4AL8C

Structure of dengue virus diii in complex with fab 2h12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'SYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENVELOPE PROTEIN
molecule tags Immune system
source organism Dengue virus
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
total genus 13
structure length 98
sequence length 98
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4al8C00
1Z66A 3N40F 4FFYA 2R29A 3C5XA 3C6EA 5JHLA 4UTCA 2JSFA 4UTBA 4BZ2A 4AM0Q 1ZTXE 1OANA 5LBVA 1UZGA 1OK8A 1URZA 3J2PA 2H0PA 3N41F 1TG8A 4X42A 3UZEC 3VTTA 5KVDE 3G7TA 4UT9A 3UZQB 2P5PA 1PJWA 1RERA 1S6NA 1SVBA 4ALAC 3N44F 5GZNA 4FFZA 4AL8C 3WE1A 4GT0A 5GZOA 4L5FE 5KVFE 3UAJA 5KVEE 4UT6A 5IREA 3N43F 4FG0A 2JQMA 5H37A 5LCVA 4GSXA 1Z3RA 5JHMA 2I69A 2JV6A 2GG1A 3IRCA 4UTAA 5B1CA 5LBSA 5AAMC 3UYPB 4BZ1A 5IZ7A 3P54A 3N42F 5AAWC 2V33A 2ALAA 2HG0A 3J27A 5KVGE 3UZVA 1OKEA 2R69A 3MUUA
chains in the Genus database with same CATH superfamily
1Z0NA 4OCWH 3AB0C 3WFDL 5JHLA 1RH8A 1TQBB 3KJ6L 1RIHH 4HXBL 1C5DB 2XTJC 3O0LA 3T3PE 5AAPA 5HHME 3L9RB 4IMLA 1NFAA 1CI5A 3QZLA 5CXPA 3ZDZB 3FB8B 3RHWF 1PFCA 3LNFA 4TLTA 2UZYA 2WBJB 1MY7A 4WW1B 1C5BH 1F3DH 2XJLA 3V0HA 3BVDB 4PLOB 3R0NA 4PRHE 5AQ0A 4AYID 3VFTB 4OSUH 1HSAB 3AS3A 4YK4C 1Z9SA 3DTUB 5GHWL 4OJAA 5L4FA 3SEPA 4Z77B 4U1LA 3RWGB 5ICZB 2CJSA 3E80A 2V8LA 2Y1ZA 3MV8D 2CALA 4PJDF 1XL4A 4XP1L 1EHKB 1L4IA 1SM3H 3HR5A 2DWEA 2W60A 5DJDA 5DHXB 2EDNA 4LARL 1JV2A 2XZZA 2CG9X 3AW5A 3FOLB 2XNAB 2OI9C 1L0YA 3IDMA 1PDKA 3Q9QA 4D94A 5MENE 3VD4A 1RHFA 4OCMC 3BYYA 5IROC 1NBCA 4ZAKC 5IEHA 3VXSB 4HJTA 3CE1A 3K3QA 1MJ8L 3CFEA 3ZDYF 1OD7A 3WFBL 2DD8L 3ZMEA 5BVJA 5KANI 2N7SA 3OAZH 4JY4A 4F7KA 2VE6A 4ELMF 3PGDA 1VFUA 2DMBA 2YQGA 5LGKA 5EO1B 2WW8A 4W9EC 4AK2A 3AT9A 4QHNB 1FZMB 2CU9A 2XG4A 3K6NA 1FBIL 1QTYT 3CVDA 2ZX7A 1NCAL 5KN5A 3IWVA 1IEHA 4KTDL 4P2QA 1JGEB 5I73C 1KN4L 3U36A 1L5GA 4Z8FL 4O02B 2JF1A 2A73A 4N0FB 5E6IA 1G7MA 2LLLA 1BMGA 2ZG1A 4WHTB 4MKTA 1DN0A 5C8JB 4N3UA 4OR1A 4IJ3B 3UYRH 4OV5B 1TZAA 4GT7A 3DBXA 4NKIH 1DQJB 1OM3H 3CVCA 3NMEA 5CSZA 4K71C 5A3ID 4BYHA 2XWCA 4U1NB 2H6UA 3D08A 5T3XL 2D73A 2EIZA 5CEZD 3UJTL 2FUTA 1CQYA 3FQUB 1I4FA 2P9RA 2ZUVA 4Z0XA 2I9LB 1X9UA 2AGJL 3TLRA 4NWTH 1OLLA 2P26A 2DV6A 3N44B 4LLQB 2L7JA 4UANA 4UDTB 1ZD6A 3JWDH 5AYTA 1KCRH 3QFJD 4H1LG 3RNKA 4L8BB 2XWBB 1HI6B 3C6SA 1SLWA 1OSPH 5F7UA 5KOVC 1DLHA 2YD9A 4RBPK 3FT4A 3HFMH 2MQ3A 1UCBL 4MA3B 3M1BB 3AC0A 6FABH 5IR1A 3APNA 1QD0A 1Q9KA 3F01A 5KYUB 1NLBH 1JHKL 2ROYA 4GKSA 3CZNA 3UTOA 4KDTA 4OF6A 4PV8A 1GZPA 3CN3A 3OB0K 3BYTA 1KSRA 4APXA 1CG9A 3VXRB 4LFHD 5DDHA 3L1GA 2VABB 4MB4A 5AOKA 2FATL 3U48A 4CJ1A 3FU6A 5JDSB 3QC6X 1JGDA 1IGIL 3MLTA 2QPSA 4PI0A 5LBSA 4MLIA 2COVD 2VDKB 2VNCA 1IFHH 2VW4A 4PHXA 2A74B 2GUYA 3O81A 1A47A 4M7ZB 3KD4A 1QUNB 2DQGH 3GIZH 1G0YR 1HINH 4I0PC 5T33H 1UB6B 3QWRD 4Z7OB 2XTLA 4FNPA 5GGRY 2DLFH 4WHYG 1PQZA 1BJMA 5AW7B 3K80A 2FJFB 3IF1B 5ALBH 3FFCE 4BFNA 3PGCB 3RKDC 2OMYA 1GC1H 4MA1B 2N3JA 3MNZA 4HIEA 4MSWB 2HFEA 3DETC 4N2IA 3V7MA 5C3IA 4H20H 5H37A 4ZG1A 1JL8A 1P4BH 3U4BL 5D9SB 1KN2H 4XNMB 2XN9B 1ZPLA 2AVFA 3LZFH 2ZPKL 3FTWA 3I02B 5HGBA 3ARDC 4W9GC 4CADB 5FO9B 2R4SL 2FE0A 3OZKA 1KJ2A 1B4JH 1P4UA 3OLDA 3EXJA 1ZLWK 1A9EB 1JZIA 2AKRB 1TJIH 1MCIA 3RX7A 4DKEL 3KPMA 4MDRA 3RDTA 1U3YA 1XZ0A 2Z0UA 1MIML 4JO2H 2OYPA 1Q94B 1W72B 1EH9A 4Q58C 3OQ3B 1WTGT 1YNTF 4U3SB 5E99L 3K6SA 3OAWA 4ONHB 4ZQKB 4W9FC 3VRJA 5FCUH 5AAMA 5E4AA 2NY2B 3VG9B 5C0BA 4F33B 4DNLA 1MCCA 5IFAL 1AFVL 2A9ML 5E03A 4WY7L 1U58B 1GY1A 2I5YH 4HV8B 2D7TL 4XRCB 4PRBA 4AG4H 1PCXA 1GTFA 3HPLA 5C0JB 4Q9BA 1NIAA 1WFMA 5IB5B 1AGEB 4JPKL 3UTZA 2P8MA 4OCXH 1BF5A 1E42A 2R23B 1CQKA 1HQRA 2IALB 4B27A 3QDAA 4A04A 4P49A 3MRIA 3EJJX 1XB6A 4BDVB 1AHWB 2HPOA 2NY1C 4AQOA 1AGDA 4XBGA 2FLMA 4ZD3H 3OR6B 4N2BA 2W0FB 4DK5A 3EFFA 2XVGA 2G5UA 4QJ5B 2FWLB 5E4OA 2F6AA 3BDXA 4QTIH 2BC4A 3ZRFC 2FJGB 4ODWB 4Y2DD 5D7IA 5IOPB 1A0QH 2ZAHA 1D5XA 4RETB 3X13A 2VDOH 4U1GB 3IDJA 1FZJB 4ODHL 3GPEA 5HDBE 3PPSA 4WI0B 3ZQXA 3O8XB 2BIPA 3UZEA 1NL0H 1QFOA 4NWTL 1AOHA 1E65A 5ESQA 4HOMA 4LCWB 5AYUH 3SQOH 1T89A 5B39B 4I87A 5CMAB 2BXYA 5TJWK 1W6LA 4MJ6B 4E9QA 2AEWA 2VUOA 3B7SA 3V5HA 2YC1B 1XAKA 2EAEA 2WKGA 3KPRE 3QJFA 4WK4B 4NQDE 5AB2A 3BAEH 1MRFH 1LLAA 2WXQA 2K70A 4PLJD 4JFYB 4KRPC 3RNQA 3CK0H 5K59F 4NXKA 3TWCL 5I0ZA 1E2ZA 3PWVA 3WS6C 3C2AH 4Z7NE 1JK9A 3SE9L 5TTRA 4RISL 3UROR 2YQ2A 5GS1C 3DPDA 4UV7L 5IROD 4HWBA 3B5GA 4OKVB 5KYXB 4XPBH 3DI3B 5IHUH 5BZDB 5KVGH 3SO3C 4LZKA 2YPKA 1M2OA 3IU3A 5F3HA 1MFNA 1KB5L 2YPLD 4QHUB 2AXGB 3VA6A 3P4MB 3OHXC 4TQHA 3B8SA 4QF1B 1BYPA 3VB9A 4WGVB 3WHE1 5BW7C 5JPMA 1CLOH 2L0DA 3D6GA 4YSDA 3W2DL 1HL8A 1RMFH 5HVHB 1R5IA 3T0XA 2G0LA 4UQAA 3ZKMC 4DP2X 3QZBA 4WNQB 1U3HC 3IB4A 2C3VB 3K8LA 3BKMH 3QIUD 5ICZA 1CLZL 2V2TB 1MUJA 2NY2C 3VG9C 2H2PC 5CP7B 1S9YB 1E9QA 1CE1H 2F8IA 3HOGA 3NA9H 2OCCB 1IAII 2WXKA 2A6KA 2DQCL 3NAAH 2XNAA 3SYOA 5L2KE 3UJJH 5GRVL 4RMTA 1RIHL 2FX9L 4HXBH 4NCC2 2XTSA 5I6LA 3ECUA 1T21A 2QGCA 3OZ9H 1QSEB 3O6FD 2K3TA 3AXLA 3QGVA 4JFOB 4APQA 4HWBH 1OAUL 3GSNA 2HP4A 4NQVA 5E0FA 1N7MH 