE 3BVTA 1P1ZB 5F3BB 2AXHA 3SD2A 5DS8B 1M3IA 2Z31C 1RJZB 3QDJB 2F58H 4XNYH 3D5OF 1BIHA 2BCKA 4WU7A 4Q9QH 1XF3B 4M6NH 3WEXA 4DWHA 3QEQA 2IDUA 5SWZB 1JTPA 3S36L 5TE4L 2WIIB 2WTRB 4N6RB 2AXGA 5G4NA 4LSQH 1XBRA 3RTQD 1PEZA 4NO0B 4QRPE 2OA9A 2GTWA 5FA3A 1JJUA 3BH8A 5ETUA 4NRYB 4WGVB 4GG6F 3P40A 2NMSA 2HN7B 5F1IB 4NFBA 2EQDA 3P54A 3HB3B 4M7KL 1KBBA 3UGEA 3FU7B 5E9DE 5GZND 5D71H 4B7LA 4LAJH 4M4PA 1TFPA 3OPZH 3UZVA 1EO5A 3FU9A 4ESKA 1QRKA 4XN1A 1XXFC 4RMVA 4RMSA 4K7PH 3V7MA 5CEYA 4HKXA 1V5JA 4IJ3C 2UXVA 4EOWL 5H8DA 4NP4L 3PNRB 5D8JL 5TK2A 1B0GA 1AR1C 1MG2C 3WFCH 1U93B 4GSQA 4GI9A 4OCMC 5TQ0L 5C2UB 3DURA 3EHBD 1VA9A 4TYUA 2VXTL 1FNHA 5HY9A 2BH0A 4WHYG 3V4UH 3MRGA 3MRQA 2ICWB 5BRQA 5GS2D 3KPSD 1PSKH 1QVOA 5DDHB 1V05A 3NGBC 2OMTA 5FXCH 3T0EC 4YVUA 2P5ED 1ZE3H 4A2GA 5CBAA 1HI6A 2R0KH 3ATFA 4N90E 5DJYB 3NABL 4M7LL 3GHEL 4PTUA 2OMXB 1UURA 3WMQA 4XTRD 2EUXA 2JWYA 2PWHA 4RFEB 5FHBH 1A6UL 1WICA 3ARZA 4UOQA 2AITA 5EZPA 1A14H 1C5CH 3U25A 3OHXA 5KJ4A 2FBJL 1DDTA 3ARGD 1WZ1H 2ITDB 3QDGD 4N0RA 4G6FD 1BZDA 2G30A 2YKLL 4UCFA 1P84J 2NDGA 5AVQB 1MJ8H 2HVJB 4EIUA 1BIIB 3P4OA 4F5CE 2YPLB 4B9CA 4WWOA 3RX7A 3VD0A 5CZRA 5ICYA 3ARDC 3FBQA 4WHTA 3ARSA 1M7UA 2R9HC 4TTDC 2MJWA 4CC4C 3IFPA 1V3JA 3O3EA 1FZOB 2Y06H 2PPAA 2X4RB 4L8BB 2A6DB 4PJIA 1YCSA 5CZKA 3IXAB 5E8EB 5JR1H 5IOKA 4Z7VA 3PIQB 2BFVL 2OLDA 1NGXA 3RAJH 4NQEE 4MMXA 1KXHA 2G9HA 3VXMA 4MHHG 4FHBD 3JWOL 3WEBA 4BRVA 4F7CB 5DHMC 1WO2A 3W1ZA 4U6YA 2WNKA 3PWLB 2PYFA 4LF3A 4KY1H 3IMRA 5LG6A 4WHDA 2O1AA 3FCSB 3T0VA 1WAAE 4IRJC 1L5GA 2OJEB 3K6OA 1Z9LA 2NY0D 3GB7B 5HHQB 4Y5YB 1W72B 4RLDA 5J1TC 4GAAA 1BA9A 5INDA 3LV3A 4LRNL 2XA8H 3CZSA 5DYOB 1QLFA 1MVYA 3HLAB 1TZ8A 4Z3TA 1B9ZA 3FTVA 3K8KA 2LGNA 4MAYD 1NUDA 2CBOA 5E6UB 4MDIB 4PJCA 3CSYB 2DM3A 3R0NA 2ZXEB 1FFRA 3X1FA 2BSTB 3P0VL 4DJMA 4WFGE 3MDJA 3AU0A 1RIUH 2CK0H 4AGMA 2EDBA 4QHNB 3V0GA 3M8OL 3INOA 3C2AL 2UXFA 3DGCR 3K6IA 2J2ZA 5I1DB 5MEPA 3ZDXF 1WZMA 3PXHA 5E0QA 4KMTL 4N1EA 1INQB 5CJ5A 4Y1AD 2B7DT 3O6LL 5DS8A 4ZAKB 1RJZA 3IDJB 1S9XB 3QZPA 4YDIH 2DIAA 3CBKB 3IDNB 1XF3A 3G08B 2IOOA 2OMUA 4BSVA 5DWUH 1P7KB 3NIGF 4I9WD 3SKUD 4HOZA 4JCMA 3D0AA 4NO0A 1DQIA 4MNQE 3VFUB 2XWTB 1QPPA 4Q52A 1C9SA 4CNIA 1L9MA 3BFQG 5HGDB 3FCTB 3V4PH 1OT4A 4GINA 1UB6B 3OGOE 4P4KD 3OHMB 2E9GA 2WQXA 1GGUA 2EKJA 1Q1JL 1OHQA 2LTQC 4XX1E 1XSIA 4TVPH 3MCLL 1G7HB 1CF1A 1LM8V 2APTA 1WGVA 5JZ7D 2ZOKB 1JUFB 3MACH 3AT8A 3GC3A 2C9XA 2Q8BL 3HG3A 4DIXA 2H47C 2VWEC 2YD4A 3ZKND 4ZOCA 3LZFH 1JNLH 2CJTA 4A55A 2B3RA 4QXGH 3ORJA 4ODWB 1IEBB 1JSYA 1YZZA 1SMAA 3BP4B 4YLBA 3RPIA 3SEPA 2YGQA 3LPFA 5HYJD 4YE4H 3QARA 1U93A 4YDNA 5GSRB 4W9ZA 5C0CD 3KE0A 4NJ9H 4HHGA 1XCTB 4UM9D 3ABKB 1TQCB 1SPDA 3OWRA 2OR9H 1CFBA 5C6PB 1LE9A 3ZT5A 1WP6A 3GHBH 4P5TD 1AQ8A 4ISVA 1BV8A 3ASWA 2QGDA 5DDHA 3ZE0E 4PV8B 1RK0A 5C0DB 1T4KB 2DKMA 3CN2A 2LR4A 2X4NB 5DJYA 3NRFA 4OLVL 4DKEL 1H8SA 1J12A 3PJSB 5EB9A 4UUJA 4XXCC 4JHBA 1UT1A 3OHXC 1RK1B 2R29A 2CCLA 4JFYA 4WW1A 5EBMB 3V6BR 1U3HD 4HZLB 4XWOD 2K8QA 1U8IB 1M9WA 2AS5M 2NUPA 4ZI8A 2VDQB 4V1DB 4WJ5A 5K69A 1A6ZA 3NIDF 1ZXKA 2WWMD 2NXZB 2YRBA 3OKEA 4O02H 3A6CL 2XVBA 4IEFB 1XHHA 1N4XL 3QUMH 4LLUA 4OFKA 4OKVB 4OM1H 1NCIA 4ENEC 1I1CA 3NCWA 5CJOL 4AE0A 1BIIA 1TJHH 2I24N 3L2NA 1ZVSB 6PCYA 4A38A 3UX9B 1BD2A 3S4SG 4Q4IA 1QPKA 1BCIA 5ALBL 4U7MA 4GRWF 1U33A 3KPNB 2GSIA 2ZXBA 3VVVA 1NSNL 1CLOL 4GYBA 4MFHA 5ECJE 2J88L 2I32A 2PPEA 2VM3A 5E00B 5HJDA 2X4RA 5IQMA 2GJ6E 2F8VA 4UIMB 4G72B 1IX2A 2AJYL 5KZCB 2GJJA 1BAFL 2ZX7A 2FH8A 5C7XH 3FFCA 3L4XA 2HJLB 5ANME 2ZYHA 3X12A 4DUWA 1GS6X 3JWDC 4YHNA 1KYFA 3N1PC 4NWTH 1U8JB 5IV2A 4FFZA 3UBXA 1FG9C 2NQ3A 1PY4A 2WQWA 1BVKA 2HTLD 4IBZA 5EN3A 1MCCA 4ZX3A 5EEYA 2NSMA 4GAFB 2VRAA 1CDHA 2A6KA 2ZWLT 2OTUA 32C2A 4JFDD 1H3PH 1H8OA 3FS9A 2XN2A 3QXUA 