2ZOWA

Crystal structure of h2o2 treated cu,zn-sod
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
151
structure length
151
Chain Sequence
ATKAVCVLKGDGPVQGTIHFEAKGDTVVVTGSITGLTEGDHGFHVHQFGDNTQGCTSAGPHFNPLSKKHGGPKDEERHVGDLGNVTADKNGVAIVDIVDPLISLSGEYSIIGRTMVVHEKPDDLGRGGNEESTKTGNAGSRLACGVIGIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superoxide dismutase [Cu-Zn]
publication title Crystal structures of H2O2-treated Cu,Zn-superoxide dismutase
rcsb
molecule tags Oxidoreductase
total genus 38
structure length 151
sequence length 151
chains with identical sequence B
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2008-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2zowA00
1B4TA 1XSOA 2AQNA 3KM1A 2AQPA 2LU5A 1XTMA 2E47A 1UXMA 3QQDB 4U4IA 2JCWA 2V0AA 1UXLA 4OH2A 2JLPA 3L9YA 4BCZA 1JK9B 1EJ8A 2Z7YA 4N3UA 2ZKXA 3HW7A 3K91A 1RK7A 2GBUA 1QUPA 3GTVA 3L9EA 1XTLA 5KBLA 1JCVA 4A7GA 2WWOA 1HL5A 1N18A 1OZUA 1P1VA 4A7QA 4N3TA 1SPDA 3CQQA 3KM2A 2XJLA 2ZOWA 1HL4A 2APSA 1CBJA 2NNXA 3SODB 2Z7ZA 1YAZA 4A7TA 4FF9A 1ESOA 1OAJA 1TO4A 2AQRA 2WZ5A 3HOGA 3PU7A 1BZOA 1PU0A 1EQWA 2GBTA 4L05A 1OEZW 2WZ6A 2WKOF 1SDYA 3T5WA 1SXAA 2SODB 2ZKWA 2ZKYA 1L3NA 2WZ0A 3GQFA 2VR6A 2C9SA 3KH3A 1SXNA 1F1AA 3QQDA 1E9QB 3F7LA 3GTTA 1SXSA 1F1GA 2C9VA 2WWNA 2C9UA 1PZSA 1PTZA 3F7KA 2AQTA 1JK9A 1SDAB 1IBBA 2GBVA 2VR8A 5CU9A 2Z7UA 1YSOA 2K4WA 1CB4A 1S4IA 2XJKA 4A7GF 2AQSA 3KH4A 3MNDA 4B3EA 1IBDA 3H2PA 2AQQA 1E9PB 1SOSA 3S0PA 1E9OB 1N19A 3RE0A 1Z9PA 3ECVA 2WYTA 2AF2A 1E9PA 1Q0EA 1IBFA 1KMGA 1F1DA 1SRDA 1YAIA 1U3NA 3CE1A 4A7VA 3GZQA 4OJAA 5KBKA 1DO5A 1E9QA 2VR7A 1MFMA 1SXZA 1F18A 2AEOA 3GZPA 1B4LA 1FUNA 2R27A 1IBHA 2E46A 3H2QA 1DSWA 4MCNA 4A7UA 3ECWA 1Z9NA 4BD4A 3CQPA 3LTVA 2Q2LA 1OZTG 1TO5A 3GZOA 4A7SA 1SXBA 1OALA 3MKGA 4MCMA 1IB5A 3KBEA 5KBMA 1BA9A 1COBA 3HFFA 1E9OA 3ECUA 2WYZA 2WKOA 3KBFA 1SXCA 2Z7WA 1AZVA 4BCYA
chains in the Genus database with same CATH superfamily
4LSVH 1RP9A 3SDAB 1OAZL 5DU7A 3NFSL 1GW0A 1ES0B 1WFIA 3MU3A 4Z7OB 1A9VA 3JUYA 4ZUWB 1UXSB 1X7QA 2V5TA 4MMYB 4HIEA 4LF3A 5K33A 4Q9RH 1J11A 3ASWA 4O58H 2D31A 3ZX1A 5KSAC 2EDBA 1O75A 1QX1A 3TV8A 4BQ8A 1FVDA 5HYJE 2Z31A 5KYXB 1MCQA 2Z7YA 5CINL 5DSCB 4UQ2B 5FKAA 5I0YA 2ADYA 3KYNA 3K6SB 2FBJH 3RWCB 3RZCB 3GI8H 5FO8A 5EDSA 3TM6A 5DFAA 5GGVY 3LZNA 1M3JA 3GSRB 3IS0X 4Y7OC 1EMTL 4QRQB 1E4WH 1OWRM 4G6AD 1D5MA 4WTWA 5L2KD 4WWNA 5IBTH 1BZ7B 3SDYH 1EJOL 3PHOB 2AQRA 2X6BA 1G1OA 2CZNA 1NFAA 2VXQH 1PX3A 4JEGB 4E5XB 4LHUA 1JZ2A 5DZOA 1TITA 5I16B 5IW6B 5IHZB 4R96A 4JRYA 4WK0B 3TF4A 1T22A 4P99A 1NFDE 4QHMB 4ODWA 1Q9LA 3ARBA 3FHQA 4UDUA 3BD5A 1WZ1L 1AP2A 3S35X 5I19L 3UADA 1LEKB 1WT5C 4PJFF 2QFRA 5AKTA 1I3UA 3OAYH 2GSIA 1TPXC 1LWRA 5T1DL 1HNFA 1AR1B 5KUMA 1SHWA 5EZIL 5T3XL 1H3TA 3T3PF 2B9AA 4KJQD 3UTPE 3PWUA 1T66C 4YSAA 5CJ8A 4N90E 3S3DB 2KZ1B 5BV7H 1KSRA 4OD2B 4YX2H 3V4VA 5CCHE 3SQBB 1U8MB 4P46D 2PCPA 3QIBC 1UYWL 2GUOA 3KDMA 4PEEA 3Q9QA 3BDBA 2EUZA 4I18C 1MCSA 5GISL 4YE4L 4HS6A 5DHYB 1RZKH 3A4EA 1ODAA 1GYWA 1XGPA 2KZKA 2P8MA 4MJ6A 3VA2C 3S97C 1ND0A 5FUZH 3CDYA 2OR8A 4RGNE 1CUOA 4G11A 4S1DC 4Z3TA 2ZICA 5EMYA 4I2XA 2ENYA 4KK5C 1F3DH 4CILA 4JAMA 4H1LB 2LVCA 5C0BD 2HVBA 1Q0YL 1AI1H 5IMKA 1ASOA 2X7LA 1WEJL 1PG7X 3RP1A 1EO5A 1AGFA 3UX9B 4UM8A 4LE8A 4N6RA 5I6XB 1YRKA 4AC2A 3O4OC 3WKQA 2WLMA 5T1LA 4OZIE 4PMEA 1NGQH 1JWSB 1YG9A 3P11L 4GFXA 2YS4A 2L3BA 3WTSA 1I8AA 4FNLH 1KCVL 4OZGE 5FM5O 1FNSH 1C7SA 2XPGA 3KWVA 1AKPA 4QYOB 1UURA 4X5WA 3QULB 2JJSC 4BIKA 3KPRB 4J3XA 2E47A 4JANB 1XZ0B 3MOBH 1YEHH 5CMAA 2PW2A 3TNNB 4BRJA 1CZ8H 1JDCA 4CRPA 3G6JB 3F7RA 4LNRA 5EO9A 3I50L 4U1MA 3AABA 5HDBE 2GIXA 1FHGA 3JV4B 4ODHH 4EI5C 2IDQA 2WM0A 4X8JB 4RESB 5I1KL 2JKRM 2VLJA 1NBZB 2NNAB 2NY0B 5AOMA 5DS8B 2XJLA 2AXHA 5T3ZD 5CILH 4IGBC 3UBFA 2NNXA 3UO1H 5KSVB 5F9AC 3ULVE 2VM9A 4MMZB 3G5ZA 1ESOA 4OCXH 5CJOH 3BQVA 3FQUB 2W9LA 4JFXB 2V9TA 3F7YA 4OD3L 1RH8A 1NC4D 3MV8B 3O6FC 2C26A 4GMTH 4UOW1 3Q06A 5GGVH 4FRWA 3N9GL 2X0VA 3SSGA 3VI4E 5FO7B 2VSDA 5MHSE 1IBYA 3TFKD 4KJYB 4LVEA 5FV1L 1S9VB 5EBMA 3DGGB 3P9LA 1CO1A 2V7NA 4I87A 3MV01 4NQCA 3QBTB 4U6XA 1W0WB 3NCYP 2JWYA 3BN3B 3ARGA 1UEMA 2XKNB 2J3SA 3MJ7A 4N0UA 4OLXH 5J8OA 5ABAA 5E08L 3VFPB 1TJIH 1BJ1H 3LRSB 3NJGA 1IFHL 2WP3O 2E6JA 4QKTA 1AE6H 2ODHA 1AO7E 1GR7A 2F08A 5SWSA 1IM3D 3IMBA 2YMXL 5EO1A 4QOKD 4HU8A 1D7FA 4IS6A 2OK0H 3CVCA 3OR7B 2K7PA 2VN5A 1VERA 4KOBA 5D6DA 1Y6NR 2WYTA 4GSXA 1NFIA 2LW3A 4LVOB 1QLEH 4M4RB 4F2MB 1M2VB 1MAML 1CDGA 2LU7A 5BRQA 3FRPB 4PB9H 4C4KT 4W9JC 2NYYD 1YEJH 3I9GH 2QADC 5MP6H 5IVXB 5AVUB 2CGYA 3TU6A 3E6FB 4DZ8B 1OGSA 3UGUA 1HIMH 2QTVA 3ZZLA 3VRJB 1YUHB 5E8NB 3NSDA 5EIQA 4GRMA 1FG2A 1X6LA 4X4KA 1KELH 3H2QA 3VFVB 1MAJA 2NY2D 1TMQA 1OARL 5D70H 2HT4C 1GH7A 4NO0B 5B3SB 5HI3D 2ZWNA 3A6CH 4WENB 5JA8B 3NJXA 4FADA 5C0GA 4OM0H 4Z7VE 3ZBMA 1BVNT 4MXQD 4TRPH 2I5YL 4P5TA 1TJGL 4I0PD 4MHHI 1MFAH 2J88H 4N68A 1C5CH 2YBGA 3INUL 3BSZA 1YMME 4JJ5A 2OMBA 2JIXA 2MH4A 4HEMA 4MA3A 1NGYA 1MCRA 2DH2A 1CBVH 5B38B 3ZR5A 1BIIA 4BWUA 2X53A 4X99A 2Y06L 1YEDB 2DQ6A 5FO2A 4JPKH 3GTVA 2AJ3A 5CZVL 4N28A 4A6YH 3Q7JA 1BF2A 2FVNA 3AG2B 3PABB 