2PUQT 4BKLA 2BDNL 3T08A 4X9GA 1IAKB 4JZOA 15C8L 2ZSWA 4PRDA 2PCPB 1GKOA 2IWFA 3L3HA 2YSTA 3JWOH 3OGCA 2OP4L 3P9MA 1ASOA 1BX2A 2ITDB 4XWGH 4WO4C 1HS6A 4ZMWA 1FV1A 4R0LA 3C5JB 4HH8A 2WIIA 5IJVA 3QQ9C 3JTTB 4I13B 4XN9A 4JM4H 3HE6A 2WM0A 2ATKA 4WUUA 2C9UA 5IMKA 3ATDA 2WBXA 2BNQB 3VFPB 3IFOB 4PJ5D 3G6DL 5HHVL 1JI2A 3V9EA 3QCTH 3FS9A 5IJKC 1DQJA 3IU4H 4HK3N 4IDJH 1EXUB 5E1HB 1BQHG 3LAFA 1T1ZB 2X4RB 4P3DB 1OAKL 5HXMA 5D6CA 2XXGA 3DHUA 2WKOF 3FQUA 4Y4FB 1I4FB 4N1CA 1BQHB 3QZWB 4X7SH 3ZTEA 3PUUA 3TJEH 5IQ7L 3D3VD 4GXFA 4KUCD 5JNYB 4J27A 2P8LB 4M6NL 1J8HE 1FJ1B 3ARBB 2DI8A 3UC0H 2WNKA 4PEEA 3KHOA 3E2HB 5E6ID 4GSXA 3VFGH 5I28A 4K8RH 4QTHA 2DMKA 1CB4A 1XH3A 5HVGB 1T83A 2MMXA 1XEUA 4I2XB 3RAJL 1EAQA 5DO2D 5AVSB 4H40A 4Z78B 2EKJA 1EFXB 3IDGB 4KTDH 5TK2A 2Q7AA 3TZVC 5JQIB 1A14H 4Y9GA 2HJLA 1WV7T 4IRSB 5C70A 1MCNA 1JNHB 3WN6A 2QSCH 1GGIH 2NY4D 3N41F 1TJGL 3APFA 3EOYG 4AV5A 3MCYA 4X4XA 1MJJA 1RUQL 2E6JA 5D2LF 4MXQD 3ZMRA 5CGYD 4HMEA 4U0RB 1KUMA 3K0YA 3LRLA 1LO0L 1MPAL 4FEIA 4P5KB 1D7CA 1MCHA 4AQAA 2F8VA 3NSXA 3BUDA 4GAFB 4XCYB 5JZ7C 1JGLH 4HBQA 4Z0BL 3BKCL 2GY5A 4CNIA 3U9WA 2J1WA 1C7SA 1CFBA 4YO0A 5T1KA 5B3JF 1RHHA 2N59A 2BZCA 1NEPA 3GHEL 2X42A 4KRPB 1KEMH 1ERNA 3SY0A 3LN4B 4ODUB 2PYFB 1M6OA 4ZUSA 1BM3L 5B1BB 4BH8A 2BVOA 1HXKA 3VM7A 5DSCB 5JXED 4AKPA 4QJ3B 3ASWA 1S7UA 4JPIA 4YBQC 4MNQD 1Z5LB 3CSYA 4FQXC 2WUBL 3PJSB 4IKKA 5DC0A 1GGCH 3NRFA 1ZLDA 4JKWA 2OK0H 4FQ1H 4L2YA 4XCCH 4M61A 1QSFE 4QGTA 2QT6A 6CGTA 4ZSOE 3L6FB 2WWOA 4NC1C 1CDUA 3CZGA 3FO1B 1DQDL 5H94A 2VAJA 5ESAA 4XOBA 1X3DA 4XNDA 3V6FB 1NAKL 1MRDH 2V7NB 3E8UH 4ICXA 3WHXA 2ZZUT 2HT3C 1XX9C 3NFNA 1RZ8B 1J05A 1K72A 3MR9A 4MD4A 3UBFA 3CFBA 3MKGA 3KYNB 3QK0A 4Y5VB 3ARED 3QQ3A 4IOIB 3FRUA 4PJIB 5TGBA 3ZE1B 1OGAE 2EYSA 1NMAH 3C6LB 4W4OA 1AZVA 3H85A 5T5NG 1GZHC 3TO4C 3VJ6B 3BMVA 4OCRH 2J3SA 1URIA 2C4FT 1GC1L 2PNDA 3SKOA 3FC8A 4GMSH 3WFEH 2IDFA 1V3KA 4UUJA 4UT9H 4WW2A 4AH2B 3Q3GA 1Z32X 4NB7A 1ZA6B 1GAFL 4Z3TA 4PBDA 2J73A 4KFMA 1AAJA 4D8PA 4GINA 3IYLW 3TYFA 2WZ6A 1EZLA 4FDWA 5DJAA 3EOAB 4LP4A 5JIHA 4P59L 3RHWK 4N0CD 5B38G 5FDWA 2NX5E 4QCIA 3MRLB 4KKNA 2TRYA 4HGWA 4I5BB 3OR7A 1NGYA 2WWKO 4N2DA 2WYZA 1KCUH 1KYOJ 3DX7B 2LW3A 4WAFA 4KKCD 2QGDA 3OC8A 4H5SB 2PPFA 1LE9B 4YDJA 5I9QC 5I76A 3W81A 5BCAA 3D0VB 4KTEH 4I0PD 4YPJA 2XI9A 3GPSA 3PABA 3IGAA 4M03A 3SYPA 1U36A 2HUHA 1ZVSA 3T3PF 5DUBA 1AKPA 3GMQB 2HZHA 3DURB 1Q0YL 4M5ZH 4A1RA 2X6MA 1LXMA 3ABMB 4XMLL 3GXDA 2DH3A 2HKFH 1EAOA 2ZXAA 4AX3A 5B39A 5GSVB 3G6AA 1LDPL 1KBKA 3C5SB 4GUPA 4ZTPH 4KJPD 4MQXC 3IKCA 2A9NL 3AWEA 3LMJL 1MF2L 5KVEH 1Y1UA 4YR6B 3U9UB 3DX6B 3L16A 1HH9A 4XPHH 3UEZA 5TDOB 4BKTC 4MWFA 4E0RA 1F4XL 1XD1A 4LBEA 5F72S 4JY5L 2EKSB 2ZG2A 1T89C 3MA9H 2AJ3A 4IBQA 4TNVF 2ERJC 5AUMA 2YAQA 5IIEA 5JW4R 3VO0A 2VH5L 1KMGA 3MUZ1 1IM3D 3KWWB 3O6FA 1CICB 4Q8BA 1LK2A 1AO7B 4CN1A 1B0RB 3RWHB 3L4CA 5I0YA 5EU3B 2H8PA 5F9DC 2ZNXA 1KGXA 3DO4A 4DGWC 1JZ2A 4DEWA 3QEHB 4M48L 3NPZB 3SDXE 1JVOA 4XZ4A 4Y7MA 1X6LA 4ANXA 3UTPE 4AUUA 3VI3A 4HEPG 1GCYA 4OLWL 3CHOA 4GNKB 1YPZF 2Z8RA 4FQ2H 4U1IA 3Q8EA 3DVGB 4WJKB 3KPTA 3TBYA 3RVUD 5FXCH 5ISZD 4G82A 1DQVA 3C8DA 4R4BB 4AGPA 3PGFL 3BQUC 2X53A 1IEAA 4WO4D 4L3CB 3W0WB 2WXIA 3KG5A 1EDYA 5EMYA 4XN4A 3BEVB 1YPZE 4Z76A 2EUWA 3CH1A 1QOKA 4X0KA 5IBLC 3VXOA 3K4AA 4F8TA 3FSVA 1DP0A 1ZHBA 4MMXC 3ETSA 2IDSA 4Q0XH 2R29A 3LV3A 5AZEH 5E2TL 5I1IH 3VAEA 2AV1B 2C9RA 3LHPH 4J1UA 1NWOA 1N8OE 1WHOA 1V7NL 4GB9A 4MBOA 4PW4A 3TBSA 4ECNA 1MI5E 5FEBA 5D70H 3VWKB 5DMKB 3HC4L 4G70B 5EOCJ 2F19H 2W80C 2KYIA 4N2EA 1JV5B 1YMHA 4DN4H 1A7OL 5SWSB 1AIZA 5IK3A 3AXLB 3GLDA 2XFXB 2VZ3A 4MJJA 1HT6A 3I74A 4OLUL 4X4YB 3D0LB 4M8RA 2HLAA 1SLXA 3B2VL 2BERA 2O6CA 3QNYA 1DVXA 3WNLA 3ASNB 3PAVA 4WNJA 5DRWB 3HB3C 1TNMA 5DF0A 3VG0H 3S35X 1E5UI 3HZYB 4FXKC 3DPBA 5KN5B 1MNNA 4NFCA 5CWSA 5DMJB 3MSPA 5HP5A 1JBJA 2MQGA 5HPMB 4BHUA 6TAAA 2BNQD 1VGEL 1SOQA 4JHWL 3DKHA 1G7MB 1NAMH 1TETL 4W9HC 5C09B 3US1A 3BWSA 4NWUL 1R9FA 1IEBA 3KL3A 5KUMA 4WO4A 2W38A 4PJXA 3GDBA 1VGKB 4OUOA 4ES9A 1SMDA 3L8QA 4N20A 3GIVB 1KJ2H 4ONGL 2Y07L 5JIQA 4TL4A 1KXHA 3DDFA 4Q56A 1XO8A 3U4KA 1NTDA 3WXVH 1M4KA 1PKQB 4XP4H 4JFEE 1F58L 4LLDA 4HHAA 1W0VB 5GS0L 4F1SA 4M5YH 3ZL4L 2VLME 4K3GA 4XC3L 2XZAH 5CBAB 5FOJA 1FP5A 3BVNA 4J2QA 4A2FA 4KXDA 4ELKA 2FBJH 3Q6FA 4JGUA 4EMZA 3RWFB 1AZUA 1G7PA 1MHHA 1GYVA 2KLTA 4IRSA 3ZJAA 2JCCE 5KSUB 1FL6A 3DX3A 4S1SH 1VLXA 4L4VD 2M1KA 2YRLA 1B6UA 3IU4L 1LK3H 4IDJL 1HTYA 3VFUB 5KBPA 1D9KC 3BH8A 3S37X 4NPYB 1G9EA 4I4WB 3DLQR 1IBDA 1GYAA 2VXVH 3OD3A 3GJFA 2MCMA 1JNNL 4Y2DC 2JCCF 5ACZB 2AABL 5CJOH 3RVTC 3CZLA 1AR1D 5D7KD 2H32B 2R0LH 3VGAC 1KPRA 4S1QL 3ZN6A 2Y22A 4IRJD 3CN1A 1SJMA 1P5UC 4WFHE 1V27A 1JWUA 3ZLQC 3RIKA 2MKLC 1OAXL 1U8CA 2WN2A 3WO4C 2HAZA 5HI3D 4F92B 1PEWA 2CUHA 3MUGA 3BH9B 3QNXB 4MDJA 3RTQD 3SE4A 1LYQA 1BCIA 2P7TA 3CFMA 2WLMA 3CLWA 1RERA 4XAKD 5BV7C 4KROC 1L3NA 2ZCLH 3BE1L 4JFEA 3VXSD 4AIOA 1MELA 1CD0A 1KPVA 1INQA 2QKSA 4UV4H 1FO0A 1FVCB 5AVUB 4FI7A 1UYWL 5IW6B 4HEPA 3N06B 4G8IA 1A65A 4U49A 4AUJA 3IE9A 3V4LA 2ZUUA 4XPTH 2R69A 3OHXB 3JTBA 1SOSA 3JT0A 2WOYA 1DFXA 3KBFA 2QR0B 