4AL8C

Structure of dengue virus diii in complex with fab 2h12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
SYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Immune system
molecule keywords ENVELOPE PROTEIN
total genus 13
structure length 98
sequence length 98
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4al8C00
1OANA 5IREA 4UTBA 3N40F 1SVBA 1Z3RA 2R69A 4GSXA 4FFYA 4UTCA 5LBSA 5AAMC 2JQMA 4GT0A 1UZGA 2I69A 4UT6A 5H37A 5GZNA 5KVGE 4ALAC 4AL8C 5IZ7A 5KVFE 1ZTXE 4L5FE 4X42A 2V33A 5B1CA 3N44F 5JHLA 3UYPB 3P54A 1OK8A 3UAJA 3UZQB 2ALAA 1RERA 2H0PA 4UTAA 2R29A 3UZEC 2JSFA 1S6NA 4BZ1A 2P5PA 3N43F 4FG0A 5LBVA 1OKEA 1Z66A 3J27A 5KVDE 3G7TA 5KVEE 4AM0Q 1PJWA 3MUUA 2JV6A 3N42F 5GZOA 4FFZA 3UZVA 4UT9A 1URZA 5LCVA 1TG8A 2GG1A 2HG0A 3C5XA 5AAWC 3WE1A 5JHMA 3N41F 3IRCA 3C6EA 4BZ2A 3VTTA 3J2PA
chains in the Genus database with same CATH superfamily
2PCFB 3PABA 5SWSB 2A4CA 4POZC 2A99A 5HDBE 3U0WL 2DWSA 3UC0H 3MJ7A 4APXB 1T4WA 1HXMB 1NFIB 3PWVA 5TK4A 3K2UH 3ILPB 4TULH 3DO3A 2M26A 2VQTA 2Z8SA 3C6LA 3W39B 2SEBA 1OP3H 5KSVB 2BVQB 5EULV 1S7XB 4JPKL 4BFJA 5BVPL 5I2IA 2YPVA 2J6EH 1AGFB 3X12A 2CO1A 4FI8A 5DZJA 3LB6D 3O4LD 3ECVA 4XB7A 3VXQB 4OVVA 4Z3IA 4V1DA 2VLKA 1WFJA 2O1AA 2PABA 5CSZA 4E5XB 3CUPA 1E4KA 1LDPH 4L4TB 1EHAA 1OZTG 4ZAKB 4QRPD 1EJ6A 1HT6A 1Q9OA 25C8H 4Y1SA 4HV8B 1CMOA 1A9BB 3KGTA 2EDWA 1OK0A 1L7IH 5D72L 3MXVL 4CC4C 3CAFA 4PJCA 4UINL 2I25N 5C7XL 1OB1B 3D85D 1QW9A 4UU9B 1FE8L 2QQKH 2BWQA 5D93C 4A6YH 1UB6A 3RWEB 4IRZL 4L1LA 2UYLB 1MELA 2X4PA 3ZL4H 1BJ1J 4E41A 2X9ZA 3FBQA 5FYKU 1ZHLA 2X42A 4PYHA 3V4PB 4A7GF 2X6VA 4NAQA 4F24A 1U9KA 2C9PA 2WWMC 4AT6B 5J6HB 3JWOL 5DURD 3HI1A 1IBFA 1OAZL 3GXUB 1AGCB 1WZ1L 3PRZA 4Z7UB 4MAUL 4X4XA 1G9HA 2Y06L 3GBDA 1AO7D 3VXUB 5GXBB 2VQ1B 1PQZA 1T2JA 2LU5A 2PPAA 4RESB 3VU1A 2KT6A 3FBKA 3RVTD 3CSPA 1AZRA 2VM9A 5T1LA 3ZLQC 3QAQA 2AW2A 5L4MA 4FGMA 2XBZA 4QXWA 4PRHE 1MW2A 3DYPA 3GHBL 3V6OE 2P42B 4X80H 3B7UX 3I6GA 4MDJA 3HG4A 4NO3A 4LCYB 4NRYA 5DUML 4F2FA 5ACZB 3F05A 3NT0A 4G80A 1X5MA 4KK8C 1OTUD 3O8XA 4LLDB 5JHLH 1QR1B 5I1KH 1V7NL 3AQXA 1I3VA 4F7CA 2CXKA 3PDGA 1EK3A 2OW6A 3CDFA 3FT2A 4EUPH 2IH3A 3QJFA 3PLYA 1MI5B 4ZTPL 4JPKH 5AAWC 1PTZA 5DVLA 3U9PH 5I6OA 3QQ9D 2XWRA 4P46C 3MV8A 5CBAB 2Z8WC 2XXFA 4GW5B 1R46A 1Q9OB 1JF6A 4PHXA 2DDQH 3DGGA 1GS6X 2CXGA 2MHAB 5EU6E 1JZ2A 3ESOA 2WUCH 1AKPA 3WNOA 4HKZB 5I5IA 2FD6H 3NGBB 4EI5C 2OMTB 5LDSA 3BAEH 4JPIB 3V7MA 5KS9F 1IQDB 4PJXE 3PS6A 2F5BH 3AWFA 3C60B 4XCEB 5FFGA 1DJSA 4PGBB 3Q01A 4X7CC 5JPNA 3GKWL 3FT3B 3RQ3A 1NCAH 4GH7B 2UX6A 1BZ9A 2PYEE 4JUTA 1HWWA 2OCFD 5CS7A 4JPVL 1EBPA 5CEZD 5ISZD 3EOTH 4ORZC 2IOMA 5BW7A 1JYXA 2EH7L 3C5ZC 3POHA 4J2QA 4PJAE 4WFHE 3SPCA 4Z78A 2W88A 3DOHA 3IDIA 2AK1H 2ALAA 3NCYS 5F1NB 4FTVE 2AZUA 1E42A 2C3XA 4X4MA 2LTQC 3SQBA 2MCPH 2YARA 2P44B 3AB0C 4MQXD 1PAMA 4HH9A 3WIFB 1ED3B 4NOBA 3KLAA 1S9YA 3G5VB 1UB6B 4KZDH 1G7HB 2W07A 3HB3D 4HC1L 4XP1L 1YVLA 1OB1A 5C07D 3QCUL 4HIEB 3U4AA 4KU1A 4YK4B 5C0CA 3LKSA 2OMNA 3MJ6A 1UYWH 3DX8B 1OK8A 1G0DA 5IBUG 3EZ8A 3HI5L 4X9YA 4LLYB 2BIPA 1UXSA 3ZTDC 4IHOA 4P5TA 1A0QH 3ARQA 5F8QC 3P4MB 1KXTA 4JFFB 5B22A 5G55A 4OAWB 3LVEA 1KTRL 4MDJB 4NO3B 2YKLL 2XBTA 4NRYB 1E7UA 4K3GA 2PTUA 4XODA 3AG2B 4XHJC 3LYRA 3OJ2C 3KLQA 3F7YA 4GUQA 4M02A 4RVBA 3SKJL 5DQ9A 4TLKA 4O02H 3BAWA 2P5WA 1R6VA 3OZ9H 1R5VB 1F13A 2FWUA 4J6RL 5BQDA 3U6RA 5TH2A 4K94H 2MMXA 2P7TB 4XOBA 1U3ZA 2R2CA 2YD2A 3ULUC 4AKQA 2BNRD 3CSYB 3GLAA 1EO8L 1NCGA 3BMVA 4YXKL 4XC3L 4OGQC 4A2DA 1UADC 4GAAA 4JQIH 2XZCH 3EH3B 3TJEH 3WUZA 2VZVA 1GJIA 1KJ2L 3LXCA 5JLZB 2XQYG 3ILEA 3DVNA 3WTTA 3VFTB 3GSWA 3Q0HA 3U7YL 3N9GH 1U8NA 3QXDA 3R19A 4NZDA 4C58B 5SWSE 3V0VA 3DV6B 4PRHA 3WTXA 4Z0XA 1FV1B 1U3YA 4X7DC 3V6OA 1CTMA 3W0WB 4L3EE 3CFTA 1DHKA 2JVUA 3BQUD 5FUOH 5J3HC 1F4AA 1DCLA 1J5DA 1FHNA 5E6IA 3FRPA 3L3GB 4QRPB 3X13B 3VXTA 4ABUA 1AD9B 4OFDA 1DDHB 3L8QA 5KVMC 5LQBH 3RE0A 4XCYA 2CDGB 3WOVA 1VCAA 4HJSA 1BD2D 1KJVA 4NN6B 2H3XC 4H25B 1X6LA 4JJ5A 1F3DH 3T3PB 3DO7A 2DQJH 3Q5OA 3FUEA 2HJFA 4JFQB 3QT2A 3QCUH 4KUCD 4ZRGA 2ILLA 4NDMA 4L4TE 5HI3D 5FF6A 3AG3B 5FOJA 1R24B 3MRMB 2XXMB 1JYWA 5KSVA 4G7RB 4NQDB 5MP6L 5A6IA 4YDMA 3M1BB 5FKPB 2QEJA 1J8HE 1IC5L 4PGEB 3VA6A 2NTSP 3BT2H 1O7VA 3I02A 4LHQB 1B3JA 4YE4H 3ZDXE 1QLEL 1W72H 4KK6D 5E7FA 3X1EA 5I23A 1X7SA 2IXQB 3MRGB 4GAGH 3EO0A 3KG5A 1QRKA 4DN3H 5J1SC 2PCPB 2QPDB 4I89A 2F1AA 3RGVA 3BH4A 2JB6A 3TX4A 2WKGA 3L1OH 5DJZA 3AMLA 3RJQB 1YAZA 3KHQA 2J1ZA 3LPWA 3TM6A 3ZE2F 3FO2A 4JM2D 3LEXA 1NCDL 4GO9A 3V10A 1E27B 5G5DB 2DN7A 5DK3A 3BZ4B 4PJAA 4BSJA 5EIIB 3CX5K 3GINA 4JPSA 1DEDA 4WRLA 1E30A 3TBYA 2DQHL 3KNBB 2IPKB 4PD4J 5B1JC 2EIBA 2A2QT 1SNRA 4WIQA 2D3NA 5DHVA 2DIAA 1A2YB 1DBAL 4KQ4H 2VDNB 3FTGA 5HJ3A 3JTBA 1NC2B 1ITBB 1ETB1 1YCSA 1UQSB 4XPGL 1P4IL 3UZEC 1Z7JA 3L2NA 3U7YH 5DHMC 3CV5A 4IS6B 5GS0H 1ZLWH 1MWAH 4QUOA 1S9KC 1AQKL 4P46B 2IAND 1I8IB 4PMEA 5AW6B 2BVOB 2QSCL 4GP4B 4PRIB 5TE7L 3WE1A 3RFZC 5FA3B 3ETBJ 3MJ8A 5SWZB 1ZPUA 2NCEA 1E2VA 3Q8CA 1NAMH 1DBJH 4Z7VF 2YGNA 4P2YA 3IVKA 5DWUL 3MRDA 3MV7A 4RSVA 5IOKA 4LHUD 1X6NA 1KTLB 2K4WA 