4AL8C

Structure of dengue virus diii in complex with fab 2h12
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
SYVMCTGSFKLEKEVAETQHGTVLVQVKYEGTDAPCKIPFSSQDEKGVTQNGRLITANPIVTDKEKPVNIEAEPPFGESYIVVGAGEKALKLSWFKKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords ENVELOPE PROTEIN
publication title Structural Analysis of a Dengue Cross-Reactive Antibody Complexed with Envelope Domain III Reveals the Molecular Basis of Cross-Reactivity.
pubmed doi rcsb
source organism Dengue virus
total genus 13
structure length 98
sequence length 98
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4al8C00
3C5XA 5IREA 3N43F 4UTAA 5KVEE 2GG1A 5KVDE 5GZOA 5KVGE 1SVBA 2JSFA 1OKEA 1S6NA 4FFZA 2ALAA 3VTTA 3J2PA 1ZTXE 5IZ7A 5LCVA 3WE1A 4AM0Q 1Z66A 2V33A 4L5FE 5H37A 1Z3RA 3UYPB 4FFYA 5AAMC 5JHMA 3P54A 4UT6A 1OK8A 1PJWA 4FG0A 1URZA 3N40F 4BZ2A 3C6EA 4GSXA 4ALAC 5GZNA 2P5PA 3N41F 5B1CA 3G7TA 2JQMA 5JHLA 3IRCA 1TG8A 3N42F 5KVFE 4UTCA 4AL8C 4BZ1A 1UZGA 2HG0A 2I69A 3UAJA 5LBSA 4UTBA 2JV6A 3N44F 1RERA 2R69A 2R29A 1OANA 4X42A 3J27A 2H0PA 4GT0A 3UZEC 3UZVA 5LBVA 4UT9A 3MUUA 5AAWC 3UZQB
chains in the Genus database with same CATH superfamily
1WC7B 1G9NC 5DMJB 4LKXB 1D6VL 4WUUD 1A6WH 3APDA 4I2XE 5D1XE 1MKFA 1BVLB 4AV4A 5GS0C 4OGAD 5KOMC 3LXBA 3NJHA 4X9YA 5B8CA 5E9AA 1XH0A 2AV7A 4MXQD 2WYHA 5EU3B 2B4CC 4GXVH 1H5BA 1MVUB 3IPBA 2ZAIA 1P4UA 4JFZH 2IALA 2WBKA 2EYSA 3T0EC 2D0FA 1R9FA 2YUVA 4R8WL 3APNA 1JGEB 4YO0A 1UUSA 1DEEA 5D72L 4BKLA 3LZRA 4QRQB 1DQJA 3KL0A 3MQIA 5BUPA 3QSKB 5GS2D 2VDPH 1KJ2A 4ZFGH 5KW9H 5J56B 3PGDB 1NEZB 2F53B 4LPVA 5CZVH 4E42A 5FW6A 2YRBA 4WTWA 3BRDA 4PCYA 3RVXC 2ARJA 3LQAC 2X70A 2ZXQA 2B5IC 3KYMA 1EEZA 2YLKA 5G2NA 1PNDA 1WWWX 3R7RA 2YAEA 5H37A 4IHBA 2CDGB 2MPAH 1Z3RA 4FHKA 4M6MH 2BHYA 4FYQA 2EEBA 4EN2A 5DHDA 12E8H 3DX8B 4R0LA 1CGXA 4OM0H 5C0RH 5C0FB 1FVEB 3BQUB 4QXVA 2CO2A 4MRBA 2D7NA 1E7VA 4Y4HB 5EU6E 4CSZA 4QAWA 5FFGA 2QSVA 3PWUA 1KG0B 1FZJB 1A7NH 5FKAB 3QDHA 4Z7VA 1CD1B 5BZWA 3NGBC 2CD0A 2EKJA 4DPCX 4GG6E 3O6LH 3KJ6L 5I1EH 4D9LL 3V0DA 4XBPA 1GS8A 1YEGL 1BBJB 1CGUA 2LABA 2PCFB 4OIIL 4Y1AD 2F08A 2A3TA 4JFFA 3BN9D 4WI8A 5H94A 4N8PA 1BQHG 3ZTNL 2MCG1 1Q9OA 4B9ZA 3DTXB 5HYIA 5C7ZA 3VRIA 3IMWA 1Q72L 2XN9A 3DHMA 2ZSWA 3APCA 1CL7I 5JHDE 3U0PA 1MH5B 4LMQI 4QEGA 2WQAA 4OLUH 4WNQA 2F54A 2GJ6D 3KVPA 4ILDA 2CJ3A 3TO4C 1FNHA 1DJZA 2VLJB 3SPHA 5DMKB 1MG3C 3LN5A 4YSAA 1MCWW 3KYAA 3MJ7A 1IBGL 3QUXB 4L4TE 4LDLB 2OYPA 3EYUL 4QHPA 4F8TA 1BHGA 3AG1B 4TPRL 3DJ9A 2A74C 4FQ2L 5E4OA 1PF3A 1I8LC 3BWUF 1PD6A 4LK4A 2EJ1A 2E4FA 5DMIL 4PJEA 2IOMA 3KGTA 4IU3A 4HAFA 4FQXD 1GYAA 3RX8A 3C6LA 2AERT 2A4EA 3C6SB 4IW4C 4XVOA 3WAJA 5C0BB 1VFBB 2DAVA 5ID1A 3P0YH 1QSEA 1YMMB 2R1YB 5HDQH 4TUOB 3SJVB 2IADB 1C9SA 3LEYL 3HC0A 2BHFA 5CZRA 4PN6A 1FZOB 5HI3D 4O2FA 3VG9C 4ZS7L 3QORA 1I1FA 2J55A 1OTTC 1YDPA 3CGTA 3UOAB 3EAKA 3QZMA 1JGUH 3IM1A 1VDGA 4EI6B 2D03H 5DZAA 1AD0B 3W2DH 1K6QL 1Q9LB 3T0AA 1H19A 5ALBH 3LH2H 1XCQB 5AL0A 4IRZH 5E1QA 1GJWA 1JYVA 1X5IA 5A2AA 1YEFH 4ZUTA 4U1KA 4HKZA 1QA9A 1JCVA 3JV4A 2AEPH 4MRCA 1BFOB 3ZKND 2I60H 4BXVA 1GGCL 1B0IA 4AVKA 3DUUB 1JF1A 3FQUB 5I0YA 5FYJH 1FCGA 5LXGH 4PGZA 2XXGA 1JWSA 4WI0A 3I02B 4KRNA 5BRZE 2CPUA 3E6HA 1J88A 3GM0A 4ZW6A 2VISA 2GSGA 3DX4A 4WWKA 4ALAH 4Z0BL 3SGJC 3SDYL 1HILA 2H3NA 1EHKB 4HP5A 4TOYL 2GTWB 3DSNA 4FYSA 4KK8D 4MAYC 4GP8B 2EH8L 4F8NA 3AU0A 2CNYA 2M26A 3BEWA 5K9OA 2L3BA 4AM0A 1RU9L 4N25A 1EQWA 3MJ6A 3NQKA 1MCLA 1MHHA 1DQQB 1TJHL 4AL8H 3X1NA 3K80A 1RZFL 2I27N 1OW0C 4YBQC 1CLYL 5LAPA 3S34H 5J12B 5GRZA 3BXNB 5BXFB 4H2AA 1BJ1H 2J25A 2VDRL 4FKEA 5L7XH 1PKOA 1XAKA 3FUDA 2E9IA 4B9KC 3CD4A 1ASPA 3PL6B 2J43A 3CHXA 4Y4FB 2GTZA 4RNRA 1Y6NR 2E9JA 2OP4L 3PP3K 4K55A 4ORGA 4Z3IA 1OB1B 1I1CA 1Z1WA 1IC5L 4WO0A 2VUYA 3O45B 1MELA 2YPLE 1G9NL 3L3OC 4PEEA 1EMTL 1F90L 1PQZA 2CRIA 2HRHA 4IRJC 4ZXBC 5GS0L 3LIZH 1MW0A 4L4VB 3M1CA 4N2OA 5HJ3A 4IBYA 4PGDA 2B4CL 5E6IB 1BD2A 1JZFA 3NN8B 3PAZA 1L9SA 1UZ6E 1XEUA 4GRLB 4PMFA 4D9RE 1UWEL 4YHOL 5TD4A 2GBAA 5I28A 1VZHA 3H3PH 4OJYA 5ESQB 2HVJA 2ZKMX 3W0WA 2NY1B 3GMNA 1Q38A 5CGTA 4LLUB 2GCYA 3DX2A 1AI1L 5CN2A 1OF0A 5I0DA 3QEQE 5LCVH 4JRLA 3GIZH 3D85B 3O11B 2KC0A 3TVMD 4AI7A 5I6KA 1KFAH 1QBAA 3LS5H 1OOAA 5ESAA 2YEZB 4YUEH 3LQAL 3VI3A 2IBZY 1EO5A 3PPEA 4G6ML 4KU1A 2NY2D 4P9ML 1TZIA 1U8KB 4NJAH 4W6YB 4TKWA 5ERWA 2KMWA 4KRPC 5ITBL 3K0WA 3KS0J 4GKSA 1BXXA 5EC2B 2XWEA 3QULB 4DP6X 1V7NH 4HCRL 2R56L 4NRYA 1Z66A 3VXMA 4YDJA 5DRZA 5AVUB 4GB9A 1FFNA 5DSCA 4AYFB 1AVAA 3JTBA 3CXDL 1TZ8A 2X4OA 4M43L 4I5BB 1SHWA 1T1ZA 4N9OB 3QUKB 4H1LH 3CVBA 1K5WA 5IVZB 1SUHA 3OC5A 3GRBA 1U3ZA 4XH2B 1TZGL 3RB5A 3QUMB 2R0KL 3A5VA 4OGXL 3IFNL 4TL4A 3OGOE 3L1OL 1T4KB 2KT6A 2P5WD 1ED3A 3VWKC 3LKPA 4XAKE 4LOVA 3GLDA 4Q6IC 4YPJA 3P0VH 2K3HA 1NM4A 5I1LB 4IDJH 1J48A 4HSQA 5ENWA 2E7LC 1MZZA 3SZ6A 2YQ3A 1HDMB 3IXAA 3LXCA 1M6OB 1RZIB 3Q48A 2FHBA 3LNHA 4MNHA 6PAZA 2EVHA 5DJ6A 1AQ8A 1RVFL 3W5NA 1LO5A 2EC9T 1GZHA 2NUPB 5D7JD 2ED8A 4MJ6A 4OIAA 3IFPB 4UQ2A 3L5WB 3FUEA 5GSRB 3V5DA 3MGAA 5ANHA 4TSAL 3MAWA 4MCNA 1SFDA 1UKSA 2P42B 4OZIF 3BLBA 2ZKXA 4EDXA 4ZFFB 2GABA 2OPCA 2A2QT 4HIHB 