1I9EA 3EYVB 3VXQB 4PGBB 3B56A 1BMWA 3AREB 1DEEA 1OVZA 4P4KC 2ZUQB 1ZXKA 2JIXD 4PQXA 1U8HB 2OM5A 2BJML 4QRFA 3QUMA 4KKBC 4PS8A 5FX3A 5BS0E 1O7DC 2G60H 2WLNA 1T0MB 4ONHA 3KM1A 3FQ1A 4XX1E 1CR9L 1LWHA 4JM2A 3KVQA 1EEYB 1J87A 1KBWA 3STLB 5E9DD 1E43A 3H55A 4DP7X 5KS9A 1U33A 1V10A 3C12A 2FBOJ 3OKEA 1ZCRA 4NBZB 5T1LB 2OYLA 5J6HA 1QBML 4TS6A 2KI6A 3SN6N 1PX4A 4PTUA 3P3YA 3OMNB 5ALCH 5FYKD 5IB5A 1XSKA 4GLRH 5GGVL 2P8MB 5T5FH 4K0OA 1G94A 3EFOA 5HI3C 2ALWA 5I1CL 3IDXH 1EHXA 4JPVH 4NM4L 5SWZB 1D5ZB 3D69B 3Q6GL 5ISZB 2RACA 4MD0B 4GG8B 3PJLA 4HUVB 4U6HB 3ROLA 3T2LA 1R17A 1P53A 1G0DA 2HUEA 2QPEB 4X0NA 5HDQH 1UC6A 5IT2L 1L6ZA 4JHVA 1I7ZB 4LLYB 2Y5EA 3RGVC 4ZTOL 2W92A 4MRBA 3KXFE 1R3KA 4N8UA 3INOA 4PUBH 1JFHA 4ERSH 3IFNL 4UIMA 3D0VA 3E8VA 4JHBA 5GGSY 2FNBA 3UYPA 4LF3A 1T0NB 4ODSL 4AOFA 3L2NA 4NEHB 2Q6WA 5CINH 5ITBH 4G7YH 1PS3A 3SDCD 3AQXA 2GIYA 1SQ2N 2LVCA 4P2QB 4FXGB 5GGSA 2B1HL 4AYFA 3AITA 2XVKA 3AG4B 2IPKA 5MEPA 1CF8L 2FEJA 3C5SA 4GUPB 1A3RH 5T8IA 2DM2A 2LT9A 3PWLB 2WBJA 4WW1A 4X9IA 2F5AL 1NC2B 4FI8A 4IKNA 2B4CL 4NRYB 4N24A 1N5AA 3NVQA 3W11C 2PWDA 3W56A 2L3BA 2JSFA 4CC1A 2WSKA 3OKOA 1JHLH 4NQCE 3C5ZA 4Z7OF 4GRMA 4JR9L 3GMPB 4YHIB 5C08E 2R2EB 3WYRA 4Z7UB 4UTAL 3AGVA 1HX0A 3AWFA 3PG2A 4LLQA 4KVNL 4WWOA 1HZHL 5HGDA 3MV8B 1SHWA 4DO4A 1D5IH 1AI1L 1N0XL 4V1DE 4X4ME 3RWHA 1G7IA 5GRJH 1XWVA 3EADA 3W38A 3HNTL 5PAZA 3CD4A 1JRHI 4Q6IB 4PRHA 1QW8A 1A7QH 5DFTA 5DU7A 5FYJE 3GJEB 2CK0H 2ZF8A 3BN9C 2ZP0T 3FSZA 1PEZA 3FO2B 1UWGL 4UILL 4R96B 3WDIA 1BZEA 5EZIL 5D4QA 1XHHA 2P46B 2DJMA 4KVCH 1P5VB 1TYJA 4XVJH 5F7EH 3B37A 5DZPA 2X7LA 2EDDA 3VD7A 4APXB 5CR1A 5IHZA 1KXQA 3P0VH 2W91A 3B4NA 3NCJH 1RLWA 4W9CC 5T3ZE 5I1EL 4KGJA 2VM3A 2BNUB 3IAQA 3V95A 3GXFA 4I3RL 1C12B 3HI6L 4QHNA 4AWJC 4BV1A 3SB3A 5EIIB 3L4YA 3JWNC 4RGNB 4P9ML 3P4NA 3GXIA 2NLJB 5EUOA 1QKZH 1AZCA 2ALAA 3THMH 3PXJA 2HT4C 2LV4A 4Z3JA 3IETA 2CJUL 4G7VL 2C26A 3BQUA 5CJQL 4UZUA 3WJJC 3X3GH 4WKZA 2BOBB 2B8OT 1OSZA 3PQYE 4B7IA 4KFZC 3AACA 4L1TA 2PPEA 5AOMA 1R24A 4FNQA 4MNHA 3B34A 1XF3A 4DESA 1EO7A 4LHUA 3UPCA 4MAYA 2YD1A 4B9CA 2H0EA 4WFEE 1U8NB 2YAFA 2P5EB 2PCPA 5LB1A 3VXUA 1E8YA 4GKLA 2OQJA 4CVZB 3MX0A 4MVBD 1ACYL 4AQ1C 1B6DA 4GRWE 4FFYH 5KSAB 1IX2A 2WXGA 4XTRC 1HDMB 1WVZA 4M6AA 4OLEA 2VDOL 5F6HJ 4POZC 5CCGE 3II2A 3KNBA 3FTZA 1OEZW 2YEVB 1M71B 4JDTH 3PAZA 1UZ6F 3OLGA 4GRWB 2BMKA 1GZPB 2EDMA 2I07A 1F8TL 2J6EA 2PP9A 3G9VA 4M7LT 4OIIH 3SSGA 4M6OH 4N8PA 3IT8D 1DANU 4G9FD 1TFPA 3QUGA 4FZEH 3I2CH 4PJ8A 5D7LB 5JOFB 2P5EE 1MCRA 3EUDA 3ARFB 2VQ4A 1KENH 3MBXL 1QHPA 2H41A 4S2SA 1WLHA 4GKZB 5IROA 1WBZB 4ZTOH 2YUWA 1A7RL 2NXZB 4K3EL 4FJZA 4A55A 4FJYA 5FM5M 2EXYD 2VC2L 3LEYH 1HQRB 1Z3GL 3AS2A 3GTNA 1SNRA 1IBGH 4IU2B 4DZBA 2KZKA 1FH5L 4TVPL 1QA9A 1U3JA 1EPFA 1IBYA 2OL3B 3B9KC 3LPOA 1PG7H 1K8IB 2IAND 2CK2A 1T20B 3RWJA 1JNHA 3KPPA 4NQUA 3BVXA 1INDL 4P46A 5EBMB 5EZJB 4UINH 1D5BB 3HZKB 3BIKB 1PLGH 2VC2B 4TQIA 1SQMA 4Q9CA 1MWAA 4I4WA 4FI6A 1MAKA 2X9XA 1J9QA 4CADA 4AIEA 3A6CL 1N8ZB 4KX8A 4MTMA 4MAUH 2ZG3A 4YSRA 3MNDA 3PP4H 1TPXC 3WIHL 2WQUA 1J12A 3QXAA 1XF1A 4AM0A 2Y7QB 1I7UA 4MMYB 5IGXL 3EJZD 4XT1C 2CA4A 4G8GA 5E5LA 2D2OA 4L8SB 3GNML 3FU0A 2XYCA 2MOGA 3FTSA 1RJZB 4WV1A 4RGNC 3BZEA 3SDXA 3F83A 4F8NA 3UG4A 2F68X 2Q86B 4Y2DA 4CILA 1SDYA 4YOKA 3S5ZA 4I77L 1S9KC 2X4OA 3MODL 4NPJA 2C7UB 2VDOB 5C0EA 1SEQH 5DUPH 3FH5A 2Q2EB 2XX0A 1S7WA 4XP1H 3GM8A 3BO8B 5MEQB 1GYWA 4PRBB 2C5DC 4PJGF 2NUPB 3QPQD 5H94B 4BA0A 3V4VH 4PB9H 3FU5A 3TEXA 5AAMC 1QFUL 2KDGA 3L95B 3ZPDA 2R23A 3HHRB 2VJXA 5LGJB 4LBAA 3CBJB 3IGKA 4OKVA 2LVEA 3VTMA 1KIQA 1UD6A 1ETZB 1OK0A 1IC0A 3A5VA 4HCGA 5F7MC 1TQWA 3EDJA 1B9ZA 4BDVA 1WZ1H 1NKGA 3FRUB 4HK3J 1MFCL 4CMHC 3VWKD 1IU1A 4KMLB 5LUMA 4JO4L 5FGBA 3QUYD 3SDAA 2AEIT 3QEGL 4CU6A 1YEKL 1KCBA 4O5LL 2FUQA 3CXHK 2UWEE 2DBLL 4OQTA 1JTPA 5HDWA 5GISL 3ABKB 1N5YH 5ECGA 3BVUA 4AH2A 1NGXA 2ZKHL 3KXFB 4MDIB 1A6PA 2UZXA 3BD5A 3G5VA 4LSQL 4OM0H 2Z7UA 3HJEA 4HDIB 3M7OA 3V0JA 1VFBA 1HZLA 5EOTB 3ZUCA 1SJHB 1NGWB 4NBYB 5TDNB 1HAUA 4XWOD 4PRIE 2Q8AL 3SQRA 4HUVA 5IVZA 3T2NH 5IEHB 2OR7A 4QYAA 2YQ3A 2YD4A 2XVBA 4ONFH 5L88H 4F7MA 1UVQB 4HJGA 3QJFB 3WMPA 4JJOA 4BEIA 4EI5C 4Y1AE 5JXAH 2MPAH 3EJTA 3VGEA 4KQ3H 2VISB 3RLSA 5CJ8A 1D6EA 1DLFH 1ROWA 1EV2E 2Z8SA 3BAIA 4LL1A 3M17B 1W2KT 4TSCH 1H8OA 1RPKA 2UUDK 2A6IA 3JQOB 2CH8A 2BFVL 1L5GB 3IMUA 3MOQA 4HCRH 2EZ0C 5IMKB 1C9SA 3MRKB 4YLQT 1QR1A 5I8OH 4YLBA 5DQ9B 3HMXA 4F37K 3DYMA 3DBXB 1ILSA 3II3A 3BVWA 3NIFF 1A3LH 3OKDB 4NFDA 2BSSB 2DM7A 3BWZA 4NRXB 5T5FA 2GUOA 1IT9H 4BGDA 1CT8A 2VW7A 4Y4FA 4KWUA 2LGNA 1R5IB 2RBLA 3APMA 4K7PL 2FJHA 3TH2T 1S3RA 4BGLA 2EH7H 1TEGA 1MWOA 1XF4B 3OBAA 1J10A 4JFED 4X5QA 5BW7A 4XR8C 3BPCA 1E8WA 2LQRA 4NQDA 4B9GA 1CDGA 1A4AA 1OB0A 4KKLC 3P69A 4Y4KA 4NSKB 1CGWA 5C0GA 3K8KA 2MCPL 2AF2A 4G6MH 1KCWA 3BFOA 4NC2B 3TV3L 1PG7X 3GSXA 1T1WB 5E8EA 1AGBA 4FFTA 3ROOB 3CSFA 1QACA 1FE8L 2N1TE 5F1KC 3FHQA 4ZW5A 3MLRL 1UATA 1OSYA 3RVTD 2AXFA 3FKUS 1YY8B 1NBZB 4YXKL 2IPUK 1RUKH 3MLTB 3FUFA 3WMQA 2X9WA 1SF5A 2JLPA 1BX2B 2L8AA 1RJLA 2IIJA 1UD4A 2GBTA 4HX1B 1NIFA 2NYKA 3WIIL 5J11C 3TTSA 4KZDH 4U3HA 