3B7YA

Crystal structure of the c2 domain of the e3 ubiquitin-protein ligase nedd4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
151
structure length
144
Chain Sequence
ATCAVEVFGLLEDEENSRIVRVRVIAGIGLASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase NEDD4
publication title C2 Domain of the Human E3 Ubiquitin-Protein Ligase NEDD4.
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 25
structure length 144
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3b7yA00
2KI6A 3B7YA 2K4AA 1WFMA 2WXFA 1UGKA 1W16A 3KWUA 4KZ0A 2LHAA 3QJZA 4FHKA 2RD0A 3FBKA 4FHJA 2BWQA 1WFJA 3QARA 4IHBA 4L1BA 5T8IA 4F1SA 4FULA 4XX5A 2CM5A 1DJHA 3PFQA 4NPKA 2ENQA 2K45A 1HE8A 3DPDA 1QASA 3NZSA 3R7RA 1UOVA 2A5UA 4XE0A 2D8KA 2WXRA 2CJTA 2EP6A 2A4ZA 4TV3A 3QK0A 2ENJA 1DQVA 1BDYA 4J6IA 4L1LA 3JZYA 5CCHE 4G11A 3KWTA 3TWYA 3W57A 4V11A 2NQ3A 2WXLA 5H4YA 4FJZA 1RH8A 1E90A 2DMGA 2JQZA 2WXHA 3ML9A 3RDJA 3ZW3A 2WXQA 2CHWA 2NSQA 2YOAA 5JHAA 3APFA 4GNKB 4NS0A 2K3HA 3SD5A 3DBSA 5CCGE 2ZKMX 2Y3AA 2FJUB 2CHDA 3GPEA 4KITB 3CSTA 4NP9A 4GB9A 4LCVA 1BYNA 4Y1SA 4WWNA 3L16A 3ZVVA 2WXIA 4FADA 2WXJA 3L9BA 3QR1A 4NPJA 3S2AA 4ANVA 2WXNA 2N1TE 3TJPA 1YRKA 5EDSA 2WXGA 3HN8A 4HLEA 2V4LA 4BGDA 4EZKA 4DK5A 3FDWA 4PS3A 3ML8A 2QZ5A 3N5AA 5JHBA 1DJYA 3NSJA 4ANXA 3R7QA 3F01A 1E8XA 3QR0A 5H4ZA 5CCJA 2WXKA 2WXOA 4OVUA 2R83A 4PS8A 1DJGA 4TUUA 4WWOA 3OAWA 1E8YA 3MJWA 4WEEA 4BFRA 3TL5A 2ISDA 4QJ4B 5KJ7E 3F05A 3ZIMA 3M7FB 2Q0ZX 3L08A 3L17A 3CSFA 3RPBA 2YRBA 2Z0UA 3HIZA 4Y1TA 1K5WA 1GMIA 1QATA 1W15A 5G2NA 4URKA 3F04A 4FJYA 1TJMA 2DMHA 1UOWA 3IM1A 4KZCA 4OVVA 4XZ4A 2CM6A 2CHXA 4JPSA 4F93B 3APCA 4HVBA 5G55A 4EZLA 4A55A 2Q3XA 3L4CA 3OHMB 4ANWA 4QJ3B 3W56A 4DNLA 2CJSA 1DJIA 4LT7A 4L23A 2QZQA 1RLWA 4TS6A 2CHZA 3PS6A 2X38A 3P2BA 1E8WA 1E8ZA 4F91B 1CJYA 3PRZA 4FLHA 1BCIA 2WXPA 4MJJA 3HHMA 1DJXA 4ICWA 4AOFA 4FA6A 4AJWA 4L2YA 3T8MA 4EZJA 3IBEA 3NZUA 4WWPA 1DJWA 3L54A 4ICXA 3APDA 2B3RA 2FK9A 3QAQA 4ANUA 1E7VA 4F92B 1V27A 1DJZA 4QAMB 1E7UA 2NCEA 2ENPA 3L13A 4PS7A 3PREA 1RSYA 3LJ3A 4QJ5B 2UZPA 3PYCA 1DSYA 2WXMA 1TJXA 2K8MA 3F00A 1A25A 3ENEA 4WAFA 4IQHA 4LDCA
chains in the Genus database with same CATH superfamily
1NM9A 5BZDA 2NZ9D 4QEGA 1F13A 4ZZFA 4PBWD 4JFFB 5FYKU 2DWXA 2I85A 4MJIA 4OUUA 1KB5H 1T89A 2XT1B 3FBKA 4Y2DB 5KJ4A 2EH7H 1D6EB 2R0LL 3QUXC 4Z3GA 2BWDA 1JGEB 1OCRB 1SFDA 2V0AA 1HKLL 2AJYH 3PFQA 4WUUE 4KJYA 5BJTB 3P40A 3EGXA 4FFYA 4K0OA 4WY7L 4HS8L 1PVHA 3G08B 3LSOB 5ELIA 2YO3A 4EAEA 5B3SB 1T21A 3GMMB 3QFGA 4M8RA 4TUKL 2HT4C 4XTRD 1KTDB 2M26A 1ASQA 5L2KA 1ZJBA 3WTWA 4PJIB 2NY0B 3K0YA 4LRNL 4NQDD 5A3IC 3RIAF 2ALWA 3DMMA 1ESOA 5JXEC 4I3RL 2KERA 4TNFA 1MHEA 3CVHL 4QRRD 2GIYA 2ZOUA 3QWNA 4ONHB 1LJMA 4ERSL 4CVUA 5LCVH 2WINA 3FTYA 1GZQA 1LEIB 1OP9A 3QIWB 3QJFA 4X42A 5BS0E 5HGDA 1TMQA 4OFVA 1EAPB 1ZA3B 2CKNA 1ID2A 2VL5B 4U1SA 4MS8C 1DJYA 1T83A 3QEGL 3RWFB 2VLKB 4N2GA 1KJVB 3R7QA 4G8IB 1GSMA 1U3NA 1NIDA 2XOTA 4AGOA 5I1IH 4WGVB 4Y5YB 5E1AA 5KYWA 3VQMA 1XGQA 3FH8A 3CQQA 4XB3A 3MBEA 2F68X 2J5LC 4ZAKB 2IBZX 3D05A 2BSED 3LX9A 3NP3A 3QSKB 3QQXA 4MLIA 4JHWH 3RIKA 5E6SB 3PL6D 3EJTA 2GJZB 3MRKB 5FGBA 3VXRB 2JELL 4CVXA 3F64A 4EI5D 1RZKC 1CU4H 1NCOA 2C9UA 4IBQA 3S3CB 3STLB 3H9HB 5FECB 4OI8A 3DX8A 3L4CA 2JJVA 3H8NA 4BKLA 2Z35A 2R0WH 3V10A 4XCFH 3VGHA 4YUEH 4HJEA 2F53E 2Z9TA 3MJ8B 4HCRL 2E7LC 3CFNA 1QHOA 4Q14A 4U1LB 2IDTA 3QH3B 3MLVL 1NCHA 4JQIA 4BK8A 3NTCH 2IANB 3BWZA 3GS0A 1I3GH 2EILB 3IETB 3UTSA 1NCUA 1DVFA 2XWJA 4HZLB 3MLPA 1O6TA 4E9YA 3L3JB 4LFHD 1DDHB 1XB6A 3MQIA 2CLZA 2J8HA 2B5IC 3HNVL 4XPGH 4L2LA 2OX5A 4JFWA 4R97B 4RQQA 4BFIB 1RUKL 4HISA 3SGKC 3T3PB 1R34A 3GHPA 3VXNA 2XWTA 3V4VL 3WEAA 4MLSA 5IB3A 2BJMH 2WSPA 2O30A 1SY6H 3ESUF 2XRAH 3B2UC 4FZEH 1D2OA 2ENSA 4Y8AA 5C0JA 5D1QC 3PXHA 2HA1A 2ICEC 3ALWA 1A3ZA 2WD0A 4I77H 4F8QA 2NYYC 1HNFA 3E2HC 4ELKA 3H9YA 5DLMH 1WBYB 2ADJA 3V0GA 4JY6A 4FHBD 5DT1H 3KXFE 4G59C 1UEYA 2CO7A 2D0FA 2X4SB 1Y6MR 2W0FA 4U6XB 4Y19E 3M1OA 3P11H 5G5DB 5C0AA 4PCKA 3ZTJG 5DEZA 1LM8V 2C1PA 3FS9A 3MN8A 4LDEB 5AW1B 3TN0C 1QLEL 1V3LA 2DQFA 4JPVL 4MA8L 1F1DA 2LLLA 3CN2A 5AOKA 1Z9LA 4U3HA 5JTWA 1WYJA 3K4ZA 3PWUA 3FT4B 1N4XL 1J9RA 5DS2A 4IRZL 1Z9MA 2ZCKH 3RVTD 2EECA 3SKMB 1PZDA 3VYOA 1T4KB 3DVFA 4M7KL 3Q1EA 5CS7A 3CMOH 1E42A 2WTRA 3LKRB 2Q2EB 3LMJH 4HJ0C 3WFHB 3WJMA 5CWSB 4DP9X 2HSIA 3BHBA 4KI5F 5I1CL 3KLHD 1L0XA 1WCBB 2YGVA 4FL4C 2FZ3B 2HFGH 2A74B 1BAWA 2P47B 1KIRA 1F58H 3S0PA 1A9BB 1HSBA 5B7EA 4JJ5B 3C5SB 3G6DH 2OMNA 1F4WL 5JOFB 3V6FA 2ID5A 5ICYA 1UUNA 4W9CC 2CAKA 1EHNA 4HCFA 1LO3L 1NGWA 2J1WA 2R83A 3MCLL 5AVQB 4WWOA 4XBPA 5EU5B 3SJVD 4GKZA 3W9DA 1S5HA 5CILL 2APBA 4DUXA 3O3EB 1YPZA 3K6SA 2ED8A 2UXVA 2WBWB 4HYTB 5D71L 2HG5B 2PWEA 2ZXBA 4YHNA 2AK1L 2ZOKB 4F24A 2GG1A 3FH7A 2V2WB 1XGZA 4FP8H 4EI5A 1WPCA 1BQLH 3VRIA 3IDNB 3OB0H 5CZRA 3A67H 5AG8A 4KJWD 1YEEL 5IKCB 3H9SD 1CIUA 2NR6D 5E8EB 4KHTH 4FLOA 2J57A 2FNBA 3S37X 1R3HB 5DD6A 3U4KA 4H44C 2DQGL 5E2UH 1G7LB 3I50H 1J87A 1EFXB 5B1CA 3SDDB 2DJMA 5LXGH 2CKBA 1OWRM 5A6LA 3MRNA 4BQ9A 2VM9A 5I1DB 3SKUD 4BFBD 3S3SA 4BINA 2OTPA 2P5WA 4RGOL 3V0VB 3O45A 