4AL8C

Structure of dengue virus diii in complex with fab 2h12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
SYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
molecule tags Immune system
total genus 13
structure length 98
sequence length 98
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4al8C00
4FFZA 1OKEA 5H37A 3IRCA 2H0PA 4UT6A 3G7TA 4UTCA 1OK8A 2JQMA 3J27A 1UZGA 1Z3RA 3N40F 1OANA 3WE1A 3UAJA 1Z66A 3UZQB 3N43F 5KVGE 4AM0Q 3UZEC 4AL8C 4GT0A 4UT9A 1URZA 1S6NA 2R29A 3MUUA 5AAMC 4L5FE 3P54A 1RERA 3C6EA 2JV6A 3C5XA 4BZ1A 5LBVA 2I69A 5JHLA 1ZTXE 2ALAA 2GG1A 4UTBA 3J2PA 5B1CA 5LBSA 5IREA 4FFYA 5IZ7A 4BZ2A 1PJWA 3N44F 4ALAC 2HG0A 3VTTA 5KVDE 4X42A 5KVEE 5JHMA 1SVBA 2V33A 4FG0A 1TG8A 3UYPB 5GZNA 2P5PA 4UTAA 5KVFE 3UZVA 5GZOA 5LCVA 3N42F 4GSXA 2R69A 3N41F 2JSFA 5AAWC
chains in the Genus database with same CATH superfamily
5KANG 4NERA 2PMZA 4ZOEA 1ET7A 4HLZH 3V2AR 3T3MF 1U4EA 2QQQA 1DQLH 1HEZB 2RFXA 3QI9D 1G7IB 3KPPA 4NN5C 3FQRA 3IRPX 3V10A 4MNHA 4HFWA 2FNBA 2F58L 5D1XE 5C8JA 4QYOA 4AYGA 5DUJA 2QADD 3BQUA 4Y1TA 2QTEA 2CGZA 1QZ1A 3QC6X 4JFPB 4YO0B 4LCCB 4PJDB 2E4TA 1XWVA 3FFCA 3DIDA 3SY0A 5L6YL 2DJUA 3DBXB 5E5LA 3MZTA 3MRGB 2WBJB 1XDTT 4Y8DC 4DP6X 5BRZB 4NBYB 1Z66A 5I15L 1NIDA 1OTUC 3KVPA 4FG4A 3ZJAA 2YZ1A 3NVQA 5FWRA 4BH8B 2BVTA 3P4MA 1WFTA 1A47A 2APSA 3V4PB 3ZOAA 4KUZL 4UZGA 2NW2A 2O4EA 2OR9H 4A1RA 1EQWA 2WXPA 1ZT7A 2WWMC 4M8QA 1AQ8A 2DW5A 4JDTL 4C55A 1QZNA 1WWBX 1NIBA 1KLGA 1U2HA 5GS2D 2AXGB 4PJDF 3S35X 3OHXB 2ICWI 4Y4HC 1A22B 4EZKA 1VJSA 2X4PA 2JKXA 4MASA 3VH8B 1O0VA 1NEZA 4BKSC 3SJVE 3MV9A 2VMEA 3MCYA 4RQQA 4X9FA 4G6FD 5C09E 1KJ2A 3X13A 2WNKA 5DTFA 4K7FB 4XXDB 1QW9A 3AB0C 4LGRB 5C7XL 5E1GA 5C0FA 1T1XA 4X7TA 3HAEA 3TCLB 1BQUA 3ASNB 1K5NA 2W9DH 1HCYA 1DE4A 2W1NA 4MNQE 2W38A 2X89D 3C6SB 3IMWA 2VXSH 4AEIL 2KKQA 4NC1C 5SWZD 2X6MA 3T2PA 5L8JB 1A5FH 2I7OA 5CINH 4ZFOL 5ADPL 4PB9H 4L3CA 5BCAA 3V5KB 4NQSA 2FATL 3WI9A 1XH0A 2WHVA 4JG1L 4YHIA 1SQMA 4QXWA 5L4JA 3QULB 1Q94B 3N50A 3RFZC 4X6EA 2ITDA 1V3JA 1ZHLB 4GI6A 4DUWA 1WT5A 4WHTA 1W72L 3S98A 5JPMB 1JPTL 2CPUA 2NRDA 2IV8A 3TO2A 4YWGL 1XGYL 1BWMA 1X9RA 2RQ8A 5DRXA 1UJ3A 3NFSH 3TJHC 5DLMH 2Z31A 3PNWA 5EC1A 4ZFZA 1F3DJ 4ODVH 4KJYB 1QHQA 4HWNA 4W4OC 3QORC 1HK6A 3KJ4C 1PY9A 4L2YA 4P46B 2A4CA 3UADA 1KTDA 3L4VA 3RVUD 3UTZA 5MEPA 2XETA 5F9DC 4X4YA 4LSRL 4JY6A 3FT2A 2E5EA 1BLNA 5KEZA 2YIHA 1QFOA 4QHUB 4F57H 1HINH 3L3IB 4ODWB 3J27A 5B22A 4UTAL 3DHUA 5JORB 1E8XA 3KWTA 3RWIA 3WE1A 4G7VH 2AI0H 2VMDA 1ZS2A 3H54A 1Z9PA 1D9KA 4H1LG 1ZGLA 5LXGL 1T5XA 4L3EA 4QF1A 2NLJA 2DQCL 3SE4A 5A3IC 4GYBA 1DCEA 1F6AA 1S9VB 1OZTG 2YQGA 1UKSA 3AACA 5JIPA 3I02B 3QFDB 1FL6A 2ZG2A 4LSPH 3GBNL 5DJ8A 1RUMH 3PWUA 5BRPA 3P73A 2GSGB 3QHFH 5GGRB 3UO1H 1HHGA 1OP4A 5D7SH 1QWNA 2YPLE 4A7GF 1ZT4B 4R97C 4XVUD 1XF5B 1IEBB 2HLAA 3VUAA 3VXME 2WUCH 2NTFA 3WFCL 1UA6H 3SQRA 4GSRA 5HGBA 2APBA 3QRLA 4UQ2B 4Z7WF 4WTZA 3OAYK 2HMID 3HG5A 4EUPB 1BMGA 1I3GL 3OB0K 3HHSA 3QCUL 3UBXB 4PCTA 2ZSWB 3DIFA 5E8PA 4HCRH 4LHUD 4XP5L 2C1PA 3MROB 1B0IA 2DM7A 3O2VH 3SKOB 2D0FA 3G9AB 2WCGA 2PTUA 3RL2B 4YQXL 3DK2A 3PIQA 2FEJA 5CR8A 3UAEA 5BZDA 4AGOA 1A7PL 1HCVA 2AJYL 1MNNA 3MRLA 1SDDA 2J8UE 3ZR5A 5DC0A 3WJJC 2CCLA 2X4SB 1WAAA 3RRQA 4GOSA 5I8EA 4P2RB 1XCQB 3QDJD 4XPTH 1FFOA 2L4OA 3PJSA 3LKQA 4Y16C 4FHKA 4C59B 3MLXH 4JZOA 2CKBA 4JZJB 3BZ5A 1WFOA 4XNUL 4PJHB 2DMHA 3CLFL 3GIVA 3VXOB 4XXCA 1E4XL 4CSZA 5JHLL 4BWTA 2WWKT 4AWJC 4WUKH 2DQDH 1U92A 4GRLC 5CILH 2YAEA 2V2XA 3R1GH 3MCLL 3O9WC 4NQTA 4PJ5B 4AV5A 1O6VA 2QKIB 4EIZC 1BAWA 5I0YA 2DH3A 1MCNA 4N5EC 3GXDA 2EE2A 2X4QA 1N7MH 2EAEA 3GKWH 5T3XE 1FGVH 2LVCA 2X2IA 1IC7H 3D2TA 2WM0A 3E9UA 3UGXA 3SGEI 3MJ8B 1RZJC 3W39A 1DLHB 4HWBL 2V9RA 3TA3A 1I8MA 2KZWA 2ADFH 4PJHF 3VFSB 2ARJA 3Q5OA 3D12B 1L6ZA 2XKNA 4ZMNA 2FHBA 1CFSA 2OMXB 1KJ2H 3HBZA 1KIQB 3TO4D 2Z0BA 3AAZA 9PCYA 3NYKA 5DF0A 2EDTA 5E5RB 1AO7A 1DQDL 4TNEA 3VFMB 3P30L 1A4CA 3SHSA 4CSPA 3EGDA 4JM2D 3HAEH 3IF1B 4M6OH 1E2VA 3GNMH 1IVLA 3MRIB 1CLOH 5KS9B 1NH6A 4I3GA 1L6XA 2VXQA 4XPHL 1XR9A 3D05A 4XGZB 4F58L 2I07B 4PYGA 1IFHL 3AT0A 1WAPA 4LEEA 4J1UB 1FH5H 3QDME 1YG9A 5CF3A 2LOEA 3Q6GL 4O5LL 1IGYA 5IJKA 6FABH 2DDQH 4G7YL 5E6IC 2ZUXA 3WIFB 4AZUA 2MEJB 2EKSB 4KKQA 5GGRY 2IDCA 4JFQB 4N86A 4GQQA 2EXYD 4M02A 4N2BA 3TBVB 1QRND 3LN5B 2C5DC 4KJPD 1I9RH 2OBGA 2CKNA 1BSIA 3D85B 4IRJB 5KS9F 2GJ6E 1WFUA 3C6EA 3X14B 1U0QA 4R6UA 3UCRA 2XWBB 4JFOB 4ZUWA 1A3ZA 3BGMB 3NUKA 1E4KA 2PCXA 1O6TA 1UACH 3TXAA 4DK6A 2BNRA 1E3XA 2WKLA 1FYTA 5IIEB 3D4YA 3MBED 3PAZA 4KFMA 4DEWA 1IM9D 4JFDB 4M5YL 2E7LA 2GG1A 4JGUA 1IVTA 4RGOH 5H2BA 5HHVH 2AEPH 5HYSA 3LRSB 4PTTA 3OZ9H 3OX8A 2WWNA 5EOTA 2XIDA 1OAQH 4Z78B 3VFWB 1DSFL 1OP5K 1KEGL 5I23A 2XWXA 4TXVB 2WBKA 4G6KH 4YSSA 4DERA 1CUOA 4XVSH 2OTWA 1B0RA 1ZHBB 3GSRB 3BZEA 4X5XB 3I50H 3D2UA 4R84A 4XP6L 1UUSA 1U58B 4PPTA 5EO1B 1S5IH 3P77A 2F08A 3CHPA 5GRJL 5JHDA 5CUSL 2WZAA 1TSHA 1ES0B 5HHXH 2C3VB 3ZN6A 5I16B 4WEEA 1AXIB 4L4TA 1H6EA 4MKMA 3KCPB 4PMFA 3R06B 1JXDA 3HOGA 3S8WA 3GI8L 1KIRA 4D7PA 3GJFB 3R4DA 5ANME 3VJ6A 2VRAA 3ZO0A 3IPBA 3C60B 3SOBH 