4AL8C

Structure of dengue virus diii in complex with fab 2h12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
SYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Immune system
total genus 13
structure length 98
sequence length 98
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4al8C00
4FG0A 3UAJA 4X42A 3N41F 2JV6A 3J2PA 2GG1A 5LBSA 4FFYA 1PJWA 1OK8A 2JSFA 4UTBA 5GZNA 4L5FE 4ALAC 4AM0Q 3MUUA 3N40F 5GZOA 1UZGA 4BZ1A 2R29A 2HG0A 3N42F 4UT6A 5B1CA 2JQMA 3J27A 3UZEC 4GT0A 1URZA 2ALAA 1OKEA 3C5XA 5KVGE 1ZTXE 3N44F 3P54A 5LCVA 4FFZA 2H0PA 5JHMA 5H37A 5KVDE 3IRCA 4BZ2A 5IREA 5JHLA 3G7TA 3VTTA 1S6NA 3UZVA 3WE1A 4AL8C 2R69A 5IZ7A 5LBVA 4GSXA 1OANA 4UT9A 2P5PA 1TG8A 1Z3RA 3UYPB 5KVFE 1Z66A 3N43F 4UTAA 5KVEE 2I69A 1SVBA 4UTCA 2V33A 3C6EA 1RERA 3UZQB 5AAMC 5AAWC
chains in the Genus database with same CATH superfamily
1TOXA 3D9AL 3ZKMC 2XSKA 1KY6A 1UT2A 3CFQA 2V2XB 1WVZA 4H8WC 5K1JA 1AXIB 2EYRB 3OKMA 2MEJB 4UTAL 1WBYB 43CAB 1A22B 4P48A 4PJGE 5HYJD 4RISL 1I8AA 2MHAB 3MNZB 3T2NH 1KN4L 3BSZA 2PCXA 4NWUH 3K2MC 4CW1B 2O5YH 1KCRH 1EZLA 3RVWD 3C6LB 3OAZH 2ETWA 2OBGA 1Q9OB 5E03A 1T04B 1V3KA 3N1GC 4YLBA 5FM5M 2R1XA 5IEKB 1NMBH 2DL9A 2F19H 4U6YB 2IWGA 1EHKB 4S1QH 3J27A 4TULH 2X4OB 3MXVL 3MBXH 1LK3H 5E5MA 1PBYA 5BRZD 3V9CA 2IAMC 1A6TB 4ELMA 1JN6A 3RFZB 3B2UC 1IEAB 3QO0A 3WNKA 2Z3FA 4UOJA 2ZXAA 3PWNB 4JO4H 1D9KC 1NGXB 4MNGB 2NY3D 5AOIA 5FHAL 2DH3A 1J1PH 3K1DA 1BQRA 4LEEA 1U91B 4B7IA 3QHFL 4GXFA 3WELA 1MCPH 4U3HA 5DQ9B 2ENJA 3T2QA 1IBDA 2BVEA 1HEZB 3QQNA 4Y16C 3WIFB 3V0WL 2WYZA 3ECWA 3FQWB 5GIRA 4KZEL 1V10A 1AO7A 3ILQD 5D7IA 5I76B 1ND0B 4EDWL 5FM5O 1RD6A 1AIFB 3FU6A 2HAZA 2YEZB 2EDXA 3TCXA 3ULVL 3HHSB 4LNRA 1U58B 1D5RA 4LLMB 3B9VA 4K5MA 5EDSA 3GI8L 2WZ5A 3CLWA 3MO1B 3QUXA 4D0BA 4PRPD 3H9SA 1IMHC 1VACB 4X6DA 3PLYA 5T3XL 1MHCA 4FL4C 4I1NB 3WN5A 3K0YA 4K9EL 2NY0D 4OQTH 3EO9H 4ELMF 3IDIB 5C0IB 1A2YA 4ZRGA 1RUKL 4P9MH 4EKXA 4Z0BH 3CQPA 5K9JH 1G9ML 2EQDA 5EPMB 4C4KT 4D9LL 3SDXA 2E8YA 1TYJA 2WLKA 3QEUA 2PCFA 4KJPC 5E4EB 3RB5A 3WMPA 3HVNA 4ALAH 2ATAA 3BRGC 2Z0UA 4M6NH 5EO9B 1MAMH 3ZL1A 1E2VA 1G6RA 3ZZSA 3PWVA 5E2WH 1U8OA 2YRBA 1GW6A 4M6OL 3RIKA 1FYHB 3VWJC 1ZHLA 3KCPB 2QHLA 4G7VL 4IRSD 4Q0XH 3D8MA 4DPRA 4AEIL 4M1GH 1ZS8A 3MJ8A 3D18A 4QO1B 4U1GB 4Z95L 5CBAB 2DZEA 4KUZH 4GT7A 5I1AB 5D4QA 4Z7WB 4R3SA 4AEEA 1BECA 4X6DF 3WIIH 1IGIL 1EO5A 5IVZA 3AXHA 3GJEB 3RWJA 3UAAA 4C8XA 1T66D 3MLWL 3QZNA 1J0HA 2DKSA 5CM1A 2BSEA 1KFAL 2HZHA 2PPDA 1V54B 3FQUB 5TH2B 5B39G 5CJ5A 3S36H 4HGKC 1JHTB 3GSNL 1ZHBB 3SDXF 4AW7A 4LLVB 1X5MA 3CLFL 3ZO0A 4RMBA 5DI8B 3CBJB 1EHLH 1OW0A 1FRGH 2HRGA 4FHKA 1LEIB 4JHBA 1R5WB 4R7LA 1XF5B 2WB1A 2F68X 4OZGE 5AW0B 1T0MA 4H2CA 4RGMC 5EB9A 4LF3B 4M4PA 4ONHA 4XNUL 1S5IL 3ALPA 5J6SA 1BPLB 4GKSB 3BZ4A 4GW4B 2ICWB 2OZ4H 4W4OC 2GJ6B 2WSKA 3LRGA 5IWLC 3NCXA 4BXVA 4PRAA 3CZFA 4X5LA 5E4AA 4AVKA 2FWUA 4RIRB 4O58L 4TV3A 2DDQH 3PDOA 5EORH 3UO1H 4F58H 5HHQB 1NGZB 3NIDF 5DJ6A 4CVZB 2D0FA 3BQUC 3UZVA 4WENB 1JHLL 2VKWA 3ILPB 3MGTA 4YGAB 1NOFA 4LIQH 2FLMA 3FUIA 3LD8B 4YE0A 1K5NB 2AJVL 4KZ0A 5A2IH 1JSYA 3VI3E 3RG1C 4AIZA 2K6WA 5IMOA 5IQOA 2YFNA 2G5BB 5ETUB 1TJGH 4UOZA 1RZ7L 2QLVB 4OLXL 5T33H 3L9EA 4U49A 4FCAA 4XXCA 1WK0A 4PR5B 1BQUA 3ZRFC 2VDKB 4WK2B 4OUUA 3QZBA 1MZZA 3RZWA 1CL7I 1VA9A 2QZQA 1TO5A 2W65A 3ALXA 1S7RB 4FLRA 3RP1A 3SBWA 3WFHB 4OIAA 2ADIB 4AGOA 1JI1A 2XG4B 3UFIA 2XJKA 1RZ8B 1U95B 1I3RA 5I8KL 1TJMA 3EBIA 5J6HA 3IJEB 3SDDB 2VXSH 4NNPH 1JYWA 2Y7LA 2AK4B 3IN0A 2YWZA 4IU3B 4OGAD 3EOTL 1JVLA 3TM6A 1GKEA 2DEYX 1DBBL 3CVDA 3EH1A 1RJZB 4BYHA 3S8WA 3BUTA 3ZKQD 5C09E 5D6CA 1C08A 4P59H 1DQLL 5HHVH 3UBHA 3E0GA 3LZFL 2WVUA 3O2WH 1VIWA 2CA4A 2KZBA 4QRQB 1HH6B 2EDMA 3LRKA 2QQNL 4LRNH 5E8PA 5DD5L 1KIUA 1W0YT 5GGVL 4X80H 2GQHA 5TGBA 2XFXA 1QACA 2MH4A 1A3RH 3IN2A 2D03L 3QYNA 4JFDA 3SGKA 5BMFL 3OKLB 3QZLA 4AMKL 5I6OA 1N0XL 1UJ3A 2X1QA 3QA3B 1OSPL 4YE4H 4Y5YC 3L3OB 4BHUA 4OD1L 4XAKE 1JFHA 5CN3A 4J6RH 2DPKA 1HWHB 3ZYOA 2BNUB 2YA1A 1HHHB 1YEDB 4XBMA 3BZDA 2RQEA 3MNDA 5D70L 1QOKA 4I1PA 2DMHA 5F89A 4JPKH 1N68A 4WEEA 5FK9A 3RDTD 3RVXC 3FCTA 2OCFD 4YDLC 4H5SB 3TT3L 3EJSA 4U33A 1RHHA 4ENED 3OKOA 1T2QH 1J18A 5CJ8A 2H2SC 4P2CG 4QRUA 1HE8A 5IW1B 3KBEA 2EINB 3ULVE 1Y07A 3MFGB 4WCYH 3ZE0E 1E5CA 3C2AL 4GKOA 5DJZA 1HEJC 1KYOJ 3OKMB 4XE0A 1HK6A 4X7DC 2CWRA 1DBMH 3CFCL 5CILL 5CKGA 5JUEL 2D0HA 1A4KA 4FQCL 3WEBA 5T3XE 3LTVA 5H8DA 1ZTXL 3CTTA 2E46A 2W0PA 3TJEL 3ABZA 1GGTA 1YUHA 2PXYC 3L08A 2ZXWB 3MV8D 4RMRA 2V3FA 4OAWA 4JFYA 1G1KA 5AW3B 3TF7C 5GRUH 3MLUL 4UILH 4KKAD 3B83A 2VW4A 4DGIL 4IIZA 4HGWA 4WI5A 2R1XB 1E40A 4KTDL 5IBTL 4XMZA 4JM2A 1FH2A 4OH2A 1J87A 1MEXH 1O9WA 4GSXA 3UAJC 5EO1A 2DEWX 3E2HB 4KV5E 1A1MA 1BBDL 3BFQG 3HN8A 5E5MB 3GB7A 2YGPA 2ZX7A 5FLUA 4HG4K 3G5ZA 4WHYG 3QXWA 3QO0B 1O6SA 2OSLA 1A0QL 1F56A 4M9OA 1YJDL 5FW8A 1NC2A 4RRPM 5E7BA 3ZT7A 1UVQB 3QS2A 4AT6A 2OI9B 4KROC 5D5MF 3R19A 1X4XA 3QJTB 4NXSA 4PY8I 4X9GA 2BSBA 4Y2DA 3QDAA 4E0RA 4OZFA 4Y9EA 5FLVA 3AS3A 3PFUA 3IJ7A 3SBPA 4XCFH 1HYSC 1AO7B 5D7IB 2RD0A 4A2MA 5CCKL 1DTUA 3QIBA 5C7ZA 2R15A 2Y5QA 3QXUA 4KQ3H 