2DWTA 3OAYK 4L1SA 2BLFA 2BP0B 4R7NB 1E9PA 4OJAA 2BRQA 5E6YA 3MLTA 3LRHA 4ORZC 5MP6H 5C0FB 5EF3A 1YJDH 5KWYC 1A64A 4ZO6A 1KB9J 2VN4A 1PG7X 1ZVSB 3BP7A 1KLGA 1A6UH 4MCNA 4GIOA 2M2DA 2BSSB 1EGJA 1CXIA 4JFVA 1WFUA 3EDJA 2OMWA 2JKLA 2WCPA 4IRSB 5KSAD 1I31A 1T22B 2MFNA 2UZXB 3O41B 3UYRL 2EIJB 1Q9KB 4KMQA 2WIIB 4ODBD 4PLJD 2KMWA 4X5QA 3E3QE 1TENA 3OKOA 4WJ5B 4U7MA 3ZTCC 4ZNCD 1ERNA 1E43A 3FFOA 3RP1A 5J12B 1N12A 4MMYA 5B8CB 5KSUA 2VDNB 3MLXH 3BEWA 5D1ZC 5H4YA 1U58B 4QHMA 3PHOB 4L9LC 1M6UA 2D2CC 3RVUC 1OSZA 4ZW5A 4OIIH 2PUQT 3CSYB 5DJZB 5E8DH 3ARQA 5J6HA 1WUZA 1BLNA 3ARBC 4PS4H 4IRJD 3D5OF 2DM2A 3LRLA 3II2A 1KFAL 2EDXA 3T0WA 5ICXA 1QTPA 5T5NG 1CICC 3LVEA 5GGVY 1MKFA 3L4XA 1BV8A 3KPSE 1P4UA 1SYSA 3ZT5A 2XV6B 1AKJD 4G1MB 1NOLA 5IHWA 1LO5B 5F9AC 5T1MB 1UKTA 3NJVA 3IDUA 4K5NA 5ERWB 4B60A 5K93A 3VD7A 2VABA 4BFGA 5D1ZI 1ET5A 4PBVC 1ZLUK 1MVUA 5DTFB 4OCWL 5ESVA 2HT3C 3MRLA 1CO1A 4FXGA 1KBKA 5IQ7L 1TPXC 1SDDB 5DJ2B 1EFQA 2Y07L 3ECBA 1MZYA 4TRPL 5C3IA 4UTBA 5ENWA 4UDTB 3ULUE 5AOZA 5DMGD 3Q44A 1NINA 3GMPB 5BZXA 3CBJB 2HRGA 3PWVB 4PJGE 1KBWA 5G55A 4NO2A 3L3OA 3NQKA 3PUUA 4AMKH 1HSAA 3LCYA 4QHUA 5BS0D 4NPYB 5LKNA 3BXNB 1MCCA 1HEHC 4Z1PA 4A1RA 3IAGC 4RVBA 3S3BB 4DKFH 1XR9A 3NZUA 2NNRA 4PJBB 4ZW6A 3S5ZA 3WIHL 1OXYA 1CDUA 2P4AB 2Y5TB 5DJCB 3C6LA 4WV1C 4ZS7H 1SDYA 3F5WA 4RGMB 5C0CE 4BKSC 5F7HA 1E2WA 3W39B 3S97C 5I1GH 3C08L 1AZRA 1N59B 3QEUA 2W80C 3M6DA 4G70B 4HLZG 4RMUA 2K8MA 1AD9A 3UOAB 1RURL 5ADOH 1P5VA 2KQMA 3DUSB 4JLRB 4F33A 2YRLA 4TQ8A 4YR6A 4Z6AT 5E95B 5DJXA 4JN1H 3GSRB 4PJAA 1JSYA 4LZKA 1ES0B 2X5PA 2PO6B 4IHOB 2IDSA 3BDBA 4U6YB 3S5LA 1JDCA 3LIZL 3RX7A 3DHJA 4A2DA 3MGOB 5CR1A 2B3IA 3QFJE 1K4CB 3L2LA 4XO4A 4D8PB 3MV01 1I7TB 3UABA 4Q6IB 4UINL 3FQRA 5ITBH 1W0VA 3MA9L 4JVPA 1RZJL 3QHZH 1SXSA 4P23A 3QZPA 3SDXB 1MNNA 3B7TA 5DZVA 3NCJL 3U9WA 4FTVA 4JQXA 4IRJA 3KW8A 4U1HA 4GP5B 1MQKH 1QACA 2WXNA 2YAQA 3UBXA 1PLGH 3STZB 4G9DA 2AXJA 2NXYB 1B0GA 3O9WC 4MQ7A 3OKDA 4U1NB 4WUUA 3ESNA 1MVYA 2P48B 1L9MA 1NWPA 4OZHF 4FXKA 5BW7C 2A9NH 1Q72H 2QZ5A 4AC2A 5I73B 3V5DB 4MAYD 4Y1AB 3BUBA 1IFGA 3VXUB 3WO3B 2BVOA 4GI6A 1QSFE 1JN6B 1KCSL 3DV4B 3IJSB 3U79A 5IUCA 5FGCB 4F2ME 2JB5H 4DZBA 5E7FA 4AYMC 3OTTA 3QUXB 5I28A 1C08B 3L08A 4JO3L 4M6OL 4R9HA 1YECL 2FSDA 2DQUH 3QRGH 3FFDA 4IBVA 4M61A 5LBVA 2IGFH 5E23A 3FUFA 1I7ZB 4F1ZA 3FRPB 3SQOH 1HH6B 1CFQB 3SGJA 1RD6A 5LB1A 5D2LA 5HHOB 4WHYG 4O02L 5BRZE 3N44B 4R4ND 1MN4A 1M3IA 3AXLA 2O6FA 3RY6A 3KLKA 5ANME 3EGDA 3B4NA 4NOFA 3L1OH 3ZZ1A 4NNYB 1I3RB 5CEYA 4NIKB 3TBCA 4AEEA 3TBYA 2O5YH 4WO4B 1KCRL 1ZIBA 1NPUA 3SE8L 2D7MA 4F58H 1QW9A 3WTTA 3D51A 1WK0A 4ZMLA 1BBDL 2BSTB 5IR1B 1IZJA 1KENH 2Q1EA 3O2DA 4JJHA 5BV7C 5KBNC 4QUOA 3V7AE 2YLKA 3CVHB 3AQDA 5B3NA 3W5NA 2GAZB 1M7XA 1MVFA 3JYBA 3X2QB 2R2CA 3D48R 5IHUL 5F7EH 3PGFH 2Q3ZA 4AW7A 2VDPL 1UZ8B 2WLHA 1TQBB 4R26H 4NT6A 1BWWA 1NBYA 1QVOA 2QHRL 1ORSB 3CQFA 3VGGA 4ESKA 2B59A 1PCSA 4UQAA 5E6IB 4H2AA 3GMNB 4FHJA 5FHAH 2F53A 4EOWH 4XX5A 4YDVA 1ANUA 2V3FA 2HWZH 1JF1B 2ROYA 4P05A 1QSZA 4A6YH 1ZT4A 3E9TA 5DMIL 4Z5RA 3V0AC 1K9TA 4EVNA 3VFOB 4O5LH 4WK4B 4YE4H 4KDTA 4HAGA 4IEFA 4XNQB 2YA2A 2P52A 4I87A 4FXLA 4KK8D 4UM8B 4L8DA 5TTRA 4P5MA 3TYGH 2DWDA 3BSZL 3MX0B 4BQCA 3WKNA 1NGYA 2TRHA 3BP5A 3IBOA 2QR0A 5DJ8B 1HHJA 1JPGA 5LO7A 3PAZA 2RA1A 3DX3A 4GKNB 4IK7A 4YBHA 5C92A 4M3JA 3T2NL 4WWKB 5DWUL 3S2AA 3H55A 4HC1L 5FKAB 3ESVF 3S8WA 3NIDB 3H0TB 1S9KC 2XKNB 1L7TL 3KGRA 2MHAA 1R5WB 1A3RL 4GG8A 1RZFH 4OCXH 4EDXB 1W0WB 4UT6L 3KXFA 2E74C 4Z7VB 3MRFB 2OJEB 3HFFA 4Y19A 4NQSB 3SE4C 1BZQK 3P30H 4G6JH 4XNZC 1PZ5B 4XPHH 1JZ8A 4I3SL 5D1QB 1GZPA 1WD8A 3H9ZA 2QADC 2ICEB 1PKOA 3V4VB 1RZKH 1YUHA 4JKNA 3UPCA 4ZTPL 3TONA 3JWNH 3PWLB 5CSBA 3NJJA 4BFRA 4MD4A 3CFEB 2X4RA 4ZMNA 3HB3D 4UDUB 4P06A 3IDMB 4XWGL 1IC0A 1UA3A 1W15A 4H2CA 1X6NA 3TBVA 4S1DD 1D5IH 1Q8MA 2RFXA 5CHNB 4F93B 3DX9A 2O4EA 5JDSA 1CGUA 1F4YH 3KPSD 3L9YA 4KI5E 3ZZSA 3OKKA 5KG9A 3TN0B 3BKMH 5IJCC 1JCKA 3QNYB 3K46A 4LIQH 3V0HA 2OFQA 1HINL 3BPLB 3EJJX 3ROLA 2FX8H 3BZ4A 4QOKE 2EDEA 2YARA 1TIUA 3ZLQC 4Q4EA 1QLEB 2ADIA 2H6UA 2FJFA 4BFOA 2X2IA 3QDME 3M86A 2QHLA 2X6MA 5C0ND 3D0VB 1D5ZB 3CVIH 2H0EA 4OCSL 2R0ZL 4OZFA 4BWWA 5E5UB 2A6KA 3KJ6H 4NPKA 3WS3B 4HFUL 4RBPH 4FL4B 1JE6A 1F8TL 1SM3H 3I6LD 3HG1E 4ISVA 4JQVC 3QHTC 2WO4A 4NRXB 5EMYA 4D7PA 3E6HA 4KC3B 1QTSA 4EDWH 3LYRA 4KZ0A 4EQ2A 4QHNA 4CN1A 1KCUL 1SVZA 2F8OA 5DUPH 2NTFA 5H94A 3DRQA 3U0TB 3BPCA 3GIVB 3GSXB 5T8IA 1OB1A 4WJG3 3P9LA 5GRUH 1N67A 4HUWA 4X4ZA 4HUVB 2KDGA 1NOFA 3P77B 2CK2A 4YFDB 2CR0A 2VLRD 4X80H 4MNGE 3FB6B 2A4ZA 4S0SD 2UX6A 4GEIA 4FE9A 1KELL 5C0CD 1QNZL 1U2HA 1A3LL 4XVUD 1I75A 4LP8A 3IU4H 3MJ9L 5C9JA 5CMAA 4PGEA 1T1YA 3AXIA 3NGBC 1IAKB 2V9TA 4ZUUA 2VERA 4PRDA 2I69A 1YNKH 3MV7E 5I1KH 3FRUB 3AGVA 1MHPL 3B2VH 3BH4A 5EDXA 4EN2A 2EDQA 5KANG 3D7PA 2BSRA 2K8QA 3U2IA 4B3EA 4U1KB 4L3CA 4ZMZA 4BCZA 4K9JA 4YXKL 1TETH 3GRWL 4DZ8A 2X2YA 1GAFL 1INEL 5CD3A 1K5NA 2YPLB 4Q9QL 1M7IB 5FYJL 4K8RD 5IMMB 5EF1A 1LP9F 1KJMA 1YN6B 3EKCA 3GSNL 5EBLA 2EZ0C 1FNEB 2XV2A 1OW0C 4E41B 3FPXA 3IB4A 2FO1A 1SJEA 2B7DT 3B34A 3GZPA 2ADYA 2DLFH 4R6UA 5EA0L 