1J0IA 3HBQA 4MA8L 4WSJA 3OLGA 1GZQB 3N43B 4G5ZL 4N2DA 4OKVB 1M05B 3OAYH 5MHSD 4XWOC 1OKEA 4WFGD 4E9SA 1GZPB 1OD9A 3VGGA 3OXRB 5EU5A 1P53A 3TCXA 1T66D 4HGWB 3UBXI 3OB0H 4KI5C 3P0GB 1U42A 5DJ6B 3COOA 3V0JA 1GS6X 3DRQA 4L8DA 3SZKC 1ITCA 1TJMA 2A6DB 2HFGL 3CDGA 2FT8A 4IMLA 1NFIA 4ZUVB 1YY8B 3BWAB 4D0BA 3SQBB 1OF2A 5JA8B 2QVMA 4TNFA 4A2LA 3GS0A 1E4WL 4DKFH 2DWEB 1SY6L 1OY3B 2VUOA 1G1KA 3LNGA 2G5BB 2DN7A 4LE8A 4G82A 3WAKA 2OR8A 4R4BB 4I7ZC 3N43F 2ADIA 3NQIA 1CWVA 4N20A 5KJRL 4AQ8A 3NZ8B 4WWKA 4AQOA 4KHXH 2R4RL 3EGXA 4GP5B 1ZSHA 4ZOCA 4IIQC 3DMMA 3T8XA 2CIKA 3ROOB 1YEKL 3SE9H 2J6EL 4J5VA 3SDDA 1NCBH 4JREC 4C83A 4P2QB 1JF5A 2RGSA 1DQQA 4EE2A 2QVTA 2CMRL 4DGYH 5AAWA 1DCLA 4R5XA 3UC0H 4GSDH 5C0AD 4JZNB 2MNJB 5AZEL 1KPUB 4HIXH 1X5JA 4MTMA 4WTXA 3V6OC 3LNFA 2EXWD 3L4ZA 2DH2A 2WQSA 3TU6A 1J48A 2D2OA 5D96B 4GBXB 3UGUA 4ZO8A 4HQQL 3QUGA 5GGQH 2EDHA 3KPRE 1GS7A 5HD8C 1TQCC 1XGRB 4KH2A 1U21A 2ZT9C 5H35B 3WJMB 3QJTB 3OLIA 2ZCKH 1NGPL 3TPUB 5A7EA 1CDIA 5DMKB 4OIBA 2KS0A 4MJ5A 5E9AA 2RQEA 1ZLSH 1WHPA 3PV7A 2HWZH 4YLQT 4EEEA 3GXUB 4U6HA 5IW1A 4MKTA 3DVNB 4LEOB 1PCXA 3PL6B 4NEHB 5ANHA 3UTTE 2F8XC 5GS3A 2Z1KA 2XPGB 3NOIA 4W9DC 5EUOB 2HKFH 3JXAA 3SGKA 1V7ML 43C9B 1KJMB 3X17A 3ZW3A 2MHAA 1WGOA 5AWNH 1QHPA 3Q6FB 3T6XA 1MFVA 2A74A 2VLRA 3ZKXC 2R0WL 1UVQA 2F1EA 3H0TB 5ADOH 4H20H 4WLCA 2L0DA 3HS0A 3HCVA 5FCSH 3S4SA 1C8QA 3VWKA 3SPJA 3A6OA 5F72S 5GSRA 1HL4A 1AHWC 1IGJB 3AXIA 4EQ3A 3VRIA 2YAFA 4LHQB 1XMEB 5JPNB 4RMRA 1YMHA 3VU2A 3ZUCA 2YQ2A 5DZAA 5KSUA 1IM3D 5IBUG 1JHTA 3BEWB 1KCUH 2P5EB 3EH2A 4XCNA 4P07A 2MIZA 2OL3A 4F5CE 3OPZL 4RSVA 2HRPH 5HPMB 3H9HB 4OJCA 3T3ME 5CEXA 3K5RA 4CVZA 5DA4A 1TTRA 3MV8A 4M93B 4MMXC 4QLWA 3ME0B 2AJ3A 4OT1H 3J07A 4K7PH 4K23L 2VR5A 3ULUL 3U36A 4B27A 3QEGL 3KEDA 1Z5HA 4YHKH 1ANUA 4R5TA 3KLAB 2JCCA 2JFCA 4W6WB 1QW8A 2UY6A 1OP5H 3IS1X 4UINH 4DQOH 4BK5A 6TAAA 1YC8A 3KXFB 1VFUA 2N0MA 3NSYA 3LJ3A 4FQHB 4PRHA 5MEOA 4JFYA 1HSBA 1EEQA 3CN1A 3D33A 2VLMD 2VLLA 4NM8L 4CVXB 4TSCH 1SMAA 4N6RB 2MQCA 5AAPA 4MAYC 5DUPH 4XNAA 4PREA 3QWRD 4UV4L 1MRCH 1HESA 1XGPA 4OZFG 1WGVA 1S5HB 3X3GH 4A2DA 1PDKB 3ELQA 1X5ZA 3E6FB 2VDKB 5BOJA 2KDYA 5E8DH 3TZVD 4EXPX 4Y2DA 2HFFB 2CCVA 4TULL 1EJOH 1E7VA 1MDTA 1U3ZA 3IJHA 3P3RA 4WNJA 3L08A 4WFED 3V4VL 3LD8C 4HAGA 2MKWA 3JSSA 3NJLA 2H1LM 4PJDE 1P4IL 4JRFA 1FFNB 2Z92A 4PV8A 3CC5B 1DUYB 3BHBB 1T3FB 3LEXB 1TITA 4Y2OB 3SPHA 3WN6A 1G9NL 5AW2B 3KYOB 2L7JA 2R9HD 5DD6B 1PLAA 1HIML 1FRGH 3WTWA 1G7MB 2HUHA 4JR9L 5DGQA 4CDHA 4OR1A 1I85C 3VG9C 4Z7OB 1BOYA 2FWSA 5CP7B 2ZUTA 2ZJSL 5DHYA 3QXUA 3P4NA 3DOSB 2DD8H 1KZYA 1PPIA 4BFEA 3GS7A 4YZWA 1SXCA 1O6SB 1OP3K 1YEJH 1U8PA 3MLYH 1QOKA 5GGUB 3KR3L 4KPHL 5I1GH 2LR4A 1MN4A 2Q3ZA 3NJHA 1MJ8L 2V17H 1J7VR 1ID2A 5JZ7D 1IGFL 3KE0A 3B37A 4OF5A 4U33A 2CBQA 2OJZH 1T0NA 3FQTB 1ZTXL 2ATPA 3EO0B 4KVPA 1U8NA 4ONGL 4KKCC 5D5MB 4Z7OF 2WQXA 3FRUA 1G9ML 4NBXB 5EA0L 4I0PC 5ESQB 3BZFB 3GJEB 1D7CA 1BFOB 2F54B 2YD3A 5HI4C 4F7MA 3U46A 1MXGA 4E0RA 3EOBB 4OLXL 3A4DA 2VDOH 5DJ0A 4LASH 2CA3A 1G0DA 4FCHA 4DZBB 5GS0L 3TV8A 3VD9A 1RHHB 3EXLA 3L3GB 3PDGA 4PIBA 3NABL 3EDEA 1JNHA 3JTBA 1ZPLA 4N0RA 4HC1A 1RLBA 3I6LE 3IDGB 1IGMH 4HD5A 1ZT1A 5D5MF 3T0EA 1NGQL 1D5BB 3EH3B 4GXVH 1F1DA 2YQ3A 3ISYA 3RWCA 1PEZA 1DBBH 3JT2A 5E2VL 1LDPL 1AD9A 3HTLX 3UEQA 1DBAL 4S1SL 4UOQA 5EEVA 3K81A 1PLBA 3O45B 3GO1H 5KVDH 1WV7T 1NBCA 2AJVH 5E4IA 2XU9A 4JPWL 3JZYA 1M2VA 3CFCL 2J7LA 4AKQA 2J8OA 3QPXL 1ETA1 3RPKA 3WNMA 2WXQA 3P9LB 3V8CA 1I7ZA 2IH3A 1OAXL 5IR1A 3SKMB 1U2YA 1JF1B 3BAKA 5HGHB 1NAKH 2BW4A 3C08H 5EEWA 4M7LL 4AITA 3FSAA 4D7BA 4Z7WE 4RFNC 2PWEA 2WW8A 2RD0A 3CZJA 5HYQB 1DUZA 2OL3H 2YJQA 3EIFA 3Q7JA 4ZSOB 5IOKA 3U79A 3P0YL 4XCFL 3LDBC 3LY6A 4ELMB 3FO2B 1MFNA 5ALBL 2F53B 4DP2X 1S7WB 4MQ7B 2FYYA 5BVJA 3ZDYF 3KPQB 3QXTA 1G7LA 3LQZB 5B1BB 1PJ9A 3IMRA 3B5GA 4N1CA 3W0WA 2RJMA 2GTZA 1R3JA 4GW5A 3ZE1E 1UENA 4OZHF 2O26U 5TDPA 3CBJB 1FNSL 1DBJH 2XNAB 1CICA 2IEPA 1QSZA 1TTBA 4NUGH 1JXKA 3HC2A 1M42A 3WMQA 4HJGB 1TG8A 2BY1A 2UX6A 4AENA 4O2CA 1J1XL 1F90L 2NZIA 3QO0B 1RZKL 2NY0B 1DN0A 1E2WA 3EJYC 2A0LC 2EIZA 4H8HA 5LCVA 5FO9A 5D7LD 1WISA 2AERT 3QIUD 3VXSE 4NIKB 4F20A 1EAOA 2AJUH 2PYFB 4TVPL 4ZX6A 5E08H 4PTUB 3RWGB 3B2XA 5JMRA 3K80A 1L9PA 4LPWA 4OJAA 1NBZB 1SQ2N 1BBJB 2DBLH 4OJFL 4ZAKB 3P4OB 4LP8A 4ZW3A 4K3JL 2Y1VA 2GB2A 2X12A 5A2LH 1A0QH 3S5LG 2ZUUA 3K46A 3GXNA 4B3EA 2QHRH 1S7VA 3ZKMD 1F11B 1CD1B 2Z64C 4PJHE 1R9FA 1OARH 5IBTH 1XVSA 3MOBL 3TIDA 5DDHB 2AAAA 3TVMA 4PP1C 2ZOLB 4ERSL 4X4MA 2MQ0A 2R8SL 2OULB 1XSIA 1RK0B 4U6XB 5JMOC 4K2UL 5DZPA 5I1CL 5BQ7A 2FGZA 4F7CA 4DP9X 2ARWA 4U1KB 2PW1B 1BFVH 3GBML 3L5IA 1QEWB 4PRBB 2D8KA 1DVTA 1TCRB 4KZEL 2HRHA 1OPGH 3L4UA 1EEYB 2K3TA 1KYFA 1NPUA 2KQMA 4XX1G 2PTTB 1AGBA 2MNWA 2D7QA 5B39B 5L2KE 2ID5A 2FR4B 3IVKB 2HT3C 1MLCA 4LLYB 4NN7C 2JE8A 4UDTA 3D39D 4X4KA 2JQAA 3VQLA 4ZTPL 3E80A 4IJ3B 4YE4H 1YMMB 4X8JB 1DBKL 5LQBL 3O4LA 1JK8A 3VFUA 4FQQB 1CMOA 1RU9L 4H0IA 4XI5C 3MYZA 2DM3A 5FC9A 2GAZA 4KMTH 2G60L 1QFUL 2KQNA 2E76C 2FL5B 12E8H 2YWZA 4HC1H 3LH2L 1HNFA 1SFDA 1URIA 5CEZH 5C3LD 4HJUA 3ARBA 3CWGA 4WDIA 3C09B 