3AU0A 2EXWC 3FK3A 3TJHD 4EIUA 2A6JA 3HMWL 4PU2A 1B88A 2BP0A 4RRPA 4WJ5A 5ITFA 5LNDA 3V0DA 3E9TA 1MI5A 3RDTB 3II2A 2D8KA 4B9KC 2ORBL 1PJWA 2VDLB 4D8OA 3Q05A 1TPXC 3QUXB 2P52A 3VGGA 4D0BB 4HPHA 3ABGA 4RA0C 3V6ZB 1MHCB 3G5YA 4KJQC 3L3GA 4NQEE 3WN5B 4ZBJA 2BVOA 3MRPA 4NZJA 1ZRUA 2VM3A 4XBPA 2XXMB 3T0DA 2A73A 4X7TA 1A2YB 3ZL2A 2GSMB 1LWHA 5FYKL 2IGTA 3VI4E 1PX3A 4XB7A 3QFDA 5IVXB 1P4LA 5G4NA 2EZ0C 5H4YA 5GS0H 3K91A 5J12B 3WE6A 1YA5A 1V55B 3H3PL 4FQ2H 4ZFGL 2A9DA 3NEXA 4AQOA 3JWOC 1G6RB 1ZLSL 7FABH 3HI5H 3PWVB 1H5BB 3V55A 5H35A 1U8OB 3ABLB 3TN0C 4UT9H 1THAA 1CJYA 4A67A 1NEZA 1BP3B 1ZHLB 5CJOL 2Y1VA 5ISZE 3BKJL 1EJ6A 1NCJA 1K85A 1M6UA 1ZS8B 3MJ8B 4LCVA 4RGOL 5LQBL 4LVHB 4IJ3B 4LHUA 2QVMA 1OAYL 3GBEA 3BH9B 4S1RH 4R3SB 4Q4EA 3MYJA 3I3DA 3STLA 2ID5A 5DC4B 4I1RA 3RWJB 5JHLA 5E5UB 1B4JH 4B9IA 4E5XA 2ZXDA 2YD5A 4NO0A 3L2MA 2FGZA 1ZKAA 2IAMA 3QG6A 3PUCA 3OAUH 2CBPA 4ZD3L 2XG5A 4HH8A 1HCFX 1D9KA 3QXAA 2F5AL 4X7SL 4EPSA 1W91A 5JHDD 3O8XC 4UNUA 1IC7L 4FZEL 3DJ9A 4ABVA 4G71B 3UEZA 2CKNA 2ED6A 1R9FA 4CDHA 5IHLB 2UV3A 4YL9A 4NZFA 1ZT4A 3K6DA 3MOBL 4HWNA 1SMOA 3B2XA 4Y16A 4FLHA 1T0MB 4ZTPL 2LU3A 3N43F 2AQ3A 3ZSSA 4PLOB 4V1DE 3FUMA 2GBUA 4ONHB 4Y4HD 1DVXA 1F4YH 4KRPD 3BZ4B 3FUDA 4QCIB 5CEZD 3OJVC 2DYPA 1MOEA 4XC1H 2X6BA 4X0KB 1ZGLM 4QYAA 4XI5D 1NCIA 1RIUH 2C9PA 2CNYA 2ED8A 2DQTL 4PRAB 3CZFB 2UY6A 2GB2A 1NAMA 4K9EC 3CBRA 3ZZQA 2XZQH 4QYOA 1BZDA 1Y6MR 4HJGB 1FWXA 1QBMH 5DJ6B 3B3BA 1F6FB 1GHFL 5DD0H 2EIJB 2UXTA 3MGTB 3HLAA 3HZVA 4JG0L 5MI0B 4GSQA 2VO8A 3LXCA 4HHWA 1L9NA 1R3IL 3K4AA 4OI7A 4AIZB 2ZICA 2GI0A 2KERA 3F6JA 3L9RA 3WTUA 2RCSL 2B1OA 4MTMA 1TZ8A 1VAHA 2FIRT 2DWYA 2A74B 2AJ3A 1GTNA 3T3ME 1UXMA 3HEIB 2YBRA 1ZSDB 3EJQA 2JIXA 4OUUB 3V4VA 3D50A 3GXNA 2NTFA 2W65B 4M3HA 3GRWL 1ODUA 3DJTA 3GTNA 3VWJA 3DURB 4HKJA 5LBSL 1I3RB 5J6HB 3FZUD 1UOKA 3G6DL 3EYVB 2VAJA 4M48L 3BUIA 4KHXH 2VJXA 3QEQA 2IBZY 4WHYH 5C6PB 4A7TA 1C08B 1ZTXE 3WFEH 3CX5K 4J3OD 2GTQA 3EYUL 2Z7WA 4BCXA 5CJQH 2E7CA 3DSFL 4W68A 4HPYH 2XTLA 2DLTA 4OF3A 4ESKA 2X2YA 1BF2A 5TGBB 5D72H 2APXA 2XFXB 2XV3A 2HXAA 5IREA 2LT9A 3S34H 4PV9A 1AD9B 4JFDB 4TUKH 3BX7C 1CXFA 2ZKHL 3CXFA 4F15B 1J9CT 1NIAA 1D7CA 1UJ3B 2GSGB 4PWKA 4DTGL 4Y4HB 3BQVA 4KRPB 5T5NF 3UXFA 5IP4A 1M6OB 3W5MA 3OKEB 3QUGA 4ZUTA 2KI6A 1ADQH 1QSFD 5FK9B 2IWFA 3HBZA 4XX5A 4W4OA 4NJAH 4F7MA 4OGXH 4HEPG 5IWLA 5BZDA 1HHGA 1WD8A 3T6VA 3F85A 3OKOB 1TLMA 2AAVA 5BUPA 5D1QA 4Z7NB 1OAKL 3LS4L 3GSOA 3BQUA 4K3JL 2V33A 4F80A 3KBHE 5C8JA 1BPVA 2FBOJ 1N4XL 1TJIL 5DJZB 1HIMH 2OKMA 2RH0A 2YXVA 2QMJA 4ODTH 2VDNL 2WXHA 3QC5X 1L9TA 1A4KB 1IAIM 1QYGH 1ORQB 1U42A 1TTRA 2W0FA 4L1SA 4AW4A 4HWEH 4X9YA 1YUHB 5D1XD 5KSAC 5FYKE 2YEQA 4OAWB 5IFAH 1YUKB 3QIUD 3GMQB 5JIIA 1QZNA 2F8OA 3SOBL 1TQCB 2DQIL 1WZMA 3ZHNA 4HGWB 3S36X 5JXEC 1LK2A 3SKJH 2F8IA 4KQ4L 4M93C 3O2DL 3MRCA 4JM2B 1DDTA 4YVUA 1AG0A 5CD5D 5M7QA 5EO1B 4ZTOH 4PJGF 4G3YL 5CCGE 4JB9L 1ANUA 1TVHA 3GB7B 5AOZA 1J8HA 5CBEA 1N10A 1I4FB 3MBWA 5IOPB 2VLJE 1HQRA 1AIZA 4BUHA 2H7WA 4QR7A 5MEOA 3QORC 1NC2B 4JRXD 3UAEA 2MKLC 3A23A 4J3TA 1JWUA 1G7LA 2E86A 2YMXH 4NNXA 2ZX6A 5C0AE 4AT6B 5JYLA 1BOYA 4OT1H 2D3VA 3JV6A 1Y6NR 2CJ3A 4K0OA 4Y2DB 1COBA 1GS8A 4RMVA 2LOEA 1I85A 4ODWA 1AP2A 2WC7A 3GIZH 4X6BB 3BAIA 1XH0A 2J1ZA 4CC0A 4ZJ9A 1N59A 3QIBB 4A63A 2ZAHA 2XWZA 1HFUA 2A6JB 3ZYJA 3W82A 4N1CA 3W0WA 4WJ5B 2BP0B 5ITFB 1S3KH 4Y5YA 1MI5B 2C8NA 4CSTA 4K94H 3JWDL 1F90L 1E4JA 4URTB 2APFA 2E9BA 2A6IA 4XNXL 1V27A 4FAAB 3G5YB 3L3GB 2BVOB 1NFDA 3MRPB 3MLZH 1A7RL 4XBPB 4G70B 4K5OA 4UI2A 2A73B 4X7TB 5AKSA 3VB8A 2H2PD 4JZJC 2EE3A 4N3UA 5EOTB 1E42A 3QFDB 3U0TA 5IJDC 1S9YA 2DB8A 1PLGH 1BV8A 3DMMC 4OLEA 1R75A 5DUJA 1TETL 3WE6B 3MDJA 4EJ1C 4R96A 4KKCD 1TG8A 1VRSA 5DMKA 5G5DB 1DBAL 2Q86A 2E75C 3QIWA 5GSRB 1TTGA 4F8PA 2A4ZA 2OXHB 1QAWA 5C0CE 5H35B 1T3FA 5DEGB 5ABDE 2Q8BL 1E6JL 4K71C 3JTBA 1MIMH 5EUOE 4KXBA 3INUL 3Q1SH 4ONGH 5EU5A 1NGWA 3FB5A 3QO1A 2PXYA 4LASH 3NMEA 3NQKA 4JO5A 4N2NA 2L7EA 3CGTA 2L7JA 3H8NA 1PSKL 3SQOH 3K71B 2WHVA 2NW2A 1XF1A 1OTSC 1EXUA 1E67A 4IOFD 1AGDB 1KCRL 2E9IA 1F1AA 2FH6A 2O5YL 3FDWA 4LCIL 5FYLL 5AAWC 4XXDA 5L7XL 3STLB 1XGZA 2BFVL 4WHDA 2MFNA 3M88A 3UAJA 1JF5A 2IBGA 5JR1H 4NO0B 4F7TA 1YJDC 5D4JA 2BLFA 3QG6B 4R6UA 1AXSA 1FFQA 4Y2LA 2IG2L 3FU7A 1OAZH 1D9KB 3QXAB 1KPVA 1ZV5A 3KPNA 3EJPA 5D7SH 1JZ6A 4YGVA 1M05A 4RFNB 4JO4L 5ITBH 5JQHC 5F1NA 1Q0YL 1HN1A 2X38A 4UT7H 3DDGA 5MHSD 1ROWA 2VDMH 1KN2H 1RFDL 5E8NA 2A9NL 3MLXH 1DQJA 2HKFL 4PJ7E 2DYPB 4XP5H 1K2DA 3N55A 3VI3A 4PWJA 5D2LE 4GO6B 1PQZA 1NAMB 2IDQA 2TRYA 3LNIA 2R29L 1BIHA 4QYOB 1U36A 4FLSA 4AEFA 2HB0A 4FL4B 3ARZA 4HHAB 2GEEA 3FUJA 4YHNA 1FE8H 4MHHI 4HUWA 3OZ9H 1P7KA 3HLAB 4KK9C 4OZGF 4EXKA 3HZVB 1ZANH 4IBYA 3K0WA 2CCVA 5E08L 1GL4B 2CQVA 1H6TA 3ECUA 4CSZA 1KXQA 2WO4A 1QEXA 3EO9L 1ZIBA 3L9RB 1UWGL 4HCFA 1OP3K 2QFPA 3IE4A 4YZFE 2VZVA 4Z0BL 5KSUB 3QH3B 1E30A 4MJID 2AJ3B 4KTEH 5K9JL 3MGOB 2YBRB 5B8CC 4ALAL 2JIXB 4P5MA 1INEH 2BNRE 3V4VB 2NTFB 4EUPA 4PJXB 5DMIL 1QSZA 1BG9A 3TN0A 4M6NL 2HLFC 3NCYP 3VWJB 3W11C 4HKJB 1T0NA 3SEPA 3IRPX 1OY3B 3R4DA 3VI3F 5E1HB 3V4PL 1E4XL 1T7WA 