4G9FA 3U4BL 4CSPA 1U95A 3ATAA 3APFA 1DLFH 1DVFC 1H8OA 1HL4A 5E4OA 3S96B 1RURL 4DP0X 4Z76B 4EKXA 1R33A 2HSIA 2EDQA 2P5EB 4XMLL 5JNYB 3BVVA 4EQ3A 1EQWA 3K8KA 1SJHA 2FGWH 2NW2B 35C8H 4V1DD 4KRPC 2AK1H 4ZAKB 3HZMA 2CRYA 3OLGA 3TT1L 1JF5A 3Q8FA 3Q05A 1AY1H 1H8LA 3C8KA 3GJFH 4ABVA 4X6DF 1G9HA 3S8FB 2L8AA 2RFXA 4X7SL 3KXFB 1NLDL 5L6YL 2XU9A 1XCWA 1JF6A 4PGEA 1MNUL 4FNPA 3EYVA 1OAUH 1UJ3A 4BELD 2X28A 3GD1C 2F7OA 3QW9A 3UYOD 2G3NA 2H2PD 4UIKH 4QF1B 4QYAA 1I1AD 4UMSA 2CJ3A 5ITBL 4GG8B 3GEFA 5C71A 1LP9B 4JFZH 1UB5A 1KBGH 3BKYH 3KPPA 3TEZA 3ECVA 3N0PB 1K6QL 3Q6GH 3FSOA 1GHFL 3MJ8A 5DK0B 4PRAA 3FMGL 2VDKB 3DHPA 2HN7A 3QCTH 3GSOB 2B7DT 3HS8A 2EC9U 1G9EA 1SHMA 2QQLH 3D2UA 4ZBJA 5GSRB 5H94A 3IS1X 5EEXA 1NBYB 4R2GD 2V2XB 3I02B 4M48H 3WSQH 3VXTA 1A7PH 3MA7B 4GUPA 1CVRA 1HHIA 2YEVB 4FC3E 2I60L 4GY4A 1RZJL 5A7EA 1TR7A 3P0YH 5E1QA 4JVUA 1EHKB 3LTVA 2ID5A 5DURD 4B5EA 4LBAA 4KQ4L 1WWWX 5C3IA 1ZK5A 4XVJL 5KYNA 1YDPA 1IB5A 3C60B 3M1OA 4ZNEE 4PY7A 4U1KA 5D7JC 1ZJBA 3MRMB 3NQKA 2PTUA 3IFNH 1L5GB 1A9BA 1XF5B 3BEVA 4LHJB 2PXYD 1MLBB 3DTUB 2Y7OA 4FFWC 3RX9A 3GBMH 1CICB 2NY4C 3UGEA 5IQ9A 1Q4NX 1XGRB 4R0LB 2VABB 2ITDA 3FH5A 1WPCA 3V5HA 4B9ZA 2MPAL 3QNYA 3N41B 3PIQA 1S7QB 4A2MA 4G6FD 1RUKL 3KE0A 5I30L 1DYZA 2CM5A 1QBAA 3KD4A 2DQFB 4XVTH 1MFBH 2Y07H 5CBAB 2X0UA 4Q8BA 1RK0A 3WKNA 1ZV2A 3NIFE 3B2VL 1ASQA 4L37B 4ORZC 5HI5C 5E2UH 4XXCC 1T0NB 2E7LC 3FC8A 1JDAA 3SODB 1SM3H 1I1FA 5TK2A 3S5LB 1BQUA 1QPPA 4HXAH 1NCAH 1GGIH 2DH3A 4A68A 4AH2A 4Y5YA 2R2HB 1HKLL 4NKQB 3HS0B 1XGYH 1XBDA 3AAZB 4K3HA 2YD6A 3FQNA 1G9NL 1DBAH 3DIFA 3BE1L 3G3LA 4HX1B 1TFPA 1V54B 2B1HL 4X4MA 3EFDL 3HE6A 1Q9WA 1MCBA 2AJVH 2Y7QB 5FCUL 5ABDE 1NLBL 3ZDXB 4IOFC 4AK1A 2WLKA 2D9CA 4OLVL 4Y16B 2PCXA 4GB9A 3V10A 3CZFB 3WL9A 1AGBB 2NZ1A 3WO4B 4WV1A 4QHNA 1WIPA 2AJSH 2KPWA 3MRHB 3GMLB 3WFDH 1FZOB 3TP4A 2QSCL 3EO0A 4KKAC 4QHKJ 1MEXH 5DEGB 2XTJD 2EYSA 3RGHA 1QBLH 4W9ZA 5LNDA 3FQXA 5CBEB 2XN2A 2X4QA 5LN4A 1PLCA 3H9SA 3TT3H 1ZT7A 3SJVB 2V2TA 5DJYB 4YIQB 5DI8A 2PYEE 3T0EA 4I3SH 2ZXBA 3LMJH 4MCYB 4UOW0 2IH3A 3WFHB 3UAJC 1MN4A 3ISRA 2KI6A 5E6IB 3T8XA 3QHZL 1C8QA 3APDA 4R3SB 5KSUB 1D6VL 3MUJA 1XMWA 3DBXB 4YK4C 5GGSB 1JUFB 5E1HB 4KX8A 1VZIA 1Z32X 3D0LB 3FQRA 4S1QL 2AXGB 5DFTA 1DBKL 3V8CA 5IEKA 4AYBA 5F7HA 2XC8A 1KGJA 2XQYK 3GXPA 5JR1H 4NUJA 1PBYA 4N20A 4AQ1C 3OQRA 1A6WL 1O9ZA 4MX7A 1QTYT 4XOBA 3BLKA 4Q9QH 4PJ7A 1F11A 4OZHA 1A3LH 2H0FA 4G80B 3ULAB 1DQLH 2BRRL 1N9PA 1UXMA 4YVUA 1SDDA 1UXLA 3CFDB 1KN4L 3L7EA 4LP8A 5D2LE 3TH4T 2AV1B 3SOBH 2J8OA 2OCFD 4KRLB 3VXSE 2XETA 3R0MA 2B4CH 4J7RA 1EA9C 1FNHA 2MOGA 1E42A 3NABL 4DVBA 3NG5A 2OYLA 4QI3A 4XBEL 4G1MA 4MQTB 3JXAA 3TBYB 1DQVA 2J25A 3KVQA 2GK0B 3NK4A 3RWGA 5KVDE 2N7AA 5IBUG 5D1ZI 3RX7A 4NO3B 4ZXBC 2IWEA 2Y2YA 1XGZA 1BX2B 3O6KL 5BW7C 5H35B 4IIQA 4ZMTA 5KS9E 2YFOA 4EN3B 3ZSSA 5KBNC 1XR9A 1PZ2A 4NN6B 4AI7A 5J6HB 1IGJB 4XMKH 3LKRA 4GSUA 3K71B 2WZ0A 4I48B 2NX5E 1NM4A 3CHQA 3H4HA 3S37L 3W56A 4JX0A 4J3UA 5E8DL 1T0MB 4XAKD 3FCTB 4BH8A 3VGBA 4XVSL 3BMWA 1LDPL 2XWTB 4FHKA 5I6KA 5JZ7C 1I9IL 3BYYA 3O41A 1G94A 3M45A 3UG5A 4C54A 1IQDA 4Z7WB 1ZVNA 3A6BL 4RFEB 1VFBB 1KG0A 4CADA 1JHTA 2QGCA 3C5ZA 3IFLH 3KH4A 1AXIB 5ANHA 3WUWG 4R8WL 4JUSA 2BOCB 3O6LH 3QIWA 1YO4A 4Y4HA 3DMMB 3KS0J 2Q7YB 3V0IA 4WWKA 1YQ2A 4PG2A 5MEQA 4YR6B 3UTTB 3DK0A 3IPFA 3II2A 1AQ8A 1AC6A 1NICA 3TJEL 1ZT1B 3FPYA 3D5OF 5L2KE 4TQ8A 4F57H 4L0YA 3FSAA 4MZ3A 2WINB 1UGKA 4M6MH 3GHPA 3W0WD 3QK0A 1IARB 1SHSA 2UWEB 2XHNA 4YDLB 2J20A 3IE4A 4H7VA 2R59A 5I1IL 3B2UD 1EX0A 2NLJB 4BSWA 1YYLL 3DDFA 2XWJA 5JMRA 2IEPA 4XP9H 3EJRA 4CVZA 2OSXA 1P84K 3E8UH 3LN5A 5KOMC 3MDJA 2HLAB 3TO2B 4JQIH 4FA7B 5JXEA 4KV5F 2EABA 4AWJC 2Z0BA 5BVPH 4XN8A 4RBPK 3HPJB 1IM9A 3D4ZA 1MCPH 5CLZA 4EDXB 4RZKA 1JDDA 2RD0A 1OPGH 3RYMA 3LH8A 1XH2A 3BT2H 6PCYA 1E43A 3UTQA 3SDCB 3SO3B 5EO0B 2BSED 3AGVA 2HVJA 3HA0A 3SBPA 2HRPH 4ZQKB 3TN0D 3UP6A 5C2UB 1TCRA 2B9BA 1CU4L 2B2XL 2R4SH 5KSBE 4GAAA 2F19H 1NAMA 1YQVL 2WSPA 1KDIA 1KDJA 1C9SA 4JFFA 3ZGIA 3ZKXC 2XWDA 5IMMB 3MNMA 4RX4A 1SLWA 4ZTPL 5I74C 1S7RB 1YA5A 3KVDD 1UA7A 4XMVA 3DJ9A 2WLHA 4G9DB 4YFLF 2Q5BA 3RWIA 1PKQA 5IV2A 2CJUH 5CD5D 2F1BA 4N3TA 5IM7A 3KR3L 3BGMA 3EO1A 2GTZB 3RU8H 1UM5H 5J5EA 5C0BE 3UBXI 5D7LA 4P2CG 4WFGE 2AQ2A 3C12A 4LSPL 4RNRA 3RA7H 1EHAA 4HOXA 3IRPX 4BFBD 2A77H 2DIAA 2X9WA 2WKOF 2IQ9H 3DPBB 3B9AA 5INDB 4EZMA 4HKBB 3D0VA 1TZIB 5LBGA 1S7VB 3IMWA 3RUGE 4OCLC 4GKNA 4KPHH 1R3LB 3WHXB 3N1FC 5EEWA 5JLZB 4YBQC 4HIJA 5D6CB 1X4ZA 2IANA 5ICUA 1UUSA 1A6ZA 3ESNA 2JKSA 2ATKB 3WTWA 5ICXB 1ADWA 4R26L 3RY6C 1QSFA 2X4RB 1A4JB 3WTVA 4KTEL 4DGVL 4DKFH 3EFOA 3VH8B 2HG5B 3L3JB 4QRRA 3C5JB 3MCKB 4NRZB 4UT7H 1M7DB 2EINB 1VKXB 1LO2H 2YPVH 3QZWB 3PCYA 5H4YA 1AFVL 3L4CA 5ESVB 1MFVA 3V4UH 5T3ZE 2VLLB 2FSEA 3REVB 3GSQA 1QQDB 3D85D 5TPWL 5B8CB 3WFCH 4Q97A 4LLQA 4G8GA 4G5ZL 3V2AR 1P4BH 1ZEAL 1N10A 1W6WA 3CU1A 2BMKA 3QUXD 4H0LC 4H8WH 5DJ0B 3QDGA 4QRSB 3HR5A 1JXJA 3VSQA 2CUHA 4U6HB 1CK0L 4RGMB 4PJCF 2OYPA 1GGBL 2X4SB 2YGOA 3CFCL 2DJ4A 4B9KC 4XGZA 4AENA 1HEJC 4WW2F 4ZW8A 4MCNA 4WKXA 5B4MC 4I3RH 1KCRH 3LV3B 3DUHA 5F96L 4LBEA 2B8OT 2E8ZA 2MTAA 1KTLB 1MOEA 2HKHH 1FBIH 