2ZOWA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
b'ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
total genus 38
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2zowA00
2Z7YA 1UXLA 2R27A 2WKOA 4A7QA 4BD4A 2AQNA 3SODB 2WZ5A 4MCMA 4BCZA 5KBLA 1IBBA 4BCYA 1DO5A 2XJKA 1E9OB 1QUPA 4L05A 2AEOA 3H2QA 3H2PA 1YAIA 2Z7ZA 2VR7A 2WYTA 1ESOA 2WZ0A 3L9EA 2AQPA 1IB5A 3F7LA 4A7TA 2GBVA 1XTMA 2GBUA 3KBFA 1F1GA 3MKGA 2AQRA 3ECWA 1AZVA 1SXZA 1TO5A 1OAJA 3GTTA 1IBFA 1YAZA 2V0AA 1OZTG 2WYZA 2XJLA 2WZ6A 2ZKWA 3ECUA 1Q0EA 4N3TA 3HFFA 3MNDA 1IBDA 1E9OA 4A7GA 2Q2LA 3QQDA 3S0PA 1JCVA 1SRDA 1EQWA 3QQDB 2ZKXA 4OJAA 1OALA 1PU0A 2AF2A 4B3EA 4A7UA 1E9QB 2C9VA 2JLPA 1B4LA 2GBTA 3KH4A 2C9SA 4MCNA 3HW7A 1CBJA 5KBMA 2LU5A 4A7SA 1RK7A 1TO4A 1IBHA 1OEZW 3CQPA 1XSOA 2Z7UA 1F1DA 3GZOA 5KBKA 3CQQA 2AQTA 2VR8A 2AQSA 1PZSA 3GTVA 3KH3A 1L3NA 2JCWA 1CB4A 3PU7A 1P1VA 1BZOA 1YSOA 3GZQA 4FF9A 1SXCA 2WKOF 1SXAA 3T5WA 2AQQA 3KM1A 3L9YA 4U4IA 1E9QA 1XTLA 2ZKYA 1BA9A 1F18A 1FUNA 3F7KA 3GZPA 4A7GF 2Z7WA 2APSA 1HL4A 4OH2A 3KM2A 1SXSA 3K91A 2C9UA 1Z9NA 3LTVA 1JK9A 1MFMA 1PTZA 1U3NA 5CU9A 1JK9B 2WWNA 1DSWA 3KBEA 3RE0A 1Z9PA 1F1AA 2WWOA 4A7VA 1E9PA 1UXMA 1B4TA 3GQFA 3HOGA 1KMGA 1E9PB 1COBA 1SDAB 1SPDA 1SXNA 2ZOWA 4N3UA 2E46A 3ECVA 2K4WA 2E47A 2SODB 1N18A 1OZUA 1S4IA 1N19A 2VR6A 1EJ8A 1HL5A 1SOSA 3CE1A 1SDYA 2NNXA 1SXBA
chains in the Genus database with same CATH superfamily
5BZDB 5ESVA 4HUWB 5INDA 5C08E 4DGWC 1XF2A 2AXGB 1PCXA 5FW8A 5HGDB 4B0MB 1UGNA 4EQ3A 1ZIAA 5TE4H 4X9BA 2OSLA 4PJ5E 5GGUA 3RIKA 1E7VA 1CD0A 2UYLA 3IB4A 4PMFA 1HEZB 2Q3XA 3IETB 4KRPC 1UWGH 4PHZA 3BZFB 5SWZD 4LQFL 4LL1A 1RUPL 4WJKB 4LDOB 2C8NA 3VFPA 5K9JH 3UAJA 1X4YA 4H26A 1IKNC 1UA6L 4LLMB 3BQUB 1JMZA 4ZFOB 2FT6A 1AIFA 2DRUA 3AQDA 1GOFA 3BMVA 2ILLA 2FGWL 1ZLWK 2VLRB 3SE9H 4Z77B 1JXJA 3IYLW 1Z5LB 3FQNB 4A2GA 3PHAA 1KJ2B 3EBAA 3QIBC 2WVTA 5CGMA 3FDWA 3RWGB 3MV7A 5IHUH 2K7QA 4WWNA 3VXMD 1O6TA 1HJBC 3P3UA 1LXMA 5JMOC 3QG7L 4UQBA 3FU6A 4HX1B 4UZSA 2VGLM 4GP8B 2R1YB 1A1NB 1FQ9C 3CFQA 4HKZB 4PGZA 5KYWA 1D5ZB 4TNFA 3KYNB 3CN4A 4KUZH 4QXVA 3QC6X 1RUKL 3GNML 1QR4A 3GMRB 2O93L 4M56A 3GMNA 1U8IB 3KLKA 3QDMB 5F7EL 1G7QA 4FKEA 1BZ8A 3RLSA 4WV1B 3FCTA 1NGPH 3EOTL 4P48A 1FNSL 3OG4B 4NQEB 5JDSA 2Q9OA 1QLRA 1EJ6A 3KLHD 2V5RA 3EYOB 1YMHA 2DH3A 4NRZB 1PKOA 2IVFC 5E24E 4XMZA 3FFDB 2HRHA 4LLQB 5BOPA 2JKXA 1MXDA 1U58A 3KPSD 1RJLA 4XP5H 4LSSL 5LDUA 1M7XA 1FORL 2BNUA 4KDVA 5E9AA 1J05A 1ECYA 4NUMA 5SX4I 2Q3ZA 2PW1A 3UZVA 1QAWA 4AJYV 4Z7WE 2VSKB 3A4DA 2EIMB 3HNVH 3MO1B 2PO6D 2WTPA 4NX0A 1DCLA 4QHMB 1CT8B 5GZNA 4Z3FA 2CGRL 4DGVL 4LL9A 1PW3A 2XXFA 3BEWA 5DD5H 3SKMA 5T5FA 2APXA 1Q94B 4Y1AE 2KLRA 3C8KA 3DXAD 1U93A 3MRBB 4OD3H 3V4PA 3ZQWA 4ANVA 2V7HB 5JQHC 1NGYA 4Y7OC 5T1MB 4YEFA 4KQ0A 3HC4H 1ETJA 5FA3A 5FUOL 5J6HA 1BVKB 1SDAB 4JPWH 1ORQA 3ZL1A 3ECVA 1MRFH 3GHBL 1XGRA 3SGKC 5T1LB 4JFOB 4Z7VF 4UDTA 4FHKA 1MQKH 4FG6C 2XTJD 3FB5B 3MRDA 5CF3A 4HJUA 3VI3F 5EWIL 5DJDA 4DUXA 3EJQA 2H1PL 4RETB 2WQUA 4N2AA 5BZWA 1DDHB 4FG2A 4X6DE 4BSJA 1JF6A 7TAAA 5I0WA 5T1KA 5SWSD 2X6MA 3MLTB 1WQVT 1W15A 3FH5A 5FYKU 1WBXB 2XIIA 2KYIA 4UOW0 3DETC 5CKGA 2DWDB 2ADFL 3B9KC 2GEQA 3ULSB 4GXUM 2F15A 4U1JA 2VDRB 3RUGB 3IDXH 5JPNB 1D9KD 2FQFA 3HZKA 4Z7QB 5SWZE 2MCMA 3MUGA 3I2CH 4MCYB 3IGLA 3BVVA 1AHKA 2NZIA 1OSPL 3HB3D 2TRHA 3LPFA 2DWSA 2VXUL 1WSST 3AG4B 2AXHA 2AAVA 3VG9C 1LEGB 3TOPA 1R9FA 1A7NL 5IHLB 4JO1L 3QORB 4OCLC 4ISVB 1JZDC 3N6YA 4IK7A 2QADB 3VXME 4JB9H 5IB4A 4R5VA 2VZVA 2AF2A 1L7TH 4LBEB 3ULVL 1TZAA 4FXGB 3OGCB 3IJEB 4PJCB 4LDLB 3ZHFA 4JFUA 4IBTA 3MGAA 4ICXA 3APFA 5AVYB 1VJSA 3OLDA 4WENB 3ZL4H 1QNZL 3Q8FA 1LO2H 1N12A 4KHXH 4PB9H 3W5NA 3HNSH 1F58L 5TE6L 4MMZB 5ILTH 3MNMA 2D03H 3BJ91 1JTTA 2BIOA 2BHFA 2OJEB 3OXRB 1XGYL 1PDKB 3U48A 4X6EA 5FYKH 2J1YA 5F3BA 1RK1A 2ALAA 3NEXA 3ZRSA 5A43C 3RL2A 3FUMA 5TDNB 1EJFA 1QWUA 3NZ8A 3U1SH 2VR9A 4FQ1H 2FEJA 3BKCL 1XVSA 3KPSE 1WWBX 3BWZA 4W9CC 2W9EL 5D1QE 5MEQA 4G6ML 1O9VA 4JKPH 1CU4H 2JCCE 1TENA 1ZA6A 1A0QL 3CFMA 4XN8A 5AW1B 5GGSA 5KANI 2M26A 4JDVB 1J5HA 4HZLA 1N2RA 5EBWB 5BRZD 2Q8AL 2FO4B 4QRUB 3LYRA 5EV7A 3DVNA 3FF7A 3NJFA 4AOFA 1IFGA 4KGJA 4GUOA 3QIWD 2GABA 4DVBB 2ARJA 3DXAE 5IESH 5GZNC 3S96B 4X99B 4L48A 1U8JA 1TNMA 5CD3A 2JB5L 1T0OA 3K2KA 3W11C 1I1YB 5IFAL 5DVPA 2OP4L 1YN7A 5E1GA 5IKCA 1SXBA 2QDVA 2WKOA 2EE2A 2XT1B 1Q9WA 4TMPA 2R2EA 3IGKA 3EOAB 4DP2X 2HB0A 2IDSA 5CBAB 3NABH 2R39A 5TTRA 2R1WB 2DQCH 2GTQA 1G7MB 3V0IA 2CWRA 3OAYK 3SDAA 5G4OA 4Z78A 5FWRA 4DK5A 2X3BA 5SWSE 4X9YA 4DUVA 4PGEA 1CGSH 5LXGH 3W2DH 5D71H 3FW6A 4N90D 5FOJA 5I76A 4OIIL 2LAAA 4JPVH 2L0DA 1HTYA 4F5CE 3TA3D 2LT9A 4GG6B 3C08H 2NY0D 3BSGA 3QH3A 3MRMB 1N0LB 4EZJA 4TQEL 4JVPA 2JKTM 3HUJF 4XOCA 4C59B 2Y2WA 1AI1L 3FO0L 1F5WA 3MODH 2PNDA 4B9IA 1CPUA 1ORSA 3V4UL 3ZR5A 3NAAL 4FZ8L 4UILL 3U6XA 1QRNA 5KAQF 3OJVC 1LD9A 5IBUG 1JYNA 3OF6A 3L08A 1ZEAL 2EO9A 1PQZB 2R4RL 5CJOL 1IGJA 2VSCA 2VWEC 5ITBH 4P4RA 3RGVD 1JZ7A 4P57A 2WQWA 1XSIA 2VC2H 1AS8A 5DEGB 4ODXB 4ZD3L 1WCBB 3UC2A 4CW1A 2ROYA 4Q4IA 1Z66A 4DZ8A 4LHUD 1YMMA 4PH8A 