4M93C 1AQMA 2XJLA 5L8JB 3NABL 3RNQB 3T65A 3DK2A 3O3UN 4HUUB 5AD0A 3KVQA 3ZDXB 5MEPB 1EAJA 3CSPA 5EN2A 2X4RB 4FXGB 1JZ4A 4UQAA 1S9XA 1RZJL 1LO2L 1L5GA 4Z6AT 3UBXG 3LPPA 1BLNA 3QO1A 1MY7A 3D1MC 1J0IA 3TC9A 4YHYC 3QQ3B 3H4HA 3QG7H 3QT2A 1H9VA 3P77A 3I6GB 4LIQH 2X4NB 1LEKB 1T1WA 3IFOB 1C08B 1IIIA 2Y7SA 2BERA 5CAYB 3PHSA 2QGBA 3MOBH 1NANH 2W9EH 5EOCL 3QP3A 4ZMTA 5EC1B 3KH3A 3U0WL 1P1VA 4XMUA 5ABDE 1VCAA 3AG2B 4WFEE 1OKEA 4OCSL 1KY6A 3QHZH 4DKEL 3MRCA 2GT9A 1WWBX 4RAHA 3ASWA 3QNYA 5LGJB 4AEHL 4OT1L 3GMQB 4BGDA 1BXVA 1JHKL 3HZ3A 4F7CA 3ULVH 3TV8A 4FQXB 3C87A 5IT2L 1N4XH 4CMHC 2WYZA 35C8L 3FUMA 4KDVA 5MENB 3PU7A 1EZSA 1NCBL 3EJRA 2BNRD 3OKYA 4DAGL 3V9EA 4GQPH 4OJCA 1RJZB 5C07E 4YHLL 2BZ7A 2BP3A 3C5SB 1WF5A 3CDZA 4HGMA 2LW3A 2ZXCA 3R8BB 3RG1C 1XF1A 2OCJA 3UH8A 5AVTB 1DZ0A 1K4DA 4AEFA 2HT3D 5JXEC 5DJXA 3SE4A 5FYKD 1QBML 4OGQC 2Y5EA 5ISZE 5KS9F 3SDDC 1HEHC 1ZPUA 4M56A 3O3DA 3BP5B 1QLFB 2WB7A 3TYGH 5DO8A 4BSJA 3GSUB 3NZSA 1QPKA 4K94C 3LYRA 4ETQA 4PJIF 2XZCL 4U4BA 2CM6A 3BUIA 4JQIL 1JD9A 1CQYA 4FYRA 5KVEH 3OR6B 5EZOL 4BZ2A 1U3HC 2OTWA 4L05A 2PO6D 1HCFX 3LKNA 4J23A 4U7MA 1HZKA 5MI0C 1ZJAA 4M6NL 1OP5H 4TNWK 4X6FA 5C9KA 1UATA 3WN5B 2EADA 1AZZC 5CD5D 1T0NB 4K8RD 2ICWA 1YQ2A 3S5YA 2OSXA 4XNZB 2G5RA 3SGEI 4LBEB 2ENSA 1BZ8A 3GXIA 4TLKA 2IGFH 5TQ0H 3FFCA 2GC4C 4JCLA 3CLFL 1OSPH 3H2QA 1KMGA 3IWUA 5BOZG 3I3BA 3DPDA 4P23D 2I69A 4PRHD 1ZGLB 3H9HA 3HE6A 4P2RD 2O5XH 4DNLA 2A73B 1AIFB 1HQ4A 1KXVA 4UOJA 5BW7C 4MD4B 4P46D 3QWQB 5HDRA 5CILH 5HVWA 2ZCLL 1U3JA 3PNWA 3WNKA 2JXMB 4U1LB 5D93B 1BIIB 1HHGB 2F1BA 2HRGA 5FYKU 1KGCD 3EO1A 3F6LA 5I1KH 4EUPA 3P9WB 2KZWA 2DH2A 2GKIA 3ULUC 4S0HA 4B96A 4BFFA 1PD0A 3KM2A 1ESOA 1QBLL 2GIYA 3VE0A 1AXIB 2JB5H 1UVQB 4JPIB 4L37A 4X7CC 5AYUL 2WKLA 1P4IL 2HFFA 4XRCA 5ICXA 4R96B 2AK4A 3MCKA 5TPWH 2E7CA 5DDHA 2YXWA 2OMWA 1KN2H 3NH7L 1R3KA 4FQLL 4JRYE 4KTDH 4G7YH 4NQVB 2WMPB 4G6AD 4WJKB 5E2UL 5KYYB 1SDDA 2J5WA 5DD5L 4BA8A 5C2BL 1PDKA 3CZEA 1IAMA 1TIUA 3S8FB 1WZMA 1NCJA 2AJXH 2LVEA 5INCB 4KY2A 1T21A 4DCQB 3M86A 3LKOB 4Q52A 1J8HA 1DVUA 4S10A 4BK5A 2PTVA 1U42A 4IIQC 2QFRA 5DJZA 2FIRT 3DRTA 4OIBA 2MCPL 2JCCA 3GB7B 1K3ZA 4QKXB 2OR9H 4N1EA 3FB8B 3QDGE 2Z35A 2A4CA 5IR1A 1MJUH 3FQ1A 3D2UA 4FZEH 4OW6A 3TFKC 2YPVL 2A9NL 3RUGA 1C8QA 1A66A 5A6IA 3LRSA 3TVMB 4DWHA 3P4NA 4C4BA 4JFDE 1IZJA 4D3CH 4JFYB 4QWWD 4TUKH 2OZ4L 5B4MD 3WLBB 1JSYA 2EVGA 3F83A 2NY2B 1DQTA 2CDFB 1JG9A 2V3EA 1UTDA 4FLOA 4ZRGA 2YXMA 1UXLA 5CIPB 3UAAA 3X11B 5JNYB 4LHQB 1P7QA 2WQXA 4M1CC 3MRGA 2D7PA 2MTAA 2X1XR 3UEQA 1PJWA 3CDFA 2VR9A 5BJTA 1JL8A 3QIUD 1J8KA 1GYUA 3LRHA 1HS6A 4OZFG 1WC7A 5GZNA 3EGXA 4LL4A 1VKXA 4GEIA 5JDSA 4BWTA 4QHUA 2R1XA 4X7DC 1JERA 2Q5BA 2Y2WA 3VYPA 3WV0A 5DI8A 5EU3A 1G6RL 1IAII 1MVUA 2OJ1A 1LP9F 4RISH 3MGOB 3O9WA 4QXUL 3UYOD 3VA6A 2F54D 4URTB 4GO8A 3NCJL 3RPIB 1ZTXH 2O72A 4XB7A 3CVHH 5DHVH 5FB8B 4RQQB 4NO2A 1JDCA 4ZAKD 5JIQA 2E7DA 3NK3A 2XCMC 3PV6A 3R1GH 4YHML 4IMLA 4LPYA 4LEEA 4RMRA 4QRQA 4UBDD 1TVHA 1IQWH 1NCWH 3L7FB 4AVHA 3O8XD 4RIRB 3N04A 4WNJA 4UTAL 4JO4H 4ODBD 3HI6H 4HHAA 4I85A 1TTFA 4KROD 2VLKD 1RPKA 1LD9A 1OO2A 2V7HA 3C6LD 4JHBA 1LEIB 1QSFE 4O2EA 5C0IA 2G2RA 1ZT7B 1ADWA 3TOPA 3DRQA 1KTLA 2DJMA 5I82A 1HNGA 4LSRH 5FS5A 3NACL 3NJNA 4IRSC 3VFOB 4W9GC 2Q8AL 4DO5A 5L2KA 1SN5A 1KIUA 2IJ0C 3OWEA 1DQVA 1R46A 5C0FA 1BAFH 2OR7A 3VGGA 5D7EA 5IFJA 5KVGE 1S4IA 3TZVA 3F58L 4JDEB 1T2QH 1CD1A 4BBWA 5JIKA 1YY8B 5IMOB 3B7YA 4WKZB 2Y5TB 3U6RA 1UASA 4RWYH 2VN3A 2QFPA 1V5JA 3SZKC 4PIBA 1KY7A 2F58H 4AGMA 1JXFA 4XCNB 3TYFB 3VD5A 4A63A 1ZCRA 3VFNA 3C5ZC 2ICEB 1ULVA 5TF0A 3AXIA 3EJTA 4X6EA 1HHHB 2WJ7A 3B56A 1I7UB 5CMAB 4OV6F 2DWDB 3MRNB 3EYSH 4WWKD 1MFVA 4K94L 4H0IA 5FO7B 3PWPD 4OU3A 2HFGL 1IC7L 2VLME 4HJJL 1KB9J 4ZSOB 1CR9H 2BNUA 3AS2A 3AQDA 5F71A 2K8MA 4N0FA 3WYRA 5CJ8A 4Q97A 5GS0D 4MA7H 1KLFB 4X9GA 2BSRA 4W81A 3OAYH 4NQEE 3L9RB 4JFHE 1OCCB 3SE3A 3IDYB 3K8LA 1MUJB 1YPZE 2FJUB 4DFIA 3I2CH 1I82A 1MI5A 3PDOB 3KHQA 4PD4J 3N41F 4RFNB 3IVKB 1EANA 3C6SA 5DD0H 5LGKA 4AZ8A 4KKLC 1AR1C 4DF9A 5F7BA 5T3ZE 1XFPA 3N42F 1RZ7L 4HA1A 2PWGA 4XPFH 1IGIH 2DRUA 5CWSA 1NAKL 2GY5A 1G7QA 2PO6B 3O2VH 4PJFA 3LKRA 2UX6A 3JWNH 1U8JA 4KDTA 1YA5A 1OWWA 3B1TA 2FJGB 3HRZB 4L1HA 3CXHK 1DUZA 2DI9A 5IMLB 5EG6C 4RGOL 2B9AA 1CMOA 3CZJA 4GNKB 1ZK9A 4EZJA 5TDNB 3ULUL 1T89A 4G42B 1MQKL 3PAUA 1ZGLM 1JDAA 1Q0XL 5CHNB 3ABGA 4WSGA 4NCDA 5D5MF 1R6VA 3W0WD 4M1GH 4JM2F 4EI5A 3ZMRA 4P2RB 1HOCB 1MJJB 1KXHA 1AKPA 4P46B 3DUUA 2FBRA 3GLZA 3SBQA 4AW7A 1UWGL 3F64A 1X7QB 4EDWH 4CAGA 2G9HA 3VXTA 1AFVL 4YHZH 4AOFA 1UWXH 4RCAA 3T04D 3X14A 3MR9B 1CVRA 2HT2D 1ZA6B 1RV6X 3WSQL 3PREA 2IXQA 4N2DA 2E6JA 1RMFL 3GEWB 2Y0SA 3AY4C 3IPFA 1BZ7A 4CVUA 1P4LB 2YD6A 3VXMD 1U8PB 1DQQA 2HVBA 4C8XA 3KPRA 1ERNA 2BVYA 3N1MC 5IQLA 4KKAC 1NOLA 1L3NA 2VXTL 2YBRB 5LWYH 2ZE0A 4WF7A 1N3NA 4XO3A 3S36X 2VW4A 2Y7MA 3BC9A 3FN3A 5AQ0A 1FV1B 2LLGA 1E9OB 2VXUL 2J72A 1AZBA 1ZANL 4J8RA 4PV9B 1FLRL 2WCPA 4HJTA 2G4EA 4JZJA 3GRWA 4QOKE 4OJEH 5TE4H 4WI2A 4FL4B 4ISVB 3H1ZA 3PIQB 3P3RA 1ACYL 2NR6A 3VXSD 3QIBA 1RZ8B 1T5XB 4C57C 3FN0H 3FQXB 1QYGL 5C0GA 3VCLA 4YE4H 5JPNB 4PJBE 5GQBA 2GYSA 3NP4A 