1HL9A 4YBLB 1E6JL 1JG9A 3EOAB 3TO4A 3BP6A 5EOQL 4OM1L 1EJ8A 3C08H 1GCYA 5DDHB 5B3JF 1A7RH 3ZTJH 2W0PA 4QOKE 2PWEA 4PAZA 2R0KH 2R1XB 3MUGB 3CLWA 1CFSA 4NXSA 4B50A 4BGDA 4UB0L 4IKJA 4CGTA 4XPAH 1T5WA 4NPKA 1FLRL 5JQIB 4PJCB 3F64A 3CDZA 2OMXB 4ZFZB 3ZT7A 1INEH 4OB5L 3RGVD 1BAFH 1AKJA 2PO6B 3U2SA 5FEBA 4CNIA 5KBLA 1TVBB 3KL3A 1ZANL 5AOLA 4XI5D 1NCCL 2V7HB 4XPTL 1YECL 3BX7C 3VI3E 1T4KB 4TPRL 5DEFB 3HBGA 1CDCA 1AH1A 1F0LA 1ZMYA 3CPUA 4X9IA 5E2WH 5IHHA 4UQDA 3RDTA 12E8L 4Z7UB 4F8PA 2WXNA 1UVQA 3NCXA 3KPQB 1WFOA 2NZ9C 4ZNCD 1QMUA 2CPUA 5C0EB 1I9JH 1N6VA 1T1WA 4Y9BA 3V95A 1T20B 3ZTNH 4AMKH 1HSBB 1SVCP 3L08A 5SV3A 1J8SA 1YNTF 5CHNB 2R0LH 4KMTH 4YHYC 1PZSA 4LGRB 2MIZA 5KBPA 3AZUA 1JGEA 3SBWC 1RIUL 4QT5B 4QRTB 3O0LA 3O9WA 1OE2A 1YNLL 3VDAA 2AQSA 3FTSA 4HGMA 2UVFA 1INDH 3ECQA 4HCFA 2Z0UA 3RVXC 2HLFD 2Y69B 2V8MA 1VHPA 3IRCA 4XBPA 1OCWH 4LCIH 3NPZB 1P4LA 3NEXA 1QNIA 1HE7A 3MRPB 1F45A 3KPSB 1I7TB 43CAB 5IQMA 4HVBA 3TA3A 1YNTB 2ADIB 3A0OA 1MLCB 2CUAA 3CE1A 4TSBH 3TYGH 2W0LA 2H0JA 4DPCX 2AK4D 3AREA 3MYJB 1FORL 4V1DE 5E7BA 3I6GB 3DIDA 4AQOA 1XSKA 2WWKT 1FL5B 4UTAH 2OCCB 3BH4A 3ILQC 3MODH 3K2MC 2RBLA 4JRXD 1FJ1B 2ENPA 2BK8A 2B59A 5F9WB 1LEIA 2DWEA 4JN2A 4XT1C 2BLFA 5AALA 4OY9A 2WBJB 4CVXA 2WAHA 2I27N 1MIMH 2RR3A 3HI6L 1PDKA 4RGNC 5GGRA 5KBMA 4IHOB 4LP4A 5D1QA 4AIXA 1OF2A 1HU8A 4XZUB 1XSOA 2QTEA 4U0RC 1WC7B 4D0CA 1C08A 4F2FA 5GGTH 3EGDA 2OTPA 4WU7B 1LEGA 2ZWKA 3U46A 1TTRA 2E9IA 1EFXB 4K9JA 3ATBA 1M6OB 4O58L 4QGYA 4X6EA 5AAPA 3CFMA 1IV8A 3QT2A 4GIAA 4PJIE 3T2NL 1PZUB 1TEYA 3U6RA 2ICEC 3E7JA 5I1EL 4P5MB 3T4AB 1J18A 4G6MH 2FBJL 4F9PC 4Z7OE 2IQAB 3GI8L 4N86A 5J1SC 5GRXG 2HYMA 2OR9H 5C0AD 2X1QA 1DQQB 3NA9H 1JJUA 2GFBB 4BKLA 2G5BB 4U2ZA 5LDUA 1TTUA 1DLHA 2AI0H 3UJIL 2YPLA 4DEPB 3ML9A 4QJ5B 3DVNB 3SDYL 4FL4C 3IU3A 3FU3A 1IEBA 5FYKD 4IRZA 2I26N 2VXQL 3HUJB 4ZS6C 4KK9C 4MD4A 4P04A 3JWNH 2ZUSA 4G8FB 1F6LL 4L4VD 1TQTA 1THCA 3NBNA 3ALPA 3MRNB 4QRUA 5KOVC 3ULVC 4RFOH 2GABA 3Q6FA 4EI6A 3K1DA 3KVPA 5IVOA 1HAUA 1CYGA 1FL6A 3R4RA 2OMTB 4XO3A 4L8BA 5FM8A 5BRZB 1UHVA 3SGEI 1A8JH 3MFFB 2P8LB 1FO0L 4M6NL 2E7HA 4HF5L 1SVBA 3I6KB 4MSWA 5JW4R 2XA3A 2XVLA 2VUKA 3MLWL 5D7IF 3BAIA 4JPWH 3O3AA 1ODUA 1J1OH 5G4MA 4OCRH 2DY2A 1RFDL 1NCBH 4YHPB 2AZUA 5HTSA 2M1KA 5DR5H 2GJ6B 4KKLC 4NUMA 5B1JC 2X4TB 3PP3H 1MDTA 4F1SA 1NKOA 2E4FA 4Z23A 4F7CB 3C6LA 4ODXA 4FFVC 5IY5B 2EDNA 3TS8A 4PJ5B 3VXQB 4N5ED 5K9QG 3CHSA 1L0YA 4W9FC 4OFYD 1UA6H 2X1WL 4IDJH 5D1XB 3HAEG 4FXGB 4K9EL 1U8JB 4P2OA 3RKDC 4OSUH 3CDFA 1QD0A 2YSSB 3EFFB 3DDGA 2N0MA 2P43B 2HVKA 4XCEA 5DO8A 1TKWB 2EO1A 2WLIA 5IMLB 4TQIA 1PCXA 1TZOA 3C5XA 2IADB 1OD9A 3FN0L 5C2BH 2TSAA 1RKRA 4NPJA 4X9YA 2ED6A 4PJFE 4BWWA 5JHDD 1KYAA 5ICYB 3SDDD 3NZSA 3OVUB 1IC4H 1WAPA 4M9OA 3RB7A 5IB4B 4PGBA 4K8RL 1XH3B 4M8VA 3V9FA 4LSDA 5TE7L 3T3PE 3WJJA 2WNKA 2CK2A 2EIZA 4FQXB 3MV7B 1ACYH 3QS3A 4ZMXA 3ARFD 3QR2A 3EUDA 4XZ4A 1TVDA 2ZG3A 1P7KA 2AXFA 3E8VA 3PWLA 1BQHA 1NMCC 4WUKH 2NDFA 1A6AB 2XTJE 1DANT 1PKOA 4OH2A 1N26A 2VR4A 3MOBL 3G04A 1JGIA 2XQYG 1CZ8L 1GZPA 3DRTB 1DUZA 1G7PA 2VQ1A 5IB3A 1U8HA 2WMPB 3K5SA 4Y9CA 2E7BA 2DQGH 5CEZH 2WVVB 3U7WL 2IAMD 4LCVA 2WQRA 4P4KB 2JJVA 5BXFB 5EU3A 1CD9B 3MRBB 4FF9A 3M8OH 1UH2A 3UO1L 5LN8A 1LMKA 3LDBB 3N2JA 4JZJB 1YEWA 3NJFA 1QEWA 4XMPH 2QZQA 5DWUL 1TQCB 2JJTA 3KPTA 5EWIL 1HZHL 2DBJA 4NZTL 4X2UA 4HG4J 4YHKH 2LABA 2YRBA 3MX0B 1A64A 3HE7A 3QUML 5CSBA 1VRSA 4LLVA 4XTRD 1CE1H 4EVNA 5MEPB 3OR6A 1IAIH 2XN9A 2YK1H 3KGTA 1ZPLA 3SYAA 1YC7A 3MREB 2FWLB 2DLTA 2K4WA 5I75C 1HE8A 3C6EA 2WQXA 4NNXA 3BWUC 1QRNA 1I1CA 1A7BA 3L7FB 5DK2B 2OR7A 5E94A 5K1VA 3VD9A 3WD5L 1TJIL 2OTUA 4KROB 4QR7A 3S0PA 1AD0B 4WK4B 5TK4A 2X6UA 3JWDL 4NAQA 4QRBA 2BHZA 2QT6A 4XMXA 3R8QA 3VG0L 4TOYH 2OK0L 1U92B 3MRFA 3OPZL 3JWOL 4TUJA 3VGAC 1QLEL 4JFSA 3ZE2F 4BZ2H 1S2EA 2UY6B 1DP0A 3PPEA 1TOXA 3QORA 4RAUA 4RLDA 1OB0A 4XMWA 1NCDH 5D72L 2OMVB 3FT2A 4DCQA 2B14A 2BSTA 1AMXA 4E0RA 3PUCA 3BZFA 2H32A 3ZKND 1HIML 3D34A 4XAKE 5IROA 3PUUA 3PWPB 2KERA 2Z91B 2OQJA 3NTCH 4AM0A 1BBJB 1WAEA 4QCIB 2PO6D 3DROB 1DCEA 5GRUH 4Z6AT 1E9OA 4K3EH 4GG6A 3MRLB 2K78A 2OXGA 3KPNB 4ICWA 1G7HA 4JL1A 2DI9A 2VJ8A 4XCYB 1N6QL 5A2JH 2RQEA 3ZE2B 4Z78A 2BS8A 3L54A 2DBLH 4UIMB 1SNRA 1WFTA 2EYTB 1P4UA 1UACH 2NSQA 2VN3A 1U8KB 2DTML 2WANA 2Y1AA 3TPKA 1G7MB 2JE8A 3RKPA 5JPMA 2AHIA 3W0WE 1AIFB 1TVHA 3H55A 5I1LA 4JO2L 3ZL4H 1R9FA 4L8SB 2LTQB 3QQ3B 3QUGA 4ZOCA 5GZOA 3BXNA 4QY8A 3IJSB 3A4AA 4MJHA 5IK3A 1NCNA 4ZDHA 3QC6X 2XZQL 1MI5B 1LVEA 4PRHA 4A7TA 4ZMYA 2P48B 1E30A 2NUTB 1ROCA 2TAAA 1YJDL 4QRPA 1KBVA 1BZOA 2Z8SA 1E2WA 1M71B 1I9EA 5KSAA 1FGNL 4MS8D 4MBRA 3LHAA 4NNYB 4P2QB 4MDIA 4ZFFA 2NTFA 5JHLA 1QR1B 2E9BA 3ALWA 4PREA 3CZJA 2CLRB 4APQC 2FGWL 4X6CB 1KXTA 35C8L 3QXVA 4LCUB 4XHJC 4DP4X 3TNMB 4M7ZC 1S9YA 2F8XC 4MJIA 3T0VA 2NY7H 1T7VA 5CP3A 2HFGL 4U4BA 3PHSA 4WW1A 4ETQA 4KZEH 4YHLL 4OKVB 5B39G 1JGVH 4A55A 3ZMEA 3KWXA 3RTQC 5J11C 2PCFB 3FO0L 3VXUA 1XT5A 3IGAB 4GQ9H 1RUPL 4N9GA 1L3WA 5HGBA 1JAEA 1JXGA 3QDJD 5IFAL 4IW4C 4TLUA 4Q58C 5I9QB 1KIRA 3P4LA 2VDLH 3CH1A 4JHUA 5IQ7H 1BPLB 1UZ8A 2QQQA 1JWUA 4MMXB 3UTSB 1R3HB 43C9B 4L3ED 3OX8A 4XODA 