1YNLL 4R7NB 1PD1A 4JO8A 4WUUB 2WD0A 1OKEA 3PWPE 3P3TA 4WKZB 1YUHA 3WKYA 3SO5A 3T3MB 4JDVA 4JPVL 2SODB 1TSRA 5F89A 4D9QD 3Q1SL 4ZODA 4Y8AA 1ZS2A 2HRGA 3P3SA 4P04A 2ITEA 4WFGE 4U33A 2D7OA 1F1GA 1OM9A 1HHGB 3DXAD 1A6UL 2OZ4H 1Z2KA 3NCFB 1T2QL 5I5MA 5F1NA 4YSEA 2ATPB 4MNGE 3GSUB 4ZAKA 3U0PA 2OYMA 4DGYL 2KH2B 4ZUTA 1NCBH 4DPRA 4HG4J 1YEKH 2ZD0A 4HJ1A 4B96A 1MLCA 1I31A 1OAJA 3H3PH 1KLFA 3ZZ1A 1QFWI 3AFLA 5HHQA 3SPIA 2VR9A 2NTFB 3L3DA 4ZFGL 2Y69B 3BMWA 3QWNA 2YHGA 5TQ0L 2BP8A 5F1IA 3KW8A 4F5CE 2Z64C 2EVFA 3LEXB 2WPGA 5GZNA 4DZ8A 4U3SA 3GMMA 1DLFL 2EYSB 2OXHB 2X88A 4PGEA 5IG7A 2NY5L 2QTEA 5JOPD 2CLZB 2B77A 5TQ2L 1U2HA 3S2AA 1E90A 3V8CA 1WDAA 4WF7A 4A2HA 4LL9A 3LRHA 1G84A 5DC4B 4XCNB 5K1JA 3HCVB 4Z3IA 2NNRA 2AAVA 2EDJA 3ORJA 4LIQH 5I6NA 1G1OA 2VLRB 4TRPH 5FYKU 2PO6A 5LGHL 2YOAA 3QUML 4PR5B 1AY1L 2GVYA 3VVWA 2C1PB 4C83B 3G5YB 4NN7C 5L0QC 2HJKB 5I8CA 2FH6A 4FZ8H 4OZGA 4YWGL 5L2KA 1MFDH 4KPHL 4L4JA 2V3FA 3MRMB 3PHOB 4WTWA 1A9BB 4XBGB 2CGZA 1WPCA 1XSIA 3NJLA 4MYPA 1UUNA 3NGBB 4FXLA 4ONOA 2XKUA 3MNZB 4MSWA 1ZLUH 1F1AA 4FA7B 1IIKA 3WTTA 2VDQL 1IUZA 4PREA 3UTQB 1OY3B 2B5IB 3D3VE 4JDTL 1E3FA 1E9PB 1DVSA 2HYMA 5I76B 4RGNE 3CZUB 2AI0H 4PJIF 5L2JA 2PWGA 5BXFA 4WI2A 2ARWA 4IHOA 2G9HA 3T1FA 2CCWA 3GMQA 4O2EA 2VL4A 4PJCE 3U46B 3BQUD 3UGUA 3D2UD 4KQ4H 2D7QA 2DYPB 5IQ9A 4Z5RB 2Y7LA 4FQXA 1Y6NR 4TSAH 4M1DL 5F3FA 4XBPA 4PCYA 4S1RL 1ZANL 2NY5C 2XA8L 4PJGA 1ONQB 1IM9B 4YUEH 3VTAA 4OBSA 1KBGL 1MW2A 5DRNB 3FDWA 3B7TA 5FPIA 4IBWA 3LCYA 5E2TH 2UXGA 4NENB 4E9XA 1O7SA 2K0RA 2JJVA 3VFTA 5DHMC 1XMWA 4J8RB 4NNXA 2QQLL 2QQKH 3SKOB 4Z7AA 4WV1C 3G5XB 2DQUH 3MV8E 3O45A 4OTXH 2BY0A 2VERN 4G1MA 5DHYB 4AMXA 4EAEA 1E3ZA 3O6FB 1DQML 1KELH 1FE8H 1BGXL 4R84A 3ETBJ 3FQWA 2HKAA 2CHDA 3DOIA 2IALA 2NY3C 4JVUA 4Y4HB 3PDDA 3C8KB 3QCUL 1S7SB 2V3EA 3QRGL 3QUYB 2WCPA 1ICTA 1HEZA 1GJWA 3POCA 4PBVC 1J8SA 4JHAL 1ET5A 2K7PA 2YEZB 3CFEB 1MOEA 3EDEA 1RK0A 4RRPA 4AQ8C 1NAML 4P2QE 3ARDD 1D7BA 1U8PA 5DR5H 3FZUD 1NBVL 4ODTL 4DN3H 4NRZB 1GOFA 1OHZA 4JRFA 4DJMA 5D96C 2HRPH 4GP4B 4PJAB 1CD1B 3GK8L 3WIHA 3WTVA 4JRXD 4HP5A 2JVUA 4PJ5E 3DMMD 2D7TH 3SDDC 5H4ZA 1QSFD 2A4EA 1CDCA 5GRUL 4TUKH 4ISVB 1XR8B 2IANA 2A73B 5EN2A 1D6VL 2ESVA 4K3EH 3Q8BA 5C07E 3VWKA 1QWHA 4XN5A 3UOAB 3JVGA 4G1EB 3H53A 4Z1PA 2ESVE 3FK3A 4URKA 2QFRA 5CSZB 4YE4H 4YGVB 3SDAD 4JFOA 5F0MB 1KTLA 2VRQA 4GO6B 4YDZA 3MXWH 1LMIA 3GSOB 3ENEA 3QNFA 3NABH 1TZGL 4RA3A 4KQ0A 2J71A 2YKLH 3EJZC 4ABWA 3HN3A 1WZLA 3DETD 4GAJH 4YDNA 4UDTA 5KVDE 1SYSA 1ML0A 1NPUA 3CUPB 2A6IB 4LSUL 1MCOL 1ZDSA 4H8WL 1BIHA 1OGAB 2A4ZA 1I8UA 2Y3AA 4UOW0 4QDGA 4IEFA 3HZMA 4L3ED 2J25A 1R3JA 1DLHB 4XH2A 3ULUC 5IWLA 5JO5B 1FN4B 4HWNA 3MLYH 5KTEH 4BCYA 1ADQH 4F7TB 1OGTA 1ZT4B 2AABH 4PJFF 1AS8A 4X6EB 4RMBA 4GSRA 4YPGA 1GMEA 3X3FL 4P48A 3Q6GH 5T1DH 4KOBA 3R4DA 5F96H 3P4MA 5CSGA 8FABB 5E08H 1KULA 1PLAA 4WFFD 2NZ9D 3U7YL 5DDHB 3W1ZA 4NQSB 4M62L 4OZ4A 2VABA 4CBZA 3K81A 3P11H 4RZKA 3IS0X 3RZWA 3LXAA 1TQVA 4ODBD 1WD8A 3QWQB 4JJ5B 3MV8A 4PJFE 1W72H 1XQ4A 2F54B 1Y0LB 4BXVA 4TSAL 1BYOA 1NPJA 2AJXH 5F21B 1JGVH 3IGUA 4EN3C 5I74B 2VH5H 5I19H 2YS4A 3GO1L 1V8HA 4QHMB 5SX5H 3S3DB 3GMLB 3LKNB 4AT6B 1JF1B 2EXWC 4N22A 3QQ9D 5K59E 1YEIH 3AZUA 4DK6A 2WZPD 4R96A 4A6YA 3LEVH 3UFIA 1NDGB 1EDQA 2HXAA 5DO8A 4BFIA 2JV6A 4Y7OC 1JS4A 2HJLB 3SPCA 2ZJSH 2KUTA 1VPOH 3H3BC 1VCAA 4NUMA 4N6RB 5IK3B 2LTQB 4K7PX 5IHZB 2PYED 5FUCC 3H2WA 2IEPA 1OOAA 3V10A 3MXVH 4JZOB 2VDRL 3RIAK 4BH7A 3QEQA 3T0DA 1EBPA 3H9SE 3LKPB 4QRQA 1EEUA 4FA8A 3V0IA 1CFSB 1YYLL 4R0LB 3GJFB 5CO1A 1XGTA 2IFFL 4YZFE 3PWNA 5EO9A 5CD5C 3D3VA 4PMEA 3F58L 4BCXA 1TEYA 4UAOC 4BFEA 3VI4B 2DQUL 4RWYH 5C0FB 2K6ZA 2VXUL 3CSPA 4X98A 3QJSB 4JREC 3I6SA 2NUTA 1UD8A 3SGDI 4M02A 3T77B 1WGVA 5I18L 3G04B 5FECB 1RIUH 4JDVB 3DIVA 1DVZA 3DJTA 3MUGB 2H3KA 4KUZH 1VGKA 1WA1X 5A1AA 5IESL 1REIA 1XF3B 2PO6C 2W81C 4UT9L 1JFQL 4WWNA 1BQHA 3GK8H 2DQGL 3SPVB 1U8NA 1KGUA 3MBWB 4TVUA 1WYJA 3ZXAC 1IC7L 1FJ1A 3T0WA 1R3HA 3NIGE 5LXGL 2RQEA 2ZXQA 4CMHB 3ZW3A 1YEDA 3FCSB 4KRPD 4UM9A 3JWOL 1MLCB 4FFZH 3WFCH 4AEHL 1PJ9A 3IJEA 1X9QA 4F91B 1Y7VA 1VB9A 2UY6A 4FABL 5FLVA 4WRLA 2PYEA 1SXBA 1EO8L 1JNLL 2K8QA 2CGRH 3WIIH 1N64H 3OXRA 3CN4A 4Y5VA 1F6FB 2EC8A 2J44A 3EF4A 4LEXH 1MCQA 5ABAA 3OJVC 1HHJA 3GEFA 3PL6D 5FUOL 3PWUB 2OXHA 5C2UB 2BSBA 3OL2A 1KCVL 4X4XB 2VDPL 1EEYA 4N87A 3SD2A 4CGUB 1DSYA 3VXUD 4P4KA 4Y5YA 3VE0A 1XCQB 4L18A 1KT2A 2X5PA 5BJTA 4X7SL 3QDGD 4HUKB 3LRGA 4IRSC 2IQAB 4O58L 4KTGA 1FZJA 1WBZA 4BWTA 1SLUA 4LIQE 1FAKT 2HX7A 1KPRB 2WYTA 4PRIB 2B9BA 5IM7A 3TONA 4OGYH 2NY2D 5DD5L 3EOAA 2E9IA 3QIUC 5FHAH 2GK2A 2IQ9H 1BLNA 3P02A 4JCMA 3AM8C 4FP8H 4NKQB 4U2ZA 3U30B 1DVUA 2YPVA 3QIWB 3V5HB 4OF7A 2GW5A 4N90D 4Z7VF 5GRXG 4Z7QE 3WS3A 2EH8H 3QI9D 4XZUA 3LQAH 2V7HA 1AP2A 3HHSB 3GO1H 1RZ7H 3CU1A 4GQZA 1K8DB 1J1XH 3CXDH 4EBQL 4ODVL 4E9YA 2BVUA 2WJ7A 1KOAA 3M8OL 2J8UE 3V52L 5C0AD 4IMLB 2G5BB 4J28A 3LY6A 1OGPA 1T3FB 4FQJH 3X14A 2XG5A 4XBPB 4QRUA 1Q9WA 1T4KA 5DTFA 4IW4C 3TJHD 4ADGA 4F9PA 2NZ1A 1AR1B 1HVXA 4UQ2A 2NXZC 2J55A 3O6KH 3BLPX 2ZOOA 4NRYA 2J12B 1BXAA 4NZJA 1P9MC 3LRKA 2WK2A 3E6HB 5FO8B 