3WJMA 1U8HA 2XV3A 2EINB 3N04A 5IM7B 2A9ML 5B39G 4WWOA 2RQEA 2WUCH 4XX5A 3VO0A 1OM3L 2VXSL 1E4KC 3FKUS 1CB4A 3GJEA 2OXGB 4BKSC 4AY0A 5I0XA 5JR1L 1SDDA 2H6PB 3JVGA 1KLFB 3NSJA 4GG8A 4KRPD 3AG2B 2XDHA 4AZ8A 5DMKA 2X89D 3AG1B 3WFHB 1CFSB 2AJZB 2OJ1A 4TNWK 3BFOA 1H6TA 4GKNA 1WA0X 2XIBA 4H8WC 2ZONA 3VWKD 3DLQR 3QNFA 4XOEA 4AX3A 2HKHL 3BESR 2YARA 5G55A 4YPGA 1OCOB 1RJYB 2F18A 3QHZH 3QIBD 3RWHA 4ODWA 1N3NB 1PZ2A 3CVCA 3A0OA 2CR0A 4E9LA 2HFGL 2WOBA 2E56A 4PCKA 5J0BA 3FUJA 4CKQA 5K1NA 5AVQB 4F1ZA 4J3WA 3V5KB 1IGFH 1A64A 1Q9LA 4HCIA 5IK3A 3T3PE 3HG5A 5BRZE 2ZUWA 3EH4B 3F7QA 3GF8A 2AEWA 5BO1L 3NACL 2N7AA 5FOBB 3RHWK 4R7LA 4JRYB 1JZIA 2DWEA 1KGYE 2GEEA 3HBQA 3BWUF 3GXFA 4EUPA 4CA4A 4W6WB 4JW3A 2XHNA 4XCEB 4PJIB 4JG1H 3U4AA 2XJKA 5CS7A 1RPUA 4LCUA 1T1ZA 3TJHD 1AE6L 1X9LA 4R4FL 2ATKA 4PG9A 1TJIH 1A6UL 3QR0A 5BQDA 4U7SA 2EE3A 3SJVA 3VSQA 2HKFL 3K7UA 4H8WH 4LE8A 2Y3AA 3LHPH 2HXAA 3HC0B 3NG5A 2GK2A 4G1MB 4BIKA 1T0MB 4N90E 5IMMB 1PZBA 5L8LB 2XICA 2VOTA 1JV5A 4FEIA 1CURA 2O5XH 1XR9B 1Z1WA 2JIXB 4Y2LA 1YDPB 4DGYL 5DSCB 1JPGB 4G72B 4TPRH 2FECL 2Y07H 1AQHA 5ESAB 4HMCA 2R0WH 3GO1L 4G11A 3FTVA 3T2QA 4UM9D 4EN3B 4QLRA 4MJ6B 4ZZFA 3VGAC 2FNWA 5EOTB 1UD5A 3N43F 3FB8B 1O0VA 1PNDA 5E5MA 4ZXBD 4WO4A 3HC3L 2I24N 3GXUB 2FECI 2LU5A 2BNRA 3MNWB 3DHPA 4XCCL 1BFOA 2QLYA 3EYSL 1MFDH 4FP8L 4DJMA 4M48L 4JZOB 5GGVL 5HYJA 5J57B 4HUVB 2WLIB 5KJRH 1HT6A 5DHDA 3QULA 1ZLVH 4EQ2A 3FH8A 1ZVSA 4FNUA 4UV7H 5EN3A 3SQOH 3PDGA 4P3CH 3DETD 4ONHA 4L4VB 1CGWA 3B9KD 2AQQA 2VXQL 1CXFA 4YE4L 1G0YR 5I6MA 1H0DB 3BH9B 3NOIA 4MXWL 1XF5A 5FYKD 2R56L 3GSNB 3ASNB 4G7VL 2XIDA 5KVEH 4L3FA 1F3JA 3JVGC 4JM2F 4XN4A 5EG6C 4X8JB 1W0VA 1A02N 2Y06H 4PJAF 3L2MA 4HIHB 2VUKA 2XYCA 5HI5C 1FGNH 1D7CA 1M57B 3IFPB 3UAJD 5F9DC 5E2UL 2IPTL 3EGSB 3MRRB 2ZX9A 2HTLC 1X5HA 4N0UA 1NC2A 1W80A 1ZDSA 3L5HA 5DT1H 2OR9L 1XR8A 1ZWIB 4JN1L 4P9HC 1QBLH 1VFOA 2XWTB 3MV7D 4GAGH 1RHFA 4OGXL 4UT6L 3RIFF 3FQXB 4AYSA 5EEUA 1TCMA 3KPQA 1I3UA 1ND0B 3FUIA 4Q9CA 3ZKXB 2CNYA 5C6WH 1V05A 1KULA 5IUSA 4FX5A 3FF8A 1U8NA 4JFFB 2O5YL 1YQVH 5JQIB 3QNYA 3GLAA 3CCHA 4JRLA 1K8IB 3CBRA 3IDIA 2IG2L 3VWJC 5DYFA 3KPRB 4PAZA 1DR9A 3KPMA 3K8LA 5B38B 4N5EC 2QDWA 3FO2A 4DESA 5LGJB 2YEVB 4HEPA 5DQJA 3J27A 5KW9H 2WGXA 4YXKL 5IBUB 4AYBA 5HD8D 3RY5A 3QYCA 3E6FB 3FO9B 1EAOA 3G6DH 2XJLA 3T2PA 2WWMC 1AZRA 5EO9A 3EGDA 4ZNEA 5BVJB 2XOTA 3UOAB 5EU6B 5BPPA 1YUKB 3TNNA 2JJSC 3KJ4B 3FSWA 4FQXA 2XN9B 4Z7VB 5KUMA 2NYKA 1YJDH 3AWEA 4KK6C 1AMXA 2XVBA 3L9BA 5SV3A 3CSTA 4UQ9A 1M7DA 1D7FA 1ZLWH 2AJSL 2UVEA 5IVXA 4WWKB 3WNLA 3MJ9L 1WZ1H 2F19L 3AS0A 3MXWH 2QQLH 5GZND 5HHOD 2A1WL 4YC2C 4DN3L 2EDOA 1AQ8A 5EC1B 4M61B 4OAWB 3W11D 3UAEA 4MAUH 2HP4A 3H85A 4RAHA 1M1XA 2R23B 4TUOA 5C0IA 1DDTA 3VG0L 4PGJA 1FNGA 4LEEA 2AQSA 4L1BA 3WHXA 2I5YL 2HJFA 1LDSA 3VFRB 4LARL 3ZHLA 3B4NA 4F7CA 4WO4C 3HZMB 3GZQA 5FEBA 4H88H 2AJ3B 3FSVA 4JL1A 3QZOA 5DA0B 3BKJL 3VDBA 1UD2A 1ZHLB 5C0RH 1PX3A 3FUEA 1Y6NR 3HI5H 4NKQB 1UJ3A 1EMTH 6FABL 5T1KD 4MB3A 4Y2NA 2DQEL 2V2XB 2C3HA 4KX9A 3LRKA 1LL1A 4V1DB 3T04D 3MJ7B 4L8DB 3EHBC 4O5LH 5DEJA 3VTTA 4KITB 1PTZA 5FYKE 5FLUA 1FGVL 4WI7A 3MJ8A 5JNYA 5TQ2H 2BNQB 5F3FA 1T1WA 1WFUA 3TBCA 2IPKB 1HKFA 4NBZB 4WTQA 1CLYH 5H37H 5C0DA 3VNYA 2Q6WB 4PJEA 1C08B 2P7TA 5H2BB 4LSQL 5H37G 1P7HL 5FO2A 3CSGA 4FKHA 2NY5L 4N0YH 1HHGB 4AL8L 1MRCH 2D31B 3ARYA 4LVEA 3EIFA 3ZTJH 4BM7A 2AC0A 2LTQC 4MNQB 1RI8A 1NWPA 3KL0A 5EF3A 4BWWA 3RWFB 3WXVH 1VFUA 2R0ZH 3O6FD 3MV7E 4PB0L 4Q52A 1NIEA 5E7FA 4X4KA 1TJGH 5C6TH 2NLJB 5IMOB 2B0SL 4UF7C 3RBGA 4L3CB 1YC8A 4B5ZA 1N7MH 2H1XA 2XZCL 4JY4A 4M4PA 3MLYH 1FFNB 2WYTA 4R7XA 1I7RA 5FFOA 3A4EA 3MBEA 1QFWM 1IE4A 2R2BA 4Y4FA 3FTSA 4RWYL 3OR6A 3CFJA 3ARFB 4MMXA 2IALA 2VO5A 1LDPL 1XCQA 5TH2B 4JDZA 4Z95H 5EIIG 4OCSH 2R7EB 2WQXA 3OKNA 4KZ0A 3QQNA 4QRQB 1U91B 1ZHKB 1JZEA 2DQGL 2GITA 2CLVA 4XNXL 5B1CA 4X5WA 3O8XA 3ZW3A 1I3VA 3G9VA 1L6XA 1P69B 2X42A 2YS4A 5C92A 4L0YA 1DE4B 2F5BH 1U4FA 4JGUA 4PLOB 3BZ4B 1QHQA 3VCLA 1EZVY 2GFBB 2NT1A 4A6YL 5I15L 1U36A 1EV2E 4PV9B 4XVUD 3KH4A 1ZKAA 2O6CA 3QT2A 5A2IH 1Z9LA 5KVGE 2ICCA 1ADQL 4NZRH 1HILB 3D05A 1P0SE 2UZXA 3QVAA 4FQXC 5DHYB 5HHOE 3TBBA 4CL7A 1KGXA 2CO2A 4QRPB 3WEAA 4UNUA 1TJMA 3STBA 3NRPA 5JYLA 4WK4B 1UURA 4TUJB 4OI8A 1B2YA 1IM9A 2EUVA 1Q9OA 1ZHBA 3PU7A 2GJZB 4M5TA 1N0XH 4GW5A 4IIQA 3X13B 1TZGL 4IU3A 5HGBB 3Q2WA 4ZW7A 2EUXA 1A6ZA 1FC2D 3ETSA 1GSKA 3J07A 1ID2A 3SGEI 3E6HA 1S7TB 2BY2A 4LOEA 3JWDC 3VFUA 4NQUA 3RWIB 4JLRA 1J0HA 4OQ1A 3SBRA 4JZNA 3TH3T 1F3DJ 2ZYSA 3SDAD 3HN8A 1UM5H 1S7RB 4AJWA 1ZS2A 2LV4A 1VGEL 2BCKB 3CMOL 5HYSA 3DJZA 4KV5E 3OSVA 4F57H 4LLWB 3CQFA 3GSOA 3S36H 1NKGA 4DAGH 1UJ3C 4W9FC 3VI4A 2M8XA 4ZUTA 3BSHA 5DS8B 4NLAA 3S35L 3ATEA 4G43B 4HFUH 1FFOB 1E30A 3UDWA 2YAQA 3DTXB 3OKKA 3A67H 1J0JA 4ABVA 2QKIA 5IW6A 3E1ZA 4BA0A 1NCAL 1TSRA 5G5DB 1SOSA 2NDGA 6PCYA 3EGXB 3NH7H 4HJJH 1ACYH 1HINH 1SJHB 4D8OA 1JV2B 1KPUB 4XCFH 4XNMB 3ATBA 4Y19A 4BD4A 2J8UA 2YRPA 1QRND 2DF3A 2B2XH 4HLJA 3KBHE 1KJVA 3OF6D 1MJUL 3FAWA 3II1A 5J1AB 2EIBA 5PAZA 1NKOA 1SLWA 2ENYA 2ZIDA 1TVHB 5HVHB 3P1VA 4QKTA 