1JPSH 2R56L 1MHEB 3TT1H 4MJJA 2DDQL 3KHOA 1NDMB 2EYTB 1FFNB 3EUDA 3KJ6H 1HL9A 4PJGE 3MBXH 5IMKA 4BXVA 3C5XA 3FRUA 3MLUL 4HJTA 5H2BA 3V0AC 1NGYB 2IDSA 1CBJA 5IW1B 4RWYL 2DQUH 1YECL 4KVNL 4WY7H 4P2OB 1IVTA 1KMGA 5JPMC 2Q5BA 2AEPL 4LLMB 1D5BA 5KYYA 4CJ0A 1CYXA 4XNMA 1JZ3A 3O4OC 4Z7QF 4G8GB 3UAJA 1JCVA 4ZG1A 4K23H 4XR8C 1MFBL 5JO5B 2VUOA 1CDYA 1ZOXA 1ZDQA 3MV9E 3QJHA 5EZIH 4BYHA 2L4OA 3UMNA 1A7OH 5SWQB 4PCKA 4PWEA 4BM7A 3IDJA 2C4FU 4WZ9A 3BHBB 4GW4B 4PVNA 5F1KC 4HK0A 1SMOA 1N8ZB 4QTHB 2A9ML 4P9HH 3D1MC 1KUMA 1MAJA 2WAQA 1W16A 3PABB 4PHXA 2WO4A 1NFDA 3IAGC 3HB3C 1P53A 4FEMA 3SDXF 4PGJA 1SUHA 4QHMB 5FM5O 1KGJA 3R4RA 3L4TA 2VL4A 2CDEB 2DQJH 4Y5VB 5F9JB 3M17A 1JZ2A 3AACA 3WLWC 4WI4A 2ZNWA 4Z78A 1LO5A 1WQVT 5EU6A 2KBGA 3CFBA 1P7QA 3U7WL 1SVZA 2GI0A 1UADC 4GP4B 1H3TA 4WO4B 1Q9KA 2VM4A 3EJPA 4I4WB 1C08A 4LVHB 5IK3A 2W38A 3E8UH 2PYEA 4ZTEA 1U6AL 4P2QA 3V6OC 4NQDB 3WHE1 4A66A 3NH7L 3OB0K 2D73A 1NFAA 2EDDA 3VH8B 3HNSH 2PCPB 4ZYKB 5D7LE 3MGOB 5LO7A 5FDWA 2VLJB 2VC2L 1OTTC 5L7XH 1EXUB 4I13B 5DHXB 5FGSA 4CW1A 2EIZB 3S34L 1LO4H 3C6SB 1QI3A 5DHDA 1PW3A 2DQEL 3GXTA 4KO9A 1BDYA 3RX9A 3F6IA 2F19H 1FLRL 1ZHLB 3DBXB 3VRIB 4K3HA 5C0DA 1S7SB 4K7PX 2DEXX 4N1CA 3RVTC 5D4QA 1OT2A 4L4JA 1KTKE 3FO1A 5JW4Q 3K0YA 1XF5A 2ZOOA 3U82B 3L16A 2FATH 4LU5L 1GC1C 3DJ9A 5DZ9A 1BBDL 4LVOB 4YX2L 3KGTA 3L5WB 5K1JA 5CSGA 5AALA 1JWMB 2KZ1B 4G7VL 4CN1A 2ZKHH 1XFPA 4LARL 2QPUA 3HE6B 2I25N 2IBBA 4HWZB 5K9OA 3HAEH 4HKZA 4L3AA 3ZTCC 1MIMH 3E3QE 3IFOA 4YBQC 2YA2A 2CHWA 4KX7A 1KYOJ 5DQ9B 5E6RB 2L7QA 3MNDA 2P5EE 5AZEH 4WEMB 5FUOL 1AG6A 2I5YH 1SY6H 4WEEA 2X6UA 4X5RA 5CCKH 4PGBB 3RWJB 4KJQC 2IJ0C 2G2PA 1KBGH 1HOEA 2XTJD 4NHUA 4OJCA 2AABL 3HW7A 3U0PB 2NRDA 3G7TA 4LHQB 4X6DF 1G9EA 4TF4A 3SDAB 3T04D 3T6XA 5I5IA 1IZKA 3GRWL 4MLSA 5I1EL 5B1JA 4H26A 1AQDB 2DV6A 4FCAA 4OCNC 5MI0C 1UHVA 5DVKA 3T65B 4QT5B 1OAKL 3FT2B 1AOHA 4QTIL 3QJTB 3QUZD 2BOCB 1DN2A 2QGCA 1YA5A 4PRIB 4Y5YC 3VX0A 3ZE2B 4LEBA 3OKLB 4LT7A 4F2EA 4LSTL 4X83A 1G7IB 5DMKA 2F74B 1A6PA 4BEIA 1XGZA 4F8PA 5GISL 4H2AA 1G9HA 3R8QA 1VRSA 2DLGA 4JB9L 3U83A 2OPCA 4KVCL 3RLSA 3VMNA 3TJHD 4JFFB 4WU5B 4EXPX 3JYBA 3GT6A 2EE2A 5TE7L 3HVNA 3FC8A 4CSSA 1MOEA 4WNQA 4YVNA 4O51B 4TKWA 5CEZD 2Q76B 2VDRB 1W0WB 3UAJC 4ZO6A 3RL2B 5IW1A 4A7QA 3QCVH 1F41A 1IBZA 5AG8A 2BY1A 2IALB 4HW6A 4ZAKC 2FT8A 3R7QA 2Q7YB 3AT9A 4JFQB 4O58H 4H8VA 4FFVC 4X5WB 3SPJA 2W95A 3WDHA 4RDQG 1A3QA 4PJ7E 1EJFA 2HUEA 4MJ4A 5I0VA 5KBPA 2J8OA 4DETA 3FSWA 2Y7NA 3MTRA 4ADIA 1SJEB 3FB7A 1CJYA 1MH5A 4B9GA 5ESVA 4ZODA 4ZUTA 4FXGB 5KSVB 4HP5A 3MSPA 2XETA 3LS5H 2X4TA 3RWIA 5H4YA 2E7HA 4IHOA 1R3JA 1FPTL 4NRXA 3L3KA 4DOHB 3UIZA 4ZS7H 3LB6D 1RQ5A 3IS1X 5DLMH 1P6AB 5F9JA 3IRPX 4HIQA 4R90H 1JV2B 1N12A 4IDJH 3B2DC 3FT4B 2BZCA 3CLEL 2FYVA 5I1AA 3WU1A 4JNXA 4KROB 4Y1AE 4G8FB 3EGDB 5C6WH 2F7QA 3KYNB 3U7YH 2Q3ZA 2EIKB 3PU7A 1F3RB 4J1UB 3SY0B 2OTPA 3TA3B 1XWVA 5T5FA 4MRCA 3ET9F 4YSOA 1JZDC 2GBTA 1TQCC 3MUY1 2FTAA 3RUGE 4F8TA 4N2CA 4NUQA 4JR9L 4MCNA 2DH3A 4HHWA 5DK2B 5I1CL 1BYOA 2E8YA 3C6SA 1GS8A 4LCYB 3W2DH 4XP9H 4FQXA 3QZWB 1QRNB 1ZHLA 3DBXA 4F7TB 5CEZL 2UZIH 2YEVB 1U92B 3ESPA 4K9EL 4YSEA 4NZRL 5L2KA 4F1ZA 3TN0B 4ABUA 2VDLL 4MMYB 3ECQA 3VGFA 1HHKA 2JK5A 4NB7A 3ZKXC 1CI5A 2J55A 2W60A 3RVUD 2NXZC 3GDCA 5HYJE 1Z3GH 2H3KA 1JXDA 1N5YL 4L3ED 2CHXA 4UILL 2I7OA 2AJVL 4FQQA 4GIAA 2NZ9D 1E90A 2OJZH 4J2QA 4ZSOA 2VH5L 5JHLH 1JK8B 2BOBB 1LP9F 4PBDA 1P84K 3U4BL 4IIZA 4N0UE 1OIOA 3TO4D 4GG6E 5KN5B 4GFTB 5IMLA 1IGFH 4O2EB 1F1GA 1ZTXE 2ALWA 5J3HD 3OR6A 3PREA 2BSDA 4PG9A 1RZPA 4R0LB 1OF0A 4UQ3B 4LQFL 4PGBA 4HPOL 1UKTA 2IO5A 3W38A 5B1JC 1T2QL 4B50A 5HVHB 1N8OE 4ZX6A 1FZKA 2WBJB 4RA0C 4WW2B 3QJFB 3SSGA 3RY6A 4AUUA 3U6RA 4PRPB 5AOJA 1VFMA 4PBWD 2R1YB 4PREB 1RVFL 4ACPA 3SIKA 2N3JA 1U8QA 