3B7YA

Crystal structure of the c2 domain of the e3 ubiquitin-protein ligase nedd4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
151
structure length
144
Chain Sequence
ATCAVEVFGLLEDEENSRIVRVRVIAGIGLASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase NEDD4
publication title C2 Domain of the Human E3 Ubiquitin-Protein Ligase NEDD4.
rcsb
source organism Homo sapiens
total genus 25
structure length 144
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3b7yA00
3GPEA 4AOFA 1HE8A 2EP6A 1DJZA 4FHKA 5G55A 5G2NA 2WXRA 1E7UA 4KZCA 4OVVA 4XX5A 2WXLA 3TWYA 2CHZA 4WWNA 4ANWA 4A55A 1UOVA 5EDSA 2WXFA 3APCA 3NZSA 4IHBA 4XZ4A 4QJ4B 2WXHA 5CCGE 4ANXA 3RPBA 3JZYA 3QARA 4FLHA 2WXPA 3L08A 3QJZA 4LCVA 4KITB 2D8KA 2ENJA 4NPJA 3ZVVA 4EZKA 4FHJA 4TS6A 3M7FB 4L1LA 4BFRA 1E8XA 4HLEA 4EZLA 3DPDA 4URKA 4V11A 3L9BA 1RH8A 3TL5A 2NQ3A 2CJTA 2CM5A 3N5AA 4GB9A 3FBKA 4NPKA 3ZW3A 2CHXA 2JQZA 4L1BA 2K3HA 4G11A 1DQVA 4FULA 3OAWA 3QAQA 2WXMA 2CHWA 1K5WA 4QJ3B 2NCEA 3LJ3A 4EZJA 1E7VA 3KWUA 1DJYA 3IM1A 3CSFA 3DBSA 1QASA 1UOWA 2RD0A 2WXQA 4FADA 3PREA 2QZQA 5JHBA 3SD5A 1W16A 3CSTA 5KJ7E 2B3RA 1DJWA 4WAFA 2Y3AA 3PRZA 5T8IA 1E90A 2K4AA 4LDCA 4LT7A 3L17A 3PYCA 4F92B 4F1SA 2WXOA 2FK9A 3L13A 2Z0UA 3T8MA 1CJYA 3QK0A 5H4YA 1BYNA 4WWOA 4XE0A 4ANUA 2N1TE 3HN8A 4Y1TA 3F01A 3PS6A 1TJMA 4GNKB 1V27A 4F91B 5H4ZA 3L54A 2A4ZA 3ZIMA 4ICWA 1E8ZA 4J6IA 1TJXA 3HIZA 4KZ0A 3HHMA 2WXJA 2WXNA 4OVUA 3W56A 1DJXA 3MJWA 4PS8A 3APDA 2V4LA 2YOAA 3NSJA 1E8YA 2ENQA 4MJJA 3L16A 3KWTA 4QAMB 3F04A 2ZKMX 4FJYA 1DSYA 1QATA 3APFA 1WFMA 5CCJA 4L23A 2A5UA 2CM6A 2LHAA 4PS7A 3RDJA 2R83A 3ML9A 3TJPA 3NZUA 2DMHA 4JPSA 2KI6A 4HVBA 1BCIA 1DJIA 2CJSA 2WXKA 4L2YA 2K8MA 2K45A 4FA6A 3PFQA 