5LKNA 5DJCB 1P84K 2R9HD 5EA0L 7FABH 4YL9A 43CAA 5JW4R 1NCOA 4U1HA 2R1WA 1D2OA 4JRLA 3REWA 1E5YA 2WVSA 3SDDD 4BDVB 2UVFA 2WQSA 2QGBA 3NG5A 1F4WH 2IAMC 1AC0A 3ME0B 4LCUB 3MODL 3D39D 4WO4D 5IB3A 3QIBD 4PJCE 5ESVA 5TDNA 3VFPA 1XCTA 1OAUH 4WW1A 4NN5C 5CUSL 4NZTH 2KYIA 3VFNB 1QLFB 1EA9C 1S7VB 5JHBA 3MLXL 3OKNA 1MH5B 1N3NA 4DCQA 4F5CA 3OC5A 2O5YH 4FNTA 1YMMA 3GHEH 3GJFA 4YBLB 1YUHA 2FX7L 2IC2A 5IMLA 3H53A 1T3FB 2ZOKA 4M5ZH 5ICZA 4NQQA 3HHRB 5I1HL 4N0UE 2DQCH 3OTTA 4ZK8A 3SGDI 4JDVB 4HHWA 5IR1B 3GDBA 2FJGA 1MKFA 1XR9A 2QQNH 1HYRC 1DBMH 1V05A 3C8KA 5KYUA 2XVLA 3HMWH 1F2QA 4PVBA 3OPZH 1FFPA 4FZEH 5SWQB 5GGQH 2ZJSH 3CMGA 5CLXA 4E0RA 2WBJD 1CYXA 4Z7WF 3K1KC 5A3IC 5DHYA 3DGCR 4ZTOL 1S2EA 2YPLE 1YN6B 5GGVY 4RFNB 4XXCC 2XDHA 1AQ8A 3IKCB 5FHAH 3R0MA 4G9FB 4ENZA 4OZFH 4K3JL 4LLUB 4MA1C 4MJ4A 1GKEA 4ZD3L 5HVGB 1KFGA 3NIGB 1ZLSL 1LO3L 5DVMA 4A2GA 5E8PA 1L7TL 2O5XH 3RWHB 3EFOB 3C6LC 3NJFA 1QSFB 3QFGA 1OP3K 1WC7B 5E9NA 1HTYA 3ZKNC 3CPLA 2J73A 3FUJA 3D34A 3P2DA 2YC1A 5E9DD 3FMGL 2NY3D 5DWUH 4A68A 1T0MB 1ZSHA 4CSZA 1HFUA 3GNML 2W81C 4Y1AD 2X6CA 4GSUA 2E5EA 1KPUA 1GXEA 4TLTA 4JY4B 3QI9A 3IFOB 5C0ND 4AMWA 4F9PA 1WBXA 4RWHA 2D31B 1H9VA 2WVVA 1N5YH 1OL0A 3L17A 2HT4D 2DBLL 4ZUTA 43CAB 4HF5L 4PRDA 5D6CB 1ZLVK 3E0GA 3H0TA 2NLJA 2I7OA 3IBOA 5KVDL 2ZWLT 3HAEA 1FFOB 5IROC 4G6FD 4OCWH 3W3BA 3MXWL 1M7IA 5AYUH 3TWCL 1WFTA 2W9EH 1V10A 4WI6A 1NCHA 2FQEA 3E8VA 4NAMA 5D5MF 1O6VA 5E6IB 4DZ8B 3FQWB 1IBGL 3DA0A 4Y2DD 1M7DB 4DK5A 1VDGA 2A77L 3E6FB 3VQ1C 2J1KA 1HQ4B 3DRTA 3MJ9L 1EANA 2FQFA 5DYOA 4EI0A 1G7IB 4L8DB 1A7OH 1BZOA 5CNHA 2D7OA 4JHZA 3WXWL 4PJGA 5FDYA 2JK5A 1PG7X 3DVIA 3GMPB 4Y4FA 4OLYH 2XNAB 4A7GA 1UASA 4P8QA 3I75B 1FNAA 1CLZL 1U93A 2ORBL 4YWGH 1WCBB 1HS6A 5BO1H 4P2OC 1OP5K 1T7VA 1S7WA 3LXAA 4ZXBD 3T8XA 3FONA 5AVUB 1G7PA 4R4FH 2NYZA 4TNFA 3HC4H 3UGXA 4K3JH 1G7LB 4JDEA 4QI3A 1ZLSH 3VD3A 2YKKA 5EU3B 3TT1H 5I0ZA 1CURA 1EAQA 5IKCB 2VXQL 4OZIA 1L7TH 2O5XL 3H9HB 4X7FC 4MNQB 5C3LD 3KGSA 2R8SL 4EIZC 3MRJA 4NI6A 5KVFH 1QZ1A 2GSIA 5HHQA 1MY5A 3CDZB 3DUUB 4Z7IA 1JZ6A 5J6GB 1RJLA 3IFOA 2O5ZL 1SLUA 4KH2A 4PVLA 4XMLH 1KBKA 1O6TA 3L5HA 4PRHD 2XN9B 4KXCA 2DQGH 5FUZL 5GS1C 2R2EA 2WANA 4HXAL 2ICES 3WUWB 4NP4H 4LGPB 2FBJH 1PGRB 3OMNB 5GS0C 2YGPA 4MLIA 3CFDA 2XWCA 2VSCA 2Y4SA 2CHWA 5EEXA 4GRMA 3FOLA 5E8PB 1D7DA 4HEME 4HIHA 1SQ2N 3DI2B 2J44A 1W6LA 1U3HC 4P57A 4WEBL 5TGBA 4PJ9B 2X5PA 1G4MA 4PP1C 4X0NA 4FD0A 1YNKL 1L9RA 2ADYA 1JWUB 3G08B 2AJSH 3QUML 3QIWD 4UOQA 2OL3L 5AYUL 4YHKL 1IT9H 3UIZA 4HOZA 3DKHA 4V1DD 3PAZA 2ZKHL 4JDTH 4N3TA 1CG9B 3S6CA 5DRNB 4F93B 4LOUD 4TVPL 3LRSB 3BUPA 4K9EH 1NSNL 2ZX6A 4W9JC 25C8L 4AYID 1AR1C 1IBGH 2ZG2A 2ATPA 4QNPF 4E9RA 1EJOH 4NHCH 3VRLF 4N2BA 4LPTA 2YRLA 3GBLA 3NJLA 4ZMVA 3NSFA 1OT1A 4C56B 1RUAH 2V8MA 2FGWH 4I48A 4ODSH 4QTFA 1YNTF 4JGJA 2Q2LA 1SLXA 5EFIB 4FQQA 3A0OA 3BT0A 4YHPB 4CVXA 4Q14A 5AW9B 1TFPA 5DI8B 2Y1YA 3FU7B 2WLHA 4GG6E 2Q86B 2R39A 2V2XA 3QNFA 1N3NB 1I7RA 2N56A 1TEYA 1T2QL 1HXYA 4L1TA 5IF0A 3HCVB 3QDJD 1N6QH 2QT6A 4OZFG 4X0KA 3IT8D 4ZX6A 5L6YH 1MLCB 1FO0A 4A55A 2UVEA 3MREA 3LRSA 2K1MA 3D0LB 4DP8X 3ULVE 3T3ME 3FSOA 5F7LB 1ECYA 4TVPD 3AROA 1XT5A 2QVKA 2X12A 4MZ2A 1OP5H 3VRJB 1MFEH 4JZJB 4A37A 5HYJD 1M42A 4GXVL 2QQLH 5DUPH 4X80L 4BSWB 4H0IA 4KK5D 5TQ2L 3RLSA 4ZMOA 2HFTA 2X4NA 1WF5A 1IBBA 4IU2B 2PO6A 2WKOF 3CZJA 1MEXL 1NLDL 4HUWB 5D5MB 5JW4Q 4ZODA 4OM0H 4E9WA 3W5MA 4TUKH 3LRHA 4OCSL 5MEND 2VR3A 4AV0A 1I8LA 4OZHA 2GT9A 3AM8C 3ZYOA 1AXIB 3PP3H 5EO9A 3EW3B 1IGJA 1UOWA 5BS0E 1U42A 4ZTPH 2C7UB 3B2VL 3H9SA 2AGJH 4YUEH 4PRPA 1OCWH 5F6IB 1RSFA 2YGQA 1SXZA 3QA3B 1F00I 3TCLB 3FRUB 4ZXBC 1NC4B 1S3KH 3LQAL 3CDGB 1NCBL 2JLLA 4HDIB 1T80A 1WIOA 3VI4E 2VRKA 1UB5B 4YQXH 4R97C 5FO9A 3CPUA 1ZAGA 5A2LH 4GAYA 3FB5A 1HEJC 3F64A 3B3IA 5JR1L 4LCWD 3G04B 3F58H 2FT7A 2Y2TA 2R0LH 3HC0A 1NMCB 5GSVA 2MCMA 1BQLL 3H9ZA 4DKEH 1O9WA 3V0VB 3E1ZA 4RISH 2NPLX 1BLNB 2ZTBA 4G5AA 4JG1H 1R3IH 5FUCC 5IB1A 3RA7L 4GB9A 4F37K 3BXNB 2VLRE 1JGDA 2QMJA 4MRBA 1ZTXE 4ZNEE 1LQBC 3RWGB 2EIJB 3HKZA 1NFAA 4CVWA 4E41B 1S7TB 4LK4A 3TO4B 3OAUH 1NUFA 2XOTA 5T3ZL 2GBUA 4G11A 4Y7OC 2MRYA 5DS2A 2UWEA 1GSKA 1WWWX 1REIA 2AK1L 2N01B 1YEEL 3AXLA 1QQDA 2UXVA 2R23B 3UBXB 5IHWA 1FQ9C 1TG8A 2G60L 3AB0B 4HJUA 3VA2C 3VFSB 1E9OB 2BWDA 1BZQK 3ASNB 1ZPLA 3LPGA 2EIEA 1FG2A 2OX5A 1EVUA 1P9MC 1U0QA 2R69H 5IVXA 4JE4B 5IUSA 4AVJA 3A4FA 2YD3A 4UQDA 5GRUL 4CNIB 4U1IB 1DO6A 4G7VL 4PG2A 4ZPTB 5FYKH 2RAMA 4H25A 5D7IA 3VFUB 3C5ZB 2AV7B 2Q7YA 43C9B 2AHIA 3HI5H 1XIWB 2XFXB 5D4JA 2X28A 4NZ8A 2GIYA 3W9DA 5C9JA 2EIMB 4JKWA 3II2A 3S5ZA 2PWDA 4N2EA 1ZK9A 1KIPA 3H4HA 4NO2A 4RGNC 2AJUH 3TN0B 5FYJH 1CYWA 4B9JA 3GJFH 2CHDA 4QO1B 2NSMA 5EU3A 5CSBA 1XTLA 1Q9KB 2HWZH 2VL5A 3OVUB 4KOCA 1ITCA 2HTKC 3NJGA 3QFJE 1Z2KA 1VFAB 3EH1A 4JY4A 3VU2A 1WAAA 3QEGH 4PJEF 1MW3A 3DNKA 3QIBA 1VRSA 2ZUUA 3NCFB 3QJVB 4S1DD 4BWTA 1YYLL 3TIEA 3BGMA 3VGHA 2X6MA 5LDUA 1ILSA 3MMEB 5E99L 4YSQA 2W0PA 4PJ7B 3IRCA 4B41A 5TJWK 1QBML 2VN7A 4JBSA 5FGBC 1JV5A 2BO0A 4P06A 2R0LL 2WJ7A 3FU0A 1F11B 2FJHA 3JVGA 3LKPA 4ZS7H 1MDAA 3WTUA 4JN1L 4NGHH 1ZHKA 4NQXB 3DTDA 3MACH 