4DN4L 1Z7JA 1KZQA 1NTDA 1YNKH 2WW8A 4PUBH 4X5LA 5TGBA 3BKYL 5GIRB 1UT9A 1OAYL 4IKKA 4WUUA 2EVJA 1CFTA 1QFWM 5DT1H 3GRWA 3PGCA 4PGDA 1JZ8A 4P23C 1QPKA 1ZA6B 2NT0A 3QCTL 2AITA 5ETUA 3W1ZA 4PBVC 3P4OA 4XCNA 2UX6A 4LASL 5BS0D 2BJML 2W9DH 3COOA 2A6KA 1SN0A 1NWOA 2LLNA 2ZAHA 2FT6A 2NPLX 3QIBA 4KHTL 4ZPTB 5J12B 2CJSA 2XWRA 2LE9A 4YC2C 4I18A 4BXVA 4POZD 4X6DE 1U9KA 1X5JA 1ZSDA 4Z3IA 1JZ7A 3H2WA 1O5DT 2QVKA 4GRWB 5E2TH 1FVEB 4GQPH 3RWEB 3L13A 5C0CB 4WHYH 1W91A 2N7BA 3EJYC 4JHZA 3QEQD 5EN2B 6CGTA 3B2MA 4WI5A 3QUKA 1I9RH 1JV5B 4V33A 1MQKL 4GEIA 3VD2A 5CLWA 3IDJB 4H13C 4Q0XH 2AKRB 3ARUA 3WE6B 3V5DB 4HUVA 2FBRA 4IU2B 5GS0H 1C16A 4YDIH 3BLBA 2GSMB 1IAKA 5J56B 5DQDH 3LVEA 3NOIA 4HH8A 4HV8A 3QIUB 3UIYA 2O26U 3WMQA 2QMJA 3K91A 1SF5A 3JV6A 3BKJL 4Z0BH 4O4YH 2EEFA 5HGHB 3Q8EA 4KTDH 5FKPB 2QPEB 3WLWD 3CHXA 4JFUA 4XR8C 3F58L 1NMBH 4NQSB 4BDVB 1Q1JL 4NQDD 4P2RA 2JJSA 5CP7B 4A66A 2MHAA 1JOIA 3AG3B 4NQED 5BRZD 5AB0A 3L45A 1NPJA 1F42A 1OTUD 1JMZA 2NY5H 4GSDH 4LSSH 5KJ4A 3V4VL 3VSTA 1SM3L 1MCWM 5C0JB 2G2RB 4XCFL 4FI8A 4HXAL 1K8IB 2AQ1A 5ES4B 1XGUA 5FM4A 4P48A 5DFVC 5FB8B 2QKIC 4FTVA 3K74B 4EI5A 3RVUD 1JZ4A 2J2ZA 2A83B 3TVMD 4HC1H 1DBAL 1WBYB 1W72H 1WH0A 2A74C 2P49B 1DN0A 1S9WB 3HHSB 4BFIA 8PAZA 1YPZB 4IGBA 1IC7H 4JRWA 3FZUC 2ZWYA 3MGTA 3OKNB 4PJ5D 1KULA 3C09B 2YAFA 4K71B 4LFHD 4CKVX 2FYVA 2CD0A 5LAPA 5KVGH 5IHLB 2YA0A 1FZMB 3NZHH 4NO5A 5EZLB 3MMEB 4JHBA 3O6FA 2GAZB 4WRLA 4XNUL 5IB5A 2E4TA 3AROA 1XGQA 3H42H 1IGCH 3HVDA 3NH7H 4MB5A 5IFHL 1JNLH 3ARZA 2A6DB 4FDWA 2JCCB 1FPTL 3UTOA 3QEGH 4ISVB 4HUMB 1JYNA 5I6OA 3U6XA 5I8CB 2ZWSA 1OGTA 1O7SA 4JKPH 5LDSA 3STLA 3VMNA 3HI1A 5GGUA 2ITCA 4MNQB 4ZOEA 1MEXL 5I71B 1IEAB 1NDGA 2GEEA 3HRZB 1QBLL 3QAZC 2ESVA 3MTXA 3GHBL 2YD3A 1EPFA 2XZAL 2J4WL 2XWEA 3HC4H 3OKKA 3TT3L 3FFCB 4F15C 1OLZA 2X40A 5IT2L 1TDQA 4DEWA 1MDAA 4DQAA 1XAUA 4I3SL 4RQQA 1TZHA 4G6AC 2A6JB 2BSRA 3DX1A 3CSYB 1TU2B 2FJUB 4KXBA 2QPUA 4PPTA 2WXGA 2JB6B 1ZPUA 3P3YA 2NXYD 5C9KA 3FU7B 1RZQA 2WQAA 5DRWB 3RX8A 1QASA 3WI9A 4ABUA 1FV1A 3DX6B 4L29A 4PRDB 2XKSA 2ZG1A 3FSVA 3QFGA 4MQ7A 4M6AA 4RMRA 1AZVA 5E4EC 4L4JA 2Z1KA 1UB6A 1RAMA 2X1XR 1MH5A 1TTBA 3AU1A 3Q13A 4YO0B 3BVNB 4OCNC 1I75A 3FOMA 2HFFB 2FH8A 5D4IA 3L6FA 4E2OA 2FJGA 5GZND 4GRLB 3CN3A 1CS6A 4KJQC 4KQ3L 4X9HA 5AYQA 1H6FA 2R2EA 1S9XA 1NIDA 3DURA 5JORB 1NIAA 3UZQA 2YXVA 3N5AA 4P46C 3L95A 1LDSA 3ZE0B 1CBJA 4JRXE 3TEYA 3TEUA 1F4YH 1BM7A 2D2OA 2FJFA 4Y2NA 5I76A 1QA9B 1KJVA 1TO4A 5E70A 3SE8L 3JBG7 3QFJA 4PRPB 4P3DB 2C9PA 2F7RA 3O8XB 1PG7H 1FFNA 3D18B 1KGYE 4OGXH 4EMZA 2O61A 3JTSB 1UEYA 3U0WH 4OCMC 4ONFL 3C87A 2HG0A 2IPTL 2WTPA 3BISA 1R3KA 5BQDA 1DVFA 3OSVA 2ORBL 3S2AA 2P24B 4PJ9D 4DERA 5KYYA 1SDAB 1X5LA 3VM5A 1D5BB 3OG6B 4L2YA 4Y5XC 5G5DA 1DE4B 4A7GF 4ODVL 1LTXA 4QHUB 5I8KL 3RAJH 3M1CA 3H3PL 3LNHA 1R5VB 3LEYL 5CWSB 2BIPA 1TTCA 1S8DA 1JYWA 3UZVA 2W65B 3WFEL 5C0AE 1L9NA 5TDPA 2CKBA 2FYYA 1WBXA 2UX7A 3HLKA 1XZWA 1MCFA 2C3XA 4HWUA 4F57L 2IG2L 2PWFA 5FYKE 3LZPA 3OKDA 1F8TL 1P5UC 2AEPL 4FYRA 9CGTA 3B43A 1KEGH 3ILPB 5D1ZB 2AEOA 1KBPA 1J8HB 4L4VE 2A73A 3BPOB 2EC9T 1GC1C 3UTTE 2WSKA 4FXKB 4N0FB 1A9EA 1A65A 3Q8BA 4J8QA 5LAXA 1HQ4A 3LS4L 2W0KA 4U6YA 3F5WA 4WO4B 5DQJA 5AVTB 4XNXL 1ZVYA 1CMOA 1J9CT 1T04A 1OGAB 2ZONA 4PJ8B 3ZOAA 1IGMH 2E74C 4P9HC 5BVPL 3DOSA 3GUTA 4N2AA 4PRBA 3S3JA 4NSKA 2N01B 1QNZL 5FYLH 2WQ8A 4HUNB 1OPGL 3BPLB 4PD4K 5HHVL 2EDOA 4LLUA 5FGCE 2Q6WA 3FRUB 5JO5B 3TFKC 2WWMD 3D39A 2WZAA 4QD2E 1DBBL 4KXAA 4HGWB 3N6YA 4Z0XA 4YUEH 1I7RB 2BHFA 2JCWA 5CIPB 3MXVL 5EBGA 1U3HD 2VL4A 4HAFA 3VXRD 5IVZA 4PJBA 1G4MA 4WNQA 4FABL 4JDEA 1E5YA 3GSVA 2DYSB 2OMWA 3VXNB 1G6RH 1UXSA 4ZUWA 3VWJD 3ZDWA 3EZ8A 4XP4L 5L4MA 2HTLD 3FT4A 2RJMA 3TURA 5D7JA 5D7EA 4CC0A 2BX5A 4UQ2A 2DW5A 5DJZB 4M6OH 4XNMA 5F21B 3G9AB 4QHLB 1Y1DA 3K6SA 3RZCA 4DPBX 2TSBA 1AQDB 4HWZB 3U9UA 3B2PA 1UM5L 5JTWA 2CO7A 4YSOA 1VCAA 2BSSB 4P3WA 4Y19B 4QRQA 4I4WA 2DF3A 3FKUS 5JHDE 4EEEA 3EXJA 4NP4L 3PHOA 1V5JA 5F9JA 2NYYC 3PFUA 2LLGA 4X98B 5ID0A 2ZKHL 3MRCA 2X1PA 2ZCLH 2DYPB 5IHUH 1H3XA 2H26B 3PE9A 4PG9B 5DD1H 4XXCA 5CEZD 4O02A 2WGNB 3GMPB 5AVQB 3PP4H 5A2LH 3UC2A 2E7LA 2NY2C 1FO0B 1KLGB 5IQNA 2D0HA 3LQZA 3ZQXA 2XT1B 3NJVA 4PV9B 5F89B 4M5ZH 4U3SA 5HI3C 3ZPDA 1Z66A 3WBDA 5DJXB 2XCMC 4P2YA 3UCRA 2EVHA 3LX9A 2G75A 1U8OA 4DZBB 3WO3B 1IBDA 4FNQA 4MXQC 1CN4A 5DRNB 5EA0H 5EIIB 1BVLA 2YD1A 1F41A 4I0PC 1KYDA 5JW5A 4K3GA 2BDNH 2AGJH 1RQ5A 1EZUA 3IAPA 3VFWA 1AGEB 4ZO7A 2NUPA 2JV6A 5A2KH 3OHXB 2L7UA 3GMMA 3GMQB 3DTXA 3MCLL 2BC4B 1TLKA 3U9WA 4E5XG 2K7QA 3TZVD 3UBXB 4UTBA 3MUY1 4PJEA 1TJXA 1X5AA 1A7OH 1JWMB 2K0RA 2VMDA 2IBBA 4ZYKB 3KYKL 4A39A 2VSCA 5E5MB 1A2YB 1KPRB 3BAJA 4H1LA 3H9HB 4KMLB 1S7XB 3EXLA 3U2JA 4I3RL 3OD3A 5JYLA 5MENA 5CKGA 1BVKA 4OCSH 4HQQH 1NCUA 4MD0A 1A1OB 3ECUA 5T8IA 5T1MA 4WWID 4X5RA 3T77B 3KCPA 3HMWH 3OSKA 2DLFL 4L4TB 3UAJA 4ZPVB 1EIBA 3ZE1F 3ZZSA 5DQ9A 4W9IC 4C56A 2VDQL 3FQ4A 3GSUB 4PRID 3GBNH 1UH4A 4QAWA 1AMYA 4M93C 2R0WH 5F7KC 3KPRA 4E9QA 2MKWA 4J27A 1AZRA 3CFEB 5F97E 2H2PC 1FC2D 2BP8B 3DSNB 5BUPA 4G7YH 4YXKH 4AQ1A 2IPUK 1I1AC 4FHJA 4OF0A 3CZEA 3AXLB 3QDMB 2DJSA 4FMFA 1BOGB 3F65A 4JB9H 3Q9PA 