3U4BL 1CGWA 1USQA 1CFVH 4J3WA 5CZVH 1PLCA 3KEHA 3HFMH 3FO0H 3RNQA 1AZBA 4HKZB 4TSAH 4WVRA 5IUCA 1OE3A 1CIUA 3PWLA 5ECJE 4OF0A 2EH7L 4EZMA 1IVTA 1BFVH 3SSGA 2FQGA 4S10A 4KUZL 2YRZA 3BLPX 4MB4A 5C0BA 1UXWA 3F83A 6FABH 1KY7A 4XMKH 2GHZA 2DL2A 3QB7C 1I3UA 4AI7A 2NY1C 1JD7A 4TQIA 2PR9A 1EAOA 3O8XA 1HILA 1U3ZA 1NAKL 5L88L 4JO2L 1DEEA 1FDLH 1QVOA 2IXQA 4KOCA 2EIDA 2NY6D 4LT7A 4NO2A 2DQEH 3SCMC 2Y25A 1MXDA 2PYEE 3K72A 1C8QA 1BJMA 4JY6A 1HINL 3OM3B 3ESPA 3CCHA 4R5TA 3AREC 5A2CA 4WDIA 4MMZB 1ZTMA 1UM4L 1CFTB 3Q3GA 2W1NA 2NR6D 2ZIDA 4F7MB 5A1AA 5KBDA 2QL1A 5BZDB 1KC5L 3TU6A 1HHGB 4ANUA 4JHWL 4XX1E 4I18C 5D1QB 5EZJA 2AV1B 3BJLA 1NDMA 1OAUH 3GSOB 4K7PY 2WQXA 2PTTA 3E1ZA 5T1KD 5EEYA 3IGLA 3GGWA 4X50A 1JPFA 5TE4L 1KCSH 1KXTB 3PL6A 3UO1L 4PLJD 3FU5A 4UQDA 4I2XE 8CGTA 4P4KA 1QABA 5I1HH 2AABL 3BAYA 1AHMA 2WQWA 2C7UA 2W0FB 4K8RD 2E74C 1W9XA 2NNXA 4N0FA 1OXYA 1OSEA 1Z5YD 1A6UH 2ZONA 1NUFA 3IRZA 1TENA 2PWGA 1JBJA 3TL5A 1RUQH 3FYEB 4M1DH 2R0WH 4R2GC 5T33L 3ULVF 2NYYD 5B7EA 2B59A 3ZE0F 1LK2B 1JCVA 2QQKH 3VU1A 3MRCB 4NQVA 1SHMA 4TUOB 4TLTA 5DZJA 2Y06H 3VFVA 4B27A 3ZDXE 1RUPH 1GSKA 2KZ1B 5HHOE 3RILA 5CBEB 1J8HB 2C9AA 2Z91A 1F2XK 2OK0H 1L0XA 2CHWA 1ZK5A 3MBWB 3KZ8A 2VXSL 2OYPA 1OTTD 4JO8A 1L0PA 3V5HA 3LKNA 3WIAA 3V6OC 4X8JA 2JNZA 4NNXB 5CFHA 2V5SA 1DUZA 4P59L 5KTEL 1Z5HA 3HAEG 3JV6B 2DQGH 4WRLA 4C59B 4ODWB 5TE7L 1AP2B 1JF6A 1WSST 1L7IH 5JW4R 2P80D 4NC0B 4RETB 3DX1A 1ZSHA 5ES4B 3F04A 3L16A 4N2KA 4KV5F 4NQEA 5I0VA 2HX9A 1CZ8H 3O45B 3P9WB 3QQ4A 4FKEA 3W0WB 3TYGH 2VCOA 2AEQL 4Y5YB 3KWTA 5AB9A 3US9A 1JPTL 2EADA 1CF8H 4PCSA 4FFWD 1HESA 1JZ7A 3VW3H 5E9DE 2A9AA 5DUMH 1NFDB 5CCJA 1XIWC 1XZ0A 3CSGA 3Q9QA 4PH8A 1F4AA 3MROA 2LLLA 1A14H 1CVRA 3P4NA 1L5GA 1GJIA 1JV2A 4IDLA 4C83A 1J11A 3DO4A 1EHXA 3GMNA 4PJHE 1NEPA 2XQ0A 5ISZA 5GS1A 1S9YB 2Q3XA 4BFIA 4AL8L 5KBPA 1RZIA 4JS7A 4LKCB 5FUOH 2HJKA 3GMMB 5DMKB 3QIWB 2Q86B 1CWVA 2HG0A 1A25A 5AL0A 4UWQB 1M7DA 1T3FB 3O3EA 5D7JD 1IGFL 3ELQA 3KJ6H 3QO1B 2H3NA 3M17B 5KSAA 3EGXA 2F08A 3VI4F 3DPBB 5D7KD 4F7PB 2MJWA 1XF4A 1UWFA 1P4IH 2GC4C 1EXUB 1YRKA 3P54A 1Z7JA 1K3ZA 1QFUH 2F2HA 5JXEA 3H1ZA 1W80A 5GRVK 1I8UA 4XXDB 3ZO9A 4OCWH 3IJHA 4C58B 2Y7SA 3R8BB 4JK0D 1NPJA 3BUYB 3WKNA 4Z7VB 1FYTD 1X5AA 4F7TB 3QBTB 1AXSB 5DJ8A 3C6SA 1PKQE 3FU7B 4G5AA 4I9XA 4V1DA 1HSBA 3LMJH 2FX7H 5C07A 4A38A 3T1FB 1KPVB 3QORA 4DZBA 5I2IA 3KPNB 4HPOH 4KXCA 3IDGA 4YGVB 3GXTA 4HETA 3EJZC 1BM3H 1M05B 1RULH 4PI0A 3DUUA 2HG5B 4HZ1A 2J1KA 4OZ4A 4BRVA 1SN5A 5F1NB 3X12A 1OM9A 1FJ1A 3L54A 1IZKA 3NAAH 3OC5A 1FPTH 5CS7A 2TAAA 1DJWA 2DLGA 1RIVL 2ZF8A 3DXAE 1JVOA 4PB0H 2HUEA 5E8NB 2Y69B 5E8DL 2P8LB 3ZRSA 5C86A 1DQJB 2J7LA 2XPGB 1FUNA 3JWDC 2BFGA 3K6OA 3V4UH 3WXWH 5CF3A 3GUFA 2YGNA 1KT2A 5JW4M 2DEXX 1EH9A 1R3LB 2X12A 3GPEA 4KQ3L 1MAKA 1PQZB 3TTSA 1TPXB 1TQVA 5KBKA 5I1CL 3VXRA 2YXWA 3VYPA 5EN2A 1VPOL 4FC3E 5IQNA 4PWHA 3ZE2B 3WJJC 5PCYA 3WY3A 4YHNB 5KN5A 4Q9QH 4AG4H 1P7KB 3CMGA 2BW4A 4NZDA 2E76C 3GUTA 4JZJA 1UM5L 2XJLA 4JFED 4PJIA 3V2AR 5KSBA 2R7EB 4HSCX 3DMMA 5AZUA 1JJUA 1WQVT 1MLBA 4XPTH 1XGUA 3QXVA 2DQUL 5ID1A 1J12A 2MQCA 5LCVH 1XR8B 5D7JB 1NPNA 3BMWA 2QSCH 3F58H 1PTZA 3KXFE 4N0CD 3CDGA 3CZGA 3KS0J 1KDIA 1RVFL 2VL4A 2BCMA 4P5MB 5GS0L 1OPOA 3KLAA 1T7VA 1CLOL 5KZCD 4W70A 4CMMA 3TN0B 1C5CL 5JHBA 4FG2A 2ZUTA 3NA9H 2HJFA 5EIIA 1T0NB 3UIYA 3ZIYA 2P5WA 4PB9H 2FNWA 4YEEA 5AZ2L 2X4SA 3HI5L 1Q9KA 1NA8A 2FZ3A 4M5ZL 5KBLA 2B39A 4OVVA 4R7NA 4DPCX 3KPSD 1NICA 1T0PB 1JXDA 5AAWA 3PWLB 3T3MF 4JFFD 2V3DA 5BZXA 5E1QA 4DN4L 2XACC 1HJCA 4DVRH 4DP2X 3WTTA 3MUJA 1LYQA 5C0BB 1UXWB 5FYJD 2QR0A 2C1PA 3HAEH 4P2RD 1AR2A 3PAVA 2X42A 3ISWA 3WYRA 4XWGL 1NCWH 4UF7C 1PZAA 4XPBH 3GFUA 1HILB 1FP5A 3AUWB 2YUXA 3EOBA 2BHFA 1DEEB 2H6OA 1QVOB 1YNLL 4NPYA 4IDJL 4AYID 4XCEA 1U8QA 4IEFA 5ABAA 3ARVA 3BAKA 3AWFA 1ADWA 2M1KA 4JY6B 3JZYA 4HWBH 4L4VE 3HE7C 1EO7A 3VAEA 5HGBA 4NUPA 4M5YH 2FQFA 4WEBL 4EN2A 3HC3H 2MRYA 2I7SA 3Q3GB 4RMWA 3VD7A 2X0VA 2J1YA 1CUOA 1Z9SA 2OL3H 4IRJD 3T2OA 5EZJB 7CGTA 5L8JB 4I9WE 2YAFA 4PJCE 4UINH 5HTSA 1NDMB 2AV7A 1PG7X 1QRNA 3M45A 3MV9D 2VXVH 2FLRT 3GGWB 1E4KC 2XZQL 1IM9A 4NNYA 1A6AA 1D5IL 1SXBA 3PL6B 4ZSOE 2MCMA 1WGVA 3ARBD 2QQLH 1CD9B 3NTCL 4P4KB 5DD0L 3FFCD 3ESMA 2FWLB 2C7UB 1QR4A 4RBPK 4LU5H 4K5LA 3ZJAA 4PJ9C 1SGKA 4PMEA 1O5DT 1A3QA 4N0FB 3NA4A 1FZOA 5B8CA 1AXTH 2VLJA 3GZQA 4AV5A 4JBSA 3KEDA 3I2CH 2WM0A 3CZJA 4Y4FD 4LGRB 4OCNC 2BJMH 5E4IA 4DK6A 1XL6A 4JFFB 4Z3TA 2Z91B 5DDHB 4U6XB 4WO4C 3BESR 1DO6A 2DLHA 4HC1A 1B0WA 3V5HB 1ILUA 3BW9B 2WXOA 4ELKA 1HAUA 1X5KA 4X8JB 3DV6A 4HF5L 2JKRM 2B0SH 1DUZB 3HS8A 4PRNB 1ICTA 3ETTA 3WFEL 1WDAA 3QEHA 2HT2C 1QPKA 5AYTA 3RX5A 3S6CA 3DC0A 4GG8A 1YN7A 4CJ0A 4BQ6A 3VFPA 3RI5F 1DQMH 5CJQL 4Z7UE 1KCVL 3MI6A 3AXLB 2WXKA 3ARPA 2O6DA 3BJ91 4HPYL 5FKAA 4LOEA 1CU4H 2ALAA 3I9GL 1OF0A 4JDTL 3SCMA 3QQ4B 1KB5H 3DUSA 4BDVA 3PV6A 1NCHA 4TSCL 1F97A 4N25A 3TEZA 3AREA 3BGFB 4R90H 4YS4A 2W5PA 3V9EA 4XNYL 4PG2C 3VG9B 4YXLL 1XZ0B 4G7YH 4M7JL 4BZ2A 2FCBA 1CDUA 1JV2B 5H37G 4C83B 2LGNA 5H4ZA 3MV9B 1URIA 4OKDA 2EUWA 4AV4A 1S7XA 5GS1B 4NJAL 4BZ1H 4CC1A 3QNXA 5D7HA 4PJAB 