3UTZB 4LSQH 1CFTB 1JNNH 4M7LL 1Q90A 3KMDA 5I1IL 1CICA 3FO2B 4R6UA 4KKZA 3THMH 1NANI 4FE9A 3LKSB 5FUOL 1URLA 1A9BA 5CS7A 1WGVA 4L3EB 5GIRA 3P2TA 2HWZL 3QIUB 4LF3A 3MRJA 5E2TL 3CPLB 3QPKA 2Z1KA 2AMGA 2CK2A 3U4EB 4AE1A 1NICA 2H6PA 4AQEA 2W07A 2ZX8A 3T4AC 4BK8A 1WFMA 4QRSB 3KYKL 3GBLA 3TASA 4X9IA 2BP8B 4OF3A 4MTMA 4QRRE 1DLFH 4W4OA 2GI7A 5HYSG 3N44F 4EF3A 1OANA 5FR3A 5LNDA 3RU8L 3IJSB 4RX4A 2V9UA 3QAZB 1TVBB 4TL5A 3VH8B 3SD2A 3VFPA 4ZAKB 5FDYA 2QKIC 4GSDL 4HLJA 4AYFA 1KJVB 2GAZA 3DPBB 3F3HA 1BBDL 3F5WA 3NAAL 3QUKA 4MS8C 3WY2A 4YAQB 4ATWA 1RL1A 2J2ZA 3VD7A 3O8XB 3S5LG 3QUMA 3FN9A 5L8LB 4PRID 5I73B 5DFVD 5DVPA 3NIDF 4KROB 2VLKB 4Z18A 3LNGA 4PJBF 2ED9A 1R5WB 2WLIA 1L9QA 5ALCH 5CCKL 1XTMA 1QX1A 2NCMA 2KLTA 3HKFA 3MBEC 5EH1A 2P8MB 4XP4L 2Z8RA 1YLBB 4JKWA 5LBGA 4BFEA 1D5ZB 1M1XB 1W15A 3L4CA 2W0FB 3FB5B 5DD3H 3HPLB 4TSBH 1M6OA 4HS6B 3SDCC 1RZIA 3ARFA 4PJ7E 2BDNH 4P2QA 1MAKA 5DURD 1DVFD 3GZOA 3QIWA 3FYIB 3IFPA 4MJIA 1DQMH 5DJ0B 5DJYB 3KLHD 4MDJA 2DB8A 4IBVA 3ISWA 2W59A 3QJOA 3WGUB 1M6UA 4DVBA 4PJ5A 2UUDH 4K2UL 4JM4H 4NNPL 4OCYH 2P48B 2W0LA 3ZDZE 1KV7A 2VH5H 5BS0A 2JKTM 2Y06L 4UINH 2PYEA 3BPOB 1C5BL 4JL2A 5MEPA 3HC4H 2ORBH 1KT2B 3GJEA 1OPOA 3NFSL 4R5VA 2BP0A 4BE6A 4A2MA 1TEFA 1FVDB 1KBGL 2JWYA 2OYMA 3FFCD 2Y4SA 1OV8A 3B3IA 1IE5A 3PWPB 2GJZA 4HLZH 2DQMA 1W2KT 3ZL1A 4APXB 2X4NA 1CFQA 4Y89A 3OBAA 3K6SB 2ZCZA 4KKCD 1R5IB 1JV5B 1SXBA 2MEJB 5KN5B 3AXHA 2P5EE 5EC1A 1MQ8A 3IDIA 3NSDA 3QI9C 3HMXA 2BNQD 5G4MA 1TVDA 2KBGA 1D7CA 2AV1B 1DJGA 3FOMB 1FYTE 4N3TA 4DW2L 3RFZC 3SY0B 4LCWD 1OTSC 3T0EB 3MV9E 2AVGA 2RD0A 4J3SA 4PRAB 1DHKA 1XXFC 1IGCH 4W9LC 3D25A 2FVNA 4PCTA 4PJ7F 1XH3B 1UJ3A 4NBXB 5KSAA 3BUQA 3MHZA 4O02L 2VN6A 3HE7C 1T03L 4KQ4L 5FM8A 1R0AH 4PJHE 3HJ0A 4GO6B 3DOIA 5I24A 2EVFA 4MVBD 2AMUA 1CTNA 3E3QC 3HJEA 4LHUG 3L1EA 3MX0B 4CSSA 2E0PA 3V5HA 1F6FB 4K7PY 1QFWH 5F7DB 3ZDZF 4HPYH 4FG4A 5JOPE 5KSBE 5D6CB 3V0WL 3QXAB 5JR1L 1DQDH 2KQMA 5B38A 1QRNA 1UFGA 1SXNA 4MX7B 2UYLA 4NOFA 4ACPA 1OLLA 3LH9A 2EIZB 2V7NA 5I8KL 3A4FA 1I7TA 3FTYA 3HS0C 1UYWH 4QYOB 2NTFA 1RUQH 4N5UA 3V6ZA 3ZE0E 3WFDH 2VL4A 5FDWB 5EU4B 2WIIB 4N0UE 3ZR5A 2AGJH 3JSSA 3JV5A 1EAOA 4DKFL 5L6YH 5LGHH 2HH0L 1AGCA 3NGBB 4ZUWA 1WQVT 3X12A 5CSGA 3VTTA 5ABAA 5I1CH 4NC0B 4J27A 5D7LA 2HTKD 2O61B 3DVGB 5IHWA 2ZOLB 3HG1E 1DSFH 1LYQA 1XGZA 3QNXA 4X8JB 5GISL 5CD3B 1QTYT 3MZTA 2C26A 3MNVA 3T8MA 3W9EA 4FMKA 4GBXC 3TBYA 5AW6B 4Z5RB 4S0SD 1P7QD 2UZPA 4WU5B 1ICTA 2VSCA 4WHYH 3FH5A 5HYFA 4H88L 2QBWA 3QHFH 4XX1G 3VGEA 3NG5A 4HLEA 4PJHF 3F7LA 1JHLH 4UIMA 5DLML 1A8ZA 1XH1A 1OGAA 1ZSHA 4X4ME 5ECJE 5EMYA 4KXZH 3T2OA 4MA1C 3O6FA 1MIMH 4P2CG 6TAAA 4X5PA 3UBFA 1FAIL 4NZRH 2H2PD 1ND0A 4GS7C 2DTMH 5KSBF 3U36A 5AZUA 2WTPA 2K0RA 2A74B 3O6ML 3NZUA 1CDGA 4PW3A 3C75A 4A67A 3L48A 1H3WM 3OTTA 5C0EA 1YQVL 3S36H 2P52A 4P5KB 5HHXL 2DQUL 1JAEA 4PUBH 3IJHA 1IBFA 4J3OH 3VXSB 2H45A 3K72B 3MACL 4G70B 4M3JA 4MMYB 3ZE0F 3GFUA 4P4RB 2OR8A 1B4JL 5CEZE 5IOKA 5HGBB 3S88H 2LAAA 4MQTB 1A1MA 3OGCA 4B50A 4JHUA 2O5ZL 1LHZA 5H2BB 3GSQA 3FTGB 1MWAL 4N85A 1E5BA 1KN4H 1NJ9A 2QQLL 3P4MA 3OF6D 4JG0H 3HC3H 4Y4KC 3RNKA 3VG9B 3ZE2F 2P26A 2KYIA 3EYOA 1J12A 2F7IA 2VXQA 3L3JB 3IDXL 4EUPH 1GS7A 1YG9A 3QWRA 4XO9A 2DQFB 4E5XA 3FB8A 1U8MB 4L5FH 1ZLVH 2PCPA 5DUPL 2D0HA 5IB1B 4IOFD 3KW8A 5E00A 4PTUA 4XWGL 3D06A 4ES8A 4JFYA 1U3HD 3LXAA 2XTLA 2FX8L 4NYLB 3WLBA 2CAKA 3UCRA 1FJ1A 2EDXA 4OQTH 4ZMLA 3X11A 1K5NB 2QR0B 3ZO0A 3P3UA 3HLAA 2VL5A 1EERB 2WW8A 3DYMA 4FFVD 4MCMA 4OCXH 3REVB 5FC9A 5D1XA 3S3PA 5I30H 4KMTH 4YDKL 1U58A 2WWKO 1ILSA 2GC7C 4Q2ZA 2QLVB 3TS8A 2X2IA 4P2OC 3RA7H 1ZIBA 4ZI8A 1CO1A 4PRIB 5MEOA 3IDMA 2CDEA 1MCFA 5KVDL 1EPFA 3MGOA 5TE7L 4DGIH 1IM3B 3MUY1 4GMTL 2JF1A 1Z2KA 4LNVA 4Q4EA 2X4TB 3MRMB 3P4OB 4K7PX 1SY6A 4KH2A 1ACCA 1XB8A 15C8H 4JR9L 1BYOA 5A7EA 3L95B 1AE6H 1GMIA 3G6JE 4OCWL 5L8KB 3MVSA 5KSVA 1QW9A 2C7FA 2F74B 4RIRA 4BH7A 1SZNA 4FQ1L 4HKJA 4EN3D 4GW4B 1OM3H 2QQKH 1DVFB 2V17H 2NUTB 1OCWL 1C5DB 3P9LB 1AZUA 1FNGA 1MJ8L 1LEIA 1GIGH 3L9YA 1IFGA 3P11H 1ZT7A 3QBTB 4Z3FA 1NSNL 3L3OB 4ZMAT 2WOBA 1RULL 1DBKH 4CGTA 4W4NA 3IGFA 1Y1DA 4IRJB 3LX9A 4FG0A 4NRXB 5EPMA 4JJ5B 1KGXA 1P4BL 2D31A 1N70A 4XVSL 3OLEA 4RLDA 2XZAH 1XGRB 4PR5B 2JMRA 4TNFA 3T4YA 2RA1A 1CK0L 1FQ9C 2W88A 4FTVE 1MFDH 2MQGA 3OX8B 3AS3A 4G1EB 3EUDA 3RWIB 5KG9A 4CILA 4Z3GA 2J6WA 1I3RA 4M48L 3ZHKA 1YY8A 4A7GF 1TQWA 1TNMA 4U05A 4HULB 1TTAA 2DYRB 3OHXA 5GHWH 3B8SA 4M8RA 2B1HL 3X13A 5DJ2A 4BGLA 2XWXA 4HMEA 3UC2A 3VXQB 1NC2A 4N90D 4JGJA 3P0GB 2C3GA 2EDWA 3DDGA 1MWOA 4XCNA 3R4RA 1Z9SB 1Y18A 3BKMH 1HL8A 1WZLA 2QDWA 3TA3D 2F7OA 3GMLA 3VAEA 1HHHA 2W65A 2IAND 2B2XH 3SPCA 4C4KT 3A21A 2A83B 5GPRA 3G6JF 4LCWB 2HUEA 3R18A 3EOTL 3UBGA 3HZVB 4JFVA 1HCZA 4TNVK 3WIHH 3TF7C 1QI4A 3JTTB 4ZSOA 2EO7A 4XMLL 5IQ7L 1SLXA 1KC5H 1XGYL 1W0WA 3TT1L 4Z3TA 4DKAA 3KPRD 1F58H 4IOIB 5KYUA 3MLUH 4JKPH 4HWEL 2CMRL 1J1PL 4W1TA 3D12B 3DJRA 3Q43A 1G7LB 4LMQE 1GOGA 2OTUA 4Q6IB 5DTFB 5IJKC 1JDDA 1KXQE 1E5UI 1GGBL 5F1OB 4FN0A 4DPAX 4AEIL 2XOTA 2VM3A 2ZXGA 3N1GC 5CJXA 3SE8L 2VLRD 4MJ5A 3T77A 3MLXH 3ZZQA 3CCHB 1K4CB 2QTEA 3UTTD 4GG8A 3V9CA 1CLOL 1S5IL 4AENA 1O6TA 