1VFAA 1U42A 1AJ7H 5E1AB 4ZMOA 3B3IB 3ARDD 1KB5H 4NRYB 3IU4H 3NACL 1NBZA 2BVEA 2OW7A 4NERA 4FG2A 4W4OC 2CGZA 2YBRA 4Z8FL 1BXXA 2EH8H 2DKSA 2HA1A 3HB3B 4HPOL 4MXWH 5L9DH 5T1JA 4JLRA 4PVMA 1YEIH 5DHVH 4XN1A 3BVWA 5AW9B 4AQZA 5AD0A 3FQUA 4PWFA 2H45A 2WIIA 3QUMB 3VFRB 1MHEB 4R2GC 1MG2C 3V6FA 5HDQH 1EWHA 1E9QB 2VDPL 5D7KD 2DMKA 5A3ID 1CLCA 3QYMA 1L7IH 1FYTA 4LIQL 2F61A 2O5XH 1P7HL 4C57C 5B3JE 4KJYA 3JT0A 4PB0L 4ORGB 5EH1A 3VYOA 2BP0B 2IDFA 3GKWL 4W6WB 1MJUH 5CU9A 4YHOL 2GCYB 5BW7A 5M7QA 1KLUA 2VC2H 3D4GA 2IFGA 3DV6B 4AJWA 1QKZH 2AQQA 2R1WB 1KJ2H 5HJ3A 3RVVD 3F62A 3VG9B 5EC2B 2CHXA 3DNKA 2EUVA 5E0QA 2MRYA 2PXYC 2ZQKA 1E40A 3DX7A 1P53A 4N9OB 4D8PA 2DLHA 1HXYB 1Q94B 1QLEB 3N55A 3FO2B 1RULL 3MBWB 3PL6B 1WWCA 5SWZA 3DTDA 2CIIB 1DFBH 1N59A 4RAVA 2QSTA 5C7XH 1PX4A 4PLOB 4PW9A 4CJ0A 4F2MA 1PX8A 1M2VA 4LLYA 4JFQB 5JW3L 4X6FA 3GZPA 2WXPA 1EV2E 2H6PA 3U9PH 3L3DA 4Q56A 1MJ7H 1IC5H 1H8SA 1OT4A 3DGCR 2AABL 3CFNA 5FUOL 1A6TB 2X38A 5E8NA 1U8NB 2J1KA 1VB9A 4GT7A 3RX5A 5IB1B 3WXVH 4MCMA 3NCMA 4Z7QF 3THML 1QUNA 3PNWB 5ISZD 3HG1D 4AYEC 3QDJE 3CLEH 4FLQA 5CU5A 1AS8A 2GY7B 2VZOA 1A6UH 5BZWB 2FTAA 1BWMA 2VYRE 1TZAA 2XUWA 4QXUH 4L3EE 3PAYA 3T4YA 1XMEB 3IFPA 5ESQB 5GGTL 1FQ9C 1J1XL 3DRQA 3HNVH 3ATFA 3SD2A 3UXFA 4XXWC 3QAQA 4WTZA 4RMUA 5ILTL 2EACA 2FO8A 4NB7A 3X13B 5HHOB 3EGXA 3HHMA 3GZKA 3LKSB 5T1KA 4HA1A 1DDHB 2DM7A 2EO9A 3LSOB 4QTHB 3SPJA 3PV7A 3FUEA 5CSGA 3FRPG 5EOCJ 4Z7QB 5EBWA 2WZPD 4HIIB 2BWIA 2XTJC 3QZLA 5D71L 1J8RA 2W60B 2X2UA 5IB2B 1GPOL 2G0KA 4GBXB 5FS5A 2MOQA 4I1PA 1A0QH 3S96A 2IPKB 1LHZA 2P5EA 5DJ8A 3B7RL 4Y2DD 2UZIH 5JNYA 3QJRB 1QSEB 1X5XA 2CMRL 3MFGB 3MGOA 2NW2A 1MCOH 3QEQE 15C8L 1UCBL 2CR6A 4WEMB 3GJFB 4PVNA 5CFAA 5E00A 4MCZA 2QBWA 1T2QH 2MQ3A 1HQRA 2DEYX 2F54B 4MZ2A 3TONA 1GS6X 3ME0A 4UT6H 1EBAA 4L5FH 5A1AA 2ZXAA 5DJDA 5AKSA 5LBSH 1BG9A 3ARXA 4FQQA 4ABQA 5A2BA 3O45A 1OOAA 4ZTEA 4XPFH 1J8HD 2K4AA 3Q1SH 4K94H 5B38G 1KJMB 4ZTOH 4M8RA 4QF1A 4N2NA 3L3IB 4YDKL 1J1OL 5DRXA 1GAFH 4OCRL 3RWJA 4CMMA 4TSAH 4PCKA 1JCKA 2FEDD 3E1ZA 4NQEE 5BRZE 1X7QB 4HIEB 1YY8B 4KFMA 4LF3B 2EICA 4WGKA 5LCVH 4IKLA 1NAML 2D31B 3MBED 3RY6A 1KPVA 4UCFA 2Z31B 4QXGH 3L17A 4GPVA 5DK0A 4ANKA 5FKAB 3QQ9D 4GQRA 1E6OH 3KYNB 3LQAC 4OSUL 3GSOA 1BP3B 1WDAA 5FO8B 3QZMA 4AIOA 1IEHA 2C5DC 1NSNL 3AMLA 5ECJE 5DMYA 3JUZA 2BIOA 5CGBA 2ADFL 3MA7A 4PJ5E 5C2BL 1MCLA 1XIWD 5D1XE 3EH3B 1T6WA 2G5RA 4LHUB 3RI5K 4ANWA 3S4SB 5FECA 1E5CA 4F7TA 5KAQF 5EORH 2Y9RT 4JGUA 4NM4L 4JFEA 3UP1A 4R96B 4JRYB 4ANVA 4AQEA 4OCYH 1F4XL 1TNMA 4ODWB 1Q9LB 3ARBB 2X70A 1GMEA 5D7IE 4UDUB 5EEVA 1AP2B 1UD2A 3WNMA 4FEIA 1P1ZA 2GSIB 4XAWL 3NIGE 1MLBA 3Q5TA 1JTTA 2MOVA 2O5ZH 2OI9C 2R83A 4HJIA 1P9MA 4LOEA 4QTFA 5C9JA 2P1YA 2PLTA 3RNQA 4Y2OB 3PWUB 4AKPA 4JFDD 3IVKA 2YXWA 4Y4FD 5K59F 1N7ML 1S7QA 1PLGL 1PEZA 2VDNH 1CFBA 4RCAA 2R2BA 5D7SH 3V4VB 5I6NA 5KYWB 2PCPB 3WLBA 2VE6A 3LS5H 1ZTXH 1SHXA 2GUOB 4GKZA 3ZY7A 3DA0A 1R75A 1TENA 1KCSL 4YHZH 1RIVH 2IO5A 1DEDA 1G43A 3B2UC 4ZUTB 1TXKA 1C5DA 3H1ZA 4PQXA 1XGPB 5IQLA 2P8MB 4MJ6B 3KL5A 1JFQH 1ND0B 3F8UB 4JG0L 4YEEA 4YSPA 1A1NA 2NXZD 1KCWA 5BV7C 4K7PL 2Q8BL 4TVPL 4HWEL 2VM4A 3CN1A 4I2XB 3AAZA 4JAMB 1W80A 4HX1A 1HKFA 3AY2A 1SYSA 2OFQA 5HHPA 3QUYD 3GF8A 4NN5C 5IMKB 2VLKD 3NCJH 2X7LB 3D69A 1Y18A 4PGZA 5HYJA 3O3DA 1AGFB 1JNHB 1RZKC 4N6RB 1B9KA 5F8QC 5T1LB 5F7YC 3N3EA 3TN0C 4A1RA 5A2FA 4OZFA 5DD0H 5DVNA 4Y16A 4Y1TA 3AWFA 3A67H 5I1JH 3CZFA 1Y7VA 5LWYH 2XPGB 3M7FB 4X5WB 1IO4C 3VQ1C 4R6UA 2X5PA 2D73A 4K8RD 1BFVL 1UKQA 3D12B 1HEZA 4QEGA 2OV0A 3BI9X 3SBWA 3X3FH 2PW2B 3S5LG 2CA4A 2DM4A 3ZTCC 2ADJA 5DUPL 1EAQA 4KOCA 3BQUD 5EO9B 3AJ7A 3AXHA 4U1MB 3EH4B 4BZ2L 5C0ND 5CD5C 1NFDA 1MFEH 2R39A 4C47A 4WI9A 4TN9A 1JD9A 3TH2T 4MCYA 4F33A 3KYMA 4JPVH 3QI9B 4JVPA 2NOYA 3SGJC 4BXSV 4O9HH 1T4WA 3G5ZB 1CLYH 1WRFA 1MFCL 2V2WA 3FU0A 3NTCL 3FJTA 2FX9L 4MNGE 2WYZA 3VJ6A 3F7YB 1R46A 3L5WA 3Q2LA 3L5JA 1F90L 3V5KA 3GO1L 4AUUA 3IDMA 4DP2X 3JWNE 3N42B 5EBMB 3ZGHA 3P9LB 2V7NB 5F1IB 4WO0A 2DBLL 1F2XK 4NQCB 4JHWL 2Z1PA 4U6XB 2R0ZH 2GC4C 2Q3ZA 1DO6A 2WYIA 3ARGB 1RZIA 3BVDB 3GNML 4G8EA 4N0UB 4W9CC 4PJDF 2XZCH 4HISA 5E2VL 5FYLD 3TBBA 3ZE2E 3QO1A 5AYTA 4I85A 4KVNL 1F3DJ 5SWSB 2X3CA 5EO1B 1HSAA 4JREB 5I8EA 4IS6B 3OKEA 2JQMA 1MAKA 2GK0A 3MXWH 4OZIA 5L0QB 3RHWF 1NFIB 2YUWA 3ZMNA 4B0MB 3ZHFA 2DIEA 2VDRH 3B7UX 4C59B 5HPMA 1B4RA 1BX2A 3U36A 4OZGA 4P4RA 3RZWA 1U58A 1F1AA 4G71B 4BCXA 3RJOA 1GTFA 3EH2A 4ELKA 5BQ7A 5ELIA 5L88H 2XXMB 4R0LC 1SGKA 4HXBH 5ENWA 2UXVA 4F9PA 1EHLL 4ZFOA 4CBZA 4GRMB 3EYUH 1FG2B 3U7YL 4FZEH 1GGCL 4TM9A 2BWDA 5LJYH 4KZEL 3VXRE 1BZ9A 2D3LA 1JGVL 3R1GH 1CGSH 3FN3A 3FUHA 3JVGC 1RP8A 1PZ3A 1BGXL 3JYCA 3I6LD 2W38A 4MB3A 1CR9H 5L7XL 1AXTL 4AEHL 5C0GB 1CJYA 3UO8B 4HIXL 3MROA 1T7XA 2FIKA 4P5TB 2NY6D 4YLBA 3FQTA 2XPYA 1JGUH 4UBDD 4N8CL 4BE6A 1MF2H 3O4LB 5H37G 5EBLA 4JJ5B 3JTBA 2JIXB 2E8YA 1YNKL 1IUZA 2XZZA 1NKGA 1ZT1A 1ZLVK 2EEAA 3RGVC 1NGYB 1B2WH 2DQIH 2Z35B 2V5SA 1BIIB 3V0HA 5DT1L 4X99B 4QJ4B 4XI5C 3BAEH 1FAKT 4PJGA 1KEML 1YCSA 5DZLA 4EAEA 3OJVC 4E41D 2R27A 3TV3H 2HRLA 4HCIA 4PWGA 4X7CC 3H9ZA 3BDYL 3CVBA 1U95B 4CDHA 5B1JA 4H88H 3U0PA 1N0LA 4HW6A 4XB8A 