3A5VA 1A6WL 1ETZA 2BS8A 3BD4A 4XPFH 1AZVA 2H6PA 2O6PA 5DD1L 3BVXA 1OZTG 3MJ8B 5IGXL 5IFJA 1FVEB 1VADB 4FNQA 1QLEB 2XWBA 4OZFH 3TEYA 3CZJA 2Z7UA 4DZ8A 4Y9FA 4AC4A 2WKOF 1ID2A 3U9PL 2GK0B 3GUFA 2UYLB 4G6JL 4L4VB 3DXAB 4BV1A 1GKEA 25C8H 4YHLL 2BOLA 1V54B 1A5FH 2DN7A 4DP2X 5JHDB 2N59A 3V5DA 3EOAB 1F90L 4KAQH 2DQIH 3UTSD 1NAML 3KXFB 1BVOA 2XN9A 1BX2B 4HWBA 4AKQA 1J5IA 4KZDH 5KVFL 2IALA 5IT2L 4QLWA 3NN8B 4KJYA 4I48B 3TO2A 4UQAA 4GO6B 4JQVA 4JG1H 2QMKA 4JFQA 3JSSA 4JFDE 3RPBA 3ZDZE 1T83A 3AVEA 1AJ7H 4W6WB 3WOVA 4XGZA 2FO1A 4WI7A 4PUBH 4UB0L 4L48A 4OCWH 2ZWSA 5PAZA 1JYVA 3KLKA 4ABVA 5IBTH 2IGTA 4QJ3B 1U8NA 4ODVH 5IVXF 4EEEA 4FXGA 5F6HI 2ZUUA 2R4RL 3BWAA 1NCAL 4L5FL 5D6CA 1KIUA 1X7SA 2LT9A 5ITBL 3HE7D 4TULH 4A67A 4OFDA 2DBJA 2AQQA 3O2DH 5JA9A 3IDYC 2YGPA 2AK4E 2EABA 5FIEA 1LVEA 4AQOA 1NFKA 2VDOB 5LWYL 5LQBH 4LHUD 2HT3D 5HGHB 1THCA 4HH9B 4JN1H 3N0AA 1CXFA 5LG1A 1NBZA 2O5YH 1A3RH 2D8KA 1OKEA 1MHCA 2NUTB 2XWXA 5CJ8A 2I60H 4QNPE 3IKCB 4J1UA 4MWFB 4L9LA 4BSJA 1I7TA 2XFXA 3EGSA 1ZJAA 4MQSB 4Q9RL 3ESOA 2AJ3B 5A7EA 4FLSA 5KVDL 1CF8L 3BVUA 3QAZB 5F7HA 1TDQA 3OMIB 5AYUH 3RL1B 3SYOA 2WK2A 1RY7B 4FQXC 1RURL 3OXSB 3R18A 3VWKB 1BVNT 5F7AA 3VSVA 4IBTA 1WUNT 3RI5F 4QXUL 3GUTB 1UM4L 4PJXB 1GZQA 4RCAA 4TXVB 2XRAH 4K71C 4MNGA 3VXOB 5DJ8B 1OCZB 3ZDXE 3EO1B 4LVOC 3KNBB 3QB7C 2O61B 3DYPA 3GJFA 1I8IB 3UTZB 3BW9A 5D7IE 1J8HB 3QUXD 3DDFA 2ZG3A 1UWEL 1P1VA 3H2WA 4KKRA 1GXEA 4TLKA 3ULUH 2EAEA 3RIAK 4K3DH 2P80A 4PB0L 4ZUVB 3VFNB 1JXKA 4JZNA 1IM9B 2QSTA 2NOYA 1DBBH 3MJ7B 4PD4J 5C0BD 1L0XA 4R9HA 5AFAA 1UA7A 2GEEA 3DBSA 2YR3A 3MRCB 3QCUH 4DW2L 5FCUL 4JQIA 3QNYA 4XC3H 4PJBB 1F42A 3L3OA 5TQ2H 1BZOA 3ARPA 4Q6YA 5CLWA 4JJOA 1XGPB 3SDAC 2EC9T 3QRFM 4PRHE 4ANXA 4KVPA 4MCZB 3OAYK 1QBLL 4WUUA 3CX2A 2HMID 1ITBB 4GUPB 1PZUB 5E6ID 1HH9B 3RVWC 3ROLB 3GINA 4NPJA 1RHHA 4Z7UA 3JWNE 4BDVA 1KBVA 1YRKA 3CJJA 2C34A 1VFBB 4E5XB 3P0GB 4XRCB 2MOGA 4Z7OB 5C8JA 1ZS2A 2X2UA 4U1KB 2K1MA 4R8WH 1QEWB 1W8EA 3MR9A 4TVPD 4MJIE 4ZT1A 3O3BB 1ZKAA 4DKFH 3MJ8A 4UV4L 1C1EL 3SN6N 2EVFA 2FGZA 1NIBA 2ZXQA 1KJ2A 2Y36H 4P2RD 3FQWA 3O3AB 1HH6B 1U41A 2DMHA 4G43A 2K8MA 3SGJA 2IWKA 2WWKO 2O5NA 3CFTA 4GMTL 5JHAA 3S37H 4NWUL 3TL5A 1MCBA 4RISL 4JAMB 4ETQB 3GSWB 3PDDA 2BNRA 1ANUA 4YMPA 2MNJB 4EVNB 5CMAA 2YAHA 1EO8H 3A4FA 4X8GA 2FJSA 3IVKA 1NDGB 4JQVC 4BBWA 3VDCA 3WE6A 1T83C 5KBLA 2UY7B 5E5RB 5BRZD 2OI9B 3EYSL 3TIDA 4I48A 2AJSL 4OBRA 5HHOD 3L3IB 3OQRA 2C3WA 3GNMH 1MZZA 5J57B 2NY3C 1NCWH 1RZJC 4IRZA 4NQXB 5SX5H 2QSVA 5SWSE 5T1DL 1X9RA 2F1EA 2VDPB 3DMMA 3C8KA 3L17A 4FXGC 4JFSA 4JRXD 4QYAA 3VFOB 3MPCA 5HYQB 1ZIAA 3OLIA 4RGND 5EOTB 1DUYB 1WBZA 3S5YA 4LLVB 1ETA1 4PS4L 4ELMF 1KCRH 2J1YA 1EXHA 4JVWA 4LPTA 5BO0D 5BPPA 1E7VA 3HMXH 5DO2C 3TLRA 3ZRFC 2WM0A 4M6MH 5DHVH 2X3CA 1DUZB 2HFEB 1AKJD 4A1RA 4YPGA 1FYTA 4KROC 5GZOC 1A4JB 2K9FB 3TZVD 4QHPA 1ZT4B 1KDIA 1M42A 1QSEA 4YXLL 1IGTB 5KYUA 5HGHA 4B9YA 1TTCA 3RDTB 4L9LC 3TA3C 2CUHA 2XFGB 1TJIH 4RH4A 4K3EH 3ARXA 3TFKD 1NMBL 2BERA 3O8XD 4JHZA 1PD1A 4NGHL 3MUGA 5LCVH 1OAYL 1OALA 4PJAE 4N2NA 4V2CB 5IF0B 1SXCA 2I7SA 3DX0A 3JV6B 4ZW3A 2IBZY 3TFBA 2PXYB 3L3GB 4K5PA 2DYPD 3BH9A 3RL1A 5D2NA 4LCWE 5IJVA 1FG2A 3BLPX 4L2LA 3IJ9A 4Y2DB 5T1KB 1SDAB 1YEDB 5CEXB 3UBHA 4NUJB 4NKDA 4Y4FB 3QULA 1BFVL 3EO9H 1BMZA 4RBPH 5CJXA 4AYGA 3N06B 2GIYA 3HHSB 1VZHA 4XN5A 1Q9WA 4X9HA 2DQCH 5FWQA 2H26A 3KNBA 4IK7A 2X6VA 1NJ9B 2EXYC 1P5VA 4NNXB 1T03H 3I85A 4LCUA 1A8ZA 4YSAA 4AG4L 3WSQH 3N6YA 2VB5A 4X9IA 4LSVH 3FSVA 5HYIA 2XX1A 5DS2A 2ZX6A 4XPHH 2WYHA 1AQKH 4PS7A 3SDDB 4UDUB 4JRLA 4PG2A 3UPAA 3L3OC 1Q0EA 2CMRL 2EDYA 1ZT7B 3KH3A 5AW4B 5F96H 3VFGL 2W0LA 4FN0A 1YDPA 1BF2A 4KKLD 1HXMA 4N2HA 1I9IH 4LPXA 5F6IC 1KB9J 3WIIH 3CZUB 3PV7A 2DLFL 2HRHA 5HVHC 1J0YA 1OPOA 4AVHA 4ZMPA 2D3VA 4M8VA 