3QR0A 2ENPA 3L4CA 3S2AA 2UZPA 1RLWA 3R7RA 1DJHA 5JHAA 3F05A 4IQHA 4DK5A 4ICXA 4NP9A 4TV3A 3F00A 2WXIA 2Q3XA 3B7YA 1W15A 4BGDA 4F93B 2BWQA 1E8WA 2X38A 1RSYA 3P2BA 2DMGA 2QZ5A 1GMIA 2FJUB 3R7QA 4DNLA 4QJ5B 1UGKA 1WFJA 3FDWA 4TUUA 4ANVA 3OHMB 1YRKA 3ENEA 4Y1SA 5CCHE 1DJGA 2CHDA 3IBEA 3QR1A 4PS3A 2ISDA 4AJWA 4NS0A 2YRBA 3W57A 4WWPA 2NSQA 4FJZA 1A25A 3ML8A 4WEEA 1BDYA 2WXGA 2Q0ZX
chains in the Genus database with same CATH superfamily
3GXDA 1CICB 1JI2A 2BP5M 3HI6L 3TYGH 2UY7B 3CFKA 2A77L 5ESQA 2H2PC 5KJRH 2X1WL 3G5WA 3O6ML 5D1QA 3VFWB 3HMWL 3V4VL 5T3ZD 5B3NA 3DTXA 5CXPA 1GHFL 3ABZA 1KG0A 5KBLA 1MI5E 3QQ9D 3EFFA 5CZRA 1QACA 1FG2B 4ES8A 3IFNL 1HHHA 2ZKXA 3W9EA 4DKEH 4EEEA 1A6UL 4FNQA 3MNZB 3WTWA 2B4CC 1RZQA 1UZ6F 4XPAH 5BVJB 1N18A 1MJJA 1VJSA 5I8KL 2QFPA 1HE7A 2V37A 3T3MF 4AEEA 1JD9A 3VI4A 2ADIA 4X5XA 3MRNB 5TQ0H 3GBLA 4PBVC 1FFOA 1JXGA 1WT5A 4X80L 3RWGA 4N5UA 3O6FA 3P9WB 3FTUA 5AVRB 1GGIH 1E6JL 1MIML 2OTPA 3N42F 2CCLA 5EOCJ 5I0YA 3EGDB 2H3KA 4WWKC 1JWSB 1E42A 1MWAA 4HEPG 3HFFA 3V52L 3LVTA 1GIGH 2GBVA 1LWHA 4H0HB 1JZEA 4K3JL 4Z1PA 5BV7C 2G3NA 3P0GB 1CFVH 3JWOC 3PS6A 3VM7A 1HI6B 3ZSSA 1FNGB 3VB8A 2J7LA 1MRCL 1WFOA 2XV3A 4MNGB 5JHDE 1FGVL 3KG5A 4PB0L 3MBEA 4GJTB 2QSVA 1ZSDB 1RK1B 1HH9B 4G3YH 2AI0L 3QUZD 4O4YH 2YA1A 5FM5M 3KWTA 1T1WA 3D0VB 1PX3A 5D70H 1QFWM 4Y19B 3KLLA 3AG2B 4JG1H 3RY6A 3S4SA 4RFEB 3BO8B 4HJUA 3MCKA 5IJKC 1U0QA 5I2IB 5T5NG 3QZLA 3OSKA 3K71A 1BAFL 2F7RA 5AAMA 4EN2A 1CXHA 5BRZD 5AL8A 3E6HA 3ZR6A 1N3NB 3DJSA 3JV6B 3ARDC 3V5HA 4EIZC 2Z34A 3VD5A 1NAMA 1SRDA 4RSYA 5IQ9A 3WN5A 3F83A 3S2AA 2ED9A 4CDHA 1GOHA 3HEIB 4J3UA 2QQNL 1HDMA 4HKJA 4AV0A 5AOJA 3OR6A 2A0LC 4JHAL 2RACA 5GPRA 1JK9A 2H6UA 2MNJB 1O9VA 3ASWA 4M00A 