2B1OA 2VUOA 4Z5RB 3WNIA 4ZMQA 4FHBD 1BJ1J 3APNA 1DJXA 4N1HB 3D33A 1AO7A 3KJ4B 3V55A 4O2CB 5E8PA 2KMWA 3VUAA 4UZGA 3SDCA 3HZMB 4IRZL 1CLZL 1QFOA 4QRFA 4OLUL 5FA4A 3C8KB 3C8HA 1WCQA 1MRCL 1M6UA 3L5XH 3IJHB 1OP5K 5GS0L 4B0MM 1B90A 2RFXB 2YGQA 4RWYL 4JZOB 3LAFA 4MJJA 1QSED 3EJZD 4HEPG 4PGEB 1JRHH 1NINA 3CPLA 3EYVB 2OL3H 1UJ3B 1DBMH 2NY3D 4OQ1A 1V55B 1SYVA 2HLFC 3FYIB 3OC5A 4KO9A 4LPVA 2PMZA 1RL1A 2FECI 4PCSA 2L7JA 3C5SA 4X80H 5CO1A 1NMBL 2P5WD 1IX2A 1JPSL 2WKLA 3DXAD 4FFTA 4TUKL 2RQ8A 1UB5B 3BESR 4ZFQA 3KPPB 2DWXA 4E9LA 2OSLA 5FYJD 2N0KA 5AVRB 1BOYA 3QUZD 4ZOBA 3SPGA 2I7SA 4PRAB 2ZUVA 4RZCA 4Z7VA 2HN7B 2P52A 3KYOA 4UT9A 1IMHC 1BMGA 2IPUG 2EECA 5E03A 4M1DL 3D2UB 2Z3FA 1V7ML 2QLVB 3FUKA 4L8DA 5H94B 4A2EA 5CEXA 2ENJA 4HKBA 1FCCA 1ORSA 3K2KA 2VUYA 3VW3H 3ZRSA 1YMMA 4GUPB 4PRIE 4IRJD 1HHIB 3I2CL 3WIHH 4XE0A 3UGXA 2ZYSA 1PAMA 2X6VA 1DQJA 2VJXA 1J5OH 1RU9H 2R69A 4U1NA 4U49A 4J2XA 3KBPA 2BS9A 2A38A 4JN1H 3K46A 4NHCL 2A6IA 4BFNA 3CFBA 1YDPB 4PJAA 4H25A 3V0VA 1CTOA 3EOTL 4PY7B 4GAGH 3NZHL 5D2NE 2XFXA 2CDGA 1PCSA 3NH7L 3H42L 1IGCL 1LNUA 1OY3B 1XGTA 1NPNA 4JBSA 1A1MB 1A9BB 3BEVB 4KWUA 3CUPB 2LAGB 4OLYL 1AANA 5CJ5A 3IDYB 1M7DA 4HSAC 3BZ4A 5IQ9B 1JZDC 1Z9MA 2ITDB 3PGFL 4K7PY 4UQBA 2DLEA 3QNYB 4OFVA 5E1IA 1MRDH 2P4AB 3PIQB 4OUOA 4U1LB 4YZFF 4LQFL 4IJ3C 4EDWH 3F83A 4PFEA 3S9DB 3WEMA 3WELA 1S78D 1IBHA 4C55A 1RK0B 5C6WH 1U8QA 4G42A 4QRSA 3EF4A 4MNQE 2AJZA 2F58L 5I0WA 5IP4A 1MFDH 3FTWA 1BSIA 3LH2L 3KNBA 4AZ8A 1VACA 1I1FB 2DOCA 4TUUA 3S35L 5F7LB 2CM6A 2ZXEB 1CE6B 4XB7A 3V0JA 2CHNA 4D8OA 4JFPA 4AH2B 4Y5YB 3RJQB 2VDQB 3LHPL 1N8ZA 2AQNA 4KK8D 4ZS7L 3BAYA 3VH8G 3FCGA 1ECYA 4NDMA 3CVHA 3HE6B 1Q9WB 4Z18A 4W6YB 3QZWG 2XSKA 1ASPA 4W9HC 3FSZA 4OQTH 1OAKL 5D4HA 3T65A 2Y3AA 3BFQG 3EDEA 3MUGA 4Z7NB 1K8DA 3CSGA 3V0DA 5SWQA 3QS2A 2UXFA 2WBXA 2OMXA 2C7FA 3OB0H 4TNWK 5TTRA 4BSJA 4AEIH 2H4EA 3H7BA 4WV1B 2ZZUT 5GHWH 4QHNB 5AZ2H 4W4NA 1IT9L 3EO0B 2D9QB 3MLUH 4LOVA 3BP4A 5EHFA 3WHE1 3WUZA 1O9WA 4N5EC 2EIJB 4JO4L 2E56A 1BYNA 1PQZA 2X4QB 3H9SB 4ZNEA 1ZT7B 4FYTA 2VDPB 2V2TB 3NCEB 4OZHF 5DI8B 5ALBH 5ISZE 3HG1E 3W9EA 2Z4QA 2IH3B 3FXIC 1SXSA 1D9KD 2YD0A 3MKKA 3NFPA 3T8XB 5C08D 2Z93B 1UWYA 4KXCA 8FABA 4ZFGL 3OZ9H 3A4FA 3OJMB 1P5VA 3ZHNA 2EDMA 3SDDC 4XRCA 5IEKB 4WLCA 3GS0A 5I1DA 3DO3A 1DQDH 2F53D 1MNNA 2F15A 4QT5A 5I66A 4NUJB 3H2PA 4WNJA 4APQA 3LRKA 4PGJA 2VLJD 4MX7B 3ARFC 2GTWA 3CFKA 4FCAA 4EBQL 4JJOA 4PJ7B 2BNQD 1F11B 9PCYA 4IMKC 3CH8A 1WFMA 4U1GC 4L3CA 3B6SA 3QC5X 2EIKB 3RTQA 1SDDB 3L7EB 3KPSA 4M56A 4OJAA 5KVFL 1J0IA 2DQDH 3T6ZA 1T2XA 1XCQB 3AWEA 1XWVA 4LL1A 4NJAH 1UG9A 4DVBB 1IBGH 2Q87A 3MYJA 2IAMC 3G6AA 5DJCA 3DHUA 2CLZA 1X3DA 4PIRF 1DSWA 1G5AA 2Q76A 3GINA 1NOFA 3RWGB 4GS7B 4NP9A 2VN4A 2ZX6A 3ARGD 3L3KA 3GK8L 2E9GA 3SDXA 4ZX5A 2YKKA 4OIAA 4FLOA 4L3AA 2X05A 4IIQB 4GIPD 2B4CC 4P23A 1J8HE 4LVNC 1XR9B 5EU6D 2YEZA 5IG7A 3TXAA 2VERN 1D6EA 3BD3A 4Z95H 4FQIL 5F0MB 1NBQA 3LKRB 1NCWH 5JHLL 5MERB 3RBSA 1Q8MA 3BGFC 2AERT 1ADQH 3IPEA 4P49A 4XTRC 3AU0A 5FHAH 3NDYE 1EDHA 5J6SA 4A2LA 2MQCA 3IBOA 3MNWA 5I0XA 7FABL 2VSMB 2JKJA 4RA3A 5F71A 3O41B 1PF3A 1TETL 2VN6A 4L9LC 4KNQA 1IQDB 1E8ZA 1OF0A 3DO4A 1KG0B 4KAQH 5KVGE 4CADB 1JHTB 3C5ZB 3KHQA 3KM2A 2MNJB 4R4FL 1A4KA 2V5RA 2XVKA 4Y4HB 5MEOA 2HFTA 2WUBH 2HFEA 1Q9KA 1RZFH 3PU7A 2WVSA 4M6OL 4YAQA 2CCVA 3A22A 4YPGA 2ZSVA 3ULVH 1BFOA 2CBQA 4ERSH 3FB5A 3FAWA 3DJSA 3WGUB 4QHKI 1J9RA 3BW9A 3F7LA 2GQHA 2RCSH 3GRWL 1JF1A 2XWJB 3V7AG 5FOJA 1J0JA 3ZKNC 4M7KL 4CVZB 5CJBA 2YKLL 2X9YA 5IREA 3LN5B 2P44B 2JIXD 4WW2C 3SQRA 3UAEA 2BP3A 2PO6C 1IM9B 3NRQA 4F91B 7PCYA 2XQBL 3VXSA 2Q10A 1Z3GH 4M5ZL 4BKSC 1MG3C 1CF8H 4JFDE 3UTQB 4UTCA 4FFYA 2QKIA 4G9FD 4ANXA 2HVJB 2HKFH 2ZX5A 3EJQA 5EA0L 1NCHA 2OBGA 1TCRB 1RLWA 2A74A 4GMSL 3V4LA 1NAMB 1FSKB 1IBFA 1TT6A 3HNTL 5AW7B 4JFFB 3WNNA 5AZUA 3GLZA 2R4RH 3WAJA 3TYFA 2XTSA 2CGRH 2ENSA 5KS9A 1NC2A 3KJ6L 1UZ6E 3W57A 3HBQA 1CLOL 4ODSL 3O3UN 5KANG 1N5AA 1OSPL 2WK2A 2P80D 2NX5A 2VO8A 2FECL 2XBTA 2ZOKA 3F6LA 2EVGA 1CQKA 2V33A 3RWIB 1PKQB 5IV2B 4WI6A 3P54A 1ORQA 2EDKA 4QHPA 3QFDA 3I9IA 3EO1B 1MVYA 5D7LB 3MA9L 4MAUL 1TQSA 2VLKE 4MS8C 2GKIA 4RNRB 3VXMD 2TRYA 5I15H 2K3HA 2C3GA 1WUNT 2D03L 3TWCH 1RPQA 4BQ6A 5ICYA 1YN7A 3PPSA 1EEYA 4HQQL 1RVFH 4B9JA 3WNPA 2MCAA 1PLBA 1ETB1 2A9NL 3L1OH 4K73A 2DWTA 1M2OA 2OSYA 3HMWL 3IEAA 5EEUA 1KACB 4GKNB 3ZO9A 3US0A 1CFVL 5D93B 5BZXA 5L2KA 4DVRH 1KIPA 1ZV9A 1LO4L 4W9KC 2UZYA 4HIJB 4NFBA 2IANB 5K69A 1A6ZB 4WGVB 2R0WL 2ZKXA 1RK7A 2G4EA 5J6GA 1A6AA 3DETD 3HI5H 4ZUUA 2YMOA 4HULB 1QSFB 4X4ZA 3SO5A 3AQYA 2EZ0D 4X8XA 3EYFA 2WXJA 4LFHG 4QRRB 1BD2D 5E9DD 1OHZA 1R1CA 1KYFA 4K3JH 3FPXA 3BIKA 1AJ7L 5HDWA 5HVHB 4PS4L 4PTTA 3W2DL 3TTSA 2FSEB 1AR2A 3GSQB 3ETSA 3CHOA 3MLZH 1UC6A 5HHMB 1M7IB 5G4NA 3H53A 4LLQB 1SEBA 4G8GB 5FDYA 2ZKYA 4MXWL 3D1MC 2IF7A 3QG7L 5K9JL 1RLBA 4DTGL 2APVA 5FGBC 3SIKA 5G2NA 1BFTA 3QDGB 3HR5B 1OKEA 4AV5A 1GY1A 1GKOA 4CN6A 3VGEA 3ZE1E 4AENB 5AAMC 4YS4A 4POZC 3GBEA 2XA8H 4JDVA 1H3GA 1HOEA 3KLLA 4LGSB 3HAEH 4YLCA 2NSXA 1IGIH 2AANA 4LBEB 4ONGH 4HFUL 2DN7A 2DTSA 4EUPA 3AADB 2VC2L 4I0CC 1I1RA 2QV2A 3TO4B 1R0AH 3BP6B 4H8WC 3BIBX 