3EO9H 1BD2D 4RX4D 3TGXA 5J5EA 3ZTJH 3ARGD 2BK8A 4D0CB 1K6QH 1QSFD 4C56E 1HOCA 2N3JA 5TDNB 4WCYL 3DWTA 1MNUH 4HPYH 1MCKA 3C5ZA 4UTBH 1KEML 4KNUA 4NO3A 3RL1A 3S8FB 4PJ5A 1GZHC 2P1YA 3MNZA 3UTOA 1FL3A 2AS5M 4PD4K 3CK0L 1F3JA 5ILTH 5LXVA 5BZZA 2Z93B 3MLZH 1MCHA 2DLFL 1UB5A 2ZAGA 5D1ZB 1YNKL 3SGEH 1WCBB 4L1SA 2PYEB 3BVUA 4K3EH 5HHMB 1S8DB 4BZ2L 3FTYA 1ZE3H 4EJ1C 3N1PC 2FSDA 4RESB 4K94C 4EI5D 4RDQF 3HE7A 2A73B 2VDMH 5D7KD 3H56A 2ZUQB 2CJ3A 2D3LA 1W16A 1MEXH 1DEEA 1FFPB 2VDNL 1HFUA 2V7HA 3CQQA 2BXZA 4KV5E 5IMKA 1M4KA 5I8CA 2FZ3A 4P5TC 5IESH 2G5RA 1XTLA 4OQTL 5F1NB 4ZD3H 5TK2A 1P7HL 4QT5A 1TZHB 2P5WB 3H9SA 2CHZA 4KJQC 3D3VE 2CO3A 5DEFA 1BYNA 4JJ5B 3Q0HA 2YD2A 4DKTA 2MFNA 3M8OL 3P9MA 3HNVL 2WUBL 5DK0A 2K9FB 4KRPB 4ZMAT 1G4RA 4UQEA 4MSWB 4ONHB 4F37K 3HZKB 2MNUA 3UTSA 1BYOA 3CXDH 1BOGA 1HXKA 1NICA 2C9SA 4FABH 3ABMB 1OW0C 5BJTB 2CUMA 3T9WA 4NZTH 5E94B 2GSIB 4Y4KC 3VCLB 3LTVA 2YC1A 2LU4A 3TX4A 2ZICA 1OLZA 5ETUA 4KVNH 3ULUD 3FULA 2W0KA 3D4ZA 1OGAE 1SYVB 4Y1AA 1AACA 3QEQD 5LCVH 5I8OL 1NEZG 5BXFB 3TASA 5DEGB 1FZKA 4XVTL 1IGIL 3Q1EA 5ISZD 5INCB 4O58H 4YXLH 3Q1SH 4J8RA 2P7TA 1CFNB 4LIQH 3QQDB 1CURA 1WICA 1A6VH 3S35L 4NZJA 3HAEG 1JDAA 3MA9L 5JO5B 3O4OC 5I1LA 2X7LB 1X5FA 3KBHE 1M7IB 3EZJB 3REWA 3AT8A 2CDGA 2QQKH 3K72A 1VPOL 1CPUA 3FTWA 3IXTB 1MF2H 3VM7A 1MI5D 3G5YA 3L3KB 3U6XS 2C9AA 1Q9LB 2HVJA 3QR1A 3W9DB 1U95B 4O9HH 1EA9C 4P2QE 4ZXBC 3O2WL 1PZ3A 1V54B 3MRMB 1KYAA 1L3NA 1X5XA 3G6DH 3QFGA 1LK2B 3TT1H 5FECA 1S9YA 1E6OH 3P4LA 1ODUA 4BFIA 2EYRB 3VFVB 2X1PA 1NGWB 1VHPA 1FBIL 4M5ZL 1N6QH 2Z4QB 1L6PA 4MBRA 3CFQA 1SOQA 2Q2LA 2V37A 3QJVB 1MHHA 4GQPH 1G6RA 2NX5A 3BIKB 3GXFA 1NCNA 3D09A 3B6SA 3C60A 3L6FA 1LNUB 4KX7A 4NM4L 1GZQA 1PQZA 1BBDH 2R59A 5DD3H 2P24A 5I75C 3L16A 3OR6B 4IHOB 3RY5A 4LSTL 3WXVL 1TLMA 1XIWD 2K6WA 4HGWA 4N0FA 4WW2C 2KPNA 1J8HD 4PJ9D 4Z77A 2R1XA 3ZX1A 1WC7B 4HUWB 2HJKB 2ZSVB 3FB8A 1YY8A 1MAML 2FHFA 4ZI8A 3LZFH 2W07A 3EOYG 5C9KA 3PGCA 1SEQH 1JXFA 5J1SC 5LNGA 4JAMB 4AYMC 4YJZL 1P1ZA 4WUUA 1P1VA 3GSVB 5AQ0A 3W82A 2PPCA 2WMPB 3GSOA 5KYUB 4KAQL 2H1PL 4WI3A 2E0PA 4MJID 1BQLL 1JNLL 1GCYA 1NFDB 5K1JA 3E9TA 2AK1L 2WVVB 5T33H 5I28A 3FFDA 1I1AC 1XBRA 5JYMA 4NZRH 1T4KB 3RX8A 3VMOA 5GS0D 4H8PA 5EG6C 1JWUA 4X5PA 2VIRA 4G9FA 1BJ1H 2WLLB 4WTZG 5EFIB 3MRJB 4AXWB 4S1RH 3MGTA 4TSAL 5E5MB 3NG5A 2YPVH 1HX0A 4APQD 5FV2A 1ZLUK 1N2RB 3HR5A 5ID0A 4JKLA 4CU8A 4GY4A 4X6DE 2CK2A 3MRFB 2Q8AL 1IV8A 4BE6A 5HHOB 5E4EB 4Q52A 4EMZA 1DANT 2BCMA 3DX6A 3IU3A 3L1EA 4J3BA 1UWFA 3F84A 4I3RH 3TJEH 3VSVA 3L45A 4POYA 4U0RB 1NQBA 2DPKA 5ACZA 1AZVA 2Z0UA 3QJQB 1G7JA 3CHSA 4GG8B 3IDMA 3VFRA 5D2LB 5CEYB 4AMKL 4AV4A 1T83A 4K3HA 4L3AA 5FOBA 5D6CA 3GI9H 4HBCL 4R96A 4ALAH 4YEFA 3GFUA 1OM9A 4XN2A 1RP9A 4AM0A 1D6VH 4JO1H 2O5YH 4L4JA 5EUOA 2XPGA 2ZZUT 5KTEH 5FYJH 5FA4B 5IHUL 1R17A 4WU7A 3PU7A 2IQ9H 1HYSD 2JJTC 3H0TA 2UZXB 2J88L 1W8EA 3K4ZA 1D5ZB 3C8DA 5L8KB 3MNMA 4QKXB 3WY1A 1SGKA 2E6QA 4G6JL 1MRFL 4LFHD 1XAKA 4U7SA 3X3FL 3MRCA 2QPDB 4IGBB 3FTGA 4CU7A 1GC1H 3G5VA 4XWGH 3SKNB 4PAZA 4HUVB 1FIGH 1RIHL 4LOVA 2ZKXA 4FKHA 5E2JA 5HJBA 1E8ZA 5MERB 1XV8A 4BSWA 4KDVA 4TPRH 3DHPA 4Z7OE 4K71C 2ORBH 5IB2A 2BP5M 3ESVF 4XPBL 4JPKH 2P5EA 4Z3TA 2OSWA 4M4PA 3U7AA 1FE8H 2Z7YA 3HE6C 1GYVA 1OK0A 4PW9A 5I24A 3I2CH 3QNYB 5KUKA 3CN4A 1LEKA 4B95C 4JRXB 2AABH 2BRQA 4NQCA 3QUMA 3UYRL 1I8AA 3ETTA 4KZDL 4UOJA 4U7KA 2D3JA 2JJSA 4TVPD 3BUPA 3C6LA 2FGWL 2K3HA 2UUDK 2E27L 4NWUL 2KERA 1H3TA 1MCWM 3QH3A 4QO1A 2ZUYA 1NDGB 2MPAH 1PZ5A 5D5ME 4AGLA 3K8LA 1JGEB 2V7NB 3CH1B 3OF6D 2O6PA 2PXYC 3T08A 2BZCA 5GRZA 3FO9A 4DTGH 2B9AA 1ACXA 4DO4A 4NKOB 4XX1E 2OP4H 4L1HA 2BW5A 1R3HB 1PGRB 1XB6A 1G6RH 3N5AA 3DV4B 1GSKA 1HZLA 4TUOB 5IV2B 2IANB 1HDMA 2BNQE 1AGDB 3FN3A 4M1DH 4TUJA 1QBLL 1PW3A 3KPNB 4YMPA 4ZPTA 1A21A 1JZ7A 4BINA 5E23A 5IEHB 2BSED 5FGRA 3WSQH 3PWJB 4Z7UB 4KUCF 5HYSG 3EJCA 5DSCB 4QXUL 4WGWB 3K6NA 2O6CA 2QKSA 4WJG3 5AZUA 3MYJA 1NM4A 3FHAA 1QO3B 4X9YA 3TNMA 2XQYG 3VWJC 3VD5A 4UU9B 3S37X 2I27N 3B2PA 1RVFH 1S7QB 1U3YA 1R3IL 2P28B 3FT4B 4GMTL 1WZ1L 4E42A 3U0TA 4GS7C 1UOLA 4HFUH 3LQAC 4RIRB 1HEJC 1AGCB 43CAB 1UD2A 2PETA 2XN9D 2FUTA 1HWWA 4PY7A 5FR3A 4K3DH 1BW8A 3RI5F 3D69A 4OIFA 2YD8A 3QG6A 4OGAD 4F7EA 5E51A 1M3JA 1U93B 3CN2A 3ZDYE 4W4NA 3ZE2F 1CCZA 4Z7UF 4OD3H 2CLRB 4LLMB 1RPUA 2P9RA 1UD4A 3H53A 3SPCA 3B7RL 5A43C 1SJEA 4KOCA 4JN2B 5E8OB 5EZIL 4JQIL 1FNEB 4OZHE 3SCMD 3KLHD 1J18A 5IK3A 4I4WB 5G4NA 5ESAA 3QUYA 1XH1A 2FLBT 4KGLA 5GS1C 5BV7B 1VEMA 2RBLA 2NQCA 1MPAL 4UUJB 4NXSA 5HGAA 4XRCB 1FIEA 3L5HA 1NGYA 4RMSA 2BZDA 1AGEB 1UH4A 3TF7C 5J13C 3FTVA 2V5SA 3EOBA 1CDBA 1ZLUH 1SMOA 3GGWB 1U3HA 4CADA 2X44D 4M9PA 3EBAA 2OMWB 5C0BB 2JCCF 3BPNC 5FYLH 1AANA 1YPZB 2WLMA 4X0KB 2JCWA 4XBGA 4HZ1A 1HSAA 2EADA 2Q9OA 3FFCE 3BDYL 2PWGA 5J6HA 1AZZC 1NCAH 4JMNA 4P3CH 2A6IB 3FO0L 3GTNA 2FX9L 4HKZB 3D18A 4Z3JA 4FDWA 1HXYA 4RISL 2Y24A 3D0LB 3MFFA 2H5UA 1VLXA 3L9RB 1E9OA 3RDJA 2VJXA 3EDJA 2Y22A 2QT6A 4U49A 4GAGH 1TZIB 1A3LL 4FFWD 3WS3B 2ZWZA 3WNKA 3JWDC 3HN3A 3CG8A 4FFZL 3UZQB 3OKEB 4F9PA 1H5BC 2V3DA 3RDTC 1B4JH 4FLRA 4DKAA 1YPZF 3KVQA 3B9KD 3QYMA 