3UOAB 2XN9E 3FT1A 1ADQL 4WK4B 4HUXB 1W0WA 1KB9K 5F72S 1RUQL 3QO0B 4R7VA 2M83A 1G1KA 1P84J 3CC1A 3P3TA 3VD5A 3EZJB 3KPTA 4FP8L 1RPKA 1P5UA 1AQDB 2FTAA 5I1CL 2Z91A 4HHGA 2NW2A 3KYOB 5D71H 1JV2A 4N9OB 3K8MA 3EOBB 5CCKL 1PNCA 5DVOA 5BRZD 5EBWA 1N59B 5I2IB 5KYYA 1L3WA 4FQJL 2HVJB 4YO0B 2EIZB 2R69L 1P4LA 1F56A 5KEZA 3Q6GL 3H85A 1K8DB 3NIDF 4WFGE 2FZ3A 1KELH 5DR5L 3VXRA 2R29A 4E9QA 5B39A 5I1AB 5IMLB 1R5IB 2VXUH 3VGBA 1D3CA 2CIIB 3ZHDA 4TTDD 1HEZA 4QXGL 4HFWA 1AGBA 1E5AA 3B2UC 2GJZB 2OPCA 3ALPA 1WFMA 1A7RH 4MD0A 3FFCA 2YPLA 2H6UA 4R96A 1JTPA 1IIKA 3WN5A 4IK6A 4Y9EA 1IKFL 3ULAB 5E5MB 5C0BA 7TAAA 5AEAA 4Z78B 5HHMB 3VWJC 1G84A 4XNMA 3TBWB 3WENA 1AJ7H 4OCLC 1EO8H 4LVHC 1XSIA 1WIPA 4MJ5B 1LL1A 2OMUA 3WJLA 4QHLA 5CCHE 1MI5D 1T89C 3VG9C 5BJTB 3ZMNA 1KLFA 2ID5A 5BS0A 3SSGA 5HYEA 3FB7A 2YK1L 4E9YA 2ZT9C 4P49A 4XCFL 5JMRA 2WXHA 3JV6A 2G2PA 3CE1A 4XVOA 4JCWA 3TEWA 1MCBA 3HG5A 2F53E 3T5WA 5B7MA 4ALAH 4OJFH 1N0LB 5IMKB 1ZD6A 1KEGL 1AKJB 2Z9TA 3QH3B 4LIQL 4P9HL 3SCMC 3V6ZA 3EJRA 4HJIA 4EJ1C 5IUCA 3CXFA 3IGUA 3B9VA 4I18C 1NIFA 4PS4L 3FQ1A 4Y2OA 4DESA 3KPOA 4ELME 4NP9A 3L9BA 3TPUB 2W91A 1U8IA 3MOBL 1ZLUH 4TS6A 5GS2D 1SEBB 5AKVA 2MNUA 4M7JL 4HVBA 2KLTA 4I3SL 4J2XA 4EOWL 5I1CH 2OR9L 3SJVE 2NY1D 1A3LL 3U30C 2H9GB 3T0EB 3NCJL 3CZUB 2VWEC 4EN3B 5EF3A 4R97B 4FERA 3PWJB 1F6AB 2YD5A 3QR1A 2BNUB 3K72B 1DBJL 4PJ8A 3AREB 3G6JE 5DK0A 1ZHNB 4PSRA 5DK2B 5H37H 2N1KA 1P7KB 1U8CB 2CO2A 3LEXB 3Q6GH 5LAXA 1QSFA 3FCGA 2F7IA 3RKDD 4BINA 3VSTA 4OLWL 5FFLA 4W9EC 3OKOB 4AG4H 4ZUUB 4B9ZA 3WIIL 1FL6A 2Q0ZX 2VLJE 2ZCHH 4BWUA 4QHMB 2L7UA 4BGLA 3OM3B 1UA6H 2ENPA 3O6KH 3P9WB 1PIGA 3RPIB 4CDGC 4MMZA 3ORJA 4MQSB 3MODH 3U25A 4ZFFA 3VYPA 2XV3A 3E3QE 5AVVB 3WFEH 3BCFA 2EILB 3FHQA 3NZHL 1KGIA 1UEMA 5H2BA 2Y3NA 3MRRB 4FFYH 1BD2E 1P4BH 4MZRA 4FQ2L 1K8IB 4PJIB 4EUPB 4AEHL 5D2NE 1CLYH 4XPBH 1WH0A 1V54B 1KTDB 4JFFD 3FUMA 4QCIA 5BXFA 2X40A 4AVKA 1SBSL 4JVPA 5FCUL 3D39A 1IGFL 2DKUA 2EKSB 2ITDA 3RNKA 3RRQA 1CFTB 3VD1A 1CL7L 1DN0A 1H0DB 3QZPA 4D0BB 1T4KA 1BVKA 4X5WB 4XNYL 4JS7A 4Z18A 4DKTA 4NUPA 1LK2A 1K4DB 5AW7B 3P0GB 1A6ZB 2MQ3A 4QAMB 4X9GA 1BBJB 4H0GA 1I1AD 4LCVA 1I82A 4V2BA 3HG2A 3WNPA 5I18H 1WZKA 5C0AE 1IFHH 3SGKC 4K94L 3OJMB 5L4FA 4MJ2A 4KX9A 4URKA 2NNRA 1NICA 4M8QA 3ME0A 1M1XA 5C0CE 1EEUA 4ABQA 4JFEB 5T1DL 3SKMA 1HNGA 4M1DH 4UB0L 2UY6A 4WWNA 1JZ3A 4BEIA 4XN1A 1TMCB 2BMKA 3OGCA 2GPZA 3O6FD 4DP6X 4ZBJA 2EDOA 4NWUL 5EZIH 5F7MC 1JHKL 3DJSA 2WV3A 3CDZA 3DUUA 2E46A 4KO9A 1T7YA 4XC1H 2RQEA 4CJ0A 3SE9L 2VDQB 2UX7A 2DEYX 4F7TA 4IOFD 1XSOA 5KBNC 4P46D 1PZUB 2IANB 5FKAA 5JMOC 3KPRD 2ARJQ 4FG6C 1EX0A 1N8ZB 3FU5A 2Y36L 2PO6D 3K0YA 5KBLA 2IJ0C 3RGBA 3WFEL 1WP6A 2AI0L 2PPFA 5GIRB 1X3DA 4LHUB 3PWNB 1VADB 5HGAA 3BWUF 3OKNB 4GEIA 2O4EA 3FAWA 3HS0A 3IJYB 4OKVA 4Z6AT 1QFOA 2WN3A 1TZHA 1FV1A 3OPZL 3MRQB 5F7WC 2YAMA 4GT7A 4JFSA 4O02B 5ID0A 3DVNB 3KBEA 5KZCD 5JOPD 1OSEA 7CGTA 3RURA 2ODIA 3DX6B 4M6OH 2B4CC 4P04A 5I17A 3NRPA 5C0FA 1R47A 4B0MM 5D2NA 2ED9A 3S3PA 5EPMB 1UKSA 4PJ6A 1AGBB 1LO3H 2HVBA 4PJHB 3WXWH 1QSZA 2OM5A 4J3BA 5I18L 2BPBA 5I28A 2H45A 2NYYC 3MPCA 4E9LA 5AENA 3S0PA 1F0LA 5B4MD 4LVOC 1FLTX 1UM6L 5DFAA 3FL7A 5FYJD 3WGUB 1J48A 4EKXA 2KQMA 4NCC2 4WJKB 3JWNE 3FTXA 3G5YB 2E7DA 3L3JA 2ZYSA 5GJSH 4M1DL 3IPBA 2UUDK 3HI6L 5HDOA 1TVHB 4Z5RB 3UZEA 1YPZA 5FGBA 2BSRB 1IC7L 2IWKA 3RWFA 1BP3B 3GI8L 3LPOA 1U8PA 2XTJD 2XV0A 3HZYB 1T0NA 2AEPL 2J1YA 3D85A 1YYMH 1A65A 5IFAH 4OQTH 2KC0A 2E86A 2RQ8A 4N90E 5E95B 1TTBA 3VXPA 2AQQA 2XACC 3IAGC 1WC7A 1CLOL 1T0PB 1TQCB 3LKQB 4MXWH 1A25A 2Q3XA 1CGUA 3SYQA 4OCWL 4RMSA 5C09E 4HMDA 5M95B 2NY2D 2J3SA 1KENL 1YEDB 2OTWB 3FT2B 5JIKA 2WUBH 4YDIL 4X8CA 3A67H 2KI6A 4AW4A 5ENWB 2WNWA 4HH9B 2WXIA 3WIFA 3U1QA 2ZYRA 5H35B 4UM9A 1W91A 2FX9L 3NPSB 1DQIA 3TEUA 3VXOB 3MRFB 2MWCA 1BCIA 2H26A 3BXNA 1JGVH 3KM2A 3MJ9H 3N91A 4LB8A 5LG1A 1G1CA 1CVRA 3NZUA 2Y7OA 1B88A 3JWDC 3MLTB 2AXFA 4HG4J 3L2MA 2NTFA 1XH0A 4HS8H 5I6KA 1Z66A 4AYSA 3ARBC 5J12B 4FTDA 2AEIT 5DZOA 1WISA 5FO9B 2HRGA 2AAAA 2PPDA 4ZUUA 2OW7A 2N4IA 4M6OL 5FYLD 1ZOXA 4MNGA 4CN4A 4WSGA 3BPNB 3QZLA 1R19A 1K72A 1RH8A 3CFJA 3ARBB 2UY7A 5E5RB 2EE6A 1XEUA 2VDLH 4HKBB 3HE7C 1ZLUK 4QHNB 2QQNL 1M57B 1ND0A 4FNQA 2KPNA 2VLJB 2R8SH 1MJUL 1DBML 1GYVA 1IAIM 3K6FA 4O00A 3VM5A 1A6WL 2KERA 4I77L 4DVRL 4QRTA 4XO8A 1J1XL 5DGRA 3ARSA 4H8PA 4GIOA 2DLGA 4B9KC 2PWGA 3MQIA 4JANB 3CLFL 1T7XA 2ENSA 2FIKB 2VUKA 1ANUA 2HMID 4U0RC 3P9MB 3WO4B 3DOSB 4QTHB 2H1PH 4P2QE 3KD4A 1II4E 1BD2B 2ARJA 4PBDA 1BM7A 4QLWA 3MV9D 4R7DA 5DQDH 2JI1A 2F58H 3N04A 4LPXA 5DD5L 1KCLA 3IDXH 4PJXF 1JYVA 4WCYH 5K69A 3CXDH 4GSDL 5TQ0L 2PXYA 4YHMH 4PJ5D 5D1ZI 4NQDD 1A4JA 5EO0A 4WEBH 3AXHA 4MQ7A 5ISZE 1USQA 5C9KA 1HILA 3MV9A 5EG6C 3BDBA 2BCKA 5JHDD 1NEUA 1N18A 1ETJA 1WE5A 4WKXA 4PEEA 3AQZA 3OAZH 5B8CA 4JM4L 3F12B 1E67A 1IAIH 4LSPH 2QVMA 3UTSA 1XZWA 2X89D 3WL9A 3OZLA 2CKBB 4GBXC 3FAXA 5DJYB 4NUJB 1MAML 1U3HD 1OCWL 1CZ8H 3MX0B 4KTEL 4Z77B 3W11C 4RAHA 3U4EB 1N64H 4HF5H 1NCAL 3QG6A 4JEGB 1L0PA 3EYUH 3VNYA 4OI9A 5F7HA 2G3XA 4HD5A 3L3OC 1BAFL 1NCWH 1TJIL 3GXNA 3BAJA 3Q2LA 3IGLA 4LCCC 2DAVA 