2ZOWA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
total genus 38
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2zowA00
5KBLA 1E9QB 1E9PA 2AEOA 3L9EA 2ZKXA 1SDYA 1QUPA 1E9OA 2WWOA 1UXLA 4A7SA 2ZKWA 1OZUA 1SXAA 3GZQA 2VR6A 5CU9A 3QQDB 2GBVA 4A7GF 1FUNA 2Z7UA 3LTVA 1YAZA 1JK9B 3H2QA 5KBKA 3H2PA 3GZOA 1YAIA 3GQFA 1N18A 1UXMA 1B4LA 4N3UA 1EQWA 4L05A 1CB4A 2WYTA 2Z7YA 3GZPA 2C9VA 1IBFA 3K91A 4A7VA 1Z9PA 4FF9A 1Q0EA 4BD4A 2GBTA 1SXNA 1SPDA 1JCVA 5KBMA 2C9SA 3GTTA 4B3EA 1F1DA 2R27A 1F18A 2V0AA 1SXSA 3MNDA 1XSOA 2Z7WA 3HOGA 3F7LA 3QQDA 1E9PB 3ECUA 1RK7A 4OH2A 1SOSA 3MKGA 2E46A 3PU7A 2K4WA 3KM2A 3KH3A 3SODB 1XTLA 1MFMA 1CBJA 1S4IA 2JCWA 3RE0A 1TO4A 4A7GA 3L9YA 3ECVA 2AF2A 1BZOA 2AQPA 2WKOA 2AQSA 2ZOWA 3T5WA 4BCZA 1COBA 2Z7ZA 4U4IA 2WZ6A 3CE1A 1OEZW 1F1GA 1PZSA 3CQQA 2Q2LA 1E9QA 4BCYA 1IBDA 1OZTG 1DSWA 1P1VA 2XJLA 1OAJA 2AQQA 2C9UA 3KBEA 2AQTA 3HFFA 1E9OB 1TO5A 2VR8A 2AQNA 2SODB 1HL4A 4A7UA 2GBUA 1HL5A 3ECWA 1DO5A 1ESOA 1JK9A 2E47A 4MCNA 1U3NA 1OALA 2ZKYA 1EJ8A 2WZ5A 2XJKA 3CQPA 4MCMA 1KMGA 3KM1A 1Z9NA 2NNXA 3GTVA 1SXCA 3HW7A 3KBFA 1YSOA 1IBBA 1IB5A 2WKOF 2APSA 1PU0A 2VR7A 2WYZA 4A7QA 3F7KA 4OJAA 4N3TA 1N19A 1BA9A 1SRDA 2WZ0A 1IBHA 1AZVA 4A7TA 2JLPA 2WWNA 1SXZA 1F1AA 1XTMA 2LU5A 3KH4A 1SXBA 3S0PA 1PTZA 1SDAB 2AQRA 1L3NA 1B4TA
chains in the Genus database with same CATH superfamily
1B0GB 2FAUA 5HHPB 4EVNB 5DDHA 4PJ5B 4OCRH 1W0VB 2HT4D 2AK4A 3TN0C 2H3NA 4ZAKB 4FFYA 1MQKH 2YMOA 4X83A 1FUNA 3I9GL 4JO8A 1SN2A 3N42F 2E7LC 1W16A 2W9DL 5AW8B 3FN0L 3F6LA 3UIYA 4J3TA 3VXSD 2ZWKA 3MRLB 3OXSB 3BRGC 1EAJA 4M62H 4NO0A 4N3UA 4N2DA 4RMTA 4WKZA 3SQOL 4Z7QE 1RMFH 3PXLA 1GYWA 1NCWL 4HK0A 5IVXA 2XZAL 4UQBA 5FYLD 3QUYC 3HMXH 5GGSB 2IH1A 3V0VB 5TPWL 1CYXA 3QWOB 4PJDB 5E94A 5KUMA 3AGWA 3MREB 3KYKH 4LL4A 5F9JA 1MWAH 5DT1H 4C83B 3VJ6B 2WP3O 3VW3H 1NBYA 2BP0A 4R7DB 4EIGB 1U3YA 3QT2A 4PJ7E 5IJKC 5I1IL 1S3RA 1S9XA 3L3OC 3UBFA 2VIRA 3QXVA 2TSBA 2VXQA 3HG0A 4R26L 3LPFA 4K7PL 5J11C 3H3PH 1A4KA 3OB8A 4JG9A 3NJMA 3QIWC 1O5PA 5E2JA 4DGYL 4CVWA 1QATA 5FV1L 1CF1A 4LCWA 4DESA 3CZUB 1IL1B 1WCQA 3IKKA 1MH5B 3MZGB 4N9GB 2CBPA 4NPJA 4JCWA 4HCFA 2E7CA 1MI5A 5EU3A 3T0BA 2F8XC 2HFTA 4UYQA 2ZXQA 3W3BA 5IB3B 2R2CA 1KGYE 2A6DA 3RPKA 4P3CH 1TENA 2W65A 2A74A 1KTLA 4BXSV 2W0FB 1HZHL 1HOCB 3HHSB 1RPUA 2L7EA 1OP3K 1MI5D 1A14L 4KMTH 4NN5C 3LDBB 1D2OA 2PR9A 5HDBB 2O6FA 1WV7T 2Y2WA 4KKLD 4D8PA 5B7MA 3VD1A 4X0KB 3VH8G 3GSNB 2YD7A 4M8VA 1YYML 1DVFB 3B2DC 5IV2A 4DQOL 3CNKA 1WHOA 4IRZL 4LQFL 4Y4KA 4RNRB 3BUIA 1EFXD 2ESVE 5DFVC 3TN0B 3WV0A 2KDYA 3QSKB 1KF9B 2VR5A 4KGJA 1NIAA 1KLUB 1LK3L 4XAWL 3O6LL 1A7NH 5KOMC 1JN6B 3ROOA 1U21A 4XGZA 4YSOA 5AKSA 3T8XB 4A7TA 4WUUA 3SKUD 2MCMA 1Z5LB 4XB8A 1JS4A 1XF1A 3QDMB 1YO4A 4YO0B 1EUUA 5JOPE 1Z32X 2QVMA 5JIKA 3BH9A 3D18B 4NNXA 3QUYB 4ZO7A 5I1CH 1FZJA 4QCIA 5C7XH 3QE5A 3VXNB 4DP2X 5IHUL 1PIFA 4KKCC 3PHQA 1PSKL 3QQDB 1KIUA 3TPKA 2RR3A 4HDIA 4M5TA 3AW5A 1QSVA 2V9RA 2X4QB 1JL8A 3L3OB 4MVBD 1XBDA 3TL5A 4LBEB 5E00A 4HUMB 1IBGL 2A9BA 3M46A 3WIIH 3QEGL 2F54D 5J11B 1SHXA 3DYMA 3AAZA 1ZOXA 3SBRA 5HHOB 1I9RL 3HLKA 1G9ML 3QIWB 1C08B 3U83A 3NFNB 1DDHA 2LW3A 2OMTA 4XBGB 3V4UH 5D72H 1OP3H 4WENB 4NAMA 3ASOB 3ULVH 4FFYH 3EJJX 3OGCA 5IWLA 4RMUA 1YECL 2A9CA 3MLSL 1A7RH 3HE6C 4N0UE 3TIDA 3SDYH 5IQ7L 3WJLA 2D3VA 5E8EA 1IGIL 2UY6B 4PFEA 3MCKA 1URIA 3HG5A 4H25B 1NCGA 1WA1X 4R96B 1RZKH 3M07A 4YDVB 2OMNA 4NN5B 3RNQA 5J57B 4JM2D 4LO9A 5IFAL 4TQHA 3STZA 3P9LB 2K78A 3K2IA 3UG3A 2CXKA 2H9GB 3I50H 3KH3A 3KPOB 5G55A 5IW6B 5KVFH 3FQYA 1OE3A 1NCDL 4XCNB 2FWUA 3OXRB 4N1HB 1BQKA 3BYYA 3QNYA 4AOFA 4ENEC 1MG2C 3RPIA 3ATBA 3BAIA 1Y18A 3T08A 5L6YL 4W6WB 3VXQB 4XC3L 1XHHA 1WTLA 3V8CA 5KSUA 3VYOA 1T22A 4M02A 2MQ3A 5IBTH 2VXQH 4NKDA 3QEUA 1NEZA 1X5ZA 4HHGA 3V4PA 1YZZA 3ZSTA 4XB7A 5FV2A 2B3IA 1KGCE 1TTBA 3EJRA 4YS4A 2AITA 4LF3A 4ZTOL 2QSTA 5GHWH 2MQ0A 2EDBA 5IUCA 1NMCC 4PJXA 3PHAA 1CDJA 2VAJA 2OJEB 1SYVB 2PF6A 3BJLA 5EBGA 3PWPE 4FQCL 3AT9A 3DHMA 4YHIB 4Z3GA 2VRKA 4OCRL 1NOAA 3VSQA 1DR9A 2NY6D 4URKA 4XAKD 1MQKL 2DLFH 32C2A 3KD4A 4LDCA 2JIXB 3QR2A 5ACMA 3BW9A 1J05B 1ZWIA 1WZ1H 4HQQH 5M95B 3DETC 3TBTA 5F8QC 1V54B 5HYFA 1HCVA 3A21A 3TBWA 5LB1A 4AMWA 1FC1A 3TVMC 2V8MA 3CH8A 1RZIA 6TAAA 4M62L 3MUUA 4NDMB 1F90H 1YA5A 5CR1A 1K85A 4PS8A 1RMFL 3BOVA 1ZVNA 2VRAA 1G7QB 2AXFB 3HMXL 4MMXA 4JQXA 3BUPA 1SDYA 2COVD 5DJZB 4G1MB 5C0AA 3JV4B 1TTAA 3TNMB 3LKRA 4HS3B 1SXAA 3KYKL 2ENQA 1UXSB 1MWAL 3IMSA 5DT1L 3VDCA 4FAAB 5AENA 3VW3L 3UTZB 5TF0A 3P30H 5DO2C 3HE6B 4KZ0A 4NIYE 4PJCE 1EBPA 2H26B 3RVWC 4C4KT 1UM4H 3S35H 2GJPA 1TKWA 1CG9B 2X1PA 4DTGH 3H3PL 3MCYA 1HSBA 5CS7A 4KQ4H 3ARBD 4FQJH 1PLAA 4N8PA 4AGLA 2EH7H 5GZNA 2XCMC 2Q76B 1BLIA 3MV9A 4X7TA 3FTYA 4JANB 4AE0A 1I3VA 4KDTC 2MRYA 5L8KB 1SMDA 3RFZC 1YEDB 1T0OA 3EJCA 4XN7A 5GZND 1F1DA 4H0LC 1CGTA 4UDUA 2QQNH 3CDYA 4P3CL 4F8LA 1YPZA 1CO1A 1KXQA 3IS0X 2DQJH 2NY3C 4M6NH 2Y7OA 4K4KA 3T6QC 4KMTL 2BHUA 4GXUN 4JFEE 4PJBA 2YFOA 4I0KA 3QUHA 4UBDC 3NA9H 2B1AH 1MLBB 4PRPA 1NH6A 1NMCB 1HJBC 4A7GA 5T8IA 1E4XI 4NKMB 2BSRA 4JFDA 