4XOBA 1FSKC 1RZIB 3Q8BA 4DQAA 5JPNC 1TYRA 3EJUA 2HJKB 2C3GA 3FFCB 2GY7B 1F13A 4DP1X 1Q1JH 3NFNA 4KVCH 1KYFA 3DVNA 4NCC2 3VFGH 1VKXA 2XNAB 1BGXH 3IJ9A 2B9BA 4W9DC 5I0DA 3MNMA 2ZUSA 3O3EB 5I15H 2MKWA 2BWIA 2R51A 1XL4A 4NO3A 3AS0A 4IOIA 1E9QA 2H3NB 2DBLL 5KSAB 5IESL 3EGXB 2F5BL 4TSBH 3MR9A 1XF4B 4HWEL 4GRMB 5EU7C 1JL8A 4M3KB 1I1AC 3VNZA 4KH2A 3WNPA 1R24B 1A6ZA 4M93B 3OSKA 2F61A 2PKDA 3D52A 1FIEA 3CBKB 3LNGA 2IIJA 3AFLA 1KACB 3IJYA 4PJDE 4PM1A 5AVUB 1QLEH 5AB1A 2IO5A 3HG2A 4IU2B 5E4OA 3TCLB 4ZI8A 2K3TA 4Y0GA 1AHWB 5DJ8B 3TNMB 1NBVL 3B43A 5EUOF 1YMME 1GZQA 3ORJA 5C07B 5I2IB 4DZBB 3V6OA 1M2OA 3P11H 1BMWA 5HHMB 8FABA 3IDGB 2FSDA 2B1HL 1OGAE 5I1DA 1NWOA 3DUUB 5JOFA 1U8HA 4OZ4B 5DD1H 3GXIA 3Q01A 3V0AC 3RZCC 5B7FA 5FPIA 5F7FA 4LKXA 3X12B 1FJ1B 1YVLA 2YMXL 3U4KA 3QDMD 4HUKB 1WFUA 2BY2A 1A6WH 1OZUA 4TNWF 2BHZA 5FGRA 1BEYH 4YHPA 1HH9A 3FULA 4LDLB 3MRKA 1L4IA 2J8OA 3SDCD 4NKIH 5A2FA 3D39A 4BUGA 5TQ0H 5HHXL 1KT2B 5SWZA 4N28A 1CXIA 5T5FH 1UXLA 2OCJA 1QRKA 3BUPA 1DQDL 5CZKA 4GT0A 2ESVA 4KI5D 3VXRB 5DRXA 1IGCL 4D0CA 5EN2B 1S3KL 2BW5A 5LB1A 4JO3L 4TL4A 1XIWA 3ELAT 2PTVA 2WLYA 3NJMA 1UWXK 1DUYA 4HMEA 2CLZB 3QRBA 3GUTB 3VXME 5E2JA 3TFKD 3V5KA 4EBQH 3LZNA 3QXTA 1AS6A 5HDBE 2DQMA 1T7XA 4PJIB 2R23A 5GISH 3BPLC 4CILA 4RVBA 5IV2A 5KSBB 1OAXH 3DMMB 4PJ7F 5BUAA 4L1BA 1MCFA 1MLBB 1SDYA 1XGUB 2ERJC 1EDHA 5ID1B 5D2LF 1DANU 1QFWI 3E3QE 1GGBH 4ODHL 2PPFA 4Y2NA 2Y7NA 3CDGB 3ULSB 4Y19D 2FX9L 4CMMB 2RALA 3AACA 4ILDA 1T5WA 1TCMA 4WI8A 3WIHH 4RDBA 2BOLA 2HJFB 5EIIB 3ZY7A 4ES9A 2P5WB 2YUWA 4MVBD 2X4SB 1Q9KB 3PHQB 5DSCA 1MIML 5HPMA 5JMOC 1K72A 3HZ3A 4ONGL 1TMQA 4R7NB 4ZDHA 1G4RA 2NY5L 2P9RA 3DIFA 4YZFF 4GYBA 4BFKA 1YEKH 5MEPB 4LOFA 2J1WA 2YSSA 2PYEA 1UT1A 3CIAA 2C1PB 1CYXA 1FF5A 4GBXD 4JR9H 4QXWA 1S7QA 3L3IB 1E27B 3A0OA 5JR1L 4UTCA 3BZ5A 2BWQA 5AZEH 1FGVH 5JW5A 4G9FD 2F8XC 4UAOB 2JJUA 1FGNH 3EOYG 5KAQF 1U8KB 3NFPA 2FWOA 5C6TH 4XCEB 1U8QB 2EYTB 4IEFB 2OFQA 5GXBB 4X4MA 1XF3A 1EIBA 1SJHA 1U8NA 1U8JA 4ONOA 5D7SL 4F5CE 4P5TD 4XAWH 2CCLA 5HGBB 3Q13A 3CXHJ 4BA8A 4P3CH 3WTSA 4GG6E 2UWEA 1RP9A 3PV7A 2AXGA 3EUUA 1M9WA 4HJ0D 4I2XA 2F54A 2WQAA 5H37H 3FMGH 1GOFA 1Z9SB 3MA9H 4NZTL 4L23A 2H41A 4XP5L 2VLMD 3D0LA 4N8CH 2AV7B 3U7YL 1QRNB 4WI9A 2BSDA 3WJJA 5EWIL 2AANA 3PAZA 4ANVA 1NGQH 4FA8A 5D8JH 2BVYA 1IM9B 3KYMA 1A6AB 4NNYB 3L3DA 4UT6A 1G7QA 4HAFA 3CXDH 3MJ6A 3MJ7A 3OZ9L 1MHHB 5HVWA 1SY6A 3DX4A 2YUVA 3QR2A 1ET7A 1UM6L 3L4ZA 2HVKA 3PWPD 4N22A 3IDYC 1U3HC 3OQ3B 1FZOB 5B8CB 4CVXB 3C5ZC 4JHAL 4MD0B 4J3SA 1LGVA 5DZNA 3AW5A 4YX2L 3QJRB 3D25A 3RWGA 2F7OA 5KG9A 1INEL 4PJ5E 4HT1H 5DMYA 5I17A 4EI5D 1IZJA 3QQDB 3T0ED 1II4E 2DQHH 1IVLA 1IL1B 2VRQA 5DC0A 3TBWA 2QPEB 1C5BH 3G9VA 3WFBH 3MOQA 2J57A 3HBGA 4JPIA 5DGRA 2HPTA 2VXUH 3VYNA 4JN1H 3O6KH 1T7YA 1CFVL 2P7TA 3DV6B 3BVTA 2K70A 3HFML 3SGJC 3NJVA 3FO0L 4I88A 1OLLA 3MRRA 12E8L 2NY1B 1BFVL 1K9TA 3UTQA 1X5IA 5GSVB 3H2WA 4L29A 4U1MA 1JRHL 4PJ8D 1ZHKA 1J9RA 3ZDXF 4TQPA 5FKAB 4ODBD 1QWHA 3ZZ1A 1PZ5A 1I8LC 3H54A 3SCMB 1KULA 4X5WB 3DUSB 2EDRA 3PV6B 3ARGD 1JGLH 4PJHA 3CC5B 3HE7A 4MA8L 2OZNA 1F1GA 3AREB 3NZ8A 2X9WA 4I3RH 2CBQA 3FHQA 1PZDA 4MQXD 4G6MH 2VH5L 4PJBE 4XB8A 3RHWK 3DV4A 4M1CD 1FL6A 5GHWL 4CMHC 1FCCA 4EQ2A 4K07A 3FT4A 4EQ3A 1DCEA 3FBQA 2WZPA 1ONQA 4D94A 2VXTH 4JREB 2D7TL 5GGQH 1S7XB 1ZDSA 3QNXB 4XN9A 3DX3A 5HSFA 2AZUA 2VDQH 2X3AA 4HIHA 2Y36L 4OQTA 3KYAA 2VDRL 1A02N 2QV2A 3WD5H 3NFNB 3O4OC 1SDDA 3PWPB 2VXQH 1EUUA 4XVUD 3MCLL 4E41A 1R3HB 1NCTA 4JE0A 4U05A 4R7DA 4GO9A 4L8CA 4EE2A 4PJ9A 5C0NC 4G5ZH 4A7VA 4IOIB 4L1LA 4F37K 2VW7A 3MR9B 1RKRA 1GS6X 1PKQA 1TZGL 4PJHF 4WNQA 5IROC 3TBTA 2X7LA 1ACYH 1JTOA 3HRPA 2VC2L 3FB7A 3PGFH 4DW2L 1N7ML 3JWNG 4FFYL 3T0EB 3WI9A 3O9WC 4LARL 5F9JB 5I6LA 3KDMB 1NMAL 1RUQL 4M1DL 5HI4C 2R0WL 5BQ7B 2OR9H 3IKKA 1OP3H 4LHQB 5AW4B 2NW3A 1PIFA 1BCIA 4WO4A 4U6HB 1UD4A 1GZQB 2BVTA 3HNSL 3PE9A 4Q6KA 2CLVB 3VXPA 1NINA 3FO1A 3AMLA 1UH4A 5KVEH 1AKJD 3KL0A 2XWRA 4LVOB 5KEZA 5K39A 1FORH 2OSYA 2P42B 5BVPH 1N64H 4FQPA 1SF3A 4JFXB 4I87A 5JOFB 1U8HB 3DGGA 1E4WH 5L4FA 1E6OH 4LKXB 5F1KC 2C34A 3LRSA 1OAJA 3FQTA 4CA4A 3JUYA 4UBDD 4AOFA 4WHTB 4Z7QB 4YHPB 5F7WC 5LGKA 3AMKA 1HH9B 3X14A 3MN8A 3MRKB 5KS9A 1CC3A 3NFSL 3D39B 5IZ7A 1NSNH 3ZKXB 4QRRA 2NDGA 1BX2A 1WJ3A 4KKRA 5SWZB 3X2QB 4XTRC 4GQ9H 3K6SB 3BWUF 1T7ZA 3B8SA 2ESVB 1HL5A 5DRXB 4D0CB 2EUVA 2A1WH 4PG2A 1MFDH 1KEGL 3QC6X 1B2WH 2QHRL 3DBXA 2EIBA 3KXFA 2X4NA 3ESVF 3VE0A 2OZ4A 1JERA 4KK8D 5IB5A 1AG6A 3MCG1 5CMAA 4ZX5A 4PRBA 4E9SA 1MCBA 3V5KB 1MW0A 1PYWB 4XHJC 4XVTH 3VW3L 2A9CA 3C08H 4JM4L 2IPTH 4X9BA 3E80A 4AYBA 3OJDB 2DYSB 3HZKA 2DAVA 4G6JL 1D6EA 1O7DE 3DIVA 5CIPH 1KPRA 2IFFH 4OU3A 4ANWA 2MPAH 4OCSL 3QZWG 2HX8A 1BIIB 4LEOA 3VTAA 4F2EA 2FJGB 3HNVH 1SHWA 4R9HA 4UQ9A 3JXAA 1T5WB 2R2HB 1WP6A 2V9UA 2XWXA 4NN6C 4U1SA 5A2LH 3WSQL 1BG1A 3BPCB 2GJPA 4XNAA 3S35L 3EYFA 3KH3A 4G6FB 2E6PA 3UTPD 4PRIE 5DSCB 3GINA 3P0GB 2ZXGA 3KJ6L 4RFEA 3MV7A 1I1AA 4MMYA 3A22A 2WY3B 2DD8H 4ZDHB 3RUGA 1YEHL 1THCA 2FR4B 3D6GA 3DIFB 3OC8A 3CHOA 1P7HL 4WKZA 4YHOL 4QHUA 1U8MA 4ADGA 2HFGL 1SEBA 1QFUL 2Y24A 4X4ZA 5FDYA 