1IGFL 1AO7E 1G9NC 4YHIA 2IFFH 5J6HB 1HOEA 2Y5QA 4X42A 3R06B 5AZEL 5I1IL 4EUPB 2XWDA 3BZFA 4PP2A 2EE9A 2GSGB 3D48R 4R8WL 4CSTA 1E9QB 1ZLWH 4G42A 2XV3A 4HKBA 3C8KA 2R1YA 1CL7H 5DHVB 4IRZL 1F02I 1D5MA 3GJEA 2LU5A 3CVHH 3JWNE 3QDJE 3VCLB 2BP0A 4MD0A 5ITFA 5IZ7A 4K9EH 3ARGB 3BDYH 4OZIB 4OD1H 4CDHA 5FUCE 4LPVA 3VGAB 4LLWA 1NCNA 3GSNB 4YQXH 3PV7A 1IAIM 2QTVA 4JLRA 4YDJB 3ZTNH 2O5ZH 2NY0B 1UM6L 3GWJA 4K5MA 5EO1A 1X5ZA 1G6RH 1IC4H 5GRVK 4XN2A 1RULH 4G5ZH 2BO0A 1W16A 3FN9A 2V37A 3SE4C 3PHAA 3TBBA 4B41A 4ZFOA 3F04A 5IJVB 4QHPA 1DBJH 1PSKL 1RP9A 3ETBF 3L9BA 3DROB 3RGBA 1KCRL 3SKJL 1RMFL 3MRFB 2WLHA 2P5WD 5LBSH 3GZPA 4YR6A 3FO9A 3Q44A 2NZ9C 2AJYH 2E9BA 4HCIA 2CNYA 1UVQA 3EHBD 3B9KD 1VADB 2ARJQ 2P5PA 4XPFH 3D0LA 1RUPH 1GR7A 1XEDA 4MAYB 5I15L 3WXVL 1J1OH 4PJXF 1EGJH 3C5ZB 3VH8B 1XTMA 1DFBH 4OCYH 5D7LE 1ACZA 4HSQA 5FUOH 3ZL4H 1AO7A 4GBXB 4NO2A 4JFZH 2W59A 1G5AA 2B4CC 3K4DA 2IWGA 1KYUA 4PN6A 1NA8A 2XKNB 2Z6FA 1EZVX 4H8WC 4IKIA 4YDIL 3D85A 5HYQA 1F18A 1HHHB 4NN5B 2X12A 4MA3A 3VGDA 4ZDHB 3EFDL 2CUAA 2LFEA 1KB5B 3D05A 3K2MC 5FO7A 1KYFA 1KCLA 4ZO8A 4Z18A 3SJVA 1FIGL 1RCYA 2JELH 3BCFA 3HI5H 3UTSE 4YUEL 2PPDA 3E3QE 2YMXH 1IBFA 2UXTA 1CO1A 2VZVA 2QHLA 5DD0L 4K3DL 5IKCB 3D33A 4OGQC 1NSNL 3S4SB 4AL8H 1F4XH 1P7QD 3X1EA 4XHQA 1TKWB 2XXFA 1G6VK 1T0PB 3P40A 4YE0A 5C2BL 2MJWA 5ETUB 2AC0A 1Z66A 5DJXA 3VNYA 3ULUE 5IOKA 3IFLL 3QQDA 1RZFH 4ZMYA 4L4VE 1AJ7H 4XMPH 3A4FA 1RIVH 3MBEC 4YN3A 5JW3H 5JW5B 3WD5L 1FGVH 5H35B 4TL5A 1OSZB 1A4KB 4LCCA 4X5PA 1W8OA 3MLYL 1FZKB 4HJJH 1GXEA 3TCLB 2P5ED 3K46A 2BSTB 5DEGA 3WBDA 3LH8A 1HIMH 1CURA 5ID0A 5CBEA 4MJ2A 2V5RA 1Y18B 3HS9A 3N04A 3NIFB 4HKJB 3HC0A 5C6TH 4PS3A 3QJXA 2AK1L 2PLTA 3CSTA 3FO1A 5FGCE 5LG1A 3RPKA 1JZHA 1WAAA 2AJZB 1E5ZA 2WBJC 2WV3A 5AWNH 2WLYA 3HI1B 4WWKB 4NGHL 2EE6A 5KSAA 1OP4A 2DQFA 5HYEA 4PJ9D 4F8QA 3U6XS 4ZFZA 5LCVA 2DLIA 4GQRA 3NTCH 5FF6B 2EC9T 3L81A 2J5LB 3CFJA 2WXFA 4PS4H 4TULH 5EF3A 1EZUA 1J0IA 3I6GA 2PR4L 4I2XE 5E70A 2WTRB 4DTGH 1NBYB 5C0BB 3VJ6A 3CCHA 3TV8A 1L7TL 5C08B 4QOKE 2WBWB 1J8HB 4XRCA 2PXYD 3ATBA 4GKNB 4U6XA 5IHWA 4R7XA 1K5NB 1P6FA 5LCVH 2ZAIA 2X4QA 3CHXA 4F2ME 4RMUA 1I7RA 3QT2A 1DJZA 1VENA 5IREA 1QFWL 3DTXB 5GIRA 4HISA 2EDRA 1C16A 1RV6X 2C4XA 3BN3B 3IJEB 5J6SA 3BUTA 1YNKH 1R47A 3ESVF 4D8PB 5BV7L 3EH3B 4FQQA 1QG3A 5C0CB 5I0DA 1QPKA 1BAGA 4TSCL 3UAFA 1EJFA 2O6EA 3US9A 5FDWB 2BOCB 5C0DB 3FT1A 4LL4A 2B1AH 1HHIB 3Q2NA 2BHUA 5B7FA 4N0YH 4O2FB 5DZOA 1X5HA 2CBTA 3TJPA 7FABL 5DJ2B 5EBMA 1CLYL 2AK4A 3EFFB 1V7ML 1V3MA 5JR1H 2CGYA 2VKXA 3VGBA 3WUZA 3V0EA 4LCYB 1VEMA 1ZVHA 4XGZB 1CFTA 2C9SA 2B9AA 4NO5B 4V2BA 3GHBH 3KPOA 4YHML 3W37A 3CPLA 4R90L 3IGAB 1XCQA 2FO4A 4I18C 4KDTC 3GS7A 4O51B 2AGJH 1KYDA 1J5OL 4GAGH 4HEMA 1S9XB 1DE4A 5CGTA 4W1TA 5CN2A 2PO6B 2M26A 5AAWC 4KY1L 4HGKC 1JIBA 2LU4A 4BE5A 3SDAC 2FIKB 3HBQA 4H8UA 2QZQA 3ELQA 1X7SA 3E1ZA 4NJ9H 3ZU8A 4MAYC 5I19L 1C08A 3WFHA 4ZFGH 2IMNA 1K3IA 1YQ2A 4M1CC 3U83A 2IOMA 1U3HB 3QNXA 4MDJB 4Y2DB 3QO1A 2D2CC 3ERXA 1F5WA 4UTAH 4L9DA 1FI8C 3TH4T 4PPTA 5JUEH 4BWUA 1HWHB 3QAQA 3RL1A 2CUMA 4DO6A 2UWEA 1F6AA 3EJSA 3M17A 3S35H 4GRWH 3QISA 5FV1L 3BVVA 2F5BL 4LAQL 5BS0B 1FYTD 4I1NB 4J3XA 2QR0A 1IGJB 4X8XA 5K39A 3WKPA 3NCWA 4GH7B 4ZFOL 3D1MC 4WWPA 1KXVA 3EHBB 5EC1B 2BHFA 1N59B 3STZB 3L3KB 4H44C 3QUMB 2XBTA 2XXCB 2J8UA 4KV5E 3F6IA 4F9LA 1AIFA 2FHCA 4UBDC 4WFED 4PRAA 1NIDA 2VDMB 4JM2B 3BSGA 1GRWA 3GB7B 3UABA 5LHDA 2FX9H 4TV3A 4DO5A 3OC5A 1CFMA 2XWTA 2YARA 4IHBA 3D50A 5IFJA 4TNFA 4YHPB 2F8XC 2BY1A 5HGDB 2A6JA 5DUPL 3NGBC 4HJJL 4JFUA 1TEFA 1JTTA 3FB5A 2A83B 1AMXA 4PP2B 3EYQC 3NQIA 2FZ3A 4DKTA 4NQDB 1YECH 1ECYA 4HDIA 1RFDL 2ZSVB 4UB0H 4AIZB 2JJTA 3H7LA 4FQIH 4BZ1H 1QLRB 3QUYA 2VDNH 4RDQG 1D5MB 3ILQC 3C6LD 1V3LA 3UO1H 2E9GA 4E68A 4P9HH 1IQWL 3MHZA 1HILB 2VOTA 4LCWE 1AGBB 2KLRA 4ZW7A 3ROOA 4G80A 4L5FH 4TQ8A 1CTNA 3WEAA 1A1OA 2DDQH 4XO3A 5F7NC 1FYTA 1WBXA 4IKLA 1E30A 4U6YA 2VSCA 1JZ7A 3FOMA 3PF2A 4R4ND 4JRYD 2PR4H 4JFSA 1G9NH 2CUIA 3ECVA 1RZPA 2ZWSA 1U8KA 1YEFL 5DJCB 1G4RA 1N5YL 5BRZA 3HS8A 4HJIA 3KYMB 1PVHA 3B8YA 3LNHA 3MYJB 2VXQH 3DRQA 1QRNB 1QUPA 4OZIE 4JKKA 1AZZC 2DICA 3UJIH 3CFUA 4G9FE 4LEOB 3OQRA 3EGSA 3ET9F 1F97A 2PYEE 3BPLB 3O6LL 1OL0A 3GZKA 1Y07A 1K6QH 2P47B 3N40P 5L6YL 4M7JL 3HE7B 3BGMB 3F84A 3NSFA 4GFXA 4QRTB 3RYMA 1JD9A 1N5AB 3BIBX 2XX1A 3GHBL 3ME0B 1E67A 1CLVA 4WUKL 4Y5XB 4YHYB 1A6WL 2DMGA 4X8CA 5DRZA 1P4IL 3VXRD 1YEJH 2VTFA 1YNTB 3MNVA 4R5VA 3DSFH 3KLAB 1S46A 3O0RL 4YDKH 3P73A 5CEZL 1LO2L 3LTVA 1WT5A 5C0IA 4PJAF 2UUDH 5I1GL 1WCQA 3BPCB 4L3FA 1MCDA 2NYYD 3UBHA 2CO3A 3IPEA 3X12A 2V3DA 1JUFA 2WINB 4HMDA 3V0DA 2A6DA 2BM3A 4IGBB 1IARB 1MHEB 1EFXA 1GGBL 3I85A 4N2KA 5C09E 3FAXA 4O2CA 5C0GB 1RQ5A 2P52A 3E6FA 4ZO7A 4YXLH 2BVEA 1KPUA 2IG2L 1U8OA 5AL8A 3VTTA 3SGEH 4LGPB 2W9DL 4DZ8B 4RCAA 5E8EB 3IVKA 3JZYA 43CAB 3SOTA 3ZE0E 4U1JA 2APFA 1F4WH 4PJ8B 2B16A 3NEOA 2FJUB 1TTRA 1DQIA 4HSAC 3PP4L 4PIRF 4AQEB 3GRWA 2DPKA 4LAQH 3EJQA 1JHLL 4S2SB 3N85L 4MAYD 1BF8A 3FHEA 3LN5B 3UBGA 3FCUB 5GZNC 4X8GA 4DP5X 3HMWH 2GJPA 4U1SB 3PYCA 2A77H 6PAZA 1N12A 2I60L 2BX5A 3CHPA 4ETQB 2ZIDA 3IETB 5FYLH 