4F93B 2B4CH 4L8SB 2N7BA 3B2VL 2EIJB 4NUMA 5EOQL 5C7ZA 1JTOA 3T6QC 3Q48A 4P5SA 4NLHA 5LAPA 4BCYA 5GGVY 1LILA 4EUPH 4L3EE 5EUKB 3F01A 4OZFG 1G1KA 3ZTDC 3C5ZB 2W91A 2XC8A 1UWGH 2ZUTA 1VERA 4HIEB 5H94B 1NLBH 1F4YL 4LEXL 4MVBD 4KK5D 2RFXB 1U3JA 4U1KA 2RACA 4L5FE 2O72A 3VXSB 2VDNH 5KYXA 3REVA 2YD9A 2YUZA 4C57C 1AI1H 5FGBC 3MCKA 3VWJD 1Q94A 4U3XA 5KS9F 4R7VA 4ZK8A 2BVOA 4NQCA 3X2QB 2H32H 2FSDA 2FJFA 1UXMA 1XF4B 2VLLB 3C6LB 2Z0BA 3QYCA 3HNTL 4P3WA 6CGTA 3ES6B 2P44B 2BSRA 1XR8B 3ZN6A 3NCFB 1IAKB 2P26A 2V3EA 4L29B 4X7DC 3ZPDA 3B9KA 3QDGA 4APXB 2DIBA 3MRNB 4F1SA 3MJ9H 3RY5A 2GI7A 3P3YA 4OSUH 4QAWA 2OQJA 3O2VH 1D6EB 4JHWL 1ASQA 5JIKA 9CGTA 2X88A 2UY7A 5IR1A 4I89A 3SJVE 1YMME 1A9BA 3RWFA 1HINH 1VEMA 4E0RA 4LPCA 1MF2H 5C0JA 5EF2A 5DD5H 5T3XH 3PLYA 3KYKH 4Q0XH 3EJYC 3N1FC 4NZFA 4XMZA 3BZ4A 2WINB 3AG4B 4PJHB 4QMEA 1BWMA 5EOTA 4JS7A 3P02A 1E6JH 1KCLA 2XWCA 1NH6A 3S35H 4Q2ZB 2AXJA 3LN5B 3UERA 3LHPL 4FG6D 3C8HA 3QPXL 1EHNA 2HFEA 3EOBA 1IE4A 3OAUL 2JKTM 3QRLA 5DZAA 1PG7L 5GGQH 4HWEL 3SKJH 3D7PA 2JCWA 3CDYA 3U6XS 4FQJH 1K4DB 4H88L 3MRDB 3DX1A 3K4DA 3Q8FA 5C0AE 3CIAA 2DBLH 2W81C 3PWVB 4IU3B 5LXGH 3S5LB 1AXIB 3KCPB 1ES0A 3MRIA 3QAZC 4YDJB 4EI6A 4UQEA 4FQ1L 3FB8B 3QXAA 5D2NC 5TTRA 4NXKA 4MJ2A 1FZMA 4KXDA 4O00A 4S0TD 1I9EA 4V33A 2HT4C 5IIEB 3OKMB 2FLBT 5TPWL 2YD1A 4PM1A 3F83A 1NMAL 5CJXC 4JJHA 2L7UA 3KWVA 4Y2DA 1P4BL 3MREA 5D2LB 5L4JA 4JREB 4DERA 4UT9H 4OZGF 2KERA 1UCBL 4PPTA 1I7RA 2AQNA 4MCYA 5DWPA 5LGJA 4A2EA 1NQBA 3V4VH 3BH4A 2CZNA 1S7XB 2AAAA 3GSQB 2W0PA 4FABH 4NQSB 2NW3B 1DSWA 5D7SL 3EFDL 3WFBH 3S3JA 4HT1H 3VG0L 1F58H 3KLHC 3SYPA 1FO0B 4M03A 4MXVE 4WFFD 4X6CF 5CGYD 1RULH 1PDKB 3O4LE 2A7BA 3ERXA 1AHMA 3RHWF 1D7BA 1JDDA 3KBPA 3V0DA 2R1WB 4HLZH 2APWA 2WHVA 1KIQA 5G55A 3FRPB 3Q5YA 4UQBA 3HC0A 4AIZB 1XMEB 3I9GH 1BFOB 1QO3A 1EGJH 4U05A 1RZKL 2UUDH 2XKNA 3BE1H 3QXVA 3KPMA 2OSLA 1X5AA 1N0XL 3ZZ1A 1RP8A 2E7LC 3N9GH 3QZNA 2Q87A 4GRLB 1CBVH 4YLQT 1XDTT 4BUGA 5BV7B 5B7MA 3FQ4A 4J8RB 5JOFA 2NXYD 5KG9A 3MMEA 3GZOA 1QSFE 4OLEA 4QAMB 1EJOH 1GYUA 1CGSH 2JCCE 1LO2H 4BZ2L 2X3AA 2E7CA 3TYFA 5I8EB 2VIRB 3C5ZA 4LCCA 2ZWKA 3HG1E 3MUZ1 3BCFA 4QRBA 2EDEA 2BVTA 1OGTB 2H2PC 3AS3A 3RGVA 1S9WA 1IKOP 1FAKT 1NBVH 1D5MB 4XVUC 4XMKH 2E3VA 1DVFD 4P5KB 3ZY7A 4J4PC 1AIFB 1N5AB 1TZIA 4FKHA 2XPGB 5EDXA 2H8PA 1ODUA 1JGLH 4BHUI 3ZBMA 1SRDA 4CVWA 4F58H 1FE8H 4FJZA 2R2HB 3B9KC 4JKLA 3A4AA 3F64A 5HVFB 4GB9A 3WN5B 2QT6A 3BP5A 4PRBA 1IAKA 1IKFH 2J6EL 5BZWA 4L37B 4YHZL 1M6UA 5DD3H 1T04A 1U0QA 4WTXA 4APXA 4OQTH 3MRNA 4LSSL 4RMWA 3LJ3A 4AX3A 4AYDC 2KUTA 4H25A 2VDKB 1FN4B 2WOBA 1JGEB 3IGLA 2NCMA 4FD0A 4NPYA 4PV9B 2XKUA 4TVPE 1VZIA 2A99A 3AXLB 1Z9PA 4X4XA 1DN0B 1TQBB 3FCBA 1IGIH 3U30B 3C5SA 7FABH 4PIRF 4P2RE 2FD6H 2Z35A 1EAOA 2EACA 3KG5A 2DWSA 4WI9A 1GSMA 1SHMA 2YEZB 3B9DA 5I1JH 1UT2A 2AGJH 4AQEA 3QQ9C 3U9WA 1YPZE 1DJHA 3HS0B 3MXVL 3SGEH 2HKFL 2VOTA 3BQUD 3EIFA 3BD5A 2WGNB 3MKKA 1EZLA 2BP5M 5IHUL 2IMMA 4KRPB 4DPAX 3LN5A 4G6KL 2VMJA 4XXWC 2QV2A 5E94A 4D9RD 1Q72L 1YO4A 2FEDD 4Y2NA 1SEBA 2Z6FA 3M86A 5BRZE 4HGWA 4HIXL 3VYOA 1D7FA 4TPRH 5C09B 3GMQA 1EJ8A 4XHQA 3ARFB 5CJBA 5FLUA 3AY2A 3K71B 2JKNA 4PRAA 3LKSB 5DTFB 2C9UA 1K4DA 2MMXA 3MRDA 3O6FA 4XVSL 3CDGB 1MI5E 2ZSVB 1DQKA 1U8PB 1H6TA 3NEEA 1AZRA 4KK6D 5D1ZB 4P4RB 2F61A 4JRXE 4FYQA 2WTOA 4HOXA 1AZBA 3VFRB 3WNIA 2BSSA 4N0YL 1NCBL 3DIDA 4NNYA 1G6RB 4P0DA 3ATEA 4H8WC 4LSUH 4Y2DC 1CQKA 5LBSH 2EKSA 1HSBB 1WISA 2CIIB 2HLEB 1NINA 4ORGA 1CGTA 4IOIA 3EGXA 3VH8G 4B97A 1TO5A 5I76A 1X9UA 2VDOH 1MFMA 2ZICA 5FK9B 2CG9X 2QQKH 2OK0L 4NZTH 2XG5B 2KZWA 2ZX9A 1I1FB 1UFUA 3MYZA 1D7DA 4NN6C 5IQ9A 4AEIH 1EVTC 4DAGL 3QUYD 1D9KD 4D0BB 5GRWA 5IB4B 2CBMA 1CFNB 2V7HA 2WWNA 3CMOH 3DPBB 4G3YL 1JWSB 3QH3A 2NW3A 1AE6H 4H2CA 3MV8B 5HDQL 1AACA 1ZD6A 