2GITB 4PRBB 5FF6B 1GGBL 3K6IA 3A6BH 4PJCF 1FNFA 2W80C 4JY5L 5E5MA 2D7QA 2I60L 2DEXX 3FMGH 2AEOA 5L9DH 5L8JB 5EOCL 3APNA 4M93B 5C0GA 3AS0A 4EZMA 3CBKB 5FOBB 5LLIC 1RD6A 4YDVA 8PAZA 1NCHA 2BJMH 1U93A 4FQLH 3SOBH 2N3JA 5KSBB 4W93A 5E8OA 4AEIL 2B15A 3DOIA 3GMPA 2RAMA 3H54A 4MCZA 4RFOL 1N2RB 1ETJA 2ICCA 3FQRB 2XV6B 3ES6A 1A5FH 4R7DB 3V95A 2GSIB 5EO0B 3F6IA 3DHPA 4A37A 2D8KA 2VSKB 5I73B 1MFAL 5TPWH 3SBRA 5ID1B 2FH6A 3MKKA 1IC7L 2G9HB 4LSRL 4P2QD 1B0IA 1E27A 5CM1A 4G8FB 1UJ3A 3FQXB 1KV7A 4PW3A 1ZLUK 4BZ2A 2FQDA 2XKUA 5CGBA 3D4YA 3PDOB 3CSGA 5A2KH 2DQCL 3BZ4A 3QNYB 1UWFA 4YVNA 5F9AC 2ZSWB 3V6OC 4X8GA 2YD1A 3DK0A 5F7FA 1QRKA 3PQYE 3VXUD 5H37G 3EUUA 1H5BA 3EF7A 4KDVA 2DJMA 5H2BA 3QIWD 4KKBD 3OHXC 1R4XA 5HYIA 4NDMA 3QUMB 5LAXA 2ZOWA 1RHHB 2V5SA 4ABQA 2CUIA 5I17A 5KG9A 1RJZB 3FO0H 4JN1L 4PY7A 1R3KB 1TZAA 3VRJA 2K4WA 3KPMA 5CEZE 1CU4H 1GZHC 2F6AA 2UWEF 1PG7H 4G71B 1ETZA 4L37B 4PRAA 2Y4SA 1TJMA 2DPKA 3QUZB 3ZRCC 4DVRL 5F3FA 2YQBA 4JFDB 5EPMA 4WEBH 4NP4H 4HS8H 1KBGH 2GBTA 4P05A 4R6UA 3RL2A 3V4PL 3PNWB 1WGOA 3BEVA 2OPCA 4JDZA 4YH6A 4JHUA 1Z3GL 3CXDL 3IDMB 5BRZB 1OF2A 3DX2A 4WJKB 4RMUA 5I1EH 3I2CL 3N55A 5EF1A 5EEWA 1RZGB 4KROC 2A1WL 3QQ3B 4M8QA 4ESKA 2AQ2A 2Y5QA 4HIJA 4JM4L 1LO5A 5DFTA 2QKIA 5EO1A 3QR0A 1AXTL 4Z23A 3DYOA 3MGTA 5EUKA 3C9NB 1AHWB 4PRHD 1RCYA 3GM8A 1DSFH 1E9PB 4O58L 2GBUA 3TO2B 5F1NB 3TBWA 2L04A 3O8XC 4N87A 3T0WA 3NZ8B 4QRFA 4TUKL 3UZEA 1B4LA 4KI5C 2MOQA 4GMSH 4IRZL 1T7YA 1WBZB 4KNUA 4WO4C 3DX1A 3EYFA 3TBSA 4XO5A 1THAA 4FLRA 5CJXC 1A25A 5F7WC 4OLUL 1A7QH 1AO7D 3QDHA 2A6KA 4KRNA 5IBTL 2JH2A 2ZCHL 4X6BA 3ZTEA 3I50L 4JO2H 3OAZH 4UT7L 4TLUA 1N8OE 5J6HA 1S7SA 5L7XH 2JMRA 5C3IA 1I3GL 3I6LD 4KO7A 2ADFH 3UAJD 2DLHA 4MMZA 