5IESH 3G5YB 5HHQB 5JW4R 2BOBB 4HD9A 4MKTA 3VFGL 1G6RB 1GGIL 3FC8A 2PWFA 4C56E 3QJFA 4FQQB 3F7VB 2B1AH 5KSUB 3LEVH 2B8OT 4AG4H 2VDML 3NTCH 3SDXA 3ILPA 3TP4A 1IGTA 4KHTL 1EFQA 5C9JB 2H1PH 4M02A 2H8PB 2H32A 3HFML 3V0HA 2YC1A 3BEVB 3DXAE 2EDQA 4R4BA 3ZDYE 1G7JB 5C0CE 1B0RB 5BOJA 2K6YA 1RZQA 3CN2A 3F62A 5IEKA 2NXYC 3BWAA 1NIAA 3GLAA 4RAVA 3RWGA 4KJQD 4BKTC 2UY6A 3AMKA 3Q2CA 1UHVA 1OAJA 4IKNA 2CJUL 1FPTL 2EAEA 4LEBA 3W39B 1JGLL 3Q9QA 1ZV9A 4N20A 1BGXL 4PJ9C 3BDYL 3BPCB 5IHZB 4CL7A 3RKDC 1MSPA 4PJAE 2DQGH 2OL3L 3LS4H 2FK9A 5F7FA 1BMZA 4RX4D 5E8NB 1HKLL 2X4SB 3Q5TA 1EFXD 4D8PA 5K5YA 3QPXL 1XGPB 3M1BB 3TF4A 4JO2L 4GRWE 1IAKB 4HAKA 3DO3A 4CMHB 2KDGA 5BNXD 1A3RL 3VX0A 1JHTA 2DIJA 3OKEB 3BQVA 1F6AB 4MBOA 4R84A 1XL4A 5IF0A 3VXRE 3ZJAA 3H6JA 3JXAA 2H2SC 3OD3A 3F6JA 2XWJB 4N8VG 4U1IA 3T8VA 5IBLD 5D55A 3EOBB 5TDOA 1RI8A 4NUGH 4XPHH 2RTTA 4AQ1A 4OH2A 2J56A 1EHXA 1VEPA 2XNAA 2YPLA 5J4MA 3ISRA 2WBJA 3LVTA 5AVYB 3DO7A 3TBVB 2VAJA 2H41A 1XF4A 4M7JH 5I2IB 4DPRA 3DGDA 4PYHA 1S7WB 4CVZA 4QRPE 1ASOA 1F11A 1IB5A 3QZWG 5E24E 1V3KA 4KKLD 4CN6A 4Z23A 1KENL 4XXWC 4AYMC 2CGRH 4MA8L 2X4QA 1U3HB 3CSYA 1CFNB 2X87A 2E8ZA 2B14A 2N0KA 3AY2A 4XNMA 5MI0B 1IRAY 4MD0B 1HEZB 1IGYB 4J3VA 3LKSA 4P59L 2KZKA 2H9GB 1KZQA 3L7EA 5GJTL 3VFUA 1S9VA 4GO9A 3WO4C 3OKKB 4L3EA 5DMYA 1OZUA 2R23B 2WLJA 2Y69B 4GSRA 4PJAF 1NMAH 5MERA 4KITB 1RJLB 3GRWH 3QJHB 1BVOA 3TWCH 5E6ZA 3KYNA 5E99H 5D1QE 4OV5B 4E9WA 4OZIA 1TCRA 5C09D 4ODUA 3G04A 2VZUA 5D7IB 4E41E 1BF5A 1RKRA 3EGSA 4PRNB 2JKWA 4X5LA 4GRWF 4X7SH 4JUSA 2N56A 1GPOL 3QUYC 1W9XA 4MDRA 4AJVA 4BFKA 1Q94B 1QACA 4LLQB 1J1XL 1ZTMA 1ZHNB 3IJSA 4EJ1C 2RR3A 3S6CA 5GRYA 3L2NA 5DWUH 4PTTB 3RVUC 2EP6A 3DO4A 2EECA 2MTPA 4KY1H 1QFWI 1D2PA 1FORL 3K91A 3QXVA 2NY6D 2ZCHL 4HOXA 4TVPH 4N0CC 4OY9A 5LBSL 4K7PH 1IGML 4U6YB 4RGMB 1TFHA 1KIPB 2XY2A 2E5EA 3NRQA 4Z7UE 4FABH 3N9GL 4ZFOA 1C5CH 1R5WA 5FGBA 2W1NA 2XQYG 4OZ4A 3WEXB 2ED6A 3H9SD 1KNOA 3ARGA 1JPEA 1DQLL 5I1AB 5IM7B 5KVFE 2ZSVA 4HXBL 4HEPA 1AGDB 3QWOA 5DHEA 2D4DA 3IDNB 1MCNA 1SOSA 4XAWH 4YHNB 4L8SA 4DKDC 5HDBB 1X9RA 5EFIB 3R0NA 4IIQB 4PJDB 4WFGE 5L88H 4MQ7B 1JFHA 1B4RA 4JAMB 1GW6A 3DX7A 4JPVL 4MZRA 4HUWB 3VUAA 3VVVA 5CBEB 1DDHA 4H7VA 2DDQL 2V8LA 5GS2H 4YHIB 1MIEL 3QUMH 2EUZA 2G75A 3QDMD 4WFFE 1E4KA 2R69L 1HIMH 2P24B 3X3FH 2Z4TA 4ODHL 1O5DT 5KS9A 4PLJD 2HKAA 3WNOA 5KZCD 4J3BA 3SQBA 5TH2A 2EXYC 3FT4A 2FQDA 1IEHA 2F2HA 2R83A 3EFOB 2Y6SD 5CZVL 3BVWA 4MNQB 4PJIA 5D4IA 3UBXB 1P5VB 5EEXA 1VB9A 3OG6B 5D8JL 2IANB 5J7CC 5BUAA 2BC4A 2IDFA 1BJ1J 2ICWI 2DQEL 3R06B 4M6ML 1N9PA 4APXA 5A3ID 1NL0L 5DO2C 3E8UL 2EDLA 3DOHA 2WQVA 1KPUB 4NZFA 2RMNA 1NFKA 1D5RA 1DVTA 1R5IA 4OM0L 4Z7UF 2WXNA 3ZKSD 4FQJH 5KN5A 2PCXA 1W6LA 3LZPA 3P9MB 1EHAA 4OUUA 3VFRA 1TTRA 2OX5B 1I1AC 4XNXL 3WEBA 2OMZA 3ZR6A 4O9HL 1YEHH 3GI9L 3CQPA 3G6DL 1FVCA 2G60L 3FOMA 3MV7D 2ZG3A 1OGAD 2GJRA 4GKNB 4HETA 3RZCC 1A9EB 2HRPH 3T0EA 3O6FD 1KWGA 3N91A 5ILTL 1X5FA 1XD0A 4U6VH 1KB9K 5B22A 4I0PC 1LK3L 4GLRI 3UP1A 3PHQB 4ADJA 1DBML 4WWID 4BELD 3BP6A 1I7RA 1KBBA 1KCRL 4QTIH 1E3XA 1EAQA 4Y2OA 5D9SB 2CBQA 3BIKB 3VXOA 2UVEA 3UTTB 5DWPA 1ZLUK 4ONFH 2HLFD 3HFFA 1P6FA 2NY4D 3QS3A 3I3DA 4PRDB 3S3SA 1WIUA 3MBED 3MNMA 4PD4K 4DOHB 1UGKA 2HPOA 2EDOA 4MX7A 4TMPA 2YAHA 1G1CA 3NCMA 5FK9A 3MROA 2DICA 4IRSB 1MEXH 1ZLDA 1NWOA 5LKNA 4FFYH 4HCRA 4JREB 1GC1C 3QH3B 1UM5H 3NDYE 2CO6B 1NBZA 1HESA 3M7FB 2CRZA 4X6BA 4PCKA 1DBBH 1F02I 1AGBB 2VC2L 2VQ1B 3RTQC 1Q9KB 1WZ1L 3IU4H 3ATDA 1T3FB 1PZBA 2J1KA 2FTAA 1UWXK 5DD1L 4MDIB 1ODAA 4FXKA 2W92A 4Y5YB 2ZOLA 3Q1EA 4MQXD 5I0VA 2BFVH 4UWQB 4ZTPL 1FBIH 1GW0A 2H0EA 3C5ZB 1Z0MA 2XWBB 3GLEA 1HYSC 4Z5RA 4QTFA 3QEHA 4XP9H 5T3XH 1G9MH 4C83B 4YHMH 1MAMH 3CQQA 3LB6C 3AM8A 4M8QB 3N0AA 1EFXB 3CN3A 3MRLA 5FKPB 2Z4QA 4CC4A 2BS71 5D1XD 4RMQA 3F7QA 4YSPA 5SWSE 4XP6H 1F42A 2MKLC 3MFFB 5ALBL 2D3VA 3UMTA 3TO2A 2PXYC 4X2UA 2KL6A 2VLLB 3TO4A 1P2CB 5E8DH 1PYWB 4LT7A 1I3VA 3GS0A 4JHAH 1LO0H 2RCSH 4PS4H 4IBQA 4ABQA 2AXGB 4AJ0A 1OEZW 1SN0A 1I8LA 2I60L 5E5RB 5HYJA 4IBLT 1UA6H 2XI9A 4Z9KB 5IQMA 3NFNB 4DT2A 1JVLA 4F27A 4JRYA 1IFHH 2VMJA 1LP9A 1OM9A 3BVXA 2Y07H 4PGCA 2VXVH 3WD5L 3NFPB 4P9HC 3FT2A 1QABA 1F2XK 5L9DL 1AR1B 5E6UB 3PQYE 2EIDA 2I26N 3QS2A 1MFEL 4XMKL 1NGYA 1QSZA 3D34A 4N87A 1M71A 4WI4A 3SBWC 3BZEA 5JYMA 2SEBA 2CRYA 3GXDA 1BVKB 4J3TA 4QCIA 2VABA 3RY4A 1W8EA 1U6AH 3QZBA 4CNIB 1E27B 1JUFB 2DJSA 4BZYA 4OLWH 4C47A 5HD8C 2KLSA 2OJZH 3FO9A 3FH7A 3ISYA 5EU6D 3NSFA 4X6CA 4GQZA 2Y22A 5C09B 5CBAB 4RRPG 2CKBA 3X3GH 2AJUL 2E59A 5E2WL 1F4WH 2JJSC 3IJ8A 4O02B 1NINA 2ZX7A 4CKVX 1QR1A 4RMBA 2E6QA 1VGEL 3N40F 1FN4B 1G1KA 5DRWB 3FMGH 3OKLB 2QHLA 4XBGA 4Z76B 3MRPA 1L4IA 4OZFB 2EC8A 3KVDD 2KPWA 3KPNA 4BRVA 2WO2B 1P7HL 3MGTB 3RDTC 2VXQH 1QLEL 2ZG1A 3GJFA 3IDUA 3JT2A 2NY6B 1FC1A 3POCA 1UKTA 4MAYA 5SX4H 3AC0A 3MJ9L 5JHDD 2BWQA 3ES6A 2CK0H 3O6KH 1CT8B 2WQSA 1RK1B 4JRXE 3IRZA 3HBPA 4E9SA 4W9IC 1IM3A 5I16A 2KZ1B 2G2NA 4D7PA 5F1NA 4ELME 3J8F7 3H9SB 1OW0A 4L4TD 1JTTA 4YHKH 4KV5E 4G8GA 3H4FA 1SJXA 3GI8H 4WEBL 5I8CB 1KFAL 5CIPH 3RAJH 4WUUE 4YUEL 3ARBA 3CJJA 3MRBA 4XP1H 1UKQA 4PY8I 2C7UA 4R7NA 4EO5A 1QWHA 3IN0A 4D94A 