5AW3B 5FW8A 5JIHA 2MIZA 5DK0A 2OULB 3D33A 5J6HA 4N2BA 3PABB 1P84K 2YUWA 5E1GA 5DUJA 5AOJA 3RL1A 4DF9A 1A7NL 2HB0A 5DUMH 5I66A 4G70B 4HT1H 4IS6A 3RVTD 4XT1C 3PRZA 4IHOB 2R1XB 4NNPH 4F7PA 3TVMB 3WHXB 4YVNA 3D12B 3BVNB 3BVVA 2EC9T 4J28A 3RWDA 5I1CL 4K5OA 3O3AA 5C7XL 3OPUA 2X4TA 2X9ZA 1I9EA 3GNMH 2P80A 3C87A 3GMLB 4MRBA 1LD9B 1KJMB 4P2OA 1PCXA 3O3UN 1UA7A 3V4PH 1EZSA 3GSVB 1KEMH 3N41F 2A38A 3GSQB 2F19H 4NO2B 5B8CA 5EEUA 4OJAA 4X5WA 4BXVA 5DJXA 2EEFA 2X5PA 5E70A 3BIAX 1GKEA 3MBWA 4ZZFA 4GXVH 4F8PA 5HGHB 3SDAA 4PGDB 3VD5A 4PWFA 3WIIL 3TYFB 4G7YH 4UILL 4ETQB 2CXGA 1JHTB 3CPLB 1HK6A 2E9BA 2VERN 4HIXH 1PZ5A 2E4TA 3DV6B 3AADB 3FJTA 4P4RB 1OCOB 2X4UA 1AO7E 3MGOB 3MNMA 5E1AB 2AXGB 1E9OA 3WEXA 3V4UL 3EYUH 1SN5A 5KYYB 5D72L 5EG6C 3ULVL 3EGDA 4FFYL 3Q2LA 4L4VD 5T1MA 1D5BA 3RFZB 1ZIAA 1A7RL 4R84A 3FB7B 3SDYL 2KLRA 2VB5A 3DRTA 3ZYZA 1ODAA 1NLDH 1Q90A 4XP4H 5JW4N 2NY3B 1RZKL 2BSSB 3DX8B 1KFGA 3EF4A 4ORZC 4KO5A 4C4UA 4X6FA 1E65A 3I50L 1OAZH 3C8HA 3UEQA 5KVFL 2BCKB 3CCHB 2W0PA 3PHOA 3AQZA 3VD2A 2ITFA 3OWEA 4LCCA 4XNZC 5DHVB 2F8VA 5MEQA 4M5YH 5HHPA 4EVNA 2B9BA 3QORD 4JKNA 3H9SD 5IBTL 1MHEB 1Q1JH 4WFHE 2VXQL 4I2XA 5FM5M 1AKPA 4EUPG 1BHGA 1QLEB 1E9PB 1B90A 2WBKA 3HZYB 3FT3B 2BS8A 2DF3A 3NEEA 1EXGA 3O81A 3OQ3B 4TQPA 5GHWL 3RX7A 1OF0A 4H1LB 3SODB 4FXLA 3DX0A 5FW7A 3MA7B 4TLKA 1Z9SB 1NQBA 4HG4K 1M05B 3O4LA 2WWMD 1DBJH 1ZV9A 3PQYA 1SOKA 5GGSA 2NW2B 3FBQA 1WZAA 4HS8H 6CGTA 3CSFA 4PJDA 3VFVB 1H8LA 4DPRA 4HQQL 1WZ1L 2FECI 3AG3B 3O4LD 1J8HA 4FYSA 4LRIA 3VJ6A 3X11B 5AOZA 4F9PC 4Z95H 1N8ZB 3I3EA 4D7PA 3S9DB 2GAZA 1F90L 4CKQA 3ARDA 3UYPB 1H0DB 2Y7SA 4DW2H 1CTMA 3FNKA 1D7DA 1PQZB 4DFIA 5ADPH 3QI9D 2Z65C 4XMXA 1JDCA 5A16A 1VHPA 4TNVK 1MCIA 1IL1A 3HNTH 4E5XB 3FAWA 1MH5A 2CRYA 1KIQB 2HG0A 1I53A 1MOEA 12E8L 2XV0A 3P30L 5JPMA 5HHQA 1FO0B 1PKQA 3O45A 2FO4A 2XY2A 1OSZA 4Q74A 5D96C 1FPTH 4QO1A 1UM4L 3S35L 2BVOB 3KH4A 9PCYA 1QRNE 4DTGL 4IU3B 2DH3A 3ZUNC 3HHSA 3GMQB 4FQJL 4KQ4L 5E4IA 2X4NA 1Z6JT 4LSDA 2EH7L 1Z0NA 3SCMC 1TEYA 3B2MA 4BHUA 1FH2A 3K6DA 3K3QA 3FRPG 4XNZB 4IW4C 3BEVB 2QQNL 4Z7VE 3H53A 3TN0A 1M56B 5MP6H 1PX3A 2DQJL 4M6NL 1NAMB 4OGXH 2HRLA 1WISA 1A7PH 2Z4QA 2H1LM 3HPLA 3GXIA 3TBSA 1WE5A 3MDJA 3NA9L 3GXPA 4XP5H 2B1AL 3PS6A 4U1NB 2P5WE 3DJSA 5HGBB 1KCSH 2OQJB 4YO0A 1NCAH 3IJEB 3M45A 1IFHH 4MNHA 4QRPA 3OAUH 4HW6A 4YSTA 3FCTA 4YSRA 2DTSA 5E2VH 1JFQH 1FG2B 3VXNA 4WFFE 3AG1B 1JDDA 2L8AA 2OZ4A 3X17A 3OX8B 3QQDA 5KVDE 4HIHA 4UOJA 2QZ5A 1MCCA 5DUML 3NZ8A 4HT1L 4JFFE 2FQEA 4NNPL 2R9HC 1KJVB 1NMBH 3TJHC 4B41A 3LNDA 4ANXA 2PN5A 2XRAH 5K59E 2C34A 1MCFA 1OB1A 2CUMA 4MJIE 2NY2D 4X5RA 1ACCA 5HHOA 5I6KA 4IBVA 1BV8A 4QJ3B 3GNML 5DHYA 3V6ZB 1N6UA 2QQQA 4N0YH 3VXPA 1NCUA 2NYZA 4AW7A 1MDTA 2C9PA 2KT6A 4XBGA 4R4NC 2QZQA 3V4PL 4FQ1H 1KEML 2F19L 1FV1A 1USQA 1B3JA 2MHAB 1XSKA 3HFFA 4GXVL 4NUQA 2X4SB 5D96B 3ZMNA 2WW8A 4G7YL 2AQNA 1EANA 3M7OA 3F6IA 4OIBA 4UI2A 3UTTB 3VXSE 3P4NB 4HIXL 3UG4A 5CEXA 5DA0B 1NGQH 4H25A 5KVEH 4R96A 4IK6A 4XZUB 4HWUA 1QSED 1HN1A 3V5HA 3CFTA 2EVGA 3SCMB 3P9LA 3EYUL 5FYLE 3TTSA 3KPOA 1WFNA 2GFBA 4DUWA 4F5CA 3DUSB 1WFMA 1A64A 4XCNA 3H7BA 1EH9A 4G83A 1JMZA 3WNKA 1CXKA 3FU9A 1ZGLB 2JK5A 1IAKB 3H3KA 2NX5B 4PJFB 4ZQTA 1NLDL 2YD2A 2XQYA 4XP4L 3TA3C 4MMZC 5DA4A 2CAKA 2G5BA 2HX9A 1M1XA 5C0FB 1DDTA 2VDKB 1KCUH 4QRTB 4PUBH 1E9QB 1OAZL 3QNXB 3QUMB 1KYOJ 4PHXA 1Y0LB 5AG9A 1NKGA 4LAJH 4U1IA 3VXOA 2J73A 3MA9H 1P4IH 2CHZA 3V6FB 1XIWD 3VTTA 2YOCA 5ITBH 5FO7A 3Q43A 3SDCA 3K1KC 1SYVA 4Z77B 3KVQA 2KLSA 4M5YL 5E2TH 4ES8A 4HHWA 4YHIA 3HN8A 4JUTA 4OIAA 4PRHB 2BNQD 1OAKH 1Q1JL 5DZLA 2HLAB 1KTKE 4L0YA 3DROA 3SDCD 2I7SA 5IFJA 1CFMA 2EDTA 3WE1A 1J05A 1F3JB 2MJWA 5FYJU 4EN3C 2H3XC 2FJGA 4OD2B 2HPTA 1MI5E 4FXKC 5GPRA 2XBTA 4D0DB 3AT8A 1F3DH 1T2JA 1RZFH 1PLCA 5I6OA 3C6LD 1U8QB 3D4CA 1RFDH 4RRPA 2FSDA 3FOLB 2H0PA 2GTWB 3DPBB 4KROC 1DBJL 4P07A 1G7QA 3WY3A 2FWSA 3AG4B 3D34A 1XR8B 1ORSA 4HS8L 1ZA6A 4Y16C 1F18A 5DJZA 4G1MA 3G08A 3D69B 3IAQA 2BPBA 4HS3A 4HX1A 4XOAA 1AGBB 3QO1B 5JZ7C 4DFHA 2Y36H 1YC7A 3O3DB 1Q9OB 4Z95L 3UTZA 1GVIA 1I7UA 2X0VA 4U33A 4IKKA 5IB1B 4MD0B 3EH3B 4JDEB 3WUWA 4NWTH 3VXRD 2CUAA 2JV6A 4JPWH 4DW2L 3AXIA 1T1YB 4X9YA 2XQYK 5ADPL 1FDLH 3MV7A 4TNVF 5DLLA 3KPPB 4F2FA 3HZVA 3HRZA 1QWUA 5D6DA 3SGJA 5I8KH 1F1GA 3HB3C 4WWOA 3QDJB 2Q76A 1RIVH 5E9AA 4UQ9A 3HNTL 5K39B 1XF4A 2OZ4H 4QHPA 3FSOA 3CU1A 3OC8A 4PLNC 1IILE 2Y2YA 1W0WB 3UXFA 4ZMVA 2VLRB 4ONHA 1YEDA 1FPTL 3CDGB 4LU5H 3GMPA 4LVEA 1BVOA 1L6PA 1CFTA 4QF1B 3TA3B 1MUJA 4MMZB 2X6VA 3TZVA 1VIWA 5B7FA 5H37A 4YFEA 4O2CA 1JK9A 5DZ9A 3V4VB 2YBRB 1UFGA 1N6QL 1VGKA 5IM7B 2F54E 3CBRA 3SD2A 1GGYA 5JHDD 2WXPA 3AZUA 1MSPA 1PF3A 4AH2A 5T5NF 2OA9A 2FZ3B 1ASPA 3PP3H 1TU2A 5AVVB 3QRFM 2BVQA 2HT3C 1DQKA 4NKMA 1NDGB 2ADJB 3US0A 4XRCB 1VFBA 3FUDA 4FNUA 5CBEB 5MP6L 2EDMA 4OGXL 2WWKO 4XOCA 2C4XA 3FCUB 1A7PL 4S1SH 5ESAB 3LH9A 2BOCA 4EN3B 5KBLA 4FXKB 3NJGA 1CE6A 3DJTA 4XP5L 2AAVA 2IH9A 3RUGE 4J27A 1S3KH 1KCSL 1K6QH 3BVNA 3FQTB 3WS6A 1NCAL 2TRHA 2FDBP 2M1KA 1IFHL 4KROB 3OAUL 1UB5B 4HAFA 1NANI 1UGNA 2H2PD 1JFQL 4Y16B 