4L3CB 1YEKH 3KWUA 1CVSC 3KPRB 3CQFA 1H9DA 2YGVA 3O6LL 1ZT1A 4XWGL 2KS0A 3RZCC 4L37A 4BK4A 1INEL 4G43B 1F90H 2PO6B 3SDDC 5I1LB 1PZCA 3E9TA 4IGBD 4FRWA 4A6YA 1L9QA 1P9MA 5LWYL 5GGSA 1A22B 1HINH 2FQDA 3A6OA 3JT2A 3D4YA 4QRTB 4RCAA 4BFIA 3L5XH 4BA0A 3NQKA 1HL4A 4MXVF 2E6QA 4U3SB 5EORL 3LZNA 2CUIA 3OL2A 4QKTA 4DGVL 3VW3H 3IAPA 3V0DA 3OLIA 1NFDB 5LB1A 3ULSB 1EXUA 3VWJD 1A02N 1ZA6A 4IOIA 4OIBA 3DTXA 5KJ7E 4RGNB 1ET8A 2JLPA 4DJMA 2JE8A 5IHLB 4NZFA 2GTWB 3O45B 5CLYA 2CKNA 3T0XA 4LDEB 2WK2A 1DVFB 2GB2A 2NT0A 4N85A 1R24A 5ESAB 1AXTH 2CBTA 1O7DC 2ZNXA 2NZ9C 3GXDA 1RZKH 2W38A 5DLLA 3QUXA 4U1GC 5KVGE 4PRIE 3ILPA 4FKHA 1L9TA 1WUZA 2Z1PA 3P77B 1HNYA 2KUTA 2C9XA 4LLVB 3VXNA 4S1DC 1CF1A 3LKNA 2B15A 4FKEA 4OFIA 1TTAA 2H5UA 1PDKA 1YUKB 1CICC 3FUNA 4RMWA 2P48B 3ZE0E 3TBVB 3KS0J 1JF1A 3ARUA 2MEJB 1JK8B 2AGJL 4YUEL 1NCIA 5AUMA 4ZUWA 2ZXBA 1VEPA 3BD4A 4HIXL 5KVFL 1E7VA 2WGXA 3RL2A 3RNQB 1IU1A 1E9PB 3BPLC 3OZ9L 4N6RA 4IOSA 4WV1A 2FYYB 1U8HB 2XWXA 3NACH 4C47A 1F4XL 1HEZB 1U8JB 3SQRA 2XZZA 1W16A 1ID2A 3DOSA 1OGSA 2YZ8A 4PJCB 1YN7A 5F7KC 4EE2A 3GXTA 3MRHA 4N24A 3INUL 3VJ6B 4XMVA 5K9KB 1BVLA 1QO3B 2OXGB 4NQTA 4ZZKA 4EIBA 2YMTA 5LBSL 4E5XA 1ZLWK 5AYTA 2WLZA 1E2WA 4ZDHB 4DKFH 3UTSE 3O6LH 3ZTJG 4X6FA 5C0NC 5IFHL 3BVNA 3ESMA 3M88A 2W95A 4FQHB 3S4SB 4NM4L 4PI0A 3VG0H 5FUOL 3S3CB 2GAZA 4MD4B 3SDCB 4D9QD 5ICYA 5E08L 1LEKA 2APSA 1RURL 2AABL 2DL2A 3TBTA 4A7SA 3VI3E 3X14B 3L6FB 3LNFA 2AJZB 3B9DA 2CK2A 2Q86A 5J11B 3F7KA 1OCZB 1KXTB 2VRAA 3G6AB 2UUDH 5GGRA 1RJLB 3A4DA 3VFRA 5F0PB 1A9EA 4NCC1 5FWQA 2WOYA 4KKPA 1JYNA 3MLYH 5K39A 2H26B 1CC3A 2WVTA 3MRJB 4K8RH 1ET7A 4JN2A 2CJUH 1OSYA 5E8DL 2V5YA 1EFQA 5CZVH 5DEJA 4IBLT 1KC5L 3ECBA 2X4PB 3SKOA 2AQ3A 4CMMA 3NIGE 2ATPB 3Q7JA 4KMTL 4EAEA 4XVJL 3ASOB 1M6OA 1T1WA 2XQ0A 1YLBB 3D50A 2K8MA 5HPMB 4ODTH 1RK0B 1B2WL 2E4FA 4YSSA 4AM0Q 3K6SA 2XN1A 3VWJA 2WTOA 4ODXA 2VN5A 4NKIH 1UA7A 4TTDC 2ZUSA 3I3EA 3BVXA 3UYPA 1I7UB 3L5WB 5ETUA 5L6YL 3HVDA 5E2TH 2AZAA 1WAPA 1T83A 3QXAA 3FU7A 4JR9H 2H32B 5E2UL 2GITA 2ZWYA 5F9JA 2X88A 3Q1SL 1UZ6F 43C9A 1CS6A 1G7QA 3H2QA 3NACL 1KCUH 4F91B 2XQYK 4YDLC 3A5VA 1F4XH 1MCNA 3UJTH 4X7SH 2COQA 3H9SB 1AGEA 3LXUX 2J88H 4ZMNA 2BX5A 2K70A 1R3LA 3RZCD 4KK5C 4Q2ZB 4C55A 5F0MB 4HJGB 4WEEA 4AYFA 4TRPH 2DOCA 3I9AA 1XF3B 2R0WH 2H0FA 2WZ5A 4EUPA 5FO8B 5DURB 1WPCA 1PZBA 1Z3GH 3TA3C 3D1MC 4O51B 3SO3C 4FKKA 4TUKL 4U4BA 3LZFH 3VH8G 1INQA 4L4VB 3GM0A 2X89A 3FCBA 3OKDA 2QDVA 3DGGB 2W9DL 5DJ0B 3IXAB 1NIBA 2BOCA 2DV6A 4Y2DA 2ARJB 4XN4A 2XZAL 1P7QD 2VMJA 4P23A 2CU9A 2IH9A 1C8PA 2CHZA 5KWYC 4QYOA 3EGXB 2DQIL 1YUHB 2V9QA 3WDJA 4G6ML 5KAQG 2QR0B 1NMBL 1D5XA 3QIUB 1S7UA 2FECI 2JMRA 1RUPH 4P5MB 5KG9A 2Z31D 4X7EC 3GSVB 5AZ2H 5LO7A 4GLRH 1E28B 1XB8A 1JMXA 2VXSH 3F58L 1NZRA 1WGOA 3L1FA 3K4DA 3B8SA 3MOBH 3WJMA 2RA1A 2X4RA 5DR5H 2XCMC 1CICB 2CO7B 4PREA 4DHLA 5ADOL 5EF1A 1T03L 4N2KA 4L05A 5TE4H 5SWSD 3K6IA 4U05A 5F96H 1FH5L 4BE5A 5MEQB 2EXWD 3TJPA 3S2CA 2YFOA 5CKGA 3DJZA 1EVTC 3RFZA 1IGYA 4XMPL 5C0GB 2XWTB 4FYRA 1CB4A 3OR6A 2R27A 3LZOA 1U92A 4MYWB 4R4NC 4BZ2L 1HSBA 3QEHB 4OZIB 4ZMXA 4F7PB 4Q9QH 4KK8D 3IMBA 1DQLL 4AOFA 2R29H 3EDFA 4G3YH 2FATH 3QFDA 4KVCH 2B1AH 5AAWA 2X4UA 3LS5H 1TYEB 3HJ0A 4OCMC 3QDHA 3E9UA 2PP7A 3KLKA 4PTTA 2VCOA 5D8JH 4RGND 3FXIC 2F8IA 3BRFA 3SE4C 4XVSL 3FO9B 3GIZH 4YMPA 1MJ7H 1UJ3B 1A4KB 2OA9A 1H19A 4R7DB 4LSSH 2OSXA 3EFFA 3MJGX 4PLKC 4PJ9A 4YVUA 4N2AA 4P2OB 2ZG3A 3E6HB 1KJ3L 3DRTB 4NQEB 1AD0A 3NQIA 5D2LF 4XNMB 1COBA 1NFDE 1TVDA 4GI8A 4EI5D 2XWJA 2ZXAA 3TN0D 2KZ1B 5FW6A 3SOBL 3B9KA 4IQHA 1QRND 1J9CT 3KPLB 5L7XL 1F3RB 3QORA 2Y7SA 5ECGA 3WFBL 4Z7OB 4MJ6B 4JY5L 1UATA 1CD0A 3PWJA 1NDMA 2ZKMX 4UM9D 1KYAA 2ATAA 5FHAL 2IV9A 1SMAA 4OD2B 2FEEL 3Q5YA 1LLAA 3WXVL 3FFDA 3EJJX 4PRBB 4GBXB 3CC5B 4ZD3H 4FN0A 1S7UB 2XZAH 2CIIA 3OAWA 2OK0H 3A23A 2GCYB 4BDVA 3FB6A 5A1AA 5I0YA 3DIDA 4XO9A 3EDKA 4Y4KD 1DBKH 3KYMA 2Y07L 1AGDA 2FCBA 3SPVA 1NKRA 4AUUA 2Q8AH 2DICA 3OKDB 2W0FA 5BVJB 5IJDC 3FDWA 1UCBL 5C0BD 1Z9NA 1J12A 4M1GL 4KVNL 4PM1A 4UB0H 4DEUA 1N19A 4N8CL 4PGEA 4PS8A 4ZW6A 1T1ZB 1KGYE 2Z35A 2A6DA 5F89B 1FH5H 5I6NA 5GRXG 2V17H 5EC2B 1MFAH 4RWYL 3JV4A 3IDUA 5BJTA 3CFEA 3FCSA 3LH2H 1XHHA 3V4LA 4JGNA 1AIZA 4ZMLA 3EFOA 2AXGA 2IVFC 3P3YA 2X6AA 2X2IA 3SE9H 5I1DB 1ZHKB 2LV4A 1VCBC 2VW4A 1MY7A 1UUNA 1P4BL 4DGUA 4KKBD 3V52L 2BNRB 1F1DA 2BZ7A 4H8WH 1ZGLM 3BP5A 3PV6A 3VXPB 1SBSH 2X4RB 3W5NA 4A2EA 1C7TA 4WJ5B 4LMQI 1DLHA 4GRWE 1KT2B 4MB1A 3WHE1 3QULA 1VEMA 4M3HA 2VR4A 2V3EA 1XGQB 3WEBA 1BQHB 2AQSA 4KMLB 3TONA 5ITBL 1C1EH 1CD9B 3SE8H 5IWLA 2NLJB 5FW8A 4XXDA 3O3EA 3F65A 4IJTA 1KJ2A 1JK8A 2XPZA 4ZUWB 3VMOA 4BH7A 3ZMRA 2X4QB 5EZOL 3WN5C 3MV7E 3BRGC 3HRZC 1KCBA 5AB2A 1P2CA 4QRQB 1UJ3A 4EZMA 1ZS8B 1GKOA 4JDEB 4KZ0A 3FB8A 2YD1A 3WY3A 1N0LA 5IMKA 1E50A 1PVHA 5EEYA 4XP5H 3LHPH 1OF2A 3JUZA 5E7BA 3H7BA 2B7DT 1FCGA 6FABL 4PAZA 1LD9B 1RHHA 2FBRA 4JM2A 5AB9A 2HJLA 2RB8A 1RZ8A 4JY6B 3EHBB 2XYBA 4AEFA 1MWAL 2EDTA 1NGZB 4PRNA 2AVGA 2R7EB 2WBJB 3WMSA 2BP0A 4TVPE 5T3ZD 1R3JA 2D9CA 3WGVB 2VMEA 3QIWC 5HDBB 4GQRA 1ADQA 3REWB 2AS5M 3ZKSD 1QQDB 3QJXA 3X1NA 5EUOA 2BHYA 