4V2CB 2YLKA 3G5YA 1MCOH 1E28A 1P1ZA 4H8WH 4HUMB 5KVDH 1OP3K 2B15A 1ZKAA 2ZXCA 1TQSA 4OZGE 1YN6B 2W8CA 4FNTA 4M93B 2KLSA 4XXWC 2ENJA 3VWJC 2Y23A 3FQNB 4JFFA 2VLLB 4OFKA 3UBXA 3NZHL 2CLVB 1KYAA 4EOWL 4Z3GA 3QE5A 1BQSA 1HSBA 1OLZA 2EIDA 1Y18A 2K9UA 2EC9U 3BZDA 1SBSL 3AWGA 1Q4NX 3SKNB 2DQTL 4NT6B 2V6HA 5IW1B 4B0MM 2XPYA 3TIDA 1X5MA 4S1DD 2VDPB 1O5PA 3SO3B 1IAIL 3SIKA 1BOYA 4FGMA 3PWNB 3ZT6A 3HI1A 4EI6A 1I8LC 1URLA 2W1NA 3O9WA 1H19A 3VXRE 4BK4A 2YPLA 3DK0A 5A2CA 2UXVA 3TGXA 3KWTA 1QQDB 3WNMA 2EUZA 2P28B 2YD0A 4M3HA 4TF4A 3SDXB 1YRKA 1M71A 1IQDA 4BUGA 1N70A 4KTYA 3LNEA 3U6RA 5IJBC 4WWID 5KSAC 3L9YA 5GISH 5D1XA 1G9NL 2D3VA 4FTVA 1R5VA 5MEOA 3LKRB 5DVPA 3OKEB 3P0GB 2X2UA 1IQWH 5C08A 1UZ6E 5D72L 1BBDH 4QRPA 2V2WB 4K71B 2ORBL 4WSJA 1BFOA 5GQBA 3MCLH 4R7VA 5ES4B 4E41E 3D85D 2DKSA 1CK0L 2QPFA 2W07A 3C2SA 1P84J 4NQTA 4DOHE 3PHQA 4KH9A 3E9TA 1KB3A 1Z7JA 2NT1A 4G9FB 3IRCA 1KJVA 4HJ0C 2HJFB 4KZEL 4M5ZL 1T03L 1CD9B 1P4IH 2G4GA 2QQNL 4DGIH 2Z9TA 4P3CL 4XNXL 4AQ1A 1HCFX 1PZ5B 5EZJA 2X4PB 2HWZH 2WVVA 3MRJB 5K9OB 5GGUA 4ABQA 1IBZA 4F58H 3T0EE 1GVIA 2UYLB 1R1CA 4HW6A 3DX1A 2Z4QB 1WD9A 5CD5D 5D7JB 2LU7A 2Q6WB 3OAYK 4F15B 3CDZA 2FGWL 3L4XA 4G8EB 4JZJB 4L2LA 2VL5B 1KIPA 2Z92A 4JDEA 1RVFL 3MACL 5D1XD 4EVNA 3VXSE 1RJZA 2XV0A 3B2UD 5ICYA 3LXCA 1IM9A 1M7DA 3OG6B 5I0VA 3GJFK 2X44D 4L0PB 5HSFA 1FNGA 5GRZA 4NERA 4TUJA 3GSVA 1LQBC 1MY5A 2CGRL 4LSPL 4N0CC 2F7OA 3FT0A 4QI3A 3HNSH 2OX5A 1ZAGA 2EKSA 3KCPA 3RPIB 4G6AD 1E4JA 2JXMB 3RURA 1SXAA 4PRPE 1KJMB 3LQMA 2F54E 3JUYA 3FUJA 3RZCA 3F12A 4JRXE 4GG6F 4NKDB 4OLXH 5E9DA 2DIAA 2DS4A 3MI6A 2GEQA 1H5BB 3FQWB 2PTUA 1I1CA 4QY8A 3U1SH 2VMCA 2GPZA 1BZOA 4Q6IA 5JYMA 2FB4L 5JO5A 4KJYA 1R3IL 2JIXA 4J4PC 4XI5D 4E5XG 3RWDB 3CG8A 1ITBB 1JCKA 3F2LA 4BQBA 3JVFC 4OGYL 3WL9A 3VMNA 3QZPA 4JQIH 4IIQC 4JY6B 1NFDF 1QLEB 3N55A 2CIKA 3BISA 3NTCL 1NCTA 5HHMB 1LHZA 5LAXB 3TBWB 3NG5A 3BZ4B 2UVFA 4ES8A 1QSFB 4DP6X 3L4TA 4OJEH 1ORSB 4IOFD 4JRXB 3MV9A 1C12A 2F7PA 2WZ0A 2P24A 1P4BL 3MUUA 4MYWB 2UZXB 4LU5L 5FKPA 4FE9A 3HMXL 4CAGA 1I9IH 2GQHA 4EOWH 5E51A 3D39D 6PCYA 3FQXA 4PJEA 2ESVB 3CDCA 1YQVH 1FNHA 5TE6L 5IVZB 3OKKA 1DBAH 1OOWA 4H8QA 1HK6A 2NQ3A 2OZ4L 3BWUF 4JKNA 1U8MB 4LLWB 2JJSC 1KIUB 4Z23A 3MV7B 1GJIA 2AXHA 2VE6B 4HUCA 4JN2B 5EDSA 5DVLA 2BSRA 1OCOB 3HNTH 1JOIA 5EB9A 5ICXA 3RL2B 3IDNA 3JVGC 4GYBA 2QLVB 1TCRB 1GIGL 4XC3H 1MWAL 1O9VA 1SY6A 2Y4SA 4GMSL 1NBVH 1XXDC 2N01B 3MKKA 2CZNA 4ODTH 1E0OB 2JCCA 5DJCA 3WXWL 3H2PA 1TZOA 4AG4L 4LP5A 5BRZB 1ES0A 2OCJA 3U36B 4LMQI 1R3JB 4FYQA 4XNZC 3TCXA 4ZAKD 5CS7A 3OX8B 4KY1H 5BRZD 5E8NB 3LVEA 4ZFQA 4N5EC 3DUSA 4LCIH 2H6PA 2JKRM 1S7XA 2ZXEB 3NIDB 4IRZH 1HQ4A 2BMKB 3RDJA 1X9LA 2CDGB 3ME0A 2OMVA 3HC3H 3O11B 5EU4B 3N2JA 4KO7A 2QVMA 4OZ4B 4MNGA 1IB5A 3F7QA 1MW3A 1TFHA 5LG6A 3QPXH 4ZPTB 1SVBA 1ACXA 5IMOA 5A2BA 3Q0HA 5E8OB 4OFIA 2YRZA 3KLHC 1VFAA 2APTA 4QLWA 4ZNCD 2QSTA 1JDCA 3FT3B 1WTLA 1HHHA 1TF4A 4OZFB 3WELA 1IGTB 2KT6A 5BUGA 4ODVH 2HKHH 3OXRB 4LRIA 1BZ7A 3G6JB 2CIIA 4U1HB 3RWFA 1DBJL 4FFWD 3H42H 1UJ3B 4PWJA 4RGOL 1WT5C 5JHAA 3O9WD 5FA4B 4DW2L 1BQ5A 4BK8A 4J3OH 3RTQA 1J1PL 3U0WH 4WDIB 2NPLX 4XXCA 1UGNA 2LLGA 3NFSL 4FQCH 3OM3B 2QSVA 3VMPA 2P4AB 4UM9D 4P4KB 1L0XA 1MFMA 1FH2A 3IJSA 2ZP9A 4XN1A 1NICA 4FG2A 1HH6A 2XYBA 3LN5A 2ZOTA 5JPNB 1VDGA 2B59B 5EIIG 3NCCB 3A67L 3ALXA 4PJDA 3U6XA 4OZGB 4YL4A 1N2RA 4OI8A 4NQXA 3SDYH 3LSOB 3S5LG 3T77A 5H8DA 3G04A 1QR4A 5FECA 2G2PA 3PNRB 5JHDD 4BHUI 1X5JA 2NQDA 4NCDA 4R8WH 1E4HA 4ZNEA 3U9PH 3UO1L 4HAGA 4HS6A 5IBTH 3TNNA 3QDGA 2XXMB 2D03L 1A7RH 1QWNA 4OGXH 3P9LA 4OGAC 1CLOL 3MLRH 3E7JA 3ZHDA 2X4UA 5ILTH 5HGAA 4PJ8D 5C7XL 4OSUL 4DCQA 2XBZA 2MQCA 1JZJA 1FNSL 3MJ9A 3O2DA 2OMXA 3E0GA 1LEIA 2K7QA 2YA1A 1PZBA 1SUHA 1T6VN 1T2JA 2BP8B 1Q9WB 1T4KB 2X6AA 3EH1A 5DXWA 5F1IB 1HEHC 5ECJE 5GGVH 3MROB 3T0AA 3S88H 2IPUG 4IOFC 4ABUA 3ZZSA 4Z7NB 1UKQA 2HVKA 3PWUA 5IVXA 4ZPVA 1UXWA 4HWZB 4B5ZA 2OL3H 2DQEH 3E6HA 5FO8A 4KUZL 4MHHG 3GRWL 4K23L 2WLIB 4P2YA 1ZWIA 1MFEL 3OZ9L 1X9RA 4N9OB 4ANVA 1LD9B 1BFOB 3AU1B 4U0QB 3MRGA 3MMEA 1HJBC 4UQDA 3FXIC 4KHXL 3H7BA 3QHTC 4PJ9A 1FNEA 3FSOA 2BDNH 1IC7H 3ZDXF 5IB2A 1S78D 2D0GA 1K4CA 4NM8H 3K4ZA 4HKBB 2R1YB 1YMMD 3KVPA 4POYA 4AKOA 2EYRA 4WLCA 2F74B 4FYRA 1Z3RA 2YEZA 5HDLA 2ZXGA 4U7KA 5G5DA 3T0EC 2JKXA 3PWPB 1QRNE 3D8MA 2WXOA 4OVVA 4FJ6A 4UAOB 4WUUE 3BUYA 4XVSH 2YBGA 4HVBA 2FAUA 2AQ3A 3GBNH 4Q6IC 3QFDB 4YXHH 3VXPA 5EEZA 1OAYH 4D9LH 2Z4QA 2ZYIA 4NP9A 2AV7B 3FT2A 3QVAA 4A67A 2QPDB 4BSWB 1QBBA 4ELDA 1GS7A 4F8OA 2XA3A 5IV2B 1DE4B 3HE7C 2H45A 1JPGB 3VFWB 4BIKA 5I6PA 3FAWA 3B7UX 2VDLH 4AYFB 4DGUA 2XG5B 4KV5F 3BSZH 1VSCA 1BAFL 3MRKA 2IOIA 4JGNA 2LAGB 5C6WH 2N7AA 5HI4D 4H1LH 5BRQA 4PRID 2Z31A 2ED8A 3NZ8B 1FPTL 4PGZA 5EUKA 3X2QB 4JNXA 5DVMA 1UZ8A 1JRHH 4X6CB 5LDUA 2Q0ZX 2IPTH 4HJSA 2P1YA 4FOMA 1FWXA 4A7UA 3ZSSA 3U2SA 3HAEB 4F9PC 3WNPA 1GGIL 1KJMA 2B08A 2H7WA 1CGXA 2R59A 3GLZA 1PAZA 2OXGB 1W0WB 4EUPA 1DO5A 4JRLA 4GIOA 1K2DA 2XQ0A 1PAMA 2H1LM 2EIMB 4EF3A 3N91A 2EDQA 3CFDA 3TC9A 4LFHG 2KQNA 2CWRA 1J5CA 3EJCA 4ZXBA 2BSEA 4KJYB 5EHFA 3BI9X 1BZ9A 2PABA 2HMIC 5AWNL 2P49B 3FSWA 4WSGA 4R7LA 