4X4YB 3TCTA 5I16B 3RWCA 3HHSB 3PLYA 1HQRA 4RNRB 4L5FL 5ACZB 3HEIB 3NFPB 4P59H 3ARFA 5I6KA 3S35L 3R4RA 5JXAH 4HUXB 4X8CA 4S1QH 3CSFA 2IF7A 3OB0K 1MUJA 3LXCA 4HQQH 4X7SH 4Y0GA 3DXAE 5GZND 2ZOOA 3RGVC 4FJ6A 4OGZA 5AOIA 2GUOB 2WP3T 5GGTH 3DJ9A 1BG9A 4GAYB 5IQOA 4H8HA 3KPSA 3JV4A 4N6QA 5D1ZB 3WBDA 3BCDA 4LLYB 5AVRB 3VDAA 2AITA 2EIZB 1I1AC 3DECA 4FQHA 4L9LB 3Q13A 1BXAA 4G9FE 3D2UB 4ELMA 5D9SB 1CTNA 3H2WA 4FGMA 1RUMH 1A0QL 5E2VL 1Z5LB 3LB6D 3VFMB 1OAYL 2FLBT 1D5MB 1DN0B 3KEDA 3ARBB 1TQTA 3RU8H 4JG0L 4LLWB 2G60L 2ZYHA 2R2HA 4JFZL 3FPYA 1CICB 4PRNA 3KYKH 4XMKH 1WBXA 1RIVH 2JCCB 4GBXA 3FUIA 3GSWB 4OB5L 3O6LH 5FW6A 5JIKA 1NPJA 4P46C 4UQEA 2D0GA 4NWTH 5DO8A 4YLBA 3VWKA 2QDWA 2YMXL 2BK8A 3MCG1 4PJGA 1O7DC 3N85L 4B6ZA 1M7DA 3EH3B 4AL8H 3MRHB 3WJJA 5DEGB 5BRZD 2P26A 2BZCA 5IROC 1TPXB 5D72H 3ZRCC 2OK0H 3B6SB 1SLUA 1FN4A 4Q6YA 2A6DA 3T08A 4OLWL 2QFRA 4JHAH 4PGDA 3Q6GH 1T1ZA 4HEPG 3LKPA 1EJOL 1VSCA 1NCAH 1XAKA 1KY7A 4PY7B 4PRAB 2AI0H 4J6IA 5C0CA 3S3DB 3CFTA 1B9KA 3DOSB 3NDZE 4JKWA 4K71C 1IVLA 1CXHA 1D9KD 2W65B 4U1IA 2OMYA 4DVRL 5JMOC 4A2EA 3WUWA 2X70B 3AU1A 2V8LA 1COBA 1LLAA 2ITCA 3FT1A 3PCYA 5KYYB 2X4UA 2PPFA 2A9BA 4OF6A 3RWHB 1R1CA 1UD5A 4QWWD 5J9PA 3T4AA 4ZBJA 2CCLA 4RGNB 1C16A 2CDFA 5IEKB 4WV1B 4WW1A 4PMEA 3F2LA 3LQZA 3QUZD 2YQ2A 1L9OA 1YRKA 4KHXL 3SCMC 5F6HI 4LVHC 3MRJB 1WICA 3P0VL 4P4KA 2D3VA 3VFWA 1FCCA 3WFDH 1QUNA 3F7YA 1CD1B 4I89A 2PYEB 3F7VB 1F3DH 1W72A 3IRPX 3ISWA 3QFJA 1KGCE 4DFIA 1G7HB 1FL6B 4PSPA 5LWYH 4P2RE 1OAKL 4WU5B 3KL3A 1AGCA 5TE7L 5E2WH 2WUBH 3WFCH 5DRNA 2VR7A 3KYNB 2FX7L 3C5ZB 5GZNA 1UCTA 3FOLB 1A66A 1ITBB 4BE5A 5KOVC 4HIXL 1EHXA 1NQBA 2O6CA 3RL2A 4CVWA 3SE9L 5AD0B 3DRTB 1HHKB 4YXHL 1G9NL 5BO0D 3QBTB 4OZHE 3JSSA 4YSPA 3K4DA 1KEML 4G8EA 4PYGA 2G9HA 1QO3B 3CJJA 3QPXL 2P8PA 1YEIH 1MEXL 2X1XR 3BAWA 4L2YA 3X12A 5LG1A 2X1PA 4MSWA 1LXMA 2L3BA 4ANUA 3VD4A 3KDMA 3X1NA 4G6FD 2QQKL 1QSFA 4KGLA 4XX1E 4ZFZB 3EFDH 4MJ5A 4P3CL 5DJDA 4F9LA 4F2MA 3WLWC 1M4KA 1P1ZA 2EXTA 3I3EA 4JZOA 4PJ7B 4RAVB 4CJ1A 3EYVA 4E5XB 3UMNA 3O9WB 2VXQA 4PV1C 4OV5A 2XN0A 4J3OH 1AGEA 1MW1A 2TAAA 4PLKC 4L4VB 1OAUL 1UT1A 4KI5D 5IJKA 5E9DE 4NZUH 2YAFA 3QUMA 3N1MC 2HMID 2WNWA 3TT3H 3L5XH 4XXWA 3FNKA 1MHCA 5ANMA 4QOKD 1PY9A 5IT2L 4QLRA 1QQDB 4RWHA 1I4FA 1X5KA 1GGCH 4QXUL 5EU3B 3TWYA 3WN5C 3HLKA 3H42H 2L8AA 5MEOA 5JPNA 5KYNA 4L8SB 4N8PA 5HD8C 4X5WA 2Y36H 4LAJH 4Z8FH 3CFJB 3CCHB 2Y72A 3EJSA 1OE1A 2YFNA 4KFMA 3CFCH 4O02B 3GMOB 3QI9D 4J3XA 5LBGA 3SY0A 4LDLB 3MUGB 2MPAL 4N2CA 2VIRB 1CD8A 2X4TA 3RVVC 2UY6A 4PTUB 4X99A 1OZUA 3T65A 5E00B 2ZX5A 1YQ2A 3MUHL 4IU3A 4YLQT 4PB9H 4CSTA 4BGDA 2NW2B 3QZNA 4AUJA 1VGKA 2QPDB 3OJVC 5KS9E 4F9PC 1YN7A 3DIFA 5C6WH 4TSCL 1YDPA 4QPEA 3TA3D 4JUSA 1KN4H 1ZIAA 5F97E 4PS8A 4YX2H 2CIIB 2EEAA 3LRSB 3MMEB 3FQTB 3D6GA 2VDPB 4GS7C 1KYOJ 3MV7D 4R4FH 1JZ5A 1IGJA 3LZOA 4FNPA 1LEGA 2E9BA 2OMUB 3QULB 4NQEB 4JRYB 3MODH 1MRFL 1U3YA 5AVVB 3FU9A 1NMBL 5ADPH 3QWOB 1NC2A 3W56A 2H3XC 2AQNA 2O72A 4G42A 3ZL4L 5DD0L 2Q3AA 4KFZC 3IPFA 1IGTA 3OC8A 3PDOB 4Y16D 4I88A 1CE1H 1OTUD 4HWBA 4XNYL 5BV7H 1Z7JA 2QMJA 4TNEA 4YC2B 3G5YB 2IV8A 2N59A 3ZE1B 5GS1A 2Y06L 1S78D 5T1KD 5JIIA 4NRYB 1H0DB 5GRWA 5DEFA 1L9TA 1CXKA 3BO8A 3R0MA 2IDQA 1KF9B 4K3DL 5K9JL 1FF5A 3CAFA 1YQVH 4M1GL 1FG2A 2QLYA 3DXAD 4XMPH 1KFGA 2E8YA 3ARWA 4GRLD 4LDCA 4MDJB 4MQTB 4V1DB 2R69A 3JWOC 1MNUH 1CL7L 4YDJB 3CUPB 2WNXA 2HFGL 4FQXD 1WZMA 5JW4N 4B41A 3QJZA 4XNZB 4ZQTA 2BS9A 4PGCA 4NKQB 1WFJA 2QADB 2UVFA 4QXWA 1WT5C 3IMTA 3L9RB 4G9FD 3RFZC 4ZD3L 2JJWA 4QOKA 3X11B 1RI8A 2XWBB 2WVSA 1NTDA 8FABB 1F11A 4H20L 3RVXC 2G0LA 4JGMA 4O2CB 5EUOF 2DQDH 4YDIL 4AY0A 3QDMA 4ZX4A 1QLFA 1TQUA 4GPVA 1NBZA 4EKXA 3LKNA 2CXGA 1IUZA 1T5WA 1PZUB 2WXQA 3AAZB 3PQYB 5E0FA 4FKKA 1FIGH 3V8OA 4K3JL 3HG1A 4XBEL 5SWZD 2J6EA 3QYNA 5I2IB 1CL7I 5L6YL 5AAMA 3W9EA 4H26A 2FIRT 4NXSA 4EIZC 3LNIA 1BFSA 5EEZA 4LOUC 5KEZA 4HKZA 4KO9A 5EUKA 4S10A 2UY7A 2KS0A 2A6IA 1S5IL 5TFSH 4ZOCA 1E30A 4MNGA 2IFGA 2YD4A 1GVIA 1KGXA 1JZFA 1MIEH 1S9WB 3BGAA 4HXBL 4O51B 1YNTF 2NZ1A 2JJTC 1OTSD 1QWNA 3VWJD 2H32A 3QS2A 2MIZA 3UYPB 1D5BA 3FONB 4DP0X 3L8QA 3K7UA 1SJHA 1CG9A 1OM9A 3CPUA 3FCGA 2WLLB 4ADIA 1T04B 1O6SA 4JDEA 3ZGHA 1AO7E 5LHDA 1L9NA 1OF2A 2WBJA 1NMAH 1LNUB 1TTUA 2E6PA 3RWGA 5EEVA 3IWVA 3T5WA 3VH8A 1S7RA 2N56A 3QO1B 12E8H 3KLSA 2VQTA 1LP9E 4WU7A 5JIPA 3RTQA 2JF1A 1K3IA 1E65A 3PRZA 4QHLA 3UH8A 1FNSH 3NGBB 1TLKA 4Y16A 1KV7A 1LILA 5HGHA 3VSQA 3ATDA 3MNDA 5IG7A 4PRPB 2B14A 2GB2A 5GZOD 2A9DA 2P24A 3HPJA 1KGCD 3K3QA 3NACL 1OIOA 2BVTA 3FTZA 3MU3A 4BH7A 2G2NA 3NN8B 3TZVC 4GXVH 4BA0A 5ABAA 3RGHA 4XCCH 3V6ZB 3FB7A 3QIBA 2PPAA 1U3HD 2Q6WB 4LLVA 1DBML 1QR1A 3T4YB 2YSSA 2VNCA 3DXAA 4QXTA 4GRLA 4UMGA 3FTVA 3O3AA 4PAZA 1ZHKA 4Z7OB 1I1FB 2VC2L 1XGUA 4QXVA 4FQXA 1L7IH 4AG4H 2AEPH 2G2RA 1TDQA 5EOTA 3GSNB 4W9EC 2VDQH 3HOGA 4KKNA 4U0RB 3L9EA 1QP1A 4G9FA 4KXDA 2GJRA 3HBPA 2C7UB 3HI1B 1K8DA 3ZT6A 2VOTA 2EIDA 1ET8A 3HMWH 1UJTA 2QQNL 3FT3A 3RGVB 3HAEB 2YK1H 4ETYA 1DLFL 4XPBH 1XTMA 3OZ9L 1HILA 3V9FA 3QJSB 2PP8A 1TYJA 4OCRH 5TPWH 2PWDA 5BZZA 4MJ6A 1CTOA 1I1AB 1AHWC 5FM4A 4XVSH 2ZSVA 2XXCB 