4N6QA 1EJOH 5DJ0A 3Q05A 3L5WA 1Z0NA 2XN9D 2NY5L 4P2QB 1OL0A 4LPCA 4TTDD 4APQC 4WFFE 1ZS8A 4TSBL 4CSTA 2QKSA 3D5OF 4Z5RB 4RMBA 3W2DH 3BLPX 4XGZB 4FABH 4URTB 2X1OA 1F1DA 1P7QA 1V7NL 4OCRH 1ZANL 3D48R 4HYTB 3UTSA 3CPLB 3WEMA 4BQ6A 1WO2A 1X7SA 2Y1AA 3VXUB 2R4RH 1RVFL 4NNPL 1X7TA 3VRLF 3GB7B 1A0QH 4Y2LA 3IM1A 4UF7C 3CSFA 1ZLSH 5D4JA 2Q7YA 4RNRB 4WENB 5D1ZA 3MRMB 5B7FA 4UTAL 1E9QB 1RULH 1ZHKB 2WTRA 3P0YL 2WQRA 2XZAL 2B20A 1JJUA 3U9PL 2FGWH 4PWEA 5KUMA 3T4AC 4AZ8A 4BFKA 4C4KT 1NPNA 4YHZL 4FQCL 1CTOA 3LPPA 2IPKB 3TA3C 3LQZA 3ME0B 3NN8A 1JUFA 2BK8A 4F5CE 2DWDB 4Z95H 1PZ3A 2X88A 3BP4B 3GRWL 3K0YA 3SHSA 1W80A 4XWOD 3MN8A 4LOVA 1BVNP 3AVEA 1WTLA 4YZWA 2X41A 5BMFL 2Z4QA 2HFGH 1MHHB 5DS8A 2ZXAA 2V17H 2HVBA 5DQ9A 1PZ5B 3FOLA 4Q0XH 3EOBB 4Q89A 3ZHNA 4TL4A 3WJLA 4JVWA 4OZHE 2PF6A 3TFKD 5LG6A 1TQWA 1VEMA 5AUMB 5I6XB 3ZMEA 1A7NL 4XBEH 4Z7IA 1S8DB 4NQDB 1XDTT 2EC9U 5BRZE 3V79C 2CM6A 4PRID 1UGNA 2HZHA 4ISVB 3UTPD 5D71L 3OQ3B 5G4NA 5JOFB 2BSRA 5C08A 4UOZA 4QF1B 4PRHB 3Q8FA 4RMSA 4A2HA 1NWPA 3VG9C 3IMWA 4XNXH 1EZSA 4F9PA 2ZOUA 5SX5K 5EZIL 1NMAL 1OPOA 4XCFL 5C6TL 4H26A 1LXMA 4G1EA 1VGEL 5L2KA 1IBDA 2BVEA 1ZTXH 1KIRB 1RP8A 1CLYL 3TH3T 4BUQA 1BYPA 1P6AB 1SEQH 2VLRA 2PR9A 4DNLA 4U6YB 3A0OA 1AO7B 3L2MA 2ZAGA 4M62L 5E9DD 3QT2A 2FRGP 1LK3L 4X6EB 1CL7I 4WWPA 4KKNA 5DEFA 1BZ9A 2VNCA 2Q2EB 4TQEH 4KAQL 1BIHA 3L9YA 4F7MA 1ADQH 2XN9B 2ED8A 1EO5A 3DPBB 2ZSVA 3G7TA 3C09B 2FJHA 5KVGH 5HJDA 1JDCA 3VI3F 3HC4H 4AQEB 4PRNB 3KVDD 3H2WA 4GINA 1NCWL 3W0WA 1MXGA 1OCZB 5J89A 2X70A 4P23D 3VWJD 1HC1A 1LNUB 2IBGA 1BVLB 4Y5XC 4WFGD 3DNKA 5KBNC 4R8WH 4E41E 4AKPA 5IB2A 3FB5A 2NDGA 3PWVA 1R33A 1KGIA 1BSIA 3MRLB 1E5ZA 4JAMA 2A9ML 2V7NB 2Y06H 1SY6A 1FSKC 1TZOA 3L7EB 