2X41A 1XH3A 1BG9A 1CXLA 5MEQA 3LHPL 2D4DA 3GXTA 4WK2B 1E6JL 2XZCH 1SJMA 4FG6C 5JNYB 2FNWA 1TJIH 3GZOA 1BIIA 1X5KA 5F88B 3L7FA 4EI6A 2XBTA 3MV9E 1A6TA 2P48B 4MXWH 2CIIB 5HY9B 3WNLA 3EFFA 4O00A 4CC0A 1CFMA 1YO4A 1KGIA 2CO1A 1S7SB 2MRYA 3ARFD 1NMCB 3LZLA 5IM7A 2ZCZA 1E28B 5I1IH 1XZWA 1SHSA 4ANWA 4O4YL 4PGDA 5K9OA 4QXTA 5DWUL 5CCGE 4H0GA 7FABH 5DEZA 1MIML 1T6WA 1TTAA 2R29L 35C8L 4NZUL 1VENA 3QUMH 1ZA6B 3NFPB 5D7EA 4JDEA 1A14H 3BWUC 1AJ7L 1ZK5A 3PQYD 1S7WA 3IXAA 4YPGB 1KBVA 3GSNL 3TO4B 3JWOC 2R0LL 3POCA 4UANA 1Q72L 3ECQA 1Q1JH 1UZ8A 4WEBH 5EB9A 1KIUB 2X4UB 3DUSB 3EJZD 4JFZL 3FB7A 4L23A 4Z7AA 2XVBA 2UUDH 2PR4H 3O6FA 3ARUA 2YGQA 3MLVH 3RU8L 4X6FB 2KH2B 4JFFD 4QGTA 1DDHB 1K4CB 4KTGA 1EJFA 4L4VA 3ZKQD 4FTVD 5J57B 3SKJL 3NCEB 4Z5RB 4GW1A 3KPSB 1D5RA 5I6PA 1DDTA 2X4RB 5GRUH 2ADJA 5D1QC 2DJSA 4EIBA 2IWKA 1WBYB 3H9YA 1YYML 5CLXA 2YQBA 1JV5B 3L17A 1XF3B 2F1BA 3RUGB 4PGCA 4QRRA 3DX4A 1YEFL 3QJRB 4OSUL 2VDQB 1MJ7H 1QRNB 2VDLH 4WJ5A 4WAFA 2NXYC 1SM3L 1AP2B 3LKRB 2C3WA 3UZEA 3FT0A 2X9ZA 4K9EL 2EXTA 1S3KL 1C16B 2NNAA 5DQJA 1YUHB 1FC1A 1G0XA 4PI0A 1QWHA 1U8IB 2Y4SA 4TNVK 1YYCA 4X5RA 4XVJH 3TYGL 2L7EA 2VDMB 3QJZA 3DVFA 5AVRB 2CBMA 1Q1PA 2WAHA 4HF5H 1SOSA 1CI3M 1CGSH 1FQ9C 2EDBA 3WIHL 5JIHA 2XWTB 4JCMA 1MREL 2D3NA 2NOYA 3ILPA 2NY6D 4L3EE 2E9JA 1H3PL 4P23D 4YBQD 5T1LA 3TYFB 5CSBA 5AFAA 1EZLA 1HQ4A 4U6VL 3FQUB 3DXAB 2AK4A 2W9EH 1A9BA 3RUGF 4A7TA 3B83A 3UZVB 1G7HA 1JVOA 2H2SD 2BCKA 3WGVB 2ROXA 4TL4A 1OOWA 3U4BL 4ZRGA 3KL3A 5AYUH 5HHME 1QUPA 2NY5L 2XV0A 2EVHA 2Y5EA 5HHQB 2AXHA 3FSWA 1YRKA 4JRYB 4E41A 3IRZA 1PG7H 5CMAA 1OAZH 2HT4C 1F2QA 2P8PA 3QIWA 3V6ZB 2Y7SA 4F93B 2OTUA 8CGTA 1JDCA 5DD0L 3AGVA 3A6BH 3RWHB 1QLEL 5TE7H 2CDEA 2VXUH 2QSCL 3NACH 4J4PC 2ZCLL 4MD5B 3SGJC 5JR1H 5E1AA 4NKDB 1XF2A 2V5MA 1FF5A 4L2LA 5A2AA 3K7UA 3CN0A 3A3YB 5F9AC 3JV5A 3EOTH 4BSJA 1X9UA 3MACL 5E2TH 4RAUB 3MBXL 4AE0A 2X4NB 3Q8BA 1CF8H 2X70B 3T0AA 3D4GA 4MNGA 4X5WA 3NSFA 4GSUA 4HCGA 4OLVH 5DMGC 4WO4A 5JIIA 3IE4A 3WNPA 1WAAE 3MV11 3HEIB 1HH9B 3H42H 1KFAH 5TTRA 1A1OA 2VWEE 3FQXA 3C5SB 5I17A 3BLPX 2IOMA 3PDOA 2BNUB 3ROLB 2BH0A 5E2WH 1F4WL 3DHJA 3CFMA 2P49B 3O8XB 1G9HA 1MWAA 1QLRB 2PO6D 1TU2A 3FCUB 2WINA 4AGMA 3LZQA 3TJPA 2BSBA 3GZPA 4JJHA 4XZUB 4ELKA 3BAYA 1JD7A 3GD1C 2VOTA 4JG0L 5AB9A 5L4FA 4IRZH 1TETH 4NO0D 2BP8B 1JGDB 3NA4A 3IDYB 5E70A 1NGXA 1RUQH 3SYAA 4P06A 4HH9B 4WI7A 2HLEB 4DFHA 3LV3B 3VXRB 2Z93A 5KYWA 1U8OB 5I74B 3RZCC 2P5PA 3TLRA 4PFEA 2G2NA 1VACB 3R19A 3UP6A 3RVWC 4B7LA 4BQ8A 2Q7AA 2YD0A 4NQED 4E5XA 4LLVA 1YYLL 1VESA 1M2OA 2IDTA 2RMNA 4JEGB 2DEXX 3NZSA 5DVOA 1AO7E 5F0JB 4G8GB 3CFJB 5LNEA 4TQEH 3N9GH 4PRAA 1MCPH 4KROC 4HJTA 3ZHLA 4KY1H 3G04B 3RWDA 3N04A 2IG2H 1L7TL 2BS9A 2WO3B 3F7LA 5F7NC 3L5WB 1FHGA 3QEUA 4HWUA 3V4LA 4BQCA 4HUCA 4ODTH 5C07A 5CLYA 2NYYD 2P5WA 3THMH 3ZTJG 1PBYA 4OF0A 2XFXB 2B8OT 1ZVSB 4YSQA 4YN3A 5GJTH 5H94A 1MHPH 1TJGL 1RZKC 5F0PB 1EUUA 3BKJH 1JE6A 4MB3A 1FORH 2YMXH 5SWSA 5LGHL 3HG1D 8FABA 1I1RA 3K2IA 2CHNA 4GRLA 3WUWA 1K2DA 2QZ5A 5J1TC 3SDXB 5IMMA 3GIZH 3O9WA 4DVRH 4MVBC 1N5AB 3BISA 4ZMTA 2OSYA 5GXBB 4R0LC 4Q9QH 4FP8H 2UXVA 5LNDA 4MA1C 4R2GD 1IQWH 1RUKL 1XZ0B 4JKPL 4WTWA 4YHOL 3VH8G 4BFJA 3RBGA 3QIBA 5AD0B 2ICWJ 4MQXD 2I26N 1AG0A 1FYTE 5HDQH 4ZPVA 4U1NB 1RERA 4JDVA 4KZCA 2NYKA 4POZD 4RZKA 5F97E 5IJVA 1AC6A 5F8RC 4FRWA 4I18C 4Q6IC 4YSUA 3NIDF 4M7JL 3CVDA 1OTSC 3H2WA 5ESVB 4JX0A 4ADGA 5CGTA 3SKUD 2OMVB 3KGRA 1NC2B 4H44C 5T3XL 3SDXF 3LS5H 3CVHH 3CBKB 4P9HC 2FB4H 1TNMA 1KCVL 1QSEA 4RGNE 1TQWA 1L0PA 2VO5A 4XODA 3BFOA 5TF1L 1F4AA 4NSKB 3WN5A 1YN7A 2CH8A 3QUZD 2YRPA 1IQDB 5IHLB 3B9VA 3F12B 3N40P 2FLRT 4DAGL 3OXSA 1KLFA 5JHDE 1UCBH 3ARDC 4Q56A 4JKMA 1T4WA 2WNWA 5K9JH 3GHEL 1TVHA 2E7DA 1KJVA 2HT2C 4L4TE 2P43B 3WFHB 1X5GA 5E6IA 1OAKL 5FF6A 1PZUB 2NY3D 2FD6H 4B9IA 3QQ4B 4V33A 3S3CB 4Q9RH 1INEH 3I6KB 1UD3A 4HCIA 1E9PA 4PP2B 3MZGB 2DTML 3BZ4B 1RH8A 2CG9X 4D9QD 2OZNA 3WHXB 3DVGB 4NUQA 3EG9A 3KS0H 1YQVL 1MFCL 3WTVA 4D3CL 3VU1A 1BV8A 4PWFA 4L8SB 4OZ4A 2H3NB 1X5YA 5FB8B 2G9KA 3IGAB 1ML0A 4NAMA 1NBQA 1A7NL 3ZMEA 4QRPD 4D9LL 3BAEH 1AR1C 1RULH 4KVCH 1AI1H 5CFHA 2BLFA 3MUZ1 4V1DD 4IDJL 4PHZA 2H6UA 3T6WA 4PJBA 3M1BA 5LGJB 1XF1A 4OCYH 5E99H 5FYKH 4PSPA 5HYJB 2AV7A 4NT6B 5L4MA 1HJBC 1EFXA 4G8EA 4D94A 2LAAA 1JTTA 2HYMA 2B39A 2N7BA 2CCWA 1BECA 3RTQB 1MWAH 2D9CA 2DMGA 4FEMA 3MMEA 1JPGA 4ANXA 2NUPA 3RNQA 4GQ9H 1U36A 5H37G 4FYRA 3AU0A 4TNWK 4XN8A 2DQGL 2XJKA 1GHFH 1D5MA 5DHVA 4GO9A 3HNTH 1KENL 1TVBA 2BJML 1DVFD 3L3JA 3DGGB 3GMNA 3LRGA 3UJIH 3PCYA 4XP4L 1J1OL 3MRHB 3KBEA 4DP7X 1KCRL 2Y07H 4J8QA 1OTTC 2VN4A 2W0LA 2C4FT 3QJHA 1J5OH 3KYNB 1LMIA 1KB5L 1QFWI 4OV5A 3ZIMA 1U3JA 4PRDA 3QQ9D 3S48A 3STZB 3CXHK 4J3XA 1KT2B 4KRLB 4WI0A 3UBXG 1YEIL 1Z1WA 3I75B 4DN4L 4JRXE 5GZNC 4H8WC 3UL4A 5FFLA 1W15A 5CSGA 3QFJB 3C9NB 3OKDB 1ORSB 1BXUA 1LJMA 4MJJA 1LEGA 1A6ZB 4D9RE 4Y4FC 4G71B 5J3HC 4YNYA 3EGSA 4HH8A 1X3DA 2YKLL 3IDJA 4OTXH 5KBNC 3GK8H 3GXIA 2ALAA 3L3OA 2A9CA 5CP3A 1FVEB 1KGUA 2XBZA 3E6HB 5TE6L 3QI9A 3NCXA 5EOCJ 1MCOH 4U0QB 3B1UA 1V55B 4Q8BA 1JFQH 3W81A 4F2MA 4QHMA 1U8QA 2WLYA 3ASWA 