2XTLA 4MHHG 1YNTF 2JQAA 3GMLA 5L2KB 3QISA 1B4LA 5CNHA 2V6HA 3GSQA 3LPWA 4GKZA 1DLFH 1AKJD 1NCCH 1UOWA 2C9VA 4XH2B 4KNUA 1NMBL 2JQMA 1M71B 3TYFA 3UCQA 2XRAL 2P5EB 2KMWA 4FI7A 4M61B 4XNUH 1CDIA 1OARH 3UL4A 2VGLM 4P4RA 1XL6A 1DUZB 4JZOA 4YR6A 3ALWA 3MGOA 5FGCB 4N0YL 1N5YL 3TEXA 3HB3B 5A6LA 4OV5B 1YUHB 2J2ZB 5KYYA 1HYSD 4FQ1L 4XAKE 3OJDA 2BXYA 4KDTA 4Z78B 2Y5EA 4N4YB 4HAKA 5GSVB 3IF1B 3RFZA 2XNAA 1EEZA 1SGKA 1KG0B 4YSDA 4XX5A 5AQ0A 3PWUB 1FP5A 1NGQL 2LQRA 4X9GA 3L1EA 1XCWA 5DK2B 5KVEL 1A02N 1CL7H 5IMOB 3P40A 1YY9D 3APFA 1R6VA 4U4IA 4RFNC 2VM3A 4TLUA 4IEFB 4HOZA 4FFZA 3Q48A 3B9KA 15C8H 1KLGA 4MS8D 3U9UB 4AV0A 1MCBA 3KLHC 1A3QA 3CU7A 1KXVC 5I0VA 3DYOA 3IRZA 1M57B 1YEJH 2VXTH 2JVUA 3AITA 4AQ1C 4QWWD 3REVA 5TJWK 3B9KD 4LE8A 1GSKA 2P42B 5CBAB 3CMGA 1KCUL 3U36B 4NLHA 4PUBL 2WTRB 3WE6A 4ELKA 5HHNB 3MA9L 1P4IL 4YXHH 3VGDA 1GJIA 4GQRA 5B3JF 4HULB 5ITBL 5BW7C 1YSOA 2B8OT 3MA7A 1Z9SA 4IBZA 1IFGA 5E2TL 2IALB 4OQTA 4YH6A 1N2RB 3KLKA 4K07A 1OAKL 3VM7A 1N0LA 3PGDB 3W0WB 4G2AA 3K46A 8PAZA 2Y4SA 3VRIA 4A39A 3SE3C 3UTPD 4KX8A 4OB5H 5H37H 5K1JA 2E59A 3CMOH 5ANMB 3VI4B 3X11A 4P2CG 2ATKB 1RZFL 1WFUA 3OHMB 2OTUA 1EEQA 1RFDL 2G2RA 2D2CC 3CC5A 2IOOA 1H0DA 1UG9A 2XWXA 1PQZA 5E1IA 3MRFB 4G8EB 5EIQA 3W1ZA 4P23D 4WZ9A 5D1QC 3PJSB 3O6FD 4S1DC 4JNXA 2LU7A 3DKHA 1ROWA 1NIFA 2Y36L 4E5XA 1VPOH 1EHAA 2TSAA 2ICES 1PIGA 3T04D 2ADGB 4NQDD 4NWTL 2F61A 3KPSB 3VWKA 4P5MB 1D3CA 1FH5H 4JPWL 3V5KA 4BK5C 3SYCA 1FDLL 3LN4B 5D7JB 2VUOA 4H20H 2BCMA 5E8DH 1BQLH 1DE4A 5F89A 2V2TB 3MX0B 5I8KL 1FHNA 3HKFA 4RFNB 3EZJB 3F7YA 4NCC2 1MF2H 1RIVL 1YQVH 4MD5B 1BLNA 2ERJC 2OZ4L 4FQXA 1K3IA 2WLJA 4UZSA 4R5XA 2B3RA 4F7TB 3VXUD 2CGZA 3F05A 3HHRB 1D5MA 2ALAA 4LU5L 4GS7C 5G2NA 4AQ1B 2MNWA 5ABAA 2Q87A 1L4IA 2X9XA 1SYSA 3KGTA 1TZGH 2X3AA 2X2HA 3MQIA 1O6TA 2AQ2A 3BFQG 4FKHA 3L9YA 4WO0A 3JWNH 3V0GA 2C9AA 3LX9A 2HSIA 2YJQA 4DEUA 2NNCA 4RQQA 1ONQA 2WQ8A 4YEEA 4MX7A 1XGPB 4AGQA 5HBBA 2IH8A 5HGBA 2EYTA 3PDGA 4PJ9D 1JWMB 5DMYA 5KANI 1HHHA 1ORQB 1Z9MA 4L4VE 5ICYA 4PS3A 1PY9A 1CDCA 1TTFA 2D0FA 3D3VA 1T21B 1HH6B 4Q2ZB 1Q8MA 2BERA 2YGPA 4JPKH 1NIBA 3MUJA 5AAWA 1AH1A 2J72A 2VCOA 5JLZB 4S1SL 1NC2D 1PZAA 3Q2CA 2X44D 5IROD 2E47A 3VH8B 1JZ2A 4ZNEE 4NNYA 1R19A 4F9PA 5EZOH 4ZFFB 2FYYB 5IEKB 1BFVH 4X5QA 5HGDA 3LKNA 1S3KL 5KJ4A 4H44C 4FX5A 4U05A 1ET8A 1K6QL 1ZT7B 1KJVA 2CDGB 2A3TA 2WC7A 3LNIA 4LLQB 3EJTA 5DJDB 5CZRA 1F4XL 1ZSHA 3WU1A 4FFZH 4P2RB 3SGDH 4LPVA 4AUUA 1WG3A 1TJHH 4DP5X 3V6ZA 5D1QB 3K71B 2W5PA 3TASA 1J8KA 5C70A 5JIIA 2WXFA 3VA6A 3NIGE 1NM4A 1T7XA 1KTDB 3H9SE 1DQJB 3F04A 5A3ID 2XWDA 1DLFL 2P26A 4JRXB 1NCCL 1B6DA 2NY1C 4YNYA 3KLSA 5KVMC 1N26A 2MHAA 5L4MA 4Z7IA 2X4SA 1QUPA 1FNEB 1AFVH 4KTDH 3UTTA 1GW0A 2KDGA 3P4NA 3IDYC 4XNUL 2WBJA 4FULA 1OARL 1NJ9B 4MZIA 2ZSWA 4M6AA 4OQTH 1R4XA 3V7AG 4TUUA 3MRRB 5EZPA 5FWQA 3SCMA 4ZMAT 4RSVA 5AB1A 3UTSB 2ERJB 4JRLA 3NJHA 4PBDA 2WBJD 2WGNB 4OFDA 3T3PF 1RIUH 4Z7UA 5KVEE 5KW9H 3K4AA 5GS1C 2CGYA 4GS7B 3O4LE 4MAYC 1IBFA 2EDKA 1T1WB 5ACZB 2NQCA 2VWEE 3HUJB 4PJFA 4W9HC 3BP7A 4PS7A 4KQ3H 4DWHA 5EBMB 5FM4A 1CL7L 4OBSA 5CAYB 4JFPB 5J12C 1JCVA 1RP9A 4QRTA 5KJ7E 5FDYA 3K6FA 2R27A 1Y0LA 2PKDA 4G3YH 4UMSA 2UZYA 2Z91B 3NSFA 4TLTA 3V6FA 3DOHA 3G5XA 1C5CH 15C8L 2VLKA 3EYOB 1FFOB 4G11A 3AFLA 2X2UA 4TNEA 1YEJL 4I0PD 2VXTL 4V2BA 4XTRC 3BSZA 2PCYA 3FTGA 2KHAA 3MMEA 3B5GA 2HLAA 3L4TA 3P2DA 4PCYA 1X5JA 3JV5A 1FIEA 5A6MA 3HTLX 1UZGA 3QQ3B 3NSXA 4K3HA 3KPTA 3ZR5A 1SBSH 1Y07A 2HG5B 2NDFA 4OD2A 1PKQE 5DC0A 4YXHL 4MYWB 3UO8B 5I6MA 3N3EA 1MHCA 2IV9A 3H1ZA 4PWGA 5FPIA 4CBZA 3NDYE 1U8QA 1XB8A 3HG1A 2YO3A 1A9EB 3GPSA 4PGCA 1WGVA 2AQ3A 4MNGE 2ZOTA 4ODSH 5C07D 1FL6B 2Q86B 1TMQA 1XR8A 4BWTA 3D69A 4OB5L 3TTYA 4L3AA 1AGBA 3QO1A 2CDFB 4ZW6A 3CMOL 4N90D 2NY1B 5ENWA 4MCMA 1Q9OA 2WCSA 5CLWA 1DN2A 3VE0A 1HNGA 2ZT9C 3KBPA 2EKSB 1XCXA 4MD0A 5EF2A 3QJQB 5D1ZC 3IDYB 4YXKH 3D4YA 1I85C 1T1YA 3BZ4B 3LZPA 1CI3M 4LZKA 2BFVH 1T5XB 4Z7WE 2F15A 1O9WA 3IFLH 4IDLA 5FYKD 2YN3A 5EA0H 5K39A 1C7TA 3EJUA 4OGYH 1VPOL 2JTDA 5C0BE 3HMWH 3TBVB 5GS1B 1IVTA 1W0WA 4JN1H 3FQXB 4MAYB 4KMQA 3CDGA 2BW4A 4U1MB 2F7PA 1FH5L 4RIRA 2FLBT 3KGSA 2YUXA 5IGXH 1IJNA 4H20L 4ALAC 5E8DL 5J12B 4PPTA 2YBRA 3CAFA 4WEUD 1BAFH 1Y6MR 1RPQA 3IWUA 4P57B 1KCWA 3GIVA 2DJ4A 1MF2L 1YQVL 2UYLB 4OCWH 2WTPA 1MCQA 3OHXC 4PU2A 1MJJB 3H9HB 3L8QA 1BZ7B 2Z6FA 3MUGB 2FZ3A 3GBDA 4RFOH 2YUZA 2CD0A 2C3GA 1AQHA 2CJSA 2BIQA 4MD4B 4ES9A 1NDGA 2ADJA 5GGQH 4G8IB 1W72A 5HHMD 3FQUB 1TZGL 2YXMA 4R7NB 1I1FA 2HH0L 3PUUA 3C6SB 2JCCB 2OS7A 4MJ4A 4ZSOE 1FVCB 3CZFA 2JKSA 1P84J 3QZWB 4QLRA 4PJAA 4ZD3H 2VLJA 3ASNB 4FXKA 2FWLB 1QSEE 1U58B 3EGXB 3L2NA 2JJSA 5LN4A 4ODTH 4AW4A 4B9FA 2UWEA 2QTVA 4YDZA 5DJYA 1FVEA 1OLZA 3V6OC 1BG9A 4UTCA 5F72S 1L9PA 5L2JB 4JPKL 4YDIH 4Y16A 4M5SA 2CA3A 2BNUA 4JLRB 1Q9WB 4I13B 4YGVA 5C0ND 3WS3A 4CVZB 3HRPA 3IEAA 3UJJH 3ULAB 4F5CE 1ZK9A 3SD5A 4NC1C 5EZOL 3V52H 3QG6B 1BFVL 2VDKH 2X12A 3N43F 4XZ4A 3LIUA 5C0JB 5I1EH 1AG6A 2E56A 2J1WA 4ZXBA 5D1ZB 1M71A 3VU1A 1U8OB 3FO0H 3VI3A 4FFZL 4YEFA 1W8EA 1TJHL 4FQIH 3FAXA 4FCHA 1DUZA 3ILPB 