1FA4A 3GBEA 1NFDA 3DX2A 1OP9A 4G71B 1BM3H 5EN3A 3NIDF 1ZEAL 1KTRL 4FG4A 1VFMA 1Z9SB 4N2OA 3RG1C 2EEFA 2IXQA 5C3LD 3ECBA 4QNPE 2NNXA 1I53A 2QV2A 3D25B 2ZKMX 5D93C 5B1JA 3T09A 1MDTA 3REWB 2IBZX 1KTBA 3P0YL 1J8HD 5CU9A 2RFXA 2BCMA 2EICA 3FFCB 3FU7A 4W4OC 1MJ7L 1DJXA 1BVKA 1ZY9A 4HS8H 3D39A 4G6FB 4Z7OE 1WUNT 1L6PA 1Q72L 4KH2A 5A6LA 3W11D 1JYVA 2E9JA 3VXSA 1W80A 3QI9C 4FFYL 3TBVB 2SEBB 3KH4A 1NEUA 3QXVA 4DWHA 1VADA 1MIEL 3QIBC 4PJBA 3VFMB 3PGDB 1CGVA 4BINA 1G9MC 4DVBB 1IAKA 1T5KA 2BSED 2J21A 3NEEA 1BFVL 3CDFA 3JV0A 3O6MH 3R4RA 1IBGL 5M7QA 1NGZA 5KS9E 2P5WA 3VFSB 3S3BB 2F19L 2XY1A 3WFEL 4M3KB 2BLFA 5IB3B 3BC9A 4O02A 5F7FA 3MJ8B 1CXEA 3ZYOA 5DUML 1XVSA 4NKMB 5AVWB 1J5OH 4GT0A 4MB5A 4LPCA 1TTGA 4PJBF 4MCZB 4EZLA 1S7XB 1UQSA 4GAYA 2FX7L 2FWOA 5T3ZH 4LDCA 3TVMA 5I30L 1OP5H 1YQVL 4BD4A 5T1KD 4JG0L 1FH5H 4TVPH 3EAKA 4NHCH 1UT9A 4PH8A 3QZWA 2UZIL 1MNUL 2DQJL 3VWKC 3LKQB 1UWEL 3MLWH 4UDUA 4Y19B 2CDFB 3F8UB 1CXKA 5C0BE 4OFVA 1I8IA 2R7EB 4EJ1C 5J8OA 2UY6B 4PB0L 1XH3B 2ICWA 1N10A 1DCEA 2OCFD 1DSWA 1EUUA 3BUIA 2NDFA 4ZUVA 4OCWL 5CKAA 3VWJB 4JL2A 1P7BA 2VN3A 3N1MC 3QHFH 3VI4E 4O2FA 3K5SA 1MCPH 3VMOA 1KIRA 3UGXA 3ZE1F 4HJ0D 2BZDA 3KHQA 2P8PB 1YZZA 5A2AA 3WN5B 2JI2A 1II4E 5IWLC 1UTDA 3HB3D 4WENB 5EZOH 3NCMA 3RQ3A 5I75B 4JRWA 3NDYE 4OAWB 4LRIC 4D0CA 1RU9H 4UI2A 5ERWA 2FO4B 4XPHL 1AQMA 1JRHL 3VD0A 2ICEB 3ILPB 2A1WH 2VR7A 3SE8H 2WQRA 2ZX6A 3O2WL 3N43B 1U92B 2KZ1B 2MNJB 1CLZH 1E28B 3T8XA 1FLRL 1TUPA 2ID5A 4NQXB 4P5SA 3CC1A 3A6OA 4JL1A 1JAEA 4MQ7A 5F0LB 3MGOA 4PLNC 3NUKA 3O2VH 4L4VB 2HFEB 4MFHA 2VRKA 4UZGA 3W5NA 5KVMC 2DQHH 1DQQA 4FG6D 5INCA 2VN5A 4K07A 1BVLB 4KVCL 5IHUL 3ZL1A 5AFAA 1KB5H 2V7HB 5A43C 1MSPA 4U1MB 1KCUL 2DJSA 4HWEL 4U6XB 3RZCD 2EXWD 3GI9L 4JRYE 5J13B 4YL9A 3D52A 1ZEAH 4UM9B 4I3RH 2X4NB 4IRSD 4OB5L 2RCSL 5DLMH 1BLIA 3N85H 1QATA 4BJLA 1TTCA 2FT8A 3DVIA 3KPLA 2OTUB 2A7BA 2A99A 5AD0B 2Y72A 2Y6TE 2YXVA 3LH2H 4LSQH 2FDBP 4HC1L 5E6YA 1XR9B 2VR5A 1IJNA 2ICWI 2XWJA 3SYQA 5L2KD 5HHVH 3FHAA 3B3IB 1A22B 5ALBL 1B0WA 3D4CA 2YRPA 1DN2A 4KNQA 3LKRA 5JHMA 3MO1A 4JQVA 4WJG3 3J07A 5JIMA 2Z3FA 1CYGA 3KXFA 1E4XH 4GEIA 4PJAA 2Z91B 4IIZA 5C0JA 2F53D 2DWTA 4LCCC 1WQVT 1TT6A 1ZA6A 2CSPA 2HT3D 4HZLA 2PTVA 1NCWH 4IK7A 2B3RA 2ARJA 15C8H 1BMZA 2W60B 3LS5L 3V4UL 2VGLM 5C7XH 3RWEA 1TNNA 5CR8A 2AQPA 2DIBA 3ZDWA 3VG0L 3BFWA 1MFUA 5M94B 3GSRB 4K8RL 5G5DB 3HFML 1EQWA 2W9LA 4G7SB 5DCCA 4OZIA 1XBRA 5J13C 1HILA 3HIZA 4PJ5B 3E3QC 5DWUL 4FXTA 1B4RA 3G08B 4KKAD 2GB2A 4PJAE 3Q05A 2BC4B 3H42L 2A9CA 1WWWX 4RGOH 2FJGA 4XNYH 1I3GL 5G2NA 1FYTB 1YEHL 1YPZA 4TQEL 1T7VA 1KCVH 4Y5VC 4C47A 1YY9C 2QV4A 2O5NA 1BQUA 3BAXA 3VXNB 1ZA3A 5LN8A 3MUY1 5F0PB 4FFVC 2Y07H 4YHMH 5IB1A 4GO8A 4QRUB 1OB1B 5DTFB 5LQBL 4P5TD 4PHZA 1DN0B 4MCNA 1SXZA 5I0XA 4F7TA 4JDZB 2FCBA 1UEMA 5DR5L 3QDJB 5ACLA 1FFNB 2YAHA 3OPZH 4QRBA 2AJUH 4YNYB 3HE7A 1HINL 2QKIC 4TTDD 3VXMD 4FFYA 2GUOB 1CUOA 4JRYA 2JLLA 2F7RA 1RU9L 3GSWB 3V0FA 2MCPH 1T1YA 2X05A 5AUMB 5A2JH 1UACH 2GFBB 3COOA 2WWMD 2QSCL 1AJ7L 4FRWA 5SX5K 2EILB 3TA3A 3FB5B 4OLUH 1R0AH 3LB6D 5DD1H 4QY8B 4IOSD 1BBJB 4QHMA 3L08A 4YSCA 3KLLA 3X12B 1VKXB 3KWUA 4JO1L 4S1DC 2JKLA 4Y2NA 5D7JC 2R4SH 2DJ4A 4U0RC 2AANA 1IAIH 2IWEA 2PCXA 2XZCH 2CRYA 4KKAC 4HKXA 4N8CH 4M6MH 1P6AB 4R97C 3W9DB 4AUYA 1QYGL 4YX2L 3V0WL 1FFTB 3MLSH 4N25A 3N5AA 4KOCA 4N6RA 4PJCB 3PY9A 4HBCH 4EEEA 4R4BA 3EOTL 3PWPD 4L0YA 1ORSA 4K94C 4I77H 4BFJA 2Q3AA 3FFOA 4B97A 3ILEA 4OIBA 1FORH 5KUKA 1A6VH 2VMFA 2HVJA 2A0LD 3N9GL 5CZXD 4Z7QB 3WJMB 3QQDB 4U1SA 5LDSA 4UV4L 3MLUL 2VMJA 3GI8H 1FDLH 1QRNA 4XP5L 5F9JA 3V6OE 2XPGB 3QUKA 4KROB 2IV8A 5E6IB 3RY5A 2X6UA 3W39A 5C8JA 1UWXH 1B2YA 4X6CF 4ANKA 2EIJB 3ARDB 4GI9A 2YMOA 3PGCA 3H3PL 3VD3A 2BINA 1YUKB 2NDGA 2E5EA 2GC7C 2GJRA 2VLRE 2GK0A 4Q9RH 1JPST 2XFXA 2YOCA 2ZYRA 4KJPC 4QT5B 2FYYB 1TU2A 1A6ZB 5DRZB 3CNKA 3KZ8A 5D7KE 3VX1A 4G6KL 4NNYA 1DCLA 1UB5B 5LNDA 1OZTG 2WKLA 1WA2X 3U0PB 2IGFL 1YEIL 1C8QA 3NK4A 2QELA 1NGZB 5FYLE 2P5WB 3ARVA 4UTBA 4RDBA 5C7ZA 3WGUB 2XKNA 4EI6B 1BFSA 2NTFA 3UTTE 3EH2A 1JZ3A 5B39G 3LRSB 1KB5A 5FO7B 5C09A 1DTUA 1PZAA 4AV0A 2Y1VA 4MQSB 3E6FB 3AROA 2YUVA 1NL0L 1H15A 4UM8A 5EPMB 3TPKA 1EXUA 3NJKA 4AMKL 2JQAA 4MJID 2OR9L 4RA0C 1DUYB 1H0DA 1DBAL 1L7IH 1N3NB 2OI9B 1DYZA 3DUUA 5CM1A 4MNGB 4YHLL 1UXSB 4F2MA 4HGMA 4MKMA 2NY6D 3OWEA 5MHSD 1FAIL 4M7KH 4N90E 5JA9A 1O75A 4AQEA 4XCNA 1O6SB 4PY8I 1IGYB 3PJNA 1YEJL 1BXXA 3IFNH 4YBLC 4OCYL 1RZGA 2JJSA 3QIBB 2WNXA 3JT2A 1KGYE 3SBPA 1AANA 4KTEL 3FT3A 2X09A 3F5WB 3WEXB 4I2XA 2ICCA 4W6WB 2JCWA 1KJVB 3SE9H 3MRMA 3WFDH 1ZLUK 3HB3B 4FX5A 4JO3L 2HLFD 4UAHA 1VEPA 3CFIC 4A7SA 4X6BA 5DUMH 1FZKA 5IBUB 3PAYA 4PREB 1Z9NA 2PPAA 1G9HA 1N0LA 4X9FA 1QI3A 2CJ3A 1WAAE 1A3LL 2BSCA 3LNIA 2WUCL 1AZRA 3L3GA 3VFUA 5ESVA 4LKCA 3H9SB 2R0ZH 3T2QA 1YEGL 4FCHA 2OMTB 4NC0B 4XHJC 2FR4B 2P80D 1KFGA 3CDZB 1X5XA 2FHFA 5C2BH 3OLEA 4HK0B 3QO0A 3FN3A 3PL6B 3AADB 4XNBA 4XAWL 5EO0B 5JTWA 1UXLA 2C1OA 2VMEA 1WISA 3QB7C 3T65B 1RJYA 2CKBA 3S3CB 3WJLA 5KBKA 3F7RA 4FXKA 2VIRA 4R83A 4D3CL 2ZCKL 3I6GB 1PW3A 1JXDA 3IEAA 1ET8A 3CVBA 1Q0XH 4KK5C 1UENA 3NQKA 3EUUA 1JXFA 