3B7YA

Crystal structure of the c2 domain of the e3 ubiquitin-protein ligase nedd4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
151
structure length
144
Chain Sequence
ATCAVEVFGLLEDEENSRIVRVRVIAGIGLASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C2 Domain of the Human E3 Ubiquitin-Protein Ligase NEDD4.
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase NEDD4
total genus 25
structure length 144
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3b7yA00
2WXPA 2ENPA 3F01A 1W15A 1E8ZA 2QZ5A 5H4YA 4QJ5B 3QAQA 3CSFA 4LDCA 1W16A 4PS8A 4IHBA 2DMHA 2NCEA 3L54A 1UOVA 3F05A 2CJTA 2WXFA 3TL5A 5JHAA 3L16A 3TWYA 3APDA 2EP6A 4L2YA 4FJYA 4Y1SA 4XX5A 2K8MA 4TV3A 2Q3XA 2ENQA 1GMIA 2WXKA 1E8WA 3HHMA 3PRZA 5T8IA 2Q0ZX 3B7YA 3PYCA 1BDYA 1WFJA 2X38A 4EZKA 2D8KA 4Y1TA 3OHMB 1BCIA 1QATA 2WXNA 4L23A 4AOFA 3ZVVA 4ICWA 4TUUA 3NZSA 4FA6A 4LCVA 2KI6A 4AJWA 4NS0A 4FLHA 3APCA 3ZIMA 4L1LA 4GNKB 2CJSA 2FJUB 2ZKMX 4IQHA 2N1TE 4FJZA 4MJJA 5EDSA 4NPKA 4F92B 5H4ZA 4QJ3B 2WXRA 2NSQA 2R83A 4LT7A 3W57A 2CHZA 4F1SA 5KJ7E 3QK0A 1DJXA 3GPEA 5CCGE 2K4AA 3QR1A 5CCHE 1E7UA 1A25A 3SD5A 3ZW3A 3APFA 4A55A 2ISDA 1V27A 4GB9A 2WXIA 3PS6A 4ANVA 3DBSA 1K5WA 4KZCA 3RPBA 3NSJA 4ANWA 3PFQA 4EZJA 2QZQA 4ANUA 2NQ3A 4OVUA 4DNLA 2CM6A 3L13A 2K3HA 4FULA 4WWNA 1DJHA 2YOAA 3DPDA 3HN8A 3L08A 2WXHA 2WXMA 3QJZA 4WEEA 3R7RA 4QAMB 1E8YA 2DMGA 4FHKA 3M7FB 4FHJA 4PS7A 4PS3A 1DJIA 2CM5A 4NP9A 3T8MA 4HVBA 4J6IA 2CHWA 4V11A 4BFRA 4OVVA 1HE8A 4WWPA 5G55A 4TS6A 1QASA 3ML8A 3W56A 4WWOA 3PREA 2K45A 3F00A 2V4LA 3HIZA 3R7QA 1E8XA 2CHDA 3F04A 3IBEA 4L1BA 1E90A 5JHBA 4EZLA 3MJWA 3QR0A 4JPSA 1YRKA 1RH8A 3KWTA 2Z0UA 1DJWA 2WXLA 2A4ZA 4WAFA 1RLWA 4KITB 5G2NA 2WXOA 3L9BA 2UZPA 1DJYA 3FBKA 4KZ0A 4XZ4A 4HLEA 2WXJA 3CSTA 3ENEA 4G11A 1E7VA 2WXQA 3OAWA 4BGDA 2WXGA 3QARA 4ANXA 3ML9A 1DSYA 4NPJA 4F93B 2B3RA 3KWUA 3RDJA 3P2BA 2LHAA 2BWQA 1DJZA 2A5UA 1RSYA 2FK9A 4FADA 3FDWA 3JZYA 4DK5A 3LJ3A 2JQZA 5CCJA 1TJXA 1UOWA 3L17A 2RD0A 4F91B 1TJMA 2ENJA 2Y3AA 4URKA 1UGKA 3IM1A 3L4CA 4QJ4B 1WFMA 2YRBA 1CJYA 4ICXA 3NZUA 1BYNA 1DQVA 3S2AA 3TJPA 1DJGA 4XE0A 3N5AA 2CHXA
chains in the Genus database with same CATH superfamily
4M3HA 4P46B 2BM3A 5EA0L 2WC7A 4Y2DA 3AZUA 2BCMA 1PYWB 1FF5A 5DVOA 1OP4A 2R59A 4KKRA 5C9JA 2LR4A 4JMXA 1BGXL 1AD9A 1R19A 2CJTA 3V6BR 4DGYL 1U58A 1AGDA 2Y22A 5IROA 4PCYA 4PY8I 4XX5A 4AUJA 1UKTA 5BPPA 2IG2L 2IH3B 1SM3L 1ZV9A 5T8IA 2BVUA 2P8PB 1F41A 4GRMB 4JKNA 5I0DA 1WFJA 1H5BC 5GGVY 2NY6D 4AOFA 3CXHK 5C09B 1EDQA 2QPDB 5ID0B 3MXWL 3FFCB 1ZKAA 4WUKH 1FGVL 1G6RH 4N85A 4F2MA 2CH8A 3DHMA 4C56A 2X4UB 4HLZG 1ED3B 2BLFA 3LNEA 1VHPA 3BO8B 3HNTL 1G94A 1URLA 4K3EL 3TEXA 4WK2B 5LAXB 1JF1B 1XAUA 5ETUA 3QO0A 4HIXH 2Y1YA 4EUPB 1ZVHA 5HYEA 3I9GH 1LD9B 5I1AB 1T3FB 1G84A 1FGNL 4ANVA 1A7QH 2E7MA 3F85A 1GOHA 4NNYB 3GYRA 2B2XH 3WSQL 1MVUB 1UA7A 5E8OA 4ZX4A 1HI6A 1PVHA 3W1ZA 3D2TA 3WIFA 1I7UB 4H1LG 2VUOA 1U4EA 1IBHA 4KVNL 5ENWB 3P73A 3ZGHA 1S7WB 5DT1L 1CLCA 4JS7A 4XHQA 1AACA 2ORBL 3HRZC 1BYOA 2YFNA 4ZK8A 2A1WL 1GJUA 3D85D 5I82A 4PLNC 2FTAA 2YMOA 1HE8A 3S34H 5FO9A 3BD5A 3OJDA 3D52A 3Q2WA 4WU7B 5I0XA 3CN4A 3T6QC 1WUZA 3ASWA 4MMYB 4BQCA 5ADOL 3AS0A 3B37A 3VXUB 5B8CA 2F53B 2ZJSH 2W0FB 3RGVA 3TP4A 1WD9A 5FCUL 4QT5B 3CX2A 2DL9A 1TITA 1KLFB 3ROLB 4Y4KC 5JMOC 2EEFA 3ISYA 2R2BB 5CJOH 3B9VA 5FYKE 3MVSA 2HMIC 3G5XA 3VRJB 4O5LH 3OB0H 1FAKT 4AYDC 4JFZH 2WO2B 3W0WB 2VN7A 1FAIL 3QCTL 4ZO7A 3HVNA 5I1JH 1YEFL 3LV3A 3EO9H 2DQHH 1XD1A 4KKLC 3RWGA 4F7TA 4BH8B 4P2QB 3HNTH 3VXMD 3W9EB 1FFOB 1P5UA 2FUTA 4FA8A 3D12B 3L4CA 4W4OA 2A9DA 4Y9FA 5GRZA 5A6LA 3T0VA 4D94A 5K9QG 5I18L 5HDWA 2G3MA 5F9WB 1TEFA 1NC2A 1BZ7B 1HXMA 4E42A 3JVGC 4FL4B 4XVSL 1MIEH 5I1KL 1LE9A 5DQJA 1HIML 3EJJX 4IDLA 1MRDH 3QDJE 3SDYL 4Z7QE 2LU4A 2ATKB 3F5WB 4KAQL 1SOXA 3BRFA 3GKWH 1FL3A 4OZFG 2QPEB 2LLNA 1ZTXL 3MA7A 4X6DB 1IARB 4M1GH 2UXVA 4KGLA 4MQSB 4FNQA 2UZYB 1J48A 4K5PA 4IOIB 1GIGH 4KOCA 4GRWF 4PJBB 4XE5B 5H37A 3RVUC 2D3VA 2ZKHL 3B2UD 2YBRA 4KDTC 4GSQA 2F7RA 3L4VA 4OGZA 4YDJA 5B22A 4EIUA 5LKNA 2R0KH 4K3DL 1N8ZA 1E2VA 4LMQE 2PF6A 3OKNB 4OQTA 3VFRB 2O5ZL 4M43L 5C6PB 1HILA 3DECA 3ET9F 4K2UL 2H8PA 4OKVB 1YEEL 1A6TB 1NCWL 1TQUA 2IDSA 5KOMC 2HPOA 1KYOK 2CDEA 5IJKC 1SJMA 1Q94A 2ADYA 5CCHE 4JMNA 1T5XB 2Z0BA 2Z31B 1NJ9A 2XFXA 3DJRA 3FOMA 3HR6A 2RH0A 4XPBL 4F9LA 1R3IL 3GSXB 1XF1A 2I9LB 3G5ZB 4QUOA 4IRJC 1M7IA 4KTEH 1JPFB 1QBLH 2AERT 4L29A 3DO7A 3L2LA 4QRBA 5GGSB 1FVEA 3CCHA 4GMSH 1BV8A 1UCBL 2BHYA 3B2VH 1GW0A 3M7FB 4FHJA 4MNGB 3MBED 5EU3B 1BF2A 3FQNB 1FYTE 3ARGC 4FLOA 4CC4A 4LSTH 4KK8C 3RKDC 32C2B 4LLUA 3H42L 2DWTA 1C5CH 3QPQD 3VXRB 3GDBA 3ZR6A 1XT5A 2VXVL 4JRXE 4DESA 2W0PA 2Y36H 4N20A 2A6DB 1TNNA 3LZLA 4FXGA 2D03L 1RUQH 3ARFB 4PB9L 3VFUA 1XCTB 4MLIA 3T4YA 1ZVSB 5TH2B 4OLYL 4KWUA 1CXEA 4J2XA 2A9CA 2MQCA 2XJKA 1CGYA 4ANXA 3LKOA 3REVB 3DJ9A 4MBOA 1TTFA 4PGBB 4QHPA 4F9PA 2W81C 3EYFB 5CLXA 3WKQA 1OANA 1U91B 4AVHA 1WIOA 5AEAA 1IBFA 2AJZB 5J3HC 3BVUA 2ZWKA 2ZCKH 2MCAA 1FNGA 5E6IC 1J8HD 2EYSB 4LGSB 3MLTB 1PQZA 3G5VB 2P5WE 1RK1A 2ITDB 2NY2B 3CMOH 2Z4TA 1BD2A 1U92A 2HRGA 4LLYA 2H6PA 