4PRHE 2ITFA 4ZMYA 1L3NA 2G75A 4OM1H 5SV4A 2H1XA 4FNLL 4JY4A 4JO1L 3GXUB 5F1IA 5E8NA 1JPTH 3LZRA 3SPGA 2IGLA 1DEEA 4BUQA 4NUGH 1U8HA 5F89A 2LW3A 2GT9A 4P46B 2IH3B 4RDQF 1BGXL 3Q3GA 3TJHC 3G04A 1XCQB 1ZT1A 3QJRB 1FZJB 3SIKA 3Q2WA 1BFOB 4JFUA 1XV8A 4Z0BH 4YDKH 1EEZB 2PP9A 3GZKA 5C0EB 2OXHA 1QLRB 1RMFH 2JLLA 3B2XA 1UYWL 4L3FA 2BVEA 5HVFB 3LEXB 3QEHA 15C8H 1Y6KR 5F0PB 2DV6A 4C4KT 3PUCA 1PX4A 2FJHB 3HNSH 4K71B 1MWAH 1IQDA 4LVEA 1EBPA 1LO4H 3L5WB 1SEBA 4M7JH 1MCRA 1UM6L 3EDDA 2X9XA 4MHHG 1PCXA 5CO1A 5ID0B 4I0KA 1UWGL 5IEHA 4IKNA 3FKUS 1Z1WA 4NN7C 4EZJA 5JHLL 4MAZA 2G5BB 4KKCC 5FO7B 1RZGA 5D6DC 5AEAA 1R17A 1T6WA 5GZOA 2DDQH 2CUMA 2LU7A 3WKMH 3HE6C 4AENB 4NKIH 4P2RA 3MLYH 4PB0H 5FS5A 3MNVB 2MKWA 3I2CL 2O6EA 2BY0A 4RA3A 4YHPA 5KJRH 1E2ZA 3VFGL 1P7HL 3VFVB 2OYLA 3SCMB 1CI5A 4L4TE 3LEVH 2DM4A 5MERB 2RTTA 3OLGA 3GMLA 4HIHA 3WFEL 2KI6A 4PJXF 2EKJA 2OTUA 4Z3IA 3INUL 4UB0H 3KYMA 4D3CL 3IMUA 3FTSA 5H8DA 2CO1A 5LUMA 3IJEB 4LARH 4B0MB 4JN2B 3LKSA 2XA3A 1CT8B 4N3UA 1MRDL 3RNKA 5HY9B 2XHNA 3UACA 2BCKB 2CM5A 5G4MA 3ZMEA 2LV4A 1NDGB 5DU7A 4FQQB 4Q4IA 5DVPA 1P4LA 1R3JA 2NY7H 4G8AC 4YK4B 1LO2L 3BEVB 3M17B 1JYWA 3WEMA 2VN5A 3L5JA 2IQ9L 2PR4H 3KLQA 1HH9B 2CBPA 2J71A 2VH5H 4GW1A 2VN3A 2A4EA 3DOHA 2ZSWA 4C56E 2ESVE 3DPBB 3SQOL 1H3XA 4OF0A 5HGBA 1TEGA 4DEUA 4R3SB 3LQMA 3TYFA 3NCYS 1TO4A 3Q43A 2E47A 3PHQA 1FL3B 4L48A 5D5MB 2EE0A 5E9DA 2X05A 1UB6A 4JKPL 1ETZA 5C0BD 1EZVX 3G6JB 1X6LA 4K23H 2FCBA 4PJ8B 5LGHH 3SO5A 1B0RA 3WJLC 5DHYB 1ROWA 1KENL 2XFXB 3VNYA 3LZFH 3N5AA 4JGUA 3D08A 4MMZA 1U92A 3L95B 2YKKA 3VG9C 2X87A 5HDQL 3F12B 3S8GB 4FFYH 4NNXB 2WTOA 1UH2A 1QYGH 1YYCA 2AS5M 4J3UA 1X5YA 4P57A 4QJ4B 2X4OB 4K9EL 3MV8E 1XAUA 3RBSA 1NCBL 4IBZA 5G2NA 3WXWH 2RJMA 1DQJA 1IKNC 4UV7H 5AB1A 4Y4FA 1MZZA 2VRAA 3WTUA 4KRNA 4LPYA 3BAKA 3BN9D 5FM5O 3FO0H 1MREL 3WN5B 4KDTC 2EACA 4IMKA 3M07A 5FK9B 4O5LL 5L9DL 1A1NA 2YSTA 5IFAH 3P2TA 3EOBB 1U93B 1E8ZA 1TZIA 3BP4A 3RA7H 5KS9A 4CU6A 4AOFA 4MBRA 1IAOA 4NCC2 1B88A 3LVTA 3VXTA 1O9ZA 1BEYH 1DP0A 4JCMA 1SYVA 4WW2F 1LO0L 3BAYA 2P43B 1LK3H 5HP5A 2O5NA 2VDOH 4ZZKA 2QGDA 3H3BC 3TJEL 2BHZA 1AO7D 3QUKB 5DHEA 2GVYA 3GTNA 3QQ9D 4PY8J 2WWMD 3KVDD 4JVUA 3RTLA 1MLCA 3U36B 1G7MA 4M1CC 1S2EA 3MRCA 1VCAA 3Q8AA 3F83A 1RZFL 3Q2LA 4EPSA 2OCCB 2FIKA 4QIRA 1A6WH 1RXLA 3KZ8A 1QI4A 2IH1A 3G7TA 5T5FL 4K94C 5I1EL 3KM2A 4GS7B 1FZKB 2D8KA 4BYHA 3EJZC 3WI9A 4RRPG 4WDIA 4N0UE 3G3LA 1S9XB 1DUYB 2OTWA 3LH2L 4Z7UB 4C83A 4JQIH 3L2MA 3BVWA 3WTYA 1JPSL 2WXLA 2IQAB 3ML9A 3PJLA 4AJYV 4Y9CA 1HFUA 3KWVA 1IBDA 3V55A 3C87A 1CF8H 3FO1B 5BRQA 4UIMA 5B1KA 1I85A 1HHIB 1M56B 1XCXA 2AANA 2Y3AA 3QHFL 3P4LA 4HZ1A 1TVBA 1URZA 4ODTH 1T03L 2XETA 4MCYB 4BFJA 2XQYA 2BZDA 1QBLH 1K8IB 2RR3A 3KWXA 3MA7A 4XO3A 1PKQE 2WVTA 2XTJB 2CCWA 3HC2A 3UX9B 3AUWB 3OJ2C 5EUOE 3CVIL 5DJ6A 4PI2A 5D7JC 4QO1B 2CHNA 3KJ6L 3MRIB 2V2TB 5EPMB 5AW6B 3I9IA 3BRDA 1F86A 2DL2A 2TSAA 1E8YA 3HMXL 1YEFH 4YIQB 5JA8B 3CDYA 4PV8B 4Z77A 5C0GA 2QSTA 3RPBA 3RFZB 1WAPA 4FS0A 4IU2A 3MUZ1 2EUWA 3W37A 5GRUL 4PRHD 1MCQA 5DRWB 1AFVH 1OP3H 2HN7A 3MOBL 4NC0B 1E5BA 4M7ZC 1F56A 1V10A 5DHVA 2HH0H 4IDJL 4MA7H 5I1LA 2QQLH 4KTEH 4XN9A 2BOCA 4KJPD 4Q52A 3GO1L 2NY4D 1RU9L 4F37K 1EBAA 1KJ2A 4BSWA 1DYZA 4I7ZC 1OTTD 1UC6A 5K1VA 4OGYL 4H1LA 2DWYA 2B9AA 5KANI 4MVBC 2ZXQA 5EOQL 4A7VA 1NSNL 1OGAA 2CJ3A 3S8FB 3IDYC 5H37A 2CO6B 3FCTB 2KPWA 2ZXGA 3JWOH 3K6NA 3DX1A 1F6AA 2P7TB 2XACC 2E56A 4ZDHA 3CU1A 3MJ7B 4O2FB 1HXYB 2H41A 2ZKYA 5F1OB 2CPCA 4Y89A 4BJLA 4NQCA 1KC5H 4R7LA 4AQZA 1O6VA 2Y7QA 1I9JL 3IMSA 5FR3A 5H2BB 3HNTL 4JHZA 4D94A 1FRGH 2NY5L 1RZ7H 3K91A 1LP9A 2OMZA 1IQWL 1ZV9A 3LDBC 2WZ5A 5DHDA 3NRQA 3MR9B 4MKTA 2AJVL 3AREB 2N4IA 5D1XA 2KQNA 4F7PB 5E2TL 4NYLB 2QPFA 4J8RA 4OD2A 1H3UA 1N6VA 4QT5B 4AC4A 4CMMA 1N2RA 1G4MA 5DURD 3H6JA 1JHLH 2CKBH 4L4TD 1OM3L 1Q0XH 1RIHL 3EGSA 4D9RE 3QXWA 4YGVA 2MCMA 2DD8H 5FCUH 2I07A 1ZS8A 4ORGB 2E7BA 4PVBA 1P9MA 3D4GA 3ESOA 4LPVA 3OKEA 5DO2D 1FSKB 2FO8A 2VKXA 1DLHB 4NI3A 3TZVB 3GUTA 2QSCL 4RCAA 1JGUH 3F84A 3UZVB 3HN8A 1BFVL 4AYFB 1YMMB 1FO0A 4BHUA 4LSTL 3NUKA 4DCQB 1P0SE 3HUJB 3IDJA 4ZUSA 4CMHC 5HYSA 4NQTA 3IGKA 5EOCL 1EGJH 5LN8A 3RZWA 3Q06A 3ZDXF 5I18L 4C56D 2ESVD 3WJJC 1VCBC 2GI0A 2XN9E 2NUPA 2DTSA 2DW5A 5T3ZE 1VPOL 2F8XC 1B2WH 4ZNEE 1SJMA 4WFED 2VC2B 1CK0H 4HEME 5KVEL 1Q94A 3F7KA 4Q9RH 2Z8RA 3UROR 5I30L 4S2SB 3SGEH 4HK0A 5AG9A 4DPAX 3G6AA 4LFHG 2ZAIA 4NZJA 1CWVA 4APQC 4FMVA 1TZHA 3MV9E 4IJ3C 4OI9A 4AYDC 3FU5A 2HVJA 3HC3L 1FGVH 1W6WA 3QXTA 1IGFL 1GCFA 1T0NB 3DV6B 3PWJA 4YVNA 3F7QA 4NKDA 2WCSA 5M94B 1BG1A 3SPJA 1IC1A 3G5ZA 1DJZA 2VZUA 4DVBB 5EN2A 1KEGH 1HKFA 3AJ7A 5J3HD 4Z0XA 3WAJA 3MV8D 1JHKL 3JTTA 1FYTD 1V7MH 4R4BA 2Q87A 1NDMA 2ICWA 2ITDB 4HJGA 5LGKA 4AEHH 3GWJA 1E9QB 4KY2A 1KIQB 3QAZB 1W16A 2YC1A 4R2GC 5LN4A 3VRJA 4HLZH 3S34L 4OSUH 2X42A 4XP5L 4YXLL 1TVHB 2R1XB 5I15H 2ZPKH 4MD5A 1TZGL 2AXGB 3AY4C 4KV5F 2L4OA 2NOYA 1JFQH 5KVDH 4UT9L 2BFVH 3SDAA 4P5SA 1FC1A 1SOXA 2A5UA 3CZKA 4GQZA 3WY2A 5H35A 5JQ6L 5K33A 2XNAB 5BCAA 1RJLB 5FF6B 3C9NB 3X3FH 3Q1SL 3FQWA 3A23A 1MOEA 4NO3A 1RUPH 1U8LA 3QDJB 4TM9A 4YHLH 3SO3C 2B4CH 2VJ8A 3IFOB 