3UMNA 3BSZH 2BNQE 2ZYHA 3QJXA 1URZA 3DX2A 3DBXA 4L8CA 1BM3H 4LKCB 5CZVH 1UASA 5SWSB 3WDIA 4XCYA 4BQ9A 2XN9B 4DPAX 5EPMA 1ZHBB 4OSUH 3ZTJH 1AFVL 4KTDL 1IAIH 2E6PA 3H85A 4V1DD 1RZJH 4GKLA 3BSGA 4OCNC 4S1RL 4P2QA 3X1FA 5TQ2H 4OQTL 3BPNC 3IJSA 5ACLA 3OHXB 2B7DT 4JQVC 1H8OA 2QPEB 4JE4B 3GIZH 1TF4A 5I8EB 2OSXA 5DZNA 1RIUL 2GITA 3OC5A 3BLKA 5KW9L 2XZCH 1BW8A 4OLXH 1GGUA 5FWRA 3WN5A 3NIDE 5JOFB 4H2CA 4KQ3L 4YHZH 3VRJB 3SYAA 2HTLD 2A6JA 5FYKH 1HNYA 2XVGA 1CFSB 2RCSH 3VXRE 4K9EH 2WZAA 3VMNA 1FYTD 4G3YL 4XCEA 3WN6A 3WIAA 2VN7A 3GBEA 1T7YA 2V37A 1C5CL 1I1YB 4I4WA 3U1QA 1N59A 4JGMA 4KK5C 2NNRA 1BWWA 5D9SA 2BSDA 3GMRB 4WWID 1N2RA 4BUHA 1SF5A 2BC4B 3PGDA 3W0WA 4O2FA 3KXFD 3V9FA 4ELMA 4PSRA 3SHSA 2A7BA 5F3FA 1J9CT 1ZT1B 2XTJD 1SBSL 2CRMA 4HKXB 5ANMA 3K6SB 5BPPA 4HOWA 5JHDE 4BH8A 2EE0A 3HN5A 5FK9A 4ODSL 1EGJA 4HYTB 4CUCA 3MRFA 3QO0B 3FDWA 1LNUB 1XGUB 1W72H 5DEFB 1GOFA 3EYVB 2XWTB 3IBOA 3N1PC 3UPCA 4HALA 1ZTXH 4MSWA 2DMHA 4Q9BA 3T3PE 1KTJA 2BHFA 4NSKA 5DMGC 5BQDA 3R0MA 2EZ0D 4YXKL 2AJYH 3BZFA 4P5MA 1X5YA 4BHUI 1PL3A 1FN4A 3LN4A 1DSWA 2BFVL 5D7JA 2WBWB 3BPNB 2V2TA 5F3BA 1FCGA 3IFLL 1QR4A 4MD5A 5EA0L 1V3KA 3RWCA 5EEXA 3GEFA 5I17A 1GCYA 2HLFC 4OGYL 5HYJD 3NZSA 3HMWL 4YOKA 4BFKA 5BS0B 4ORGA 4JN1L 3KBHE 4IOFC 1BOGA 1KXVA 4EMZA 3RWGB 2P4AB 4GI6A 2HKHH 4XMKH 1VFAB 3EBGA 5IGXL 5AG8A 1CIUA 1SNRA 2ZUYA 3H7LA 3MLTB 1T0NB 2BVEA 2VDNB 1BAFL 1DQQA 3D39B 3LH2H 4LIQE 4DKEH 1UTDA 2X10A 4OCWL 2PYED 3FTZA 5GS0H 3ARED 4MLIA 5IBUB 1FZKB 4RFOL 3KL5A 3EJSA 1LGVA 4TVPD 5M7QA 4ZX4A 5CZXC 2RD0A 3FU8A 3QJFB 3ESNA 4X5LA 3V5DA 5GGQL 2ZUXA 3MJ7A 2A1WH 3PPSA 5F0JB 4OZ4A 1T21A 1HH6A 2IGTA 3CFJB 5J1AB 2QSCH 1RZ8B 4BINA 3SE3A 3DX3A 5JLZA 4Y2NA 4AZ8B 3I9IA 3ZRFC 4G8FB 2J55A 3VH8A 5JR1H 4N6RB 4ZD3L 4GIAA 4KTGA 2HAZA 3TH2T 3FRPB 1UATA 3MJ9A 1T1ZB 5DJ0B 1JMXA 5F9AC 2EDRA 4K5PA 3OPZH 4ODTL 4Q9RH 3G6AB 3BDBA 1KCVH 1OP4A 1NWOA 4LDLB 4P2RA 4PJ8D 1KBBA 1T5WB 3FQ2A 1ETB1 4YDIL 5KYNA 5HVGB 1UB6A 4JHVA 5T3ZD 4B0MB 2DLIA 2XFXA 3UJJL 3FCBA 4RZKA 5I28A 2BVUA 3V52L 3D25A 1HHIB 2VDKL 3SPIA 3S34H 1HILB 5C86A 5I1EL 2D9QB 2G75A 3BP5A 3L5HA 5C0DB 3FO0L 4BK5A 4BYHA 1ZXQA 2PTUA 4BQCA 3CVDA 4Q7DA 4FQIL 5CMAA 1NJ9A 3EADA 2IJ0C 4DQAA 5DCCA 3BN9D 2UZIH 3KLDA 3MV8D 3QDAA 4W4NA 1ZS2A 2COQA 3SYPA 4Y1AB 1NPNA 3BWAB 3BSZL 1B4RA 4X4XA 2WVTA 1XCQA 1GGBH 5CKAA 5AW9B 1LEIB 5T3XH 2YZ1A 2PTVA 3RE0A 1BM3L 2V8LA 5CZVL 4N68A 3UTPE 2WOBA 3IJ8A 1R24A 5JXEC 4PTUA 4F7MA 3HA0A 3EBHA 5L88H 2DKSA 4OSUL 1IAIL 2J5LC 3HUJA 4IMKC 1RZJL 2WIIB 3H3BC 3WNLA 5CWSA 4YBQD 5JHBA 1BQRA 1EGJH 1OL0A 4JFPA 1D5RA 4PJAF 5TQ2L 4WHYG 1CE1H 3EO0B 2X28A 1NC4B 1FNSH 4MCYB 3TFKD 2IWFA 2YQ2A 3GIZL 3ISRA 5D2NC 2A0LD 3R06A 4ZT1A 5GSRA 2SODB 5HHVH 1GS7A 2VABB 3GMMB 4N2CA 1I4FA 3ZDWA 3QFJB 2XZCL 3EYOA 4ZW5A 4OLXL 2IGLA 3LN5B 1MPAH 3L7FA 4RDQG 3WG7B 3MR9B 3OZLA 4AYMC 4YHZL 3AU1A 3DIFA 1QBLH 1U3JA 1WBXB 2OMWB 4NQDE 5FYKL 1M1SA 2RCSL 3KLQA 4PEEA 2Q6WB 4K9EL 3FF7A 3LQZB 2HRPH 3RTQC 4J3UA 3QQ3A 5FM5O 5LGJA 3R7RA 1DJYA 2YK1H 5EN3A 2ZUTA 3FUFA 4HIEB 2GSIB 1RK1B 1NL0H 3DX7B 3HKZA 5DVNA 3VWJC 3QA3B 4XMPH 3SKNB 1AIFB 3KDMA 1KACB 4P4KD 4K8RH 2VZTA 4I3SH 2X1WL 1IGML 2NUPB 5F7BA 4G80A 4NUJA 4WDIB 1FL6A 4FNTA 3VXUE 1GGTA 1VESA 1S9VA 1MAKA 4HLJA 1BIIB 4JHUA 4POZC 1VKXA 2CDFA 4TYUA 4KOBA 2GK0A 4QKXB 3QUZD 3I02B 1LE9B 2W0KA 4AGOA 2EKSA 1PY4A 1G5AA 4APQC 3DXAB 5L9DH 4NC0B 3PDOA 3RWHA 4WTZA 4TS6A 1AGCA 3QWNA 1SVZA 3UEZA 4AXWB 4U6XA 1T5XA 4TN9A 1W72L 5KBPA 4X9BA 1BX2A 3W9EB 4FF9A 5AYQA 4GUPA 2Q7YA 4GW4B 2BWQA 3BRDA 1YY8B 1ZTXL 3T0AA 3T0EC 1GJWA 3SSGA 3HLAB 1RK0A 1KWGA 2GTZA 4O5LH 1J8SA 5HGGS 4JM0A 4NXKA 3Q6FB 4MAYA 2B4CH 4NQXB 3HI5H 1GTFA 4LP5A 2J5LB 3GI9H 2AV1B 4LHUB 2AJYL 5T3ZH 4K3DH 2WKGA 3UZEA 2X9WA 3D6GA 4NJ9H 3Q6GH 5F7EH 5D7KD 3LRKA 1RZGA 1Y1DA 5FA4B 4P57A 5D2NB 1FNFA 2DICA 2UYLA 3IMUA 1U2YA 2MKWA 2OX5A 2FGWH 5HVFB 1HCFX 2ZOUA 3WTSA 5ABZA 1KV7A 5LCVA 2HKHL 3ZHNA 4FA6A 4FNRA 4G8IA 4KKBD 4GP8B 4XMKL 4CADA 2K7PA 4ELMF 5C0IA 4K3JH 2BLFA 4AJYV 2JCCA 4YZFF 4JRYD 2JXMB 3RTQB 4B9JA 3LH2L 4DKEL 1IEAA 1FVCA 5EUKB 2FATH 2QVIA 4AJWA 1FFRA 1QW9A 3CSYA 3RKDC 3BGMB 3PIQB 4JN2A 1CFQA 5GS0L 2Q5BA 2XTSA 2IPUK 3TU6A 3VWJB 3DRQA 3I6KB 3EGXA 1DLHA 3E1ZA 2EUZA 5AB2A 3CBKB 1FL3B 3HE7A 1NFAA 2J6EA 4QYOB 5BRPA 3NRQA 1DJHA 4X4ME 2QSCL 4F58H 3GM8A 2GJ6B 2WKLA 3D8MA 1UXWB 1R33A 3LS4H 5JR1L 4G6FD 3B7UX 2ICEC 1VZIA 1PGRB 3GHBH 3IJ9A 4M1GH 4OIIH 2XG4B 2X6BA 3OPZL 2IWEA 4Q9RL 1T04A 5IW1B 4APQB 3DOSB 5D1ZA 3OWRA 5CP7B 1U8OA 1I85A 1KCVL 3RHWK 4Y2LA 3L4ZA 1OP5K 4A6YB 1UQSB 3B9VA 3OR6B 1J48A 2CCWA 1NIDA 4BRVA 5I1JH 5JHMA 2AEOA 1C7SA 4NP9A 1OTUC 1TTRA 2YEQA 5E1QA 4FE9A 5BZDA 3T0EB 4TTDC 1YJDC 4AVIA 3S34L 1V55B 4LGRB 3DI3B 3VD7A 5IHWA 2MEJB 1ZHBA 3E6FB 2CLZA 3IJHA 3EG9A 1NM9A 1QO3B 2UZIL 3TEYA 1X5HA 3SGDI 4N1EA 2IGFH 5B22A 5C07E 2R0ZH 2ED7A 4L3CA 2R1YB 3OJVC 3OHXA 1H3VA 3F85A 5CR8A 3ZE0B 1GGBL 5T3XL 4JY6A 4R9HA 2IAMD 2B9AA 4EKXA 1KNOA 2DLHA 2B1OA 2JKNA 1D7FA 2YSSB 3FKUS 5EO1B 2IFFH 5L88L 4N90E 2WYHA 1HFUA 3ZDXB 5HYIA 4YSQA 2EUXA 4MCZA 3KL3A 1P1ZB 2EE2A 2V0AA 