2A9ML 1Q0EA 4DZ8A 4LKCB 2K45A 1KBGH 3OAZK 3MRIA 3L3GA 3X13A 2NX5E 4F80A 5E5LA 2NQCA 4HMEA 1FZMB 3LEVH 4RLDA 3SEPA 3VCLB 3X1BA 3X11B 3BCDA 3C09B 3P0VH 1X5IA 1FFNA 1MFAL 2CDFB 5E94A 3I74A 4OB5L 4QF1B 3UJIH 5DHEA 4LU5L 3LH2L 4OD1L 1JS4A 2DLFL 4X9FA 5F88A 2FIRT 1MJ8H 3M1CA 4PUBH 5EOCL 1DANU 5DA0B 2FEJA 4F7TB 1AGEB 2JJUA 1GOFA 4RNRA 4K8RC 2FSEB 5IR1A 2WCGA 4OZHF 5DJYA 1NC2D 1GPOH 3JQOB 4TQ8A 5E6UB 1THCA 1KCVH 4R8WH 1SJEA 4XCCL 1BQHA 3RIAF 4EBQH 1HHGA 3OR7A 4K8RD 4PCSA 1M9WA 3GXIA 3X1GA 4DH2A 1HC1A 3PQYB 3ZPDA 2OSYA 1S9XB 3QUMB 4D8OA 5I8EA 1DLHB 4OIIL 2BIHA 1HAUA 5DVPA 4HP5A 1P6WA 1XCTB 5KVDE 5DFVC 3BYYA 5HHOA 2PUQT 3GQFA 1GCYA 3JT0A 4J4PA 3VM7A 2FEDC 1T83C 1SGKA 4Z7UE 2BNRA 4LEBA 2MQ0A 2YRBA 3KYNA 3P4NA 1X5GA 1Z9SA 3FUDA 3MBED 5HY9B 3LKPB 1ZEAL 2NQ3A 2ZUYA 5HDBF 4OLEA 4W9IC 3KXFE 5ITFA 5DYFA 3VQ2C 2DYSB 3BSZA 4BQ6A 2H9GA 3EFDH 1IEAA 3GB7B 1NGWA 3T0EA 2HKFH 1CD8A 4TPRH 4UAOB 2Z4TA 4OLUL 1SEBA 5F0LB 5HYSB 4B5EA 3LAFA 4F8OA 4YHLL 4NQED 3KVDD 4YHIA 1J0IA 1NUGA 3HE6D 4L8SB 4ZMTA 1RK1B 5I6MA 3FU8A 4M6NL 3BLPX 1I8IA 2RD0A 4OF7A 2X4SA 3WEXA 4I1NB 4I0CC 2X87A 1NIDA 5BUGA 1Y1DA 4RBPK 1X4ZA 3SKNB 1OV8A 4FQXC 2OI9C 1ESOA 4OI7A 2P5WE 1CDBA 1CUOA 4XN5A 4TM9A 3VFRB 3LIUA 4X6EA 5ANHA 3RHWF 4OM0L 1SMOA 5EFIA 3O6FB 4IMKC 1EO5A 5IB4A 1NTDA 4GBXA 2K6ZA 2DLFH 1FRGL 5JHAA 3BAIA 3T65A 4JO1H 5LCVA 4HC1A 1DVFC 2OBGA 4F27A 2W60B 4NWUH 5EZIL 3O8XD 3G9VA 2A73B 3KZ8A 1WFUA 3QPKA 1TU2B 2VISB 5F7DA 4A04A 4XCNB 1J5OL 4RMTA 3D2TA 3BUYB 4KC3B 4FMVA 2R56H 4E9XA 3KPQA 4GP5B 3FQYA 5DJZB 5E8EA 3ZE0F 3LQZA 2X4NB 4AV5A 1OE3A 4G9FD 4N0UB 4TUOB 2GJZA 3RPBA 4BELD 1T6VN 4PGDA 4ODUB 3WCYA 4GUOA 2XX0A 2VQUA 1Q9WB 1MAMH 3MR9A 4DGYL 1OAKH 5IB2A 1P6FA 3Q43A 4K7PL 4YHNA 4DT2A 3PL6B 4FTVB 2YQ2A 4FXLA 2G4EA 4Z7QF 3NDYE 3WLWD 2NSQA 3GK8L 5HHNB 1DVSA 4NQDA 3B37A 2WBJC 4IM8A 3UAAA 4KO6A 5JPMC 4H8WC 2CM6A 1F8TH 1ET5A 5CSZB 1E5BA 1S9XA 1LMKA 2NW2B 3KYOA 4KKCD 2UV3A 3OR7B 1AQDA 1MFBL 2VYRE 3WL9B 1F6FB 1FSKC 5CD5C 4KX7A 2BNRE 5D1QB 1PLBA 3CMOL 3QA3A 5T5NF 5DQDL 1KCSH 1MRCL 3I9PA 2J72A 4GS7B 3VVVA 2MPAL 3LDBC 4MJ5A 3KH4A 5HYFA 2AK4D 2ZF9A 2YUZA 4LLQB 5HHPA 5IJVB 4KI5C 2Y1AA 5C2UB 2BJMH 1N4XH 4OZHB 3KMDA 1RCYA 5F1IA 1X9UA 3ZIYA 4OSUL 4PGCB 5KS9E 5B7EA 2DMBA 5E4EB 4WUUB 1JZ8A 3PWPD 2W59A 1NFDA 3ULSA 2Z6FA 2XA8L 3UYOD 4Z1PA 1AFVH 2DJMA 4MWFA 4QHPA 4ZW8A 1DJGA 3TA3A 4RMUA 5FUZH 3O81A 1NA8A 4K5LA 3OKKA 3TFKC 2Z7WA 3L45A 1BAWA 1JWMB 4X5QA 2V2TB 2PKDA 4LESA 2HKAA 1AO7A 4HWNA 1QX1A 2UXGA 1NKOA 1SRDA 1M7DA 3HG3A 4JFZL 3THMH 5KYNA 3N1GC 4GMTH 2JFCA 4XTRC 5IFAL 1LE9B 4YNYA 2ITCB 1D9KC 1OHZA 3LTVA 3PAYA 4FJ6A 1CF8L 3AU1A 3ILDA 3VMNA 3RWDB 1CLOH 3OKEB 1BQSA 4M1CC 1YDPA 2V4LA 1NDTA 3PP4H 5IVXF 4HOWA 1H5BA 4L5FH 2WIIB 1XH2A 5AAMA 5FEBA 1MCQA 3DTXB 2OL3H 2QDWA 4NUJA 4MKTA 3OB8A 2HLAB 3ZHFA 3A67L 4UQ3B 4TVPH 4OM1H 4B97A 2GSIB 5DFWH 2EEXA 1JNNH 5IY5B 3NGBC 1XCXA 2ZF8A 1VFOA 4X4ZA 2VM4A 5PAZA 3H9HA 1P7BA 1RP8A 1JGVL 2D31A 1ZANL 5LNEA 5IB5A 4O2FA 5T8IA 5D4IA 3KPSE 4ZTEA 1XGQA 1F2XK 2VR9A 3V5KA 2E7MA 4RX4D 3VFTA 2D03H 3K5SA 1OE1A 3KBHE 4K5NA 4OGYL 5AZEL 3KLAB 1GTFA 2A5UA 2QSQA 2YFNA 4NQDE 4BZYA 1XBDA 4U6VH 5ACMA 5I66A 5ILTH 3KPPA 1PSKH 2OYMA 3LZQA 3P4OB 1F45A 2ED6A 4K94C 4U3HA 4D9RE 2C7FA 3VXSB 3MLYL 3WS3A 1W8NA 4QTHA 4R5XA 1UFGA 5D7LA 1WBZB 2BSTB 1YJDH 2GBAA 2R0ZL 4LLMA 5BUPA 3RVUC 4HIHB 3UTPE 5JIQA 4I9WE 3UAFA 2WXRA 4F1SA 3B5TA 1A6UL 3AG4B 3VXUA 2Z31C 5AVWB 1YN6A 3B6SA 4L1BA 4ZS6C 1A7RL 1JTTA 1EV2E 3EOYG 1H5BC 3NEOA 4S2SB 1UACL 3R18A 4HOXA 1DTUA 1A9VA 1LQSR 4ZXBA 3MRFA 3S35X 2F54A 1J05B 2N7SA 1XGUB 1PY9A 2DQFA 4M7LH 2Q20A 2OZ4L 5BXFB 4MNGB 1BYOA 2WMPA 3NSCA 1IGJB 5E03A 3QUXC 1VKXA 3EH5B 4DF9A 4R90H 3C5ZD 1K8IA 4GW5A 1LNUA 4TULL 4ZUTB 3AS3A 4HUWA 3TH2T 2A6IA 2F1EA 4AX3A 4ELMF 4R7XA 1K3ZA 5J57B 2V0AA 3IDYC 2XWDA 1X5LA 2OFQA 4L1DA 1OEZW 4DTGL 3IGKA 1ZXKA 4O9HH 1JVOA 3KCPA 4PRPD 4GUCA 2JQAA 3V6BR 2YD0A 1QYGH 4M3JA 4XNQA 3S36H 5INCA 2V3FA 2H2SC 2UY7B 1PLCA 2IADB 2N59A 3O41A 3DK0A 3UTTD 4XE5B 5GGQL 5K9OA 2AJVH 1KN2H 3FSZA 2FO4B 3GO1L 1YEIL 1FWXA 1UWGH 2YN5A 1EO7A 1A6TA 4AZUA 1UT2A 2ED8A 3EKCA 5I8EB 4Z3TA 3A24A 3NCJH 1MLBA 3LKOA 4W70A 4FQCH 5I8CB 2D03L 4OGYH 4TKWA 1BZ9B 3QWOB 5GGUA 1ZT4B 5I0VA 1R9FA 2JKTM 4PJHE 2I27N 1MRDL 1TEFA 4D0BA 4QOKD 2F54E 2GTWA 3O45A 4YXHH 1XF5A 3QHTC 2DI9A 5SWZA 1RERA 1P1ZA 5EB9A 3QXVA 1TVHA 2BSSB 4Z5RA 1A66A 3JTSA 1L0XA 5I17B 4ZX4A 1T03H 2BIIA 2VZOA 1S5HA 4LPYA 3B9KD 1HWGB 3TYFA 1CU4H 1TYRA 4Z95H 1CGWA 1KLGA 2OCJA 3II1A 3U1SH 1O5PA 3V6FA 2CMRL 1GZHA 2ICWJ 1W8OA 5IV2A 1IM9B 2BK8A 3DBSA 1MCSA 3RVWD 2BERA 3GZPA 4MAYA 5KW9H 3FTGB 1S8DB 3PPSA 3HZMA 4UDUA 1GS8A 1SPDA 2VB5A 1KLFB 3MN8A 3TS8A 1A9BA 4LHUA 4WWPA 5D1QD 3GS4A 4JDZA 4K3EL 1MH5A 5D7SL 5E9DE 5D7KD 3H1ZA 3S2AA 3ZDXF 1SN2A 4NWTH 5I8CA 5DUMH 3IJ8A 1NWOA 3P11H 3HZVB 1IVTA 4KK6C 4U1KA 3ZYIA 3MBXL 3EJYC 1KGWA 1MJ7L 4PV8A 1ZV2A 1G87A 5CLZA 5AOKA 1C8QA 3NFPA 4CSTA 4Z8FL 2Y72A 3CFDB 3HBZA 1KGCE 5DK0B 1EGJL 3FFOA 1T2XA 1WV7T 4P2RB 1S7XA 5C6TH 3O6ML 1NMCC 3VXME 3ZE2E 1FORH 5I6XC 4N2OA 4KTGA 4QRRD 3UYRL 4NUQA 1KTLA 1TZIA 1YNTB 2BY1A 