3PWNB 4CUCA 2P46B 5HHME 3T8VA 5CEZH 4I9WE 4KAQL 4DQAA 1GGIH 1L6XA 1YYML 2XQBL 1CFBA 4TSAH 1TTGA 2FWOB 4N85A 1HAUA 4GB9A 4OQTA 3H56A 1KCKA 3FTXA 5JYLA 2BVUA 4G7YH 1JYXA 4IGBC 1Z9SA 3HE6B 1J5HA 4LSPH 4JNXA 3T77A 5T3XD 1JPEA 3GSOB 1GSKA 4TPRH 4PS3A 2Z3FA 2FWSA 1TKWB 1IBHA 3EYSH 1SUHA 4U49A 5F0MB 2V7NB 2D31A 3MLZH 4I0PB 1T6VN 3LIUA 5DYOB 1ACZA 4LNRA 3CLEH 4WSGA 3QXAA 4PTTB 2VDLL 1VF5C 1W8EA 2J88L 4C56A 2ESVA 2VUKA 3BKCH 3LHPH 3ME0A 1N64H 5FB8A 1R9FA 4YO0A 2Y23A 3BWAA 3VI4B 3ZHNA 1JNNH 5D6CA 1XH0A 1LWRA 1QSVA 1T5XB 3QCUH 3QQNA 3ILPB 3PIQA 3DVIA 3FMGL 1WV7T 4PJDF 1BP3B 1KG0A 1OPGH 1SEQH 3A4EA 2X0VA 3O6FC 3P1VA 3WXVL 4X9IA 5F0LB 2NNFA 1BW8A 3C5JB 2FYYA 4DN3L 1BZEA 3BFWA 1MFEH 3N44F 4POUB 1Y18A 3OR6B 5CGBA 3CN4A 3TFKC 4JFPB 2VLKE 1CURA 1FVCA 1T2QL 4KNUA 3QA3B 3PXLA 1ZANH 1ZAGA 4M1DL 3SBPA 3MV8A 2ZAGA 4LSRH 1OOWA 5DFTA 5TK2A 3S5LG 2ZONA 4PHZA 5HHQA 3TO4D 4P9HC 1UGKA 1M05B 1NWOA 4Q58C 2BDNH 4TQEH 2AQ1A 3NAAL 2NNAB 3S4SA 4Y5XC 3VXRE 4JO2H 4KO5A 3VG9B 1IE4A 3DUUA 2EO9A 3CZUB 4YPGA 3O6ML 5DD3L 4ODSH 1FVEB 1VKXA 3AM8C 3ARGC 1REIA 4RIRA 3RY4A 1WEJH 1BBJA 2FWLB 4DPCX 1SGKA 4JO4H 4NO0D 3ABLB 1RP8A 3Q5OA 2AABL 2BXYA 1WC7A 5K39A 1CTMA 1RSFA 1JPST 1E4HA 5J1SC 4X9YA 5BO1L 3TS8A 2BSDA 1F4XH 2YKLH 5FYJD 4KU1A 1E5CA 2OYMA 3TNMB 5GS2H 2EVHA 5IB4B 3L3GA 4OH2A 1JWUA 3V52H 3ARPA 2NXZD 3LH9A 4NP4L 1C7TA 1N7MH 2H8PA 3WIFB 1TG8A 4QTIH 3O2DH 5GRJL 3KCPB 2IAMD 2D03L 4ABUA 4M5YH 5FA4B 4P2YA 5KAQF 5DQJB 1WCQA 5KVFH 5E70A 4GXUN 1FE8H 5AZ2L 3EYUH 1FYHB 5A7EA 1G94A 5BQ7B 1JS4A 1X7TA 4P2OC 3FTGA 4HD5A 5GSVA 2YGOA 4L18A 3E8VA 4JFEB 1LQBC 1M6OA 2V2XB 3D07A 3CFMA 4N0UA 3B2PA 1RV6X 1LK2A 2KLRA 3NIDF 1G7IB 3P4NA 1NCCH 4ODVL 5C2UB 4KX9A 1MFBL 4LBEA 4PJCF 5DS1A 4Q89A 4EMZA 3RZCD 3DGGB 4Z7VF 1F3DJ 2D73A 2LAGB 5HI4C 1A4BA 3NCFB 3L17A 1EVTC 4MS6A 4U33A 5F7DA 4URKA 3W38A 2DEWX 3P9MA 2ZG1A 3L3HA 2XLLA 1ODAA 2OQJA 4PJ9C 4LDOB 1H6FA 2VN6A 3MO1B 3ULSB 4OD1H 1TFHA 4FMKA 5E6ZA 1J9SA 2AVFA 1SXNA 3D8MA 4LE8A 4CNIB 5ID1A 4MNQE 2IWEA 1GR7A 1TJIH 5J13B 1HDMA 4WFHE 5EUOA 3TBBA 3MBWA 4LPTA 1HQ4B 3DJZA 1DJXA 5CLTA 2R1YA 1NJ9B 1MCKA 1WWWX 4U6VL 4ZFOA 3FQNA 3K2KA 3Q8BA 1UXSA 2AKRB 2OI9C 5DZOA 4DGVH 5T3ZD 1JZ4A 1NAMA 1ZPLA 1AS6A 1HEJC 3Q5YA 3PNRB 1D2PA 1K4DA 2ADFH 4YSUA 1DBJL 5C71A 2YWYA 3KPNA 1ETJA 1KXVC 5D7JB 4K94H 4FG6C 4Z7WB 2H1PH 2DH3A 1K3ZA 3R8BB 1DZ0A 1CGSL 1U9KA 2YN3A 4FLSA 5CN2A 2AGJL 1BZ8A 4N3TA 4ZPTB 2H2SD 5F3BB 5HHVH 1ZHNB 1XIWD 2P3YA 4L05A 4XNBA 1IX2A 1YNTA 2ADGA 1NL0L 3QNXB 2P5EB 4DF9A 3QUYC 1OF0A 1HZHL 1YEGH 4UILL 5EU7C 5JR1H 2BNQB 1CQYA 2EEXA 1GL4B 1Q0YL 4OGXH 5DRXA 4P99A 4UIKL 2DWEB 4J3BA 4M7ZB 4YBQD 5JDJA 4WTQA 4G72B 2MQ0A 1AZZC 3GGWA 1DQDH 1ZHLB 4PJEB 1WBZA 3CFKA 4K3GA 3WY1A 3ECQA 2EUVA 5DC9B 43C9A 3C6EA 3EH5B 2PXYC 4KUZH 2K3HA 4M4RA 4OZFH 3CSTA 1P2CB 3C8HA 1FNSL 2IAMA 4PWFA 4HU8A 3GBDA 4ETQB 4YNYA 3UBGA 3IDYB 3JZ7A 4K3EL 5EORL 4KDWA 4NSKA 3RB5A 4HJUA 5AZEH 2R23B 4G7VL 1A1MB 1DVTA 3VFNB 2WVVA 2OYPA 2WLYA 1MI5B 2X41A 3SKJL 2EIKB 1QG3A 4JKLA 1T66D 3IDXH 3THML 3D34A 1DE4A 1THAA 3HRZA 3PNWB 1ZY9A 2AEQH 2OL3A 3IXAA 3TEWA 5IHLB 1IC4H 2C9VA 5I26A 2K0RA 1HC1A 2FBJH 3MXVL 3OLIA 4GO9A 3FHAA 2W5PA 3GJEA 1M71B 1YSOA 3H2PA 3KJ4C 5HHMD 1ZLWK 1H19A 2CWRA 3E0GA 1IARB 3L81A 4I9WD 1OP3K 3DURB 3U1SH 2BINA 3LDBB 4NDMB 2VZ3A 4TUOA 1OARL 4TSBL 4X7DC 4HG4K 2JWYA 3WFBH 5CBEB 4KROC 1OHZA 5KZCD 4LEOB 5E1GA 4NBZB 4NXKA 2HRLA 2OJZH 3Q9PA 4MA3A 1MCLA 4OTXH 4IOIA 3RWEB 2APFA 3QPKA 1DSFH 2YEZB 4EKJA 3QRBA 1MRCH 4AQEB 2WLNA 5E08L 1ZTMA 3GT6A 2XY1A 1HK6A 5AUMA 2G3MA 4FFVC 3ZDXE 1JRHL 2V7HA 3KPQB 5T1DL 2P5PA 1CXEA 4JDZB 4UM9B 2ZF9A 3KPRA 4X4MA 3FSOA 1KOAA 2VQ1A 3K4AA 4FFWC 4XH2B 1V27A 2XN9A 3QWQB 4KXCA 5KYXB 3BD3A 5I1AB 4HKXB 2DYPB 4ZNEA 3GMRA 4LOVA 3U0WL 4N2DA 1RULL 1H9DA 3CH1A 3QORC 4HEMA 3B9KC 4ZXBB 3D0AA 1OAJA 2F58H 4F7KA 3SPVA 3FSAA 4CMHB 1BMZA 4CA4A 3VFSB 2JCCF 4JG5A 3MV9A 5IESH 4HPOH 5IJBC 2BW5A 3L7EB 4WGWB 3K8MA 3UBFA 3BUQA 4MAUL 3K5SA 3K2UL 3SOBL 3TT1H 4DW2L 2VJ0A 1GHFL 4X4KA 5D7SH 4BSJA 1U8CA 3MCKA 4XRCA 4H0LC 5T1LA 5K9QI 2CJTA 2EP6A 4LHUA 1AR1B 2YPKB 1CFVL 4R7VA 3RFRA 4GW4B 3C60C 1FLRH 1JRHI 2VLKD 2YLHA 2YJQA 4UBDC 3BZEB 1SLWA 1YEDB 4G43A 2W38A 1BZOA 4PJBE 1OCWL 5IQLA 3ZHLA 4ZSOE 1U8OA 1KGYE 2MCG1 4MHHI 2Q8AH 2R29A 3IJHB 4X6EA 4APQB 3ARDA 2Z4QA 5CP7A 1QTYT 4P3DB 1RZ8B 4IJ3B 5K59F 3CXDL 4QI3A 2ZKMX 3TH2T 3NCWA 1NKGA 1F1AA 4KV5E 3ULUH 4Y88A 1KB5A 4W1TA 4XODA 1VFMA 4OCYL 4XB7A 3WE6B 3LNEA 1UQSA 4FA7B 1I8LA 3IJYB 2L0DA 3NZHH 1IC7H 4M6NL 5C86A 2E4FA 1J11A 1HX0A 5J11C 3FCSB 1GZHA 1ZE3H 3QRFM 4MMXA 1B3IA 5FO2A 1HTYA 3ET9F 3QR0A 1HEZB 4R2GB 4H7VA 3BUYA 3IFNH 3K81A 3Q48A 2JIXB 3OAWA 4BZ1L 1A7NH 3MJWA 1T1WB 2WQAA 3BX7C 3HPLA 3KWWA 1N5YH 2HJLA 3HE7D 4JFYA 4OW6A 2OAAA 3B3BA 1I8KB 2G4EA 2R9HD 3N41B 2ZCLH 5F1KC 1OLLA 3CV5A 2H1LM 1JNHB 3IK2A 5E5MB 3EHBC 4OLUH 2WZPD 3VXOB 4LVOC 2OPCA 2C34A 4J3OF 4P2QD 1B4LA 1HU8A 4R0LC 4NEHB 4YHKL 2DLTA 2IALB 4OCNC 4GOSA 1ED3B 4XNXH 3QXVA 3RRQA 4HH9B 4DGIL 4Y2DA 3B5HA 3PS6A 1PZBA 3SO3B 1D6EA 1XGYL 3ARZA 1YVLA 1JZ2A 2F54B 2A0LD 4C54A 4ALAC 2IBGA 1JGEA 4LSUL 5BJTA 1YEKL 3EJYC 