1H9VA 4RMVA 5A6MA 1RU9L 1WICA 2AEOA 3D18A 5AYUL 3U4KA 5D7IA 2CPUA 3S3SA 2OTUB 4H7VA 4WKZA 3FPYA 2WIMA 3PWUB 3RI5F 3JTSB 1PY9A 2IV8A 4UBDC 1TTCA 2CNZA 4G6JL 3BCDA 3G08A 3OAYH 1GZQB 4QXGH 3HJ0A 4N8PA 2YA2A 3WY3A 2WQSA 2YA1A 2VDNH 4PV8B 2EAEA 4PRAA 1AQDA 3MBEC 5HI5D 4XX1G 3X1BA 1GPOH 4Y0GA 4Y4FC 2H26B 2ZUUA 3G5XB 4MMXC 2H3NA 5IMLB 3SO3B 3B3IA 5FGSA 4NQDA 2BFVL 3HMWL 3VH8G 3JT2A 4J1UA 1LYQA 2VDML 5B4MD 4XPFH 3DVFA 5DO2C 3BH4A 3O8XC 3PHOA 3BGMA 5EORL 2ITEA 1JK8B 4PY7A 2HRPL 2Q8BH 3OC5A 1JIBA 3OB8A 4FULA 1BFTA 4JDEB 1RULH 2GK0B 4F2FA 1PZSA 1EXHA 3RVWD 3GI8H 1RFDH 4LSRH 1GGUA 2I7OA 4HVBA 1FVDA 3AAZB 4Y9BA 2AANA 2ZCKL 3JSSA 4LSUL 4WNSA 4BSWB 1IC7L 3WS3B 2Y0SA 5I73C 1HN1A 3JWNE 2H32A 4N5ED 3KDMA 3GMMA 3VDCA 3T6WA 3C5SB 2FX7H 1GY2A 3DA0A 3MYJA 1KTKE 2HT3C 2EYSA 3VB9A 1KYFA 1F6FB 1KPVB 2Y9RT 2YPVA 3AQYA 3JZYA 4IIQC 2KDYA 2ZCLH 2M1KA 3N40P 4K7PL 5IVOA 3WFEL 1U3NA 4MXQC 2HLAB 2QT6A 1KXVA 4D2NA 5IHZA 1IAIH 2UY6B 4KJQC 3SJVD 4P2OB 2J88L 4P3WA 4HG4K 1W72B 1OAUL 3STLA 4E9TA 4KK6D 1R24A 1H3GA 1UWEH 4MHHG 4X6DF 3OXSB 3HAEA 2FJGB 5F71A 3LEYH 3M1BA 2G2PA 1FSKB 1N68A 3HLAA 2FVNA 3F12A 3D2TA 3T6VA 1JZ2A 2L7JA 4KVNL 1CXIA 2XWEA 3LEVL 4MD4A 1UXLA 3EG9B 2EH7L 5L0QC 4XO8A 2E59A 2LFEA 5I1GH 2J6EL 4BFIA 3UDWC 2X7LA 2QKIC 4YQXH 2J1ZA 5J1SC 1M53A 3WO4B 3VXTB 4QF1B 1QRNE 1DJWA 4P59L 4WO4D 5BUPA 2BNRD 4NENB 5KVGL 3VFVA 1ZTXL 4MA7H 2PLTA 4JM2B 2YGNA 3ZQXA 1I1RA 4BBWA 3HR5B 1J18A 4LDCA 1KF9B 5FR3A 5HYEA 1MSPA 4YNYB 5AZEH 3T8XB 3BZEB 5IB1A 2NX5B 4L8SB 1NDGB 2P5WB 4N2OA 1YMME 5DMIH 1RZFL 5T5FL 3V4PL 1KBWA 2CUAA 1KJ3H 1FLTX 5BQ7A 5AOJA 3G04B 5C0EA 3US1A 1YEKL 3EOBA 4P23A 5AOMA 2J44A 4N0CC 3HVDA 4RGOH 1A66A 1NANH 5KANG 5I74C 1EHXA 4S0HA 1GKOA 1UB5A 3DOHA 3LMJL 4RMBA 1AFVL 1HE8A 3UYOD 4ODUB 1MJ8L 5I19H 1U6AH 3WSQH 1IGML 2YD7A 3B2UC 4R96B 3L1FA 1SN2A 1BZ9B 2F8XC 1WFNA 4P5TA 5IIEA 4XNAA 1H5BB 3A23A 4X6BB 1ZSDB 3OKYA 2FB4H 4NRXB 4YMPA 4S1RH 5AAWC 1RJZB 3CFEB 3IFNL 5ANMB 3D07A 1LO5B 4OFQA 3WIFB 4JGJA 1PZ3A 3DUUB 3VB8A 3CHSA 4MFHA 2BVOA 3OKOB 1CXEA 1SXAA 1TFHA 2NY1B 2WVVB 2JCCF 3BCFA 4KH9A 4ODVL 3IAGC 1EAQA 1GYVA 4Z8FL 1IO4C 3B7RL 2IOOA 2E3VA 4MJHA 2OW7A 2ICES 5FA4A 3JYBA 1GJWA 1I1AB 1H3VA 3DV4A 1AG6A 3LN4B 3OKDA 3FOMB 2XWJA 1TTRA 1A9VA 4AWJC 3QCTL 4QRTB 3PUUA 3ROOB 3L3IA 5F7NC 4ZSOA 2A77L 4O51A 1PEZA 3SPVA 4RFOL 1UXMA 5E8DL 2CIIA 5TGBA 3VFSA 3ZKMC 5FB8A 1KBPA 4WEMB 5HHXH 2NT0A 3SJVE 5KWYC 3OKLA 5LVEA 4ZW8A 5FKPA 1KXVC 3LQMA 2D73A 3N85H 4DN4L 3UCQA 3OPZL 2G2RB 2VDQH 1H3PH 3NVQA 1RZ7H 4FQXD 3CFTA 3GINA 5FX3A 3DNKA 2WO4A 5BXFA 2MMXA 1GL4B 4U7MA 3BEVA 1A3LH 3PGDA 3DJSA 3A24A 5C1MB 1Q9KB 1FN4B 4DEPB 4MAYB 4JJHA 5E6IB 5HDBE 4NO0A 2W8CA 4ZO6A 4N8VG 3CSPA 2BNRE 3TESA 3ZGIA 3U2SA 3QXVA 1A7RL 4GIAA 5KSVA 3PL6B 4UDUA 4MZIA 4XN5A 1EZUA 5HYJE 2IBZY 1SYSA 2AKRB 1P6AB 1RZJH 3CFCH 3DVIA 3NTCL 2RMNA 2A6IB 4P5MA 1BCIA 1DQQB 3O3DB 2R0LL 3FOLA 2DD8H 2E7HA 2VABA 3EFFB 5CINH 3V0WH 5I6LA 3F01A 4FFWC 4FAAB 3Q0HA 4MD0B 4XCNB 4YHPA 2VLJD 2Y72A 1TYRA 3BAEH 4R5XA 4U33A 2H0EA 4DP9X 1F90H 3AMKA 3GBML 4P23C 2MKLC 4WJ5A 4APXB 1CO1A 1OP5K 1GOGA 4PR5B 3PAZA 1FL5A 1TJHH 4Y5XA 4ZMLA 2OYLA 5SX5H 1AGBA 3PWNA 5IEHB 1YEJH 4H2AA 3UPRA 4BFGA 1HCYA 2H9GB 3CZKA 1E4HA 3MQIA 4JFVA 3G5YA 4X6CF 5DC2A 1E4WL 5K59F 2VDLL 2X4TB 5AD0B 4P5TC 2Q7YA 3WKMH 4N0UE 3WMPA 3C9NB 5DJ6B 4F58L 1I1FB 3D2UB 1XGTA 5E99H 4UBDD 5CSGA 5KVDE 2BVPB 5F7AA 1MCHA 4MMYA 1OHQA 3MACH 4PRHA 1A6WH 5GJSH 3LTVA 3ZHKA 3T3PF 3UEQA 3SE4A 1NC4A 1FH5H 2AVFA 4KMLB 3WE1A 2AMGA 4XE0A 5F7MC 4YLCA 5JW4N 4NSKB 3MBED 4EBQL 1S7SA 1QFWL 3G9AB 4ZOCA 5EN2B 4Y4FD 4KMTH 3SN6N 3T4YB 3TYFA 4ANUA 3P73B 3SBQA 4X7TB 1OKEA 3QDJB 3GRGA 4M5YL 4LP5A 3M8OL 2F9BT 5SV4A 1JGIA 3GIZL 5HTSA 3O8XD 2WXOA 2NW3B 2Q7NA 4AVHA 1CVSC 2HVKA 4ZNEE 1JVOA 2XBZA 3GSRB 2CLRA 1JGEB 1RUAH 3P4OB 3V0VA 3H9HB 3TS8A 4KZCA 2F7QA 4MJ5A 1UZ6E 4QTHA 3QYMA 3D0AA 9CGTA 1JZHA 4P2CG 5F7DA 1QACA 1FF5A 4AE1A 1PLCA 5JIMA 3C6EA 1J0KA 5IVXE 4FQHB 3UC0H 1FO0A 3VE0A 2AXWA 2AQ1A 4WTZA 2YAHA 1NA8A 3MCLL 3HPJA 4LF3B 3VRIB 4F9PA 2NY3C 4GXFA 3TA4D 4FQJL 4F15B 1IM9D 1BIHA 4P9HL 4U6HB 3RWJA 2HT3D 1HZHL 1MN4A 5CSBA 1JHTA 3ZKNC 5T5NF 5C08B 3LQZA 3MCKA 3OGOE 3ILDA 4KOCA 5CFHA 1DQLH 4PJ5B 5CGTA 2OMVA 4IIZA 4L3EA 2B7DT 3QCUH 1E2VA 1KTDA 2BY3A 2NY6C 2WTOA 1A4KB 1EZLA 2JLPA 4HP5A 3CHPA 1JNHB 4OFDA 5FDYA 3D39B 5C7ZA 1YZZA 5CKAA 2C4FT 4DP5X 4Z7OE 3QPXH 5HPMB 1XIWB 4EF3A 4AT6A 3Q9QA 4NWUH 4UT7H 4IHOA 1WHOA 4LIQH 5L2JB 1NBZA 1KCWA 4LASH 3BPCA 5E8NA 2HJKA 4E42A 3P9LA 3EF4A 1M71B 5GGRA 2BOBA 4QRRA 5G2NA 1TKWA 3SIKA 4M8QB 4PJEE 4YBHA 4EZMA 3US9A 4J3OG 3TIEB 1CE1H 1S78C 4H40A 4Y5XC 2CMRL 2APBA 3NMEA 3AFLA 3ARDA 1B2WL 1MI5A 3SPCA 4Y19D 2V9TA 3MFFB 4L9LB 3R7RA 3GUTA 4HU2A 4UQDA 2H6UA 3QBTB 1IKFL 2G9KA 4GAYB 2WBJB 2XKNA 3IS1X 1F6AA 4U3CA 3FONA 3BAKA 1UT2A 2C9UA 2OQJA 4TXVB 3FS9A 3UTZA 2QL1A 1MCEA 3O11B 4YFDB 2CKBA 1KTBA 5F3HA 3HLKA 1FJ1B 1DVFD 1LO0H 4WFHE 3MRKB 3RPBA 3GXMA 1DFXA 3IJHA 2I85A 4LOUC 5DUJA 1KJMA 3FCGA 3TF4A 4NO3A 5LG6A 4L8BB 4JG0H 3LKPB 4KTDH 3B7TA 3SE4C 1QLFB 3PWVB 4Z0BL 1NCCH 3L7FB 3MRJA 