7FABH 3LHPL 2J4WL 5K1JA 3OKDA 3HA0A 3U9PL 3IFLL 3L3OA 2RB8A 1V7NL 2DQIL 1HINL 3QDMB 5DT1H 1KIRB 4ZXBA 4R7LA 5FA4A 2FIKB 3V9FA 1TLMA 1E4XL 4Z77B 4CADB 4H8UA 4JHWH 3QZPA 1DBAL 3LQZA 2JSFA 3GMOB 3C60C 3MMEB 3BT2H 1N19A 1J9SA 4LASH 1KPRB 5DZVA 1JYNA 2NY0D 4TQEL 3X1GA 3ZVVA 3P0VL 1T80A 4ONGL 4ZW5A 1PKQE 4X83A 2YQGA 4F5CA 3FTVA 3LHAA 4F80A 4R7DA 4TUJB 3CSBA 3VJ6A 5FYJE 4AGOA 3T4AB 3FFDA 4I9XA 5E9NA 3DUSA 3RP1A 4ELMF 1J05B 2Q3ZA 2WQWA 3SSGA 5BRZD 4OB5H 1VGKB 2XVGA 3D05A 1HNYA 5D5MA 3MV7B 2OMYB 1DE4B 5DJAB 4ZO6A 4JM2A 2WWMD 3CMOL 1S9YA 4U3SB 3GGWA 1I85C 3HZVA 3N40P 4AK2A 4DP9X 2X89A 4Z95H 1GC1L 1T1XB 3ROOA 4YBHA 5H35B 2VR3A 2ADIB 1R5VA 3MV11 1DFBH 1FNSH 2AFNA 2H5UA 2C4FU 2ZXWB 1C7SA 4KK6C 2AK1L 5FFOA 2Z92B 2BY1A 3CZFB 1U8QB 3EJSA 4UB0H 3T8XB 3PV7A 3I9IA 2NY4B 1S7TA 3VWKA 2LGNA 1LO4L 3CBJB 5ICYA 5T5FL 3ECBB 4Q6IA 3CHSA 2Z91A 3MBEB 4JPQA 2XKNA 2X42A 1HHJA 4LCCC 3WFCH 2E7LA 4NWTL 4M62H 4O51B 1CPUA 1CI3M 3BVVA 1TZOA 4LHUD 1J1OL 1PL3A 5DZ9A 4JB9L 4J5VA 1G43A 3MA9H 1OP9A 2YPLD 1V54B 1A3LL 2WQUA 4FNPA 1L9PA 3GYRA 3QQ9D 1X5MA 2W0PA 5J89A 2J7LA 2WP3O 4IBSA 2IAMC 4MCYA 4S0TD 4I1NB 2R29A 2CO7A 4LLDB 4W9DC 5HHQA 3H9YA 2BOBA 4HK3J 4KO6A 1YEKL 4DESA 1AY1L 3NIGE 4LARL 2V9QA 1XF2B 5SWQB 4XCEA 4OSUL 3WG7B 4UILH 4D9RD 4JS7A 3QXWA 1BVNP 5FYKH 3WY3A 4LCYA 3Q8FA 1S9WA 2DH3A 2WLLA 4XCFL 3UPAA 5CEXA 1I9RH 2KZBA 3QEQD 3SD5A 2FAUA 4UTAA 1KGJA 4P9HL 1M56B 4I2XB 1O0VA 3TBTB 1S7SA 2BX5A 1BP3B 2C9XA 4F3FB 2V2WA 1N59B 3WO3B 1NGWB 1AMYA 3NJJA 2EDRA 2VITA 4PP1C 4GXFA 3R4DA 4HS8L 3QC6X 3PUUA 3QI9B 1AZRA 4ELDA 3P2DA 3UJJH 1FL3B 7TAAA 3TV3L 1Q1JL 2FH8A 4PJXB 1YYML 1TPXC 3TIDA 5HSFA 4JFEE 4R8WH 1SJMA 2NZ9C 5DHYA 4FQHB 5ICZA 5D72H 3GSNL 1FA4A 1USQA 5HI4C 4QHLB 1K9TA 5IQ9A 3VFMA 2V33A 4F24A 1NEUA 5IOPB 2WB1A 3KPOB 1BDYA 3NIGF 1FL6A 5IROC 2QL1A 1MRFL 4WUKL 3Q6FA 3ARGD 4K3JL 4L8DA 5C08B 3VDBA 4NXKA 2DQCL 3NOIA 1KJMB 1J9RA 4R3SA 1G7MB 3GTTA 3SDDA 4NO3B 3WNLA 2FLRT 1AYRA 3T1WA 5AFAA 5I9QC 4HJGA 5EU6B 1LXMA 1VIWA 1D5XA 1M57B 4JVUA 1T6WA 1VACB 2YFOA 2XVKA 3FOLB 3HS0B 2YKLL 1QHPA 3SE6A 3V4VL 5KWYC 2J73A 2JB5L 2Z31C 4C54A 4PLKC 4Z1PA 1JPST 1W72A 4IMKC 3W57A 4GG6B 5B3JE 3HNSL 1BX2B 5IVXE 4S1RL 1IBZA 3UTSE 4CSPA 1UWFA 2EE3A 4UU9B 4D9LH 1SNRA 2L8AA 4G7YL 1YEGH 4HXAL 5J9PB 2R23A 2A77L 5IGXL 1RJLA 1ZSDB 4D0DB 1U2YA 2WZ5A 2ZXBA 3VSUA 4AMKL 4ZX6A 4KMQA 4LLVB 4LRIA 5DVKA 2EYRA 3DX9B 3AS0A 2WXFA 4LIQE 5AW1B 5E2VL 4Z7WE 1JFQL 2FJSA 3CSGA 5HYSB 1NC4B 3V6FB 1D9KC 3BDXA 3LZNA 5JHDB 3DVNA 1Q72H 1KTCA 2BH0A 3VD1A 5CSZB 2V2XB 4LCUA 1PD1A 2CLRB 2OTPA 4OZGE 4MMZC 3HMWL 2ERJB 1A7OL 3GK8H 4FLSA 1QFUL 4MA3B 3CFBB 4JQVC 3UTQA 4L4TB 4ZMPA 5LAXB 5FYLE 4H4NA 5IIEB 1IBGH 4MA1B 3EYUH 1WHPA 4WFED 4LSTL 1JMXA 3S5LB 5IREA 4TPRH 2EIEA 3EF4A 2DWXA 2QLYA 4FQ2H 3RKDD 4N9GB 5ETUA 4GS7B 1N6UA 2VDMB 2UXFA 2ZP0T 1CFVL 1JJUA 3X1BA 4B9JA 2B7DT 3QFJA 5IV2B 1E28B 4XCCL 3VGDA 2GK0A 2VQ4A 1ADQL 5C07D 2BMKA 4B9YA 4AKPA 3B9VA 2OQJA 1R3LB 5I1AA 5IM7A 3LEYH 4K5OA 4B7LA 1MW1A 3CFKB 5B3JF 3HG2A 4JVPA 1F4XL 1N8ZB 2Y36L 3K4DA 5DQJB 2JQZA 5IVXF 2HTLD 5FO8B 1BJMA 4ZS7H 4Y5VC 3BAJA 1EO8H 5D70L 5ISZD 5E7BA 3M17A 1WP6A 2FCBA 3AWGA 4MQ7A 4U2ZA 4JAMA 4TTGA 2OL3B 4M9OA 1SXCA 5CSBA 1SMAA 1ZTXL 5AVQB 3U48A 3MREA 2JKSA 5I71C 2PW2A 1UD2A 4P4KC 2Y9RT 4WU7A 4Z7WF 4BIKA 3FQTB 4J2XA 4GRMB 3FTXA 3TBWB 1JXJA 1RUPL 3BUDA 3DDFA 3VFTA 4AQAA 4GOSA 3D2TA 5DRXB 5D2LE 3MV8E 3TT3L 2XHNA 2DYPD 2K6ZA 3O4LA 5GGVL 4UNVA 1GGCH 2B1OA 1EX0A 3RGVC 2BP5M 5BRZB 5E9DA 2ADJB 2EDDA 1UT9A 2N3JA 1MG2C 1XH2A 3N1PC 4NNXB 2ATPB 2EICA 3MODL 1TCMA 3ESNA 4JE0A 4PWIA 4R4ND 5GS1A 3ULVF 1I1YB 4NS0A 1S2EA 1YMHB 4Z0BH 2JFCA 3SDAA 4IKKA 4N6RA 3TJEH 3VYNA 4TOYH 3PXLA 2EH8H 4GT7A 4L3CB 3FFOA 3L3DB 1SQ2N 2HJFA 1BAFL 1RU9H 2FRGP 2JCWA 4ELKA 5IMMB 1TJHH 2P8LB 4HKBB 3F6IA 4HALA 3PE9A 3MV9A 3L4TA 4GKNA 4IEFB 1CLYH 1DLHA 2C1PB 3OJMB 4JW3A 5A2BA 4FJZA 4JQXC 2EDKA 3NEOA 1WSST 1L9TA 4GKZA 1WEJL 2VDRH 2FEEL 4QLWA 1RURL 1UXSB 5K33A 4OFDA 4LLMA 5D9SA 2OP4H 4LHUB 5GGRB 2IWEA 3TNNA 2DIEA 3V7MA 1VFAB 4BJLA 1CYGA 1IC5H 3IDGA 4OLZL 4JRYD 3U2SB 3A3YB 4IK7A 3BWZA 4PJGB 4P04A 4YDLC 4WW2C 1HWGB 1F90H 4L1SA 1HH9B 2W8CA 1JD7A 5GS0H 3MTRA 2NY5C 1BOYA 5CP7B 4E9YA 1II4E 5FECA 2E3VA 5D2LF 3EGDB 3DX6B 3T3PE 1U36A 1N6QL 2B4CH 5EUOB 4HK0A 5HGHB 1TTCA 1EJOH 1UWEH 4YHOH 3VSQA 3ZYIA 3HW7A 2G2PA 2DEWX 2QJDA 3PWNB 5DS1A 2XIBA 2OAAA 3CXFA 3QDGD 5JW4Q 3VMNA 2ITDA 3QEQB 1AI1H 2ZNXA 5D6DC 3O41B 4JANA 1YN7B 5C1MB 4JFDD 2GUOB 3RPKA 1NIBA 5GZOC 4G9DB 5KBKA 3PWJA 2J20A 5FGSA 4LU5L 5F89A 3B1UA 2R4SL 2WBWB 3W3BA 3DURB 1R34A 3HG0A 3NESA 3LQAH 3H54A 3W11C 4G6MH 3ARDA 3IU3B 3TN0A 2YD1A 4XPFL 4P9MH 5F9JA 3LY6A 1AZVA 2EEXA 1DUYB 3BYYA 3FF8A 3WIFB 4UDUA 4Y16D 5ITBH 4BSVB 5KJ7E 5ESVA 4N8UA 3C9NA 2E9WA 4XWOD 1X5ZA 3CXDH 4M43H 3CPUA 4O4YL 4H25A 5IFAL 1OK8A 3BISA 1E8ZA 3U6XA 1D5IL 2WYIA 4UQ3B 3CX2A 3HZKB 2QHRL 1TZGH 2E9BA 3B37A 5CJQH 4OGXH 2R0KH 3IFNH 3B5HA 2A6DA 4JY6A 1BREA 3DJSA 3OPZL 1CFSA 2AXGA 2YJLA 2A6IA 3K6IA 5JO5B 4YQXL 1WA1X 1U91A 2C4FT 2WXIA 2NRDA 2UWEF 5AW0B 1NFDE 3VFVB 3T2QA 1BOGA 2JKRM 1MRDL 4GI8A 2XC8A 1I9JL 4G8GD 2YIHA 3GPSA 4LSVL 4AGPA 4EDWL 