3PGCA 3UTQA 5JOFA 3VRJA 3RWFB 4YHKH 4M4RB 3THMH 1EUTA 5F1NB 4ELDA 5L0QC 1EGJL 5HXMA 1MZZA 4PJGB 4EKJA 1CE1L 1E28A 3IAPA 3UBXA 5TDNA 1FNSL 2ICCA 5IVOA 3ZVVA 3BUBA 5HHVL 2K4WA 1AGFB 4QIRA 1R3IH 3KM2A 5T1JA 5DZPA 2YPLD 5CJ5A 1I1YA 3C60C 1L7IL 1F6AA 2BY0A 4B60A 3T4YB 3B9DA 5I1DB 1MPAL 4Y4FD 2I9LB 3SN6N 1UD8A 3JVGC 4KO9A 3L4CA 1KCRH 1QBLL 3RDTC 1TQUA 4GP4B 2X7LA 1OP5H 2ZCHH 3Q2NA 4G5ZH 3LH8A 1DN0A 2HRPL 5F3HA 1NGYA 4U0QB 2ICEB 1FORH 3S6CA 1ZT1A 1HINH 3DVNA 2DV6A 2YK1L 3LPOA 2UVFA 2NYKA 1NL0L 4J3BA 1UOKA 4XMPL 1I8LA 4LLYB 4K8RL 1REIA 5DUPL 4I3SL 4FNLH 4MA3B 1NICA 2YR3A 2JI3A 3GDBA 5AW1B 1X7SA 5LCVH 4EUPA 4YSCA 9CGTA 1KENH 4ZQKB 5HHME 4PRIA 3IVKB 3BQUD 4PJEB 4G9DB 5JQIB 2AS5M 2EILB 3FH8A 3WXWL 1U8NB 3ZMRA 1F13A 5C71A 5JHAA 1X5LA 3N5AA 4YFDB 4BSVB 3NCYS 1NA8A 4Z7NB 3IMRA 5L9DL 5HI4C 1G7MB 1J86A 5IOKA 2WNKA 4Z0BH 5C0CA 2GIMA 3IT8D 4U7MA 5J9PB 2J6EH 1PG7H 3MKKA 2YKKA 4WWKA 4U6VH 1BF2A 4RGMC 3BX7C 1GW6A 3A5VA 3NCMA 4PJAE 4JQVA 4NKQB 4RMVA 1LYQA 2V5RA 1I7TB 3ZDYB 3MRPB 4ZPTB 5C0CD 1DYZA 5F88B 2VXVH 1IM9B 3M1BB 2GQHA 3KW7A 4O5LL 5BS0A 2WINB 2DWTA 2B4CL 5MEPB 1HHJB 2XVLA 3HI5L 3GI9L 1QRKA 4MFHA 4K3DL 4NUMA 4EQ3A 5B39G 5L0QB 2NZ1A 3LN9A 4NJ9L 3Q6GL 4LPCA 5F7EL 4XPAH 2G3NA 3W9DA 1ND0A 2BP5M 4PP2B 4XBPA 1G4RA 2Z7YA 3FB8A 5E1HB 2RB8A 4OZHF 3MO1A 1IM3D 2DIAA 1GIGH 4NENA 2FGWL 2HJKB 4H26B 3FPYA 4G42B 3C60B 4K73A 3ARGD 3MRKB 2CZNA 1U8KA 3ENEA 2KH2B 4W9KC 4OI7A 2WY3B 2DQ6A 3RDTB 3CFJA 1YEGH 4HMCA 1JWUA 4K3JL 4XMZA 5A2FA 5IJBC 1M42A 2QHRH 3MOBH 2VTFA 3QXDA 4V1DE 2FATL 2VL5B 3D52A 1OGAA 4LEXH 4RA3A 3QJSB 4JJ5B 2HUEA 2K6YA 3FRPA 3H9ZA 1WCBB 2FX7H 4AQOA 1T1ZA 2C4FU 5JW4R 4F7CB 3FZUD 3D50A 2R2HA 3G6AA 4X6DA 1OGAD 1MY7A 1DTUA 2UV3A 3FONA 4QGTA 4F58L 5AALA 1IQDB 2P28B 2FEEL 3P3RA 4HVBA 4LL9A 4Q56A 4KITB 4U1SB 2YJLA 1F58H 3H8NA 4XO3A 5KG9A 3LS4L 4UAHA 2LABA 5DLMH 2H2SC 4CC4A 3ZO0A 4YX2H 3D07A 4FEIA 2CIKA 3GHBL 4M1GL 4OIIL 3BVWA 4AEHH 3RHWF 2GEEA 1FYTE 1U42A 2I07B 1DVFD 2Q0ZX 5ICZB 4N0FB 4ZI8A 3FO9A 4LGSB 2A2QT 2Y1YA 3EJQA 1B0RA 2HFEB 2QFRA 4HUUA 4RGMB 3T65B 5GZOA 2DWYA 1M6OA 5I1JL 3ZKQD 1QMUA 1WYJA 4HF5H 4JCLA 4Y1AA 4ZPVB 4O2EB 3TWCH 4HUVB 1NFDB 5I5JA 4ANUA 3B7SA 3VDBA 1MFUA 1N7MH 1KTCA 2WCGA 5E2WH 3KXFE 1DFXA 4D0BB 3PWVB 5GJTH 2XTJE 5IB4A 4DUXA 3QDMD 3O41A 4M7ZC 1FVDB 4MMYB 2UXGA 2FIRT 2IF7A 5KSVB 3F65A 4F1ZA 3ZMEA 4P9HH 2IGFL 4O9HH 4OZGA 2R0ZL 1H19A 2K3HA 4G7RB 4YZFE 4JDVB 4MCYA 4EUPH 3DO7A 1MIMH 3WNOA 2WN3A 4ZX6A 3ZQ9A 1TIUA 2X3BA 3KPRA 4LLMA 4NQCA 3VFPA 2VABA 3CJJA 4JGJA 1I1AA 4XPBH 1SUJA 2C1OB 4CAGA 3GB7B 2FHCA 4JKKA 2IFFL 1J1XH 1WSST 4Q0XH 5IESH 4L3ED 1RUMH 2FL5A 2OJZH 4NQCD 1Q9LB 4YHKL 3THML 4RGNC 1FJ1B 4FA7B 2V5SA 1KTRL 5E9DA 2Q6WA 2BX5A 5EWIH 4AQEA 3QIWD 1S5HA 2F53A 4DHLA 3MFGB 3UDWA 5I6NA 2CM5A 3UPAA 2O6DA 2O1AA 1R3IL 2RACA 3DX7A 3QA3A 4WSKA 1B9KA 3SKNA 5HYJE 2F53D 3GBLA 2DN7A 1KZQA 1TZOA 2JKTM 5DI8B 5A43C 3MRCB 5I5IA 1KCRL 3D06A 2DKMA 4L4TB 3SJVB 3U4KA 2AERT 5INCB 5FB8B 3UO1H 2VZ1A 2ZCHL 4G5ZL 4MA8H 4XVUC 1ZLVK 4JO3H 1FORL 3SIKA 1HINL 1T5KA 2HJFB 3QZPA 4UOW1 3QCUH 5DO8A 4L8SC 5D2LA 3HI6H 5AD0B 1BQHA 5EEVA 3I02A 2PO6C 2PYEE 2FIKA 4HJ0C 4I77H 2WLLA 4M6MH 4FNLL 1WVZA 4HSQA 5ESVB 5LCVL 4TVPE 1COBA 4GAGH 4IGBA 1SEBB 4X7EC 1OEZW 1KENL 2DIEA 5EZIH 1XQ4A 4Z76A 3JT0A 4GKNA 3QXWA 1YY8A 5EUOA 4QHNA 3WUZA 5JIDA 5IT2H 3BHBA 5ISZD 2EO7A 3HLAA 4IGBD 1QA9B 2OXGB 5J7CC 3LB6C 4M7ZB 4YHOL 1KXTA 1D6VH 3CFKB 4Z0BL 4X6CA 2J6EL 1PG7L 2DWDB 1PYWA 3ABZA 3PUCA 3UAJC 4U6VL 3UABA 5BVPH 4XO9A 2R0KH 1AVAA 5D2NA 1KB9J 3US1A 1JUFB 2JIXD 2WQAA 5T3ZE 3NJJA 2VXVL 3GXNA 3RBSA 3QUXA 1XWVA 2HX8A 3UIZA 5DMKB 2OK0H 3V0AC 2D7NA 4OIFA 4H8QA 3TYGH 1M7IB 4M4PA 1FI8C 1PMYA 1L5GA 4RGNB 3FUEA 2VOTA 2WQXA 4XPAL 2XKNB 3QUXD 1DJWA 2P52A 3TBYA 3S0PA 3V8OA 1DCLA 2BHZA 2VDMB 5EUKA 3GSRB 1OPGH 1R47A 4UUJA 1GIGL 4MTMA 4KXZI 3SPJA 3MV8E 1ZLVH 2B59B 2AC0A 1S7QA 3ULUC 4WY7H 4PWKA 4PJ6A 1FFNB 2KYIA 2L04A 1KPVB 4F2MB 4NUPA 1HQ4A 3CFIC 3SGEI 3EIFA 1YEGL 1KT2A 2OMVA 2NY5C 5AVUB 2QHRL 2AGJH 1QASA 2GJ6A 3MOBL 3MRQA 3M8OL 3ARPA 4URTB 1ZS8A 4TUJB 4LEXL 4YBLC 3CSPA 4L8SB 1Z2KA 2FX7L 2BIOA 3HAEB 1JXJA 4B9ZA 2ITDA 1L3WA 2PO6B 1LLAA 3C5ZA 5HJDA 4AV5A 2P44B 3SQRA 3DOSA 1HSAA 1S9WB 5CP7A 4JHAH 4ADGA 2ADIB 3L3JB 3GXFA 3R4RA 1UQSA 5DC2A 1CXLA 4AYGA 4EAEA 3VG9C 4F80A 3B9EA 1U95B 4WHTB 4A2DA 1IKNC 1BZ8A 1F58L 4LLVA 4JKMA 1XSOA 4HC1A 4K2UH 4M93C 4OT1H 5DLML 3QULA 4AMKH 4YX2L 1TR7A 4OQ1A 3IDGA 5M94B 4AEHL 1S7WA 2BXZA 2XWCA 3DHPA 4UZUA 1I8AA 1TT6A 5I1LA 2E7MA 3B5HA 1NGXA 3JXAA 4W93A 4ZFZA 5I6LA 3HZMB 2F9BT 1I1RA 5KZCB 4HF5L 4PRBA 3TWCL 1AGEA 4P49A 4ZOBA 3CE1A 4IIZA 3VTAA 1N7ML 4XHQA 1X4XA 4OZHE 5DS8B 4AQ8A 5E2WL 3DETD 2CIIB 1IGFH 2HT2D 2ITCA 1OZTG 3BUYA 1K8DA 4IKJA 4NQVB 3GHPA 2YSSA 3D0VA 5GJTL 5BZWA 3FH7A 3SY0B 3NJIA 2Z1PA 5IB2B 4D9LH 2E74C 2XHNA 1ZSDB 4RWYH 4OFYA 3RWFA 4M4RA 5F1NA 4P9HL 4ZFGH 4K23H 4O9HL 1DVXA 1QBBA 4FCAA 1JI1A 3BISA 5FM8A 1MIML 3WKNA 1E2WA 2W95A 4QTFA 1AGFA 2WLHA 4XPBL 4X6DF 2YQ3A 1J87A 3VGFA 1CXIA 2FJFB 5HDBF 3FQRB 3L7EB 1J1XL 1H15A 3T4YA 4Q0XL 4N2KA 5IESL 