3O3EA 3KWVA 2R69L 4P3DB 1I9IH 2KL6A 2V7NB 4QUOA 2WJ7A 4H5SA 1ZA3A 1CYWA 2F74B 3Q06A 1K5WA 4GQPH 3EJYC 1GC1C 4HBCL 1E3ZA 4NQDD 4U1NB 1J5CA 4Z7AA 1I4FA 3SZ6A 4PHXA 1B4RA 3I75B 1YAIA 1FBIH 5LDSA 4KZEL 2DDQH 3OZ9H 5I5MA 1W6LA 4LPYA 3MLRH 3DBXA 4YUEL 1BQHB 3RVXC 1LO3H 2O6EA 2B20A 3DRTB 1ZHNB 2QQNL 3GSVB 4LCWB 4YO0A 5FCUH 4TNGA 4X6DB 3FQTB 3LPOA 5IVNA 4YDLB 3FTGA 2QHRH 4Y16B 4DK6A 5DHVA 3DX6B 3NCCB 4I4WA 1TT6A 2COQA 4ZX4A 1ONQB 3ZKMD 3AG3B 3ZBMA 1TCRA 5KVDL 4Y4HD 4PWGA 1K2DB 3TN0A 2IXQA 2NW2A 1DFBH 2A83B 2EVJA 2D2OA 1TVBB 3A3YB 5SWZB 3MRIB 4NT6B 1NICA 4YHKH 4TRPH 4NCDA 5CP7A 1NKRA 5CO1A 2N1TE 2Y5TB 3QUGA 3B9VA 5DTFB 1GC1H 3VSTA 3D69A 3I6SA 3N1MC 3MLZH 4HDIA 3PGCA 3QUMH 1TPXB 3TBWA 3H4FA 5GHWH 4Q9QH 1TNNA 2WXPA 3K6OA 4OBSA 3VI4E 5CN3A 3PJSA 5FO9A 2VQUA 4LEXH 3GBEA 3GXIA 3RWCB 3VXMB 4QXTB 3GJFA 1L9TA 3FU5A 4XP6L 4PFEA 1IC5L 2X4SA 5MP6H 5JQ6L 2YUWA 4M1GL 1QI5A 3JTTA 3P0VH 4Y19E 5GRJL 2J8UE 1EEYA 2D4FA 5ICZA 1FO0H 3S2CA 3KL5A 4HAGA 3SKJL 2X70A 1OGAA 4YAQB 2DQDL 4GO6B 1BVLA 2BWIA 3ABMB 3ARDC 2Y7OA 5T5NG 3BPLC 1INQA 5JLZA 1P2CB 2HFFA 2DQMA 1M7IB 4FFWD 2W0FB 3A4FA 5E8OB 4KTGA 1UM6L 3U83A 1DBML 2WZPA 4NYLB 4P0DA 2D3JA 3S5YA 2DBJA 4P23D 4G2AA 4NBYB 2R0KL 3ZZ1A 3I6GA 2G4GA 3DX2A 3JWDL 4LHUG 3VFGL 5DJZA 2EDXA 4L4TD 5BV7L 2R15A 2JCCB 1A6AA 2OS7A 2P24B 2ZNWA 2VSDA 2ERJC 1H8NA 3NEOA 4W93A 5I18H 5CJXA 1ZT1A 2V17L 2KZKA 2PO6B 4JFPA 3I9PA 1C5BH 5LGHL 1RZKC 5ALBL 1MVFA 5E2VL 3S97C 1A3QA 4NKMB 4WEBL 4IBUA 4NQDE 3CGTA 3DXAB 1BQUA 2XC8A 2HFEB 2EO1A 4HD9A 4TN9A 1SVCP 2JB6B 3DHUA 4NNPL 1Y7VA 4YOKA 4Z0XB 3VFNA 1IVTA 2MNWA 4FI6A 4Q74A 3OKEA 5I75C 5E5RB 4N9OB 3RNQB 1MCWW 2K1MA 2O6DA 3NDZE 3ZU8A 2BERA 1V3JA 3WFBH 2DKSA 1LEIB 1CFBA 3GZKA 2FGZA 2XTJB 2X2YA 1IT9L 3ILPB 2BVQA 3V5DB 5J89A 3R1GL 1BXVA 1EXUA 2Y6SC 1VADA 4V11A 3ZOAA 4PVMA 1JSYA 4ENZA 4AEHL 5SWSB 2CKBH 2NZ9C 2LU3A 3V5HB 4A7UA 4YHYB 4Z7NE 5GSRB 2KPNA 1FIGH 3FT1A 3HW7A 3MBWA 4ZPVA 4IGBB 2EDJA 3WUWG 5J1TC 4JY6B 2Z4TA 1U8OA 3QIUA 5A2AA 4BSVA 3VXRA 1KCVH 4JL2A 3L5XH 4XO9A 4OGZA 1HIMH 4Y9GA 1D9KB 3NJJA 3JUYA 5KN5A 2W95A 3TGXA 3VYPA 1L3NA 1F86A 3TN0C 4YDIL 5CZXC 1R17A 5EULV 3HB3B 4EI5D 4XNUL 3IDGA 4ANWA 4GRLA 4RSVA 4WTWA 3BP5A 1EPFA 4X7CC 4PM1A 1CLOH 1AHWB 4KV5F 1ZTMA 3V0FA 3BVNA 3DRQB 1IU1A 2APSA 2CCLA 4HJGA 4GY4A 2NY3D 1DUYA 3FQUA 2DQUH 1CF8H 1W9XA 3U0PA 3S34L 1JGDB 1L7IL 4RRPA 1O9WA 5HBBA 3ZKND 5IB5B 4FTVA 3CZFA 1BQLL 2VAJA 3DX7A 1HKLL 1FP5A 4NM4H 4AYFA 3TNMA 4A7VA 4ZOBA 2GUYA 2K7PA 2QQQA 5FM4A 4NO0D 3LKRB 1T3FB 3F04A 4XC1L 3WKQA 1WD8A 4JFDA 1P5VA 4QO1A 1XZWA 4L0PB 2E7BA 5I6NA 4JFHD 2NY6D 3LEXA 4AGNA 4A38A 3LCYA 3X12B 2BSSB 4K5LA 1WPCA 2CO6B 5DEFA 3TIDB 2NR6A 2Z8RA 5E95B 4X6CB 1B3IA 1ETZA 2BP0B 3TX4A 2IPUG 4P5KA 3L5WA 4WCYH 2EVHA 5KOMC 4BFFA 4KNQA 1K4CA 3KWTA 2TSBA 4AMKH 2HN7B 4UAOB 1SJXA 3A21A 5E00B 4HWBA 43CAA 3OJDB 4O4YL 3RTQA 4J39A 4OZIB 4RAVB 1A8ZA 4Z5RA 2IGTA 1S78D 4RZCB 4ZRGA 1U2CA 3BIKB 4Y1TA 4OLUH 1W0WB 2VLMD 1GR7A 3IRCA 4LEOB 1F11B 1G9MC 3GKWL 5CJXC 3V8OA 2GBUA 4RFEA 2DLGA 1D5XA 2X2HA 3QIWB 3TCXA 3V0GA 5JA8B 2MQ0A 4KVCL 1OGSA 3RPIA 3OPUA 1V3LA 1BEYH 1P7QA 1BG9A 4GBXA 4HETA 4NHUB 3IKKA 5AVUB 4YPJA 3ZE2E 1HXMA 3O0RH 1TDQA 2ZJSL 3KCPB 4CDHA 1VKXB 3HG1B 1E8XA 1NANI 2APWA 2VN7A 3EDEA 1FC1A 1X9RA 1U30A 1O7SA 2PMZA 4N2LA 4NO5A 3QRGL 2OR8A 1NJ9B 3FU0A 5DQDL 1Y6KR 3PQYA 1NMBL 1HCFX 2G30A 1CZ8H 2YHGA 4NZFA 2CUMA 3KXFA 2OCCB 3FU3A 3NFNB 5K9KB 1AOZA 1LP9A 1CG9A 1WIPA 1KYOJ 3A5VA 1FAIH 3HHSA 4MA8L 4Q6YA 2KH2B 1KFAH 4V33A 4XZUB 5D72H 3TA3B 1MQ8A 3BIBX 1CGTA 3DPBA 4AIEA 1OAQH 2NY0B 4JRWA 2VMJA 5IUCA 3EJYD 4JG9A 3LH9A 4ZSOE 2P8MB 1R3LB 3NPSC 1OP5H 2WKOF 5D2LA 3NCMA 3W9EA 2YFOA 5AYTA 5J11B 3CLEL 3QIUC 4FFZH 3VRJA 1J9SA 5ECGA 3ZE1E 1KEML 5H4ZA 4KHTL 4W4OA 1G9MH 1MRDL 1DQVA 3A22A 4JN2A 2R59A 1SEQH 1NBVL 4X50A 1PG7L 2JF1A 1WZLA 2FH6A 1TYJA 4LLAA 5A40E 3RGVB 2VN5A 5EO1A 2VERN 5AW7B 3BWAA 4GRLC 2F53A 1X5XA 3FK3A 3QO1B 1UVQB 4ZTPH 4HF5L 3WHE1 4LHUB 3QHFL 4TVPH 1H6FA 4GRMB 1KACB 3BVXA 3IF1B 3DKHA 4UV4L 2A73B 3ZN6A 4HGKC 3W3BA 2WWKT 2H2PC 1HSBA 4NCC2 4Q2ZA 3AJ7A 4HUNB 1MVUA 1G7HA 1J9QA 4WY7H 5A3IC 2BP8B 4JFHE 4A6YB 4A66A 3PJNA 3U9PH 4IOFD 3KGSA 2Q0ZX 4FXTA 4XVSH 5KBPA 2I60H 5B1JA 4L3ED 4ZFZA 3A4AA 3H3BC 4Z23A 4E0RB 5BJTA 2UX6A 4MJ4A 3RVUC 4NUQA 4W1TA 1FZOA 4S1DC 4Z9KB 4PTTA 3VWKB 1Y0LA 4I13B 4ZOEA 3D0LB 5DJAB 2WSDA 4ZJ9A 4QT5B 1MCWM 2NR6C 2NXYC 5DD6A 2PTTB 3TJEL 3QIBB 1UOVA 4N26A 2GSIA 3QZMA 5B7EA 2RCSL 4ZZKA 2YPVL 3UTSA 3VW3H 4TLKA 2DM7A 4N9GA 2DLFH 2VKXA 1F1GA 4YX2H 3EADA 4HH8A 4FG0A 5KUKA 4AM0A 4BHUA 5LUMA 3S9DB 1DUZA 4WW1B 3U4BL 4QRRD 1WT5A 2VLME 4XNBA 1DBKH 2E27H 3NYKA 4IS6A 4JHBA 2A6KA 3WUWB 2EDLA 4I1PA 3KL3A 5HVGB 3P30H 4HPOH 2WW8A 3ARDD 1KUMA 1MI5D 4HQQH 3MBXL 3SB3A 2ICEA 2WLNA 3SOTA 5AFAA 2PCPA 4C56A 3ARGA 1OGTB 3EBIA 3LRSA 3H0TA 4YHMH 5T1JA 1ROCA 2CHXA 5E6YA 5EC2A 3MRLA 3D25B 3LVTA 4GBXC 1XGQB 1UD6A 3UTTA 3V7MA 4UYQA 2HT4D 4IBZA 3HTLX 3EZ8A 4N8CL 1AD9A 3S3DB 3BP7B 3IXAB 2J72A 3WNJA 4LGRB 1K8DB 2BX5A 1TETL 3BSZH 3W5MA 4FRWA 1MHEB 2BHYA 3PABA 4K9JA 4OLVH 2AK4A 2AJXL 1ASQA 