1UKSA 4JRYD 3VRLE 2H3XC 2CRIA 3BDYL 2EH7H 2YAQA 3BRDA 3CHRA 5I6PA 1FFOA 1EERB 1T2JA 3FT1A 4PD4K 3D3VD 2DIEA 1I4FA 4ZOEA 2BNQB 2GJPA 4PJDE 3IGAB 3LSOB 3MRRB 5LVEA 2VERA 4HUVB 4LLYB 4M6OL 3U1PA 3VMPA 1S8DA 3VD7A 2CM5A 4TTGA 6FABH 1BOYA 4JPWH 2ADJA 3C5ZC 4N87A 4LCCC 4APQB 3LKRB 2QVMA 1XMWA 3H53A 1EFQA 3BT2L 3BXNA 2PTTB 3QPQC 4JFEB 4B5ZA 4BWWA 5GPRA 3W0WD 4GXUN 2AJUL 3PNWB 4UBDC 3RGVC 3HS9A 1J9TA 3UPRB 1RZGA 1G9MC 1MCOH 3CZGA 2W9DH 2BY0A 3I02B 4XP1L 4KZEL 2DI7A 4TNWF 5F0MB 2MCPH 1RZFL 5F8QC 5HDLA 3WIHH 2DLIA 2VJ8A 3CFMA 3FTZA 5C6TH 1H15A 4HG4J 1AYOA 1RH8A 2OM5A 3T4AA 4CL7A 1E9PB 3RX8A 4N2DA 4BZYA 3RWHB 4G7SB 2G4GA 3BX7C 2BRRL 3WUWB 2P28B 2XZQH 3O45A 1CLCA 2HH0L 5HHXL 1SMDA 2ENJA 2O5XH 4P48A 1SOKA 2IAMA 3SCMD 4C56A 1JFQL 1JGIA 2V9UA 1RUQL 4KXBA 2PPCA 1YNKL 1LEIA 4HAKA 4Q74A 2EVIA 2DQHH 4FGMA 1X5JA 4XNUH 1MWAL 5E5MA 1MG3C 5CUSL 3OGCA 1HIML 4ATWA 3AM8A 2NNAA 1RUMH 3HMWH 2H3NB 5HHVL 4FXTA 1KELL 4OV5B 3BT0A 2VZOA 2NNRA 3DUSB 2P46B 4UT6L 3GSNB 1JF1B 3LZLA 4HK3N 3CVHB 2C9RA 4XHJD 4JDEB 4XNZC 4M4RA 4ZS6D 2XIIA 4AGPA 2QVKA 3HUJE 2J8UA 4LDCA 4MZIA 4KTGA 3ARQA 1NANH 1KXQE 3QIUA 2K7PA 3W5MA 3LYRA 4OIFA 1ZANL 1CFTA 2AERT 2E74C 4G9FB 4ZPVB 2MWCA 3QORB 3ZK0A 1GZHA 2P45B 4N3UA 1R1CA 1N59A 5E4EC 3TVMB 1FZJA 5HYSA 5IQLA 3H9SA 3O6FC 1H6FA 2Z65C 2F53A 2EYSA 1KIPB 3OJDB 2V17H 2X09A 2ZXAA 3WJMB 3CFCH 1FCGA 4Y9BA 5E7FA 4U1HB 2ZSVA 4J39A 3T8VA 3QSKB 1RZ7H 5D1ZA 5KW9H 3QGVA 1SJVA 3WYRA 4OIIL 1CLYL 1ASPA 3QS2A 3HBPA 2JKSA 1KJ3H 3GIZH 1XGRA 1NL0L 2G2RB 3VFRA 3W39B 1WAEA 3NG5A 3P2TA 1G6RA 4FTVB 3WJJA 4DKDC 5GGTL 4UYPA 2EIMB 4U6VL 1SN2A 2Y69B 1HCVA 1KT2B 2HFGH 2ZKXA 1I31A 1SBSH 3OXRA 1DVYA 3TBWB 3T6VA 5C9JA 2RQEA 3KPRD 4LK4A 3ZGIA 3VYPA 4NRZA 5A7BA 2VR8A 4KI5D 3S9DB 2B59B 3MLXL 4FJ6A 2OS7A 1M7DA 4QRRD 4HLZG 1I9JL 4XP4H 1PGRB 3MBED 4PSPA 4A6YB 2DWEB 4LIQH 5FKPB 3QXTA 2M8XA 1MAML 4JM2F 5GS1B 3T09A 4CVZA 4LKXB 2F8OA 3QZWG 3T8XA 5MEQA 3BKML 5IROD 4P9ML 3MROB 1B0WA 5JPNB 2BXZA 2FWOB 5IFHH 3D30A 3PAZA 1IIIA 4HIHA 4LXFA 1OAXL 1IC1A 3M45A 5L2JB 3LNHA 3LQZA 4ONFH 4PN6A 5A3IC 3INUH 1QFWL 3IJ7A 2GBVA 2W9EL 1QHPA 2P43B 2R59A 4OZHF 1EFXB 1U91A 1YEIH 4JPKL 3VXUD 3QEGH 4E9RA 4BRJA 2YQ2A 2H9GB 4TOYL 3JTSB 1OE1A 3Q1SH 4WI8A 3NFSL 3CVIH 2VL5B 5C07A 1G7MB 3IGAA 3DECA 3F7YA 1HWGB 1A4KB 4F57L 4HUVA 2Y5TA 2PUQT 3QFDB 3VXRA 3VM7A 1ZWIA 3FT3B 3MLVL 3P11L 4NCDA 5IUSA 2WMPB 1T0MB 5G5DB 3ARED 1A0QL 4R7DA 2V4LA 4WFFE 4O4YL 4YO0B 3UG4A 4LNRB 4I18B 2V2XB 2PP7A 4IIQB 5L88L 2IXQA 4R7LA 3CBRA 4U4IA 4ZXBD 1DFBL 4IS6A 5BUAA 3SDXA 3FK3A 3I6LD 1KN2H 5D6DA 1KY7A 2PR4H 4EQ3A 2LABA 4N9GB 1DANU 1YAIA 3US0A 3BD3A 3PWPB 1YUKB 3PP3K 3F05A 4PB9H 1URZA 4F37K 1DSFH 2DD8L 5BO1H 2F08A 5DJDB 3FONB 4S1QL 2R69H 4B5EA 2AK1L 1ZVHA 3GMNA 5BXFA 3LN4B 2GSGA 4WTWA 1CD8A 2NR6C 3E0GA 2WO2B 1MY5A 3N42F 1JPFB 3VI4E 2FNWA 1UM6H 1A8JH 5E23A 1CD0A 3ZRSA 3HG0A 1KNOB 2LE9A 4GS7B 4XNQA 4ZZKA 1TQBC 2DM7A 1G6VK 2D31B 3U30C 1WFNA 2JQMA 4R4BB 3Q05A 1YY9C 2HFFA 2YRLA 2C1OB 2DOCA 15C8H 2BJML 3NFPB 2OL3B 3G6JF 3QIWB 1JL8A 1ID5I 3DUSA 2B0SL 4J3SA 4DZBA 3FMGL 3QZMA 4A37A 3AS0A 3Q6GH 1N6VA 3QR0A 3ZZQA 5IBLD 2G3NA 3TBYA 2YUXA 2CO6A 3FUMA 3MU3A 5LGHH 2VXVH 2BSCA 2WOYA 5K93A 3LNFA 4B6ZA 5F93C 4IRSB 3ZMRA 1MREH 1FHGA 1I85A 2XWEA 5HHMD 3ULSB 3O3UN 3CHPA 4R2GC 4ACTA 3BVNB 3T08A 5CZVH 5CLXA 2X4PB 3LKNB 1IO4C 4G80B 1L9PA 1KOAA 2NX5B 1Q9LB 3KPOA 4KK8C 4UMGA 5GHWH 3TVMA 4YAQA 3IETB 1ECYA 5I1LB 5D1ZC 1F3JB 1INEL 1VGEL 2ZCLL 3UYPB 2ADFL 5CCHE 4W6XB 5DEGB 2A83B 2UVFA 2GC7C 4POZC 3NCYS 1MFVA 4HOMA 1OGAD 4YJZL 5FOJA 2WZ6A 4U1HA 2CGRH 4UZGA 2UWEF 4EZMA 2P5WB 4LAQH 3WJJC 3J8F7 4ZOBA 1Y6KR 4PJ8B 2Y0SA 3ARYA 4OZIF 3G5XA 1JDAA 4YDKL 1E65A 2QMJA 2WVVA 4NKOA 4FL4B 1KGYE 3EAKA 1UA6L 4MS8D 3TJEL 4X6DA 5EU4A 2CBTA 4K3GA 2I27N 