4MXVF 1WS7A 3G08A 3LSOA 1ZLEA 5BV7L 5EBMB 3GMMA 3U1PA 2I60H 3V0FA 2E8ZA 1KTDA 4IGBB 1CS6A 1W72H 3TH3T 2F19L 1D7CA 1AE6L 4J1UB 1VEMA 5FGCE 1AACA 1OWWA 2EDFA 4PJDE 5DLLA 4YBLC 3VTAA 4G3YL 5GHWH 2YIHA 2B77A 4PJ7F 2C1OB 3B9VA 2X4PB 1HNYA 2IJ0C 3GXTA 4JFOB 3BAXA 4U1MA 4WI0B 3S96A 1BVNP 4XZUB 4MNQD 2IWKA 4ONHA 3WUWG 1CDIA 5CJXC 2Y5QA 4JM0A 3ZHFA 2VXSL 3T3MF 4DUVA 1LEIA 3QIWA 4G5ZL 3WE1A 1EAPA 3O3UN 1ZA3A 4TL5A 2CPUA 2R56H 3LS5H 3NT0A 2VL5A 3OX8B 5C08B 2CJUH 1S4IA 1NIEA 4F7EA 1YAIA 3RWFA 2VLKA 2QFPA 1KJVA 2DQIH 5ES4B 4G8IA 1DQMH 4JR9L 2B1OA 2EE2A 4W6YB 1LEKB 2WUCL 4Y5YA 1KCLA 1F02I 3O6FB 1HWGB 2NX5E 5ALCH 4BZ2L 4ZAKA 1SY6A 4LLQB 1ONQB 4MNHB 3ZHKA 1YC8A 4NP9A 1DVUA 1T7ZA 2GJZA 3MRKA 3VXRA 1K6QL 4MX7B 2GJ6B 3STLA 3H9HA 5FECA 2O6PA 5BUPA 1P7KA 2QGCA 3KNBB 4M8QB 1MLBB 1IKFH 4NUJB 3BPNC 2F5BL 3ZKND 3MJ8A 1TUPA 1DJSA 3DETD 3QH3A 1NCIA 3JQOB 1Q1JH 2IANA 4FTDA 3FO2B 3IETA 4HZLA 4F37F 5C0DB 3L3JA 1G7JB 4UQ2B 1S6NA 4Y5XB 1DDHA 4KJQC 4MDIB 2A9MH 4LVNC 3OGCB 3JWNE 2IADB 4BFIA 3ZIMA 1PFOA 3EAKA 1VADB 3HE7A 4J4PD 4X7TB 5DI8B 3ARGB 5HI3D 3FN3A 4D9LL 5EU6E 5L0QC 3BZFB 5HHPB 2WZPA 5DUML 5EWIL 3VX0A 3PWPD 3A4AA 3UZEA 1IM9D 1ADQA 5HJ3B 5C0RL 3DSFH 3LZLA 3HFMH 1S3KL 4LIQE 4XHJD 4L0YA 3ESPA 4TULH 1KZQA 1JGVH 4H88H 4M7LL 3NIDE 3MRBB 4UNVA 1I85C 4KKLD 1M57B 3KYAA 1WBYA 2WNGA 2D7NA 1JJUA 3KLAB 3MOAH 1MFMA 4PJCE 4E9LA 2YPVH 4LXFA 2X2UA 4Z7VE 1BM3H 1QSEB 1C1EL 2X4SA 4P9HH 4U6XA 3SOTA 1RK1A 1E0OB 2ENPA 4DGYL 4QHPA 3HC4H 5D1QE 1PGRB 1PZCA 3ZE1F 2V5SA 3PHAA 4PWIA 2B1HL 2HLFD 2AJZB 5FUOH 3FT4A 1Z32X 3V5HA 1BZ9B 5T1JA 1SUJA 3VW3H 2ZYIA 1U91A 1TR7A 4XNUH 1U8QB 1KYDA 2NZ9C 4YFLI 1JAEA 4NM8L 1UOLA 3O4LB 4M8VA 4TQHA 5E6RB 1BVOA 3CFQA 4MNQA 4F8OA 2XBTA 3LKRA 5MEPA 3WFHA 5MENB 5CWSA 1SF3A 2C7FA 2LU4A 4J27A 3MRQB 5GGVL 1WCBA 1ACYH 1TZAA 2VDML 2FZ3A 2A74A 3KWTA 1UT9A 2HRPL 1A9BA 3QUGA 4JJ5A 3MRGB 3C5SA 1PL3A 1S8DB 1TSHA 4Y9GA 5I8KH 4PJ9B 2L7EA 4L1DA 4UQDA 1QFWL 4YZWA 5IJVB 4PR5B 2A1WH 4XTRC 4IBLT 1FJ1B 5EU5A 3ZW3A 5CCKH 4GO6B 1R3IL 2IO5A 3O3EA 4N87A 3R1GH 8PAZA 1TZOA 4XVJH 5ICUA 3UAJD 5GS0L 2HG5A 2YD9A 2QPSA 2QT6A 2Z6FA 1TVDA 2ZOKA 5IGXH 4OI7A 1SHXA 1A6ZB 2BP8B 2JVUA 1VGEH 3VB8A 2OI9B 2V2WA 3GI8L 3IDNA 4LPUA 1SFHA 1JWMA 2Y7MA 1IEAB 5IKCA 5KSVB 4DK5A 5E8EA 1Q9LB 4FQLL 1B0WA 5HPOA 4KNTA 4FG4A 1R3HA 4XN7A 4XXCC 2IXQB 3IAPA 1G7LA 1GGBH 1EFXA 2CLRB 4IIQC 1X44A 4KTDL 1SBBA 4HT1H 4JO5A 1E6OH 5B21A 3U4BH 1SHSA 1SPDA 4W68A 4F8NA 5I1DA 2Z93B 2DQEH 1QFWI 4A04A 5KJ7E 2EYTA 4AEIL 5E1HB 5EU4A 1PBYA 2FEDD 3EZJB 4HHGA 2I26N 3CIAA 3V0VA 2FHFA 3QUYB 4YHZL 3QRLA 3PL6C 2BP0A 4R7NA 2W88A 5HDLA 4Y5VC 4EZMA 5C0FA 4X6DB 1IM9A 4FI8A 3OHXB 3PV6B 2CGRH 3RDTB 1ZVSA 1R24B 4WK2B 1EXUB 4FKHA 2DKUA 2BSSA 4J5VA 1RK7A 5I1HL 1JHLL 2CKBL 4HKJB 1U4FA 4OKDA 1EXHA 4HOMA 4IRSA 3VE0B 2PXYB 3U4AA 2UZXA 2VLMD 3O41A 2VISB 4W9IC 1C5BL 1Q9KA 2WIIA 4S1SH 3UO1H 4YHYB 3QDGE 1DO6A 4G8FB 4P9ML 2QDVA 3VD1A 2HX8A 4WJ5A 3HR5B 5IFHH 4HUNB 1A4JA 2AEWA 2EABA 3MI6A 3IJ9A 4J2QA 5D70H 5B8CA 1QR4A 2P80D 3CK0H 3RVWC 4EN3D 1U58A 3PHOA 4W4OC 3CSYA 5DJZA 4ZW8A 1MFAH 1MIML 4KK9D 7FABH 3QJHB 4GQRA 3A6BH 3QCVL 4PFEA 4GRMB 4OGAD 2Z7ZA 2D4DA 1Q4NX 2A7BA 3V0IA 2AV1B 3B3IB 1UWYA 3GYRA 2UWEB 4MB1A 1VZHA 4Z7OF 4AQAB 25C8H 2BP3A 4G1MA 1LO5A 3BAJA 5T1MA 1Z9OA 5D8JH 2GSIB 3FJTA 1SDAB 2NT0A 5D2NC 3GZQA 2BVYA 3LPPA 2JKJA 1MJ7L 5DTFA 3LNGA 2WYZA 5TQ0L 4TNGA 3V4PL 5B7FA 4R90H 4NCDA 1SDDA 5DJ2A 4ODHL 1YMHA 1GCYA 3HBZA 3Q01A 1OZTG 3V9CA 1DBAH 2JCCE 3E1ZA 4LLMB 3QC6X 4UDTA 5FV2A 5ISZE 1OALA 1BYOA 4NM4H 1URIA 5KBLA 1KNOB 3GJFH 3QWRA 4XNDA 4U1GC 3GMPA 4IBSA 5HHXH 3RVTC 4H8WC 1RHFA 2A77L 2J1KA 3NIGF 3PWVA 2B0SL 1OAQH 5DUBB 2HT4D 4NHCL 4NPYA 1I9RH 4HALA 3BXNA 3FN0H 5A3ID 3EJUA 4PCTA 2DYRB 4XVTL 5F7WC 4GI9A 3KLHC 2C9PA 2X12A 1SXZA 4LEXL 4K7PL 4PJBA 3DBXB 4WRLA 5DJCA 2Y5TA 3BYYA 3VH8G 1NEUA 4GSRA 3FUNA 1T7WA 1QAWA 5K59E 4I18C 4UTBL 5C8JB 4KKZA 3ULVL 4YSAA 1P7QD 2NX5D 3OAUL 3W39A 2WAHA 4HWZB 4L37B 5AVYB 5I82A 1N59A 2ZXDA 3HCVB 4LU5L 1X9QA 1K5WA 1UURA 4HAKA 1JFQL 4M43L 2K7PA 2R1WB 1J0HA 4JPWL 3TV3H 4LMQI 2JKSA 1L6ZA 2UX7A 3DUSA 4JLRA 4MS8D 4WEBL 1BMWA 3C60B 2OCJA 4Y2OB 3UEQA 3TH4T 4KKAC 4L3EE 1TMCB 2J1XA 3A6CH 3QIUB 4O58L 3GSRA 3BH9B 2Q2LA 4IBUA 4KJWC 3UMTA 4HG4J 1FFQA 4FLHA 4N0FB 4QRTB 2NR6C 1AC6A 3C75A 4JKMA 2PO6A 5EEYA 4IHOA 4N8VG 3P3UA 4P0DA 2H0JA 1B6UA 4UTAL 4JKKA 4PVNA 4LSSH 4FA8A 1PG7W 4AQ1C 4FZ8H 3ATEA 3L4TA 4JY5H 1SJXA 2XG5A 5DYFA 4S0HA 3DI3B 1CDGA 3MAWA 3MGOA 1K4CA 1MAKA 4D8PA 1I7TA 1U8KB 1X5XA 3B8YA 3DC0A 4Q6IA 4BH8B 4EN3A 5CJQL 1E3FA 2FQEA 5EU6D 3U9PH 1EUUA 4NJ9L 5J11B 1A7BA 1ECYA 2MSPA 2OR7A 4IKJA 5CJOL 3LS4L 4JRLA 3SDXA 3E8UH 3MVSA 4Q8BA 3ZUCA 1JHTB 1URLA 1IT9L 1JI2A 5GRVK 1HI6B 1T7VA 3RWJB 2C3VB 3S88L 4JRXD 1GYAA 3STZA 1DFXA 3R7RA 3NCYP 4FC3E 2LFGA 3FHEA 4N0YH 4NQXA 5IW1A 3A6OA 1I8MB 5KSAC 2YA0A 3NCEB 3EHBB 4Y1AA 4YSDA 5IVOA 4RFEB 3V5DA 4LVOB 3UADA 1AI1L 2YAEA 1X7QB 3B2UD 2QVTA 4PLJC 3W2DH 4R0LB 3X13B 3VXUA 1JN6A 1PY0A 3DV4A 3IJSA 4J3SA 3P73B 3RWDB 5A2AA 3F6JA 4NGHL 5AB9A 1UA6H 4PJDA 3E9UA 2Z0BA 1P6FA 4PJ7E 3QUXA 4YQXL 1C08A 1YEHL 2YQBA 4M3KB 1I7ZA 