5BCAA 2VWEE 2F9BT 4XVOA 3J8F7 5F9DC 3SGKA 4NGHH 5C0BA 2BVTA 4TSCH 1OANA 4AE1A 5EEZA 4MQXD 4XNYL 2GPZA 2X89A 1ILUA 5GRWA 1CFSB 3B2DC 4YXLH 3WHE0 2WP3T 1UT1A 2YAOA 1T5WB 5TE6L 2VR3A 4Y5XA 1JZ6A 3CDZB 5FO9A 3B9KD 4BFRA 2V9QA 4IRSD 4H4NA 1HINL 1RUQL 4B5ZA 1QW9A 3WLWC 2LAAA 5C7XL 4JGMA 1JZGA 1AKJB 3RUGA 3QNXA 4N0CD 4CNIB 3U2SB 2UY6A 4ONHA 3ALXA 2E76C 2GY5A 3QJFA 2OMVA 4G7SB 1OTUC 1N5YL 1PZCA 1RK1A 2XV6B 3W39A 2G3MA 1JHLH 1SQMA 2CA3A 3GT6A 4J12A 2GTQA 3ZO0A 3FB7A 3RDTB 3WYRA 4FFZA 5C7ZA 3CFIC 1UVQB 2Z91A 4DP5X 1J5CA 3I6LE 4JG1L 3TCTA 3RVUC 2GSGA 1P5UA 1ZTMA 1UFUA 4HBCL 1T1WB 3HCVA 4UINH 3TVMC 1P7QD 3CLEL 2K8QA 3AS2A 6TAAA 3II3A 4XCYA 3BUTA 4OFPA 1BXVA 4GUQA 4JM2B 4DP8X 2HH0L 5D1XC 3QRBA 3T9WA 3BH8A 1JGEB 1J7VR 1XTLA 1R47A 3T0ED 3O9WB 1NC4A 5HYEA 3NZ8A 2FATL 1XEUA 4MA8L 2IOIA 3L2NA 2R56L 2BPBA 4E41E 5ACLA 3QCVH 4LPUA 4XBPB 2AMUA 2VN7A 3EBAA 4JM0A 1HTYA 1I8LC 4GAYA 2HZHA 2OMUA 1P4LB 5T5FH 4N87A 3CVIH 2BFGA 1DVYA 3FONA 4NZJA 3GGWA 2ALAA 4WHTA 1IQWH 3TA3B 2CKBL 2VR6A 4P2QA 1FFQA 3AREB 5HYIA 3MACH 1IM3A 1SMDA 3VFNA 4BH7A 1OAXH 1T1YA 4ONOA 1D5XA 4X6CA 1GS7A 4NAMA 1VENA 2VXVL 4U7MA 2E3VA 4LCUA 1HT6A 4DGIH 4MLIA 2B59B 3EBHA 2Y7MA 1LEIB 2XG5A 4XC3L 3TF7C 2DWEB 2NXYC 4JN2B 1T2QL 1HYSD 2NNRA 3LXAA 2IMMA 1S4IA 2VXTH 3O0RH 4J6RH 4CVXB 3K0WA 3P40A 1VPOH 1QSEE 1J0KA 1FVCA 2V37A 1PDKB 3NIDB 5GGRB 3KLHD 4HJGA 1SVZA 1CYXA 1BW8A 4XPFL 5D1QB 5F88A 1MPAL 2JB5H 4K23L 3PYCA 2YPKB 4D0CB 3TH3T 2A9AA 1DJGA 5GZNC 3DXAE 1A3RH 3EGDB 1LO0H 1PW3A 3W9DA 1KMGA 4HYTB 1GYAA 4J3OG 2ZCKL 3MLXH 3ZL1A 1OAQH 1LEGB 4HPYH 3U46B 4XMTA 4M43L 4Q7DA 1CFQA 1YZZA 1MY7A 5FYJE 1BQKA 4X6EB 1Z6JT 3T1WA 4H8HA 2KPNA 1J86A 4F58H 1DL7H 3UJJL 3VFUA 4JRLA 1BEYL 3D3VB 1RZGA 2EJ1A 3M86A 3I75A 2AJYL 1C12A 4OLEA 5BO0D 3AVEA 2ARWA 4RBPH 1GGTA 4MD5A 4IBWA 1DLHB 2YPLB 3MLVH 3T2QA 4UM9D 3TBWA 1IEBB 1BEXA 5IWLC 3LZFH 3D06A 4MD4B 3QIWD 4H5SA 4MHHG 1YY9D 2DJUA 4WWKD 4NRXA 5C0CA 4UAOC 3BKCH 4OCYL 4PJ9C 2A9MH 3JYBA 4AX3A 4RFNB 5HVGB 3Q6FB 1T1ZA 3FU5A 4ZW7A 3V5DA 1NAKH 4EI6B 2F1EA 3M17B 1FL6B 1ZKAA 1HI6B 4CBPA 4O02L 5LXGH 2O5ZL 3EKCA 1PG7W 1Y1UA 1G7JA 4V1DA 2ICES 1WS7A 2CU9A 4MSWB 3JWNC 2ETWA 3JV5A 4OCWL 5LGYA 3O3AB 4WHCA 5GGQH 2BXYA 2YN5A 3HKZA 1M9SA 5JXED 1KENL 4NQSA 4BDVA 3GS4A 4O51A 2Z65C 3MOAL 4ZMAT 1RUAH 4HUWB 5CP7A 2Y2TA 1LE5A 1WE5A 3C6LB 4PJXF 4YHZL 2WO4A 1C1EL 1RZ7H 2FNWA 1W8NA 2QL1A 2J44A 4P2OB 1I1AA 4NNPH 4H2CA 4TUOA 5FB8A 5HY9B 4XCEB 1RMFH 2HVKB 2WLIB 4P59H 1KTKE 2ZT9C 2R1YA 4UTBL 3RIFK 3F6IA 4W4OA 2YRPA 4GW4A 2ZIDA 1PSKH 3LVTA 1BPVA 3FK3A 3CC1A 4YFEA 3OXRA 4PJIA 3H3BC 4PGBB 1EHXA 3HJ0A 4R84A 2WWMC 4QIRA 2F5BH 4RISH 4YHMH 2J8UA 3DC0A 2V3EA 2XWZA 1OV8A 4JFVA 4L23A 5K59E 5D7LD 1U3HC 2A6DA 1U93A 2IGFH 1P7KB 2AXFB 2JCCA 2IFFH 3PWLB 1BQHB 4CC4C 4I77H 4GW5A 5DHEA 3VWJC 1YC8A 3MRJA 4OF8A 2VKWA 1ID5I 3HIZA 5CJQH 4LSTH 3V0WL 1DQIA 3DJZA 4XN9A 2QPSA 3G04B 2HTLC 4DQOL 3SYPA 5KG9A 3ETBF 3G5XB 4WSJA 4JFHD 1B0GA 1CDHA 1DUZB 1MHCA 1G7PB 1S3RA 2VQ1B 5IB3B 5KJRH 1UM4H 1U8HB 3NK3A 1J5DA 3SPVB 3PQYD 2CBMA 3CSPA 2PXYA 1Z9NA 4NUGH 5C08E 3DGDA 2NCEA 5DMKA 4F8TA 4H20H 3ARQA 5EU3B 1OALA 4R7LA 4HH9A 2Q8AL 5EFIB 3N1GC 1SOXA 4S1SH 5I17A 2Q86A 2BW5A 3I3EA 4Y9EA 1N70A 2ED9A 3VD7A 1GOHA 4JM4H 2F53E 5K1NA 1CLYL 1QEWB 1AHMA 2ZNXA 4OFKA 2ZJSH 3DX6A 2VLJE 2ZX8A 5GRJH 1VDGA 1S46A 4HCGA 4F3FA 1N2RA 4V2CB 4WSGA 5HP5A 1I3VA 3HE7B 3IFOA 1O6VA 1CFNA 5FK9A 5CZKA 3WGVB 1OK0A 4YZWA 5F6IB 4LLVB 1ZT4B 4YWGL 5HHMD 4EVNB 4ZD3H 3OR6B 4K3DH 3ZN6A 2XN9B 2WUCL 2ZXQA 1QI5A 5CN1A 1WFNA 4HJ1A 4CC1A 4F8QA 3DYPA 1WFUA 3OLIA 4L5FE 4GRLA 4YGVB 4OD1H 1M57B 5FAAA 5I5IA 4NNXB 1FNGA 1QRNB 3P77A 2ZWZA 5E94B 3D87B 2OTUB 4LSQL 2WXKA 2Z7ZA 3NJJA 3RPKA 1NDMA 4PGCA 5CSZA 4M7JH 3V0GA 1TF4A 3E9UA 5DZPA 4PJFA 4DP7X 4AVHA 3GXMA 4N0UE 4GG6F 3MRFB 1TQBB 1IBZA 3L4ZA 3O8XA 4GQQA 3K8MA 3TZVC 2D7TH 4UNIA 3IDNA 3QORB 4RAUB 4GW1A 4DPRA 3FT2B 5LGHH 4DCQB 2BSTB 2QDVA 4JL2A 2AQTA 4E0RB 4FQLL 2ZX9A 3BP7A 1MKFA 1P2CA 4HXBL 3BZFB 2H32B 4LCWD 5DD5H 5C8JA 4NQXA 4FG4A 2H3NA 4JO1H 4JY5H 4M02A 2FEEI 3L3OC 1S9KC 1OM9A 2OQJB 5E6RB 4AM0B 3R1GL 4B3EA 2KLRA 1PS3A 1B6DA 2YD2A 1DE4A 3MBXH 2J5LB 4BZ1A 4AY0A 1E9OB 4GG6B 2EDYA 3LCYA 4PJDE 2OXGB 1G7HB 4CVWA 1CR9L 4GKSA 4PWJA 5CWSA 4G70B 1XEDA 4Z78B 1D2PA 3GSNA 2WPGA 4NEHB 5T3ZH 3WFBH 3GDBA 4DJMA 4Y4KD 4HCRH 5SX4H 5C92A 3GHEH 1MF2L 1MW0A 5JPMB 1CGVA 5B7EA 1NIBA 4I9XA 2JJUA 5T5NG 1TVHB 2FJSA 4HIHA 5D2NC 2V3DA 3V52L 1A7NH 2DM3A 3E1F1 1FFTB 3EADA 1E4HA 3BXNB 4QY8B 5JPNC 3ULUF 5IK3B 4ETYA 3OF6D 4ZDHB 1OB1A 1TYEB 3AB0C 4NLHA 5E23A 3MTRA 4TQEH 1KTBA 4K15A 3ABZA 4BQ9A 1RERA 3PJNA 2Y4SA 3IAGC 3WEAA 2RTTA 2WAQA 4FXKA 4JO3H 4NC1E 4H88L 4XPGL 4QRPB 4BRVA 3FB6A 1GMIA 2X2JA 3LKOA 1ZTXE 3R7RA 5KSAB 5C0RL 4WFED 4PJ8A 1ET8A 3BSGA 4MDIB 4ZFFB 2NTFB 1T3FA 1UKSA 1E4KC 4PREB 3SY6A 4W6XB 1DHKA 3C2SA 1P0SE 5EZPA 1KXTB 3HR6A 4G9FE 1TTGA 5A3IC 4A2FA 1E8YA 4HS8L 3RPIA 1JN6B 1Y6MR 3HBPA 4M5SA 3WY4A 4WF7A 2AJUH 4N8VG 5LVEA 4ETQB 4WW1B 1I7RA 5J9PB 3NAAH 4JPQA 2BW4A 4LLWA 4XC1L 4Q6IC 1QUPA 1IFGA 5DGQA 2VDMH 1KJ3H 3VXUB 2J12B 3DPDA 3OJDA 4N9GB 5HGBB 5E1GA 2DQUL 3RVVC 1DBML 3OL2A 4ZQTA 3DJRA 4R5VA 