3K3QA 2JKWA 3QNXA 3ZKSD 1FPTL 1KB9K 5DUML 2Y23A 1JNJA 2Z91B 3EYFB 5C2BL 3Q48A 3NQKA 1NWOA 3A67H 3F7RA 4M4RB 3UJTH 5KVDE 2R2EB 3B2UD 1VIWA 1MH5A 2ENJA 3T0WA 4GG6B 3B43A 4OFQA 3LKPB 4FQJL 4P3DB 4UB0L 4GSQA 2VR3A 1QYGL 3VO0A 1JUFB 1M3IA 5FO8A 3ZE2E 1I9IL 1S7RA 3FQYA 4S2SB 1WWCA 1A6UH 5D7JD 2W95A 2B1OA 2FX7H 4XNZB 4R4FH 2X5PA 2OSLB 5D1XD 1MZZA 2WOYA 3UDWC 1V27A 1RZJH 2AP2A 2A1WH 4EN3D 3DA0A 3T4AC 5AVZB 3PHQA 4UILL 4OI7A 3WGUB 3QQNA 3F04A 1D2PA 4B5EA 2N1TE 3T1FB 4LCIL 3MV8E 3DX1A 1QLFB 2J56A 1JDDA 3TNNA 2AMUA 3ZE0F 4AJ0A 2P8MB 1QR1B 1PEWA 2JCCE 1QX1A 4OIIH 2GFBA 4RSYA 4J3OD 3W1ZA 3MTRA 3QXAA 5F7MC 4NQDB 5BS0B 1J88A 5B38A 1P5UC 4RZCA 5IT2H 3LKNB 1TENA 4IRSD 3RGVC 2IOIA 3AMLA 2X89A 3NA9L 5JW3L 3EHBC 5SWZA 3BEVB 5EWIH 1AR2A 2E74C 4X98A 2OMBA 1ROWA 2WOBA 3HC3L 1TPXB 4MDRA 3CZKA 4G8IA 3WS6C 2K8MA 3VRLE 1W6WA 1SN2A 2IQAB 2D03L 1UM5L 1OT4A 5IV2A 4JFED 5E8NB 4HK3N 3FOLA 4OQ1A 3QCTH 3TF4A 4G1MB 4PGZA 2JKRM 2IPUK 3APCA 4JFXA 4KO5A 3HVNA 5IW6A 5CGBA 3HC0A 2P8LA 1RZIA 1OQOA 5D7LB 1HHIB 4MNQD 4BKTC 3QYCA 3OKLB 1GVIA 1KCKA 3GMMA 4KU1A 4NNYB 2P80D 3TBCA 3DVIA 2QSVA 2GTWB 3OKNA 1DVUA 4XN1A 4F3FB 4EDXB 4P2OC 2MCAA 1JXGA 2G4EA 2DQFB 3BWZA 3LXAA 3AY4A 2IAMC 5HYIA 3I9IA 5EIIB 3G6AB 5FHAH 2VQ1B 5AKSA 3ZZ1A 2R0KH 5DHVH 4JJOA 1BPLB 4NO2B 1ED3B 5EBLA 4NRZA 5CJOL 3B7UX 2WQUA 5DI8A 3UABA 3LNEA 4MJ4A 2D9QB 5FDWA 4YAQB 5CCKL 2GITB 4GRMB 4Y19B 4JS7A 4NFDA 1MCDA 5D72H 5KWYC 1UADC 1PZCA 2YHGA 5I5IA 4NHUB 1S7TA 2R4SH 4LPTA 5E2UH 3HG4A 4UAOB 4QXGH 3LZPA 3W3BA 5IKCB 3IFOA 3NRPA 4LVNB 1RLWA 1BIHA 5CGYC 5I73B 1F4XH 3MLWL 4AVKA 1E40A 1WWWX 1AKJD 4U3HA 2YEZB 2VZVA 4L9LA 2ZXAA 1QHOA 4S1QL 4A7QA 1DL7H 3PV6B 4JVWA 1HKLH 5K9QI 5CEZE 3FRPA 5EOCL 5CP3H 4UT6A 5T5FA 1UJTA 4HKZA 4U1SA 2YS4A 4LHUA 5FKPB 4EOWH 3DURB 3SDYL 4QYAA 2NR6D 1BEYH 3BKML 4OLZH 2Z8WC 5IY5B 3GSUB 3PPSA 4LQFL 3KPSE 5CN1A 2UZYA 3VXPA 2MCG1 3U1SL 2DOCA 3VTAA 3WKPA 3ILQD 4O2EA 3AXLB 2B77A 3VXMD 3OKEA 3QDJA 3WG7B 3P11L 1CZ8H 5DRNA 4E9WA 4W9FC 4FI7A 5I0DA 3V4PL 3TN0C 2D31B 4XNMB 3HNSL 2CBPA 5C3IA 3V0VB 1GIGL 3ARGB 1EDQA 4GKZA 2ZOKB 1QSFB 4HEMA 4XC3L 1I9JL 5LG1A 1EXUA 3BSZH 3NP3A 4ICXA 2NY2B 4F24A 5C0JA 5J8OA 4PJ8B 2BVOB 1LO3L 3S97C 1D5IL 5A16B 5BRQA 3CPLB 1FJ1B 3KDPB 1TXKA 3QUKB 5DXWA 4LOEA 4RGMC 5F3BA 1FNGB 1IKFL 1Z3GH 3MLUH 3GMQA 3RA7H 5MENA 2IGLA 3AS3A 4JM4L 3MBWA 5D4QA 5ALCH 3L4WA 2VH5L 5LGKA 2K45A 1JGVL 4IBZA 1JPEA 5KSVA 4NCC2 4O02B 1M6OB 5DO2C 3UYPA 1GTNA 1SBSL 1HHKB 1J0ZA 4OZGB 3W0WE 2ICEB 5BO1H 1IAOB 1BGXH 2BIIA 1FH2A 5DMIL 1M71B 1T2QH 3BH4A 1UATA 3EOAA 3OSKA 5CJQL 5L2JA 4AY0A 1F18A 3CFEA 3IFNL 3PWLA 3QXDB 3QZOA 1CLZL 4JM2A 1PU0A 2VSKB 4LLWB 4I89A 3HB3C 2UX7A 4YVUA 1FSKB 1B2WL 1EDYA 4BIKA 4KC3B 4DVBA 1ETZB 2ZWSA 4XCYB 4O51B 5T3XD 1EHLH 4YHLH 2VQUA 4HKJB 4ATWA 5DD5H 3WJLC 2A83B 5IF0A 4M29A 3NDZE 4KDTA 4B50A 1T20A 5ICZA 2A9NL 2NY4D 2COVD 1J1PH 4X6BB 1WBYA 1Z0MA 4OCRL 4OZGF 4RFOH 2Y6SC 4YDNA 2H0JA 5JUEL 2DQEH 4LIQE 4I5BA 3T2LA 3FT3A 4XBEL 4F33B 1YJDH 5GGVH 3MRRA 4X50A 4A2EA 1NL0H 3K6SA 3KPLB 3FXIC 2DL2A 1RZFH 1CR9L 2XWZA 3IU4H 3QEQB 2WTOA 1X7TA 1NCOA 4KI1A 3NGBC 2OMNA 2X0UA 4LCWB 4HHAA 3U4AA 1URLA 5DQ9A 1DP0A 3LB6C 4K7PX 2LU7A 2K4WA 3OKKB 4M3JA 4NN5B 2WLIA 4OFVA 2MOGA 5C0GB 1NLDH 3K1KC 2VCOA 3MBEA 2J5WA 3DSNA 1NMBH 4JO4L 2YXMA 4LMQI 1IM9A 3SGDI 4V11A 5I1EH 5JXED 2HUEA 1MVUA 3DO4A 1WD8A 3LN4B 4DGWC 4KRNA 3MJ9L 4UZUA 4WIQA 2GI0A 2QPUA 2X4OA 4ZS6D 2DIAA 1Z9OA 4YDIH 4W9ZA 3DX7B 5BW7A 4ZDHA 2XFGB 4NJ9H 4NRXB 2Y9RT 3UTPD 5KVFL 2C34A 1PIGA 1MI5B 2KZ1B 2Z7ZA 3F58H 4NDMA 2ZP9A 2YK1L 3QRGH 4KK8C 3SYCA 2DQUH 4DETA 1CQKA 4JHBA 4N0YH 1N59A 2ICCA 5IHBA 2FWLB 4CMMB 5GRYA 3F00A 2FJHA 4CMHB 3BUIA 1X7QB 4L37A 3BQUC 4F8NA 1WIPA 1R6VA 2XC8A 4RDBA 3O4LE 3W57A 5KSAC 4Y4HB 4F7TA 1MHEA 3NCBB 3TWCL 5IB4B 5IMLA 3S96B 5FW8A 3MV7B 3NSCA 3KL5A 3CMGA 3UO8B 5HDLA 4KY2A 4A2GA 1TYJA 3EYQD 2RA1A 5TQ0L 4U6YB 2VDPH 4ZW5A 4D2NA 2ZPKH 1EH9A 3BP4B 1PD1A 2I5YL 2QR0A 3NIDE 4KOBA 4OY9A 4UT6H 4F7KA 5B8CA 4HXBH 1BXVA 3Q3GA 3AB0B 3ROLA 4QRSA 3GRGA 3CVHB 5KVGL 3SDXE 1AHMA 2ESVD 5TFSH 3T2NH 1J8HB 1NANI 4PJ9B 1FLRH 4XC1H 2FCBA 2QPSA 3KEHA 3MKGA 2ZXBA 3D7PA 3VRJA 1UURA 4PJ7A 3JV6A 5DJZA 2NXZC 3N44F 5JQ6H 2QDWA 3FFOA 1CDHA 4JHAL 2IFFL 2CGRL 5C0NC 1DSYA 4JM0A 2TAAA 3CV5A 2ITEA 3OM3B 4JO3L 4GQRA 3RFZB 4BFKA 4XPGH 4YHPB 4S0SD 1LEIA 1AAJA 1YVLA 2ED7A 4HK3J 1OCWL 4Y5XA 1A64A 5IVZB 3GEWB 1EWHA 4TNVF 5C6WH 1BQHB 1EAQA 1ECYA 1JV2B 1JS4A 1AFVH 5CLZA 4K5LA 1AY1H 1HE7A 2EUXA 1OWRM 3QORB 2IXQA 3KJ4B 5C0AA 5DMJB 5C1MB 5IHHA 2DMBA 4I3SH 5L9DH 1T1WA 4WI9A 4HWZB 2AVFA 5EBWB 4PS4L 3H9SE 2DV6A 2OMTA 3GHPA 1G7PB 5E95B 4WU5B 4NKMB 1FL5A 4UTCA 2D7MA 4HS6B 1I8KB 1TQVA 4IU2B 1P69B 2XKSA 1AZNA 5IHZA 1CIDA 5FYJE 1WT5C 4QRUB 1FGNH 3I3BA 2OLDA 3CC1A 3IMSA 3GSQB 4EVNB 5EO0B 1I3UA 3NCYS 3WD5L 4JLRB 1QP1A 3WXWH 1BA9A 1PYWB 2WWOA 1CFVH 3WE6B 1UJ3C 2XWDA 3KHQA 3QCVL 2X1WL 3IFLH 1RMFH 3B8YA 1GZHA 1Q9OA 3INUL 4GW4B 4Y1AE 3U4EA 2VZOA 3ARTA 5EN2A 1AC0A 5EF2A 1PFOA 4J3TA 5MP6L 4UOZA 4M3KB 2NSMA 4ANUA 4R97B 5D2NA 3MSPA 1DYZA 3U30C 3MV01 3RX5A 1PKQA 3ARYA 4LCUB 4YIQB 4EF3A 3LKOB 2DEYX 