2LR4A 5CN3A 3T3ME 1HH6A 1JBJA 2W07B 2Z31D 4NX0A 4QY8B 5HHOA 2R15A 4WLCA 4PD4K 5HXMA 4JS7A 1NAKH 5EHFA 2GY5A 5D5MF 5JHBA 1JK9B 2VT0A 3UIZA 4MGXA 4NNYA 2VR4A 5JXEA 4WO4A 5BZDB 1KWKA 5ILTL 3H7BB 2EDKA 1C8PA 3UC0L 3HG0A 1RZPA 4A2HA 4LCWE 1T5KA 2NY6B 1JGLH 4JHUA 5FV1L 2Y7OA 4MJIB 2PN5A 4HJ0D 4YSSA 5IR1A 4RH4A 1IC5L 3CVHA 1JI1A 4XWOC 1AIZA 2XKSA 2GAZA 5CINH 1INDL 2CHXA 3C09B 3Q6FB 3ZE0B 4RWYL 2QV2A 4ALAH 1INQB 1UZ8A 5DMGC 3ABKB 2K9FB 1OP5H 1ORSA 4L23A 4ZYKB 4M7LT 1JTPA 4R8WL 5L8KB 3GMNA 1UATA 4S11A 1JK8B 2B2XH 4LBAA 4LCIH 5AOMA 5L2KB 3EOAB 3GXIA 2CRIA 2BVPA 5IW3A 3SPIA 3GK8H 2A73B 1JF1A 1D6VH 4JM2C 4WWPA 5F8RC 3TWCL 3ZE2B 2DJUA 3DMMB 3O3DB 3U2SB 2GK2A 4OLYL 1N7ML 2VUYA 4X8GA 2FT6A 1EJFA 1ITCA 4OLEA 1FQ9C 3NA4A 4YE0A 2PW1B 2VITB 4CRPA 4XNQA 4LKXB 4P2CG 4NWUH 2PPDA 2AJUH 3KLLA 2NNXA 1QBAA 3D52A 2G2PA 4UM8A 2E7LA 5HGAB 5JIMA 4L1HA 4RAUB 3MX0A 5I74C 4HJ1A 3BP6B 4NQEE 4JRYE 2LHAA 5DJ8A 1WZAA 5IBLC 4GKNA 4QRPB 5IQMA 4JG1H 4WWKA 1UD2A 2OP4L 5TE6H 1PQZA 1VFAB 1XSKA 5IVXB 1OAXL 1HXKA 4LVNB 5FKAA 4M9PA 3QXDB 4N20A 2H7WA 1JXJA 2Z8SA 3H0TA 4DKEH 2E9IA 1MCJA 1R5WA 2NDGA 3D12B 3SGKA 3QK0A 3VG0L 3WNLA 3O6KH 3QDGD 2WKLA 5GJSH 1W0WA 4UYQA 4EDXA 4KY1H 5K5YA 2DKMA 5L0QB 3GBLA 5L8LB 2VJXA 3MRFA 2OJEA 4Z7VA 1C9SA 4NQSA 4E9QA 3TVMC 4YSTA 4PP1D 3VO0A 2GABA 1PZ5A 3AG4B 3ZE1E 5LQBL 1P4IL 3GLDA 5D1QA 3V4VA 2ICEA 2W9EH 4OM0H 4A66A 3RDJA 3ARSA 3PWLA 3MACL 3CFEA 4DP7X 4OFKA 4UDUA 4ZFGH 4HF5L 2CHDA 3IDMA 3WY4A 4UF7C 5A16A 3SQBB 3L16A 4M5TA 2AK4E 4FQJH 3FHQA 3HG5A 3WN6A 1EERB 4XMVA 2H6PB 4DK3A 1FFTB 1FFRA 3U6RB 1GC1H 1A7PH 4X7FC 3TN0A 3QNYA 3SDCD 2GEEA 3G5XB 2V9UA 1UASA 4RQQB 3ARRA 4OAWB 4O9HL 3V4LA 5H4ZA 2P42B 3ABMB 3IDIB 1YG9A 2J8UB 3NYKA 2Q76B 4MAYC 4OZGB 5AWNL 5JNYB 5CBAB 4XMLH 5F3HB 1T20B 4FLRA 3QJQB 3D0VA 1D5ZA 1MHHB 1V8HA 4TYUA 5TQ2H 4IRZA 5IVNA 3X3GH 4KVNH 2E4TA 3VGDA 1YYLH 5ISZD 1I8IB 3WS3A 4ELKB 1IZKA 4ZTOH 4RZKA 4WFGD 3SGDI 4K15A 3BIKB 4NRXA 3ZDZF 3CHXA 4QJ3B 1CR9L 1CYGA 4N2AA 2VDMB 1AS8A 3U0TA 3GIVA 3GSXA 2C1PB 4HCIA 2DQFB 3NFSH 2FBRA 4LEBA 3R8QA 4YLCA 1BAGA 4HUVA 4NQDB 1AY1L 2KZWA 3GSUA 1BF8A 3FB6A 2FK9A 1J05A 1CFNB 4OJFH 2FRGP 4G82A 3IKCB 4Z3TA 2AXHA 3GNMH 4QRRB 4LLUB 2EEDA 1NCWL 1OEZW 2VLLA 1XH1A 3KBFA 3WJMB 5ICZB 5TDOB 3K6SB 1IAKA 1OLZA 3BHBB 4YPJA 1KTLB 2EYRA 5IM7B 5GISL 3FRUA 3N9GH 4LSVH 4P04A 3NJGA 4JEGB 3D85D 3D30A 4L3ED 5AKTA 4ES8A 1E28B 4GRWB 1FPTH 3V6FB 5ICYB 3VXSD 5KTEH 5DHVH 4HX1B 2A83B 5IF0B 3EOTL 5HYQB 3O4OC 1JL8A 1KN2H 1M7IA 1NEZG 2ZICA 3KH4A 2UZIH 3W9DB 1S7VA 2ICES 5IMMA 2Z91B 3O2WH 1KJ2H 4WFFE 1YN6A 5DGRA 1MPAH 3QDGA 5CSZB 4G11A 5CU9A 1FNEA 3PL6B 5T5NF 1RZIB 3KVQA 4Y5VB 4E41A 2VR3A 3C12A 2N7AA 4FJZA 4JCWA 2DQCH 4EI5B 3A0OA 1E90A 2WXHA 5BRPA 1OOAA 4DH2A 4HMCA 4U6TA 1A9EB 5AW8B 5H37H 1SLVA 4J3OD 1TITA 3HHSA 2C4FU 4X4YA 4H40A 4RNRA 2A6JB 5ACZA 3NFPA 3KVPA 1TQCC 3OKMB 4HUXA 1X5FA 4KK8C 5CF3A 5CJ5A 2APTA 5FO9B 1WFNA 2WOYA 2K3TA 3UJJH 3WOVA 4Z7OE 1IO4C 2GUOA 3II3A 2HX7A 2N1TE 1CMOA 1JZIA 1CLOL 1Z6JT 2QEJA 3MRNB 3OKYA 4P3WA 4BWUA 4XPAH 4I48A 5AYUH 5D1ZA 2EIZA 3RURA 4TN9A 4XOBA 4L9LA 3BT2L 3D2UA 3T1WA 5D9SA 3B83A 1Z5LA 2F58L 1I7UB 3VFMA 3CDCA 2CRYA 4TQIA 1E9PB 3GHBH 1D5MA 1AOHA 1DN0A 1X4ZA 1B4JL 3ARBA 3HUJF 1XVSA 2AQQA 4JE4B 2NUTB 1P4BH 4WEEA 3WY3A 5FYLH 4H4NA 2MQ3A 1CICA 2XJLA 3HJEA 5F96L 2Q0ZX 3D3VB 2JCCA 4H1LG 5L88L 1WZ1H 5DC0A 5JIHA 3GSWA 5BOJA 1ZS2A 3ERXA 4JM4L 3HB3C 4FG0A 1ZSDB 1QBMH 2IGTA 5KW9H 4KZDH 1XWVA 5L2JB 1PZ2A 2BVQB 2VRKA 3TEZA 1R3KB 1EEYB 1XEDA 3MRRB 4S1DC 4P5KB 3VYNA 4GMSH 3MRHA 4CVZA 5DEGA 4K7FB 3GDCA 4JBSA 1QRNB 3ARDC 4HZAA 4W9DC 2BNRE 4A7GA 4D0BB 4NZRL 3B6SA 4LL4A 1F90H 5EEWA 4OIBA 3N2JA 4N2OA 4OF7A 2YAHA 1E5UI 4KH2A 4HOXA 3NDYE 4DN4L 3ATBA 3V4PB 4N5UA 5LGJB 4PY7A 4EIBA 4UCFA 4PRAA 4HGWB 4LCWD 5E7BA 5E99H 2F7PA 4IS6A 3DOSA 3MOQA 1AD0A 2W81C 5EBWB 3LJ3A 3O0RL 2W65A 4NZFA 4UT7H 5C0NC 3I9GL 3LRGA 2YD3A 3WS6C 2H3NB 5KYYA 1KPRB 3RWHA 3FQUA 3O2VH 1MAML 1LTXA 4CGUB 5I1JH 4WV1A 1N0XL 3IGUA 2FYVA 4OLXH 3GBNL 1NUNB 2RIKA 3MNMA 4XCYB 5CD5D 3WIHA 4P07A 1EMTL 3SJVB 2QLVB 5L7XL 5LNDA 2WSKA 3MRJA 2ETWA 1ZMYA 1QX1A 1CD1A 4LSQH 2ZYSA 3F7VA 4JDTH 1G7HA 5JORB 1FL6A 4CN4A 1LVEA 4XVUC 1UHVA 4NO2B 3L3OB 2TRYA 3LRKA 4ZPVB 4H8WH 3AQZA 3GJFK 4WU5A 5I19L 3M7OA 5DZ9A 1DQLH 1EQWA 4QRQB 3ZRFC 1N8ZA 3H9SB 1EDHA 3VA2C 2JXMB 3KYNA 4F5CE 3HRPA 1G6VK 2OR9L 3FOLA 3PP3H 2P9RA 4OLVH 3ZN6A 3BLBA 4AQ1B 1XR9B 3EDFA 2C4FT 1KBGL 5HGGS 5AD0A 1HHKA 2FGWH 4GEJA 3ZTDC 4K8RL 5BVPL 5AOLA 1A6TA 5T3ZL 5CZVH 1QO3A 1U3ZA 1UJ3B 1R5VB 2VXVH 2OLDA 4MXQD 4D2NA 4K8RC 1VAHA 4W70A 1CDCA 2J3SA 1YNLH 1J7VR 1J1PL 2HKAA 1SN0A 5C70A 4ZMVA 3RUGB 1SXAA 4ZFZA 4X6CB 4FRWA 3TL5A 2EADA 2R4RH 3OWRA 3T6XA 4MD0B 4RETB 2GHWB 1JWSB 1V3MA 3KGUA 5DJXB 4PJ7A 4RAVA 3UTTD 4E5XA 3O9WA 4A7TA 3KHQA 2AK4D 4EIGB 4J28A 1WUNT 4CSZA 5BW7A 5KSAB 4GJTB 3EJRA 3EYOB 2VTFA 4OQTH 5D5ME 3I6SA 2E27H 1ZGLB 1KJ3H 1EHLL 4HAFA 2AF2A 5J56B 3RAJH 3OC5A 2KT6A 5ESQB 1ZGLM 4ZX6A 4JZNA 3HJ0A 2R0KH 4GINA 1W0VB 1QQDA 4K2UL 5D2LF 2ZP8A 4B7IA 4F92B 5EU3A 2DAVA 4FI7A 4LCWA 4AYBA 3HR6A 1HIMH 2VXQL 2W9DH 4U4IA 1PG7L 2OULB 3OKNB 