4OFYA 2FYYB 3BPOC 4D9RE 1NMCC 4FP8L 3PJLA 2D2CC 3S2CA 3SDYL 1NGWA 3ISWA 1KTLB 3APNA 2ODIA 4U1LB 3VD1A 4DO5A 3WCYA 3QXDB 4NNPH 3PUCA 1OOAA 1A7PL 1MCNA 4PI0A 4F15C 5FOBB 1A1NB 4A6YA 4RMUA 3JUZA 3BEVB 4HMDA 5GS1A 4G6ML 1X9QA 4QXWA 3A22A 1JOIA 1NGZB 1KXVA 1LYQA 4W4OA 4M7JL 2K70A 1M71A 3TBVA 3QG6A 5F0PB 3EYFB 1U2HA 4XMPH 4YUEL 4QRPB 5J8OA 1MVUA 1G9NC 3HE7A 1DLFH 1XL4A 2PO6B 4JO3L 4ZMXA 4OJYA 4NO3B 4M56A 5A16B 2IPTH 4IKJA 3EDDA 1A3LH 1DQDH 4PRDA 3PGCB 2J12B 5AL8A 4Z7NF 3ABGA 1ZK5A 2VL5A 5E2UL 1BOGB 1S7TB 4W9CC 3L3DB 3KPPA 5DJAB 3WNMA 5JDSB 4K8RD 3UPCA 2XVLA 3H0TA 1FO0H 2IMNA 4JM2D 2FBRA 2P42B 4JRYE 3VDAA 2PWGA 1Y18B 4MYWB 4HALA 5IREA 5D6DC 3T6WA 2DZEA 3V10A 4ELDA 4I18A 4IIQA 3EXLA 3NK4A 5I8OL 3FQRA 3HI5L 3CQQA 2IDFA 1UB5B 2JH2A 2BK8A 4ZFZB 1VAHA 1KN4L 5CHNB 1OAUL 1OB1B 1BZ9B 2WANA 4E5XG 1IM3B 2NZIA 5T1MA 3IFNH 4ZUWA 1CFQB 1X5MA 2CKBL 4HKBB 4JDTL 1PTZA 5KSUA 5DJCA 3T6ZA 2RA1A 5BV7H 3FONA 2DMCA 2BIMA 4TRPL 2DTML 4JGJA 1BFTA 4UIKH 4NAJA 1MFNA 5TH2B 5L8KB 1OWRM 4I2XA 4KI1A 2QHRL 2Z0UA 3NVQA 4HS3B 1OPGH 3W0WE 4X4YB 1KSRA 1E5CA 3M88A 2QVIA 1GYVA 1QACA 3ETSA 5DT1H 1ZPUA 1MCHA 3WD5L 4MQXC 1BQLH 4ERSL 1I8AA 3DOIA 1LWJA 1Z5LA 1MZYA 4HUXB 5IFAL 5EF1A 2OMYB 2WXOA 3BAYA 3L3JB 5DRXB 3D06A 4BCZA 2BIOA 3QIWA 4FFYL 4U3HA 5B1CA 1DP0A 3PP4H 1KCBA 4JRFA 3LPGA 3UGUA 5IEHB 4ZPTA 4B95C 3TVMC 1E3ZA 1TSRA 4GRMB 4NQEB 2J20A 3WHE0 3IMWA 4GQZA 3B5GA 1BBJB 5DFVC 2VDKH 1YQ2A 3L9RB 3W9EA 4G80A 3NZHH 4HS6B 2DLHA 5E9AA 3SYQA 4BH8B 4YR6B 3N1GC 4ALAH 3EH4B 4PJFF 3AGWA 3BP7B 3EG9A 5HDBB 4K8RL 5F2FA 3O9WB 2YSTA 4IKKA 1XH3A 1LP9A 4J3XA 1BGXH 4HBCH 2E7BA 2QLVB 4QO1B 4ODSH 4F24A 3K6NA 3ZIMA 3C60D 1TT6A 5E99L 4R6UA 1MHPL 3F12A 3ULUE 3P77A 1ZAGA 3QQDA 2VAJA 4RMTA 1CLZH 1E4JA 3SB3A 2HLAB 3O6KH 5CP7A 2ZCZA 4ODXB 2HWZH 1S9VB 1QW9A 1DQTA 5GJSL 2R83A 1KTLA 3RA7L 1UYWH 1TVBA 5D7JB 5HHOA 4KHXL 5GS1C 2BX5A 1NC2B 5CIPA 1UQSB 4HBQA 3HOGA 5LNGA 3ME0B 5JPNC 1KXVC 1N3NA 4YWGH 4CKQA 3HLKA 3BEVA 3FOMA 4RQQB 3PHSA 4A7GA 4TNFA 4FLQA 3K2MC 4YS4A 5BVPH 3RFZB 4XAWL 1RV6X 5EIIB 1L7IL 3NCJL 1AY1L 1M1XA 3FL7A 2WKOA 2C7FA 3HFFA 3ZU8A 1S5IL 4XCFL 3LEXB 4MNQB 1NKRA 1AKJA 3QIBB 1TIUA 3UJJL 2Y07L 1EHLL 1JDCA 5KTEL 3EFFB 3KPRE 4Q89A 5DRZB 3PGFH 3RIKA 1BREA 3LEVL 5FW8A 1F13A 2VXQA 1GPOL 3BIKB 4KI5E 3LRGA 5E9DA 1L6XA 1SXSA 4RAHA 3DOSB 1HNFA 2N1KA 2R4SL 4R4NC 4Y2OB 4TQPA 2H0EA 1VCBC 3G9VA 5GGRB 4YHYC 1KZQA 3ZQWA 1HYSD 1TOXA 1BOGA 3AG1B 3GBMH 3C08H 3NRQA 2FUQA 2LU3A 1HXKA 4JY4A 4JY5L 1YEKL 3B56A 1N0LA 3L3DA 3OZ9L 1U58B 1JI2A 2V5TA 3FQTB 5EC2A 5T1LB 4P59H 5I8CB 2Z64C 2CO7B 2EO1A 3WBDA 1KGUA 4I18C 4IIQC 1CVSC 3F65A 3N85H 1TJGH 4F92B 4DT2A 2CJUL 3SE9H 1DDHB 4NC1E 4FZ8L 2BCMA 4RDQF 2YRPA 5FFOA 5IVXA 2C3HA 1G7PB 2HZHA 4M5SA 3WTWA 3VXUE 1JYXA 1UB5A 3IDMB 1KCUH 1BAWA 3EZJB 4XPTL 1UM5L 4OU3A 4OQ1A 4OUUB 1CICB 3OX8A 2VQ1B 2G5BB 5EUOF 2NW2B 1DYZA 3ZO0A 1XH1A 1NC4D 4LVNB 1JHTB 4HG4K 2P52A 4I0PA 4U1MA 4LPVA 4OGYH 3TBCA 3R1GH 2L0DA 2UZPA 2Z34A 3ARBA 3ECWA 3ELAT 3MLWH 3B9EA 2R29H 4RSVA 2BDNL 4N8VB 3S98A 2BP8B 3N04A 4LSRH 4GS7C 4HS3A 2EH8H 4JO2H 5ISZA 4YHIB 1PKQE 1KPRB 3KYMB 5FW7A 4UZUA 4WK0B 4GAYB 3DHPA 2HLFD 3E38A 4BSWB 2AXWA 1PFOA 3QIWC 4YOKA 3UO1L 5HSFA 2Z8WC 4HFWB 1Q0YH 4HUXA 2FJHB 2R2EA 3C5JB 3I50L 4XWGL 1J05B 5AWNL 3EBGA 4YBLB 5AOKA 4PJEB 5I26A 1SF5A 1HJCA 2XXGA 4S1SL 4E41D 4YDLC 3HZVB 4ONOA 3HR5A 1NCDH 3S5ZA 1FFPB 3E6HB 1LNUB 4XNXH 3LZRA 4NO2A 1X4ZA 5I8KH 1F5WA 1C16A 5GIRB 4GXVL 1HHHB 4IRSC 1FIGL 3SE3A 3WIFA 4XVOA 3AJ7A 1JZ5A 2F5BL 1JNHB 1KLFB 4X7FC 3SY6A 5EZLA 1I7UB 2GJ6B 4JPIB 4JUSA 5JQ6H 2EE3A 1FBIH 4GRMA 1LTXA 4PJ9B 3KL0A 4BZ1L 1NCJA 5C0FB 3GTVA 4OCRL 1D5ZB 5FYKU 4HXAH 5ANMB 1JZEA 1K8DB 1YEEL 2AV7B 2JJSA 4X4KA 4FFZH 3GO1L 3Q8AA 2F7IA 2Y6SD 3CVBA 4FOMA 12E8L 2W9LA 1UVQB 4N8UA 1DQMH 