3JWNE 3MJ9H 3T2LA 4KRPB 3IYLW 4N8CH 2QZ5A 1OW0C 4N0UB 3CDZB 1JZJA 3MUGB 3O6KH 1YEJH 2YA0A 2OA9A 1R3IH 1WEJH 3TZVB 5K9QI 1RZJH 2PTVA 4F8LA 4TNEA 1IM9A 4AG4H 2XTLA 4DSYA 4RWYL 3MLUL 2EVHA 2ZT9C 2PYED 4Z5RB 3NA9H 8CGTA 5DWUL 3MGTB 1JZ8A 1AD9B 1EZSA 5IM7A 5C0FA 4FQJL 1U58B 3IDXL 4AT6B 1OSZA 4PHXA 1YEGH 4TPRL 4ZTPL 3RWCA 3TA3D 3U2JA 2VJXA 1N6QH 2BNUB 1IC4L 5TDNA 5E5LA 1C5BH 3DOIA 2QKIC 4KI5C 4PTTA 3NZ8B 5EHFA 3PNWA 4G59C 2FO1A 4KKQA 4JFED 2CBOA 4P2OD 5F1KC 3R8QA 4B7LA 3TEZA 4LCUA 4WDIB 3VG9B 2XVGA 3FOLB 1I9EA 1QO3B 2C4FT 4ZOAA 4DP5X 1X3DA 2Y1AA 1ET7A 4Y19E 4MMXA 3S3CB 1V27A 2FL5A 3D25B 3DVFA 2VMCA 3Q8AA 3OGCA 4NQDB 5SWQA 3VXSA 2NUPA 2X4QA 5IVXB 1S7SA 4C58B 3FONA 1IEAB 1GXEA 2WN3A 1MREL 4OT1L 1FC1A 1PG7H 2G60L 1AKJB 2KYIA 4RX4D 4QRFA 5A2KH 3EOTH 5CINL 1HHIA 1JYNA 4CKVX 4FZEH 4XHJC 4EDWH 5AENA 3GSNL 2UUDH 3IFNH 5EOQL 4ELME 5I1EL 5JIIA 3F8UB 1OIOA 2XIIA 4WI9A 3AY4C 3QXAB 1UYWH 2OL3A 2VUYA 5BQ7B 1FDLL 1P69B 3QC6X 1J05B 4IRSC 4W4OC 3ULVL 3NSXA 2ZOLA 5CHNB 3UMTA 4KJYB 3HVDA 3HTLX 4LU5H 4XNXH 3UAJC 3VXQB 4L8DB 4PJCE 4FRWA 5KAQG 3HCVB 4LB8A 4LVHB 5MHSE 2HFFB 2IMMA 4UZUA 1LK3L 3KLHD 1YEGL 2PW2B 6PCYA 2IOOA 1AO7B 3ZL2A 2EXYC 5DQ9B 1RZQA 2OZ4L 1G0YR 3TPUB 3KS0J 4F2FA 5ICZA 4MRBA 4B50A 5LNEA 3GTVA 1NDTA 5F1NA 3UGUA 2YXMA 5A7BA 2ZSWA 4Y1AD 2IADA 5HBBA 2BP8B 3BVNB 1W0VB 5CAYB 1AMXA 2IGLA 3NRPA 3QWQB 2EEAA 1L4IA 3QAQA 4M61B 1A4BA 3N44B 2IANA 1JG9A 4KC3B 2NY5H 4H8VA 4L5FH 2WXFA 4CNIB 4HAFA 2I60H 1WBXB 1NPUA 3VNZA 4I2XB 1CFQA 2BC4A 2XN9D 1O5PA 4FQ2H 4NPYA 3EOTL 1MFVA 2R2EA 5IMOA 5DMIL 1OAUL 3BWAA 1EIBA 5MEQB 1DQDH 4N0CD 1NCDL 4JUTA 2WBJB 4DIXA 2GIYA 5E2WH 4BQBA 1LD9A 5AKRA 1ZT1B 2CO4A 4EOWL 5T3ZE 4G43B 4ONFL 5C0CD 4GG6E 1AZZC 3AB0B 4RBPH 1N5AA 3LS5H 5ITFB 4JGJA 4S1SL 4X5PA 4U1SA 3DETD 4FQ1H 5HHMD 3BQUB 3GB7B 5MERB 1X7TA 3GWJA 4K7PX 5D72H 1O6TA 5PAZA 1N3NB 4JY5L 3S36X 4PJAB 3PQYB 2LV4A 3A23A 4JFYB 3L3OB 4JG0L 4JJ5A 3LXCA 2FE0A 3LB6C 3TBVA 3DV6B 2UXTA 1TZHA 3IPFA 5DJ0B 1T66D 2QMKA 4TLSA 2OQJA 3TBYA 4I0PD 4OJEH 4PJCA 4FULA 3D51A 1NUDA 5DXWA 5JORB 2XG5B 4MNHA 2FO4A 3G5ZA 5JIPA 2RBLA 4Y1AB 3BISA 5LGHL 3V10A 1E9OB 5BZWB 4UT6A 4K55A 4PJDA 1A3RL 3WJMB 2JIXD 2H2PC 4WO4B 2BXZA 1D9KC 3W56A 3WEXB 1TVBB 3O6FB 4ELMA 1ETA1 4P06A 4ZAKC 3RX7A 1I7RB 3UOAB 3LIZA 1Q9KB 2J1XA 3EJSA 2D3JA 4H5SB 3DUUB 1RERA 3II1A 3K2KA 1UUSA 4ZFFA 1I3GH 4MD5A 2PN5A 2EE3A 5GRJH 3V4VB 2Y1ZA 1G9HA 2J6EL 2DQTH 2JQMA 2OW7A 4HALA 1BF8A 3HG3A 5CUSL 3SYAA 4O51B 2EICA 4ZYKB 1J1OL 5BZZA 4R7NB 4ONGL 1W0YT 2P43B 3C12A 1QSFE 1MCPL 2X4SA 5IZ7A 5K59E 8FABB 4N3TA 3WFCL 1AANA 3QJVB 1MJUL 2KDYA 2CXGA 4ISVA 3R19A 4GUPB 3GBNL 5CIPB 4WY7H 2X4NB 3BYYA 5BVPH 4HUVB 4OJFL 3GSNA 4FFYA 1KACB 5D1QD 3V9EA 1TMQA 2CR3A 3K5SA 3MV11 2YUVA 4OFYD 2V7HA 5L6YH 2LLGA 3H4HA 2EIKB 3AWEA 2N0MA 5GRUH 2NX5B 3QORB 5ADPH 4LLYB 4DGYH 1EK3A 5EBGA 1KJ2B 1A6VL 3TWYA 1I1AB 4O58H 2MJWA 5F7FA 4LHUA 1K72A 3TZVA 2IDCA 4RGNC 4XPTL 5CBAA 4KTGA 1BLIA 4X6CE 4Z0BH 5DT1H 1BBDH 3FCUB 4NO3B 5FYKD 2WVUA 5DJXA 3QDAA 3HBPA 3SGJA 1F2QA 3E0GA 3CBKB 1CGUA 5C0FB 4O9HL 1OAXH 2ZWSA 3QRGH 4ADGA 2OMZB 4DZ8A 1NEUA 4HG4K 3HS9A 1J5OH 4BWWA 5GSRA 1UKSA 2MQGA 3DXAA 1XF4A 4K9EL 1BXAA 3ULVC 2YSTA 2VYRE 4X80H 1JZEA 2VDKH 4AIEA 3H4FA 4JZOB 3QT2A 1XMWA 4O2CB 1D3CA 4AGPA 4LRIA 4TNWF 1QSEB 3FO0L 4PJXF 2G5UA 2X9YA 4TUOA 2QHRH 4DH2A 1XB3A 3E2HB 4JREB 1QO3A 3KM2A 1F2XK 3DHPA 4BFOA 4P2QE 1QSZA 3QQNA 3VXNB 3GLDA 3L5WB 3IU3B 3VXRA 1ZLSL 4DTGH 5ITBH 3S98A 3VGFA 4NKMA 2CGYA 3N0AA 1KT2A 3C09B 3F62A 2A74A 5EPMB 5JA8B 1Q9WA 1FNSL 2PCFA 3WEBA 2FWUA 4JFUA 4G8FB 1DZ0A 1FVCB 2W88A 1NFDB 2M8XA 1HXKA 3UTPE 3S34L 5C09A 3MDJA 1T1ZB 1TG8A 2HB0A 2QVMA 2OV0A 3BEWB 1RP9A 2JCCF 1R0AL 1MIEL 1FORH 4DVBB 3O4LD 3F04A 1E4KA 4JCMA 4LCCA 5DJ8B 3BO8A 3WMPA 3AU1B 4Z95H 1ZIAA 1QTSA 3SBQA 3K0WA 4I0CC 4OI7A 2HFEB 4OFDA 15C8H 4Z7NB 1DJYA 4F7MB 1R3JB 3SKNB 3DVNB 2WIMA 1XV8A 2VW7A 4NP4H 5K9OB 4S1QL 5FDWA 1UZ8B 3JTSA 4QXWA 2NPLX 3RFRA 2OW6A 3H85A 4Y2DD 4K3DH 4U6TA 1WAAA 2XWBB 5ALCH 2R8SL 4LBAA 1P9MC 4ODUA 4CSZA 3FO9B 3JTTA 3VFTB 2WUBH 3L7FA 4URKA 1TJHL 5JPMA 3H0TB 2YUXA 1KB5H 1ZA3A 3H9SA 1MJJA 4HCRH 4ZS6D 5BRZD 3GSUB 2P4AB 4WJG3 3QEUA 4XNMB 2XIDA 3MRJB 5D7HA 3U9PH 5DLMH 3EZJB 3ABLB 5J6GA 2YGOA 2PXYB 2LVEA 3K81A 4P46D 2AVFA 3IB4A 4KQ4H 2VZUA 1ETB1 2EC9U 4LPUA 2ITFA 4FXGC 4UDUB 4ODXB 3EXJA 4RQQB 5E5MA 2P9RA 5JXED 2F8IA 1BF5A 3BP7B 1AAJA 3U2SA 1PMYA 3K1DA 2VZTA 1AS8A 3ZE1B 1NICA 4F7EB 4FNLL 5EG6C 1SDDB 1G9NH 1PY4A 3EYUL 3P0GB 4XXCA 2IEPA 3OBAA 2GJRA 3O6LL 2Q86A 3W0WA 3TTSA 3OAUL 1D5RA 1ET8A 2R1WA 1RFDH 2NNFA 2QL1A 3NUKA 2OSYA 1N5AB 3L5JA 1H3TA 4JFEE 5GS1C 3SCMD 2NXYC 2H0EA 1EX0A 4EI5A 4TM9A 1G43A 3A0OA 2HLAB 3BAYA 5E99L 4JLRB 2PP8A 3RNQA 4D0BA 2VW6A 4NO0D 4Y9CA 3K8MA 1GYAA 3OKEA 5I71C 3A4DA 4EZJA 1TCRB 4JEGB 3QR2A 3LKPA 3CFKB 4WHDA 2EUXA 4F1ZA 1SBSL 4Q14A 2OR7A 2CA4A 1AY1H 4R5XA 4J3SA 3U7WH 4OFVA 2BY1A 3N85H 2H47C 3KYKH 3L1EA 2FLMA 4GP5B 5FGRA 3ZDZE 3EFFA 3MJ9L 2WQRA 4PG2C 2X7LA 4Z6AT 1QHQA 3I6KA 3BGFC 1N8ZB 1TTAA 1KIQB 4R97B 5ENWA 3SGDI 1EO8L 1UXSA 1IL1A 4DPAX 4AG4L 1QR1B 3SCMB 2H0JA 4HHWA 1SOQA 1E6JL 3C5SB 43CAA 