3H56A 4HCFA 5IBTH 1CLZH 1QSZA 2BVYA 3N42F 4K3EH 2EEXA 1E9QA 3QEGL 1LTXA 2UUDH 5TF1H 5ID0B 1AH1A 1F18A 2DBLH 1EDQA 3O6KL 1JWUB 1WWCA 3A6CL 4K8RC 2JKNA 4UM9B 1VPOL 5I1HH 5E08H 1R3IL 4S2SB 3M17A 2XRAL 4GKZA 1PLBA 3V10A 2Y5QA 1XH3A 4ZXBB 4X7EC 2VM9A 4YDVB 5LBSL 5GRUL 5EBMA 3LS4H 1Z9PA 4PBWD 4W4OC 3W9DB 3EYVA 3MR9B 5I1IH 5I8EB 1XF1A 2YKKA 1MFBL 3HCVB 1R5IB 1YYLH 4X6FA 4WI0B 1C5CL 4ABQA 2QGCA 2YBRA 3BXNB 4ELMA 1YN6A 1HJCA 4XOAA 2BOCB 1ECZA 1GHFH 5DC9B 2D7OA 2NZ9D 2CKNA 3KLAB 3K6NA 3SKOA 5JW4M 4LPTA 3MRNB 4P07A 3GSWB 4U3SB 2IOIA 3FAXA 1AGEB 3B9KB 3AABA 2Z7YA 4OLEA 3KWWA 4YSPA 4NZDA 2X53A 3MA9H 2IDFA 4AEFA 5KSAA 2VDMB 3MV9A 4Q56A 5ESVB 5INDB 1UUSA 4PJHE 5HDBF 1XF2B 1BAGA 4HS3B 5JOPD 4UNTA 2OSLB 4F33B 5GGUB 4XH2A 3CC5B 3TN0D 2JXMA 2UYLB 3JWNG 4L3EE 5CZXD 3L4UA 4L2YA 4CU6A 1MIEL 4XPBH 3CLFL 4YVUA 3SDXA 1MFUA 4NPYA 3VFPB 4MKMA 1EIBA 4H26B 3T0WA 4DETA 5T3ZH 3CU7A 3SYCA 2H8PB 3H7BA 5D4IA 2A6JB 4JY5L 1AQKL 5I8KL 3L3HA 2DOCA 2VZOA 4HKJA 4N1EA 3MV7B 5I1EH 4FABH 3CFDB 4QRRE 4YBLB 2BS9A 3MXVH 4NNYB 3ET9F 4P2RA 5FW6A 3S35X 1JYVA 4TQPA 1OLZA 5AW9B 3U2IA 4GMSL 3ESVF 4UTBA 5KYWB 1JNLL 3Q5OA 4PJDA 1MI5E 4OSUH 1QG3A 1WT5C 5DRXB 3T9WA 1XH1A 5F9AC 3V0DA 2EDHA 4HSCX 2WNWA 1OGAD 3OR7B 1G7QB 4YDKL 5JORA 1T66C 3G7TA 1QI3A 3B9AA 2YKLH 2R2HA 4FCAA 4JM4H 3VFMA 2ICEC 3FCTB 1BDYA 3ARGC 2VQ1B 1UA7A 5JDSB 4UINL 5DVLA 1YNKH 5I1DA 1T22A 3CZGA 3UJIL 1INDL 5HI4C 4K3JL 1BZOA 4XAWH 5B7MA 2F2HA 4RDQG 1YMHB 1KB5L 3OD3A 2XKUA 1UD3A 3MA7B 2X44D 3Q5TA 1U58B 1F4HA 1RJLB 3NJKA 5BMFH 4XRCB 3X1NA 1J05B 3IE9A 3D4ZA 4KVPA 3SDDA 2PW1B 3UZVB 1JGUH 1AXIB 5DUBA 2E6QA 1YECH 1GGIH 3HJEA 5HHOB 5D6CA 2A0LC 3QQ9C 3F58L 2X5PA 2DL9A 4GS7C 3VU2A 3T65B 4R97C 2FLMA 3P9MA 2I9TA 4WI4A 1R47A 2W65A 1EAPB 3V4PB 3C8KB 3RIAF 1U93B 4KQ4H 3F65A 2VC2B 3MAWA 5D2NC 2DLHA 1NGYB 3K0YA 4NFBA 1H8LA 1TU2A 4NXSA 2D3VA 3BT2L 1P5UB 5ESQB 1ORQB 4Q89A 1MCOH 1MFNA 4OM1H 1S9KC 4DKDC 3QG6B 1VHPA 1XGRB 1UZ6F 4UDTB 3F85A 3MRDB 1BD2A 3BAXA 4Z3JA 5E6UB 5DJDB 1E4XL 4TOYL 3N1QC 4JR9H 4FA7B 2IH3A 2AJVH 1NDTA 4PJ9A 5T1KB 3T8VA 4OLZL 4OZFA 2QV4A 3D34A 1ET8A 3Q8BA 3T6QC 4ZMZA 5JOPE 1LE9A 1OARH 3QIUD 1D7DA 2X4UA 5KSAC 2VLKA 5C0ND 3VXRD 4U1JB 4G8AC 4RNRB 3RYMA 4JFYB 2WKLA 5I82A 3MUGB 5KEZA 2X9XA 3GSXB 2DQFA 2X3AA 3DROA 3TFBA 4GRLD 1OAZH 4A63A 3ATFA 5I66A 1S3RA 4UM8A 4Z7OF 5JIPA 1QEWB 1FLRL 1OALA 3O6FB 1ZT4A 3OHMB 2H2PD 1USZA 2MKWA 3RX8A 4R90L 4DNLA 2JNZA 4N86A 5B1BB 4F3FB 4PJEF 3GGWA 4I88A 3OMIB 2VDKL 3CVIH 4F7EA 2YSSA 3AXLA 4APQA 4Z3EA 1OO2A 4B0MM 2I07A 5TQ0L 2B1HL 2DKUA 2VR8A 4HHWA 4W9HC 1OGAE 4JFDD 4XPTL 5DRWA 5F88B 3ZKQD 5HJ3A 3GTVA 3H2WA 5DUML 3OLIA 3RVUD 3BOVA 5E1AA 4JE4B 3U4EA 4NAJA 5D93C 2WIIA 2FD6H 4YBQC 4HIJA 5I30H 2NR6D 1TZ8A 4X6EB 1HQ4A 1AOHA 1NLDH 2IAMA 4W9KC 1MCNA 5F3BB 1RK1B 4GAFB 2X0WA 3FHEA 1G6RL 1YO4A 2ARJQ 2NMSA 3RL2B 3T09A 4ALAH 5FHAL 4CKVX 3WTXA 3ZL2A 1BAFL 4ZG1A 1HL4A 2VW6A 3NZ8B 4KU1A 5FYLD 5JW5A 3VXUD 1PY4A 5AVSB 1HU8A 2XZQH 1N8ZA 3HRZA 1AGFA 1YNTA 3LKQA 5D8JL 3OX8B 3RTQD 5J56B 1ZA6B 3DMMA 4EIZC 5GGSB 4XVJL 3GFUA 5EH1A 4M3HA 4ZBJA 2FQDA 3VD0A 1D5BA 1N2RB 2H5UA 4G8IA 1BF8A 1KMGA 4AYMC 4H1LH 3SDDC 5EPMB 2ZOWA 1V8HA 2AI0H 1MNNA 3KJ6L 3KR3H 3DVNB 1IGIH 5F1OB 1NMCB 1OAKL 4H1LG 2GB2A 2ITCB 5DVMA 1BLIA 1U8JB 4EVNA 1KZYA 3ZO0A 1MHHA 1P7QD 1IJ9A 1ODUA 1BOYA 1SDYA 3IAQA 3K4DA 4GBXD 4N2KA 4PJ8A 3UP6A 4S10A 4N8UA 4RGMC 3ULUL 5D7JB 1YN7B 3TWCH 5IKCB 5A2CA 4UTBH 3PUCA 1WK0A 1TUPA 2R2EB 3C5ZA 3G5WA 3MJGX 4D0CB 3ZRCC 1OW0A 4LLUB 5DVKA 4E68A 1J1PL 3IDJA 1G1OA 4UTAH 2DEWX 3PQYD 4J2QA 3SDAB 4D9QD 4PGEB 3EAKA 3L54A 2EKJA 4XMPL 2YXMA 1HEHC 2EH8L 1JP5A 3F00A 5BS0A 2VDLB 4K94L 4PJ9C 4QRSA 3MDJA 4K8RD 5FHBH 4R3SB 4TQHA 4AEIL 3IJYA 3VGAB 3VXRE 3CV5A 3BDBA 1I8MA 4XI5C 1J1XL 1YEEH 3VFOA 2C3VA 1A7QH 5FO8A 3JV5A 3MOQA 5FV1L 3VDAA 5LHDA 3JV6A 4NN6C 1A9EA 3H3PH 4L29B 1QRNB 1PJ9A 1GTNA 1GS6X 3KLSA 3F3HA 4H0HB 4YK4C 5IJVA 4QHKJ 3VGDA 4M6OH 1RZKL 3W57A 4HIPA 3FPXA 2WCSA 4P57B 5EMYA 2F53D 3VI4F 4KZDL 2JQAA 5EOCH 5CEYA 3CZUB 3GMPB 1MREL 3MJ6A 3O2DL 4UZUA 3D50A 5JW4R 1U8HB 2PUQT 1DVSA 3NGBC 3O2WL 4FTVE 2ZAGA 2Z8VC 3R4RA 4MA1C 2EYTA 1YUHA 4OY9A 3SKUD 2CSPA 3UTQA 4AQ8A 1Z5YD 2YK1H 4AUYA 4WSJA 3GJEB 4OQTA 2J8UF 3AB0C 3BZDA 4JFDE 1SDDB 1PZ5B 4GQ9L 3K5SA 2BSCA 4Z76A 5HGHB 1HEJC 1B4JL 5C0JB 5AAMC 4HFWA 1LQSR 4APQC 5DMKB 4I48A 1KWGA 5BO0D 2MHAA 4OZFH 1V7MH 1WS7A 3UZQA 4CJ0A 1O5PA 3TP4A 1FL6A 4N24A 2YUVA 3PXHA 1KELL 2X4PA 1PVHA 1THCA 4YPGB 5E2TL 5FYLE 5DJYA 3ML9A 5LAPA 5EU3A 3DDGA 4ODWB 3RWHB 3TBTA 3TONA 4OCYH 4DP8X 4RMRA 3BKML 4EDWH 3TBSA 1XHHA 2P5PA 3UTSD 3VD5A 4B95C 2WLLA 3B2PA 5JO5A 1N4XL 3QEUB 4K3DL 3S5LG 4KJPC 3HRZC 1GZPA 3V0AC 4GRWB 1Q9LB 5IK3B 3DMMC 2KS0A 4DO4A 4FNSA 3IU3A 3NA9L 5AZ2L 1T66D 4CADB 5T3XD 4GFXA 5AB1A 4FZEH 5CLZA 2BSDA 3N42B 3V6BR 2KDGA 1M2VB 4C56D 3ARGD 2WINA 1H8OA 1FL3A 5EBLA 3FYIB 4EUPB 3CVHA 2X6VA 4L8CA 4XWGH 4DH2A 4PUBL 3S88L 4LCUB 1T1ZB 3UTTD 3CIQA 1ZLSL 3R0MA 1WBZA 2ATKB 3SY0A 1HQRA 3IKCA 3WFCL 4NUPA 1EDHA 1IBZA 1RJCA 1TF4A 3SJVB 1MDAA 4XGZB 4EKJA 4NOBA 3PQYE 4DGUA 3HS8A 4D9QE 5ADPH 