4B60A 1Q0XH 4QAMB 5CJXC 3G5VB 5TF1H 2QSTA 4TTGA 3ZDZE 2FT7A 4B50A 1S7QB 4N24A 2WQ8A 4WUUE 4I0PC 3VD0A 3O2VH 4ZMPA 4WGWB 1NCAH 2PW2B 3NFPB 2XTJD 3LMJL 2FX7L 1PFOA 4L1TA 2H0JA 2QADC 3D3VD 3GMOA 4GRWH 4K5PA 3RAJL 4HPOL 3RZCA 1XF3B 1SJHB 1GGUA 1U8NB 1U8JB 1IJNA 1IGJA 5AW5B 2OS7A 3SJVD 1FC1A 2ATKA 1BM3L 1RULL 1JZHA 3BKML 4PJEE 3WO4C 3BH4A 3CFKA 3W1ZA 1NEUA 3DKHA 4PAZA 1SLUA 1EMTL 2UWEB 2VAAA 4D0DA 2AXGB 3PG2A 2C5DC 2VDPL 3BWSA 4N0RA 1QX1A 3B9KC 1J86A 2F54B 3B2DC 3GYRA 2JJWA 1RZFH 5C0DA 4K94C 3VXSA 5CN2A 3ZK0A 2OJEA 3FSZA 3U7WL 1CL7H 3D0LB 2WQRA 3ASWA 1TQSA 4K7PH 3CFJA 2R56L 4GXVH 3Q2CA 1HYRC 5LWYH 2P49B 1CFQA 4J5VA 3UG5A 3VH8G 3L3DB 1G7QB 3EDEA 1UZ6E 4IS6A 5FW6A 2WMPA 2BY1A 2Q7AA 3AB0C 4Q9QL 3MJ7B 4KKNA 3NVQA 3T08A 4KK5D 2NY7L 3RB7A 3BH8A 4POYA 4IBVA 5EF3A 3PP4H 5ERWA 4UQ2B 4NDMA 3EIFA 4A6YL 1NCDL 4QHKJ 5I28A 4PJCF 5GZNC 2IGLA 1A4BA 4KMQA 2P44B 1QP1A 3JWNH 1DN0A 3WL9B 3VXQA 2C9RA 3AU1A 3WTWA 3D25B 3RWGB 3S4SA 3P4OB 5KG9B 1GY2A 3ULUL 2BY0A 5I17B 5A7BA 3VJ6A 1YN6A 4OLYH 3TBWB 1JGDA 4B9ZA 4PB9L 4JLRA 1MCJA 4W6XB 3EH4B 2WXIA 4JFWA 2P7TB 4DP0X 4HLEA 3BN9D 1TTAA 1UGNA 3MRMB 3BD4A 1EERB 5B39A 1VDGA 3IMTA 4P49A 1UB6A 4DVRL 1CICC 4L29B 3N1QC 4U1MB 5BS0E 4HCGA 1ZHKB 3OMZA 4LVEA 3QJXA 4LEXH 5AVYB 3BCDA 1G0XA 1EFXA 5DFVD 4DAGH 5I18H 4N5EC 4KZDL 4RAVB 4JE4B 1JDDA 1PZ5B 4L05A 1PNCA 1DDHA 2Q7NA 3FUKA 4JAMB 4GS7C 1OQXA 5KBMA 3B3IA 3WENA 2AQ2A 3U0WL 4ZS6C 1CE1H 2Z4TA 3AITA 4ODVL 3HE7B 4TQHA 5AOKA 4RNRA 1AZVA 4YR6A 3A6BH 4UTBL 5AW9B 2GTWA 2WXQA 2O5NA 4HFUH 1GGCL 1HC1A 1U8CA 1FL3A 1FL6B 3ZMEA 2Y23A 3G04A 1X5JA 2X10A 2IANE 4KKBD 4Z7UF 2DM2A 1QNZH 4YSDA 2XCMC 3PABB 1ONQB 4XZ4A 2VJ0A 1UUNA 3T0VA 4HS6A 2LFGA 1JZIA 1OALA 4HEME 4J3BA 2I07B 5IJBC 4MYWB 1BBJA 5FB8B 3G08B 1RURH 2FYYA 4OCRH 3TO4C 1J5HA 4U7KA 2G2NA 3D51A 3DNKA 4HIHB 3TVMD 3O11A 4J3OG 3CSYA 1J0KA 4JPVH 4JRYD 4OFQA 5A6IA 5JTWA 1F4WH 3PQYD 4E41B 5D9SA 2IBZX 1X9UA 4R7DB 2G0LA 3ZE1E 3TXAA 4BK4A 5LN8A 1WHOA 5GGTA 1KG0A 2J43A 4JANB 2C9UA 4LRIC 3SE9H 1SFHA 2CIKA 1Y1DA 1U3HA 2Y0SA 4UOQA 5LBVA 3ARQA 3C5ZA 4OR1A 3TBTB 3CVIL 4LP8A 4LO9A 2X7LB 1WF5A 3ZOAA 1MXGA 3F12A 4UT9A 3C8KA 9CGTA 1D5MB 5I73C 3BKYL 5A3IC 1A1NA 3D2UA 3AT9A 4N2MA 2ZCKL 5KUMA 2NW3B 5DQJA 2YQBA 3EZJB 1QI4A 3VSUA 2BJML 3VXPB 4E2OA 4XRCA 3FO1B 4JKMA 1JXJA 1RJYB 1U33A 3SGJA 2ZPKH 2BVQB 3UTTE 2YLKA 5F9AC 4OD2A 5IMLA 4JY5L 3LPFA 3DGGB 2DQCL 4KTYA 2RB8A 4MJHA 3DGCR 5I5IA 3D34A 5KVGH 2CBOA 1HU8A 3LRSB 2B0SL 3FQTB 4R0LC 3DTDA 4PJDF 4ZUUA 3D85A 3ALWA 4G11A 3IS0X 5DO2C 3IXTA 2XZCH 4Z3IA 5KS9B 1DQML 3O6FB 4JG1L 5AVTB 3H3BC 4WGKA 2N0MA 1A5FL 2XQYK 3DRQA 2A6KA 3LXBA 4KRNA 4QRRB 2UY7A 4ECNA 4HAKA 5D96C 4OJFL 2JWYA 2H3KA 5I9QC 4CBPA 3HVDA 1G1CA 4FQXD 1U6AH 3I75A 1UWYA 3F2LA 3DBXB 5T1DL 1QBBA 2EABA 3APCA 5GJSL 3VE0B 5IB5B 1GGIH 5CMAB 2YGOA 2H1XA 1ZXKA 2VZUA 3B4NA 1RPKA 3IGAB 4KJPD 2XN1A 1KGCD 1V7NL 2P5EE 1FSKB 3HZKB 4JRYB 1IGYB 1KPRB 3PQYB 3L3JA 1H8LA 2WZ0A 5DJAA 2BC4A 5C2BH 4C56E 3IVKA 4BWWA 4BZ1L 4LCYA 5KVFH 1ID5I 4KXZH 4LEOB 2XXFA 2FUTA 5I74C 1R0AH 3QAQA 5I0WA 4W81A 1YDPB 5ID0B 3U6RB 3QQ9D 1DFXA 3B2VH 2WBWB 2J71A 4U1SB 2FJFA 1Q1JL 5FGCE 3VFGL 2KLTA 3QFJD 1MCSA 2F7PA 3K2UH 1QSEA 4KU1A 3TH3T 4H8QA 2DMKA 1DLFH 3H9ZA 4JGJA 5HDBF 3SQBA 3P0VH 4IBZA 5IROA 5I15L 1DVFC 1F86A 4RFEB 1CGTA 1KBGL 1WYJA 3MUGB 2GJRA 1WUNT 3MV7B 4MMYB 2EEXA 4XN1A 3RWFA 3NRQA 1HNGA 4M7KL 3RUGB 4OV5B 3CN1A 3QCTH 4TSBL 5IEHA 2OM5A 3O9WA 5CEZH 5I6KA 4WKZB 1X4YA 4C54A 2VITA 3QWRA 4QHUB 5JZ7D 4RBPH 2BXZA 5H2BB 3I6LE 2IEPA 1JXKA 2ICCA 4FS0A 2XICA 4MCZB 4N2OA 4WNJA 2HVJA 1L6PA 5AVVB 5I8EA 5GGRA 2YJQA 5FO8A 1AMXA 3ULUE 3UO8B 3QUZC 3QJOA 5JOEA 3V7MA 4DERA 1KJ3L 1SBBA 4GKLA 3ZKND 4ZUSA 4HH9A 3DHUA 1PD1A 3QPKA 1CXEA 4HDIA 3LZPA 4MDIA 5JOPD 2EVJA 3GMOB 3OR6A 3LH2L 1BEXA 2EO9A 1X5YA 2YIHA 2XVLA 5T3ZD 5D2NE 2FO4B 1EK3A 4A37A 2IH3B 4N68A 3UTTD 1IGJB 1N19A 3U48A 2ATKB 3ES6A 4ODUA 4P3DA 1NL0H 3ZIMA 2VN7A 5DD1L 4E36A 2X88A 1CK0L 2VSKB 4CC4C 1V3LA 3EHBC 3ULAB 4PS3A 3D7PA 5AAMC 3V52L 4D0DB 2O6PA 3FSAA 4KO9A 4FQXB 4QXTB 2WXRA 3CQFA 5C0DB 3MLYH 4F8LA 3VXSB 3Q6GH 5EIQA 5GS3A 4A04A 4NKIL 2GJZB 1WIOA 4XCNB 1ADQA 3CFJB 3GSVA 3G6AA 2MSPA 1BVNP 1U9KA 5T5FL 1TXKA 3US1A 2GIYA 4TNVF 1I1YA 5F0LB 4QMEA 4Z7AA 4FE9A 4Z7OE 5HY9B 1RZJH 2KC0A 2LABA 4J3OH 3UGXA 4S11A 1DQTA 4FI7A 1CT8A 4GG6F 3BPLB 4XP9L 1G4MA 4PJ5A 4NEHB 3BH8B 1BA9A 2P8MA 4BKSC 1DVYA 4QTIH 5ERWB 2CHZA 4KGJA 5C70A 1BXUA 4JN2A 1IGML 3PP3K 3SN6N 1F1DA 3GTTA 3CFUA 1WAPA 5F9OH 1A4AA 1ZPLA 2A9BA 1AFVL 1C9SA 1QUNB 2DTML 2ZWLT 3QUKA 5C9JB 5J56B 4NXKA 1GGBL 4ERSL 3AU1B 3S4SB 2IQ9L 1NQBA 3GI9H 2AQRA 4WU7A 1M71A 4B6ZA 3WGVB 1MQKH 3FT1A 1INDH 3MJWA 4H88H 1LDPL 5EC2A 3M1BA 5F21B 4AVIA 1YN6B 1JGDB 4X7CC 4EOWH 1PD6A 1GCFA 4S0TD 4JLRB 2WWMD 3WNMA 5DFTA 4TPRH 1KGIA 3JT0A 3WKYA 1L0QA 2VM4A 3KLSA 3OAYK 3FSOA 1FO0B 4JRFA 3GRBA 5AVZB 3RPKA 1VGKA 2OYMA 4U0RB 3E8UL 5CJXA 5C7XH 5B39B 1EGJL 4H25A 4YQXH 1UB6B 1G9HA 4IKJA 5EUKA 4ZMZA 3PREA 4I0PA 4BSVA 4RZKA 1HXKA 3U7AA 2EE2A 4LPVA 4UQ3A 4WFED 2B8OT 1P84J 4G8GE 3Q5YA 2XWEA 3EBAA 4AWJC 3HBPA 2DS4A 3B3IB 5JW3L 3NJLA 4JFOA 