4XBMA 3CU1A 1XGTA 4YHPB 5F3FA 3IMBA 3NFPA 3V6OC 2DLFL 2WINA 3K8MA 4HEME 4GUPA 5HHOA 4QF1B 1RVFH 1AHWC 1QSFD 4LLAA 43C9B 2XY1A 1RJYA 5INDB 1JGDA 1WJ3A 1Z5HA 4PWGA 3HAEG 2FECL 4DVRL 1BVKA 3FCTA 5LWYL 32C2B 3EOAB 4HIXH 5L4IA 4CNIA 3L6FA 3K71B 1Z9MA 3EBAA 3NABH 3DKHA 3JUZA 4HC1L 1IFRA 1TQCB 4L1LA 1S7UB 3WNNA 2JKJA 5CBAA 4LVNB 1SUJA 2NZ1A 1OALA 1RZJH 1LO2H 3IF1A 4HUXB 2J8UB 1E8WA 3MO1B 4F7PA 2NXYB 3NT0A 2NQCA 4LZKA 2MHAB 3FN0L 3T2PA 3FRPG 5GGTH 2YARA 1H8SA 4HOWA 3LQMA 3EO9L 3NRPA 4JVWA 1XIWA 4MJ4A 3F2LA 5EOCH 2DQDL 4JM0A 4JHVA 3S3JA 5JPMB 2E46A 4A7GA 3K1KC 2ALWA 3OKMB 1U2HA 1NFDF 2YQ2A 5I1DB 3U0WH 3Q13A 3CMGA 4RGNC 4OCSH 3E1F1 4JM2D 2C34A 3X2QB 4DKEH 2OMVA 2VDNL 4KZCA 4OT1H 4AEHH 2JTYA 3AY4A 4Z7VE 1CT8A 2MH4A 1JHKH 3PGFL 2VLMD 5IT2H 1T0PB 4ZS6D 2NNFA 35C8H 4R2GD 3ABLB 3S97C 2VC2B 5C07B 3CIAA 4ODXB 1NCBH 4P5TC 4XN4A 4DAGH 1KTJA 3D51A 3G6JA 1T1YB 2J8HA 4YHLH 1B6UA 2NX5A 3STZB 4JFFE 3O3AB 4NQED 4ZT1A 2MQ3A 4GKLA 3KPLB 3MNZA 4JFHD 1NPNA 2R2EB 3KEHA 3P40A 4K71C 1H3XA 1QBMH 2YD5A 2XN9E 4FNTA 3B2MA 5FW8A 1YUHA 4H0GA 1UH4A 3QG6A 3ABZA 4QRUA 4UM8A 4S1DD 2CSPA 3S4SA 3MZGB 1SEBB 5T3ZD 1B3JA 4QRAA 5K9KB 3JWNE 3PRZA 2XZCH 4JQIH 3EO0A 4P2YA 4P5RA 4JZOA 4RMSA 2JKIS 1HOEA 5EA0H 5EZOH 4LKCA 1B0GB 2VE6B 3AQXA 1EBAA 1S7RB 3EJYC 2AEQL 4LPWA 2BS8A 2DYPB 3LH8A 4M6NH 4L3FA 3GMOA 2NTSP 2K7QA 4PJEE 4ICXA 3FJTA 2OYLA 4JZNB 4MB4A 1KPRA 3CHQA 1YNTB 5D1QC 4Y1SA 3GS4A 4U6XA 1MLBA 3SCMC 1REIA 2ICWJ 2PYFB 3CLFH 4RSYA 4TUJA 43CAB 1QSEE 1YN6B 5HD8D 3WL9B 3NZ8B 2JKXA 3HUJE 3HCVA 2X9YA 3T4AA 2YRZA 1FWXA 2OXHB 4HUVA 5K59E 2WQ8A 4NUPA 4N2EA 5GS3A 2W94A 1AZNA 2J12B 2SODB 2XG4A 2XKSA 3GMRA 1O6SB 5E23A 3T5WA 3B5GA 4UTBH 2QKSA 2NY5L 1VGKA 1ZV2A 2VDQL 3N5AA 4XCYA 5DJAA 1IO4C 1MWAA 2YA0A 1Q0YL 3QUYB 1IILE 1ORSA 1NGXA 2MMXA 2N59A 5I76B 4FFZL 4NCC1 1IKNC 1JCKA 1E9PB 1TT6A 1D5MB 1T1XA 4JHZA 2QKIA 4NSKB 5EBWB 3RDTD 1JWUB 3M7OA 4XNBA 2EEDA 3WY4A 4E9XA 2ZOKB 1JZ7A 3ZRCC 1QBLH 4QXTB 1F8TL 5AYUH 3T8XA 1P4IH 4WAFA 2IQAA 4DP2X 1JVKA 4PB9L 3HHMA 3M46A 3ZRSA 4AV0A 3NH7H 4FQLH 5E2UH 1L7IL 2C3HA 2X0VA 1J5CA 5K93A 1UOVA 2XVLA 5DD5H 4PGBA 4J4PA 5C2BH 2YSTA 1FAKT 2C4XA 4X98A 5EU5B 1WBZB 3SBRA 3GTNA 2V5RA 4HISA 1OAYL 2JI3A 4QOKD 4EKJA 3QCVL 4O51A 1S3RA 4PJEF 5E70A 4HQQL 5EIIA 5FLVA 5IB2B 1AJ7L 3SDCA 2FEDC 4D8OA 4WJ5B 1QLEB 1QEWB 2MNUA 3HLKA 2MCPH 3IBOA 2VZSA 3QDGB 4FZ8L 4KMLB 5HHNA 3FO1B 1A6PA 3FTWA 4LLDA 3QPQD 5DXWA 3HUJF 5FHAL 4PVBA 2XN0A 3D39A 2YPVH 3PS6A 3CVIL 4JFDB 4YDVA 4AH2A 5DYOB 5SWQA 1QD0A 3Q8CA 1CL7L 1LM8V 2XX1A 1A7BA 4FXTA 4WWNA 2F68X 3ECVA 3BH8A 1H3GA 3IWVA 2OZ4H 3OAZK 3U46B 3B2VL 3CFDB 3DXAA 4L8BA 2EXSA 2NW2B 3GHEH 3KCPA 3QR1A 4UZSA 2AJ3B 3NCCB 1HHIB 4Y16B 5IFHL 5HY9B 4MCZA 4XOBA 4XXCC 1ACXA 3OQ3B 3WOVA 4HPYL 5G4NA 4B9IA 1URIA 1RZKH 2GW5A 4LEOB 3ZYOA 3I75A 1EVTC 1XSOA 2CHWA 4A1RA 2DM3A 1BZ9A 3CZKA 5DK0B 5E4AA 1A02N 2KERA 3TEZA 1BD2E 1NGWA 2R1WA 4PQXA 4PJAA 2N01B 1WAEA 4H0LC 1TJGL 1UB6A 1G6RH 4X6DA 3QI9A 1I1AB 2GBUA 4QXUH 3W0WE 2AXHA 3EW3B 4AUJA 2X4PB 1MLCB 1FFPB 3RFZA 5LGHL 1N67A 1R75A 4K07A 2ZQKA 3RZCB 1BQKA 1CD8A 1F6LL 4FQHA 4XNAA 3NEEA 3CLEH 4I0PB 3U25A 5AENA 4UQCA 2FWUA 4HJEA 3IETA 3MRQA 1CIUA 4DGYL 4N8VB 4L48A 3HE7A 3VI3E 1G7IB 1HN1A 2PPCA 1FUNA 2QQNL 1QSFB 3KPOA 4I48A 4NPJA 3QO0B 5EULV 1XV8A 2AJSL 3NSXA 1U8NA 3O0RL 1PGRB 5C08A 1HI6A 3OZ9L 2EEFA 3BGFB 3VXME 5AVSB 1UG9A 1PX8A 1G7MA 4JPKL 1IEAA 4RAUB 4Z0XB 2DBLL 3NACH 3FB7A 1LVEA 1BW8A 1XR8B 1PZCA 3N41B 3QZWB 3ARVA 3IN2A 3BKYL 3QUXC 3CFIC 1ZD6A 5J6SA 3WFHB 1U8OB 3NCEB 3ZKMD 4I8DA 2YSSB 4PWFA 4X5WA 3FOLA 1FFOA 1YNLL 1FO0A 3HBQA 4PP2A 3F58H 2IAMD 1UXWB 2AEWA 3DSFL 4O00A 4ZK8A 5DZPA 5KYWA 4IJTA 1X5XA 3AB0B 2XBDA 3PDGA 5AOLA 4IQHA 1QR4A 2Z7ZA 5AKRA 1A22B 1KCUL 3KYOB 4L0ZA 3TJPA 3VXUB 3KBPA 2Z7UA 2Y1VA 5IP4A 1KN4L 1HVXA 4GBXA 4NO0A 1NC4A 3VD3A 5HHPA 1M2VB 5T1KD 1IARB 4N2AA 1KCKA 1M05A 3MLPA 1JF6A 4K94H 1TYJA 4FERA 1SDYA 1WGOA 1ZHBB 1U8LA 3BZFA 3SDAD 1EGJL 3IT8D 3F12B 1IC7H 4HJJH 3VI3F 2LR4A 4GQ9L 2ZUUA 4J6RL 5JOEA 5J11C 2P5ED 1PZ2A 4U6TA 3V5KA 5IBTH 2PXYB 4JPWL 3L3HA 1AGEA 4NQEB 3S5LA 3BFQG 1A6AA 1FYTD 1OXYA 2NNXA 3TH4T 3MV9D 1YPZB 5DEFA 5HHME 3BAEL 2BW4A 5ADOL 2G5BB 3G7TA 4OCLC 4YL4A 1JZ2A 4HS3B 2EZ0D 4OCRL 3Q3GB 4PY8J 4DJMA 1MRCL 3H53A 4QHMA 3PCYA 4UZGA 1R3LA 3ZU8A 4X99A 2HCZX 1RZ7H 2CBPA 4N0YL 2A4ZA 2LU4A 2YGOA 1NAKH 4L8CB 4FQIH 5HPMA 2DQJL 4E9TA 5FO8A 1DDTA 5JOPD 1ECYA 2J6EL 3VWJD 4Y4KA 3L3GB 4NIYE 1JXDA 3CX5K 3MLVL 3PFUA 4I87A 5E6SB 4RGOH 1C16B 2PPDA 1RPUA 2CUAA 2PR4H 5J12C 3LAFA 3ULUH 2O6PA 3IJ7A 4RZCB 3NIFE 5E8PA 1MQKH 1KEGL 1Q0XH 4HSCX 3FRUB 3UJIL 3PL6C 5F96H 1AD9B 2O6EA 3KLAB 3GSNB 1A6TB 1YUKB 4BH8A 5JOFB 1YNKL 4JFXA 3EYFB 2A1WL 5J1SC 1OM3L 2JLLA 4PLKD 2JI1A 3C09B 3W9DB 2QPSA 1D3CA 1UWGH 3MUGA 1WYJA 5D96C 3RWJB 3ETBJ 1UB5B 3IYLW 3EH4B 2JELL 4NN7B 1AFVH 3ROLA 1H0DB 3HG1D 3HPJA 2CIIA 5C0JA 2I07B 3ARDD 3TN0D 4WTZG 4LAQL 4OTXL 3LJ3A 1F4HA 3F00A 1Q0EA 3WSQH 3RDTB 4J28A 1BZEA 4L3CA 4MB1A 1E4WH 3L3DA 1PW3A 1RMFH 3TNMA 4P2OA 4F57H 1A14L 1BSIA 4Z78B 3PJSB 2EIKB 5GRUL 3L2MA 1KB5L 2WXHA 2FWOA 3V4VB 2VXTH 1EJ8A 1TU2A 2IDUA 3FFCE 3WAKA 5GHWL 1MY5A 1PSKL 