5I6XC 3KXFE 1WTLA 5DI8A 1TQVA 1LP9E 2AK4D 1JV5B 1Z3GL 4PS4H 4Z7NF 2AVGA 3TT1L 2CK0L 2B14A 2FK9A 1SJEA 2EDMA 4YC2B 4XP9H 2BIIA 2A0LD 3NDYE 3QQ9D 1MZZA 1X9UA 2K8QA 1ZLDA 1CFMA 3FQYA 2QEJA 1NZRA 1RUQH 1EQWA 1MJJA 3D08A 2YXWA 3HI6H 5D2LE 5T3ZE 3P2TA 3SDCA 4F8QA 4S1SH 1N9PA 4ESKA 2YGQA 4JPKH 2X4OA 5CFAA 5E5MB 5HDBB 4WO4B 4JRXA 3QUYA 1ED3A 2F8IA 1JPEA 2ZUQC 4JANA 5ES4B 1BFOB 5GS1A 5D7SL 2RFXA 4DKTA 3F5WA 2DMKA 4NKOA 2GTZA 4FG4A 2G5BA 2F53E 4P4KA 1SQ2N 4NKDB 5BNXD 3D33A 4MXVE 2YUXA 4I77H 1YSOA 5C86A 1O7DC 1ZVSB 1PGRB 3SOBL 2VH5H 4MDJA 4ONHB 1PSKH 5K9QI 5E9NA 5JXAH 5EBGA 2ZAHA 3MOBL 5KSAD 4C54A 2GT9A 2FHFA 1XF5B 2JK5A 1YEHL 2BC4A 5JHLL 1JPSH 4AQ8C 4OCMC 2PTUA 1IBGH 3BIAX 3WUZA 2ENSA 1UYWH 2CG9X 2PR4H 4UB0H 3LPWA 3AXIA 1C12B 2DM4A 1F3JB 2ZKHL 1RMFH 5JHBA 2X4NA 2J21A 1DVQA 2D8KA 4G42B 5JXEA 1EO8L 1IV8A 4BUHA 1RQ5A 5DXWA 3VQMA 4UMGA 1BQ5A 1EJOL 2OXHA 4ODHL 3PP3K 1WGVA 3EOYG 3FTZA 4XPGH 5IROA 5AUMB 2WXMA 3MRQB 1S4IA 3MNZB 4XB7A 4JJ5B 1NFIA 1QKZL 3MRFA 4NPKA 2XWRA 3UTSE 2HKAA 4HGWB 4QWWC 5HYSG 1QO3A 4WWID 2XV2A 2QJDA 1D6VH 4P2RD 4DK3A 1JS4A 3S6CA 4BCZA 3CN3A 5GISH 1T2JA 5A2LH 2QSCL 2N7BA 5T3XE 1U92A 4ZUVA 3QNYB 5D55A 3CCHB 2Z0UA 4C56E 4CNIA 3VFWA 4FDWA 3HG0A 3IDIB 2NCMA 4YBQD 1ESOA 1WZAA 4K73A 1LGVA 2HUEA 3ZE2F 3WJJA 3WKNA 2X4QA 4KI5C 3FO2B 2EXWC 2MPVA 4H4NA 4OF6A 5DQJB 3UTTE 5HGAA 4OQTH 4YSEA 2ICWB 3WN6A 5E9DD 2YN5A 3P0YL 2VMCA 2ATPB 2HJLA 1YQ2A 1TFPA 1RIVL 2ZKWA 4QJ4B 4RA3A 3S37H 5EO9B 4DPCX 3EGDB 3PFUA 4AK2A 5C0CA 2AK4E 4HIXL 4MSWA 3D85A 2C5DC 3AU1A 3TNNB 1RUMH 3II3A 1U8CA 4FQXB 1CDCA 4CN4A 1E27A 1HK6A 1CXLA 3SDDD 4IRZA 4WI9A 1M7DB 3VQ2C 3C60A 5GJTL 1RZIB 2PW2A 3AY2A 4YDJA 4YR6B 3FMGL 1AJ7L 3MJWA 5FYLL 2WBKA 4TUOB 3D09A 1M1XB 5C0IB 3ZE1F 2CBQA 1CK0H 3SDCC 2FTAA 4HWBL 3KG5A 4Y7MA 5F0JB 4IQHA 4AQEA 3WHXB 1J1OH 2HJFB 1CFTB 3ARUA 1MFVA 1KGCE 4ELME 5BV7B 3WTSA 5F1NB 3QUYC 2D9QB 3AREC 5E2WL 2VSMB 5LGYA 1SMAA 5IWLA 5GS1C 3QJXA 1BD2D 3RRQA 4M7LL 4EXKA 1PY0A 3CVHH 4AENB 3DO7A 2NTSP 1MLCA 3F7PC 4P4KC 1AY1H 5LCVA 1MWAA 2HG0A 2FYVA 3D06A 4LLDA 4JQIA 4N85A 4OFVA 4P5SA 4PJ9D 3ZSSA 5IT2L 3PGFL 4Z7OB 3S5LB 4AG4L 2VLJB 1KB9J 3MV9E 3UBXA 1PPIA 1AIZA 5DHXB 4XI5D 2WGNB 2FSEB 4B50A 3MJ8B 5JNYB 2ZUSA 3IJSA 2G75B 2VLKD 1IAMA 4W9ZA 1T1WB 2EECA 4FLQA 5T33H 4HXBL 4U1HB 3QFGA 3WIHL 4HZAA 4UOQA 5C0DB 4PJEB 4NQVA 3VQ1C 4W9EC 3SDXE 1DBJL 2H3KA 2HH0L 4CVZA 1HL5A 5C07A 1DLFH 4AXWB 3IT8D 5KYXA 4KC3B 4R83A 2OMXA 3O3BA 3O6MH 5JXEC 4K8RL 2VZ3A 2D7MA 1JVKA 4M43L 4YXLL 5HPOA 4FYRA 5DURD 1ES0A 3ESUF 1JZJA 2XETA 3MREB 4YFEA 5IROC 1TZIA 3IMTA 4I9WE 2AW2A 5EUOA 3WD5L 4P2RE 1DQTA 5FUZL 3O41A 2QKSA 4NPJA 1CR9H 1ZY9A 4PJDE 3S36X 4JY4B 4HAKA 1UFGA 4DZBA 1IKOP 2AQPA 4APQD 1I7RB 3IVKB 5ISZA 3MBEB 2FJHA 1U8PA 3L95A 4G6AC 4M9OA 2HLEB 3GHEH 4Y4FB 5AW0B 7CGTA 3OR6B 3QJHA 4Y2DA 4L9DA 5AOZA 5LO7A 4MMXB 2IALB 7FABH 2DPKA 1XCQB 4JDZB 4OZGB 2YEQA 5B3NA 3QHTC 1G9NL 2CJSA 4LXFA 2CLVB 1ETA1 4X5WB 2FCBA 3WJJC 3O8XB 4E41A 2IAMD 3CDGB 1DJGA 1G87A 3FUKA 2FSDA 3NFPA 4E5XA 3ZZQA 2HA1A 4QD2E 3UBGA 4XR8C 4KJPD 2B5IC 1UQSA 2VXVL 2AXFA 1D7BA 3I9GH 5LBSH 5K39B 5AVZB 3K46A 3G3LA 3NEEA 2ZX5A 3OAZH 3I50H 3BVDB 3T4AB 1F4XH 5HI3C 1EEUA 1OE2A 3ARBB 4QTIL 3WFDH 4UU9A 5MI0C 5GGTH 1Q9OB 5KSUA 1KOAA 4GW5B 4IIQB 3DI2B 4PJ8D 4G6FD 4NHCL 1KIRB 4YHIA 1A2YA 4M4RB 4NO2B 4PD4K 3UBHA 5IV2B 2WB1A 2YPKA 4FL4C 2ZICA 1SEBB 4PYGA 4HA1A 1DJIA 5AVRB 4GLRI 3IBOA 3B56A 3EBHA 4I18C 1J5OH 3C5ZD 2FJUB 3I6KA 4ZS7H 1DBBH 2OMBA 1BD2E 4JLRB 5FGCE 4LPVA 1ZLUK 1BXXA 4JZNB 5I8CA 5T3XL 3RNKA 4D9LH 3MSPA 5IWLC 2ID5A 2XPYA 3MRHA 2WWOA 5D1XB 3X3GH 2HLFC 3MV01 4BQ6A 5HYSB 3GSOB 5B1AB 4BHUI 3F7YA 5BS0D 1MOEA 3VI4B 5L0QB 5IFHL 3WLWD 4PJHF 4XN1A 3TASA 4GMTL 2IANA 1URIA 1RHHA 2VLKE 5IQ7L 5IW6B 1IAOA 4XBMA 4GSRA 5FYJD 5HDQH 4IRZH 4AEEA 3RL1A 4NAQA 4PGCA 2J8UB 3KPNB 4BK8A 2A5UA 3HZYA 1KJVB 4HUKB 4ADJA 5C3IA 2MQGA 3Q6GH 3NIDE 1XCWA 2XN2A 4QIRA 4K23L 2DI9A 2DKMA 2VZ1A 1DVFB 2VR7A 3D18B 3NK4A 4KXAA 1GXEA 3LIZL 1U3HB 1VIWA 1HCZA 1GVIA 3CHXA 4ELDA 3BPNB 2MCPH 2NXZC 3NJHA 4KX8A 3TO4D 1A1OA 3NCEB 3ZE0E 1QBML 4H20H 1ZGLA 1JPFA 1IARB 2ADJA 2BSRB 2WN2A 3AT9A 3G5VA 4LP8A 1WFMA 4PI2A 4PRAB 4BXVA 4DO5A 1MJ7H 4F7PA 3US0A 4G8FB 4JHAL 5KBNC 1AQDB 4HIIA 2JELL 4U1KB 2DMHA 3BGFB 1X7QB 3GMLA 3IDMA 4Y2DC 5DEZA 1D5MA 2L4OA 3AITA 3UTPE 2XA8H 3ALXA 4HWZA 1GCYA 2MQCA 4NQDB 5D70L 3NQIA 3V7AE 1EHLL 1ACXA 2Y6TE 3QQXA 3NJMA 4AW4A 2ROXA 1BOGA 2CUHA 3PHOB 1QD0A 4XNZC 3OLGA 1YY8A 3BGMB 5F0MB 2CAKA 4L37A 3RA7L 5B3JE 5EEWA 4OJFH 1ZS8A 5CJ5A 1N6UA 4FQQA 2J4WL 1DSFL 4PWFA 2XQYK 3BRFA 5IW1A 1CI5A 5E4AA 5TFSH 5HXMA 5F9JA 3O6LL 9PCYA 5I8OL 4HYTB 5C2BL 4ONFH 4WZ9A 1UJTA 4RIRA 4HS8H 1NCDH 2AV1B 2H32B 4KI5D 3CXFA 2EXWD 3EFDH 3GWJA 4ELKA 3L3DA 2CR3A 5H35A 1EGJH 4XHQA 4Y9FA 3JWOL 4Y4HB 4W70A 2EYSB 4YSTA 2E9GA 3ARXA 4HUUA 5T1DH 1NFDA 2DLIA 2R4SH 2EEAA 4DPRA 4IEFB 2MOQA 4XXWA 1AYOA 4M7JH 4RISL 5IHZB 4AV0A 5CMAB 4O2EA 1F13A 4QXUL 1FFPA 4XC3H 1R24B 1MAJA 2QTEA 2BSTB 3BD5A 4Y8AA 3HAEB 3O4LD 4B9GA 5BS0E 4ZO9A 4CBPA 3M1BB 3IBEA 3HLAB 1CD1A 3F12B 2PYFA 4KAQH 4OUOA 1L9NA 