1ETJA 1KEML 3BAEL 3HB3D 5FM4A 4RNRB 1M53A 2P45B 2UZXB 3EAKA 4NWTL 2GTWB 3ILEA 4AMWA 4ZMNA 3T6ZA 2W88A 2NSMA 5CGTA 4DPAX 2OR7A 3WKMH 3B9KA 5EH1A 3CU1A 4FP8L 5FA4A 4P3CL 4H20H 4WWID 3VSQA 2SODB 1KJMA 1NLDH 1Z3GH 3L4YA 2XBTA 4HS6B 2JH2A 5IBUG 4PLNC 5LGJA 5AW6B 1BBJB 2HRHA 2FYYB 1ZVHA 4ODSL 4KKQA 1USZA 5JHLH 1AR1C 3GM8A 1ZHNA 4NQUA 1JI2A 1Z2KA 2DN7A 3CSYB 2FQDA 3LRMA 5LGHL 4ZUVA 4PYHA 3L3KA 1K8DA 1WGOA 4PJBF 5TTRA 1NFAA 4EIZC 2ZYIA 2HA1A 2NXZD 4U1NA 3MRQA 2RMNA 4IMKC 2B77A 3BKCH 5LVEA 2QJDA 4R97C 3GIVA 1KCKA 3F01A 1KG0B 2EIMB 2IMMA 3IDYB 2A4CA 2FB4L 1U3HB 2JKSA 2YPLA 4MAUH 5F88A 3IAGC 1RZKC 2YEVB 4M62H 3S0PA 3C5ZB 5L2KD 5GZNA 2WLLA 3G6JA 3MRJA 5DUBA 3MUUA 3QJZA 3SDAD 2C3WA 2G3ZA 4QJ3B 2NXYD 3OF6D 3C8KB 4PV8B 1IM3D 4WI2A 5D7LE 4C55A 1A1NB 2W9DH 3D2UB 4TM9A 2YKLH 4OVUA 1MFCL 4OZHA 5D2NC 1EJ8A 4BZYA 3CK0H 2W8CA 1RY7B 1W2KT 5TK2A 3IT8D 3FQNA 2LE9A 1RUML 2DQHL 1T2XA 4HWZA 1U93B 4LOUC 4LSPH 4K23L 2XN9E 5I19L 3WLWC 2GBTA 2WUBH 4D9RE 2BIHA 3GXDA 4YBQD 3ZDYB 3QK0A 4WSGA 2VXUL 3V0HA 5IMLB 1SOXA 1E0OB 3FO9A 4V33A 4YHMH 2VUOA 3O6KL 5GGSA 1CICA 1YEWA 4QWWD 2WBJD 4HU8A 5IFJA 2ARJA 1P4UA 3Q06A 4QRSB 4LAQL 3P4MA 1WAEA 2X3BA 2XA3A 3D85B 3LIZL 4KPHH 5E51A 4ZUUB 4B7LA 1J5OH 1FNEA 3IFNH 3IXTB 1J1XL 1IQWL 3HB3B 5KOVC 4HBCL 2BZDA 5EV7A 4D8PA 3L4WA 1LO5A 1G7HA 2A6KB 1BVKA 1JFQL 3DRQB 3MJGX 3MQIA 2UY7B 4L37A 4QF1B 5DHVA 5FFOA 3V4VH 2RHEA 4DCQA 3KLDA 1FVCA 1SFDA 2JK5A 3GHBH 5E70A 2AMUA 2EDWA 1JDCA 4CMHB 3EDFA 3NSCA 3ENEA 3SKMA 1G0YR 2E7BA 3MACL 4ZFOL 2OW7A 1QATA 3E6FA 4HEPA 1IBGL 1F3DJ 2WWNA 5B38G 1MFAH 2VM9A 4XPFL 5F3BB 4OZIE 3TZVD 1AOZA 5HHPA 2JB6A 2UX6A 2NY4C 1IJ9A 3TO4A 2Y7OA 3EBGA 3QRGL 1DZBA 4JFZL 3O4LA 3MA7B 3L3JB 5C09D 2NXZB 3IVKB 5IB3A 4LCYB 2FIKA 3DK2A 2CDGA 2J72A 2IAAC 1Y0LA 3DGDA 4MGXA 4BQBA 1GYVA 2YPVL 1I9RL 4ETQA 4MSWA 4AEHL 5L2KB 2FJFB 1KYUA 3IJSA 2X1PA 3T4AC 1TZAA 1QSEB 1YAZA 5I24A 3T77A 1P2CA 3F7VB 4ZW8A 5IMKB 1XHHA 3VSTA 1HXMB 4WUUA 4OLWL 4PBXA 4B5ZA 3NK3A 1FV1A 3O9WB 2VITB 1LNUA 3PGFL 3ARDD 3A24A 1OCRB 2X89A 4NLHA 4XAKD 5ELIA 4TUUA 3UCQA 1YYLH 4ANXA 2AVGA 4PY8J 1HS6A 3CLEH 2B14A 2HVJB 4UM9A 3E7JA 5I8EB 5GGRB 3QVAA 5FO8B 1SXCA 3F7PC 3QDGD 1J0YA 5AQ0A 4LPCA 5C08D 1MJ7H 5JXAH 1B9ZA 2GBVA 3HBQA 3QJHA 2MTAA 3OR6B 5F7DB 2VABA 2PYFA 4B9FA 2YS4A 4HD9A 3U1SH 4M8RA 3ULVD 1KBBA 5E8OA 1IFHL 4R0LA 2V3EA 5BVPL 2R69H 3KLHC 2IADB 3ES6B 1LQSR 3H2QA 4ODUB 2Y7QA 1SXAA 4L4TE 4AZ8A 3BXNA 2AI0L 3NRPA 2FBJL 4PGCA 4P06A 3ZDZF 2XUWA 1I7UA 3PDDA 1I7TA 5T3XD 3SE6A 3LH8A 3QP3A 1G7IA 4GIOA 4OCXH 4XZUB 3WHE0 4G8FA 2YD8A 4MQSB 1XSOA 3MVSA 3US0A 5TDNA 3OXRA 2GTZA 3REWB 1OWWA 2FECL 4KC3B 2VDKL 3GSVB 3TZVB 3WUZA 4OJCA 4XO3A 2ED7A 5FCUL 1VZHA 1C1EH 1I1YB 3RJOA 4D3CL 3FQ4A 5DMGD 5CN1A 4PJEF 5A6LA 1YNKH 1XQ4A 3VMPA 2ZOUA 2FD6H 1WCBB 4I13B 3NYKA 3Q2LA 3C08L 1BAWA 4EDXB 5FWQA 4JN2B 4GSDH 1UCBH 4GP8B 4DVBA 1AQMA 2IFFL 3N91A 4AKOA 2WANA 2AKRA 5D4IA 1KFGA 1M71B 1JF1A 3C5JB 1E9OA 1UZ6F 3OKDB 2CAKA 2HT3D 5EC2B 1FH5L 1DVFA 2XETA 1MW1A 3ZW3A 2QVFB 5DD6A 3S37H 3HC4H 3Q5OA 4FZ8H 4XP4L 3ARDB 2HN7A 5MERB 4XNMA 2KQNA 2PCYA 3C6EA 5MENA 3K6FA 4AJ0A 1RERA 2IFGA 4OSUL 4Z9KB 2ADGA 4FNPA 2EP6A 1TJHH 2DD8L 3VM5A 5T1LA 2HTKC 4MNGE 1VGKB 3TA3C 3PNRB 3H9YA 3HZYA 3NIFB 5FUCC 5J1AB 3QDGB 4H25B 4X9IA 1NDTA 5C08B 5DWUH 4HOWA 4WTZG 3K1KC 4MS8C 2ADJA 4J39A 3NCMA 3WDHA 1KIRA 4UQ3B 3QUZA 4W9HC 4P23C 4DIXA 3ZL4L 4OD3L 2YXMA 4JVPA 3L5JA 2QADB 4HXBH 1HNYA 4XP1L 4P2OD 4H0GA 1G9NL 4NSKA 1U4FA 4JFOB 5BPPA 2XYBA 4MD5A 1T6WA 2IGFH 2DMCA 4CC4A 3NBNA 2WIIA 5AAMA 1R6VA 2MCG1 1LO2L 5LXGH 15C8L 5FA4B 3QJUB 4IYKA 1OCWL 2RA1A 3BSZL 5LGJB 4KJWC 3OHXC 1QFHA 3GHEH 3BP6B 5C0JB 2VLRD 4IIQC 2DIAA 1CL7L 2CGRL 4YHZH 3L3KB 3V7AE 4K3EH 5E1AB 4EVNA 3HE6C 1MCRA 4J7RA 4U1NB 4TS6A 4Y8DC 3GIVB 2QPDB 4YAQB 3FKUS 4L2LA 4LDEB 3CVHH 3HA0A 1UXSA 1X9RA 2YPLB 4XMPL 5F88B 5B3NA 2FEEI 1EBPA 1UH3A 3MNVA 2WLLB 3DOSA 3FAXA 3G6JB 2AEPL 3MRJB 5BOJA 3PP4L 3V6BR 5DC2A 2X0WA 3QR1A 1F11A 4LCWA 3LRLA 4Q6IB 3K8KA 1DSFL 4RX4D 1TYEB 3MPCA 4Z7WE 2XIDA 4DT2A 3N44B 2FJSA 4NC1E 4OZHB 5EOQL 4AITA 4E68A 2J5LC 3ZE1F 3FQNB 3O6LH 2OMUB 4MS6A 3VD9A 2CDEB 4HWZB 4ZUWA 4YNYB 5IMMA 3TV8A 3HRZC 5TDPB 1AGBB 5HDWA 3LZLA 3RPIB 1FCGA 3U2IA 2HPOA 5BXFB 1AKPA 3FO9B 2VDLL 5GGSB 3DJRA 1ACCA 1MCWM 3DIDA 3VX1A 5I1JL 1AZNA 2ARJB 3P4MB 3VFWB 2XX0A 1ZLVK 3FCUB 1FNEB 1ZAGA 4F33A 4TVPH 4GS7B 4WW2B 5DO8A 5CU5A 1LO5B 2R0LH 1G7HB 5DHVB 2VN6A 5GRVL 4LMQI 4NS0A 4X0NA 3SZ6A 2P5EA 1KLUA 3GMRA 4DCQB 1D5BA 3ZTJH 1MDAA 3GBNL 2GJ6E 2VDMB 1SJEB 3BVVA 4GKNA 1FVCB 2I26N 5GJTL 5HGDA 1S3RA 3FTUA 1TITA 2F1AA 2HLEB 2HJLA 1G6RL 3GO1H 2XKNB 4GXUM 5DT1L 3SKMB 3CVCA 3E6FB 1KV3A 1UA6H 4Z8FH 1MRDH 3IU3A 2VLRB 3E1F1 5HHPB 2JB6B 4DP7X 3O4LB 1MFEH 1WZLA 1W72A 2H9GA 3H6AA 5CP7B 4TQ8A 1KCWA 1S9XA 2IVFC 3ZTNH 4QTFA 3RIFF 1U8PA 4GUQA 2CDGB 2X28A 1RURL 3BO8B 4G7SB 3TV3L 2XQYG 1CLZH 4I3SH 3RFZC 1NTDA 1YYMH 4ETQB 4MSWB 3LQMA 2ZCLL 4JPVL 5TD4A 3IJSB 1R3KA 2WP3T 2ZP8A 1ULVA 3BC9A 5LCVA 1P4BH 4GFTB 4BQ9A 3T77B 1P2CB 1OTSD 3HR5A 4C4BA 3OTTA 2QLYA 1FFOA 4NC2B 1H9DA 4UM8A 4KKLC 2AK4E 3Q8EA 4JVWA 3IFLH 