4JGNA 2N3JA 4HZLB 4ZDHA 4QXTB 4MWFB 2I9LA 2WLMA 1ZLWK 2OJZL 3RVWD 2I25N 1F00I 3O6ML 3F83A 5MERB 3STLB 1X9RA 4DPCX 1SXBA 5EWIL 3CDCA 4YBLB 4AZUA 5D7KE 2MPAH 3FT4B 3ZE2B 5E6ZA 2XSKA 5CN1A 3VNYA 4XC1H 5JIQA 3OMNB 1V3LA 1M2VA 1E5ZA 4GINA 1F11B 3Q8EA 3VG9B 3ZJAA 3LTVA 5KYWA 2AJSH 2NY3D 3UO1L 4XNXL 1QSFB 4MA8L 2I7OA 3LNGA 4ZQKA 2ZXGA 4JO3L 4M93B 4PJEA 4G9DA 1L0YA 4YC2C 1GGCH 4PREB 3QCUL 4UBDD 1O7SA 4JRYE 3NJNA 3HI6L 3FU6A 1JZ3A 1T0PB 1T2XA 1QBAA 4ZUWA 4I77L 4CMHC 4P06A 5BOZG 2RQ8A 4M6ML 3TCLA 5EC1B 3RNKB 4OZGF 5FUCE 4L2YA 1ZMYA 4GUCA 1VEMA 4GAGL 4UQ2B 3V6BR 1FRGH 1XGZA 2CKBB 4S0SD 3G5WA 5EZIL 4CL7A 4NERA 3IFNH 3LKPB 5IT2L 1AC6A 3IDUA 3BAXA 3ECBB 1IM9A 5KANG 4IU2B 4A67A 5FFLA 3IFOB 4O51A 5MEPA 3RG1C 3QZLA 1D6VL 3DVGA 2K3TA 2QR0A 4NHCH 4Y4HA 1QUNB 2ZG3A 1JPGB 2JCWA 5DQJB 3TEWA 1JD9A 5BVPL 5D5ME 2R0KL 4MZ2A 5B7EA 1WZMA 1IO4C 3FHQA 5H94B 2E86A 4E9SA 2HJKA 3K2MC 5BRZB 1WWCA 3O8XC 3WI9A 1CDHA 1EHXA 3MHZA 4CNIB 4HC1H 3ORJA 1JZHA 3MRKA 2OK0L 1JPFB 3FCSB 3VFUA 2XJLA 1A4AA 3G5YA 5DFWH 4HU8A 3OTTA 1DBBH 3JVGA 3TYGL 2GSGB 2Y72A 3V0WH 2AXWA 3GMNA 2EDJA 4BE6A 3MBEC 2VERA 3O3BB 4Q6KA 4RISH 7FABH 1P7KA 1DANU 2A4CA 4DP0X 3GXMA 2VL5A 4G43B 5D2LF 3ZOAA 1OPGL 3T1FB 4Q97A 1I82A 2OCFD 4JJ5A 1B3IA 3KS0H 4KK6C 3WTWA 3MV11 2X2IA 2D7PA 4F7CA 4WY7L 1UYWL 3QDGB 5E99H 1S7TB 4DKFH 5LHDA 2J8UB 3JSSA 4LOUD 3ZR6A 1BJ1J 2BSED 5DRXA 1M53A 1TQTA 4MQXC 2AGJL 5EUOF 1A9BB 4PR5A 4M29A 4YE4H 5SWZA 2HVKB 4YC2B 4O02B 1D7CA 2NY4D 4WTXA 5JXAH 1E4KC 1SQMA 3VFOB 2VITB 4OLUH 1XGRB 4LESA 5DJCB 1XAKA 4CMHB 5ID0B 4X6CF 4HJUA 3ARTA 1MFBH 2Z31A 4JHAL 4N0FA 4WSGA 3ZXAC 5ICZA 2K45A 2YPLE 4PW3A 5F7DA 4YK4C 4EIBA 2ZX8A 1LO5B 2HFEA 2UX6A 1TVBA 4ACPA 4ZUTB 2FBJH 3LEVH 2VT0A 1JF5A 3SE4A 4O2EA 4WI0A 1A4JB 4OT1L 4K2UL 4AMKL 1KLFB 4JDZB 4E9TA 5EF1A 4JCMA 1AZCA 2QLYA 2CR6A 2XPYA 1T6WA 3F01A 3PWVA 4QJ4B 1NGZB 3LHAA 1R75A 3VFSB 3AC0A 4H0GA 3T71A 2GBTA 3V0JA 4PMEA 4K7PY 3LXBA 3HNVH 2CE6A 3ET9F 1AMXA 2ALWA 4JDVA 1H8NA 4CGUB 3MNVB 3AWGA 5I1AB 3O8XB 4HGMA 2X89A 2XXMB 1IGFL 3FB5B 1XMWA 1EHLH 1ZHNB 3U0TA 1LMKA 4D9LL 2ATAA 4RWYL 3IU3B 1EAPB 3CFEB 4G71B 5KN5B 2AQ1A 3MBEB 4WCYH 2DQUH 1SF3A 2X89D 3U2SB 1VACA 2RGSA 4GBXA 3TEUA 4ZFGL 4K23L 3OLGA 1OGTB 5KS9E 2WLIB 4X50A 3ZL2A 3ZT7A 1DJXA 3J27A 5JNYA 4PJ5E 3BWSA 2PPDA 5FYJH 1WUNT 4BK8A 3GJEB 4ZOAA 1ZRUA 4X6BB 5C0CE 4QRRB 1BJ8A 1OGSA 2EXYC 5DI8A 2CLVB 4W9GC 2DEYX 4HFWB 1L9MA 3IGAA 3SJVA 3NCWA 4HEMA 2K6ZA 5FB8A 1FQ9C 1BFOA 1CC3A 2NYYC 4CDGC 5DURB 5E2UH 1BBJB 3LRHA 4IBSA 2MPAL 2DAVA 5C0EB 3UC0H 4NPYB 1ZVYA 4IOSD 5DD0H 4QHKI 5AW4B 4XC1L 4RAUA 3K1DA 3OMIB 2VUKA 4YK4B 2DIBA 4Z3HA 3LZFH 4X8CA 4A2GA 5EB9A 2WQVA 3Q05A 2G2NA 2AJSL 5J8OA 1SEBA 1AD0B 3BIKA 3LYRA 1OAQH 3L4XA 3L2MA 4I48A 4JY5H 2LU5A 4UOZA 1GGCL 5ESQB 1B2WH 2CUHA 5CGBA 2O6EA 4PV9B 5FFGA 2C3WA 2EP6A 3MAWA 3N9GH 4JFTA 5MEND 2OPCA 1DSFH 2FEDC 2Y0SA 2EXWD 3APMA 4ZTPH 1RSFA 2YC1B 3IFPB 2DQGH 5EU6A 4MQTB 1FRGL 1OGAE 3PDDA 2H32B 2P8MB 3LKSB 2DQMA 2XWRA 3CDFA 3ZDZF 2EDWA 3NFPA 3IFNL 1G6RB 2Z3FA 4CVXB 3FK3A 5F70A 3FQNB 4JMXA 1N4XH 1M2OA 1OIOA 2DM4A 2FHFA 5BZZA 1OTSC 3S3SA 2R0WH 2FR4A 5CILH 2R9HD 3SKMB 4X6DE 3RFRA 4AVHA 1UENA 3ILDA 2LV4A 3N2JA 4NOBA 5DRZB 5HDBE 3TJHD 5FGRA 1GYCA 1NBQA 4NHCL 4UV4H 3CFNA 2GCYA 3DMMD 2XKNA 4WFED 4XPFH 2BOLA 4BCXA 1TTUA 4P3DA 4R4ND 4BDVA 1QFWH 2PXYC 4JHBA 3M86A 4QRUB 3VMOA 1NBVH 5KSBB 2MTAA 1H3TA 5FECA 3APNA 4HC1L 1DUYA 1G9NC 4H8WC 1TQVA 4PVBA 5CCJA 2OYLA 4GFXA 4F33B 2ZOLB 2OTPA 3WFHB 3E2HC 3HN3A 1DBBL 3V0WL 2OAAA 3RI5K 5C08A 4NC2B 2HZHA 2VDOB 1I8MA 1QR1A 4RISL 1JV2A 3QDME 7TAAA 7FABL 1DQDH 1B88A 5T1LB 1S7VA 3JTTB 4I5BB 4C58B 1GTNA 2ESVB 5TE7H 3DJZA 1O6SB 5EU4A 4QHKJ 4PW9A 4LDOB 3QDJD 5AVZB 2BJMH 3K72A 2SEBB 5E99L 1EIBA 1BDYA 1SOXA 4DKFL 4TL4A 2VLRD 5TFSH 5C1MB 2ADIA 3HZKB 3L3JA 4OZFG 4E41B 1ZGLP 4L2LA 4OZGE 4DP4X 4MBOA 43C9B 4MDRA 1TZIB 4L3EE 4YE4L 1ES0B 4EDXA 4NQCE 3RWJB 4WU7A 1ESOA 5JXAL 4Y8DC 4W9FC 1HDMA 1ILUA 4JJHA 1P53A 4ODVH 4OLUL 1PD1A 5ID1B 1EJFA 1J1PH 1KPRB 1XB3A 1XBRA 5ICXA 2DH2A 4YFLF 5T5NG 5T5FA 2F53E 4U0RC 3AS3A 2FBJL 5DUBA 5SX4I 2Y1AA 3FUHA 4N2IA 1U93A 4PJIA 2O5YH 1HESA 3U9WA 3F5WA 2WXJA 3GRWA 4PV8B 3RY6A 2ID5A 4EN3D 3EFFB 2CIIA 2APFA 3TPUB 4N5UA 1KJ3H 2Y25A 3VFNA 3UBXI 3QXUA 2CLRA 1LO2H 1XH3B 1FYHB 3WMSA 3VD0A 4U1JA 3A23A 4JJOA 4KROD 2VAAB 5D1XC 5F1KC 1LE5B 3HNVL 3CDZA 2VLLB 3KWWB 4YPGB 4ZO9A 3SBWC 2YAHA 2PXYB 4KY2A 5D2LE 1JRHH 3VFGH 5JZ7D 4HEPG 1L0PA 3GBMH 2BVTA 4AT6A 1EHLL 1X7TA 3GSXB 2LR4A 3X14B 3G04B 3QB7C 3E2HB 3EAKA 3X12B 5ISZE 3ZW3A 1DQLH 4HZLA 1URLA 4WCYL 2DQUL 1RU9H 2OMZA 3OKYA 1JHKH 1EZLA 5AYTA 4GIOA 5BVJB 2CJUH 3CHQA 5AOLA 4W6YB 3T8VA 2PW1B 5HI3D 5C3LD 2BWDA 3HB3D 4K15A 4TUKH 1J9TA 2O30A 3QPQD 1PFCA 5IMLB 2ZUSA 2BVYA 2WP3T 5FYJL 1RY7B 4BM7A 4H5SA 4ZFOB 1AHMA 4UNUA 2V2WB 3IDJA 4XX1E 3PF2A 4L37B 3G5VA 1U8CA 4OAWB 1KYFA 3A6BH 2NR6A 1IKNA 2ZYIA 3ARRA 3PWPB 2CO7B 1R5VB 5E2UL 5EU5B 2J25A 4I18A 4Z7AA 3EZ8A 1VZGA 3UC0L 4EZKA 5CN3A 2JMRA 1FSKC 4Y9GA 1TSHA 1KXHA 4G8GA 5DD0L 4PG2C 1XEUA 2ZOOA 1ZE3C 4PLKD 3LZFL 1A7OH 2FQGA 1E8ZA 