2JI1A 4Z95H 2D7PA 5JIKA 4LOUC 1D9KC 1A2YA 1MJUL 4P5TA 1E27A 4ZFOA 4FHJA 3SE4C 3CDYA 1U8HA 2FQGA 1T2XA 4HUXA 3WEMA 4NX0A 2JQZA 1IAIM 1H19A 2XTSA 1N6UA 2D2CC 1Y18B 1IM3A 3CVCA 1SOXA 3F85A 3MXWH 3NJXA 1VDGA 3BVDB 3X1GA 4WY7H 4G5AA 4ODHL 2XX1A 4ADJA 2JVUA 2OMZA 1W72A 2LFGA 3EO1A 1CK0L 1KBWA 3OHMB 4OBSA 4UI2A 4XHJD 4Y16B 4WW1B 2WO2B 4I8DA 4P2AA 1NGZA 1NEPA 1T89A 4BZ1L 2BPBA 3SD5A 1OWWA 1XR8B 2R15A 2BSDA 2J8HA 4RAVA 2LE9A 1IZKA 1U8LA 5FK9B 3UCQA 2NX5E 2WN3A 3HBPA 4HV8B 4QHPA 3WTSA 1DJGA 5EZJA 4L29A 5K39A 3FSZA 3FH5A 4XOEA 1UOWA 1GPOL 1OLLA 2YARA 3CPUA 2XI9A 5ID1B 3VSTA 3IGKA 5I1AB 2JXMB 4UTAA 3QWRA 3CH8A 5B4MD 1AYOA 1VGEH 1PY0A 4G6ML 1TO4A 4HKXB 5T1JA 3IPFA 3TZVA 1IAKB 3HI5L 4OI8A 4ANKA 1QNZH 2R39A 5ABZA 3T4YB 1JERA 2BVEA 1JFHA 1U8MB 2B7DT 5JW5A 1TZ8A 1N4XL 3ZL4L 2XTJC 4XXCC 4WUUE 2DM2A 2G2RA 3U9PL 1I7UB 1M9WA 3WKNA 4JKWA 1LE5B 4TSBH 2AKRB 3EJQA 2Q3XA 3QEHB 3FCBA 1LDSA 3V0HA 3ZE0E 1QKZL 4YDVB 1UM6H 2EACA 4DK3A 2PCFA 3BIBX 1NCDH 3BN3B 4XOBA 4K5NA 3VGAC 1V3MA 4I0CC 5HHNA 3DX9A 4G9FE 3SO3C 2VGLM 2X40A 1IGCL 4X2UA 2YXWA 4WENB 3EFDL 5B39G 4E9LA 4HPOL 1QWUA 4PGEB 3TA3C 3U9UB 3V0WL 4BSVA 1H8LA 2A2QT 3KYNA 4OZIB 1S6NA 4ZMQA 4M7KL 7CGTA 4LVOC 2NCMA 3ZVVA 2WBJD 4ZFGL 2WLHA 4Z0XB 5BRZD 1KACB 2ZXCA 3BN9C 3Q9QA 4WRLA 1OSZB 4N0UB 3RP1A 2B3RA 4RBPK 3GEFA 4L3FA 5D93B 3H7LA 2Q0ZX 5IGXL 5KN5A 3TL5A 5L6YH 1J8SA 3S88L 1OO2A 3RX9A 5C0IA 5BS0E 3DTXA 2EYTB 4RVBA 4EI0A 4EBQL 1Z5LB 3MOQA 1H3UA 4GAJH 4ZX5A 4AQEA 2NY7L 5LBVA 4CVUA 2ATAA 5JHLA 4JDZA 3VA6A 1BX2B 3E6HA 4YX2L 4XBPA 2XG4A 3TBYA 1CL7H 3U7YL 3ECBB 1MOEA 1CQYA 1OB1B 3O3AA 4ZMZA 4KUZH 2WKOA 3F7VA 3RURA 5IJKC 3BE1L 2X1OA 4R7DB 5DK3A 4HS8L 2B1AL 3ZK0A 3GSWB 4JDTH 4R5VA 1OHZA 3HMWL 4NYLB 5IQ7L 1SF5A 3HI6H 4G11A 4WI4A 1Q9KA 3T3PB 4UT7L 4OAWA 5AVYB 1I1AA 3EDFA 3A0OA 3G5WA 3M7FB 1P2CA 5LKNA 3HZYB 4HWBA 1E4KC 2W60A 4Z76A 5J0BA 1JYNA 1KN4H 1N8ZA 1TYRA 1OM3H 2VDNB 4XO9A 4DPRA 3OMNB 4HUNB 4AYSA 3ZSSA 2LAGB 4E5XG 2E7LC 4KQ3L 1Q0YL 4NZFA 1CE6A 2V8LA 4K94H 2I9LB 3UGEA 4G43A 2ZKYA 4GMSH 1MCWW 3OWRA 3A22A 2QZQA 2GJPA 3G08A 3K8MA 3T3PF 3O3UN 1RIUH 2FO4B 3WU1A 5CU9A 5FA3B 4DHLA 4LQ1A 4CUCA 1WZMA 2ENPA 3PAVA 3PRZA 1MHCB 4PWKA 3TBWB 4F9LA 4NQCE 4RGNC 4IU3A 2X6CA 3DDFA 2E9BA 3T0DA 3S5ZA 4G9DB 4H2AA 2WIIA 1DQLL 4M6AA 4J3VA 2OMYB 4JG1H 4XMKH 5EO9A 1WFNA 4GIPD 4YSPA 4AZ8A 1JF6A 2Z35B 4BV1A 4XNYL 4FLSA 3Q06A 3GWJA 4Z6AT 2GK0B 1CBJA 1W72H 1X9LA 2FVNA 4JY5L 1UEMA 2AQQA 3WUWG 1G1YA 4NZDA 3FCTB 2GSMB 2V2TB 3PQYB 5GRWA 2XWJA 3JTTA 3FHQA 1EO8H 1SXZA 1KPVA 3F7YB 1D6EB 5D7IB 5CD5D 3Q5TA 4XHQA 4KI5F 4LSRH 4IIQB 4AIEA 5DYFA 2K70A 2OR9L 4YDJB 1FNAA 4JFFB 5I1KL 2C7FA 1QTSA 3KJ6L 3VXUB 1ACYL 4JREB 4XO5A 5JIMA 5EIVA 1VGKB 3BDXA 2CO6A 5DGRA 7PAZA 3D9AL 1YLBB 4Q7DA 3QIUA 3ZYJA 2CR3A 5C0CB 3GUTB 1A7RL 2DWTA 5E6UB 1WWAX 3ML8A 1B9ZA 5K59F 2ZNXA 5F9JA 2GTWA 4RWYL 1TQCB 5I6LA 2F1AA 4AQ8C 4WWKC 2CDFA 4HSCX 4QJ3B 3VFPB 2AQ3A 4PJGA 4Z3GA 3DMMC 3EYSH 4H26B 1T21A 4LF3B 4YLBA 4PHXA 5CWSA 4POUB 5CJ8A 4FFVD 1NAMB 4QNPF 5ACLA 2VXSL 4NUMA 1A5FL 2PXYA 2CLVB 4R7LA 2B2XH 1C12B 1TEFA 4RRPA 5KBMA 3QCUH 1A6WH 2IH8A 1I1YB 2Y7QA 4U1JB 3LRKA 4ZNEA 2EVIA 2FJUB 3MNDA 4P2RD 1FZJA 4U1MB 2ZKMX 1H8OA 2ILLA 1I8UA 3OVUB 4JBSA 1BQSA 2YFNA 3VB8A 4HZLA 5I1HH 5JLZB 4P4KC 1JZ2A 1GW0A 4XAKE 5CBAA 1PIFA 4K5OA 3VFTA 5J12B 1AHWB 2AEQL 4O2FB 2DICA 5LHDA 1QUNB 3H1ZA 3AS0A 4RBPH 3VGDA 1KCBA 3D87B 4CNIB 3IDUA 2WYIA 5AOJA 1C5DB 1IEAB 2XVGA 1A4AA 3D39A 2L7QA 1E4XH 2NW3B 1KNOA 4BRVA 3SGKC 1KFGA 5LN4A 1D7DA 4UQCA 1AQDB 4F57L 3CCHB 4P5KA 5J56B 3HPJA 2PW2B 2J6EA 1JHKL 2VW6A 2B16A 2G0KA 4MMXB 3QWQB 1FAKT 4NQVA 2VMFA 4GB9A 4M48H 5FUCE 3RPIA 2AQPA 3ULVC 1ACZA 5HGDA 3OQ3B 2YLHA 4A6YB 1X4XA 1BZ9A 5G2NA 1BD2A 4RX4A 2PO6B 3GXMA 1XL4A 3CSYB 2R1YB 3ARGA 2B4CC 4XP1L 3B5HA 4DGUA 4LSPL 4DF9A 5C6PB 2DY2A 4CN6A 4HEPA 4PVLA 1T0PB 5EU4A 4Z7VA 4UV7H 4MAYB 4OUOA 3RWEB 1KXQA 3UO1L 3TEWA 4OD1H 1A6AA 5D7SL 2VN6A 1BVLA 1J5DA 4HUMB 3UX9B 4RA3A 3ZTCC 2IBZX 2C4XA 1KDIA 2O6EA 4MCZA 1B9KA 2K8QA 3V7AG 4GRWH 4P05A 4WKXA 1IMHC 3L9YA 4PVBA 3G6JA 5FUZL 4ELDA 4XPHH 2JTDA 3LD8B 2Y36H 1K8DA 3FUJA 1IC4L 3W9EB 2XV6B 3TONA 3ZHKA 1IFHH 1YHPA 4EI5A 5C9JA 1CGVA 1GMIA 3LKSB 1W80A 3QDGE 4FXKA 25C8H 3FH7A 4HCRL 5KG9B 2EZ0D 2H9GA 1TFHA 3IN0A 3EAKA 1IGTB 3Q6GH 5IUCA 3O2VL 4UBDC 1M1XB 3D85D 2R7EA 3FHEA 4IRJD 2R2BB 3RVXC 3T6ZA 3BUYB 2H26A 1F00I 2DEWX 4LRNH 2NNFA 4XX5A 3WLBA 3VG9B 3V9FA 4M7ZC 5IP4A 2FQEA 1RZ8B 4L4VE 1F3DH 2ZKHH 4XPTL 1L9RA 2Z9TA 4YR6A 4DKEH 5EIQA 3MLXL 2MTPA 4JFDD 3O6LL 4Y2DC 1JN6B 4G3YL 4X4XA 4N2CA 2ZX9A 4OLEA 4F27A 2VL5B 1SLUA 3HG1B 2DQDL 2JKLA 4QRRE 3RWFB 3X1BA 2FIKA 3QJOA 5TQ2L 3R1GL 2WSPA 4DPBX 5CGMA 4M7LT 4EKJA 2C26A 3OKYA 3UAJD 1N7ML 4Z7QF 3GKWL 3PHSA 1FGVL 4MJ6B 3AG4B 1IC7L 2BP0A 4I0PB 1QATA 1BZ7B 1BM3H 3ECVA 5AW5B 5EORH 3QA3A 3OG4B 2DQJL 2M2DA 1I3RA 2WTPA 4J2XA 4F1ZA 5DJXB 2HXAA 2BC4A 2FEDC 4NC1E 4PRIA 5EF3A 5F1SA 1KJ2L 2AK4E 5A6MA 5KYNA 5GRJH 2H0PA 1I4FA 1HAWA 2A9BA 2Y5QA 4HIPA 4RWHA 3D0VB 4NQQA 4C58B 3BPCA 4UQDA 3V5DA 3GI8H 4MS8C 3JTSA 2DTSA 4U3CA 1ZK9A 2SODB 5L7XH 3GNML 1CLOL 4TVUA 1J05A 4N2IA 