4PG9A 1FV1B 3HS9A 1MIEL 3VG0L 2G60L 4QHPA 4O9HL 4NAMA 3AQXA 1LNUB 4ZAKC 1WZ1H 3C87A 5D2NA 2HFEA 2JJSC 5E99L 2RFXA 4LSSH 5HVGB 3U36A 4UQCA 1H3PH 3GEFA 3L5HA 4WV1B 4UM9B 5HVHC 1SEQL 1VEMA 4HIXH 3FCBA 2FEDD 5E24E 1OARL 2ZNWA 1KPUA 1W8NA 2NY2D 3HAEA 4F1SA 1YCSA 4UB0H 3P69A 2OSXA 2VABB 4YHYC 2EXYC 4UDTA 4FG6C 2IDCA 3QPXH 4NQCA 2J1XA 3ARWA 4HHGA 4AZ8B 1OK0A 3BXNB 5K9OA 5DCCA 4AY0A 5C9KA 4BQCA 1I7UB 4NRXB 4MXVE 3K81A 3ARSA 1G7IB 3FS9A 3ULUF 3IMSA 1AZCA 2F6AA 2XZCL 4HWBA 4GSUA 1NANH 1O0VA 3PWJB 1CBVH 5BOPA 3GPSA 4KY1L 5FYKD 1A3ZA 4Q74A 3FRPG 5KJ4A 2CGYA 4NFCA 5TDNB 3RVWC 2WVTA 5JMRA 2GTZB 1T4KB 2JQAA 2VMEA 4OM0L 1KYDA 4LPXA 1T03L 4JDZA 4QEGA 2ZKWA 2ZXBA 2YHGA 4O5LL 2FLBT 5IJKA 2CKBA 3VFUA 2OL3A 2JV6A 2WTPA 4U1GC 1R5IA 5FV1L 1I8KA 1QMUA 1Q0EA 1RIHL 5FYJH 3OWEA 4Y4KD 4NC1C 3QDJD 4LLDA 4BA0A 1KJ2A 2XBDA 3LOWA 2VLJD 3P77B 3BDXA 5TFSH 5I74B 5KYUB 2NY3C 1AC0A 5C0AD 2BCKA 5C2BL 1Z5LA 2WUCH 2AKRB 4JQVC 3VVWA 4Z7OF 1KIQA 3T4AA 1EANA 1JF1B 3BAXA 1E9OB 3D1MC 1ED3A 3CN4A 4LHJB 2WTOA 4HULB 2QKIC 1DVFB 2O30A 4NLAA 1S5HA 4KGLA 4YXKH 4YPJA 2JXMB 3CG8A 3ILQC 4X7EC 4HOXA 5LBGA 1Y7VA 4XNMB 1DLFL 5CKAA 5MENB 1L7TH 4QIRA 5CGBA 2V17H 4JFHD 3U9PH 1T22A 3LEYH 1UOLA 3MTRA 5T1LB 3QCTL 3F05A 3HZYB 4QT5A 2FATH 3GDCA 2VMFA 5JHMA 4PTTA 1PAMA 3SB3A 3KPOA 2G9HA 2ADJB 4S1DD 5TDOA 1KIRB 1SLXA 2HP4A 2XWDA 4KZCA 2APTA 4K7FB 4PUBL 1WT5A 3JWNE 4XN2A 2ROXA 1T1YA 2BRRH 2VNCA 4NPJA 1DL7L 1LE5A 1AO7E 1HT6A 1JMXA 3QWOA 5D7IE 5JORA 5EU4A 4UMGA 5HXMA 2R4RL 3AGWA 3LD8C 4MD5B 5ALBH 4A1RA 1QEWA 3BP4A 5HYSG 1A3LL 4N2LA 3BEWA 3CFIC 3CPLA 3QDHA 1YQVH 1E4HA 3P9LA 3EHBB 4PYGA 2WIIB 3S35X 3X1BA 3HI6H 2QDWA 5EZLA 3UPAA 5C0CD 1KB5A 1JYNA 3L3HA 3LKSB 3FCGA 4P2AA 3RWIA 5EEUA 1CLYH 1BREA 4G7QB 4FA7B 4GLRH 3NJFA 3VCLA 1U92B 4IRSC 1RXLA 3ABMB 5J5EA 3SZKC 1A4JA 1BJ1J 2MNWA 1TFHA 3TS8A 1I7ZA 3PXHA 4DKEL 1DJGA 1L9PA 1O9VA 5IVXE 3S3JA 1S4IA 3C2SA 5T1MA 5EMYA 2WSDA 3QDJB 1KIPB 1C7TA 1MQ8A 1BYOA 1T66C 3HJEA 3LKQA 4JCMA 4KX7A 3KGRA 4EVNB 4XMXA 2AJXH 4H8HA 4DN3H 2EEBA 3O3BA 2BXYA 4I8DA 1UXSB 3I50L 2YARA 1TLKA 5IGXL 1BXVA 3T2PA 4R2GD 4HAGA 1N3NA 3DOSB 2X5PA 4AH2A 5IJVA 1U0QA 1KLGB 2H47C 4PLKD 4BSWA 4F27A 3JTTA 1F11B 4LCWB 1T1ZA 4GI8A 2DLFL 3HC0A 2JLPA 2PPEA 5KJRH 1A6VL 3TP4A 5ADOH 3CUPA 2P47B 1A4CA 5CR8A 4LSTH 2M2DA 1WTLA 1U4EA 1LO0H 3FTYA 3L3OC 1MJ8H 3LYRA 4ZUWB 1FAIH 4LLYA 3IDNB 2YK1H 3BYYA 4HUVB 3TA3A 2GAZA 3VWKD 5A2BA 4DZ8A 4YDVA 1TNMA 5K5YA 3VQ2C 1B0GA 4FTVA 3UYPA 1RMFH 3SYAA 5IHZA 1BZEA 1TUPA 1VENA 4JFPA 4GP5B 3TWCH 5C7XL 2NNCA 4P23A 1LEKA 3A67H 4H0LC 4N2BA 4BFNA 5HYQA 2E7LC 3V5DA 4J8RA 3KG5A 1QR1A 3BVWA 3V0IA 3BYTA 3WAKA 5E2VH 4YZWA 3MODH 1KLUB 3GMRB 1XGRB 3IE9A 4XC3L 1D5BB 3FN0H 5J7CC 4JY4A 3X3FH 4DQOL 1KBVA 3L4VA 1VADA 4LQFH 4H8WL 1ESOA 5HGDB 2BNRD 1ZXQA 5J13B 2HJLB 4LSVH 4NCDA 1OGSA 4MB1A 2VW6A 2E9WA 1H3UA 5GGUA 1AYRA 4M8UA 3WKML 3R1GH 3MLSH 3OHXA 4RDQG 3SY0B 4G8AC 3GXFA 2QVIA 3OJ2C 3QHZL 2WLIA 1TTFA 3BVUA 2H9GB 1W72B 1AR1B 4BFJA 1Z3GL 4OUOA 4IIQA 1S9XB 3RIAK 5EU6A 1CXLA 2Y07H 1U8PB 2XI9A 4WU5A 4LBAA 1QW9A 4LVNC 3LEVL 1E2WA 1AD0A 3HE6A 5JHLL 3VFSA 3ZGIA 3C60A 4FYSA 5HGHB 3MRIA 1NH6A 3IGKA 1QI5A 1R3KB 3WXVH 4NKQB 3QI9D 3QSKB 1YEFL 4OZIF 4JJHA 4U6VL 4A2LA 2W59A 3B34A 4GEIA 4FQJH 4UM8B 1LL1A 4BGLA 3JWNC 2FE0A 3IPFA 2C3HA 3UZQB 3WIHA 5DVMA 3DOHA 4QHNA 5CLYA 4JO1H 1I53A 1AQKL 5DK0A 5C92A 4AQAB 4NQSA 2PWHA 3P30L 5EZIH 2GW5A 5K93A 3DTXA 2HFEB 1XCWA 4MQTB 3S98A 3TC9A 2RFXB 3U36B 2ENQA 1WTGT 4OB5H 2ODHA 3PP3H 4L4TA 1B6UA 1PCXA 2EDEA 2W9DL 2YKLL 1IFGA 3RDTC 1H9VA 3EJZD 3MJ9A 4OIIH 1HL9A 2H32H 2V9RA 3HRZA 4U2YA 1OP4A 3C8DA 1KPUB 3IXAA 3TBVA 5L9DH 1GOHA 4LAJH 3EFFA 5DRZA 4ENEC 4N8VB 4JFDE 2PNDA 1NAML 1DCLA 5I30H 5AKRA 3JV0A 1PZSA 4QRPA 2CK0H 3VDBA 5C71A 4NQCB 5EOCH 3NEOA 3KJ4B 5K9OB 4JG9A 4FX5A 5F1IA 2KZKA 4Q9RH 4PP2B 3APNA 2XQBH 1U2HA 4UOW1 5J12C 2OP4L 5J9PA 3TBSA 4XPAL 3ZSTA 1XT5A 3IFNL 2EEAA 2EYRA 2WLNA 4F93B 3RWCA 2QZ5A 1H5BC 3HLKA 5F96H 4WSJA 1HZHL 1DSWA 1IQDA 3V4VL 4KUCD 1MJUH 4XBEH 4Z7NE 4CW1A 4XNDA 5A6MA 4GUOA 4KKAC 4X6CA 4NHCH 5H37A 2CKBB 3T0XA 4NRZA 1R5IB 2MOGA 4LVHC 4ATWA 4YSSA 2JB5H 3SIKA 2G2RA 1JZFA 1I8KB 1T04A 3BPOC 5HHOD 1T5XA 4YSAA 1XMWA 5B3JE 3ZMRA 3HG1A 1KJ2B 3MV01 4U6YA 4Z7IA 2D7MA 2Z8SA 4LPUA 3RGVD 3PPEA 3QUYD 1XX9C 2PUQT 3FONA 1A6TA 3AG2B 3QI9B 3RFZA 3QXDB 3CDZA 3D0VB 4ZS7H 5FYLD 3S88L 1NGXA 2YPKA 3LQAH 4K2UH 4M4RA 1MHPH 4JGNA 4GMTL 1M42A 2ATPA 1CF1A 1SBSL 1TIUA 4OV6F 4KITB 2RR3A 2W9EH 5I5JA 3WBDA 4XNZC 4TL5A 5GRZA 5JQ6H 5LHDA 5C0FB 1LP9A 5BV7C 3GKWH 1HEZA 3N0PB 2ADYA 4N9GA 3RGHA 3TJHC 1T22B 32C2A 2PN5A 4AM0A 1J9SA 4ZAKA 5E95B 4GUCA 1IT9L 1RL1A 4ZZKA 1AIFA 2JFCA 1NCOA 2IPKA 4R4ND 2JJSA 4QT5B 2WSPA 4YFLI 3W2DL 5TQ2L 3HHSA 5BW7A 4KX9A 4L18A 1U58A 3U6XS 3KPOB 2G9HB 3DK0A 4WK0B 5E9DD 1SMAA 1YYLL 2UZPA 1T1YB 2N1TE 3IGFA 3N06B 1X7TA 2VGLM 1O5PA 5JORB 3QWOB 3WS6C 2NSXA 4YDNA 4MA1C 5EU4B 4LSRH 1QFOA 1MJ7L 5MI0C 5AALA 4OTXH 1N6VA 4IJTA 1QEWB 3BP4B 1IC4L 3SPHA 2AJSH 3BEWB 1MI5E 1M2VA 3P9LB 1OE1A 2KMWA 1W6WA 3UBXB 1GTFA 1AMYA 2OMBA 3D33A 5EZLB 3AS2A 5HYJA 2AQPA 3L3HB 3N40P 3P40A 