3JYBA 1U58A 5B3NA 3U0WH 2JSFA 4LOUC 4ANKA 2PCFA 1LWHA 3PABB 5SWSA 3ROOB 3QWQB 1NBZA 2ETWA 1EHXA 2E7CA 5J6HA 3BAEL 4MAZA 1HHIA 4XNZB 1SOQA 1ZDSA 3SDAD 4OLYL 2L7EA 2X4OB 4UBDC 5H35A 2APTA 1XGRA 4JHAL 5ADOH 1GZQA 4OZ4A 5GGSY 2XKNA 1RZJL 2IH1A 3C2AL 1X44A 3DO7B 3CFKA 2JIXA 4Z23A 1A5FH 3CN1A 4FYSA 4RMBA 1FIGL 1G7QB 1U3JA 4WKZB 1AQHA 4IEFB 5F0JB 1MRDH 4PS3A 4ZSOA 1HE7A 1L4IA 3ZO9A 1WCQA 5GGUB 2VXQH 3FRPB 3Q06A 4Q9QL 4NPYB 1M9SA 4AL8L 3TT3L 3RGHA 1DFXA 5KSAA 4J3SA 2HT3D 2WSPA 4Z0XB 5E4IA 5JOFA 1SN0A 5L8LB 1OGTA 2X0UA 5D8JL 1CO1A 3PJSA 4BUQA 5ESVB 5TDNB 4KDVA 3FQWA 4HKBA 1OAQH 2DJUA 4Y5VA 1KN4H 1GW6A 3EYFB 3FCUB 5JLZA 5F7EL 5LCVH 4A2HA 3VYNA 4OZIF 4YEFA 2J6EL 4U1LA 5J1AB 1E90A 3NRFA 4ZS6D 1HN1A 1WRFA 4J3VA 2SODB 5SX5K 3CCHA 3NTCL 2VR6A 2EE0A 1IE5A 3L54A 3MA9H 1NFIA 1U2CA 3PWVB 4X8XA 3FTZA 4F15C 5E23A 3X3GL 4TLUA 1BLIA 3GPEA 1EGJA 5A6MA 4KI5D 3MLTA 1IGCL 3QFJB 3K4AA 1UWFA 2X53A 4ACPA 3TF7C 1HDMB 1IM9A 2PETA 4QXVA 2D0HA 4YSPA 4Z3HA 3UBXG 3ALWA 5D4HA 2J20A 3NIDB 2CM5A 4G59C 3UAJD 5GS1A 2NNXA 3KYKH 2BVPB 3O6MH 2E56A 2QQKL 3HHSA 1K5NA 1GS7A 2CO6A 3V0IA 1E40A 2A1WH 3IFLL 3EDJA 1JD9A 4Y5VB 2GJ6D 1KPUB 3ISWA 4MA7H 4YPJA 3VXSE 5F9OH 1GYAA 4UZGA 1V7NH 2HTKD 2JCCF 1EBAA 1NDGB 2F5AL 1J9QA 1B4JL 5JXED 1WCBA 1AHKA 2H2PD 1YY8B 3U1PA 4OFYA 4M8VA 4RFEA 1KGUA 3N40F 2QELA 2R1YB 4PJBF 2ZYIA 2A9DA 5KAQF 3JBG7 4PIRF 5ANME 3KPRE 3V0EA 3QJHA 4N8CH 2XI9A 1OCCB 2IDSA 1U8PB 1KV7A 2OMYB 3MRLA 4LZKA 5E1GA 1SXNA 4NQVB 3F01A 3O2VH 2IH1B 2JV6A 5FKAB 1I7ZA 3FFCB 3II3A 3DIFB 4EDWH 2AC0A 1MWOA 1JZIA 4MZ3A 1JNLL 1JXGA 4Y5YC 1MCWM 4BBWA 1HYSD 3BRDA 2CDEB 4JFED 2DM3A 3MUJA 3S5LB 1KBGL 3GBML 1QSVA 3ARWA 5IB1B 4P59L 3ZHKA 2P4AB 3FB8B 3HNVH 1D6EA 4YHOL 4UTAL 3MGTA 3DJ9A 5D2LE 1U8IB 3ILQD 5L2KB 4D9QE 3AXIA 3QW9A 1SYSB 4KPHH 5FXCH 3ZHLA 2J6EA 4TTGA 4NKMB 4MAYD 2EVGA 2FO4A 3CBRA 2EUWA 2ZXGA 3W9DB 3WDIA 3NRQA 1RIVH 3CG8A 3FQUA 1OWRM 3IDGA 1FNHA 3IFNL 1KY7A 1Q38A 3GMMB 4POZD 3RBSA 2BHFA 1ZWIB 3GTVA 1ZS2A 1Z3RA 2FJFB 3TC9A 2QGDA 3QO1A 4GRLC 4GT0A 3MFFB 4U1IA 1I1CA 3S97C 4XMTA 3GXFA 3ARPA 4NBXB 3B6SB 3WTYA 2TSAA 2F5BL 3A4EA 2ADJB 1A6ZA 2FATL 3ARYA 1YEHL 4Y0GA 1S9WB 3BP5B 2EC8A 5DC4B 4DK3A 5CBAA 1DQDH 2WQAA 1IAMA 1JGIA 3S48A 5DRZB 1MFCH 3MUGB 1UA3A 5BV7H 5CINL 4FDWA 3KGRA 4HIEA 1FNSL 4XMKH 2CUMA 2H8PA 2I07B 4U1HB 5LVEA 2GSGB 5D7JD 1EAJA 1CL7H 1OE2A 3O3DB 4HU2A 4PV9B 4S1QL 1ZIAA 3G5VA 5JR1H 5LN8A 4QHKI 3QBTB 3CFEB 3FCSB 3QHZH 3RNQA 3MZTA 4LOFA 3WO4C 1DZ0A 3PF2A 5ESQA 4XP4H 1HXKA 1XF4A 2GKIA 2D4DA 3AUVA 4LGSB 5D1ZA 1A47A 1C16B 4OF3A 4Y8DC 1V55B 2G5RA 4QHUA 5BRZB 1OP9A 1CTNA 2FDBP 2LE9A 3N42F 1GY2A 2DJ4A 2IDUA 1CFVH 4H1LG 4PJ8C 1V27A 3QDMD 3TZVD 5I74C 5J12C 3VTMA 2ZIDA 3BKJL 3OR6B 2ENYA 1EJ8A 2HYMA 3BPLB 4X4XB 2WZPA 4G8EB 2EYSA 2DRUA 5D5ME 3A6CH 4RGOL 1A2YA 5D1XC 5I8KH 4OBSA 1ROCA 1OY3B 1XF1A 2PLTA 1NPUA 3R8QA 3WSQL 4C56A 4HKXA 5JQHC 2C4FT 4IK7A 2EH8L 2AEQL 2Y6TE 3N6YA 1QNZL 4TNGA 4FLSA 1QSEB 4PCTA 1Z0NA 5I9QB 2AFNA 4QYAA 1H3TA 2XIDA 1PU0A 4G7VH 1MSPA 2VLME 3K8LA 4I87A 4GPVA 4LQ1A 4AYBA 3JV0A 1KCKA 2GI7A 3L1EA 2ARWA 3UCQA 4L3EA 5HPOA 5F93C 6CGTA 4J8QA 4UT7H 3F3HA 2WLNA 4PFEA 2BOBA 3BJLA 1V3KA 2X70B 2BLFA 3AQDA 1BJMA 2AJUL 2AQRA 2FAUA 2YJLA 4TUJA 3T2NH 3TYFB 3EADA 4NM8H 4DFIA 1Q94B 4EIUA 2IXQA 3RAJH 1OLLA 2HLAA 4B9YA 2R56L 1PG7H 4RZKA 2DQJL 3GC3A 3QAZC 1C5CH 3MLXH 2XVKA 4JREC 5AW0B 3SKUD 4G8GD 3U79A 3MREB 4B95C 1BX2A 4H8WL 3BP4A 4H40A 5MENA 3LN4A 3MLRL 1HKLH 4KY1L 1KJ2H 2JKJA 3VDCA 5B8CC 1ZVHA 3VDAA 3RWDA 2R59A 3Q2CA 2YRPA 4W9CC 3BEWA 1MHCB 1KMGA 1HINL 1DUYB 4DUWA 4X6FB 4X9BA 1IIIA 4UV7L 5DUBB 1HNFA 1ZTXL 3FSAA 2NY3C 3HPLA 2ZAGA 3FT3A 3SPVB 3T0VA 1E9OA 3NESA 3RI5K 2FH8A 5IJKC 4ZS7L 1YEGL 2AQPA 3WTSA 2J21A 3CFCL 3QFJD 3TURA 5F6IC 3C5ZA 3MBEC 4K2UL 4MBOA 1FYTA 3P4OA 4JG9A 1NFKA 1EHKB 5ESQB 5C07E 1U36A 3ARBD 1O75A 3IRZA 3DX4A 5CLWA 5J11C 3I6KB 3MI6A 4O58H 1J0YA 3IU3A 2QR0A 3BISA 1QRNE 3C6LD 3IXTB 5I8KL 1IAOB 1XCQA 5FGCB 3ZKND 2BJML 1LO2L 3NIDE 4G6KL 2NR6A 4BFBD 3HS8A 4CA4A 4EXKA 5D7LD 5KYYB 4D3CL 1KELL 3DETC 1J5OH 1T5XA 3QZOA 5ALCH 2DQFB 4YGAB 5CHNA 4K55A 3BQUC 3JWDL 3QUZB 1EEYA 2EXYC 2DH2A 3EJPA 3MAWA 4LDCA 4CU7A 3L1OL 1SYVA 5FKPA 4JFHD 4OQTA 4URTB 3VB8A 4ESKA 2P47B 1M7UA 3ARDC 4UUJB 4JB9H 2AQ2A 3B1UA 1TVBB 2SEBB 1NAML 2E9BA 3WFDL 5FM8A 3F6IA 3S34H 4WY7L 2F8XC 1QHOA 3Q1EA 4KJQC 4EDXB 5JIMA 1S7RA 5CGBA 4FLRA 4XX5A 1RUKH 5EV7A 2C26A 4YEEA 3FQ4A 3HE7A 3RUGB 1DR9A 4F15B 1GY1A 4PJ7A 3VXRE 5ETUB 3RWCA 3KPQB 4FFWD 2G5BB 3ULUF 4CW1B 2UZXB 2WLLB 4HS8L 4LVNC 4LAJH 1QWHA 3PQYD 1EEQA 4BK5C 4GG6A 1D5BA 12E8L 3UL4A 3TIDA 5AALA 3ULUE 4ORGA 5ES4B 1DFBL 5DJ6A 1KEGH 5D2LB 1FZOA 5JXAL 3GUFA 1I9IL 3F7QA 1G6RA 1M53A 1AP2B 4P99A 3CSYA 3DI3B 3MRIB 4BZ1H 4DPRA 3WLBB 5IVOA 5F1OB 4E36A 4WAFA 2Q87A 1VZGA 1J1XH 2VXQA 5KVFE 2WLKA 4N2NA 3W38A 4LSTL 3VD2A 4ODTL 3CWGA 3PL6D 4FTVD 3WG7B 4G9FA 4N26A 3TA3D 5ICUA 3F00A 4M6ML 5E2JA 2G0KA 1MHCA 5J56B 2YRZA 3BEVB 4Z3JA 4X0KB 2ZAHA 3TV8A 5JYMA 4FNRA 1HAWA 3I9GH 3K2IA 4GS7C 2YXWA 5GS3A 4YHLH 4XPAH 4Q89A 2O6CA 4L9LB 4N2CA 2O30A 1NOAA 4CRPA 5IESH 3C12A 4JFOB 3JZ7A 5TDPB 