4NRYB 1IE4A 3QDHA 4NXKA 3VG0H 5EU6B 3QUZB 4N2GA 4MA8H 3V4VA 4QGYA 2EDKA 2IADB 1FLTX 2LTQC 2XA3A 4G5ZH 1FH5L 3PWPB 4X99A 2BOBA 2IV9A 3M88A 1XGUB 4AIZB 4H5SB 1NINA 5CIPA 3SDAD 6FABL 2DDQL 1U41A 3NFNB 3BLKA 4Y9GA 4UDUB 4IBUA 4XCCH 5DS2A 2C9UA 3TH3T 2B5IC 1HI6A 1YSOA 3PF2A 4AGNA 2HFGH 1I9RL 2E7MA 3SZ6A 3MJ7B 4OBRA 2ZE0A 4LCCC 4HJIA 4ZUSA 1LHZA 1ECZA 5FYKE 4G80B 3PFQA 3T0EC 3IETB 4DP1X 3PWVB 4TQPA 1JGIA 3MOAL 4DCQB 3TESA 1A4KB 1LO2L 1TQUA 1U91B 3QDAA 4HX1B 4R4ND 3G5XA 2BVQA 4FL4B 4RFNB 3RJQB 5KOVC 4P2QD 5DFVD 4UZSA 1NANH 2YBRB 4P0DA 2MOQA 2UWEA 1XIWA 2VAAB 1MCLA 4ENEC 4RGOL 5HHVL 4QHLB 3LDBB 2PCYA 1YEKH 3OPUA 1JK9B 1JYWA 2J6EH 1CU4L 1OAQL 2OJEA 4GBXD 5DJ2B 3MRQA 2CMRH 2JMRA 1IBZA 4NPKA 4P5MA 5JTWA 3ZTEA 3WFDH 5AKVA 2B59A 4B9JA 2GUOA 2GTQA 3I50L 3D30A 4OD2A 4X5LA 1JWMA 1PG7W 3FB5B 2D3VA 4HQQH 2LGNA 4MJIA 1S5IL 4QTIH 1UD6A 1E4HA 3L9BA 5EMYA 3B7TA 3MX0A 1HHHA 3LEVL 4MYPA 3S34L 5IVZA 4WGKA 3PL6D 2F7OA 4J4PA 5C08B 3SGJA 1NGPH 3WY2A 2NNXA 1BZ8A 4JGJA 4FFYH 1U8JB 4NPYA 1FZOB 1IU1A 2DIEA 3UG4A 4QMEA 4YXKH 5DJAA 1F13A 4GKNB 1XTMA 3SYPA 3VD7A 3DO7B 3LCYA 5IBLD 3CFKB 4H4NA 1J10A 1TSRA 2G75A 5C07E 3UIYA 4APQA 5K1VA 2YR3A 4LHUG 1DQJA 4N4YB 4MD4A 4PVNA 2EH7H 2JB6B 2VISB 4RRPM 3STLA 4QPEA 1U8CB 1PTZA 3SE6A 3W11C 4EIGB 1CICC 1L5GA 5GGSB 1X5LA 2VLKB 2H6PB 2V2WA 2FIRT 3BKYH 2ATKA 2R0WH 5KVEL 3QP3A 4MRBA 3MRBB 4KXCA 2JWYA 2JIXA 2OSXA 3N85L 3QUXD 4N0CD 3JWDH 1UT9A 3NEOA 4QRQA 3ZLQC 4OUUA 2X09A 5E7BA 1FYHB 4I48A 4GW4A 1KC5H 4P46C 4YFLF 4U2YA 5HHPA 5TE4H 3HZMB 3IFPA 1IL1B 3ZQWA 3RZCA 1XGTA 3DTUB 1I8IA 5F7AA 5J1AB 3GMLB 2ZQKA 3BXNB 4RMWA 5LAXB 1ONQA 2A9DA 5GZOD 5BMFL 1ZCRA 3SE9L 3SDCD 4LVHC 1EBPA 1GYCA 3BP5B 3CZNA 1IAII 1OXYA 3BUDA 3PE9A 4IYKA 2F5AH 2I85A 4K23H 4W6XB 3VD1A 4NN7B 3BP7A 3FN0H 4YHNA 4P4RB 3VTMA 5F1IB 4AVHA 4ZFFA 1I1FA 1JZFA 2KZBA 3TVMC 4C4BA 1KLUA 5D1XB 1H9DA 4MAUL 4PV9B 4PB0H 1PCSA 4LLQA 5CAYB 4ATTA 5F6HJ 4H1LH 5E9DA 3RBSA 3FU7A 2HFEA 15C8L 3QZMA 2FLMA 3TOPA 1W6LA 3JWOH 1QNIA 3FJTA 5GSVA 1LMKA 1L9QA 2WQWA 2EEBA 1N3NB 1YUKB 4N90D 2ZXQA 2W8CA 1PD6A 4WSKA 2XLLA 3ARED 2BRRH 2K78A 3CFDA 1GOGA 4FQLH 4CSTA 1HVXA 3QZWB 5HJGA 1HILA 4TULH 2DIJA 2HSIA 3V4VH 4UNVA 2CRIA 3EJSA 1GGCH 1ZHNB 1P4IH 3FZUD 5CIPH 2W80C 1ZANH 3SBPA 4MXQD 1ND0B 2WTRB 2YUZA 5BZXA 5ID1A 3E38A 1R1CA 1UWXK 3E2HC 5ADOL 4H20L 5HDBB 5LBSH 1HIMH 2GQHA 3EYVA 4Z18A 3FYIB 4JR9H 5BVPH 1ZS8A 3SJVB 4FC3E 3ABZA 2LLNA 2X6AA 4K55A 4PJBE 5C09B 3NRFA 3NH7L 2OX5A 3PGDB 4YHML 1RJLB 1T0MB 3GLEA 2LT9A 3V79C 3ARBC 1W2KT 1MLBA 2J20A 3VI4F 2CXGA 4JZJC 3VDAA 3NMEA 1EGJA 1LWRA 3CUPB 4IBWA 3T3PE 2ADGA 2BSEA 3A4FA 1HHJB 3M17B 1XFPA 4KPHH 4PBXA 5DVKA 3US9A 3K6DA 1UASA 3FOMA 4B53A 2EDWA 4Y8AA 4BQBA 3X11B 2FBRA 2DL9A 2HRPL 1KIPA 3C5ZC 4HIIA 3L7EA 3HC4L 5GGSY 4ZTOH 4IHBA 1IGFH 2QKIC 5HDBF 3UJJL 2HKHH 4R26L 3IBEA 5IVOA 4K7PL 1CFBA 3L3DB 5EN3A 1FA4A 1CFTB 1PG7X 3T0XA 2DWYA 3MCKB 4BBWA 4YHKL 3ZYIA 1G9MH 4K15A 4GUPB 4IOFD 5EA0H 4TM9A 2OXGA 2BNQD 1UFGA 1AVAA 1NIFA 2XN9A 4HKBB 4KK9C 2VL4A 3HE7C 2KPWA 4OLXH 1AXSA 3ZHDA 4YH6A 3ESMA 5IVXA 2O61B 1J8RA 2O5XH 4DQAA 1X6LA 1CLCA 4Y4KB 1HWGB 1YQ2A 4XCEB 1MRCL 2UVFA 2VXTH 4LLDB 4PLKD 2BVPB 3MUUA 3SCMA 2YD9A 3IB4A 3NABH 5EOQL 4M61A 1BZDA 5DZ9A 3MRKB 5E8DL 5DYOA 4NO5B 1C08B 1RURH 1UD5A 5JHDD 3O11A 2BWQA 3SB3A 2QQNL 3F6JA 2WBWB 2EXSA 2H4EA 5E2VH 1LDPH 4ONFL 4LLAA 4RFEB 1MCCA 4F2ME 1DBAH 4HBQA 1OB1A 2WNGA 4YDLC 4FJYA 4JY4B 3MREA 1G4MA 3CFBB 3QNZA 1RY7B 3J2PA 5K59E 5GQBA 1FRGL 5E1IA 2B20A 4JPWH 3CFCH 5C0DB 5IREA 5JW4N 3ZMNA 2VC2B 2DD8L 3QPXH 4BZ2A 3CZFA 4KKLD 4MZIA 1OAXH 4ZXBB 1P7KA 3VTTA 5KYXB 3BH8B 2NNCA 3MLYL 1FNHA 2YPLB 3S3SA 1WA1X 3CQFA 1A9EB 4QNPE 5J6GB 5F7LB 5I1GL 2Z4TA 2Q7YB 3V6OE 4A55A 2TSBA 2F53D 4NC2B 5DVNA 1VF5C 1RK1B 3OGOE 5C0CE 1CN4A 2OYKA 3TA4D 3V95A 2YSSB 1AIFB 4R7NB 3B9KA 5DFTA 1KPRA 4OQTA 4UQ3B 5GZNA 2OJZL 2DQIL 4XCFH 4G59C 3FFCD 3MRDB 3M07A 4N6QA 1LO5A 5ALBH 2A6KA 3TT3H 4WGVB 3UROR 5IB5A 3MGOB 1CD9B 1QTPA 4PLJC 4I2XA 3P02A 4LARL 4HS3B 4UM9A 2YUVA 4OU3A 3H6JA 1YAIA 2MSPA 2NY0D 1IARB 1FV1A 4WW2B 3ARFA 2J8UB 4AQAA 3BIAX 4YC2C 2FJSA 2WB1A 1KYOK 3CSFA 2GK2A 3WFBH 1D5XA 3FMGL 3MODL 1F90H 5CN3A 4C4KT 5J4MA 1RZKH 3QWOA 5SWZE 4ZAKD 3RAJH 2HRLA 5SWQA 3PQYA 1UH2A 4ZZKA 3PDDA 5IEKA 3C60C 3LIZL 4N2AA 4XMWA 5C71A 3KL0A 2BSRA 1DBBL 3MV9D 4ZUTB 3IMVA 5E0FA 1WD9A 1KTLB 3PAUA 4OJFH 4PG2A 1VFBB 1HL5A 1MCEA 1KXVA 3FQWA 4KK6D 4WW2F 4K3JH 2J8UF 4Q2ZA 2WZ6A 1IFRA 1NC4A 4JFFA 5FUOH 1URZA 3GO1L 4FTVA 3UDWA 1UXWB 2AJSL 2AJVL 2DWDB 3LMJL 3AWGA 3BKCH 4AMWA 3CZEA 3MO1A 5TK4A 5I76B 5AG8A 1UWXH 2C3XA 2NY4B 3ESNA 3MOBH 5ECJE 1J9RA 5CSZA 4HD9A 2XOTA 1T22B 1XXDC 4ERSH 1O7DE 1FCGA 3NCJH 4ZMLA 1EGJH 3C08L 3RY6A 1KV3A 2W0PA 5I1CH 4AT6B 4FYSA 3O3EB 2CRZA 2GT9B 3MNWA 3GBMH 1J0JA 4AVJA 4YGVB 4CC4A 1U8KB 1YEGH 4WVRA 3RVTC 4PG9A 2J55A 1AD0B 4X7CC 2YRLA 1MVFA 2D7OA 4J3WA 3W37A 1UKTA 1S78D 2YMTA 1F4YH 2Z31D 3RGVA 4HPHA 3P3SA 1ZA3B 2SEBB 4P23A 3QDMB 5LN8A 1SYSB 4YZFE 3V0AC 5GISH 2HG0A 4ISVB 1QASA 2DWSA 1F0LA 2FEEL 3HMXL 4GH7B 4ZTPH 3Q9PA 5E6SB 4LCYB 5T5NF 5E00A 1DBKH 2AFNA 2CR6A 3OGCB 2IH1B 