1A3ZA 2FR4A 2JQAA 2AJYL 4QOKB 4OGAC 1ZANH 1H8LA 4G59C 3CFUA 1SYVA 1WS7A 1FLRH 5GRVL 4LE8A 5IB5A 4XMPL 3LRLA 1KYUA 1EK3A 1PLGH 4XO4A 4ODWB 5IG7B 4PJGA 1ACYH 4PW4A 4OGYL 3PWVA 4NLHA 4FD0A 4PJBB 1ETZB 3C6EA 1QYGH 2R4RL 5CEZD 1FIGL 3F85A 3OV6A 4CVWA 3OWRA 1AKJB 2DWEA 4GAYA 4IBTA 3L3IB 2ZP9A 5SV3A 5T1MB 2AABL 1DVZA 4M7LH 5EUOA 1TKWB 3GINA 4EOWH 3MYZA 3ALWA 3Q8AA 3BAKA 4FLRA 1NFIA 4R90L 1KC5L 5I1IH 1AS7A 3KL5A 2L7UA 4G8AC 4DO4A 2AZAA 5G55A 4XXDA 3C60B 2X6CA 4DUWA 2PLTA 2F61A 5FUOH 4X5XB 2AK4E 4UUJB 3GIVB 4PS8A 5LBSA 2HWZH 3GXPA 5E2TH 3RWFB 4Y2DA 4BE5A 3H2PA 5C3TA 1T5KA 2H6OA 1T0MA 4QRRB 5EO0A 3ULSB 2PCYA 4DZBB 1HEJC 3MLXL 5B39A 1K8IA 1J8HE 1JPGB 4OD2A 4YSRA 3RI5F 3TEUA 5BUGA 3ZZ1A 5IQNA 4AY0A 2OMNA 1QFPA 4B95C 3RU8H 2JCCE 1F18A 1TF4A 5J1TC 3US1A 3H0TA 1XIWD 4J3OF 2Q6WB 4GSDH 5BV7C 3S3DB 2WN3A 3RUGE 4FC3E 3UG3A 3NAAH 1IUZA 3D87B 3ESPA 3BN9C 3N06B 4YGVB 1LK2B 5FOBA 2PPAA 4FXGC 1NBYB 2EUVA 2ATKA 2ZKHL 3AS1A 2BVQB 1SVBA 5JO5A 1RD6A 2NSMA 2EDNA 3U7WL 4J12A 1MCHA 2HFTA 3MA7B 4ZFZB 4F8LA 2BHUA 3DV6B 2EYTB 3KPQA 1TTBA 2Y72A 3ATAA 4XP4H 1KBPA 1KTBA 4PJCA 1U8HB 4XN1A 2PW1B 4K5PA 3WUWA 4GP5B 2CCWA 2WGXA 4LQFL 1CYXA 5IUSA 1E5AA 5SWZA 1F97A 1IAOB 1XMWA 4X5RA 3QNZB 4YEFA 3PFQA 4LCCB 4KDWA 4YPGA 5I6MA 3PQYA 5F7HA 4LXFA 1NCHA 2BWDA 5EO9B 3JV6A 2BVPB 5AYTA 3UAJD 1I3UA 3RHWK 2YR3A 3FQ4A 3K6NA 5DQDL 4HWBL 2R8SL 4EIUA 3UTPE 5IHBA 2G3ZA 2ZWYA 2IAMB 2XQ0A 4U1JB 4FQXC 3ZDZB 5T33L 4YVNA 2CE6A 4K2UH 4UV4L 3FQNA 5EBLB 1P0SE 4NNPH 32C2A 1T04A 1G87A 4NT6A 4FTVD 4C58B 2Y7QA 4TNEA 4S2SB 4NAMA 2VMFA 2Y06H 5DFTA 1C5BH 2JCCF 4LNRB 4FP8L 5HI3C 2QV4A 1J8RA 1F41A 2ENYA 2M8XA 3NFSH 4ONHB 5F72S 1O7DE 2CM5A 4OCMC 3MRFA 3U83A 4B9PA 1CDBA 1ZDQA 4XPHL 3DNKA 4N0RA 5T1KB 4HUXA 2X9WA 4ZFQA 1FGNL 1N8OE 1SJEA 1G9MC 3JWDL 3VB9A 1U8IB 2RBLA 4F2MB 4ZDHA 1CE6A 2WO3B 5L2KE 5GGRY 4BV1A 2X6VA 1KXTB 4PJ8D 5DJ8A 4G82A 4V11A 4UYPA 3OKMA 5E1IA 1NBVL 4PJ9A 1FYTB 3ZKNC 3WE6A 5FUZL 3K2MC 1LE5B 3WN5C 4X0NA 4U7SA 4DW2H 3UPRA 2OCFD 4JRXA 5I66B 1T5WA 1TPXB 2O6FA 4XNZC 3CUPA 4JDVA 5IW6A 1MCOL 3PWLA 4X42A 1L0PA 2FX7H 4PJHB 1GZPB 1M7XA 5EOTA 4O02H 4M5YL 1T03H 4KQ4H 3RVVD 4KK8C 4O5LL 1S9KC 1JPTL 4QO1A 3OB8A 4KK9D 4PHXA 1MFAL 1IX2A 4G8IA 4OZFH 1KCWA 4MXVE 3SKUD 5KSBB 3VWJB 1KUMA 1CDJA 2OW7A 1WLHA 4J4PD 3KPPB 2EABA 3V0WH 5JR1H 4X7TB 2YBGA 1HZHL 3ZSSA 1MHEA 3OAUL 2FWSA 3VQMA 4GMSL 5K9KA 3ILEA 3D4ZA 3OKOA 2X7LA 2Y25A 1EXUA 1LJMA 3GMMB 5I8KH 2DWYA 2B08A 4Z7QE 5I9QB 3WMSA 4N0UB 1GHFL 4L18A 4XXWA 4TVPL 1QVOB 3OAWA 1G7HB 5DEGA 1PZ5A 2NNAA 4OLXL 2ED7A 2Z31B 4C56D 1B2WL 3N0PB 5EZLB 4DKFH 3RIAF 3AU1B 2HH0H 2IWGA 3WJMA 1MI5E 2VN4A 1YCSA 2ZOOA 4TS6A 1IAIL 4P8QA 5AAMA 2GUYA 5IZ7A 3QWNA 2VR8A 1LEGA 3DXAD 1YMME 2G3XA 5GISH 3SJVE 1A7QL 2AKRA 1KIQB 43CAA 3BGAA 3NZ8A 5C0CD 3MLZH 1AYOA 5AL8A 2WK2A 5IK3A 1RHHA 4PJFE 3EG9A 4TUUA 4AUYA 2CGYA 4LOFA 2DS4A 5KYXB 1OCRB 1AAJA 5ITFB 3OXSB 3BUYB 4KH9A 1N5AA 4WO4A 1JBJA 3NVQA 2V0AA 5PAZA 1E9QA 3QUYA 4MMZB 5DD6B 4NZUL 5EORL 3QJRB 1SDAB 5DLMH 3WELA 3GSOB 3U0TA 4KVCL 3U82B 3TVMC 1HIML 1E9PA 4JO1L 2AQTA 4MXVF 1DANU 3A67L 3OQRA 4B5ZA 4NQDA 4KXCA 3DX3A 2NY2C 1VA9A 3ARED 3CAFA 3O6MH 1AQDB 4K15A 4M8VA 4QXTA 2FUQA 1E67A 4AYDC 1YQVH 3DROB 3HI1B 5DS2A 5DS8B 2DQUH 5T1LA 1MCPL 4Z7NE 5K69A 3MACH 4R5TA 4Z7QF 1CYWA 1T2JA 3PYCA 3VXRD 3ZUCA 4HU8A 1B4JH 1F3JB 2XWDA 5EU5A 3P69A 4NPYB 2OV0A 4KGLA 2O5ZH 2VIRB 4LRNL 4Y2LA 3WHE0 2J1ZA 2R2HA 4B7IA 4DQAA 4W9JC 2YA1A 3D07A 5DK2B 5DVOA 4FQJL 2QQLH 5A2CA 4BFGA 4X4XB 5IB2A 4WDIA 4QHKI 2ITEA 2ZAHA 2EXTA 3IDXH 3QJTB 2DKUA 4HBCH 4GAJL 1E3ZA 2E86A 4V33A 5BV7L 4JN2B 2IBGA 2ZYSA 2BINA 3ELQA 4JLRB 4QRPD 3H7BA 1WISA 1S46A 4KI5E 2C3VA 2P7TB 2VDNB 5DUPH 4PSRA 3GMPB 2EUWA 1A6VL 3FNKA 4OVUA 1AHKA 3ORJA 4XWGH 2C9RA 4KKRA 2Z7YA 2F0CA 1I4FB 4QMEA 4OKVB 2FLMA 1QO3A 3E9UA 3FUFA 2MKWA 1JYXA 1A9VA 5DUJA 2ZUWA 3LNDA 5J1AA 5D7JC 3KLLA 5DC2A 1FZKB 2ENQA 2LTQC 2HVKA 1YC7A 1I8MB 1O75A 2X1PA 3RGVB 5JLZA 2B39A 3SKNB 3BAWA 1HCVA 5H37G 3SYQA 3QEUA 2ADGA 4OLYL 3QXDB 1KLGA 3TGXA 3QFDB 1EEUA 4B60A 3ETBF 4L4VE 5DK0A 2RFXB 3BZ4B 3W81A 4YDKH 1A21A 3G6AB 4D7BA 5CN3A 2C9VA 4GW1A 3V0VB 1Y0LB 4A6YB 5JORB 4Z7NF 1I8KB 1UM5L 5E1AB 2VZ3A 1NGPL 2WZPA 2KHAA 5KVDH 4H1LA 5SV4A 5TE7H 1DBBL 1Q9WB 3MXWL 4GMTH 1K3IA 3ZK0A 4JRFA 1WWCA 2LU7A 4QAMB 3GSWA 1FFPA 1NEPA 1T83C 1XTLA 3IU4L 1AZCA 4NDMA 5LHDA 2O5NA 4CU8A 2EEAA 4JR9H 3BGMA 5EDSA 3RZCA 5L2JA 2V2TB 4YNYA 4OCWH 3ULAB 2AF2A 3X1EA 1ETB1 4NQXB 3DTDA 3PF2A 4I0PA 2YOAA 1AC6A 3UYPB 4H26A 1F3DH 2FO4B 4FQ1H 5I8EB 4BQ9A 3I3EA 2L4OA 4WV1B 5AOZA 3MJ8B 4BZ1L 3QO0A 4KI5F 1MJ8H 5C0AA 2WKOF 2IWFA 4RDQF 3ZE1B 1AO7A 1ZMYA 2YHGA 4WW2B 1NSNH 4YDLB 2IDQA 1FFRA 1RULH 2JK5A 3AG4B 1D6EA 2Q86A 2JIXA 4U1GC 5CGYC 4X8CA 5ADPL 3IXTB 2A6JB 2VDQB 3E2HC 4K7FB 1ZT4B 1T66D 4JUTA 1P4BH 4FTVB 4XVSH 3UG5A 3U4BL 2DW5A 1CK0H 3D18A 1LO0L 4A7UA 2HT3C 3VFWA 4L9LC 4NHCH 3GKWH 4NC1C 2A5UA 3WFEL 3KD4A 4M48H 4WFFD 1D5BB 4ZNCD 3RTQA 4GFTB 2JLPA 4QNPF 2B1HH 3IGAA 4OI8A 2XX0A 1U4FA 4ZD3H 5DQ9B 1PY4A 1A5FL 1JPFB 4WEUD 5AAWA 2F8VA 4HX1B 1U8CB 2CH8A 4W70A 5T5FA 3DOSA 4XHJD 4G8FA 4PJ8B 2X1QA 2AITA 2FD6L 2PO6C 1G0YR 4HWZB 4AIEA 4ZW7A 