1XD1A 2GY5A 5D4QA 3CSYA 2Q1EA 5FYJE 4H8HA 3GI9H 5K33A 1H15A 3SDCD 4BFIB 2VIRA 3FXIC 4GXVH 4PVNA 3PHSA 5IG7B 4WGWB 3V4LA 5ICYA 5FO7B 2BWQA 3TT3L 4YS4A 5L88L 1H3WM 1RD6A 2C9PA 2DIEA 2QHLA 4JRXD 1JI1A 4LMQE 4P05A 5DLMH 2CRMA 1SBBA 3VFVB 1OSEA 2OSYA 1PG7X 1INEL 2J2ZA 1O7DE 1E6OL 4UT9A 4LSPH 3AUWB 3MPCA 5AB9A 3ESMA 1AXTL 1AS7A 4LVNB 4ZTOL 4G8GA 3DURB 2N59A 4RGNB 5IB1B 3MYZA 2GCYB 1DEEA 5TPWL 1MELA 1OD9A 3FCUB 5BQ7B 5C0EB 2E4FA 1MLBB 3B9EA 3HFFA 1NDMA 3EOBB 4I85A 5KZCD 2H0FA 4KK9C 4QHKI 3QYNA 4IW4C 3S3CB 2K78A 5HY9B 3IGAA 4L4TB 5DR5L 1QHOA 2XG4B 5CLYA 4N6RA 1CQKA 3PREA 3CK0L 3U30C 3IK2A 3ZTEA 5D4HA 3RPKA 1R0AH 2P80A 4KKAC 5TE7H 4M7KH 2ZOTA 4OZHE 3WDJA 4NJ9H 3NZHH 4YLBA 1JZ8A 1CL7L 3SQBA 5IIEB 1V54B 1MH5B 5DFVC 2UZIL 4TM9A 1TQUA 1FNFA 4I0KA 5LWYH 2RHEA 3ECQA 4NZTH 4CVUA 2IEPA 2J1KA 2WTRA 3ZE2B 1C5DA 3SBWA 2Z6FA 5IROD 3TYGH 2Q10A 4I3RH 5BUGA 3SGDH 3NFSL 3TV3H 2BVOB 2WWKO 3U7WL 1UENA 2X6AA 1D2PA 2PWEA 2DM2A 3H6AA 1N5YL 5FPIA 1CL7I 4NIYE 1ZV9A 1HHJA 4MWFA 4OH2A 3FU8A 5FA4B 2J5WA 5C71A 4GT7A 1J0IA 1RURL 2CDGA 5D96C 5L6YL 3DV4B 3A6BL 4KI5E 1FE8H 2XWJB 2D7TL 2WKGA 3GK8L 4UWQB 2FAUA 3QNXA 2Y7QA 1I3RA 1OWRM 2GC4C 4M02A 4O51B 3L7EA 4ZX3A 5BCAA 3SPVB 5TGBB 3SY6A 2KLTA 1UTDA 2F58L 4FI7A 3ZE1B 3CE1A 1QFUL 3HZ3A 1I53A 3OKLB 4EI5B 1Q4NX 5FKPB 4G9DA 2MNJB 4QGYA 4XXWC 1JNNH 1T21A 1A4JA 5C0CD 3O4LE 4NN5C 3PP3H 5KBLA 1QLEH 3QZPA 3C60D 2NY3B 1YG9A 5BXFB 1WUNT 4XP1L 5MHSE 2HRGA 3P11H 4LLVB 5DMJB 1TTAA 3ARTA 3KEDA 2YOCA 1O6VA 3ARVA 1KB5B 3ZDXE 1TZOA 3NBNA 4JRXE 1EWHA 1XH2A 3WN5B 2DV6A 1X6LA 2NY6B 3U2SB 3T0ED 5KSVB 4UDUB 1CVRA 1J8HA 1OCWH 1IQDA 4QXWA 4TNVF 4P5MB 3WNKA 1FZKA 1JCVA 3FOLB 4DVRH 5KVFL 3TVMA 2VABB 1SM3H 1DQJA 4OCWH 3UP1A 3ES6A 4K5NA 2OZ4L 3CN0A 3SBPA 2YD6A 3MLWH 1J8SA 3VXPA 5AOIA 3K2IA 3L2NA 4RMTA 4YHPB 1WEJH 2J71A 4BGDA 2Y36L 4IDJH 1KELH 1KCSL 2VDOL 4IRJD 4JQXA 5EO0A 3TH4T 4WJ5B 1HAUA 1MZYA 2WLKA 3VX0A 1AGBB 2P8LA 4OLXL 5TDOA 3LS5H 3TCTA 3QZBA 3NCWA 3ARRA 3UPRB 1H8SA 3P0GB 3CXHK 4DKFL 1A25A 1NCBL 3CBJB 4UQEA 1JFQH 2BSEA 3G5YB 4QGTA 5C07D 3T5WA 4JEGB 4N4YB 4OLYL 1LQBC 4PY8J 1FUNA 2CPCA 3FTXA 3PAUA 4LLYB 3ELAT 4H0IA 6PAZA 4D0DA 3WTTA 3T77A 2A74A 2NQCA 2OMTA 4PCTA 3QZLA 4WI6A 1FV1B 3M6DA 4ZYKA 3SBWC 2B4CH 4MA3A 4HWUA 5FYJL 3UG4A 1F8TH 5GSVA 5C0GB 1L0XA 1R3KB 4NZUL 3L13A 5KSBA 3ENEA 1LEKA 2XWDA 1R3HA 3N5AA 3MLXL 4UT9H 5F7KC 4I3GA 2YLKA 3D6GA 3AC0A 3V4VL 3HNTL 5ISZD 4N5UA 1AQMA 1OT2A 2FL5A 3L1OH 4ES8A 4HC1A 4Y2DD 3K72A 1K5NA 4OCRL 2K9UA 3RVTC 3TYFB 4BFOA 1I8AA 2CBMA 4L4JA 2ADIA 5CZVL 4DOHE 4TLTA 2CO1A 1BFVH 2Y7SA 1OWWA 2V33A 1ZCRA 4LVHB 3VTAA 3RX7A 4P2QA 1N59A 4GKOA 4LMQI 4E41D 1CBVL 3TEYA 1T7WA 2UY7A 4BQ8A 1OAXL 2HVKB 5CGYD 4RFNC 5EFIA 2VDKB 1XZ0A 2CLRB 5C0CE 5KYUA 3E2HB 3V0VB 4ZT1A 3QISA 3QRLA 4MJ5B 4PJGE 3DTUB 1LP9F 4MKTA 3DIVA 1FZJB 1XGPA 3ZDZE 3H42H 4HKBA 1A8JH 1ASPA 3WIIH 3RKDC 4TSCL 1PFOA 3D30A 3KS0H 1CJYA 3LHAA 4U0QB 4M29A 4LAQL 3HMXH 2JKJA 3KYKH 4GAJH 2Z9TA 4HCRL 2JKRM 3HPJB 3ZKSD 5K9QG 4PCYA 4HUWA 4DKEL 2JI2A 3WU1A 1NOLA 2AXGA 4XPHL 1G6RB 3RWJB 1WP6A 5MEPB 3IJ8A 1JHTB 4YHNA 4PJFA 4PJHB 1ZV5A 3LQZB 1QX1A 3MCKB 3WKPA 3QP3A 1ZE3C 5DD1L 3BH8B 1KCUL 3T0EE 3B2VL 5I9QC 2YAMA 2YRLA 4HIEA 5FAAA 4L3EB 4XMWA 2G60H 1S5HA 3GSUB 3BMWA 5CIPB 2ETWA 5IGXL 1B4LA 1YEHH 4LLMA 4NUGL 4NEHB 4UIKL 4Z77A 1KWKA 1Z5LA 1IEAA 3GZOA 1VCBC 4U49A 2WNKA 4AT6B 1JGLL 3TVMC 4X80L 5E70A 2NUTB 2NQ3A 2X09A 4HX1A 2GSGA 1K85A 4OM0L 1S3KL 1XH0A 1P1VA 2IAND 2R1YA 4MDRA 5DQ9A 4XVOA 3FQRB 2BOBB 1VENA 4JQXC 4K9EL 2RACA 3ARDB 1MI5B 4A7GF 2MOVA 5C07E 2CO4A 4PMEA 1CYGA 3LZQA 4G1EA 5HDOA 1A7OL 4Y2OA 1F6AB 1JGVH 3QXUA 5AVWB 1J0YA 1TQSA 4NQEA 3GB7A 4N20A 2OQJB 4X2UA 2P28B 3UTZB 4LRNL 4KKBD 2DQHH 1ZE3H 2ODHA 5F3HB 4BWUA 1F1AA 3EYOA 4KNSA 3U7YL 4LP4A 1RIUL 4KK9D 3FFDA 5EUOE 3SPHA 2A74C 2HFTA 4AH2A 3TO2A 1KC5H 1MFEL 4U1SB 3OMAB 1J9TA 1A5FH 1AKJD 1KJMB 5G4MA 4OGQC 2ERJB 4NO3B 4G3YH 5HYQB 4XNYH 2RBLA 5ISZE 1QEXA 4XMLL 5F6HJ 4KKAD 4OCNC 2R2CA 3DARA 2BDNH 2V3EA 1CT8A 5EU5A 1IGCL 4BQBA 3O3EB 3SODB 3ZY7A 3P02A 1WBYA 4HIXH 5ICUA 1ZA3B 3MLVH 3CFBA 2GUOB 1CFQB 2V7HA 1Q1JH 5I1JH 5GGVY 4E41E 5EZIL 1IAKA 1BVKA 4M7ZB 1I4FB 4FNTA 3ZTNL 2QR0B 5JW3H 1BM3L 3SPIA 5HHVH 1CFVL 2KQNA 4JFOA 5J12B 1SY6L 2ZP9A 2X41A 1G4MA 1UASA 3LRLA 4RESB 3WY4A 2I32A 2BMKA 5KG9A 1F41A 3DBXB 1OAJA 1JRHH 3R4DA 3TBVA 1OXYA 4YO0B 2AEQL 3FQ1A 1YEGH 1WBXA 2OI9C 2W60B 3KGTA 4OGYL 4GEIA 3FTGB 5DHVB 3GBNL 2BVUA 3KNBA 2OJZL 2WANA 3LQAL 5HYIA 3K71A 1X6NA 1BZDA 4OCXH 1TCRB 5JPNA 1U9KA 4POYA 3TN0B 3GRWA 2IXQB 4ELMF 3UJTH 2RAMA 3NJGA 5DWUH 4U6TA 5E4EC 2OYPA 1VFAA 4R6UA 4HC1H 5IZ7A 3D9AL 1I9JL 2OL3L 1IRAY 1MCPH 3VNZA 3QORA 4XBEH 4RH4A 2JTDA 4EOWL 2DQTH 3ABKB 1BFSA 3TBWB 5J13C 3IRZA 3QJOA 3MUY1 1DZ0A 4LBEA 3B43A 1NOFA 2YXFA 2BIQA 1IZJA 1LWJA 2JKLA 2XQBL 3GTNA 3PJSB 4U6VH 5FO9B 4U3XA 2IANE 3OGCA 1PD1A 3IJEA 2GTWA 4DQOH 2FZ3B 1MUJA 3GJFB 4HS6A 2P5EB 4CC4A 1HNYA 2I9LA 2WXQA 1J5DA 2X4SB 2DQIH 5LAXA 1MKFA 3QQ3A 1SXSA 1SBSH 2IBGA 2XQYG 1NAMH 3JTTB 3SDXF 1HNFA 1W8EA 3PRZA 1OAYL 3O4OB 4A2EA 3K2UH 5E1IA 3V6OA 1XF3B 