2R0ZH 5I1GH 1O7DE 1IQDA 1TQWA 2NY5L 2WC7A 1QTSA 3CVHH 4LESA 3UC0L 3HG2A 1KCSL 3NEOA 4DVBA 4HHAB 2V6HA 4OLUL 4JO1H 1GYCA 4FL4C 1FL6A 2HYMA 3MV7D 1KJVB 3VGAB 4TL5A 1HESA 4JN2B 4XVJL 2CLZB 4PJGB 3S5LG 1ZLWH 3ZRCC 3SPGA 4ZUSB 2QKSA 3MJGX 2CR3A 4UTBH 1JHLL 3K2UL 4GKNB 4AENA 2DL2A 3LQAL 1SLWA 3FOLA 1UD5A 2ZYRA 1FWXA 5C0GB 3I3DA 1B4TA 1FNSH 1D7CA 4FKEA 4DTGL 1AGCA 1DR9A 1OGAE 1UQSA 2VN5A 3Q1EA 3WY1A 5M95B 1GGCH 1AZUA 3MV9B 4FQHA 1OARL 4IOFD 4DO6A 4AJWA 5EOCL 4XC1H 3CFJA 3V5HA 5HP5A 1BM3H 2VLRA 1BHGA 3RFZA 5I19H 3S8WA 1HXYA 4A39A 5EIIA 3RGHA 3ZYZA 4D0CB 5TGBA 3KHQA 4WV1B 3HEIB 3G3LA 3X17A 4WTZA 3PAYA 5KUKA 1RUKH 2EEXA 3LEXA 4MNQA 5AD0B 1DZBA 4NENB 4OJFL 1ZIBA 4XMXA 4B9IA 2ZOLB 4ADGA 2E47A 4M29A 3S96A 2YIHA 1KC5H 1C12A 3GXUB 3KPQB 5DRZA 4E9LA 2ESVD 2HB0A 5FF6B 2WUCL 4ILDA 4R4FL 4PIBA 4M48L 3FRPG 2VW4A 5E6ZA 1RU9H 5FO2A 4OTXH 5HDOA 3WFCL 1ZLSH 4Z1PA 2CBQA 5CD3A 2IQAB 4TUJB 4XI5C 5TE6H 1WEJH 5CD5D 3D85B 1WBXB 2YOCA 1YEGL 1G5AA 3V8OA 2IH3B 1AGEB 1QSZA 1FRGH 5C86A 1TTUA 3S0PA 5EO9B 5CINH 2ADIA 1DDHA 5JORA 5FO7A 3RTQB 4ELMA 1U95B 1T0PB 5EWIL 2X6MA 1N7ML 4ZNEE 3SOBL 3VFMA 4PR5A 1F3DH 2I07B 4I0PC 5DS1A 2WZ0A 4HC1A 5GRUL 4YE0A 4FQ2L 1JZ6A 2NNCA 3ARBC 1JHTA 3CC5A 2OKMA 5DD6A 1JNNL 2YWZA 2WO3B 4N8CH 3MNWB 4JBSA 4WUKL 1A21A 1SQMA 4QY8A 3D39D 2F54E 2ZOUA 1E67A 1YN6B 4BE6A 2PPFA 2QL1A 4Z0BL 1OL0A 1T21A 3B9VA 4GAGH 2FVNA 4F91B 4UM8B 5E24E 3EHBB 3KDMA 4GAYA 4KJWD 4N2MA 4FFTA 2WVTA 4MA3B 5D5ME 3HFMH 2IAND 2V2WA 3CCHA 3EBAA 4RGMB 5HHNA 3KPSB 3OM3B 1J05A 4G8IB 1ESOA 3W11C 5G2NA 3LVTA 2BS71 2VN3A 3NJFA 3SE3C 1O0VA 2P5EB 1JN6B 2CCVA 4ZUUB 1VF5C 1GOGA 1SQ2N 1ROCA 2VLKE 4JFOA 5GIRA 4CADA 4HWUA 2GJZA 4XBMA 5EO0B 1O9ZA 4F7PB 1GW6A 3LIUA 3GRGA 4ZTOH 3UABA 3SBWA 2OBGA 2QGEA 4UINL 2X6BA 1M6OA 5E1GA 1JP5A 4BFKA 2YRZA 3ARGB 4I0CC 1HZKA 1XZ0B 5IVZA 1OD7A 1GHFH 1YG9A 4XP6L 4G6FB 1I7ZB 1LD9A 2IPUK 1JPTL 3FF7A 3IT8D 4OW6A 3IDGB 4J3OH 3UZQB 2OL3H 2EC8A 1B4JH 1UVQA 3ARTA 1J48A 1MCPH 4YHPA 5KSBE 5IQNA 3NFNB 4HHAA 1BW8A 5E56A 1E5ZA 1DQLL 3R0MA 4MKTA 2AJZB 5I0YA 4HX1A 4MJ6A 5EU7C 5LGKA 3U9UB 4EZLA 1IAIL 1S7WB 5T8IA 35C8H 3H4FA 2GT9B 1AR1D 2AI0H 4XOEA 1A4AA 1UUSA 1JK9B 3DO3A 2FEEL 3B43A 2OW7A 3LH9A 4GQ9H 5B3NA 3CFDB 5K59E 4E9SA 4U3SA 3CXDH 4HFUH 3VXTB 1QFWI 4AZ8B 5DWUL 1NFIA 2NY0B 4Q4EA 3T1FB 2J21A 3ULVF 3BKJL 3DK0A 5G4MA 4JO4L 3RFZC 5ICUA 3D2UD 4U4BA 3D0LB 4HKJB 3N43F 4MA7L 5AZ2L 3VFPB 3T0ED 1F45A 1A1MA 2VZVA 3CFIC 2E27L 4TNVF 5C0IB 3RU8H 5KS9A 1W8OA 2I69A 4BA0A 1ZPLA 1L0YA 4ZD3L 3BQUA 3ZE1E 4MAYB 3CH8A 1CD9B 3GLEA 4JZOB 3AQZA 2OR7A 3UJIH 5K9QI 1HQ4B 4FQIH 4D0DA 1T66D 3ILPA 1AMXA 1IGJA 1A7QH 1GGYA 1E50A 3HI6L 5H37H 4FA8A 3QC6X 5C2BL 3J7HA 2KPWA 2J4WH 3LD8C 5LAXB 5TFSL 3BSGA 4RGOH 2HX7A 5DSCB 4JM4H 4MB1A 1SHSA 5DMYA 2OMVA 4G7RB 4Z5RA 2MCG1 4XNDA 1S2EA 4YHML 3QUKB 4FXKB 3TESA 4FX5A 2WJ7A 3KWWA 4NAMA 2ZG2A 4K5MA 4PJCF 4LP5A 4Y1AB 3MTXA 2YMOA 3T2NH 4M8QA 3FYIB 5BOJA 5J13C 3I2CH 1EVUA 1V3MA 2BHFA 3ARDD 3HRZA 5DLLA 3D85A 3X13A 1AGFB 1MLCA 4TTDD 2R9HD 2VGLM 4P3CL 5IJDC 4M7LT 5F8RC 1I8MB 4URKA 1P5UA 1WWBX 2YD6A 3PYCA 2YD7A 3MBWB 3UJTL 5KVEH 4D7BA 4JANB 1DJWA 1OQOA 3DV4B 2VR9A 3LDBC 1CL7L 1HL8A 5I30H 3F7VB 3B9AA 1KXTB 3RUGB 5I15H 3VA6A 5D7LA 1KB5B 3MRHA 3TWCH 4LVNC 3LZQA 2ITCB 3BWUC 4FQCH 4P4KB 4X9GA 1NCCL 3P0YL 3SE6A 4UZSA 2P8LA 3CHXA 3MRFA 2ISDA 1NGQH 2WCGA 2CD0A 3K2IA 4GO9A 4IRJD 4TVSa 2E6PA 3QWOB 4ORZC 1OAQH 3MNWA 3CVDA 2Q1EA 2MHAA 3CN3A 3BUPA 3WUWG 1D5XA 2W65B 5HDRA 1AXTH 4RMRA 2GTQA 1UZ6E 3AY4C 3UFIA 1DBAL 1T2XA 1JGDA 4KKAC 1F97A 3BSZL 5HYJB 5IUCA 4FHKA 1EDYA 3BEWB 3SGKA 1WUZA 3K0WA 1FVCA 1M2OA 5CWSA 4UM9B 5E2TH 3TT3L 3S88L 5E2WL 4HOWA 3VB9A 2YSSA 2HRPH 3F5WB 4X50A 4P5TB 1ONQB 4UNTA 1C5BH 4N0UB 5E51A 5FWRA 3G5YB 4PFEA 4AW4A 4GG6B 4MAZA 3X3FL 