3QQ3A 4NUGL 3V6FB 2HPOA 3LAFA 3L1OH 1MJJA 2GJ6B 4FNQA 3L95B 2G60H 1QFUH 1MFDL 1UOKA 2ZUVA 3HJEA 4QUOA 4Y2LA 5KAQF 3QJUB 2BIMA 3LH2H 2O5ZL 1EEZA 1T83C 5EU3A 5E08L 4IM8A 3DX8B 1P7QB 4ZQTA 3REVA 3ZSTA 1PZDA 2GJZB 2DBLL 4JGMA 5GGTH 4M5TA 4G2AA 4Z7QE 1R5IB 4WCYH 5CHNB 1MFEH 4LPXA 5DRWB 3OKMA 4P2OA 2R2HA 3ATAA 5M7QA 3HE6B 4OJYA 2QHRL 1YN6A 5D1ZD 1KEMH 5HHMD 3CDZB 4RNRB 4PW4A 3BRFA 1OARL 5IBTL 3AU1A 1SFHA 4G8FA 1REIA 3KYMA 2ZG1A 3MR9A 5GHWH 3RG1C 5IOPA 2D73A 4PJAA 1P6WA 3OAWA 4BZ2H 2O6DA 3GMRA 3NJJA 1SF3A 2WP3T 3WCYA 1JZ4A 1VADB 5EC2A 4OLWL 5T1MA 3ZRFC 2F7PA 4NAJA 4AGQA 1RFDH 5ANMB 4I1RA 4LNRA 4NO0A 3HG3A 5MENE 5F7EH 1B4TA 3VXTB 1EVUA 4H8WH 5J7CC 2EQDA 2XZQL 4KRPD 4DKDC 1P4LA 5K9QG 3BW9B 3P0VH 3KLQA 5AVXB 5FPIA 1S7UA 4PJGF 3E1ZA 3CLEL 2HTKD 4LESA 3V4UH 3C6LC 1BXAA 2VRKA 5I66B 1CTOA 2NZ9D 4NQEA 1BVKB 1R3KB 4YE4L 3ZXAC 2BZ7A 1SXBA 4X6CA 1UQSB 3HUJA 4WNQA 5IB3A 4JANB 3JUYA 4FQ1H 2GBAA 5EU6E 3VXQA 4LVEA 4YHZH 5IQ9B 2X05A 3UG5A 3LZRA 1XCTA 3VWJB 3S36H 1PZSA 3EKCA 3PWPE 2WNXA 5DUBA 12E8L 3UTQA 4YDKL 1B6DA 1MSPA 4GS7B 4HK0A 3C2AL 4HETA 1FN4B 2NY1C 3TH2T 3M46A 4NQUA 1ULVA 1MQKL 4KK5C 4UNUA 3VI3A 5I8OH 4OZFH 2OZ4L 3EO9L 3TN0A 3U6RA 2GCYB 3DUUB 3ZUNC 1NCUA 3B5TA 2G2PA 1K6QL 4FXGA 4XVTH 1ZJBA 1IGIH 1CI5A 5I0WA 3FTUA 1U2CA 2VLJB 1F1AA 4LL1A 4MMZB 4GUOA 3US0A 4N24A 1A4JA 1MNUL 1XSKA 1W0WB 4HPYL 3HI1B 5IFJA 3PYCA 3S9DB 4UTBL 3S35H 2FE0A 2GIYA 3S7GA 3EBGA 3MA9H 2F19L 5ABAA 5JOPE 5ILTL 5GPRA 3ARRA 4Y9CA 2VDQL 3KPOA 2VR6A 3DPBA 1VPOH 2X53A 5GS1B 1PMYA 1SEBA 4NP4L 3RKDD 4L8BA 1L0QA 3AWEA 2JKTM 3DROB 3KPRB 4PR5B 4TKWA 4U1HA 5AOIA 2ENQA 2EUZA 4WV1B 5J13B 1JTOA 1M7DB 2VDML 4JO2H 4Y5VB 1MWOA 1CT8A 2EEAA 3LH9A 2AJZB 3O2WH 3IS0X 5DLLA 1KGCE 4M6MH 2FSEA 1A7OH 1T1ZB 4LEXL 4XMPL 1XGQA 1IAMA 3OZKA 3SPVB 4AEFA 3U2SA 1NJ9A 2WANA 1OF0A 1KBKA 2XT1B 4B9ZA 1OD7A 4M5ZH 4X0NA 1DQVA 3D48R 5D6DC 4DWHA 4Z7VF 3W5MA 3TPKA 3OR7A 3UTTB 2VITA 4N9OB 1S9XA 4LKXA 4LEBA 2ED8A 2Q6WA 4NM4H 3WJLA 1L9TA 1FYTD 3DIVA 1ACCA 4U1LA 2APXA 2KZKA 3NZUA 1H5BB 1MZYA 3R7QA 3WAJA 4FQXA 3RDTB 4FABL 1DLFL 4UDUA 4B0MB 3F5WB 1U3HC 5CZXC 4NZTL 5AW8B 2EDLA 1OE2A 4KVNL 3WNIA 1MAMH 3CTTA 5F3HA 3VD2A 3T1WA 4PRPA 2E46A 4X4ZA 2VLKE 4NENB 2MH4A 5MHSE 2WIMA 2VM9A 3IDIB 4O58L 3FB6B 1VCBC 3Q1SL 4KAQH 5FO7A 4YXLL 5I2IB 2DJMA 5KSBA 4W68A 5D8JH 1JNLH 1HS6A 1LP9B 1MY7A 4JPSA 4YDZA 2EYSA 3WNOA 1A6VL 4PGBA 2AK1H 3DGDA 2L7UA 1N67A 4QRPA 4ODXA 4L4TD 4F9PC 3CU7A 1SJHA 3L48A 5F89B 1ZEAH 4PJ7E 3K2UL 4H1LB 1C5BH 3QR0A 3QPQD 4JQIA 4V1DA 5EIIG 2H32A 3BP6A 3R8BB 4GKSA 1HN1A 2L04A 4XE5B 1L0YA 4NQXA 4MCYA 1G7QB 1MF2L 5HHOD 5CN2A 3KWXA 3I9PA 2IGFH 5CU5A 3O0LA 3ULSA 3D1MC 4PRNB 3BRGC 1HXMB 1INDL 1WZKA 3GZQA 4IOIB 4BM7A 1BAFH 3VW3H 4LLUA 3G6DL 2EE0A 1LP9F 1QFWL 1AOZA 3VE0A 3HG0A 3BO8A 3T65A 3OJDA 1DVFA 4MA3B 3RY4A 4HWEL 1FC2D 1DHKA 2K6ZA 5E8EB 1N6QL 5D1QB 5IROD 1IUZA 5C0AE 5KSAA 3IMUA 2EDXA 1XSOA 3JV4B 2DLHA 3BWUF 1U8JA 4TTDD 5IVNA 1BPVA 1R3LA 4X7FC 5KANI 4ODUA 1H0DA 1GCFA 2Q86A 4FI6A 4GKNA 3H7BA 4Z3EA 2CA4A 1RZGB 2PWDA 4IS6B 1ORQA 1BBDL 5DD3L 4PWHA 4A39A 3UPRB 4FFZA 3PXLA 1VKXA 5IHUH 1M7UA 5GIRA 3O6FC 4BWUA 3ESUF 3K1DA 3VI4E 3Q43A 4IGBD 5EZLB 3VNYA 4CC1A 3SDDD 2J88H 3FO1A 3WLWC 1I7RB 2A99A 4MZRA 3WNJA 1R24A 4P04A 3DDGA 2EUWA 1GSMA 3ESOA 2F15A 3DYOA 2WLJA 4G6JH 2IPKB 2AV1A 1SEQL 1MRFH 4BD4A 3G5ZB 3X3FH 1E2ZA 3OQRA 3PJLA 4CN4A 5HDBE 4LL4A 1Z6JT 4HEPG 1XX9C 1EAPB 1HOEA 5AKRA 2CE6A 1T6BX 2G3MA 1CD0A 3KWWB 4JRXD 3C8HA 5T33L 5DJYB 3UZEC 5D2NE 3L3HB 4GT0A 3WHE0 4XPBH 1F8TH 1X7SA 2VKWA 3GMLA 4BKLB 3FUNA 3MGAA 1PKQE 1P9MC 2EO1A 1T1YA 2F0CA 1DR9A 4LKCA 4D9RD 3K71A 3D25A 2J21A 2R29A 1KYDA 3M1OA 4ZS7L 1A6PA 3UYRH 4NKIL 3TIEB 2WSDA 4KUCD 3GSNA 1IBHA 3QW9A 2YPVL 5D7JA 2FGWH 3MA7A 4I77H 5AYQA 3ZTNH 4S1DC 1S9WA 4NWUH 4MCNA 1U6AL 5LLIC 2NUTB 1LE9B 2J2ZA 5F96L 3A4EA 3FDWA 5ICXB 5CJ5A 4EN3A 4XO3A 2V9QA 3K4AA 3IKCB 4I3RL 3TJEL 2IAND 4PJCB 4AI7A 3B9DA 3RE0A 5C0RH 1WBXA 5J9PB 5I5MA 3VWKD 5I1DA 3BVNB 1WBZB 3KPTA 3QIWC 5I0VA 3LNDA 3GINA 5TGBB 4PJIA 4FNRA 1Y6KR 3JV0A 4ALAL 3VFOB 5I18L 4ZQKB 3MLTA 1TKWA 2BO0A 1WYJA 5F7FA 2O5YL 3IDNA 4TF4A 5KTEL 1Y07A 4UIMB 4MWFA 3CX2A 4IQHA 2DQHL 4MDJA 4IRSA 3NJGA 1N8OE 4IJ3C 4YUEL 2VABB 2H2PD 5SX4H 5INDA 1VEOA 2VTFA 4PJCF 5EUKA 4WO4C 1OGSA 1H15B 1ZWIB 3WIHA 3MNVA 3HLAB 5CD3B 4TLKA 1NSNH 5F7KC 1R3IH 4GMTH 1CD8A 1QA9B 1WZ1H 1MFBH 1FZMA 5FXCH 3B56A 1E42A 5F7DA 3VD3A 4JFEA 1GC1L 4Z7WB 1KOAA 5JDJA 1FIGL 3RWJA 3L8QA 2UYLB 1BYPA 4N87A 4TPRL 2FWOB 2H1XA 2UY7A 4N9GB 5IG7B 5LAPA 3ULAB 1YEDB 2FJGA 2J5LC 2R23B 2G4GA 3B3IB 4JPKL 4KROB 3C8KB 4F7PA 4FEIA 3EDKA 4KJWC 4PS3A 4MNQA 4PGJA 1LQBC 1JBJA 1OSPL 1ID5I 5EZIH 1S46A 3C5JB 1JZ6A 5IMOA 4QD2E 4QOKA 2P80A 2H32H 2Z65C 3KWVA 4MS6A 4BDVB 5DRZB 1AH1A 5DFAA 4HXAH 1NPNA 3ZE1B 2X3BA 1XAUA 1UWEL 2CALA 2R0ZH 2BMKA 2QGEA 4WK4B 5C0BD 2GBVA 4GUPA 4WI5A 1A3QA 3VFNA 1SUJA 4YS4A 2MPAL 3HPLB 2XPZA 1KV7A 1T0OA 2NSXA 1I7TA 2XACC 3SY6A 2DAVA 3J7HA 3K6FA 4R0LB 4XB3A 4X9GA 3TFKD 3VXSB 4XTRC 4MA1B 4DTGL 1ZHKA 4HZAA 3BT0A 2PPAA 4G42B 5HPOA 2OP4L 4JQXA 2NYZA 1XB3A 1JI1A 4JHWH 3BFWA 3ZE1F 4DPAX