4RX4A 4U0RB 1LWHA 3US9A 3C8KB 3TV3H 4AK2A 4G8GD 4UQ2A 3QVAA 2ADYA 2CKBA 2DBLH 4CJ1A 1NFIB 3CH1B 1OAQL 4JL1A 4PH8A 3I75B 4ODHH 4JY5L 1B2WL 4XMLH 4GW5B 1XMEB 3ECBA 4NHUB 2CM6A 2VE6A 4GRWB 1WBYB 5C6PB 5IHLB 5ILTH 3N9GL 4IU2A 2IDCA 3Q5TA 4LSRH 5I8CB 5DWPA 5CHNB 1IGCH 2HN7B 5F7WC 4P8QA 2BNRA 3GGWB 4JMNA 5D1XB 4ZTPL 1KCLA 2CPCA 4YIQA 1JPGA 2DQGL 4L8BB 1G9MC 5DQJA 3E7JA 3PL6C 5AVTB 4J5VA 3UAEA 3MJ6A 4E9LA 2BNRD 5H94A 5I6XC 1N4XL 3HBZA 2WWNA 2R0WL 3HPJB 1VADA 4TVUA 5CILL 2D3JA 2VL4A 3FT1A 3D9AH 3A67H 1JZ7A 2IPKB 3FCSA 4YLQT 3RJDA 4F7KA 1TLMA 1EFQA 4OCSH 3L5XH 4UV4L 1I7ZB 3PAYA 4HLEA 2WVVA 3ZKXC 1R17A 2ZQKA 2P49B 4XPFL 1WEJH 3H4HA 1BCIA 3UZVA 3RWEB 1CICC 1E2ZA 5T5FH 1ZIBA 5DZAA 4GAFB 3VM5A 4AENB 4F2EA 2FWOB 1W0YT 1QFWL 1S78C 3D51A 1NBVL 5DTFB 3QPXH 1TZHA 1BD2D 4FYQA 5KBKA 1MCSA 3QDGA 3GRWH 4JFEB 3Q44A 3RI5F 4BBWA 1CIDA 3O9WA 1OANA 1P5VB 3N42B 3GC3A 5J3HC 4KK8D 5GXBB 1NWPA 2EACA 3LKOB 3KPSD 3LOWA 1WGOA 1H3XA 4FYRA 1XZ0B 1DQDL 1WAPA 5DRWA 3O9WD 2HVKA 5TE7L 3SQBA 4EI6A 2NMSA 1QW8A 1FSKB 1QD0A 2VITA 2AV7A 4FC3E 1J9RA 1XGRA 1ZY9A 2IBGA 2BJML 1VFOA 1I8KB 3K8LA 4M48H 1JIBA 2W60A 3KLHD 5I74C 1A6AB 5IQOA 1IAOB 5TFSL 3T77B 2IMMA 4UQEA 4A1RA 4FJZA 2WOYA 4PTTA 4KNSA 4ZUTA 5L4IA 1QLFB 1JAEA 3I74A 1RJLB 4H8PA 3VA2C 4JFYB 1UC6A 3FN3A 1TMCB 1KLFA 2HRGA 2ETWA 3PNRB 4ODVL 1NCHA 5IB5B 3DGGB 3K81A 3UX9B 1J1PL 4AYFA 3MRDB 2P48B 2VDRH 1NOFA 3L4UA 1MCOH 3OB0K 1QACA 1AQDB 4XHJD 3PJLA 4OGAD 3C5SB 3VXMA 3SDDC 3PL6B 1WWBX 3SKOB 2OBGA 1OQOA 1UT9A 4XMTA 2AQQA 1YDPA 4G82A 5I6XB 1I8IA 4BFGA 3EGSB 2O5YL 3FQWB 5FCUH 4XCFH 1BAWA 4K5LA 4LAQH 3AB0C 5KYXB 3CHXA 1AO7B 3FB5A 5DVOA 2MQGA 1XAUA 1KJ3L 5F8RC 4NQEA 1JGEB 1ZHNA 1IC1A 1LO2L 1EAPA 3CFEA 3DV4B 4GFTB 3PNWB 3CLFH 3KNBB 3ZKXB 4B9IA 3MBEA 5KN5A 5ECGA 4FD0A 2APTA 1XL4A 4F92B 2WK2A 4PRDA 3EH2A 1CICB 4RMWA 4HIIA 2WLIA 4UWQB 1ZXKA 1XSIA 4S1DD 1KPUB 1E30A 3VFGL 4EI5C 4Z8FH 1JRHL 4S10A 5IREA 1QPPA 2CKBH 4K7PX 3GBML 5KSAA 4EN2A 2XOTA 2GY7B 3IS1X 4J12A 4ZMYA 4XPHH 4E9YA 1JV5B 3QJRB 2QELA 1XTMA 3PWJB 4JRXD 5C2BH 3DECA 1MLCB 1SDAB 4YDMA 3KEDA 4QRRA 1DQLL 4KX7A 4PS4H 1AHWC 1RU9L 2VQ4A 1C1EH 2VO5A 4HFWA 3R4DA 1Z5YD 2Q9OA 1JHKL 1L9QA 2CJUL 2Z35A 1YN6A 1NSNH 3NP4A 1SHSA 1U8JB 4JPIB 4TUKL 3SOTA 1MVFA 1E4KA 1UH4A 3UTSD 4LPXA 3EO1B 3IMVA 2FUTA 3PAZA 2L0DA 3DX9B 5I74B 5CSZB 2CO6A 2H4EA 4J4PC 3QJUB 2DYRB 5E23A 1U33A 3A6BL 4MQ7A 3OB0H 1SLWA 2Z8VC 5FHBH 2EDLA 2EVJA 5AAPA 5A7EA 5B4MC 4PB9H 4PLJC 5KVGE 2VSDA 4DOHB 2ARJB 2YPKA 1F41A 4GSDH 4B3EA 1A7OL 3IMTA 1D9KA 4J2QA 3SDDB 4DPBX 3HFML 3IFPA 1QP1A 2D3NA 3TV3L 4PJ7A 3QEHB 2V7HA 1RK7A 2DBLL 1QEWB 4XVSH 4G6KH 1S9YA 5D7IA 5E4EC 3QR0A 4ODHL 1MWAB 3RZCA 2JKXA 3AB0B 5EZLB 1D9KD 1XTLA 4RBPK 4XMLL 3S5LA 5HY9A 4N20A 1CLVA 3MRJB 3VD4A 5ILTL 4IHBA 4ZMQA 2NT1A 3B7TA 4NCDA 4LSRL 2CA4A 2WQRA 5DRZA 2ZOWA 2YAFA 4AYSA 1IGCL 4MJ5B 2BY2A 1HXYB 4XOBA 3FB6B 1ZA3B 3FTSA 4BSWB 5G5DB 1T20A 1WHPA 5FO8B 3TJEH 4G1EB 3V9CA 4EI5B 3MXWH 4KKNA 2NUTA 3N50A 3U25A 4AL8C 5TH2B 5EHFA 1HE8A 4WW2A 5CEYA 3ARWA 3ULVC 1FZMB 4MB1A 4ABQA 4CDHA 5D4JA 5KAQF 5L4FA 3T3MF 2FX8H 3D9AL 1G0DA 3A67L 4NKOA 3BSHA 3NH7H 3WSQH 2O61B 4GRLA 1Z66A 4OCSL 1AHWB 3L5XL 5TK2A 2B0SH 1K3ZA 1GZHA 2NRDA 3WLWC 1WEJL 3P0VH 1JZJA 1S7SB 1ZPUA 4R90H 1G7IB 3MSPA 3RY4A 5T5FL 3V79C 5JMRA 3ZT6A 2XA8H 3QPXL 1PNDA 4Y0GA 1PZ3A 2SEBA 3GRWL 2X0UA 1CD1B 1L9SA 2VW4A 4YQXH 1BXVA 1WFOA 3NZUA 3N06B 1DVZA 1LK2B 3AMLA 4AJ0A 3A6OA 4P5TA 2P5WB 4I85A 3OLDA 2RHEA 3QWRD 1UM5H 1C16B 43C9A 2W59A 2KZ1B 3MRMA 2DQFB 4GQZA 1A1OA 3VQMA 3BEWA 4KXDA 2NNAB 3VFWB 2AFNA 2V4LA 4P5TD 3KJ6H 4TSBH 4UQCA 5IMMB 3HS8A 5ID1A 4M48L 4RBPH 4EQ2A 4KRMB 1UGKA 4TUOA 3TT1H 5CD3A 1KDIA 4RGOH 3VI4F 3IPEA 2XLLA 4I8DA 4FMVA 3N0AA 4XTRD 3QW9A 5E4EB 2QT6A 3ZX1A 5TTRA 3HC3H 3K91A 4P2YA 4P99A 3B83A 2A74C 4MJIB 5C09B 4WHYH 1U92A 1D5XB 4PV8A 2NW3A 1YG9A 3TPUA 1ETA1 4YPJA 2VDRL 1MCOL 5CU5A 3GSWA 4HEME 4YHMH 1CLCA 1K5NA 3KPLA 4N0UA 4Y4KC 2UZXA 4N2FA 4GG8A 3FQ1A 4KJQD 5DDHB 3FOMA 1QFPA 2VLLA 3KWWA 2NT0A 2AK4B 1KCKA 3P77A 3VXSB 5FCUL 1D5ZB 4XCFL 2H3NB 4Z3EA 4LAQL 1MW1A 1GAFH 3L3IA 5AOIA 4C59B 2VM9A 4KUCD 1BP3B 1QHOA 2HWZH 2DYPA 4RH4A 4GQ9H 4IRJA 3X14A 2JJVA 3CN2A 3APCA 3CLFL 5J1SC 4LOFA 5FLVA 4QOKA 2XIBA 4KVPA 4WKZB 4OKVB 1U8PA 5MENE 1Q0XH 3U9PH 4HK0B 1LP9F 3OKLB 5CGTA 2O6PA 5A7BA 2L7UA 1S8DB 1V7MH 4Z8FL 4QOKD 2CKBL 2AQTA 4X7CC 5E24E 4MVBC 2IQAA 1TJXA 1N9PA 4HUNB 4XPHL 4YZWA 4ZFOA 3UC2A 5C2BL 5SWSD 1NBYB 5E5MB 2XN9D 1EEYA 4PS4L 1S9XB 1C1EL 4OV6F 2VIRB 4XVOA 3Q06A 1G1KA 5F7YC 3PWPA 1NSNL 4QI3A 1A4KB 3DUUB 1AXSA 2J6WA 3OF6A 4WFEE 2X4OA 2WSPA 5CEZD 4LCWB 1N19A 4LARH 4RZCA 1E4XH 2QPFA 2VMJA 3F84A 3MGTA 4TQIA 4NGHH 1F1AA 1S7XA 4ENZA 3OF6D 4M6OH 1MI5B 5EU3B 1MJ7H 2N7BA 3LY6A 1VENA 2B14A 3VTMA 2ZXEB 1U30A 2A6DB 5FHBL 1J5HA 2W65B 2AJXH 2A74B 3CH1A 1KTLB 2CJTA 4QT5B 2D4FA 3BZEB 4X5PA 2YBGA 4HJTA 3G6DH 3LVTA 1NPUA 4DKDC 4PB9L 4F1SA 3DBSA 4RAVA 4AWJC 4D8PB 1QBMH 2D31B 1ACZA 1A6UH 4YFLI 2DL2A 4GSDL 5CHNA 3NCFB 3QDJE 4NWUH 5L8JB 5IV2B 2J20A 4KU1A 5TF1H 4HISA 2OMYB 4Y4KB 1F4AA 3NG5A 3NEOA 4A63A 