5KVDH 2A74C 3F6IA 4FABH 5KWYC 3RWIB 3DYMA 3VCLB 5TF0A 1U8IA 1NMCB 1VFBB 4KRMB 3RY6C 3DETD 1F0LA 1KGYE 5CZXD 3UC2A 3CJJA 3SBWC 5F1SA 2R1WA 3KCPA 1GW0A 4IM8A 2WGNB 2Z31D 4DJMA 3QWNA 2I9TA 5FYJU 3IEAA 2XT1B 3MLRL 3RWDA 3LKQB 1HVXA 2CJUH 1C1EL 4I89A 3WAJA 3GS4A 4FMVA 3QYMA 5BRZA 3GJEA 1E43A 3U30C 5ICZA 4QXVA 2FD6L 3DECA 3DWTA 1N3NB 3FQUA 4AH2B 1OSYA 2VXQA 1JPSH 1L0YA 3GLZA 5ESVB 4BSWB 3WGUB 4ONFH 2A5UA 1T1ZB 4JQVA 4LLVA 3ZX1A 5IJCC 5TPWL 1KCBA 3O0RL 5DI8A 1HDMA 5JPMA 1N2RA 1UQSA 2QKIA 3CUPB 1NKOA 2V8LA 1S6NA 4MFHA 3RL2B 4V11A 4F15C 2WB7A 3DXAD 1LEGB 5BOZG 4HOMA 1IKFL 1KTJA 1XF5A 2X9ZA 4Y4HC 3N9GH 1JNLH 1BQKA 2L7QA 4KRPC 4XVSL 2V2TA 4FYQA 1QLEB 3HG3A 2I5YL 4XI5C 5I6NA 4DZ8B 4YDVB 4IBQA 3KWXA 1B0GB 4PRPA 4FTVB 3UYPB 3NCWA 3R0NA 1VCAA 5IHZB 5I1GL 1CBJA 4Z7WF 1KENH 4UIKH 4JFPB 4JGMA 1F4XL 4HMCA 4P23B 5DWUL 2WOYA 5DD3H 2VZSA 4OQ1A 4QXUH 4J8RB 2J8UA 1BQLL 1PNDA 2ZWZA 2J2ZA 1EXGA 3V0EA 1XGYL 4CU8A 2J6EH 3CE1A 4JY4B 2OQJA 1JS4A 4M43H 1DR9A 4DGYH 1VADB 4FQIL 5DU7A 2EDBA 5F3FA 3GHPA 3TX4A 4J3XA 3RTLA 5C3TA 3GNML 4Y7MA 5FF6A 1Q72L 4N4YB 3UYRH 1EA9C 2ZE0A 4PR5A 5BRPA 1I9IL 4FJ6A 4LBEA 5GGUB 4LPYA 2JLLA 4L9LC 4IRSA 1CVSC 5IQ9B 3BI9X 1S7RA 3DHPA 3FZUC 2I24N 3OHXB 4H1LB 3STZB 1ZJBA 2Y1AA 3KW7A 5EA0H 1RZ8A 1U95A 1Z9OA 3QJSB 5I1KL 4JKPL 5GGVY 5EU6B 2TSAA 1RZJC 2HH0L 2O72A 4FNLH 4IU3A 4J3OC 1KB3A 2HSIA 4XH2A 5KYYB 1UWEH 4OF7A 3GHEL 1AD0B 2VR9A 3HE6B 1W0WB 3VFSB 3C60B 1LD9A 4ZW3A 2A9MH 5FO2A 4F8OA 5EEWA 1B90A 3N85H 3DX2A 4PJXE 5CIPA 2VL5A 4PGEB 4MZRA 4N8PA 3BD5A 3NJNA 5KVMC 2G5RA 4M61B 1HH6A 1MRFH 2EH8H 4FYTA 4Y2DC 4TQEH 4X4YB 1SOSA 3QZPA 1KGXA 4BXSV 1AS8A 2WXMA 1D6VH 4QHNB 1ZLDA 3GSUB 3ETBJ 4XT1C 5DK0B 4HP5A 1T4WA 2VISB 4L4VD 3IDMB 1XSIA 2J5LB 3DTXB 2OSWA 3H42H 5F7EL 4EKJA 1UA7A 3CD4A 2G4EA 1SM3L 4ZTEA 1MCLA 1ZA3A 4N2CA 3L3OA 1FHNA 3N42B 4CL7A 4AE1A 3KBPA 2IH9A 3HRZB 1AJ7H 4NQDD 1HHHA 3IXAB 4D9QD 3UC0H 4AYGA 5DRZB 3BP7B 5DYOA 1N6QH 4I9WD 1SLVA 5MHSE 1J05A 4QRPB 2YN5A 3CPUA 3CMOH 3L13A 5FHBL 3F7YB 1SY6H 5F1IB 2E7LA 1OIOA 5ICUA 5J9PB 3TBSB 3SKNA 3GRGA 3CFTA 4TVPL 1WH0A 5SX5K 1SZNA 3RWCB 1I9EA 2CXGA 2BDNL 4F92B 5D1XC 1F4HA 1IEHA 4ZO8A 4AJWA 3FW6A 2WKLA 3CSFA 1IEBA 3HNTH 3JWOL 3QIUC 1IQDB 4WI7A 5D1QE 5DEFB 4P9HH 2F58H 5DWPA 5DK3A 2VR6A 4WAFA 5BO0D 4X6CB 1IE5A 4GW5A 4JPWH 1OF2A 1SLWA 4NRZB 3GO1L 2G2RB 5CD5C 3FTGA 4MXVF 4U3XA 5DTFA 1T5XB 5FGBC 2Q76B 4Z8FL 2XA8L 1JWSB 3HG1B 1JK8B 2AQNA 5D71H 5A7EA 3FONB 1JV5A 1KB9J 2GK0A 3ZTNL 2FO8A 3CDZB 4DP6X 3I6SA 1XAUA 3IWUA 3X3GH 2YPKB 3GSRA 2VT0A 4M4RB 1XZWA 3II3A 1JZ2A 1UVQA 2ATPB 3RKDD 3OPZL 3BDBA 3CSTA 1A7OH 4RFNC 1TMCB 2L4OA 3PNWB 5FAAA 2BM3A 6TAAA 1P4BL 1LP9B 1J8HE 1IAKB 4N9GB 3K8LA 1HCYA 32C2B 4JM0A 3POHA 4BWUA 1IBFA 1E5UI 3DRTB 4AM0B 4ZAKB 3NCJL 2G3XA 2ICWI 4Y1AD 4CADA 5HP5A 2IPKB 3QCVH 2EDQA 1SOQA 2DTSA 2OJZH 4B9JA 4NQDB 2CHNA 3EF4A 5HVHB 3HS0B 2G3NA 4OFPA 4HS8H 3RDTA 1CDBA 2IOOA 2PCPA 3I84A 2K7QA 2GBAA 4AIOA 4KNUA 1ITCA 3V6ZA 2NNRA 4K3DH 4BRJA 4H26A 1N70A 3EADA 4HJJL 4HIXL 4YHYB 4CU7A 4Y5VB 4IGBD 2HMIC 3D0AA 4XPGH 3W0WE 4I77H 2V2WA 4OLUL 5L4IA 4KKCC 3M8OH 1ZLUK 1M2VB 5IVXA 1VESA 4U2ZA 2AGJH 4DUXA 2ZYHA 4CGTA 4MA7L 5T5NG 3RDJA 5HYJB 2FECI 2YQ3A 3KVPA 4ICXA 3TLRA 4R8WH 1CR9H 4TUJA 1NFDE 2V8MA 4N6RB 2IMNA 4UV4L 4W9JC 1U8IB 1QBLH 1H5BA 2PO6D 3MV8A 4A39A 5D7IF 4RZCA 3UCRA 4G1MA 2G75A 4WNSA 4JCLA 2R1WB 3S4SG 1ZLVH 1T0OA 1CBVL 2C3VA 2TSBA 1HCZA 2ZJSH 1MLCA 4IOFC 2I9TB 2P5PA 3UJJH 1SXZA 1TSRA 1YQ2A 4NJ9H 3D5OF 3RWDB 2MQ3A 5E00A 2P26A 2PTUA 5DEJA 5FM8A 2CH8A 5GS0D 1BAGA 3BH9A 4YDKH 1FN4A 1FLTX 5BRZB 2P28B 2VDQB 5ICZB 1YMMD 3QUMH 3QZWA 1NBZB 5F9DC 2NY3B 3KWVA 1WISA 4Z77B 5LNEA 1T1XA 1OGAD 4HUMB 1GJUA 1WE5A 3OMIB 3JTSA 5IVXF 1MJJA 3UJIL 1XBDA 3UTZA 1EDQA 5IF0A 3AADB 1K4CA 3RI5K 1HDMB 2CE6A 3LKOB 5JPMB 1N2RB 1UQSB 2QKIB 5INDA 3UJTH 2QSVA 2HKHH 4Z7VE 4Y1AB 4NM4H 2QGEA 2WK2A 7PCYA 1PLAA 3PAUA 3TTYA 2JSFA 3F64A 2WINA 3JYBA 2HFTA 3VXUD 2DQ6A 2V2TB 4MMZC 2EDNA 2D73A 4QCIA 5F7BA 3RX8A 1JNNH 2WVSA 3EYOA 1M1XA 3Q9PA 3U9PL 4PRPB 1GAFH 1QKZL 3AQZA 4X0KA 4EI6A 4M7LL 1YEIH 3SYOA 4BH7A 4ZW7A 1A7NL 2NY0B 3P3SA 1KTKE 1LLAA 5D1QC 1S78D 3VXMD 4IGBB 2IDSA 4HJGA 3WS6A 2EKJA 5A16B 4G6KH 1YMHA 1DBKH 3HTLX 3RVUD 2J8UB 4B5EA 2J2ZB 5GQBA 3IMBA 3KR3H 1ITBB 4PW3A 2KH2B 2J44A 4AGPA 2OQJB 4TTDC 4H8VA 2E8ZA 5CGYD 4PGBB 2OMYA 4MYPA 3IYLW 2B9AA 4M5TA 4XB3A 5FF6B 4A7GA 2QV4A 3MKKA 2A74A 3M1CA 2NQDA 5LG1A 2WAHA 3ZE2E 1EAQA 1ZSDA 4PD4J 1L3WA 1NCCH 2CUIA 4J4PD 1MWAH 4LBEB 3RY6A 4IRSB 2X2IA 4UAHA 3MRFA 2ZP0T 1TQBC 2I60H 4XVJH 1K5WA 2C26A 3AWGA 3DURA 1KXQE 1SPDA 2QPFA 4TVPE 3EYVA 5BZZA 2UZYB 4XH2B 3VH8A 4LLQA 3S97C 2CUMA 1OPGH 4DFIA 1LD9B 3NPSB 5CIPB 1MH5A 2VL5B 2ZCZA 2A0LD 3KYKH 1UKQA 1PS3A 1IC0A 2P3YA 1PEWA 1N12A 3N3EA 3V0VA 3H0TB 2R0ZH 5JHDA 5MP6H 1GJWA 4X2UA 1I85C 5GS2H 3EDDA 5CINL 4AQ1C 2IWEA 3ECBA 2APVA 2C9SA 3O3AA 2NY6C 4YVNA 1XB6A 3AABA 4B53A 4PVBA 2WZAA 1AD9A 3OLIA 1GXEA 5E2TH 4TNWK 4EDXA 3FB8A 2GSGA 5JIQA 1TQTA 1IRAY 3HN5A 5C0BE 3VXUB 3UPRA 4Y4HA 3AVEA 4FQ1H 1ZA3B 3QG7H 1JGUH 4X7FC 3IB4A 1M6OA 2NR6C 4G9DA 3GM0A 3OKEA 4DFHA 4RMTA