1OK8A 1S7VA 1T6VN 3QEQD 4L0YA 3S7GA 1RAMA 3F6LA 2AFNA 3SBWC 4NZUL 3HZMA 4NKIH 2EYRB 4JCWA 5EO0A 2AEQL 4C55A 1RJYB 3K46A 4NP9A 4ZMAT 1U3HB 3FQNB 3MO1B 4E9WA 2XU9A 4PP2A 5T5NG 5CXPA 1ZLDA 3UMTA 4X6CA 4MBRA 4QIRA 1HOCB 1QYGL 3EADA 4DGIH 2PW2A 3HZ3A 1GVIA 3WXWH 1VIWA 2ZAHA 1DL7H 2YZ8A 3UZQA 3IDGA 1G1OA 5IW6A 4LL1A 5D70H 1ET5A 4E41E 1CDCA 1DBKL 2AJXH 1KTCA 3QA3A 4R7XA 1ZA3A 2ATKA 3MX0B 5FGCE 3L3HB 3U1QA 2ADGB 2OP4H 3CV5A 3P4MA 4Z18A 4EI5B 5J6HA 4D94A 5JIDA 4M1DH 2UY6A 3Q0HA 1LK3H 1J9QA 2GT9A 3F58H 5FB8B 1MFCH 4W9LC 4XOAA 2BMKB 2FIRT 3ECBB 2GAZB 4JG9A 5E1QA 3IE4A 4M5YH 1OSZB 2ZT9C 5J1AB 4JLRA 4HIJB 4YIQA 5IKCB 4G7QB 4AMWA 2EP6A 4G6AC 5DURD 1HILB 3ZUCA 3E1ZA 1MCWM 2FSEA 4JG0L 1J8HE 5B1BB 3ZXAC 3ZDZB 5K9JL 4JFDB 3II3A 4D7PA 4OCSH 3GIVA 4PJ7A 4WKXA 4MMZB 1T7XA 1QX1A 3PHQB 2WB7A 4WV1C 5K5YA 4BGLA 2C3VB 4S1DC 4AYEC 1RZJH 5LN8A 4U6HA 3H7BB 4TNEA 4OUOA 4JEGB 5EEXA 4NN5B 1T4WA 4KFZC 1TYJA 4UAHA 3QDMA 4LBAA 1DJSA 1ZV2A 4LLWB 3ZIYA 2YPVA 4EKXA 3MOAL 1YNTB 2A6JA 3S3CB 5DSCA 1FNLA 1TZGH 3SO3C 1MRDL 4PY8I 1O5DT 3STLA 5BQDA 5AB0A 5E1AA 1BP3B 4L4TA 3HRZC 1FV1A 4ENED 2ZKMX 1IC4L 1P5UC 1RUPL 4HJJL 1IILE 5KUMA 1E6OL 5IB5A 3QO1B 3HPJA 3OAYH 1FF5A 4CVUA 3RTQC 1AGFA 4AQAA 2B8OT 1SM3H 1FSKC 4R3SA 5FDYA 4N28A 4BKSC 1NLDH 1U8LA 3ILQC 3QQNA 1CT8A 3VXMD 2XVKA 5A2FA 1ERNA 3CUPA 1I75A 1LO4L 1PZCA 5EOCJ 3VFVB 5I18H 3DSFL 3GBNH 4ZMTA 3VXPA 4U7KA 2DJUA 3LVEA 1U30A 1XGTB 2AVGA 1J0ZA 2HG5A 4DUVA 1YEJL 2OTWA 2ESVE 4QRRA 2N1TE 3OF6A 3TURA 3SE8L 4URTB 1XF2B 2VITA 4DN4L 2A5UA 1OB0A 2MPAH 4LPWA 5I1KH 4DGUA 1AO7E 2IDTA 4YK4B 3UTQA 3ZDXB 4G8AC 3HNVH 3LY6A 4F3FB 4JDZB 5AEAA 4JG5A 3OLGA 3A3YB 3R19A 4G9DB 5D7IB 4AIOA 1TLMA 1GGBH 3HTLX 4DFIA 3MKGA 2XG4B 3P73A 4FMKA 4OD1H 1SOQA 4QGTA 4TUOA 5DFAA 3JZYA 1G7JA 5E5LA 2A9NH 3MXWH 3D25A 3X3GH 2VXSL 3KEHA 4RGMC 5TDNB 2X3BA 3E3QC 2LVCA 1FORL 1CTMA 3WEOA 4IM8A 3A6BH 4PWGA 2FL5B 3LNEA 1ONQA 1KBGL 3LKOB 4JQIH 4F2MA 4ES8A 1PZBA 2QPFA 5EORL 1JMXA 3FFDB 4CRPA 3EYUL 5I74B 1A6AB 4J3OG 5SX4I 5GXBB 1CFSB 3IRCA 3TBSA 4M61A 1TENA 3MV11 2EYRA 2KC0A 5IOPA 3GSRA 4NO0D 4MX7A 2D7QA 5HPMB 5IEKA 3KL5A 3OR7A 1BQSA 5FUZH 2A0LC 4HF5L 4MD0B 4OLWH 1J9CT 2H41A 1QNZH 4AWJC 1MFDH 2VAAB 3F7QA 2IANE 1XSJA 2WBWB 1GAFL 3AUVA 3ULVL 3WFHA 5D1XA 3UBFA 1AGBB 4FFWD 4XMUA 1KENL 3B2MA 3CGTA 2X2HA 4MJIB 5IMMA 1BJ1J 4Q7DA 5I9QB 4ZFQA 3WLWD 4AM0A 4JE4B 3DSNB 1EEZA 2B1HL 2VQ4A 3L3HA 3MLPA 3GK8L 2BP0A 1Z0MA 2XTJB 1AFVL 1K8IA 2V5YA 5GGRY 2MNUA 3CDZB 3PWJA 4C8XA 1YEFL 3GMMA 5D1QA 1GS7A 2DWXA 3C9NA 1GIGL 3JWDL 1RKRA 4OF8A 5FB8A 3S36H 5TE4H 4QOKA 3DTUB 4NUGL 3HC3L 4QRQA 4HK3J 3QUZB 4U31A 3UTOA 5KYWA 3ILDA 5H37G 1YJDC 3FULA 4XBGA 3DO7B 2V2TA 1R3HA 4XPAL 3E7JA 3CH1B 3H42L 2CA4A 4TUKL 1WHPA 3GSVB 1R3KA 4M7KH 3P4LA 3WXVL 3ATAA 5SWSB 1K4CA 2Q7AA 5D4IA 4LFHG 1MHHA 1WTLA 1MFUA 4XVTL 1WCBB 3ML9A 3RVTD 5J6GB 3WHXB 4C4UA 4AW7A 4O2FB 4JVUA 3H7BA 2Q9OA 1KCKA 1HKLL 3DGDA 5DA0B 1T1WB 1EZVX 2R23A 1KF9B 4IKIA 4RMBA 2VDLB 4EOWH 2C5DC 4NP4H 2KQNA 3UXFA 5D8JH 2EADA 5CBEB 4UOZA 4KUZL 3W9DA 4CMHC 5TQ0H 2YPLD 3ALXA 3NUKA 2VXTH 2AK4A 1X5GA 4HV8B 1F4WL 1JRHL 4JZJA 3QO0B 3ABZA 4Z3IA 4YBQD 3JTTA 4B27A 3GSOA 3I84A 2H0PA 3FTUA 4ZO8A 3K72B 2E4FA 1YNLL 3T0EE 4M5ZL 3RNQB 4KUCF 3V0JA 5IWLA 3TCLA 3EO0A 4KJQD 1BFSA 3NABH 3B5HA 4GW1B 4KK9C 2GFBB 3GHEH 4K94C 3IPBA 4M7LH 3FFCD 3CAFA 2WXJA 4PJAB 3RILA 5EPMA 4OZ4B 3WLBB 1A6UH 2FH6A 4KKCD 1IAMA 4X7TB 2VMCA 4GW5B 1K72A 3EFOB 4LCWB 3FFOA 3IN0A 4HZ1A 3WTYA 3WTXA 4L0PB 2FBJH 2BS9A 4RBPK 2P1YA 3EDKA 3G6DL 4CSPA 4U1JA 1C5DB 1XF2A 1OTSC 3OKDB 3IPFA 1TYRA 4TNWK 2YKLH 4TSBL 2HPOA 2BC4A 3WNNA 5AVRB 2EILB 5DQJB 4F3FA 2EDRA 2BSEA 4FFYA 4IGBA 2AW2A 2WJ5A 2YAFA 4W9JC 5LNDA 4KX9A 1IE5A 4IU2A 2O5ZL 2EDJA 4DP0X 2H6UA 1ZCRA 1UOVA 4J2XA 1XGYL 2YAEA 4WDIB