5EUOE 2DM2A 4P5SA 3LKRB 4OLYH 2COVD 5K9KA 1DUYA 2X4TB 2GI0A 2X4PA 4OGAD 3VVWA 5CJXA 1MH5B 3IDNA 3VXME 4HKBA 5C07B 4YDLC 3VGHA 4KGJA 4I77L 1X5KA 2QR0B 5E08H 1X9LA 2AEOA 5JDSA 4JQIH 2NZ1A 3ECQA 1TUPA 1C8QA 1KCSH 3WTUA 1FVEB 1IGYA 4R7XA 3OXRA 4C56E 5IQ9B 1TQCB 3BKYL 2QMJA 1UGNA 3BP6A 2CBMA 3BWAB 5E24E 4G80B 2XQYK 4L48A 3IXTA 3FQNA 2F9BT 1FZOA 2FQGA 3GSQA 1WYJA 3D5OF 5FXCH 1NDMA 1N2RA 4QKXB 1TTRA 5AZUA 4HU2A 1PG7X 1KFGA 5EOCL 4W68A 5AAWA 1H3PL 4U1SB 5B39B 1JZ7A 5TFSH 2B9AA 4JRLA 3QEHA 1JGUL 4NO5A 2V37A 2O6CA 2EECA 1JD7A 3RWDB 4IBTA 5I1EH 2JELH 3D07A 3L3OA 4FNRA 4UQCA 4J23A 5IMLA 5AOJA 2A6KA 1NKGA 2B8OT 4JPIB 3G08A 4UT6H 3TT3H 4MB5A 1NMAH 3VX1A 1SJHA 3EDFA 1YG9A 5HHQA 3FF8A 5C6WH 2UYLA 3J27A 4DZBB 1FNGB 1W80A 1ITBB 1GGBL 1S3KH 4HX1A 1JD9A 4OAWA 2HJKA 3WE6B 4XRCB 1IGFH 2CBTA 4NXKA 2ITDA 4G8IA 4QDGA 2H41A 2C3VB 4PV8B 4F33B 1ZLEA 3RE0A 5E03A 5ABZA 5IP4A 4HUUA 1A6TA 4DP6X 1I7RA 4B27A 5DTFB 1DDHA 3RJOA 1BX2A 1F4XH 3DPDA 1NCAL 1HU8A 1ULVA 3MTXA 3BN3B 4JZNB 3VWKB 3DYOA 3FHAA 4PSPA 4QRAA 3EH4B 1G5GA 1GZPB 1OSZB 1SF5A 4KI5F 3N42F 2PO6D 3OSKA 2R7EA 1IT9L 4XP6H 1P7KA 4NAMA 5JPMC 1AS6A 3E6HB 5GGSA 3ETSA 2KZKA 4KO7A 1MCNA 4HMEA 3VWKC 4YXKH 2QKIA 4PG2A 3VFMA 4WKXA 1T7VA 4R0LC 1DUZA 2R29L 1KJMA 3MJ7B 3FQYA 3ZZQA 5TFSL 1DFBH 1A0QH 3MLWH 2L7JA 3DX1A 1DLFH 2HLEB 3FT2A 3ARXA 4C57C 3KWUA 2GHWB 2ZUUA 2LT9A 3GRBA 4APXA 3KJ4B 2PPFA 3VTMA 4FDWA 3CU1A 4UDTA 3TT3L 1H8SA 5D8JL 4BFNA 4ESKA 2BO0A 4OTXL 1MFCL 2P1YA 2NW3B 4R97C 2W80C 1QEWA 1DCEA 2GITB 3BWUF 1AYOA 3KXFA 1J1XL 4Y16D 1V3JA 2UZIH 3SB3A 4YBLB 5AG9A 2YRBA 2FT6A 4QO1A 1D5XB 3MRKA 2AJVL 3MRLB 4A2DA 1JNNH 3R06B 2OJEB 4AK1A 1HFUA 4L8SA 4UT9H 2NXZD 3EYQC 4MB4A 2FECL 4QRPE 4L0ZA 5A16B 5T3XH 4B3EA 1MJJB 2AABH 2CBQA 2GI7A 2WBJD 1UD6A 3NFSL 3LNIA 2O6FA 2XBTA 3D2UA 3EUDA 4UMGA 3VXSD 4H13C 5D1QB 4P4KD 3DMMA 3QGVA 3H2QA 4IRSA 5LLIC 3IEAA 1VFAA 3IRPX 3CUPA 5FCSH 1T04B 4XN2A 4XCCH 2XWCA 1QBMH 4ZXBC 3O2VL 5TQ2H 1P4IL 2IAND 4L8SC 2Z7ZA 1OQOA 1YPZE 1A6UL 1ITCA 3AU0A 4GKNB 4MQXC 4X8JB 1RVFH 2F7PA 5D72L 5DEGA 1Q9OA 3B7RL 1KZYA 4HA1A 4B95C 3PHSA 3UPCA 1ZTMA 2EAEA 3K4AA 2X1QA 4OZHA 4WNQB 1AP2B 3VH8B 2Y7QB 3FKUS 4CDGC 3ASNB 3JV5A 3RX5A 5TDNB 5D9SA 1NFDA 2RFXB 2V2XB 2VZSA 3HHRB 4ZO8A 1R3KB 4KK8D 2NW2B 1N5YH 4AQEA 4EI5B 4ZTOL 3C5ZC 5ANME 2O6EA 4ONHA 3AQXA 2H1LM 4XMTA 1YNLH 5AQ0A 4M8RA 2CK0L 3MX0A 5EORH 1DQQA 3ABKB 4WSKA 1JVOA 3DUSB 2NNAA 2E5EA 3M7OA 4LL4A 3C8DA 2MWCA 2WBJA 1CQKA 2ZXQA 1R3HA 1EEZB 2Y69B 3J07A 3O2WL 5FYLH 3STZA 2IPTL 2NY1D 3PJSA 4TULL 2QVTA 1CVRA 3RP1A 2QJDA 4XMUA 1W0WA 3RWEA 1C08B 3P40A 4IW4C 2WJ7A 2H0FA 1OB1A 4NCC2 1F3RB 2Y1VA 5TPWL 3KPSA 4E41A 1M05A 4ZUTA 3K3QA 5HHMB 4GBXA 1ZLUH 3GXFA 2YKKA 2VIRA 4M48L 5LN8A 4HK0A 4HFWB 1XSIA 7CGTA 3ZHKA 4IBVA 3FB6B 3TV3H 3FQUB 4YX2L 3WMQA 2X9ZA 1X5MA 4L8DA 3VE0B 1XTLA 4FQCL 3Q5OA 4HWNA 3V4PB 4LSRL 4MCZA 4P9ML 1JZDC 4PRPB 3CAFA 2EILB 4Y1AA 3Q05A 5DQ9A 4MJ4A 5F97E 1P6FA 4X7CC 4PREB 3DV4A 2VO8A 5IB5A 4F7EA 5ESAB 1M9SA 4F15C 3MRFB 2AFNA 5CLTA 4FZ8L 5DHVB 3TO4D 4B97A 5J0BA 5HVHC 5E56A 2G3NA 3EIFA 4NRYA 1TTGA 2Q86B 1CK0L 3ARPA 1CIUA 3RVXD 1ZLSH 1Q1PA 5EZJA 2CO6A 4R5VA 5L8JB 3OZ9L 3FFOA 5F1IA 2BK8A 3KPRB 1NBVH 5IEKA 2YAQA 2FYYB 2F5BL 3EJYD 3VGDA 3W0WE 1MI5D 4Z7VB 3HI6H 5IEHB 3E6FA 1UUNA 1JF6A 4JLRA 7PAZA 2H6OA 1A3ZA 3HE6A 3CK0H 1EWHA 2HN7A 4K23L 4PBXA 5E8DH 3RWHA 1RKRA 1NC4D 4I2XA 2PO6B 2ZCLH 1S9KC 2FEEL 4WFEE 8FABA 3PGFL 1SRDA 3QJFB 5D2NB 5IHUL 3FTYA 2IG2H 5HHQB 1IEBA 4YLBA 4J3VA 4ZNCD 2FUQA 4FFZL 1JWUB 2MQ0A 1A9BA 1J88A 5CSZA 2FATL 1Z9PA 4OAWB 3MOAH 3V4VL 4NP4L 3GJFA 4C8XA 4EI6A 1AIFB 1V3LA 1OGAB 1OO2A 1WAAF 2E6QA 3V5DA 1CBJA 3P0YH 3UZQB 1EXUA 5E9AA 5I30L 1BAFL 4WWKB 3WFDH 4F33A 3HN8A 3Q2VA 3DLQR 3DNKA 5D55A 4BFIA 1A21A 2J8UE 1CLZH 1QBBA 3Q48A 2C9SA 5E1AB 1E5UI 4MZIA 4NP9A 3ZT7A 2XTJD 1A1OB 1TZHB 2BSDA 5FECA 3VXRD 2Y4SA 1P4LB 1LWJA 1RZ8B 3LQZA 4XNYL 2BRRH 3TBYB 4MCYA 5DLML 1A6PA 1M6OA 3VWJB 2XWJB 4CBPA 4G6ML 1FVDA 3MBEB 5HDBE 4IGBA 2XQ0A 3Q8CA 4A6YL 2I24N 3KW8A 3FHQA 1BREA 2VDQB 2F15A 3G6JB 1PPIA 3HG2A 4NAQA 3OZ9H 5CJ8A 4YHML 4U6HB 4PRHA 5F7HA 1MI5E 2ARJA 1QX1A 4P2OB 3QUGA 3RPKA 3BI9X 2HRPL 3QSKB 4FNTA 4DO4A 2O93L 1CDHA 3HI6L 1TOXA 5CFHA 4XMXA 4IBZA 1BP3B 4YHLL 3MBWA 2P5ED 4X5RA 1T89A 5I1CH 1PF3A 3LN9A 2YA2A 4IGBC 3H7BB 2FDBP 5I6LA 4JFOA 1MZZA 2CKBH 2CIKA 2O1AA 2B16A 3E1F1 3BZEA 3VXRE 1FGVH 1G6RL 4KXAA 1IUZA 2WXPA 3KXFB 1HNYA 1UA6H 1I3UA 3SQOH 2X4SB 1OAZL 3QQDB 2UX6A 3MV8D 3OWRA 1B4JH 1B9ZA 2W07B 3WS3B 4E9YA 4L4TB 2DIBA 1TSHA 4X6EB 5EH1A 1OCRB 5DJ8A 3VSQA 3DTUB 5I23A 2ED9A 4CL7A 5F44A 4KHXH 4DW2L 2DL2A 1PIGA 5ACLA 1ILUA 5D1XB 3BH4A 1UURA 1LNUA 4D3CH 2G4EA 3NGBB 3TIDA 2AQPA 4PR5A 4XVUC 2BNQE 5IMKA 3IDUA 2ZTBA 1GS6X 2YD3A 3T0EB 1RAMA 2F7OA 3OAUH 3ZLQC 5E6IB 2H3NA 1K3IA 2JCCE 4MAYA 2XWBA 4OZ4B 4L8BA 3W57A 1MZYA 4PVMA 1ML0A 1EO8H 4A1RA 1F18A 4CGTA 1J7VR 4N0UE 4MJIB 2YSSA 4Y2OB 3L7FB 1SEQH 3PWPB 2DYPB 3WEXA 2EO9A 1ZA3B 2DWXA 4M3KB 4LLQB 5KW9L 3W0WD 1AP2A 3NCMA 4PUBL 3G6DH 3DX2A 4JM2D 3UX9B 5AB0A 3IS1X 3EDEA 2H4EA 4NO0B 1Z0NA 5AB2A 1NBYA 2NZ9D 2PWEA 4RMUA 3SJVE 4ABUA 3Q06A 3Q8BA 