2PP9A 4F8PA 4P0DA 3SDXA 2HUHA 1XB6A 1ZE3C 1NGWB 5JA8B 2YXVA 4PRPE 1JPTL 3P1VA 4JZJA 1AP2A 2EICA 3PP4L 3JV5A 3AUWB 3QDMB 3TZVB 5JHDA 4YFEA 1W2KT 4F2EA 5CF3A 1S6NA 1D5MA 4OFPA 4XBGA 3M45A 4MJID 4POUB 4D8PB 2DTMH 3EYFA 3ZTNL 4BRVA 2QKIC 5KJRH 3KPRA 3ARGB 1NPJA 2C1OA 1ID5I 1MLCA 3B2XA 3FYEB 5FB8B 4OM1L 3SJVD 1PKOA 4YZWA 4CSPA 4MRCA 5CZXD 3H6JA 3O8XB 3QR0A 2VDMH 3N5AA 4LOVA 4AK1A 1BG9A 1CLYL 4XPBL 2ERJB 2R2EB 5LBGA 4WHCA 3UBXI 3HE6A 1HZHH 1FVDA 4MDIA 5I1JH 3HIZA 1ACCA 1CXFA 1P69B 1ZV5A 2YSSA 3ULUD 3QUMH 2IGFH 3IDGB 3EXLA 4M56A 1RZ7H 5FM5O 2M8XA 3HEIB 3RDTB 1NAKL 5MEPB 2JNZA 4XWGH 3Q5TA 4G5ZL 1XH1A 4EDXA 4X4KA 3ZIMA 1HHJA 2JIXB 2WHVA 3KAAA 5E6RB 5IKCA 1KV3A 2XXCB 3MRDB 3MV7B 4ONHA 5FO2A 3X3FL 4AENA 4POYA 1OAKL 1SJHA 3EDDA 1JPEA 4D0DB 4UTCA 1A4JB 3L9RB 1UJTA 2ICWI 1IQDA 2P49B 1YJDL 2R0ZH 1VGEH 4JO3L 3ECWA 4Y9FA 3T6VA 3L4XA 5D2NC 3FF7A 4PV1C 1K2DA 3FO0L 3BKCH 5ADPH 1X4XA 1AC6A 4WO0A 2PWFA 1M05B 3GGWB 5DRWA 4AJ0A 3TO4A 4LKCA 3VRJA 1J9RA 4A6YB 2I24N 1WBYB 1KXQA 5E8EB 3RWGA 1I8KB 2YPKA 4K73A 1U3HB 1R3JB 4OF6A 4ONFL 2F7RA 4L3EB 3T8VA 3QEQB 3DPBB 3V4PH 1WHOA 1P7KA 5LAXB 5MHSE 4XCNA 3WKYA 1KCSL 2XWZA 3U1SL 1RUMH 5BO1L 3T4YB 5DJ8B 5DMYA 1F3DJ 3V9FA 3K1DA 1F1AA 2G30A 1BIIA 1GL4B 3L2LA 4R4FL 3TCTA 3S9DB 3MGOA 1HXYB 1IBZA 1AI1L 4I0PD 2EEAA 3WMPA 1FYTB 2TAAA 3H55A 3V4UH 1FZJA 1VFMA 2AMUA 4PJGB 3F85A 2QPEB 3EYQD 1AGFA 3X12B 4X5WA 1TCMA 1AXSA 1GGTA 2C3HA 3HR5B 3UC0L 5IV2B 4GAJL 3W0WD 3KDMA 1T6WA 3NN8B 4H88L 2EKSA 2ITDB 3EUDA 3EYQC 2FHFA 3NMEA 3ZDXB 4IKLA 2IPTH 1KTDA 4HSCX 4QCIB 2AXFB 4QLRA 1OM3H 3V8CA 4ZUSA 2KLSA 4BGDA 3ROLB 1TCRB 1FORL 5F88B 1DZBA 5A7BA 5ID1B 5CAYB 4HH8A 4HXAH 4Y19E 2CBPA 4DEWA 5D5MA 3V95A 3VXOA 2P5EE 3D87B 4JQXA 2IGFL 4OF5A 3RTQC 4Q7DA 1CDIA 1DBKL 4LP8A 4ONHB 2YJQA 4PU2A 4OGAC 1HESA 1GJWA 3C09C 2AKRA 3CK0H 1BAGA 1HSBB 3QEHA 4G1MB 1YECH 4G5ZH 3QYCA 1UENA 4HSQA 3RY5A 3I84A 2YD8A 1CFNB 4WWOA 5CMAA 2ZX8A 1RU9L 1NC2A 2XWBA 4ZMWA 3SCMD 3BAYA 1UWEH 3QI9B 2YSSB 2IADA 2HN7A 1BF2A 1G9ML 4BCZA 1JNNL 2V17L 4RFEB 1KB5A 3REVA 2ZKHH 3B2MA 4OV5B 3HE6B 2KL6A 2AITA 3CTTA 1T0MA 5INDB 1BFTA 1SBBA 3V8OA 1JK9A 2BNQA 3FO1B 3B7SA 3KPLA 3CPLB 1GIGH 4AQOA 4ABWA 1I7RB 1LEGA 3TP4A 2AXHA 3UAEA 4ZMAT 3ARBA 1KTKE 5DI8A 3ZMEA 3D52A 1TO4A 5D7SH 1KPRA 2FGWL 1CICD 5D6CA 1BQRA 2IAAC 3DYMA 3QNYA 4NERA 2NY2C 4OH2A 3DHUA 4OQTL 1GYUA 5IG7A 2CBOA 4JDVA 5DJCA 3V0AC 4XB8A 3HFML 2BRRL 2VC2L 4FLOA 5CSGA 3WELA 4XP9L 4OFYD 1B0IA 4YS4A 1N59A 4AM0A 1MFDL 1XMWA 1CN4A 3JWOC 4XE0A 3CC5A 2EC9U 4XGZB 1O6SB 1FFPB 2YEQA 1S7WB 5B21A 2BMKB 3UH8A 2E9GA 5CR8A 4JDTL 3ZX1A 5C0FB 3QDGE 1BIHA 5FS5A 1WA0X 5JNYA 3HRZB 4P46A 2XQBL 4K15A 2XNAA 4WWKB 1UACH 2OXHA 3UJTL 1PZ3A 4MCZB 2GABA 1U92B 2HA1A 3O3DA 3BWAA 4GNKB 4NZRL 5LUMA 4MAYC 1IM9D 1TNNA 5DYOB 5LXGL 3T3MB 3LVTA 1QLEB 4DAGL 1KTBA 3S35L 4LSQH 5IGXH 4JFDE 4PPTA 2AXGB 5DRZA 3U0PB 1S7QB 4TSAL 4NPYA 2ADJA 5BMFH 3LKSB 1G6RB 4B60A 4N8VA 1DQQA 1NLDH 2Z92B 3KLLA 3TOPA 4RFNC 1X5FA 2HFFA 4RAUA 2WXQA 2WUCL 5AW3B 4GIAA 3SIKA 3QJSB 3V7AG 4EO5A 1QTSA 1Y0LA 2HLFC 4PJCF 2YUXA 4Y1AA 5E1HB 2RMNA 3OC8A 4L3AA 3QQXA 4KDTC 1NQBA 3CXHK 1OF0A 3D39B 3APDA 3HBQA 3VD0A 3ARGD 4LEOA 3DMMD 2GYSA 5TD4A 2ESVE 2ZD0A 2X38A 3CGTA 3P0YL 1BSIA 2UXFA 3BPCB 3GMRB 4YDVA 3STZB 3S8GB 5DJ0A 2VSKB 3O3EB 5C9JB 3Q9PA 4XZUA 1FNGB 3VH8A 3NCXA 3UACA 3CH8A 2R4SH 4Z7VE 4YSOA 4ZNCD 2W0KA 4K3DH 3IWUA 1G7PB 1JIBA 3IMVA 1MOEA 2VABA 5IW1A 4UIKL 3WJMB 4YXLL 1JK9B 2BNQB 4WFFD 5E0FA 2X2YA 3GSNB 4LAQL 3DX6A 4IRJC 4P59H 1RMFL 1R0AL 5A43C 2D4FA 1QBBA 3PCYA 4IS6A 4H0HB 1EXUB 1JNHB 3QB7C 4MHHG 3E6FA 3FS9A 1KB5B 4LLUA 2AQTA 2QPSA 2ZZUT 1S3KL 3ABKB 1DYZA 4Z95L 2R1YA 2HH0H 3TPKA 3GHPA 4KMQA 4KITB 2ZX5A 1GRWA 1FHGA 3IVKB 3OKLB 4WNJA 4XHQA 3TBYB 3NJVA 4N1HB 5LLIC 3CQPA 2GJJA 3SHSA 1CFMA 3TZVC 3DSNB 2F19L 4QDGA 2HFEB 2HFGL 1QSFD 2V37A 5KYUB 4JKMA 4L4VE 4YDKL 4LQFL 3ZZSA 2AJYL 2H4EA 2VL5B 5DMGC 1KIQB 1QRNA 2CGRH 5EC1A 1ERNA 1OXYA 3BUTA 3SKJH 4FA8A 2OZNA 2GC4C 5AUMB 4P5KA 1JJUA 1IKNC 3MX0A 4Z77A 3MBXH 3L16A 4ODWB 1P1ZB 2P43B 2ZXDA 5IQ7L 4DPCX 1BPLB 4FXTA 5JZ7C 5DJXB 5FX3A 5DMGD 2XFXA 3ZUCA 4HJ0C 4DQOL 1DBBH 2HRPL 4NC1E 3BO8B 3T0WA 4JO5A 4LDOB 3X14A 2G60H 3OXSB 1PQZB 2WB1A 1T66D 3QQ4A 3CCHB 3HPJA 2OI9B 5DQ9B 2CNZA 4LIQH 4M62H 1U6AH 4J23A 3GBMH 1MJJB 4XP6L 1FYTE 4MZIA 1H6TA 4H26A 3WJJA 4JPIA 2G3NA 3FO2B 1JRHH 5JPNC 4X99A 2EIDA 5SWZD 4IU2A 3QUYD 1FVEA 1KXVC 1KJVB 5FYKL 3ECBB 4HLEA 5C6PB 3CHOA 5IMMA 1IGIH 1WQVT 4BSWA 2MTAA 4FNLH 3VWKC 4P2OD 3SGEI 3E8UL 4I9XA 4HCIA 4XMZA 2CLZA 5F6HI 1A4KA 1AAJA 4PJ7E 4YXLH 5IHBA 2J1XA 5KSBF 3U83A 3IFNH 2LVCA 4BUGA 5DD1L 2ZE0A 1FF5A 4FFZA 2NY5C 1H6FA 1XXFC 4HT1H 2OV0A 3SGJC 2DH3A 2LW3A 2P5EB 1WD8A 3BAXA 2EXTA 4H5SB 4O2EA 4PJ9C 1H3GA 1B6DA 2V9TA 4MNHB 3JVFC 4FG4A 3SY6A 4IDJH 1M3JA 1WTLA 3G04A 4L8SC 2I7SA 4E2OA 1UA6L 2FJGB 3O6KL 3TO4C 1HHIB 2MOGA 2Z91B 3BAKA 5JUEH 3LCYA 1UB5A 3BT2L 5LXVA 3DX1A 4ICWA 4AMKH 1JSYA 2H41A 4IHOB 2GY5A 2NY5L 3ZDZE 2YPVL 1YNTA 3K6OA 3L5WA 4H1LA 2L8AA 4MCYB 2ZYHA 1CE1H 5BNXD 2WKLA 2OJEA 3MA9L 1A1NA 5IQOA 4WWID 5KYXB 5T3XH 1JXFA 2CCLA 5CJQH 5H94B 