2VLRE 2FLMA 3LD8C 4G6KL 4PJCA 1N5AA 4GLRI 3TCTA 3KCPA 2GI0A 4YSUA 3UP6A 5AWNH 1MZYA 4XMUA 2I9TA 1PJ9A 2UZPA 4JFXA 4WUUB 2O5ZH 3SDXF 5EEYA 2NY6C 5GRZA 1SXSA 5ITFA 4DGVH 3L3GB 4NNXB 2OCJA 3TJEL 1FZJB 1XF5A 3QIUA 3MXWL 4ZO8A 5GGSY 4TNWF 4NBZB 1KIUB 2FX8L 1OSYA 3MJWA 1RJCA 3NH7L 4HDIB 3WSQL 4JFEA 4UU9A 3QYMA 1IC5H 5B39A 4DGWC 2E9IA 3VDAA 1HAWA 4JVWA 5E00B 2B0SL 3LKOA 4Z7QF 1N70A 4KHXH 4KZDH 4UQ3A 3P0VL 3ZSSA 4PWHA 2X42A 4R90L 2G9HB 3AAZB 4XE5B 2NTSP 3X2QB 5C0RH 3E9UA 1R0AH 2CG9X 4EJ1C 5HYSG 2XA8L 2Q7NA 1DDHB 4N2MA 1N0XH 4Y89A 2OMTB 1PBYA 2XKSA 5ERWB 4J3OD 1QFWI 2YOAA 4YQXL 5GRYA 3EDDA 5C2UB 5HJGA 4XXDA 4PJ7F 4Y2DD 2DMCA 3B8SA 1CCZA 3O2WH 5D7IF 3TIDB 5F1IB 5E8EB 1UM5L 3A4EA 3P0YH 1EX0A 4HUXB 3RNQB 3MRNA 3D39D 1MAJA 4PY7A 4ZOCA 3KJ6L 4TSBL 2J7LA 3II3A 3STZB 3CG8A 2X3CA 3ZZLA 5GZNC 3TA4D 4FTVD 4U1GC 5CLZA 3TNNB 4FHBD 3MRDA 2J12B 4C56A 1K8IA 1BVKB 3TT1L 1JYVA 3QNYB 4RGOL 4F7EA 3RPIB 3QARA 1Y18B 5CJXA 3LD8B 1VFUA 4RCAA 5BJTA 5KSUB 1OT2A 3HC3L 1T22B 1EAOA 1HEHC 2AJVH 3D2UA 3L9EA 3QEUB 4KGLA 3V4PB 4C56D 4ZNCD 4WEEA 3RKPA 5LBGA 1ETJA 1VAHA 4MAZA 3T3ME 4XN5A 4QRAA 2ZTBA 5K9OA 4PVLA 2NY6B 3NQIA 5D93C 1XO8A 1UWEL 3PNWA 2XXCB 5GRWA 4BFOA 1T66D 4YHML 3OMZA 4BEIA 3TX4A 2ZYSA 2C1PA 4JAMB 3MRBA 1A3RH 3NYKA 4HHAA 5JIPA 2NSQA 32C2B 5AKTA 1AS6A 2MPVA 4G8GE 1GAFL 2KUTA 3BW9B 1ZWIB 1PZCA 2HWZL 4U1LB 4GQ9L 2PPAA 2A9MH 3KWTA 1MLCA 4HS6A 3TBWB 5CINH 4QR7A 2Z8RA 4I87A 3WO3B 3H6AA 1CLOH 5KBMA 4FG4A 4TOYH 3DIVA 3MGAA 1Q0XL 5H8DA 3U9PL 2YXVA 3POHA 5JW4M 1QFOA 4G7SB 2K0RA 4IBQA 1V7ML 4BQ8A 5C0AB 3LKRB 3PU7A 3EO1A 4P2OC 2X09A 4J7RA 2BNRE 4FFWD 5B8CC 1GSMA 1S4IA 2EDEA 5DD5H 5DVKA 1B6UA 1SLXA 1PFOA 3TJPA 3BXNB 4RMSA 3VI4E 1ZHLA 5CGYC 3SDAC 3RGVA 4C57C 3KJ4B 3MLUH 5I0WA 1QFWM 4GO6B 4MZRA 1HSBB 3MJGX 2R51A 1NC4D 3DARA 4E9QA 2VDLH 5JUEH 2C9UA 1ITCA 1DBMH 1CYGA 4LARL 4U1GB 1E4XL 4X7TB 1P69B 4HKZB 5IJCC 4NGHL 1HWHB 3QFJD 4KUCF 3Q5YA 4LOVA 4M6OL 1BD2E 1HL5A 1MJ7L 3SDDA 2CO1A 3IKCA 4UDUB 3OKKA 4KO7A 3CTTA 1YPZB 2AJXL 2V3DA 2H45A 2VMFA 4HZAA 5E4AA 3KPSE 2ZXBA 4Z1PA 2VC2H 3G6DL 4Q6IA 3OKNA 2CSPA 3QQ9C 4J3OH 1XDTT 4WW1A 4BQ6A 3MRJA 3L45A 4FG6C 5KUKA 1QBML 4B96A 1A6UL 5GGVH 3VFMA 2X6MA 3JZYA 5D93B 1EERB 4PRPB 4ZUVA 1MFNA 2OSLA 4NWUL 4R0LA 1VERA 4GSUA 3Q13A 1HXYA 5DJAB 3OSKA 4LPYA 4Z18A 4R7XA 5TF1L 4YAQA 1E6OH 4BSWA 4JFDB 4AVJA 5G5DA 4DN3H 2WWKT 4UANA 1P7QA 2JKWA 1LP9E 3GWJA 4G1EA 5J6HB 1UJ3A 4EI5A 1MNUH 1QRNA 3CHSA 3PAUA 1PX8A 5AWNL 3UZQB 1FZMA 2R2EB 1HCYA 4IS6B 5H35A 4OLZH 2FJSA 4F7PB 2WWMC 5EOTA 2O5ZL 3MLXH 1TVDA 3DXAD 2R15A 5IMKA 4DGVL 4LRNH 4PAZA 1VRSA 1A2YA 3O3AB 3EXJA 3CZNA 3BUDA 1E4WH 2X4TB 3T0DA 4Z7VA 2WYTA 5IIEA 3WHE1 2WLNA 3VB8A 4FXTA 1LVEA 4NLAA 2G3ZA 4P2OB 1N6VA 4LSTH 43CAA 4CJ0A 5B8CB 1FFPA 5DXWA 5JXED 4ISVB 1IC5L 4LRIC 2E27H 5DJXB 1LK2A 3MBWB 2CRIA 4PBXA 4Y88A 2P5WA 3SDAB 4LHUD 4KHXL 4KZDL 3ARDC 2X4RA 4JO1H 4TVSa 3FFDA 4JZNA 1BWMA 1LEKA 4PJHF 2X4UB 5C0RL 2C7FA 2V3EA 1R0AL 1A5FH 3M1CA 1N0XL 1JG9A 4IMLA 3WEXB 4YSEA 2J56A 3CQFA 4M1CD 2XYBA 5AVWB 1ICTA 1SLVA 5T1MB 1U3HA 4WKXA 1D5BB 4JFFA 2X1QA 5JPMC 3O2WL 4FI8A 4JRXE 1LDSA 5E6SB 4U3XA 1RV6X 2PR4H 3F00A 3WTUA 3DRTB 2KPNA 4GI8A 2Z7ZA 3P0YL 3PYCA 2V2XA 4JUSA 4B9PA 4MJIA 4X80H 5EDSA 1S5IH 5JQ6H 1IBDA 5AZEH 4X6FB 1DCEA 2AW2A 5JOEA 3FFCA 1TEFA 4YHLH 1VZHA 3UTSE 4MA1C 4A68A 1TO5A 1X7QA 4KBPA 2KKQA 4ZFOL 1XT5A 3SDXE 4J3XA 4M7LH 4ADIA 1XCTA 1R3KB 5MEQB 3FFCD 2W9EH 5CLTA 2DWSA 1K2DA 4I2XB 3ROLA 1HVXA 2AJVL 2FECL 4WFGE 1U8MB 4PV1C 3VXSA 1D5ZA 1BXUA 4Z3TA 4POZD 1AQKH 4KRNA 3VNZA 3MOAH 3U6XA 4LCVA 4ICWA 4MJHA 1HWGB 4UM8B 2BINA 1E6JH 4J3OF 4OZIF 4GW1A 4OKVA 4F15C 1FBIH 2AMUA 1EDQA 3OKLA 5C8JA 3O4LB 1CGXA 3J8F7 3PQYB 1PTZA 3EO9H 4FA8A 1A3RL 1S8DA 1I9JH 4MKMA 2AZUA 3EYSH 5DYOA 3T0ED 4JZJA 1E4HA 3VD3A 1CU4H 2EIZA 3H56A 1J8HB 4BWUA 2A9ML 5CINL 5E5MA 3QYNA 1CLOL 2GAZB 1I31A 4X7DC 5IK3A 4TOYL 3ARDB 1CURA 5D7IE 4F3FB 3IGFA 1DO6A 5ABDE 4PCTA 4JKPH 2F1AA 3DUUA 3U4AA 4B95C 3OAYK 5A16B 5DK3A 4WO4A 1XGTB 1FNGA 1YNTB 5DD5L 5JPMB 4JFHD 5HHQB 4W9DC 4BFIA 1PKQB 3O45B 4YDLC 2FO4B 5ANHA 1OSZB 2WV3A 4QO1B 4WO4D 4F20A 3MLUL 4QT5A 1WBZA 3BZEA 1L9TA 1YMHA 4L4JA 2X4NB 1HHGA 3FUIA 4OF3A 4X5XA 5DVPA 3AVEA 4XODA 2VDLL 5JUEL 1JPTH 1DBML 1MREH 3ECUA 3MU3A 2D31A 1EFXA 2QKSA 1HQRA 2FQDA 4MA1B 4HJGA 4N22A 4UDTA 3FU5A 4Q9QH 1QOKA 5CM1A 1NANH 1KV3A 4U6YB 3U48A 3KMDA 2OMYA 1TO4A 3CVIH 3Q3GA 1HE7A 4IIQC 1E2VA 3SKJH 1MN4A 1OAUH 3NTCH 2VC2L 4OI8A 4J3SA 2XY1A 2Z4QB 1HIMH 1Q9KB 5EIIG 2IOIA 3HPLB 1BG1A 3JWDH 3TBSB 3GINA 5GGVL 1D6EB 2X0WA 5EO0B 1QI4A 4J1UA 1UA6H 1V5JA 2RJMA 1P9MA 4F15B 4W68A 5KVDH 3SDCC 1FNLA 3TM6A 1IJ9A 4DN3L 3L3GA 4MNHB 4QRPB 2P1YA 3FCTB 3GS7A 1A7QH 1OTUD 1MNUL 4BSJA 1E43A 1U8LA 4BFRA 4XN1A 4HIHB 4LSUH 5I9QC 2F54A 3NZ8B 2V7NA 4MJ2A 2BMKA 4OLZL 1XH0A 2X4PB 3OAYH 5KOVC 3TBBA 1OW0A 1MY5A 3W39A 2MCAA 4A7QA 3MLXL 1UFUA 4BGLA 1WZLA 4XPGH 4EBQH 2H3KA 4LRNL 4R4BA 2ROXA 1OB1B 2X40A 4N8VG 2G9HA 2DM7A 1E4WL 3CD4A 3DLQR 4UIMA 2EXSA 5DHYB 3KYMB 3VXPB 4OF8A 3H9YA 3ZY7A 3K5RA 1Y7VA 4LSTL 4ZSOB 4AL8H 3QEQD 5ERWA 5EDXA