1Y07A 3QUZB 2X0VA 2J6EA 1M2OA 5CU9A 4D7BA 1NBZA 4OLXL 2YPLE 2WKOF 1HH6A 3RZCA 4XI5C 3TNMA 3KYKL 2LAAA 4JFZL 2TSBA 1LO2H 4OD1H 4Y89A 1NCBH 5GGTA 2AC0A 3CC5A 1OAQL 3K74B 5AB1A 5J1TC 4HWBL 1ZT7A 1XFPA 35C8L 4U1JA 2EXSA 3TNNA 1OAZH 1FA4A 4AQOA 1DL7L 2CZNA 1RZGB 4H88H 5ICXB 5DK0B 4DN4L 4FQLH 2V8MA 2COQA 5I18H 4NNYA 5D7EA 1N64L 4N0FB 2CBPA 3UO1L 3HE7A 4DHLA 3SQBA 2G4GA 1BBJA 3LZRA 2A9AA 2WKGA 1NLBH 1XQ4A 2Y0SA 4HXAH 5CZVL 3KPOB 3LDBB 4X8CA 3MA9L 1JZHA 5I66A 3WNNA 3IKCA 1G7PA 4WHYH 4LEXH 5L2KD 1D5IH 2QQLH 4GSDL 1UA3A 5MENB 3ALPA 3DSNA 3QNZB 3RIAK 1TZIA 4PJ7F 3PL6D 3TBSB 1GGBH 1CFMA 3MLZL 3QIWA 3H56A 1SEQL 2GTWA 4JRYA 1AMYA 3RFZA 3M1BA 4HD5A 1ORSA 5JIMA 3VD3A 2EDDA 3UZVB 2VR6A 2ZUTA 2DMHA 1UOVA 3G6DL 1OP3H 2APTA 4I18B 1T7WA 1LVEA 2CG9X 2BFVH 4YBLC 4WGVB 3T77A 4G9DA 4N2MA 1Q1JL 1YN6A 3KLHC 2ATAA 3LXUX 2WQ8A 4M7JH 3P02A 1KCVL 3S3SA 2G9KA 3M1CA 1ZHKA 4OLXH 1UWEL 3L4WA 2ILLA 5L9DH 1MHPL 5K9KB 3HZYB 1H19A 1EUTA 1QFWH 1UOKA 1MLBA 5D7IE 2BNQA 2VE6B 3AS3A 2FJUB 3WIIH 2EO7A 3ABGA 1CTOA 4B9GA 1SN2A 3D7PA 3HE7D 1Z5HA 1JK8A 1SVCP 4DQOL 4MVBD 3IDIA 3GBLA 2ZUYA 4RWYH 2K4AA 4EI0A 1DBKH 4Z7OF 4LCWE 5DQJB 1JZFA 3QQ9D 2FJFB 1QA9B 5BS0B 4P9HH 4K5MA 4BM7A 1IAIL 3DUSA 4IGBD 1DANT 5DRXA 4YE4H 2MCPH 2VDRL 2N7SA 4IEFB 4A2FA 1NWOA 2PTUA 3O0RL 5C07D 4Z3IA 5HYIA 4N8VB 3BWZA 4XI5D 4OJDH 3RUGF 1V55B 4PGEA 2WTOA 4NZTL 3L5XH 3NIDE 4TVPL 4L4VE 1K4CA 3ECBA 4ODHH 1RUPH 1KGJA 4EO5A 2CDGB 2B3IA 3QDJD 3C6LC 1DVFA 1T1WB 2WZPD 3RILA 4D0BB 1Z66A 3HLKA 2EDLA 3OKEB 4DP0X 4HJTA 4QLWA 5I16B 5G55A 4TS6A 4UM9A 5MP6L 3N42B 1NCTA 4HSQA 4MDRA 1ZHNB 3F00A 3C8HA 3GUFA 2HA1A 3HBZA 3A4AA 4ZFZA 4LFHD 1RUMH 2XOTA 4JPSA 1PIFA 1XSOA 1WP6A 2OI9C 4H8WC 4MCYB 3VWJA 5B8CC 4UCFA 1NJ9B 1FVDB 2XFXB 1CR9H 1Q1JH 4AC2A 3LKQA 1WZLA 3WL9A 3O3DA 3IMRA 5EIQA 1MQKH 3GSNH 1FZKB 1X6NA 1QBML 4BSVB 3QI9D 5I76B 1IBDA 4NZJA 1BIIB 2EIZA 1YYMH 5GS0C 2ADFH 1NOAA 5BJTA 1OSPH 4FADA 4XOAA 2EDWA 4YDIH 2YKLL 2ADIA 4IDJL 1KB5B 4RGND 9CGTA 4UQAA 1YMME 1J1XH 4X9BA 2Z93B 4Y2NA 3CFBB 3DJTA 4QJ4B 1DUYB 4ZUSA 4JANA 4OM0H 3OKMA 5AFAA 3IDNB 3N5AA 2XY2A 3MV8A 5D4IA 5L2KB 4G83A 4JG1L 4QHKJ 2BIQA 4MKTA 4ODWA 2X1OA 2X44D 1X9RA 2ARWA 4HV8A 2QGEA 4FLQA 5F2FA 2EYTA 4GO8A 5GHWH 1J0YA 3FH5A 3LQAC 1I9JL 3IRCA 3WS6C 1VAHA 3FT4B 1CE6B 4OH2A 4HJ1A 4F24A 3EYFA 3RTQA 5FYJU 5HDBB 5LBSH 2J21A 2UWEB 2ZUVA 5D4JA 5FK9A 2GJPA 2IGFH 4GW1B 2FJGB 1QW9A 2DLFH 3ARGA 4PYHA 5AKVA 5F96L 4YDKL 4L1LA 3MUUA 3U4BL 3X1FA 2IFGA 4XMPH 2QPSA 3KPPB 2VQ1A 3FTXA 1LXMA 5AVXB 3JWNG 4M03A 4O00A 5EN2B 3X11B 5J11B 3GF8A 2R83A 1GGCL 3WTSA 1A1NA 2Q1EA 2X42A 5D2NC 3WGVB 3TYFA 5EF2A 2P80A 5D2LE 5HDQH 4RLDA 3MN8A 3LPPA 4FL4C 4LP4A 2YSSB 4Y2OA 1ZLWH 3LS4L 3O2DA 2LU7A 5MEPB 2X2HA 2WWKO 3O45A 4OVUA 2OJ1A 4A7QA 2YD6A 2J8OA 3MV9E 3QEQD 3DVGA 3U82B 3QEQE 1MCHA 2YKLH 3CQPA 1YECL 5FB8A 5BNXD 2J71A 4OCYH 1YNLL 1OHQA 4OIIH 4Y9GA 4U0RC 3NSCA 3BQUD 1EMTH 1RU9H 1T04A 3EO0A 2V2TB 3COOA 3V0JA 3O2WH 1N4XH 4LSVH 5IOPA 3NCJL 2ZYRA 4X4KA 1FO0B 5F7AA 3V52H 2H26B 3HHSB 4I4WB 4DAGL 4NQEA 5DTFA 1NINA 3OX8A 3P9MA 5D1XD 4XBGA 1N0LB 2V7NA 1UM4H 4FEIA 4D0CA 5BCAA 5I8OH 4ETQB 1S46A 3S35X 2WXQA 5CD3A 3QPQC 1Q9LB 2RTTA 3FRPB 1NC4A 2R7EB 12E8H 4JPKH 4AIXA 2XCMC 1RZJC 3ARFA 3TV3L 3V9FA 1XGRB 3MRMA 5BV7L 3FTZA 5AKTA 2Q7YA 5HYFA 3MLVL 2YPLA 3I6LE 1AYRA 4LSPL 2FSEB 1R5VB 3HB3B 5BOPA 1A02N 1ZJBA 3WDIA 1DSFH 4IKLA 1CFTA 1IB5A 4HS8H 1DQQB 3A6BH 3LHPH 2ENPA 1W15A 4R83A 2P5EB 2GVYA 4HGMA 1OPGL 1KTJA 4YPGB 1EHLL 1BXXA 2NW3A 3NJHA 5DQDL 1ZD6A 4OLWL 3RDTA 1OT4A 2Q3XA 4UAHA 3PDDA 3UZVA 3UBXB 1JIBA 2ZCHH 3GS4A 5SX4I 2LOEA 3IGAB 4L4VA 1GW6A 3NP3A 2BWIA 1A1MB 1BMZA 4XNUL 4DP4X 1I1AD 3SPCA 3DMMD 4AWJC 3SPVB 4P4RB 2MNUA 4ADJA 4PJHF 5DHYB 1O75A 1L3NA 4M8VA 1IX2A 5JYLA 3EJUA 4X0KA 3D2UB 4PY8J 1BA9A 4PIBA 4OGXH 1RIHL 4D8PA 1CYGA 1OGSA 3VXOA 1QRKA 1A6VH 3RYMA 1T22A 3VXPA 1N12A 2G3XA 3QK0A 4UM9D 3FNKA 4F57L 3Q1SL 4NWUH 1MCSA 2R4RH 5C0AE 3DYMA 1AKJD 2XUWA 4JKMA 4QF1A 1AGBB 1NGWB 3D3VD 3APMA 5AOZA 2AK1L 3VFOB 3O9WA 4E2OA 5HGGS 2X05A 1LK2B 1HYSC 1TLMA 4NPYB 2PPAA 5IBUB 2ICES 5DHVA 1OWWA 3QIUD 4Z7QF 2GC4C 4G6JH 4QTIH 4LIQE 1A8JH 2XTSA 5HGHA 4NUJA 4O02H 2VXQH 4G5ZH 4HF5L 5D9SB 4N1HB 1UATA 4JKPL 4JO3H 1B6UA 4QPEA 4M7ZC 2FYYA 2WTPA 1T7ZA 3V7AG 2EDMA 2QELA 3KR3H 2YAFA 4OZIB 1XIWD 2J2ZB 2VB5A 5I1GL 2VDLL 4I48A 4KDWA 2DZEA 4DKEL 4F2MB 4RESB 5HYSB 4LO9A 5LBGA 1QD0A 4XBEL 3TT1H 4QRRA 3OV6A 1G7PB 3MRBA 2AI0H 2C34A 2C4FU 3HE7C 4K3JL 1X7SA 5D4HA 4N3UA 3P0VL 1GYUA 3AG4B 3ZYOA 4PVLA 3QWOA 3QIWB 3WS6A 2D0HA 4XWGL 4Y2DC 3MACH 3M8OL 1KIRB 4KRNA 4RZCB 4U6VL 3SO3B 3TZVD 1HEHC 2CUHA 4AH2B 2PTTB 1NUNB 4KRPD 5IROC 3RBGA 3WIFB 1OB1B 3SDAD 3B2VL 4OGXL 4ANKA 5IB4A 2BSSA 4FQPA 4NKIL 3CIAA 3P30L 3EOAB 1KELL 4H1LA 3BUIA 4WO4A 1PCXA 4X99A 2ITCB 2VIRB 4JM2A 4Z95L 1BYNA 5C0DB 4HFWA 3KWXA 5ICUA 4HCGA 4P2OC 1IIKA 2R29A 3VI3F 2PABA 1IBGL 3VSUA 2IH1A 4G9FE 1UH2A 1Y1UA 4JBSA 4MMYA 4XCEB 4Y4HD 4JN1L 3WFEH 5LG6A 4HZ1A 4UT9A 4KHXL 2JI1A 4CDHA 2X5PA 3MV9A 1K8IA 2GT9A 3KCPB 4D3CL 2KI6A 4P2OA 5AW9B 3SJVD 5BXFB 2NY1B 2UWEA 1HN1A 3U9PL 3WTTA 3FHEA 2AV7B 3CFDB 2I26N 4R2GB 2QTVA 