2XWZA 4A2HA 5HYQB 5GSVB 2HN7A 4P2QE 1CTMA 3Q9PA 4YXKL 1HQRB 1QPPA 3HRZC 5A7BA 1UACL 3FH8A 4F9LC 5D4QA 4MJIE 1M2VA 5CD5C 4K8RC 3EOTH 4AITA 2H3KA 2OJEA 4JDTH 2BIOA 3JVGC 3F12A 4PJ5E 2O26U 4GSUA 1U93A 2R59A 1F2QA 3G3LA 2I7OA 4OLWL 4XMLH 1WO2A 5BS0E 1A6ZB 1F13A 5IQ7H 2I5YL 4NENB 4P23C 1XGYH 3OL2A 2PYEE 1NCUA 4L29B 3E1ZA 3L8QA 1MDAA 3TT1H 2Z1PA 4DN3L 2HLAB 2AXFB 4HHGA 1RUKL 1QNZL 2PABA 2ZZUT 4XGZB 4P46C 5AEAA 1WBXB 2CMRH 2EH7L 1J1PH 4ZX5A 4HWEH 4M3HA 4WENB 4WFHE 2FJFA 4PW9A 2ZICA 4PHZA 4TF4A 5A6LA 5DZOA 1GGBH 3JTSB 5DJDB 3A6CL 2CIKB 4AEIH 4PREB 2R2BB 1ET5A 1NAML 1T22B 4WNSA 1FFTB 4POUB 3QQDB 1K8DA 3WIIL 2FJHB 3VQ1C 5DC0A 3RVTD 2WD0A 1J0KA 2Q8BL 1AHWB 1DVSA 1CLOH 1S5IH 4ODVL 1LWRA 5FYLL 4LO9A 4HBQA 1ZWIB 4I89A 2HXAA 3T1FB 1JWMB 3DMMD 3K74B 4J7RA 3VFGH 1GGIH 3L4XA 4G6AC 3SBWA 3KPSA 4RZCA 1B3IA 2H6UA 3DHUA 2VDMH 4XTRD 5HDOA 5MENE 4KHTH 4EZMA 3DK0A 3ZDYB 1UT2A 1X5LA 2HFEA 3FRUA 4Y5XA 2VRAA 5CINL 5C0CB 4BWWA 5AVZB 3HFMH 4MWFB 4ZNEE 4Y7MA 5JOFA 3MV8A 1XQ4A 1NLBL 1P1ZB 1QAWA 3QDJB 1Z5YD 1TJXA 5EEYA 3AT8A 2JJSA 2HJLA 4QY8B 3WS6C 4Y2DD 5F7KC 5EUKA 1DQKA 2ITFA 3VMOA 1P6WA 4R0LC 5JPNC 3QK0A 2DF3A 2PUQT 2CJUH 5T3XE 1QRNE 2NY7L 4J8QA 1FPTH 1OCOB 3HS8A 1BGXH 3BDYH 3WJLC 4QWWC 1H3PL 4MHHI 2OL3H 4HDIA 3M1OA 2DM4A 3L5XL 4I0CC 4JDZA 2ZUTA 4M9PA 3HB3C 3AREB 4H8QA 4JKMA 4M4RB 5JHLH 3RIFF 1HKLH 2BXZA 3G5XB 4XVJL 5EZIL 3S9DB 1JV2B 3OLGA 5SWSD 3QPXH 5HXMA 3DWTA 4FLQA 4JO2H 3QIUC 3IJ9A 4NP4L 3LZLA 3T6XA 4BK4A 4KAQL 4NN5C 1A3RH 3VXRB 4WCYL 4AEEA 3UZEC 4P5TB 5D7LE 5BZDB 4TYUA 1X7SA 1HSBB 1QUPA 2APSA 2LOEA 3D0LB 3DYPA 4K71B 4PBXA 4ZUVB 4RFEB 2W60B 3MUZ1 3V0IA 1BPVA 4Z7OE 1NPUA 3N43F 2C3XA 3ZTJH 4CN1A 1IIKA 2X44D 4HKXB 4PI2A 3RBGA 2ATAA 3GSRB 1IGJB 4QT5A 4YSOA 2LT9A 2Q20A 4OFVA 3PQYD 2UWEA 4XN9A 1AKJA 1CGYA 4UBDC 5ANMA 1KENH 1MCSA 1PZDA 4MA8H 3OLIA 3UADA 1ZA3A 4NEHB 5I73C 2IH1B 1V27A 2OSLB 3BAIA 2ALAA 4NRZB 4UB0L 3C6LC 2AP2A 3O4OB 1P7BA 1NOAA 2CJSA 4P59H 5ICUA 2RHEA 3RWHA 4G8EA 5GJTH 2CLVB 4W9HC 2ESVA 4EZKA 5D1QB 4CVXA 2XPGA 2IPKA 4U1NA 3KLSA 1R3HB 3C8DA 5FGRA 3NCYP 2MOVA 4E41B 4NX0A 3ESMA 4P0DA 4R97B 4G80A 1ADQA 4KJWD 5LLIC 1FF5A 4XZUB 5G4OA 3BWSA 1GPOH 5FLUA 2VCOA 3BCFA 1J1XH 1JNHB 3LN4B 1T7XA 1VSCA 2PTUA 2BJML 3QUGA 3VSTA 1DJSA 3SGDI 5L0QB 1E90A 1CLCA 3MLWH 1FORH 3QE5A 2CG9X 2ZCHH 1NCCH 4QUOA 3VD2A 1PZAA 5DHVA 5LBSH 4Z7UB 2BOCA 2X41A 4JRXD 1DANT 1IGMH 2CR3A 3UZVB 2K4WA 2ZUXA 1JK8A 5I1JL 1HAUA 2YK1L 3B5TA 3N9GH 3O81A 3MA7A 3IJYA 4WWKC 3L16A 4AYSA 4X5QA 2EYTA 3N55A 1ZVSB 4G9FB 3V4PL 4DUVA 3I6KA 4LLYB 1U8HA 2PW1A 1DQLH 2EKSA 3NCXA 4HXBH 1JK9A 4JGNA 4PG9B 5CU9A 1GGUA 3CDYA 3SO5A 3B9KA 4XODA 4HEMA 1A2YA 1KYAA 2F5BL 4NNYB 4K8RL 2I9LA 1TQBB 2CO4A 1UA7A 4TRPL 1U0QA 3UJJL 4JPVH 3HAEB 2BRQA 5I1HL 1KYOJ 1OF2A 2DDQH 4JFQA 2BCKB 4U1JA 4X9HA 2D7TL 1MIEH 4LDEB 4HFWB 1LDPL 2BSDA 4OM1L 4PPTA 2BVOA 5LNEA 2R69H 3NA9L 4NFCA 1IEBB 5IW1A 3TH2T 1A1NB 1JOIA 1KB5B 4ODHH 1ZS8B 2WVVB 3DGGB 3RIKA 3F84A 2K1MA 3NZHH 5TF1L 1OD7A 4PG2C 5F1IB 4LNRA 4IKJA 5F6IB 1Z5LA 1F4YL 2Z65C 3CC5B 4AT6B 5D8JH 5EEUA 1MFMA 5CR1A 5IB3A 4F93B 2WLZA 5E6RB 2DQEH 1RK0B 5FYJD 2VDLL 3MSPA 4Y19A 1ZAGA 2PTTA 3FRPB 4WHYG 1PCSA 3N1FC 1KYFA 1NL0H 1U8IA 3E8UH 1WCBB 2CA3A 4H20H 1MCDA 3CFJA 4F33A 5AW5B 1TSHA 1R24A 2XTJE 3FT1A 3D50A 1J0HA 3ZTEA 3PP4L 4XNXH 2OMBA 1S7XB 4O9HH 3GI9H 3O3BA 3PDDA 1BF2A 2OW6A 3G6DH 2G60H 3OLDA 5LQBL 1A4KB 1KJ2L 2P80A 4KJYB 1OP3K 4LQ1A 4ANWA 4A7SA 4AX3A 5ILTH 1TZHA 1LK3H 2R0WL 5AW9B 1WFJA 2ZWKA 4WWOA 2C9QA 1DBMH 4WHDA 3MRHA 3KJ4B 3O3EB 1KCRH 2HT2C 1WE5A 2YLHA 1ZGLP 1S5HA 4I7ZC 1PG7W 1MCJA 3DIVA 3G9VA 5T1LD 3B7RL 2YXVA 2A9DA 2NLJA 3MRIB 1MHPL 2YD8A 3ZTCC 2VAAA 1MREL 1XBDA 3AXLB 4NIKB 1DJWA 1UH3A 1W0YT 5IROA 3KPPA 1XF3A 3DMMB 3UROR 4MNGB 3UX9B 3GK8L 1T7ZA 1N5YL 3FBKA 4XN5A 4F9PC 4ZSOE 2XWCA 3DIDA 5G5DA 5BVJB 3GMMA 5FYJU 1GOFA 3BHBB 4LFHD 4LPTA 4X0KB 2A0LD 2X6AA 4P3DA 4DN4L 1F3RB 1GJUA 3CH1B 1OAXL 2VC2H 3DI3B 1AP2B 4HH9B 3VB8A 1WZ1H 2Z31A 1QASA 5DU7A 1XEDA 4IMKA 5EZLA 1QSVA 3HN3A 2O5YL 1QQDB 1RZJC 1OAUL 4H8WC 5DD1H 1L9RA 3H3KA 3ZT5A 2VWEC 1EDHA 2X53A 4PYGA 4P3CL 1E50A 3P73B 1A25A 3HUJA 4ZTPH 2QPEB 3IS1X 3KNBA 4AQ8C 2X28A 4ZMOA 1XO8A 4MJHA 5JW4N 4TTDC 1TXKA 2XRAL 4U1MB 4XPBL 1EO8L 1CDHA 5GGVY 2N7AA 1D9KA 1ETA1 3ARZA 3BUYA 4H5SA 5SWSB 1EWHA 1EV2E 3WKPA 3NJLA 3UZQB 5IEHB 1EDYA 3FU7A 4PRPB 4QTHB 3VMPA 4G6KL 1BFTA 2NDGA 1ZLSL 3ASOB 4JQVA 5AYQA 2WWNA 3SDXE 5J11B 4BD4A 1DJYA 2GITA 1RP9A 2XBZA 5J6GA 4XC3L 5M95B 3QNFA 2BK8A 3P3TA 4F2EA 4RA3A 4KO7A 1AC0A 1AQDA 1U92A 2FYYB 4JFED 2DD8L 3ME0B 4MD5B 2ITCA 1Z32X 2CLZB 3VO0A 4KPHL 8FABB 5IKCA 5EOQL 1I8IA 3WD5H 4OGZA 1F3JA 5L9DH 3TJEL 5CEYB 4AIZA 2AZUA 1IC0A 1BCIA 3WE1A 1MFEH 4XMKH 1WWAX 2PMZA 5F3HB 5DFVC 5ACZB 4MJ2A 5DK2A 5DRNB 1A4JB 2E76C 4ODSH 3WFZA 3MRRB 4Y5VA 4YK4C 4MLSA 3BVNB 5EOCJ 2HJKB 2ZOWA 5IWLA 1LE9B 1LL1A 1G9EA 2IFFL 4FLHA 3FPXA 1A7PL 3MI6A 2GBVA 4J1UB 3RJDA 3GMPA 3UO1L 4P4KA 1HH6A 2AQQA 4ZQKA 3BVTA 5I0XA 4B41A 5E6YA 2AJUH 1QLRB 4OKVA 3AAZB 4WW1B 2PWDA 4NFDA 5E2WH 3LEXA 5AUMB 1JXKA 1M7IA 1DVFC 2DIBA 3UTSD 4H8VA 4DEPC 1LNUB 1QW8A 1VGEH 2BSTA 3RGVA 1N0LA 1INQB 4UM9D 5IB4B