2XY2A 3CSFA 1BJ8A 1KIRB 4HIQA 2RH0A 3CH1B 2JQAA 1FLTX 1UZ8B 3VSVA 1JWUB 5K9OA 4HMDA 3OX8B 3SBRA 2DQHL 5FGRA 4XWOD 4DO4A 4H0IA 5TGBB 1TPXB 1CL7H 1ONQA 3VACA 2W0FA 1CFTB 3N44F 4Y19A 1Z0NA 3PGCB 4PGDB 5FLUA 1E27A 3KLKA 2YOAA 3B34A 3RWFA 3H85A 4K7FA 3M07A 1TQUA 5ETUB 4F9LC 5EZOH 3P4OB 1G7LA 2EH7L 2A6KB 4M3KB 3QIBB 4WWOA 2N3JA 1YSOA 3W0WA 4PG9A 4NS0A 5AVZB 1E3ZA 4I18B 3B2XA 1ZSDB 2X88A 1DR9A 3WJLC 5KVMC 4D2NA 1E65A 1SOSA 5HD8D 2W07B 4QLWA 2W94A 4N0RA 3C2AH 4RVBA 5I8OH 3PHQA 1ZLWK 1X5MA 4WJG3 3WMSA 4A2DA 4M61A 1BD2E 2LU3A 2XG4A 1VFMA 4X7DC 5DO2D 2WQWA 3N44B 5E9DE 3P3SA 2DZEA 2R9HD 3CK0L 4HUVB 1BREA 1C16B 1IAKB 2ZYRA 4WY7H 2CRMA 1GTNA 2XX0A 3TEXA 1BJMA 2VCOA 3V0EA 4HV8B 3N91A 1CT8A 3EO9H 3KYAA 3O4OB 2B5IC 3JV6B 2XWCA 2BSEA 3OHXA 3TN0A 3BUBA 2B0SL 2OULB 4NIYE 4EDWL 2EE3A 1VADA 1T21A 1SN5A 2WWKO 3R0NA 4NKMB 1DEEB 2PWHA 4AGQA 5IJCC 3K2UH 4A7SA 1YMHB 2FB4H 4P2RB 5EF2A 4FTDA 3DOHA 2MHAB 1JWMA 3POCA 1GGYA 4IBZA 3U1QA 4Y2DC 1KPRA 1QFPA 1AS6A 4FXLA 2H7WA 3AT0A 5F3HA 3VDCA 2QKSA 4HWNA 3O2VH 1XGUB 1IVTA 2NNCA 5IOKA 4FTVB 4EI5B 2WNWA 4HHWA 4JQVC 2J2ZB 3HC3L 4PWIA 3T77A 4AJVA 2YARA 3PJLA 5EIIG 3PDOA 3VD4A 1DN0B 3RPBA 1XH0A 4IGBB 4TVUA 3MGTB 2NY5C 1PJWA 5JW4N 1JXDA 4ATWA 3QZPA 2D7MA 3BRDA 4M62L 3DUUA 1UM6L 3T0WA 4DP6X 3CFEA 5TQ2L 1RUMH 2H1PH 4NO5B 5E6YA 2IV9A 3O6FB 5IB5B 4C8XA 1XGQB 3QXUA 4YZFE 5TF1L 1A66A 1CF1A 3UBXG 2AEQL 1IE4A 2E9WA 2FEDC 3QDMA 2VW4A 2CDEA 1G1YA 1OGTB 4NXKA 3STLB 3HI1B 5GGUB 4X6DA 2ITCB 3MBEC 4CW1B 1SY6H 4TNVK 1PPIA 1NDGB 1UH3A 2NZIA 1R5WA 2ESVB 4Q9CA 5JHAA 3T2OA 2CBPA 3OKKB 3QQ9C 4N0YL 3SQOL 5EULV 2IVFC 2PW1A 3GXNA 2EE2A 3D4CA 1TUPA 2O72A 2CO4A 5FUCE 3VCLA 1CGTA 2Y1VA 3VFRA 4ATTA 3LPGA 5HYSG 4RQQB 5CCGE 2YD8A 1JNNH 2VH5H 1TZHB 3D85A 1O6TA 2BSRB 1JPTL 3OZ9L 4I0KA 4J2QA 1NUNB 1XIWC 4XWGL 3H9SE 2VC2B 1KFAH 4UILH 5CZRA 2L0DA 5AB2A 2I69A 3T0EE 3WCYA 5ADPH 3VYNA 5JXAH 3D05A 3QUXA 4L29B 1YEFL 5I0VA 4MQ7B 4N2GA 5IESH 1FH5H 1KZYA 2ZXGA 3QH3A 3P9MA 3ZDZF 2QADB 1UB6B 5BMFL 1MH5B 3J27A 4LPXA 1AQKL 3AU1B 1YAIA 3ZLQC 1GL4B 3FOMB 1PEWA 3B7YA 1VZHA 2ZNWA 3L6FB 4QMEA 3RY4A 2FJGB 3JVGA 1A7QL 1RD6A 2ERJC 1TJHH 4LZKA 1I4FA 3PXLA 1VCBC 4C4BA 4Y4FC 2CIIA 2R2EB 4HZLA 3WS6C 2PUQT 1S5HA 1FN4B 1S9XB 2DQDL 3DURB 3FT3A 1RJYA 4OVUA 4B41A 2R8SL 3UZQB 1UD5A 2JQZA 4OZHE 2ZOOA 5HJDA 1W8OA 3L95B 5SV4A 4GQZA 4WJ5A 4I13B 2VXUH 1L7TL 5AG9A 2FR4A 2FJFB 3VA6A 3E0GA 5I76B 4BK8A 1KJVB 3ZDZB 3P30H 3QFJB 1DVZA 1IFRA 5LO7A 3ZT5A 3L5HA 2HX7A 3Q48A 1X5KA 3RGVA 3FF8A 4BCYA 3FTVA 5IB1A 3WKMH 3WV0A 2VNCA 1Z3RA 2NXZC 3BLPX 4P5KA 3VXOA 3QQXA 4OIIH 4MS6A 5FFGA 3CJJA 1ZCRA 3M1BA 2EDXA 4WI0A 5DUBB 1CVSC 3BMVA 2DQCH 4PV1C 3QUYC 1KTDB 2BOLA 3HG0A 4UI2A 4X50A 1R3KB 1DVFB 1URIA 3VTTA 4ZMNA 3K72A 4F2EA 3HG4A 5KYYB 2FEEL 3PG2A 4FEMA 4FMKA 5ACMA 4ZFOL 5G5DB 3HBZA 1UD4A 5AOIA 4XN7A 4AYGA 1LJMA 3B1TA 1L9RA 1P4IL 4L1DA 1CG9A 5ERWA 4KRPB 4A6YA 4BK5C 4TLTA 3WN5C 4G7RB 3GTNA 4K8RC 3UDWC 3NSFA 1S8DB 1PFCA 2NQDA 3UZVB 1N67A 4B53A 5TDPB 2CKBB 2FYYB 1WBXB 2WZ6A 3DHJA 3F3HA 5ANME 1HYRC 5D55A 2UY7A 3ULVL 1ZHLB 2HT3D 3BQUC 1U30A 2CDFA 2IDCA 1SZNA 5C0NC 1DZ0A 4KXZH 1FGVH 3S8GB 3N1PC 1G84A 3ZHKA 2EDHA 3REWA 4Y8AA 3U1SL 3ETTA 4ABWA 1OWWA 2BS71 5HHQA 3H9YA 2Y7LA 3WXWH 3CV5A 1U91A 2A73B 4PJBF 3T0BA 3II1A 2CBTA 4FQCL 4GLRH 1A9EB 1EK3A 1JGLL 2R15A 3GJFA 4NI6A 5LAXB 1HQ4B 4U6YB 5DQJB 3B3BA 5IOPA 1T04B 2DQEH 4G6KH 4N5UA 3DOSB 3GUTB 4PRBB 3MZTA 2AK4A 4NSKB 2AXJA 2CK0H 1LO3H 1R3JA 3L3HA 3M46A 4UUJA 4LLUB 5BVJA 2Q6WB 4JFYA 3KWTA 1CF8L 4JRXA 3CC5A 5I1GH 3D39B 4PRHD 4Z0XB 3EOYG 2FH6A 5FX3A 1OGPA 5LB1A 4YSDA 2GG1A 4KUZH 4OVVA 3HZVB 3GJEA 4XP1H 3DK2A 4PJBB 4WNQB 5IVZB 4JDEB 2DM2A 3GSVB 1H6EA 2K6ZA 2OMWB 4YXHH 2WC7A 4E68A 1YY8A 3MJ9H 4DK3A 2JMRA 2VWEC 4TQPA 4G3YH 4UQIM 3FT4B 2X4OA 5D7JB 3QRGH 4MJID 4FNSA 5B22A 2WLLA 3ULUD 4XNMB 3QNZA 3S88H 4YDJA 2NR6D 3CZLA 3U9UB 3O2DA 2OZNA 25C8L 2NY4B 2CO7B 5E51A 5LLIC 4I4WB 4JKWA 4LSUH 5F0LB 5F9JB 2GUYA 3A4DA 3CFQA 5ID0B 3S4SA 2YJQA 3MRCB 4X7FC 1IZKA 3F7PC 1ZHKA 4KDTC 2BVPB 5C0AA 1FFOA 1H8NA 4I7ZC 4PW4A 5GJSL 3WKPA 4UT9L 5D7LE 1K72A 5AW5B 4O02B 3NCYS 4WUUD 2OMZA 4ELMA 3Q3GA 3MLYL 3T2LA 3LQZB 4S2SA 4PSRA 4OI8A 4UAHA 3VRLF 1MELA 4U3SB 4RIRA 4PJEF 4HT1L 3WY1A 4RWHA 2EEBA 5C0FA 4KXDA 2G75B 1U8OB 4JFHE 4L4VA 2R69L 1M7UA 1PVHA 3IKKA 2X9ZA 4Y2OA 1YVLA 2D4FA 2NY6C 1BVLB 3PQYE 4HEPA 3ZKMC 3S34L 4UBDC 5JW5B 4K3JL 4LOUD 4Z77A 1O7VA 1RCYA 2CRZA 3VE0A 3VFWB 2JH2A 4TLSA 1LL1A 3KGRA 4YPJA 2NUPB 2AVFA 2QSQA 2CNZA 3ABKB 4ICXA 3GRGA 4XNZC 3GMMB 3DTXB 1PZ5A 2H9GA 4HFWB 3MLTB 4ZUTA 1HHJB 2F5AH 4LHUG 5KVEH 2W92A 5C09D 4ZSOA 1HH9A 4PJEB 1UWXK 1YEKH 4NZUL 3VFGH 1BBDH 4OF5A 2VLRD 1DQMH 5HHME 2O6DA 4H8QA 1ZLSH 2NY1D 3Q0HA 4LRIC 3G6JF 4N2OA 1CWVA 2ZXWB 3MNDA 2BCKB 2ZOLA 4OFYA 1FE8H 4TVPE 4WFGD 4XPHL 4YDNA 5FWQA 2VRQA 5MENB 2B77A 4WCYH 1BVKB 1JNHA 4MD0B 5AB1A 3QDGE 4NO2B 5T1MB 1G7QA 5HGGS 3KCPB 5C6TL 1LE9A 5TFSL 2HB0A 4HKZA 1DBJH 4J1UA 4KY1H 5DQ9B 1HNYA 4C56B 5DJ6A 4YSCA 1FH2A 3LPOA 4LSRH 1H3PL 5KAQG 5JHDA 2DL2A 3EJZC 3SDDA 3CVHL 2NY3C 3MRDA 5EF1A 4IOIA 2XBZA 1KWKA 1HEHC 1RJLB 1RY7B 4AQ1B 1DSFL 1TYRA 2YD5A 3QJOA 4GAJH 1P6FA 3IWVA