4Q6IA 3T3ME 6TAAA 1IGCL 1QUPA 5HJDA 3TT1L 2NXYD 4S0SD 3HJEA 5D7LE 2XN0A 5CKAA 4WI0B 3TA3A 4DN4H 3E7JA 1KXQA 2V7HB 5DD5H 3BAKA 5FLUA 1WZ1L 5A3IC 1KLGB 1INDL 3TJEL 5HPMA 4JDVB 4K3JH 1YNKL 2NX5A 3QORA 4X5LA 3E6FB 3QRLA 5KSAA 3B2XA 3V6FB 4DOHB 1FPTL 4HLZH 3QUKA 1IC0A 3HZVB 1RULL 1S7TA 2GB2A 4OUOA 4LHUB 1HCYA 5IJBC 3LRHA 1REIA 3MJ8A 1I8MA 1ZHNA 4OFIA 4BSJA 2BERA 4ZBJA 4CADB 5GISH 2I7OA 1KXTB 5SWSE 2XZQH 4E9LA 2MH4A 3OKYA 1MG3C 3BH8B 3W9DA 1LEKB 2UY7A 4HUCA 5DUBA 3AS1A 3TIEA 3ZMNA 1CUOA 3BGMB 1KC5L 4ZUVA 3HUJA 1JWUA 2X9XA 1CO1A 4QHMB 4R9HA 4WEBH 5AVSB 5I71B 4ALAH 1C5BL 3ULSB 1TKWA 2EABA 2EH7H 4OVVA 2YUWA 2IC2A 1FYHB 5DSCA 1VGEL 2OXGB 5IB3B 1WITA 3MV8E 1DO6A 3RKDD 5I19H 3PWUB 1QSVA 1GJIA 5I6XC 1BQLH 2HTKC 3L6FA 4LK4A 4MAYB 4W9ZA 3FQ1A 1C7TA 3I9GL 1NKOA 4FABH 3T4AC 4JRXA 1XO8A 1QFUH 4E0RB 3QARA 4ZUSB 1CD1A 3KPNA 5F21B 4BKTC 1UWEH 1BZOA 2DQDL 2OULB 4W9JC 4D8OA 4U31A 1A6AB 1VFUA 4WLCA 3S8WA 1D7FA 5LB1A 3WN5A 2CK2A 3ARSA 1RUAL 1Q9WB 2DOCA 2IALB 3MKKA 4N2KA 4TMPA 1CGXA 4NO0A 4FNSA 5I74C 3DX9A 4BK5A 2C9XA 4NKDA 1OP9A 1WT5A 2FEJA 1IGCH 2N7AA 3I85A 5E0QA 3ZHDA 4OCMC 3FUHA 2ARJB 1UOLA 1AZUA 1JN6A 2Z1KA 4NQXA 1HL9A 5FFLA 4BCYA 4XE0A 3F6JA 1FE8L 4OLUL 3WNJA 2N3JA 5FK9B 4YHYB 4PJ6A 3KDMB 3MV7E 3JWDC 3AU1A 4QHNA 3UTQA 4L1SA 5F6HJ 4UINL 1V7NH 3H7BA 1YMHA 1QTPA 3NK3A 2D7TL 2VMJA 5EN2A 3GJFK 1A65A 1VZGA 5HDRA 3MJ9A 3PDGA 3PYCA 3FQ2A 1BMWA 2FBJH 3HI5L 2PYEB 4NB7A 4NQCE 4WKZA 3SE4C 5KVFE 1BCIA 1F3DJ 2IF7A 4LPXA 3V0VB 4B53A 2W0KA 2CDFB 2J55A 4M5YH 2GQHA 4XP5L 5LHDA 4PGBA 2AGJL 3HI1B 1JNHB 3HZ3A 1GHFL 1OAYH 2UY6B 4FI6A 5DF0A 4I3SL 1TTCA 3QWRD 2WSDA 4NPKA 3DARA 1F1GA 3IKCB 5F9DC 1RLBA 4QRQB 3UBXG 4DQOH 5EBMA 3UYRH 1JCKA 4N90D 1KLUA 4BRJA 1ZV5A 2Y2YA 5J56B 1MFDH 1CLYH 5EOCJ 3TBSA 4DP1X 2ESVE 1LNUB 1GSMA 3OMNB 2EDOA 1ZMYA 1Z7JA 3NN8A 3NSJA 4JZOA 5SWZE 4OCXL 1TQVA 4YAQA 2XWXA 5IV2B 3ILPA 4H0HB 5EO1B 3B5GA 1OWRM 4IBUA 2P8MA 2VDLB 4BA8A 4I4WA 4J5VA 3C09C 4I18A 4FQ2L 3UROR 1HJBC 4UQBA 4NZTH 4TVPH 1CD0A 4FC3E 1PL3A 2WXHA 5C0CA 4R90L 3T0EE 4E5XA 3HMXH 2YGVA 2ZOKA 3IFOB 4PW9A 5KJRH 1GPOH 5E9NA 2YO3A 1TU2B 1NAMB 1VB9A 2H45A 1U8LB 1FVCA 5KVFH 1JV2B 1LP9A 5FS5A 3NZ8A 2V9TA 2Y7NA 2Y2WA 1IM3D 2YPLB 4LPWA 1QPKA 2J2ZA 5D7JA 2NY6B 2IBBA 4XO4A 3IETB 1F4HA 1HH6B 2W92A 3RZCB 3RWJA 2JTYA 4PGCB 1T0NB 4B9KC 4CGUB 2PUQT 4NN5C 3GMPA 1CFTB 3CC5B 1OSEA 2XQBL 3VA6A 1BAWA 4MBRA 4RSYA 1R47A 1YYML 3MGOA 2WK2A 5ICXA 4XMPL 3FB7B 4MA3B 5DO2C 2KBGA 3KNBB 3U1SL 3PWLA 4EIBA 5HVWA 2QVFB 3Q6FB 4PMEA 2ENJA 1RD6A 1K4DA 3VGBA 2VLME 2V17L 2AAVA 4N2EA 3T1FA 1E2WA 4UT6L 5L88L 2BP5M 5IW6A 1I3VA 2A6JA 3EOAA 4TL5A 3QO0B 3AB0C 1OM3H 3V2AR 3EFDL 4KK5D 1N9PA 1UG9A 2AQRA 2V3EA 3AM8C 2N0KA 5I5MA 4XAWL 1RJLA 5LCVA 2ZG1A 1I1RA 5E9DA 3L8QA 4WFGD 3SGDH 1MVFA 4LASH 5E5UB 4JDEA 3UTZB 1HKLL 2XA8H 3M1BB 4PWFA 1KBWA 1O6SB 5HHOE 1M9WA 4FA6A 2HG5B 2PR4H 1Z9MA 1K3ZA 4NBXB 4QHLA 1DANU 1HHGA 1AJ7L 4R4BB 2NOYA 4K8RD 1BEXA 3MNVB 2IH8A 4IRSD 1NFDE 4G9DB 3L95A 5BVPL 3IT8D 2QPFA 1J5CA 3ARDB 2VDPL 2ZSWB 3QG6B 1CDIA 3M17B 4AYGA 1FZOB 4X7DC 4YBQD 2H9GB 4ZUWA 4L8CA 2F61A 2BSCA 5DCCA 2BCKA 4XN5A 2QLVB 2W91A 1AQHA 4L9LA 4DPRA 3VCLA 1QUNB 2Q3ZA 1MUJB 1DQLL 1PJWA 2BZDA 5E2UL 4ZO6A 1CGSL 3BW9A 4TVSa 1SLUA 3E3QC 2ZYIA 3ZL4L 2WIIA 5KOVC 4Z0BL 1E4KC 4HISA 2OI9B 4J3WA 1I8UA 2MKLC 3ROOA 3F7RA 2VR8A 3T8XA 3VDAA 1H9DA 4JE4B 4PWHA 1RL1A 3FXIC 1DQJB 3KLLA 2JJTC 3GHEH 5DC9B 1BQHB 4BINA 2VLJA 3TN0A 1YY8A 2H2PD 1L7IL 5IGXL 3MJWA 3VFPA 4Y8AA 3KH3A 4QMEA 3LNFA 2J6WA 2RMNA 3WKML 4PJDF 3QP3A 5F0PB 4F9LC 4PHZA 4GJTB 4XXWA 3IPBA 3UBGA 3PABA 5LGJA 3QNFA 4U1IB 2XPZA 5T3ZH 1DSYA 1I7TB 5DJYB 1J8HA 1JFHA 1KYDA 1VFOA 4MQ7A 3DRQB 3JYBA 4KNTA 3RGHA 4WSJA 3AUWB 5ALBH 2NY4D 4EQ3A 1S7XA 2FHCA 2IH1B 5C0ND 5FYJH 1KCWA 3RHWK 5I8EA 5AL0A 3OG4B 3QJOA 2CHNA 2V5SA 6PAZA 1G1CA 2EEXA 4BZ1A 3G6JF 5JTWA 4J2QA 5DFVD 5FKAB 2YBGA 5I76A 2J25A 3UPRA 3ZZLA 1AQMA 3NSYA 3MV9B 2CCWA 1Q94B 2W0LA 2VLKB 2WCPA 2ZXGA 2AK1H 3SODB 2IWEA 1WHOA 4R8WH 4PW4A 5E5RB 4Z7VE 3WTWA 3MRDA 3ARGD 4JN2B 5FWQA 2GUOA 5C09D 4S2SA 1M7UA 2HJFA 5HI3D 4UV4H 4X7EC 5T3ZD 3OKLA 4HUNB 5BRZA 5CWSA 1WFTA 4Z7QB 3A67H 3R1GL 1N6UA 1A14H 1HCZA 4LSRH 2JVUA 3VFNB 3JUYA 4U7SA 2GCYA 2IWFA 2A9MH 4LLWA 1Y18A 5ES4B 1SQMA 2X89D 3ZOAA 2ZKMX 1TYRA 2DQEH 4NFDA 1JHTB 3X1EA 4HSAC 1P1ZA 5KBMA 2QKSA 2B4CC 2XQYA 4NRZB 4K3EH 4XMZA 5KJ7E 2UY6A 3UJTL 2WCSA 3L3KB 2B08A 3BE1L 4AQ1B 4Y4KA 3UERA 4HUMB 4XB7A 4ZUVB 2ARJQ 2FJGA 3F7QA 5DJCB 2E7HA 1XCTA 1WWCA 3T0XA 5DURD 1XBRA 5C0EA 5T1LD 5AW7B 1HDMA 4JY4A 4Y5XA 4TSCH 2FT7A 5DD3H 1B3IA 3UYPA 4DKFH 1RJZA 3OR7A 2H32A 4QCIA 1OQXA 3KW7A 5AZEH 2R1YB 3RDTB 5B38G 3H7LA 4ATWA 2E56A 1Z3GH 1CURA 3TYFB 3R7RA 1BZDA 5DFAA 4JKPH 1KELH 4JO3L 1J8KA 3JVGA 5F9JA 3HAEB 3V5HA 5DJXB 4ONFH 2VDMH 2CCVA 5CIPH 4HKZA 4HULB 5IUSA 1R6VA 1U8PB 3MRIB 2C26A 2V5YA 2DI8A 4PVNA 5KYWB 5FLVA 3GMRA 4EJ1C 2B1AH 2CRIA 1U8LA 1ADQL 4NQED 4DN3L 1XR8A 3CIQA 5ISZE 3IBOA 3NABH 3T6VA 4PJ8D 2PWFA 3DX8A 4D9LH 3WYRA 3II3A 4XN7A 4RX4A 3VFMB 3WGUB 4Z1PA 1JDDA 2VWEE 1KJMB 2A9ML 4U6VH 2VITA 1IV8A 2GKIA 1AG6A 2GFBB 2Z8SA 5T1MB 4OV6F 4AL8C 2WLIB 