1IVLA 5A6LA 5ICZB 2X70B 5KJ7E 2BINA 1OGAB 3BGAA 3QO0B 4OF7A 5I5JA 2ZSVA 1BVLB 1JTOA 3IPFA 1E9PA 4X0KB 4R26L 1S9XB 3ARQA 3I84A 4FFVD 1B3JA 1PDKA 32C2B 4WV1C 5TDPA 1INQB 2DMGA 5JLZB 1MCCA 5F96H 4W81A 4G8GD 2DL2A 1TEYA 3J8F7 3ESOA 1HYSC 4G6KL 1C1EL 4BELD 3PWJB 3AZUA 3KPTA 1T6VN 2C9XA 3DOSB 2EABA 3SE8L 1E5ZA 4POUB 3I6GB 4PJDF 2CO7A 1BSIA 2AK1L 2Y1ZA 5C09A 2XV6B 4Q4EA 4NDMA 3OQ3B 4BZ2L 2CDFA 5EA0L 3L4TA 4JDVA 5EBWA 4FMFA 5AVTB 2VN3A 3BDYL 2E4TA 3S98A 4I7ZC 1V10A 3U0TA 4G82A 4JFPB 3K6DA 2P80D 1KJ2H 5I6OA 3BUTA 1U21A 3AGWA 3S96A 3VSVA 5CHNA 4DP7X 5LCVL 2VL5B 1MWAL 4XCYA 4JQIL 2F5AH 3LZFH 2GSMB 1WUZA 4FQIH 4OGAC 4HXAL 2VCOA 4XVTH 1DQDL 4JHWH 2G0LA 4FNLH 5LQBL 3ZYJA 3OKEB 1R6VA 5CBAA 3F7VB 5JIKA 2F54A 4HK3J 3TBYA 4PS3A 2B15A 1MF2H 1DL7L 2EO7A 2WQ8A 4JO3L 1G7PA 1IGYA 3DJTA 2BVQB 1EXUB 3DC0A 3UO1L 1PU0A 1VADB 3UBXI 5C3TA 4BH7A 1A3RL 4BFRA 2ORBL 1ZOXA 2ATAA 4UTCA 4XBGA 3RVTD 4GG6A 3FTWA 3VM5A 5F8QC 3Q2CA 3MBWB 1KFGA 5D4JA 4ZPVB 1CUOA 2D0FA 3ROLB 3SYPA 4FCHA 4O9HL 2PPEA 1U8OB 2HG5A 3ECBA 1HHHA 5DF0A 4BSVB 3VXRB 1NFDE 2FE0A 5HJGA 3QEHA 1AYRA 4UIMB 3C2AH 2ZT9C 3UEZA 4ZFGH 5JPNC 3GMQB 3L3GB 2A9CA 4MVBD 1PQZA 3WEBA 4KTEL 5ID1B 4Q0XH 5ALCH 1AS6A 4A2MA 3BP5B 4JFXA 4F8NA 4KH2A 2KZ1B 2AEPH 3QORC 1SJVA 4LVOB 2XSKA 4H8PA 4HJGB 1FNHA 2QADC 1DUYB 4FNRA 4GSDH 4JFZH 1JK9A 1WC7A 2A9DA 2VDPL 1JF1A 4OT1H 1A7PL 3EUUA 2L8AA 1IFHL 2N0MA 4FXGC 3CZFB 3BO8A 2OXGA 1ROWA 4AYFB 2E8ZA 1OLLA 3MI6A 3MRGB 4CC4C 1P84K 1DZBA 4OD1H 1T6BX 25C8L 2YD5A 3N9GL 4MZ3A 5ADOH 3DX8B 4NGHH 3WFHA 1CFSA 1UACH 3ARZA 3LEXB 4K71B 4I2XB 4F80A 3NIDF 1J8HD 3VGBA 4MMZC 3IGUA 5DEFB 3QAQA 3MZGB 4G8GE 1GKEA 2HWZL 3NUKA 4JO2H 2VDRH 3CDZB 3NT0A 5DA4A 3S4SA 4DTGL 4IKJA 1FZMA 4V2BA 1ETZB 3TVMD 1N3NA 1TTFA 3L5WB 5EU4A 2CJUH 2VRAA 3GRWH 2OK0L 1K4CB 1R19A 5I1CL 4ZOAA 3VXUB 3LXAA 4FKKA 2C1PA 4BDVB 43CAB 4U1GB 3ABGA 3BDXA 3H9ZA 4IRSB 2Z7ZA 3RTQB 3V5KA 2GHWB 3ALPA 1KY7A 3ZE0F 4AV4A 1KGIA 1T04B 4ES9A 1KSRA 5E5LA 4AC2A 1D6EA 1CICB 2L7UA 4O58L 2Z4QB 2I25N 2DIBA 5J7CC 2OKMA 5CR8A 4RFEB 1U8MA 2W5PA 5AWNH 2IBBA 5GS2H 2EZ0C 3RPIB 2BSED 4PP2A 1KLUB 4UCFA 5I17A 3WL9A 4XCEA 1P7QB 4PJIA 1TVDA 4GBXB 5CBEB 5BZZA 5JHAA 1K6QH 3NSYA 1AC6A 3QUZA 1WISA 3T0AA 4YHOL 1HHIA 2G5RA 1YNTF 4MAZA 5B3JF 1T20A 3RGBA 1YVLA 5E8PA 5I0VA 4HLZH 2QQKH 4FQ2L 4LCIL 3DX0A 5BVPH 4NO5B 1JWMB 4NQTA 2J73A 3HC0A 4HLZG 4G1MA 2ZXCA 1A14H 4OTXL 4WUKL 3E38A 4X4MA 5TK2A 2X1WL 1XR9A 2JIXA 4QKXB 5C7XH 5DSCA 1JPGA 4TULH 1CG9B 1T2XA 2P44B 3HHSB 3L5IA 4PQXA 3D87B 1YEDA 4GQZA 4BYHA 5IMKB 1E42A 1KYDA 4QHLB 4AQOA 1DQMH 2L04A 1RKRA 3WTUA 4LPUA 4LCYB 3W9EB 4ERSL 3ZXAC 3H55A 4HLEA 4XAKE 3NJNA 5GRYA 4CSTA 2WPGA 2ZPKH 1JZ4A 1WV7T 3WGUB 1ZANL 4POZC 4JN2B 1X4ZA 1WHPA 4O2FB 2FATL 4J3SA 3GDCA 1FVEB 5GS0C 4HUVA 1BBDH 1F4WL 2WLIA 5E8EB 1LO4H 2EC9U 1MIML 2WQVA 5EO1B 5ERWB 2XZAL 4LSTL 3LH2H 4WHDA 4RDBA 4FEMA 5JDJA 2CD0A 1UCBH 4L4VA 1Q0XL 2IGFL 1IX2A 1JZ5A 3I02B 4NJAL 1P4IH 3P3RA 4C4UA 4OFYD 1KGWA 1H0DA 3BH9A 1HSBB 2VLLA 3O2VH 3Q1SL 3FUHA 4FQLL 2ED6A 4Q2ZB 5ENWA 4O02L 4YL9A 3BKYH 5DC4B 1G9EA 3K80A 2DQJL 3QPQD 4AUJA 4JKNA 4KXZH 4W9DC 4X8JA 3K4AA 3U9UA 2OAAA 4AM0Q 1J8HE 5BUAA 1Y1DA 3HFML 1DO5A 3IFPA 1AC0A 1FZOB 4PTTB 4KOBA 2ZD0A 3VM7A 2GKIA 3MRRA 4JBSA 1I9RL 1JPTH 5DD6B 1MCKA 2W59A 3POCA 4D8PB 4G7YL 2B1AL 5CEZH 5IW3A 2UXFA 2GSIB 5FGRA 2XWTA 5GS0H 3F83A 4PLNC 4HJ1A 3DPDA 2J12B 3UTSB 4QI3A 3UYRH 1ND0A 1VEPA 3BLKA 4N9GB 3GTTA 3LKSA 2NTFA 4AM0B 1DUZB 2H1LM 3RVVC 3SCMA 1KEGH 2V5SA 4FFYL 4JFFA 4KY1L 2A6KB 3O9WA 3APMA 3OB0K 3TWYA 5L7XL 2Q2LA 1GIGL 4OZHF 4X4YB 4K7PY 1NLBH 4RMQA 5CLXA 5D1ZA 2AFNA 3AGVA 2W07A 2ZCHH 5D1QD 2AGJL 2OV0A 4C56B 3ARGB 5AZUA 5CJQH 1IM3A 4NQED 4N0RA 1U8KA 1SOXA 4Q7DA 1FFQA 4XMKH 2R29H 3MRLB 3Q9PA 1HYSD 1SVBA 3UTTB 1KT2B 4K2UL 1JF5A 4KKNA 4X8XA 2EE0A 3QUZC 4M62L 1F1DA 2FO1A 4I3SL 2EIDA 4M6ML 4ODTH 4HULB 3DK0A 3WXWL 5KSBE 2MNUA 4B9PA 3KVPA 3HRPA 2XN9A 4C83B 4KROB 2ZUYA 5ETUB 4PY8I 5L9DL 3F84A 1FPTL 2AK4B 3UERA 3RBSA 2J5LC 1KV3A 5B39A 4Q9RH 4LU5L 1KBGH 2Z31A 2B08A 1JHLL 4KI5F 4LPWA 4NFCA 1FRGL 2NY7L 2G2NA 3BE1L 4GS7B 2IFFL 4R97B 1RIHH 1HOCB 5DWPA 2EEDA 4NKIH 4OGAD 3W0WB 2VM4A 4E9WA 4J5VA 4EN3C 4JNXA 5HHMD 1S7XB 3M17B 3PYCA 4AVJA 1XH3B 3VFRA 2H6OA 4ZQTA 1YY9C 4WSGA 4PGBB 5EBMB 3CTTA 4CMHC 2IDCA 4J3BA 3EYVB 4KPHL 4ZMAT 5BOJA 1B4TA 5CCGE 5K69A 2UWEA 4X6FB 4ELMB 2L7EA 2YBRB 1ZHLA 1VZGA 3B7YA 4P9ML 1YN6B 5HHPB 1CD8A 3MLUH 3KEHA 3JV0A 5CNHA 4X42A 4EPSA 1I7ZA 4EEEA 1CDYA 4M6NH 1EBPA 2XWBA 1RLBA 3SKOB 2W9LA 3MOAL 4G5ZH 5EOQH 1I3GL 3MGOA 2YD2A 3C09C 4YHLL 4FN0A 3KWWB 8FABB 5KSAB 1WVZA 1KN2L 3KHOA 1PMYA 4IBQA 4PJFE 1TLKA 2YD4A 2YJQA 3ZDXF 1AKPA 1TEFA 3RIFK 2Q6WA 3Q1EA 1SHSA 4NP4H 4XH2B 5H2BA 4F27A 2JXMB 3B8SA 3K8MA 4MX7A 5I1KH 1E4KA 1GGCL 1NAKL 2X0UA 4GYBA 2C3XA 4JFSA 3SDXB 1NCWH 4MJ2A 3E8UH 4NPYB 2OA9A 3BHBA 4Y9EA 4BV1A 5IQ9B 3L4VA 1MCQA 1YNLH 3MUZ1 4GI8A 5FECA 3AROA 4MNQA 1QUNB 4HWEL 3QORD 3BP4A 3LN5A 1DJHA 1FDLL 1DLHA 3TZVB 1IBFA 3RWFA 3UH8A 1WTGT 2R8SH 4HCGA 2QFPA 2EXTA 1GOHA 4DF9A 3ZTCC 5IMOA 4NM8L 1KIPB 3PWPA 4TL4A 4L3CA 3L3HB