1PKQE 4FQ2L 3VI3F 2CO6B 1P84K 3V2AR 2ODHA 3L6FA 2VSKB 4JCLA 4NP4H 5E9DB 5J7CC 1CC3A 2V0AA 4OY9A 1KCSH 3QIWD 3QH3B 4YXKH 3ULVH 1NGQL 3IN0A 4R4FL 1X4ZA 3FONA 4UYPA 5F7AA 3QR2A 4FQQB 3PHQB 1M1XA 4H20L 5I0WA 1CZ8H 3MRIB 3ZVVA 5I24A 5EOQL 2BP0B 2C9AA 2BHZA 3MV11 3L9EA 4Y1TA 4ABVA 4ZMZA 1S8DA 5J3HD 2IH3A 1ZTXH 3GB7A 4OU3A 2PCYA 4IMKA 2LLNA 2ZKYA 1JTOA 5D1QE 1YLBB 2WBJD 2VZUA 3S97C 3UDWC 2WLIA 2L04A 5IOPA 1ADQA 1XGZA 1XT5A 4NYLA 2C3VA 1HWGB 3KJ4B 1A21A 1FNEB 1PZ3A 5C92A 4H25A 1MDAA 1U91A 4I85A 2NX5A 1KWGA 2A6KB 2VR8A 3ISWA 3QXDA 4M5YL 1MI5B 3DJSA 2XT1B 3DXAA 2WO4A 1MREH 2R8SH 3OKYA 3NRQA 4JN1H 1UCBH 5L9DL 4HC1H 4Z3FA 2DAVA 5J12B 2Y5TB 1BJ1H 2BWDA 2HX8A 3D4YA 2DYPD 3V55A 3KXFD 3VH8A 5KAQF 4J2XA 2XICA 3GRGA 2XZQL 3QULA 3LPGA 2ZUXA 3B9KA 3H9ZA 3P9MB 4YHOL 2XBDA 2HRLA 3BVTA 4WO0A 3P0VL 3B7RL 5D1ZI 2Q8AH 1HKLL 4NCC1 4XH2B 4HU2A 4OLYL 3OMIB 5AZ2H 4HC1A 2BNRB 2W95A 4IYKA 1B0GA 3RZCC 4ELMB 3RVUC 7PCYA 4X6EA 5DJZA 2OJZH 2YPKB 1EGJA 4FYTA 4AEEA 3QYMA 4QHUA 3QDHA 4QNPF 3HN5A 4X7CC 2C3WA 1ETA1 3TBWA 1F4YH 3D7PA 2BOLA 5AKRA 3LEVL 3QJHB 5BO1L 3KLAA 4GRMB 4YHPA 5F0JB 4R7DB 5AEAA 2VW6A 5A40E 2JNZA 3ZTDC 2JB5L 4AKQA 1B3IA 1W0WA 2I60H 3QDGE 5E2VL 5ETUA 4UINL 3FO0H 3QZMA 3TESA 4U7SA 1BWMA 4U1KA 1D3CA 4WEBL 1G7IB 1MXDA 1HI6A 3C6SB 4CN4A 5HHXH 3GMLA 5DJDB 2NY1D 1H3GA 3WN5C 1JUFB 3UO8B 1IGML 4KVPA 2FWUA 1AHMA 5SWQB 3M1BA 3QJQB 4AYDC 4JANA 2YMTA 2BW5A 2DI7A 3IDGA 2EYTA 3LIZL 1OWWA 3VDAA 4F57H 2BRRL 4ZTPL 4Y1SA 3R19A 1N6QL 3UG5A 3U2IA 1B9KA 3DMMB 5GXBB 2RTTA 4N26A 3F85A 1EVTC 2H3XC 4TM9A 5ICXB 3QEQB 4P2RA 3IDNB 5B7MA 1EAJA 3O4LD 3TA3D 1UM5H 1V05A 3MCKA 3L5IA 1RUMH 1M9WA 4AJYV 3CH1B 4JGJA 4M6OL 4WCYH 3CLEH 2R2CA 5GHWH 3PV6B 3DARA 2X2YA 3JTTA 4IBUA 1ZIBA 3GUTA 1A5FH 3ARGD 1BGXH 1CYWA 5ALCL 4YFLF 3IJ9A 1NCWL 2H2SD 3OX8A 5BQ7A 5FYKE 2JMRA 3V4UH 1OQOA 3VACA 3L3OC 1BZQK 3UZVB 3SGJC 4U1NA 5C0NC 4XE5B 5ENWA 3BKYH 3HG1E 3QAZB 4KRMB 4B3EA 4KMTL 3O8XC 3RKDD 2CLVA 3OAZK 4QT5A 3H4FA 2EXSA 1JHTA 1RSYA 1YNTA 1ZE3C 2NY3B 3BSZA 3B2PA 3IFLH 1AGFA 3RTLA 5KBNC 2K78A 3MRBB 2DDQL 5DRWA 1INDH 2YD8A 2M83A 2ZWLT 4A7GF 2NNFA 5ESAB 1YEDB 4MA8L 2XN1A 5KVFH 3E9UA 1EDHA 3VI4F 1QBMH 5J3HC 2VQ1A 3V5KA 4FLOA 1RZ8A 4MD4B 4XOAA 4OZFA 3ZE1E 4Z78A 4J8QA 2J1YA 4K2UL 1DJHA 5D1QC 5G4MA 5JORB 3ZRSA 4HYTB 4JFXA 3X11B 4PJIA 5TGBB 2YPLE 3HRZB 5C0AB 4CSPA 4JM0A 4TQPA 5J11B 1M53A 2DWDA 3ZQ9A 1WUZA 1MFVA 4N2AA 1NGPL 4A6YL 2WBKA 5GZOD 2X0VA 3KPOB 2DOCA 5KVGE 3X1BA 3OAYH 5FIEA 2IQAA 1Y6KR 1S2EA 3RVWC 2FT7A 2R2BA 4W68A 1S9XA 4KDVA 4ZJ9A 1P7QB 1W0VA 3D9AL 4GRLD 2AHIA 3QIBA 2IJ0C 4X6DB 2F53A 4D9RE 4XMWA 4EIBA 2WQ8A 2OMNA 1N0XH 3P1VA 2ZX9A 3BJLA 3DTDA 3HS0B 4ELKB 5M95B 2OL3A 2MQ0A 3NCXA 5HVFB 3IAPA 4BH8B 2OKMA 5D5MA 2VERA 5KSUA 2WVVB 2N7BA 3K74B 1G43A 4MMXA 3FJTA 1GSKA 3WS3B 5T1DL 2X70A 3PJSA 2VDNB 2BS71 4AC4A 1WZKA 3C5XA 4MZIA 2ZTBA 5ADOL 5ESVB 4OZGF 3U1SL 1SEBB 3SKNA 3BUBA 1ZVSB 4FZ8L 1JK8A 3P11L 5DI8B 2ICEA 4C8XA 3T4AA 1CFQA 4JEGB 3OG4B 2VXSL 3RU8H 5T3ZD 4MGXA 3DYPA 1ZGLP 3TEZA 1E7VA 1LEIB 4XMXA 1CBVL 1TJXA 2HLFC 5EO0A 4MCMA 1S7TA 1ADWA 2BIIA 3F64A 1W72A 3ARBC 4HKZB 5DD3H 2CO2A 1UG9A 1JDAA 4PU2A 5ABDE 3CFKB 3T71A 1SUJA 3DIFA 4C56E 3U7WH 1K85A 5HYIA 5IVXB 5IVXF 1WP6A 2WB7A 4LBEB 3UJJL 4I9WD 4RDQF 3OV6A 4K73A 5E00A 1RUML 3S96B 4NN7B 4DP1X 1BZDA 5L0QB 5GRYA 3IXAA 4Z7UE 4K9EL 4WFGD 4BQ6A 3K1KC 2ZNWA 4NQCB 1BYNA 5GGTH 3R06A 5JIKA 4WW2B 3ARPA 2J6EH 1WIOA 2AJSH 3DECA 4M00A 4H1LB 4C54A 3VU1A 4JKPH 3DOSA 2ZSVA 1D9KB 3GGWB 5FA3A 3TL5A 4AGMA 3VXQA 1GW0A 2GJZA 1WICA 2WANA 4W9IC 1GY2A 4Z7UF 1QSED 4DETA 2DH2A 1EO5A 3D5OF 2EYRB 5KYXA 3VI3B 4I48B 4LPTA 2NYZA 4A39A 1XR9A 3MRLA 1EXHA 4I1RA 3BT2H 5IEKA 3UYOD 3QEQD 1KEGL 1A1OB 4M43H 2UYLA 1TSHA 1U4FA 1YN7A 2XKSA 3A23A 1CN4A 2OW7A 3RY6C 1UOKA 2ZCHH 1D2PA 3SPGA 3G5VB 2GG1A 4K23H 4ALAL 5D72H 5LBGA 4RFOH 3MA7A 5E5MB 3BX7C 3MRRB 1A9VA 1Q9LB 3UDWA 5IBLD 4BZ2A 5E8DL 3RX9A 4L9LB 2H2PD 2EUXA 5D7IF 2B7DT 2CRIA 4TNWF 3GSRA 3FTUA 2OMUB 1RY7B 4IBYA 3MJ9H 3O2DH 4TSBL 9CGTA 1HHKA 2ADGB 2GEEA 2FBJL 3QG6B 5TDOA 3S3SA 1BZ8A 3V5DB 5FM5O 4HPHA 3ZKMD 5JPNC 3ZKXB 1NFIB 3L4WA 4QXGL 3KL0A 5CEZE 2QLYA 3TV3H 1N4XL 2DN7A 2ZKWA 5DA4A 4WI8A 4D0BA 2DB8A 1TCRA 2G5RA 4JJHA 4OIIL 3L4UA 2R15A 1FV1B 2NW3A 3UAJC 1FFOA 2B20A 1Q1PA 2EDLA 2VJ8A 3H9YA 1ES0B 5B7EA 4L8CB 3WSQL 4O58H 5IJDC 1JVKA 5CJXC 3ZL2A 4GKOA 3OSKA 2YQBA 4P23D 4KHTH 1FZOA 1VERA 3QJUB 2HT4D 2A1WL 2H6PB 3N42B 4N4YB 2IBBA 1U8IA 1UQSB 2AXGA 2R29L 3ARUA 4XODA 3VGHA 1FCGA 3PIQA 1E8XA 1QI4A 2C3GA 3DRTB 4H13C 2PW1B 3O11A 5EU4A 4GXUN 5JW3L 5LLIC 1CT8B 1ZLSL 1O0VA 4P4RB 2ENPA 3O8XD 1IEAB 3MJWA 4R7DA 4ZPTA 3AY2A 3AT0A 1O7VA 3L13A 3A67H 4UWQB 5BZXA 2PCFB 3LPPA 1KG0A 5I2IA 3L3OA 3VXOB 2CXGA 3PU7A 4X6CE 3TVMC 1A6UH 2V17H 4KKQA 3QUZD 2AI0L 2Y2TA 5CBAA 1JCVA 4GG6E 2JJUA 1I85A 4JANB 4CVUA 3FF7A 1A1MA 1V55B 4JM2F 4MS8D 4NHUB 5FW8A 1H3WM 3PFUA 2EVIA 1G7PB 1MHHB 4PWHA 5TH2B 2ILLA 5F9OL 3VGFA 5A2KH 1DQLL 5FA4A 2X7LB 2QZ5A 2X1XR 4G43A 5CEZH 5SV4A 4QXUH 3WN5A 5ID1B 4BKLB 4XMZA 1U93B 2FWSA 4HEME 5ILTL 1KBGH 2AJSL 2Q1EA 4PWFA 4L3EA 2HB0A 4ZFFB 3S0PA 2YN3A 3T0VA 3W2DH