3NJXA 3ECWA 4MMZA 1PLGL 2Q76A 5CU5A 5FYLE 5JNYA 4X7FC 4HZLB 1A3RH 1MFAL 3NCWA 1K4DB 1NCHA 2ADGA 2DJ4A 4JR9H 4PY7A 5FHBL 4I88A 4MGXA 3VDCA 3BSZL 2ZX7A 1VEPA 1VKXA 2X4RB 4KAQH 4ZFOA 1HQRA 2FIKB 1IQDB 4FLSA 3CSYA 4MHHI 5CEZL 5A16A 5AZEL 3QQ4B 4PN6A 1BDYA 3ARDD 1D5ZA 2GJ6D 3L9RA 1UWXH 3EHBC 4OUUB 5ANMA 4RAUB 5EUOF 4CN4A 2DAVA 1I8KA 2WBJC 2OMXA 3HPLA 3OKKB 1UZ8A 3QEGH 4PU2A 5FKPA 3VM7A 3ZT5A 5BZDA 4RSVA 2XN9E 1THCA 3H42H 3F7PC 3WN5C 4FE9A 3FYEB 1HK6A 3TURA 2BW5A 2R0WL 7FABL 3P4OB 4G9FD 2HG5A 2WY3B 4OZHE 2I9TB 3CLFL 3E8UL 1YY9C 1HZHH 1U9KA 4KMLB 4LARH 4MZ3A 4OR1A 5C9JB 3E2HC 2CLVA 1E4JA 3QXDA 5E2VH 2RB8A 3UEZA 4WNQA 3M17A 2P52A 3H9SD 1AHWB 2OMUB 3GRWL 3L1OL 4YUEL 2R69L 4UYQA 4JFHD 3HG4A 4OJYA 2ZXAA 4Y19B 4JKLA 4YHMH 4QLRA 4FN0A 1WBYB 4XCEA 2XRAH 3KVPA 3RRQA 3WNLA 2V0AA 1J0HA 3NACL 5IEHA 3GSVB 2I7SA 1BBDL 1WG3A 3TF7C 2JCWA 1NCGA 4XC3L 2AEPH 2J56A 1OSYA 2QHLA 4J6IA 4DWHA 4FYRA 4Z77A 2GUYA 5I15H 1FE8H 3D33A 1W0VA 2NNAB 3BGAA 4NDMB 5K33A 3P3RA 1FIGL 1KB9J 1TF4A 2FLRT 2K3TA 3SKJL 1WWWX 2PW1B 1T1XB 3ZSTA 2AXFA 5ESVA 2Y5QA 4DUWA 3EF7A 3RZCD 1D5MB 3QA3A 2OCJA 3SE3A 2R1WB 3SN6N 4NQCA 1Z32X 4LQ1A 3UL4A 3E80A 3B3IA 2QHRL 2LLLA 2FWLB 1JWSA 3IDXH 1DQIA 4P5TA 4QTHB 5GRWA 1OCWH 1LO3H 3CD4A 3T1FB 1E40A 3N44F 1KFAH 4NIYE 3QEGL 3SGKC 1LQBC 3SDCD 3IMWA 3I02A 3EF4A 4PP1C 2DRUA 2YLKA 2YMXL 3BDYL 2G0KA 2OMTB 4CADA 5F3BA 4BFFA 2R0WH 1I85C 5CEZE 7FABH 4ZS7L 4LLVA 1ZPLA 4AC4A 1I9RL 4ICXA 3T3PE 2YLHA 3IXAB 5L0QB 1HINH 4AGNA 3AROA 4YZWA 3ZTNH 1N3NA 4F8TA 4MCZB 2X40A 1U3NA 4QXUH 3T09A 3MFGB 1G1KA 5I1LA 3F05A 1V8HA 1WA1X 2B9BA 2WLYA 3PL6A 5FA4B 3B9KB 4M62L 3TBBA 2NTSP 2VSKB 1HHHA 1D2OA 1DFBL 3VRJA 5I24A 4EZKA 4A2HA 3Q1EA 3QJHB 3KYMA 4EDWL 2Z4QB 1QRNB 4YNYB 4JRXB 4M5YL 3SGEI 2X4TA 1COBA 1YZZA 4ABVA 5IJCC 5LQBH 3U0TA 1O9WA 1ODUA 4U2ZA 3ETTA 1YN7B 2D3NA 3D69A 3UAJA 5BUAA 3E9TA 5HHOB 1W91A 1E28A 3PHQA 1QNZL 1MAJA 3ILEA 3HE6B 1ZLVK 1OF2B 1IRAY 3ARWA 1JHTA 4FMFA 3MLPA 1LE9B 1IGTA 3ZW3A 1F02I 4L0YA 3LKNB 2YHGA 3IJHB 2WGXA 3HC4H 3NDYE 2EH8H 2PKDA 5GGRB 1KIUB 4HKXB 3ZPDA 4MD5B 5JW4N 2J43A 1NZRA 2NY7L 4KKLD 3ELQA 3V4VA 2UXFA 3GXUB 3AG3B 1I1YB 2DLTA 4GFTB 1J8SA 4NC0B 1EEQA 4ZFQA 1DQKA 5AW5B 5DC0A 3D85A 3QDGA 2FJHA 1NEZA 3Q8FA 4FZEL 1W9XA 4CMHC 1ZCRA 3MRPB 3SCMC 5JW5A 1TLKA 2E4FA 2IFFH 1EANA 4LCIH 4YE0A 1HINL 4X42A 1FJ1B 2AJUL 1XWVA 3BT2H 2H3NB 4OZ4A 5J8OA 5ERWB 2V9QA 1J0ZA 4FTDA 1KBBA 4P99A 1RVFL 5H2BB 4JRYE 5BZXA 2CGRL 3ZHLA 1P4LA 4OU3A 4W6YB 4MNGE 1M6OB 5FO8B 5E99H 1OP5K 2ERJB 2Z91A 2QVKA 5F9AC 1DEDA 1LK3H 5DK2A 3KDPB 5DMIH 5F0MB 1JPGA 3HS0B 1N5YL 2C3VA 4PV8A 2BS71 3FL7A 1JHKL 2BFVL 3QZMA 4NO3A 4X8GA 4OLVH 5KANG 2CMRH 2ED6A 2GHZA 3BPOC 4HBQA 2WQWA 3LRLA 3VSTA 4E36A 1MRCH 3BSHA 2WO4A 3CSBA 4DVRL 2OSLB 1FL5B 4AI7A 1TEGA 3CXFA 1QNZH 1RK7A 2VXTH 3GXMA 3OG6B 4YSEA 3JWOL 4LLUB 1MN4A 4U1JB 1CD1B 3KPNB 1G7JA 1PLBA 4QXVA 4XVJH 2NT1A 5L88H 1KGXA 1FG2B 2OPCA 2KL6A 4L4JA 4OCRL 5DK0A 1IKFH 4L18A 2WZPA 3BZEB 3FU7B 3VFUB 2VJ0A 1D6EB 1TNMA 2Y9RT 2EP6A 4P0DA 1KNOB 2ADFL 2WWMC 3FULA 1GMIA 2WLKA 1OP3K 2QDWA 5E2UH 5INCB 2WTRB 3CZNA 1KBGL 3CVHL 1OAUH 3FJTA 1CT8B 4L05A 5HYQB 2AJ3A 4YQXH 3U0PB 3JBG7 2C9QA 4PGCA 3LZOA 5LGHH 4CRPA 4BFJA 1CXHA 3DOHA 3VDBA 2KPNA 3HUJF 5CJ5A 4EOWH 3GZPA 2GJ6A 2BY2A 1OM9A 5CXPA 3F12B 1CLVA 2YD4A 1YMHB 1C12A 3MGOB 4XMKL 5D2LA 1O9ZA 1DJSA 3IDYB 4QJ3B 3ZDYE 2A83A 4FQXC 4YXHH 4JQVA 5DD0H 3IS0X 3QWRA 4N0UA 2X41A 4RA0C 3T0EA 3V0VA 4HIXL 1T4WA 3UPAA 1J9SA 4PRIB 1NSNH 5KS9F 5K1NA 3N1PC 1WPCA 3OF6D 3GHPA 5BMFH 1A7BA 4RETB 3QUHA 4PD4K 3UJJH 5E2JA 3CN3A 2C4XA 5T3ZL 1I31A 5KSVA 2DQFB 1RUML 5JR1H 3TBTB 3GSOA 3KJ6H 2IV9A 1WUNT 4EN2A 1MWAL 3VG0L 1JGLH 3IDMB 2NY3B 2UWEF 3FFDA 4B0MB 4X9FA 4FQHA 4YEEA 3RKPA 3TO4A 1IM3A 2CU9A 4Y5YC 1NBVL 1JZ6A 2E6JA 2WKOA 5ABAA 3RZCC 2YD5A 3PHAA 2X0UA 2BNRA 3KPLA 1FHGA 4BFRA 2WN2A 1JRHL 5JPMB 3UC0H 4LCUB 2V6HA 4LSUL 4FJ6A 2R2HB 1UZGA 5GS1A 3IDIB 3F58L 4IK7A 1HHGB 1L7IH 1ZWIA 3CLWA 4R8WL 5LCVL 1S9WB 2E7CA 4BFKA 2XTJC 3QDGE 1TMCB 5I17B 4DK3A 1XAKA 1YEHL 4OZGB 3V4PH 4UV4L 3IVKA 3ZDYB 3AMKA 2E76C 5ID0A 1RI8A 3OAWA 3D48R 4N86A 4YQXL 2VRQA 5F71A 1IKNA 5C1MB 1U8NB 3WEAA 3OAZK 2EO1A 1VERA 1EMTL 1RU9L 4IMKC 1J1OH 1EUUA 3MMEB 5C0GB 1I7ZB 1I9JH 4YDLB 4MD0B 1LEIA 1JGDB 1J5IA 3QRGL 1QABA 5D7JB 4EAEA 3BIKB 3GM0A 1KWKA 2E9IA 1DEEB 1M3JA 1NEPA 2ZAHA 1MCKA 5DJZA 2BVQA 5A1AA 4B9ZA 1AI1H 4X80L 5I16A 3O2DL 3GFUA 5D1QC 2IGFL 5JZ7C 3UG3A 2YIHA 4QGTA 1DJGA 1WAEA 3T08A 4AQ8C 4D9QD 5F96H 1IT9H 1X7QA 2F74A 1QNIA 3MUHL 3JWOC 5ANMB 4RZKA 3C8KB 4JW3A 3ARZA 3ZKMC 4ZQKB 1F0LA 3TL5A 4QGYA 2OYKA 1UWGL 3HG1D 4L1DA 4HP5A 1F8TH 3TFKC 2Q8BL 2HG0A 2ICWA 1WIPA 2K8MA 5SX5H 4UOW1 4TSCL 2CWRA 4EXKA 1Z9SB 1MLCB 4N2NA 1Y6MR 5CMAB 1ZE3C 2X28A 2PCPA 3FQWA 4OF8A 4PWGA 1Q0EA 3KPSB 4E41B 1R33A 4GBXB 4TUUA 2LTQB 2RCSH 2PMZA 3L3HA 5EIVA 4WIQA 2EZ0D 2YN3A 3JV4B 5DGQA 1NCJA 2BVPA 1U8QA 2Z93A 4WI7A 5T3XD 3RB5A 4LDLB 2Z7UA 1ZK5A 2P7TB 3VE0A 5DJ6A 5IIEB 1F90L 2AXGB 4YGAB 3RI5K 1TPXC 4QYAA 4NUQA 2GG1A 3M45A 4YSQA 1EGJH 1QSFB 1F58H 3NABL 5EU6D 4GKSA 5MEOB 2AABL 5JQIB 4IRJA 5FW6A 1HOCA 5L4MA 1B4JL 3TJHC 