3HA0A 1OP4A 2DMGA 4MKMA 4MQ7B 1HE8A 2C1OB 3ARGA 4LARL 4OF8A 1KXQE 5I71C 2O61A 3P54A 3N44B 2E47A 3SKOB 4CMMB 2EO1A 2BZCA 3K72A 2W1NA 3NFNB 4U3SA 4V33A 2HJKB 3EUUA 3HNSL 3MUUA 2XJKA 4JKPH 1JF1B 1MRCH 1WO2A 4NCDA 5E4OA 1YEGH 1H3UA 1I1AC 3C6SA 4QIRA 1MCEA 1TJMA 5AW1B 1BQHG 2XSKA 5F9OL 2BP8B 1IFHL 2B77A 3TU6A 3ZKXC 4PG2C 4U7MA 4PIBA 3APNA 4ZOBA 4YHZH 3VGDA 2G9HA 5JXEC 2IGTA 4ZMYA 2EDLA 1GW0A 3PHQA 1S9YB 3G6DL 5CZVL 3D85B 4L4TA 5H4ZA 3M8OL 1QTPA 3U4BH 1TQVA 3LEYL 2NY3B 3RWFB 5D7IB 5E51A 2F54B 1YPZB 5KN5A 5HHOE 3G3LA 5DD1H 5T5FL 3W82A 4JFDB 2IBGA 3T2NL 5F8RC 4F2MA 3QWOA 1OQOA 4XT1C 3AREC 4BCXA 5CJBA 3UZQA 1GMEA 3PFUA 4JVWA 1UGKA 2BP8A 1BZ7A 5L2KD 2BSTA 4N0RA 5E9AA 1Y07A 4IDJL 5BRZA 1E27A 1DP0A 3B83A 1NOLA 2DIEA 4KXZI 1U2HA 3K8KA 1R34A 3KW8A 4B9CA 4UM9B 1QHQA 5ACZA 2BNQD 3MRPA 1TKWB 4FQPA 2P52A 3RJDA 4CAGA 4LCCA 4JN2B 4WUUA 5DZVA 1THAA 5ELIA 1XZ0B 4OIIH 4C54A 2EYRB 2OMZA 5BOPA 5EUOB 1LO0H 1CDHA 1MQKH 2NY7H 2ROXA 1MUJB 2YD4A 3H3PL 1J18A 4HK3J 3ZR6A 3DX3A 2E27L 4Z7VB 2DW5A 1XGTB 1KBBA 2BIMA 4UMGA 3B3IB 3IDMA 1L7IL 2VDPB 3MHZA 5CP3A 5D72H 2LU7A 5HYJB 4I3SH 1X9RA 4OJDH 2HP4A 4YDJB 1ZTMA 4K07A 3HMXL 4Q0XL 2FJFA 3BUQA 3CFQA 4WHTA 1QKZL 3FZUD 4LP4A 4Q4IA 1EEYB 3CU1A 4BFNA 1DLFH 5KSAC 2DY2A 4FXKA 3P3SA 5G4MA 5FCUH 3UGUA 2HLEB 5D6DC 2I9LB 4KKZA 1GR7A 4ZTOH 3WEXB 2OXGA 3HJEA 5EO9B 1BXAA 4TUJB 4QRPE 3MRCA 4GKSB 4D0CB 2ZQKA 1MQ8A 1NINA 2BFVL 1GVIA 5FYKD 3VJ6A 5J6SA 2NTFB 3W0WA 1FGNL 3P9MA 3D48R 2YAFA 1L6PA 5ECJE 2FIKA 3EH4B 2NUTA 4M7KL 3LOWA 5LNDA 4PCYA 1ETZA 4NRZB 3AAZB 4R6UA 4JCMA 1JNJA 2A74B 4ZAKA 4HX1B 3RKDC 3GI8H 3CN0A 4JFWA 2I69A 3QPXH 4FZ8L 4HZLA 2UY6B 3ZHNA 3L5IA 2CLRA 4OFVA 2DYRB 3BW9A 1YYML 4C4KO 1F3JB 4OGXL 4U1LB 3EYVB 5K9JL 5F1NA 2NYYD 3MV8E 4L8BA 4HZAA 3UG3A 3VD7A 3VFVA 4AKPA 4MXWL 4R7LA 3NA9H 3K0WA 3WFCH 2CK0H 1E4JA 3HW7A 1PJWA 3QJUB 3LMJL 4LLQA 4ZAKD 2GK0A 3WIAA 3L5JA 3ZTJH 4PJHF 5JHMA 4OCRL 2BCKB 3ARGC 3BZ5A 1GZPB 4DW2H 2DYPD 4XC1L 3L81A 1NGQH 4LEXH 3IU4L 3LNGA 4QAWA 5DJXA 1NC4A 3KPNB 4V1DB 3HNTL 2J8HA 2WXKA 2Y25A 1FH2A 5AG8A 5I1JL 5SV4A 3VRLE 2J8UB 2X2JA 3GXPA 4ZPTA 3DROB 3GTNA 3U46A 2UXTA 3C60D 3GJEA 2W9EL 3WFBH 5ENWA 1UM5L 2UZIL 2VC2B 4HS3B 4G8GB 2WN2A 3PU7A 1NBVH 4CKVX 4YNYB 5IWLC 1URLA 3GRGA 3QCVH 3PL6A 3R4DA 1E2ZA 4FTVA 1JG9A 2A77H 3FH7A 1MPAH 2PCXA 4G43A 5FV2A 3T0AA 1R5WA 3C08L 3GYRA 3HMXH 2WLYA 1I3RA 1A7OL 1T5WA 4GKZB 3RB5A 2NZ9D 5I5RA 4HW6A 5L0QB 2DPKA 1U95B 1GOGA 2QLVB 3C9NA 5DJDB 1UD5A 3UPAA 4QHMA 4WNSA 2WXLA 4BZ1A 1YNLH 4NX0A 3S8WA 1S9VA 4WGVB 4F8LA 5JDSB 4XNDA 4WVRA 1BQ5A 5DCCA 4LCUA 4X8GA 1UVQB 5B1JA 2XJLA 1TU2A 2VISA 1S5IL 2R2HA 3M17B 5TFSL 3C2SA 3AREA 4F20A 4ADJA 5CU5A 4LBEB 3DETD 1JZJA 2WWKT 4YBQC 4WU5B 4Y16C 5D7JA 4MBRA 2VW7A 2E6PA 3B7TA 5L2KA 3MJ7B 4APXA 1K4DA 4FAAB 4UQ9A 3NZ8A 4OFKA 3RX9A 5CGYD 3CXDL 3MC0A 1P2CB 4LEEA 5FDWA 4YHML 1EGJH 3BP7A 1KWKA 5FAAA 4G6KH 4EN3D 1H6UA 1JCVA 3T3PF 1KIUB 3S98A 3IJ7A 4I3GA 4D3CH 1FL3A 3IE4A 1BF5A 2R69A 4NO0D 4YGVB 2WLIA 5HVWA 2BSSA 4PJIA 4HBCL 1RK1A 4QY8B 3NIGF 1JRHI 4KRLB 1VHPA 1Z5YD 4XVTH 1LGVA 2IPTL 3RIKA 4OR1A 4HEPA 4CVZB 3QYNA 4JM2F 2IQ9H 4XHJD 3KJ6L 3CZNA 5D7JB 1ZMYA 2C4FU 3NPSC 1G43A 4NRXB 2NY6C 2CAKA 5B38A 15C8H 4LCWB 4MHHI 2RHEA 3EYUL 1N8OE 2VH5L 4GI6A 1FSKB 2CKBL 3FPYA 3GSVA 2QKIA 4JFEA 1RUKL 4X4ME 5IREA 4WUUD 4I85A 5C09B 4NUGL 3LNHA 1HHHB 1U8CA 3F62A 4X5PA 2B1HH 3ATFA 5HHOB 3RDTC 3QNZB 2YPLB 4R96B 5C0RH 2X2HA 2LFEA 4PW3A 5DMKA 2RCSL 5GS1B 3L3IB 1YEEH 3EH2A 4XMXA 1C12B 4WU7A 4YFLI 1UURA 1TT6A 2VO8A 4ZOAA 3BSHA 3BKYL 3T4AA 4ONFH 1I3RB 4PJFF 5KVGH 1WITA 3GRWA 2J6WA 1KY6A 4HXBH 1QA9B 5HJBA 5GRUH 5GZOC 2K3HA 3S5LA 3D9AH 2XVBA 4WQOA 4APQA 5BO0D 3FULA 3F6JA 1WAEA 5LQBL 2VNCA 1CDYA 2HXAA 5AOIA 5T3XD 1J0ZA 4HS3A 1QLRB 2B59A 5GRVL 4ZW7A 4ELMB 5MEOB 1W15A 3KWVA 4P5TC 4RFOH 3P0VL 4LT7A 2DWDB 3JVGC 4U1NB 2VLKE 3TFKD 2OLDA 5EBMB 1QEXA 4PRBA 4MD5B 4Y2NA 3PWLB 3MNZA 4IGBC 3S96A 3FO1A 4M6MH 4Y2LA 5EOQH 4QF1A 3ZT7A 1IBDA 3IJYA 3G6JB 2APVA 1CXHA 3SE6A 3L7FB 4XPHL 1VADA 3G08A 3H54A 3I9GL 4YFDB 3EGSB 3REVB 4FA6A 4KTDL 1I7UA 2FWLB 2OTUB 2ZX7A 1WT5A 4NIKB 3WFHB 1JTOA 1MHHA 3SQOH 3QK0A 4IRJB 3ZT6A 2JKWA 1U33A 4PLJD 1CFQA 2LQRA 3VXQA 4GMSL 3ZYJA 3AG1B 2WTRA 4OCSH 1MCOH 4CKQA 1ZHNA 3KPPB 1GHFH 3ERXA 3HBGA 4MD0B 2NX5D 4MJIB 5EDSA 1XAKA 5DEGA 5LGHL 5FYLH 2BCMA 3LQMA 4MMZC 3QUMA 4XPTH 1J8HD 3DX9B 2DTML 4W9LC 2O6EA 1FAIL 5KJRL 3OX8B 1H15A 4RETB 2FBOJ 5LBSA 1A6WH 2F68X 1BM3H 1JDCA 3IN0A 2LHAA 4N1EA 4EF3A 1A7PH 3GMQB 3KPOB 1SJVA 2GEQA 2FUQA 2ATKB 1KN2L 4MNQA 4RA0C 3GT6A 3PE9A 3LN5B 1UWGL 3L08A 3ULVF 4PB9L 1T3FA 3WU1A 2F6AA 2WQWA 2AJ3B 4FQCL 5CCKH 4HJ1A 1G7LA 1OPGH 4U6XB 3NSDA 4L2YA 4DCQB 1QBLL 4PJ8B 4XRCA 3BN9C 3VD4A 2DWTA 3SDAA 1U3NA 2VDKB 4JFPB 5D96C 2XN2A 3F04A 1JI1A 3MU3A 4JG5A 4XP9H 5KSBA 1E5CA 3FSVA 3QZWB 1I3GH 2HN7B 1WEJH 5IBLC 5C0CB 1JGEA 1PEZA 4ZX5A 3ZSTA 3ARDB 1OSPL 1I85C 3W2DL 1A4CA 3IMRA 2N0KA 5CN1A 2VLLB 4V1DE 4P2OA 3KS0H 4PH8A 5DF0A 1R33A 3DXAE 1EH9A 3QI9D 4D9LL 3B1TA 5EORH 1HIML 5KW9L 4F5CE 4JW3A 5CIPA 4DVBA 2IDCA 4IEFA 5DHYB 2R15A 1ZDQA 1LD9A 2CO3A 2XN9D 1O9ZA 3JTSB 3FTYA