1MWOA 2BHYA 1CZ8L 3CFJA 5IP4A 3QJUB 4XN5A 1HOEA 3CCHA 4MQ7B 1MXGA 4BGLA 4JK0D 5F70A 1J8RA 1AKJB 2FB4H 3IYLW 3L3DB 8CGTA 3QUML 5E8OB 6FABH 1KCVH 3GMOA 4NN5C 3MUGA 5DWPA 4E9SA 2VIRA 3LV3B 4AW4A 1DL7L 2CE6A 2EH8H 2K45A 4MZRA 5E00A 5FGSA 3ZYOA 5MI0C 3FFCD 1BYPA 1GGTA 2O5XH 3NSYA 3MNWB 2NW2A 4N8CL 1AC0A 2ENYA 1KYUA 3CPLB 1H5BC 1FH5H 4K73A 3AACA 1H6TA 1YEJH 5I5IA 4AV0A 5A2JH 3UJTH 3K5RA 4FMFA 2MOQA 1M7UA 2CIIA 4Y4KC 1D9KC 1G0XA 1S7XB 2XCMC 3FQTA 3MMEA 1R75A 3FYEB 5FA3B 4M6MH 5IW6B 5BS0B 2DBJA 4U6HB 2OMUA 3HVDA 3QULA 4QHKI 4NQEA 1F4HA 4JRYA 1DBBL 4YSEA 4XNMB 2OSYA 5CEYB 1N68A 2DM7A 3S36H 4WUKL 1VDGA 4N4YB 4I1PA 3QUZC 2EO7A 2YEVB 2HP4A 4WFFD 3BGFB 5E8PB 5TE4L 3PDOA 1RK0B 5EO0B 3J07A 4PW4A 5CIPB 1A6VH 4MJ4A 1WAAA 3EG9B 2WXKA 5I74B 3G5YA 1PJ9A 1YA5A 4AGMA 3L2NA 1H0DA 3MFFB 4NRYA 4PD4J 1NBYB 5E94B 3ZX1A 4ILDA 3F05A 2Q20A 4PJ6A 4DFHA 4GMTH 2ARJB 1T4WA 4HS3B 5GGSB 2AJSL 4Y2LA 1OP5K 3NEOA 2BXZA 4MDJA 2AK4A 5IMLB 3DLQR 3BN3B 1IKOP 3NJNA 4KTYA 4YDJA 3UG4A 2X4NB 4M48H 2VYRE 3M45A 3BLPX 4P4RB 1E5AA 4LAQH 3SE4A 4G8GD 2HVKB 3U1QA 3TVMB 5F88B 5GSRB 1EA9C 1E8WA 4HWBL 2NQDA 3FB5B 1H3PH 1ZSHA 4QCIB 4IEFB 4UT6A 3L9RA 2I5YH 1BCIA 2MTAA 4NNPH 4O00A 1NGQH 3X11A 1I1CA 5DK2B 3VVWA 2XWBA 1EK3A 3AS2A 2A38A 5ANHA 4AUYA 8FABA 4XVJL 4Q2ZB 2CK0H 4AV5A 3S4SG 4O2CA 4YDMA 1OV8A 2JKWA 3L5IA 1VGEL 3FT2B 3IMWA 3HZMB 3AU0A 2K6YA 1EIBA 2R69L 4GAJL 3AAZA 3PQYA 1MF2H 3ZSSA 3QE5A 4MQSB 2VDKH 3ZDZE 3FU7B 2V9RA 3QDAA 2KUTA 3DROB 1M2VA 3ZDYF 3K72B 3SDDC 3BWUC 3EYFB 4MAYB 3K6OA 2BNRD 4ODUB 4KZEL 3WSQL 4EI6B 4HT1L 1GZPB 3Q0HA 2XV0A 1AXTL 4R5VA 1DVYA 1F0LA 3US0A 1LE5B 4GXFA 2AQSA 3LXAA 2LTQC 4O51A 1S9WA 4ZQKB 1EO7A 4NB7A 3EIFA 4JQVA 1GXEA 3QS3A 3UYPA 4PJ5D 3WMQA 1L9SA 3FONA 4W93A 5JDSB 2WKOA 1KGIA 2EE9A 2J6EL 1T04A 1MFDL 3MTRA 3VTTA 4W81A 1NAMH 4HD9A 2G5UA 4PJEF 2P5WE 4RSVA 4DAGH 2HPTA 2D7TH 3BZ4B 3U6XA 1LNUA 4U3XA 4YSOA 3EYQC 2Q8BH 3RIFK 5HVHC 1G6RL 4KI1A 4EEEA 2ALAA 1G4RA 3QO1A 1BHGA 2QGEA 3MLWL 1FFOB 2YBGA 4MWFA 1USQA 2Y3NA 2CO2A 4PRPA 4F7TB 2APXA 2ARJQ 3EADA 1BMGA 3MJ9A 3CC5B 2DQJH 4ISVB 3NN8A 2KKQA 2IVFC 4WGKA 1MJ8L 1XCWA 5HJBA 1BXVA 5F72S 3TA3C 4B7LA 4BXVA 1X7SA 3BESR 4EUPG 1NCDH 5H94B 2Q6WA 3CFUA 1J1XH 3V4UL 4FQIL 3O4OB 3T4YA 1G9ML 4HUWB 2H4EA 1E4WH 3CZNA 1WTLA 4JB9H 1FNGB 1WWBX 2VR5A 3TIEB 1I1FA 1N6QH 1KYAA 2XQYK 1IIKA 2DI9A 1OW0A 2J4WH 2GJPA 1KIPB 2YAMA 5IREA 1S7TB 2V17L 3CMGA 5C7ZA 1V3JA 1BOYA 2Z4TA 3CHPA 1BPLB 3GSNA 3VFTA 5AQ0A 5FOBB 5CMAB 1JIBA 1MFNA 5AW3B 2IDCA 2LABA 4XP6L 5EC2A 1RIUL 2ED6A 1TQCB 2V5TA 2EDWA 3HI1A 3WD5H 3HUJE 2ATPB 1XR8B 4L9DA 4Z7NF 5CEXB 5IHBA 1C5CH 4JFHD 2PWGA 3RGVA 2OL3H 3HAEA 1S78C 1RSYA 4CJ0A 4QJ5B 3A4FA 4ZRGA 4ELMF 3RE0A 4DGUA 5B1JC 3AABA 4R7DB 1CN4A 1BOGB 4DZ8B 4WKZB 1I1AA 5LAXB 3VD2A 1DN2A 2GIMA 3E38A 3MLUL 3IKKA 3UGXA 1KT2B 4JUTA 2Y24A 4HA1A 1ZHBA 1BAFL 2NY3C 3EDKA 2HJFB 3GXPA 1EAQA 2BNRA 3ULUF 3WLWD 2E59A 2JKRM 2XA8H 1ZOXA 2YZ8A 4XAKD 1GIGL 5EO9B 1XO8A 4ZO8A 3CSBA 3CZFB 1CGTA 3F58L 3JZYA 1XSIA 3HB3B 3OG4B 2I32A 4P46A 5DQDH 4DPBX 2IH3A 2H2PC 1MCPL 1E4JA 1XCQA 4XPTH 2CMRH 1FZJA 4YHMH 3B7SA 5FUZL 3AB0C 2E76C 4GFXA 4ONFL 4RZCA 1U42A 5IROA 1BFOA 2DQTL 3KPSB 2W95A 4BQ6A 4FQ2L 3MBED 1U6AH 2PO6C 5C0EA 3OV6A 1QLRA 5C3TA 2R51A 5ALBH 5I66B 3LEXA 4PUBL 5MEQB 1Y1UA 3BVXA 5I6XC 4TVPE 2GC7C 4AVIA 1V3KA 2FJHA 2EDDA 1NFKA 3IFLL 1BSIA 4HXAL 3L5WA 5HD8D 3A3YB 1NH6A 4NFCA 4LO9A 1X4YA 5FO7A 2W0KA 4PG2C 1CE6A 1FFNB 1T7YA 5AVUB 5FO8B 1OTSC 5FW8A 3VWJC 4U7SA 2FX9L 1E6JL 3RVVD 4AENA 1IGIL 3DHPA 5I0YA 5E4OA 1X5JA 4GUPB 2K78A 3V0WL 3VFVA 1XMEB 4ZK8A 3DX7B 1UM4L 3SCMA 4F5CA 1S9YB 1KPVA 2A6DB 5MERA 1NUDA 3CSGA 3MUY1 4PWJA 1NIAA 3QZBA 1OSYA 3LKPB 2APVA 2VLRB 3LQAL 4JHVA 4TOYH 1UD8A 5C6TL 1UWEH 2P44B 1WHOA 4XNAA 5C0CB 4AQ8C 3IJEA 4QRSB 1CT8A 4FTVE 2RCSL 2BCKA 3L4WA 3U7YL 3WUWB 1NDGA 4FQQA 4KX8A 2GITB 2DBLL 2ITCB 1PX3A 2CBQA 2DQHL 3BEVA 3M17A 4J3TA 5TF1L 4DP5X 3T0DA 4LKCB 5L4MA 1HH9A 2FHBA 1KXTB 1WA0X 3SDYL 5E51A 3DYMA 5FUCC 1QFHA 1T6BX 5C0AD 2XZAL 4FQCL 5CJ8A 5D93B 2OXGB 3DPBA 5DDHA 1DSWA 1TYEB 3RB7A 3A24A 1U3HC 1AXSA 2DMKA 2ZJSL 3U25A 1GY1A 3WHE1 1XF1A 3UJIL 2ZIDA 4XMXA 1FL3A 1T80A 1NBCA 2IPTL 4BSVB 2DIJA 4WO4C 1DTUA 4GLRH 5DD5H 5D5MA 1RVFL 4JMNA 1ZEAH 5D7LB 1JV5B 2FHCA 5GS0D 4HPYH 4IOFD 5IK3B 5EZJB 1XB3A 1NLDL 4YGAB 1I7RB 5D2LE 3AG1B 1FGNL 3UTQB 3O11B 4J6RL 1G5GA 2XFXA 2QKIC 2EVGA 5I8OH 4KPHL 1RUAL 2DTML 4F57H 3EJQA 3L95A 1TQBC 4NJAL 3JYCA 4N24A 2R2EB 3F12A 2YD1A 3QG7L 3RL2B 5E6IC 4NNXA 2H0PA 2OW6A 5BMFH 4M5ZH 3PP3K 2AZAA 2CUIA 2C3GA 2X4OA 3MROB 4G8EB 1WIPA 3IS0X 5DD1H 4BK5C 3ZVVA 1EO5A 4CSSA 2K6WA 3FXIC 4PEEA 2ZWNA 3MLSH 1NUGA 5KVFE 1IAIL 3L3IB 3WN5A 3WTSA 2G30A 2XVLA 3QCTL 5FK9A 2WQUA 3FQ2A 3EOBA 1MCNA 1P1ZB 2PF6A 1R3LB 2IH8A 3NEXA 2XDHA 1N0LB 3TURA 3O3BB 3PP4L 4OV5B 4H13C 1WP6A 1D7FA 2AJ3B 4IK6A 3UTZA 1Z0MA 5ESAA 2ILLA 3BSGA 4NN5B 1JCVA 2DICA 4WWKC 3NCCB 1XBDA 1U8IB 4LOUD 3NMEA 2GQHA 4UV4H 3FB8A 5BRZB 1H3VA 5MI0B 4FDWA 2P5WD 3QUKA 5EEXA 2JK5B 1NIBA 1UD3A 2VM3A 2DMHA 3VI3F 1CLZH 4KZCA 3S37H 3U36A 3W81A 1KV3A 4Y9FA 4F9PA 2GSGB 1G1OA 3EO9L 1H5BB 3EBGA 3GI9H 4XPFH 4XAWH