1E5ZA 1K5NB 1N70A 2HXAA 4BH8A 3RVTD 4OCWL 3W9EA 4JB9H 4JO8A 4ORGA 3HNSH 2VISA 5GGVL 4ELDA 3QJZA 3RDTD 4OSUL 3OM3B 4WWID 3KPRA 4I1RA 2HCZX 3D4YA 4HVBA 4LLDA 5J4MA 2FJHB 1MW3A 4QTHA 2E7LC 1NGPH 3GO1H 3AGVA 4XO9A 5D1XE 1AOZA 1NQBA 5I0ZA 2YPKB 3B8YA 3ZE1E 5IQ7L 2YPVL 3H9HA 4P5KB 4DO6A 1UWGH 3L4TA 1P4UA 4Y1AE 4WTZA 1CGVA 2V5TA 3BFQG 3ZKQD 1ACCA 1UACL 3TBVB 4ZFZB 4XTRD 3DPBB 1OF0A 5LXGL 5IG7A 4GT0A 4GEIA 1HEZB 5IK3A 1MJ8L 3FK3A 3ISWA 3QIUC 4H8PA 4Z7AA 5DJCA 2A9NH 4PJCB 2QFRA 5C3TA 1ND0B 2RCSL 1U8OB 5DQDH 5I1DA 4J3OD 5KSBA 2H8PB 3KR3L 3NIFB 1EZLA 3V5KA 2L4OA 3B6SB 1BQ5A 2EDQA 4N22A 1TJMA 3OR7B 1QYGH 2RIKA 4M5ZL 1Y1DA 3B9KA 4XBEH 1J11A 2JMRA 5EO0A 4KMTH 1TVBA 3O6FA 1DQVA 3N9GL 1J18A 4WW1A 4LSDA 1FIEA 1KGIA 3P9MB 3WDJA 1KCKA 1N0LA 2V7NB 2O6PA 3TCLA 1U8PA 1WIUA 4WK4B 2DD8H 1A7OH 4YIQB 4JB9L 1KENH 2J73A 3T0AA 2ZXEB 2D9QB 3PF2A 4HUUB 3QDMB 4UIKL 3IDGB 1FGNH 5GGVH 3BPCB 5EC1A 5ISZA 2OSWA 3UTSA 5BO0D 4WUUD 3QJUB 1IGTB 3FTVA 4WUUE 4JGNA 3BDXA 2HT2D 5F7WC 3KPQB 4LNRB 4N6RB 3AWFA 3CE1A 3BPLB 1SOKA 4JN2A 3BCDA 4GNKB 4GUPA 3B56A 4F8NA 3VD1A 3B5HA 1N67A 5CEXA 3AWGA 4MJ5A 5LBVA 3S37X 3SGKA 4FXGB 4S11A 2DWSA 4TLUA 1YQVH 2GJ6B 3TX4A 4AYBA 1L9PA 2OJZL 1CFSA 5IB1B 1C12B 2I5YH 2M83A 3OPZL 4MA7H 3GK8L 5LXGH 1IAMA 1BW8A 1K5WA 3EYSL 4ZFOL 1OW0A 3L1OH 4YUEH 1OCCB 1WZKA 3KM1A 4LP8A 2KDGA 3WY1A 4M6NL 3K71B 3ALXA 4ZFOB 2DM3A 4CMMA 3A5VA 2ZG2A 3SBPA 2P47B 2R0LL 4JFHE 4EZMA 4L4TA 4Z7WE 1PG7W 2D2CC 2JJSA 3FTWA 3T9WA 3WIHL 3IFNL 5EOQH 2DEXX 4O5LL 5J9PB 4EIGB 1V3KA 4WQOA 1FFTB 4LE8A 2MPVA 1AQKH 3OR6B 2W9EH 2PCYA 4D8PB 3TESA 1SJVA 3UTTD 4LESA 1MFEL 3N55A 5FHAL 4QXUL 1TO4A 3UYPB 2CJ3A 4AJ0A 1MCDA 2CLRB 4JRWA 1T21A 1RH8A 4NKIH 3ZMEA 4XNXL 4C4BA 5ACZA 5JW4M 3RTLA 3BQUC 2YAPA 3UZEA 2R2HA 2BOCB 5GISL 2N01B 2CLZB 3VYOA 4QXTB 4NKOB 5J1AB 1WZMA 4HS6B 2HVKA 3PP3K 2YAHA 3PWPA 1BVLA 1XEDA 3NSDA 2OMYB 4IRSB 4NPJA 3W39B 2J12B 4MMXC 4Z7OE 3NH7L 1TXKA 4UV7H 3VFSA 2PYFA 1KFAL 2CNZA 3MNWB 4N6QA 5CD5D 5LGKA 4X4ME 4JQXA 3VMNA 4PRPE 4WF7A 1MW1A 3QAZC 3MRGA 2O6DA 3ZKMD 1U93A 3ESNA 3ECVA 5KSBF 3VRLF 4ODHL 3S5LG 2WV3A 4PVBA 2VOTA 3DX8B 4Y5YB 2Q3AA 2AJ3B 3OZLA 3OJ2C 5CKGA 5A40E 2AMGA 2I32A 3S5LA 5SV4A 1P2CB 3BUTA 1NBQA 2VDPB 3N04A 3BJLA 4K8RC 4GRMA 4MNQA 4GAYA 4N0YH 3RZWA 2HFEA 4MZ2A 4YSTA 2F18A 1E6OL 2WZ5A 4IKIA 4U1LB 3TNNB 4M02A 5D2LB 3VG9C 5E4EC 1GSKA 4AY0A 1FRGL 1JYVA 3QWNA 3PU7A 2NTFA 2X38A 4QYOA 4F20A 1CTMA 5DEFA 2F0CA 4YSOA 3SQBB 4KQ3L 3HG1B 5E2WL 2FGWL 1DR9A 3MX0B 1CLOH 1U0QA 3KJ4C 5KSAD 3VWJC 1A1MA 5M95B 3JTTB 3MAWA 1FFQA 3F84A 2EC9T 3STLB 2MHAB 3EJRA 2B1OA 3D50A 4QY8A 2XACC 3JV4A 3MRJA 4NM4L 4PJBE 1MVUA 4ALAL 3O3EA 3SYPA 1CBVL 1T2QL 4PI0A 3BPNB 1IM3B 4LSTL 4OFPA 1I3RA 4UIMA 2ISDA 3HKFA 4PJAF 2Y5EA 2VR3A 4TRPL 4Q58C 3MXVH 1V3MA 4UQ3B 4TVUA 1IC4H 2Y36L 4CKQA 1IILE 4NQCD 4W9FC 1S7WA 2QADB 2WVVB 3P3YA 2R4SH 3RVUD 1RPUA 5IW1A 2WINB 5BVJA 3C08L 1TZOA 1Y7VA 4XBMA 1F4AA 1CTNA 4PJ7B 3BT0A 1QQDB 5BXFA 4AVJA 1UADC 3DUHA 3I3DA 4PLKD 2WLJA 3IFPA 1WFUA 4PYGA 4NUJB 1AD0B 2XN9A 3UYOD 4FFVD 4NZFA 4Q4IA 4NN7B 5DMKA 1WBXA 3QZNA 1KBPA 3L5IA 2MRYA 2ZD0A 4MD0A 2FNBA 4PJIF 4R96A 3ARFC 3MRFA 1ECZA 5F7YC 1YA5A 3UO8B 1PKQE 3KZ8A 2VLKE 5D5ME 1IFHL 4C59B 4N8CL 5IESL 3FB5A 3K72A 3PWJA 4FERA 2P8PA 5DI8B 3IJHA 3LZFH 2JKJA 3NFNB 4AYEC 5CUSH 5KYUB 4HSCX 5GGRA 1OCOB 5FYKL 1P9MA 3BH8A 3IJ7A 2O72A 5IG7B 4EI5C 5C3LD 4MDJA 3QI9C 3INOA 4ODTH 3HUJB 3GJEA 3IJEB 4HUXA 2UUDK 4N1CA 4PBVC 2HN7B 1VCAA 3RWHB 3T65B 1BG1A 1JZ2A 4ZZKA 4LU5L 2MNWA 3MNZA 4FG4A 1XB6A 5FOBB 3MROA 4MVBC 1HYSD 5DSCB 1CFVH 2CE6A 1T2QH 2AGJH 3S2CA 3NA4A 4IRZH 4ZOEA 5IB4B 4KK5C 4F5CA 1O6VA 3V52L 1JF1A 1IEBB 2DH3A 4H1LB 2ZNWA 5BMFL 2HKHL 5GRUL 1XD0A 3CN2A 3BCFA 3T6WA 5JORA 3K0YA 2NQDA 3MYZA 3K2IA 4H1LH 4PJBA 5H2BA 3W11D 4KROB 5CN3A 4BYHA 3NPSB 3DDGA 3IWUA 4HJJH 1RZKH 1NCCH 3KLKA 1WAPA 5E6ID 5BZWA 2VJ8A 3TVMB 2BZCA 5D7JD 1H3VA 3O3DB 2B0SH 4M6ML 1P0SE 4H0IA 4HGWB 4P3WA 3UTSB 3ZDXF 5AL8A 1IGYB 1LE5B 2ROXA 4JFPA 1AH1A 3GD1C 4HOXA 4HJUA 5E94A 3BZDA 3PWVA 2H1PL 4RMVA 5CF3A 2ZE0A 4F8QA 1KGCD 5KJRL 3HN5A 4GBXC 4HWZA 2X6BA 2ZICA 3LHPL 1IFHH 3T4AA 3H9ZA 4QEGA 3KS0H 2W0FA 1KDJA 2JB6A 3AREC 3LEYL 4OBRA 3HZKB 4JO2L 3EOBA 3KXFD 3NK4A 5FUCE 1HZLA 2C9RA 3PHQB 4O4YH 2AJYH 4P57A 5LAPA 4GQPH 1PZ5B 3HFMH 3DIFB 1MCRA 5IR1B 3CVCA 3IJSA 3P4MA 2FH8A 4XNUH 3K71A 1U42A 2NY3D 4ZD3L 2JWYA 3KMDA 1HS6A 4WW2A 2XZZA 3WD5H 5IF0B 3U30B 1JV5A 3B2MA 4U1KA 4JFOB 3NAAH 1H6FA 4WJ5B 5KVGE 4DZBA 1T2JA 2JXMB 4B96A 3PREA 2YRZA 5EBMB 1FORL 1I8AA 2IQ9H 3ZUNC 4HCIA 3FN0L 1UENA 5G5DB 4MTMA 2OZ4A 4JPVH 3GXDA 2WXLA 3P69A 2A4ZA 3B6SA 4NIKB 4WCYH 3NN8B 2LU3A 5CM1A 1BECA 5BRZE 5T1LA 5IB3A 3C5XA 3QO1A 5IV2A 1O7DC 4PG9A 1TVDA 2VR4A 1NCCL 3V8OA 3JT0A 3ZSSA 3IAGC 2Y7SA 5HDOA 3TCTA 3L3IA 2BWQA 5J1AA 1L0YA 1C1EL 3LRKA 5C08E 2FK9A 3DXAB 2DB8A 1KV3A 3QCVH 3LJ3A 3C2AL 3CLEH 3GHEL 1UJTA 4NOFA 4KKCC 4WK0B 2V3FA 1WRFA 2XA3A 4PRNA 3OKNA 3VTTA 3CDZA 2UX7A 3FUKA 4Y9BA 1HILB 3L9EA 1T6VN 4WWKD 1P7KB 1E50A 1BFOA 3EGDB 3PV6A 3DGGB 1KEML 5C2UB 1EZVY 2KT6A 2O61B 3AQDA 2N59A 3ZYJA 3QHZL 3LPOA 4MJIA 4Y5YA 4LL9A 4QHUB 4P49A 3LSOA 3MFFB 3REWA 4CW1B 3FFCE 4FQ1L 5GS0D 4ONOA 2VDPH 4YSPA 3HKZA 3ZX1A 4ONGH 4OZIE 5TF1L 4HPOL 4KVNH 1B0RB 5EO9B 4ZMPA 5KYXA 1UHVA 5B1AB 2OTWA 4JVWA 2OMNA 2AV1B 1A3QA 4D0CB 2NY4C 2L0DA 2DQMA 5HTSA 4BH7B 3FQXA 3EYVA 2NNXA 2D7MA 2NTFB 5D7SL 3Q6FA 3LQAL 4LCCB 1L7TH 4PCSA 1MI5B 1XZ0B 2YAOA 2L8AA 2V9RA 3N1FC 3QIWD 1LEIB 2HZHA 2YGQA 2I85A 3T1WA 3OGCB 2YEVB 3ISRA 1YEIH 2WP3O 2NUPB 4O58L 2ALAA 3FONB 3G9AB 5FDWB 1MJ7H 5KVEH 4P59H 1IO4C 3DXAE 5B1CA 3KHQA 5F72S 1UJ3A 3NIDF 3QZWB 4V1DE 1HL4A 3JZ7A 2JJUA 2QV2A 2HLFD 3BKMH 4JM2C 4Y9EA 4X98A 3CLEL 1MVYA 1L0QA 1QFPA 3KBEA 5JXEC 3TN0D 5A7EA 5M7QA 2Q8AH 3TH2T 2XG4B 4I0PA 4QHLB 1KXQE 3RGVD 3D0VB 3FB8B 2IDFA 3QIUB 1L0XA 1E3XA 3U9UA 2J1WA 4JREC 2XX1A 1BD2B 5DEGB 4JFXB 2WLNA 1HKFA 1SDAB 3IE4A 4OZHB 4FQIH 2OYLA 2VDQL 3IFPB 2VQ4A 1CYXA 1SXAA 4OM1H 1UB5A 1AO7A 5DD3L 5DJ6B 3Q13A 3EDJA 3MCLL 4KZ0A 3MOBH 2MQ3A 2ZP9A 3GMMB 1ZT4A 1WVZA 5HHOD 2C9VA 3D2UD 1L6PA 4QF1B 2F54D 1H9VA 5SWSB 4XNBA 2D7NA 4FNUA 2WLMA 1DJZA 1MQ8A 2XV2A 5I1IH 1KPRB 5F7EH 1MFNA 2WO3B 3C6LA 2PYEE 4GS7C 4CVZA 1EZUA 1R0AH 4APQB 3DBXB 3QAZB 4OCYL 4OIIL 2GK0B 5HJ3B 4F91B 4WV1A 3B7UX 1F3DH 1IGIL 5F6IB 5LN4A 2GIMA 4M61A 2J4WH 2Q20A 2I5YL 1N4XL 2BMKA 4LSVL 15C8L 5AYTA 3T65A 1EHNA 4PJ7E 3FOLA 5ANHA 2G2NA 4HC1A 1MFUA 2P28B 3WXVL 4YC2B 4GKZB 4QRSB 1UM6L 5H35A 2VSDA 4K0OA 4A67A 1YY9D 1S7UB 3WEOA 3V0FA 1AQDB 3H9HB 4XN1A 2VL4A 1S7SB 2ZOTA 2P24A 4N2GA 3FYIB 5EOCH 3MUZ1 4GMSL 4QOKE 2X70B 2DKUA 2W9DL 4X6DF 4G9FA 4BD4A 3IU4H 2F54E 3DPBA 3UGXA 2F74B 5FO7A 5JOPE 3DHUA 1HH9B 1HEZA 1QG3A 3D09A 3RTQD 3SDDC 1QPPA 3TTYA 2YEZA 3EJCA 1XXDC 5ITBL 1F4WL 3QQ3A 3ES6A 4JR9L 4AW4A 2OR9L 1C5CL 1RP8A 5EBLB 4HWBH 5HHPA 3LB6D 5GRVK 2W65B 2DIEA 4XNQA 1GA2A 4KZDL 1I4FA 4P5TD 2WINA 2AEWA 4MD4B 2VKWA 5JMRA 1AGCA 4FTVA 4P05A 2AF2A 4PREA 4HJ0D 4P4KB 3TWCH 4KXZI 3MOBL 1KPUA 1USQA 3SE9L 2VERA 1L9SA 2DYRB 3V4UH 1SJXA 4GUQA 1G9MC 3HCVA 3EZ8A 3ARYA 2V5RA 1G7HB 1ZS2A 5JDSB 1N8OE 2DICA 1V7NL 3SIKA 4AYID 1U8MB 7PCYA 2MTPA 4M6NH 4MDIB 3EHBD 4A68A 4Q9CA 2FQEA 5TTRA 3VRIB 4KHTL 4ZFGL 1BPVA 4P23A 4R96B 3L08A 1ICTA 3RUGE 1E5AA 1S3RA 1SYSA 5T33L 2F2HA 1MW0A 1R24A 3SYCA 4YR6A 3ZE0E 4WVRA 2CHWA 1NCBL 1F97A 2AITA 3POCA 1QI5A 1UEMA 1Q90A 3C6SB 3ECUA 5F8QC 3S5YA 3BVNA 4JDTH 1W8OA 3O6KL 1T4KB 3ROOB 5TE4L 3IBEA 5CEYB 3JWNC 5KANI 5B39A 4MJ5B 2E9GA 3SBWA 1Z9LA 5CNHA 4MS8D 1NM4A 3QXTA 1I8LA 4NZ8A 3DETC 4H8WH 3KYNA 3FAWA 3CSTA 4ZTPH 1AHMA 2WWOA 4M7JL 4KK9C 4JFFE 1KTLB 2ZPKL 4I87A 3N85L 3QIBD 3MODL 1E4WL 2BIPA 3S3DB 1B4LA 4ODVL 2X4NA 4RFEA 4P5KA 2Z7WA 2D7QA 2UYLB 5I15L 4WENB 2JQZA 2D2OA 2RHEA 1UOWA 3TU6A 1ZANH 3V7MA 3L4ZA 1KBVA 4KZDH 1A1OA 1E30A 3V5HB 3GRWA 3HRZA 2NLJA 1RZ8A 5EEVA 1DLHB 4FXKB 3EYUH 4K4KA 2FO8A 3QUYC 3KG5A 4LDEB 2BY0A 1A1NB 1E8ZA 4PJXA 3IJ8A 1U3HB 4TRPH 3WJLA 4QNPE 1FBIL 1ORQA 1PNCA 3X1BA 1BX2B 4UAOC 4HOWA 3P2TA 4OT1H 1E67A 4W6XB 2G5RA 1CICB 3BWSA 1N19A 1XGZA 3U36A 3H1ZA 4L37B 3S36H 3ZTCC 4KH9A 1DDTA 1RUPL 2AXWA 2OMZA 4NKOA 4PP1D 3QXWA 3D18B 4YLCA 4U49A 2DQJL 3CJJA 5HVFB 1HSBB 3BKYH 4E9QA 1FNLA 1CLOL 1FAIH 2AV1A 4R2GC 1MHHA 5MP6H 3UGEA 3L9YA 2J1YA 2M1KA 3MZTA 1AY1L 4YHPA 3IK2A 1P6AB 3QI9A 2BSED 2QEJA 3V0DA 2EINB 3X2QB 2H26A 5A2FA 3BMWA 2B39A 2ICEB 4XCNA 1XH3B 3N0PB 2ADGB 4NQEB 5AW4B 1CN4A 1JNJA 5IVNA 1HHKB 1JGEA 5E8EA 2VERN 4GB9A 4M56A 2O5XH 3QEQA 5TD4A 4NI6A 5FF6A 1VENA 4XCYA 4C83A 3MR9B 3O0RH 3OMIB 5AZ2L 5C8JB 3U4EB 1NIAA 3UC2A 5EU6B 4LIQH 2EXYD 5D1ZD 1OTSC 5HVGB 2GTZA 4R4FL 3VQ1C 1T1ZA 3SD2A 4E9VA 3I3EA 2EXWC 3NQKA 2NQCA 4AUUA 4Y7MA 5E08L 4XO5A 2M26A 3QZWG 4D2NA 2R0KL 2FX9L 4FG6C 4WWPA 5DURB 2K0RA 5GRYA 1U8KA 3OAZH 4JO4L 4PJHB 4TF4A 1FBIH 1JCVA 1XGTA 2JK5A 2OMWA 2UZXB 4AEIH 5KVDH 3RIFF 4W9KC 3PAYA 5C2BH 4BHUI 4BA0A 3O9WC 4HKZB 5GIRB 1S9XA 4QRQA 5DA4A 4BELD 4F7CB 3KHOA 3L9BA 1YNKH 5TE7H 2FECI 4EN3B 3V6OC 3GBEA 2JIXA 2DBJA 4Z7WF 3WDHA 3Q0HA 1BXVA 2CKBA 1CYWA 2ZKYA 1N59B 4TUJA 4G7VL 2OTUA 2YA1A 4LKXB 5IB2B 2VL5B 1E3ZA 3GSVA 4WGWB 3U79A 1B0IA 5K9JH 4DEUA 3ZL4H 4DCQB 3CHPA 5CR1A 4AKOA 4Y88A 3WIAA 4GXUM 3EXLA 3WEMA 1BVLB 2XDHA 2RFXA 1SLVA 4QI3A 4J3TA 5ICYB 3ZQXA 4Z8FL 1YQ2A 2XWRA 1X5GA 3GZQA 5AG8A 3AG1B 1IC5L 2EIBA 4PJ8A 4R5TA 2X4UA 4RBPK 1JHKH 4F8OA 5AYUL 1BZEA 1OK0A 4RISL 1G9NC 3PRZA 2CD0A 3BMVA 3QDHA 3ZRSA 1W72H 1TPXB 4R4FH 4XPGH 1A2YB 4KV5E 5IQMA 1XEUA 4OCSH 1OGTA 3RWJB 3BRDA 2C9AA 1HWHB 2UZIL 1H6TA 3FT3A 1SY6L 4XNAA 3GMPB 3JSSA 2A74B 2NY4B 4FCAA 3VVVA 1L6ZA 2WWKT 4X4ZA 1Q0XL 5KWYC 2BSTA 3CPLB 3PXJA 3QNZA 3CK0L 4K23H 4PJIE 4UT9L 2WLLA 4LLVB 4MB3A 5E8DL 4ZSOA 1C08A 4OCRH 4PJ8C 2AQNA 4EBQL 4DAGH 3GMOA 4Z7UA 3N43B 1Q72H 1EEYA 3ESUF 4OFQA 5HHME 4X98B 5AALA 2GTWB 4BBWA 4PJ9A 3RNQB 2FQFA 3LN4B 3RFZB 1DJXA 1JXDA 3U0WH 3H6AA 4LCIL 1ORSB 5IWLC 1OZTG 1G0DA 5TE7L 4BE5A 4WTXA 3BP4A 2E7DA 3MROB 1YMMB 1VIWA 2J6EH 5F7NC 4JM0A 3DBSA 4BZ2H 1ZTXE 2I9TA 4U6XB 4JHZA 4JRFA 1I1FA 5AVTB 2APBA 4FFYL 1SXZA 2HP4A 4G7VH 4XOCA 1JOIA 2BVOB 2EXWD 3M88A 1RJLB 1H3UA 3QYMA 1LJMA 4FQJH 2AQSA 1AXIB 1BWMA 4OD3H 4GG6F 1SXCA 3PP4L 4RGNB 2VXSL 4PAZA 3RA7H 3IFLL 5DS8B 3LPFA 4YWGL 3JWDH 2EDTA 3NAAL 1GHFH 1OAYL 4O02B 4ZQTA 5HYJB 2W