1PKOA 4HU2A 4K8RC 4LNRB 1E7VA 3CN3A 4NHCH 5LNEA 3RIAF 2DQDL 1QZ1A 2H6OA 3TNMA 2I32A 3CD4A 5ICXB 5AB2A 1MFNA 1QO3B 1UACL 1U8IA 4X4KA 4X6FB 4FQXC 4LVOB 4M5ZH 1F11B 1QPPA 3V9EA 1IAIM 4ZW3A 5IWLC 2JTDA 1XXFC 3RWHA 4BZ1H 1AR1B 2FIKB 3ZKMD 5GS0L 4YR6A 3EOYG 4C57C 4QKTA 5IB1B 2BY2A 1CJYA 4R2GD 1CDYA 2V8MA 3HVNA 1JF1A 3MV8A 4XNUL 2Q8AH 1LP9B 4GXUM 2FBRA 3V6ZA 3A23A 3ECBA 4P5TC 4UAHA 1KYAA 3K6SA 1VENA 3LZNA 5EIIA 3OAUH 6FABH 5DO2D 1NICA 2FSEA 4PRIB 1E8YA 4FE9A 4PY8I 2OYKA 1S7RA 1GGUA 1S3RA 3HZKA 1RKRA 2HH0L 1ZXQA 1NOAA 2YN3A 2X9ZA 3KBHE 3SZKC 3TJHD 1KGCD 2IXQA 2BSBA 4WW1A 1GKOA 4LBEB 1CYWA 3U36B 3BCFA 5DEGA 4HMDA 4FS0A 4D9QE 4D8PB 1L9SA 5F88B 4Y9FA 3RAJL 1HHJB 3SYAA 3NJNA 4XH2A 2XA3A 1NC4B 2G2RA 2Q1EA 2ARWA 3BQUC 5FDWB 5I5IA 4B5ZA 1G0YR 3LH2H 2AP2A 3RUGF 4YSCA 1EHXA 4KVNH 2WZPD 1AZVA 2VISB 4IBLT 1Q0YH 5E9DB 2M2DA 4KC3B 4QRRD 1AGBA 1GMIA 1R5IA 4KGJA 3SE8L 1IGIH 3EJTA 3N9GH 3VM5A 4PS4L 2VH5H 2ATKA 4NRZB 4C56E 3CFDA 2V33A 4IRJC 3CVDA 2XPGA 4UINL 5D1XD 3MODH 2PYEA 5IMKA 1WBXA 3I6LE 4ORZC 2JLLA 1A4JA 4HULB 4P23B 3VWJB 5JDJA 4WNQB 3FF7A 5TDNB 2OA9A 4NENB 5E1GA 1SYSB 1MDAA 4NZRL 2H26A 3Q7JA 4B60A 4QNPE 5M7QA 3GINA 3QARA 4A38A 2J57A 4FAAB 2EYRB 3CMOH 3BN9D 2XWBB 3LIZH 3QZOA 4OFVA 1R24A 3HJEA 1KJMA 1TTFA 2Z91A 1XFPA 3HW7A 1V3MA 4JPKL 4JREB 3GXMA 1XIWA 1EUTA 3N40P 4LEEA 1QZNA 2WHVA 4UT9A 3IDYC 1GJWA 1XAKA 1YDPB 3FQWA 1U8JB 1SHMA 5L0QC 5DMGC 4RETB 1WF5A 2W60B 3AT8A 3D6GA 3QI9A 4GKZA 4K73A 1HU8A 3GSVA 4ZRGA 1I1CA 1XGYL 1GYWA 2DB8A 2V3DA 1V05A 4KMTL 4U1IB 4XRCA 3V2AR 1AVAA 4OQTL 1MF2L 4IK7A 3HR6A 3VCLA 3ILQD 3MRCB 2O6FA 3Q3GB 3FUJA 3C2SA 1L9MA 1X44A 5EU5B 1ES0A 1CYGA 4TRPH 3UO8B 1F3DJ 2P5WB 4G83A 2YAQA 2QR0B 2UYLA 2LT9A 1SXNA 4YHIB 3EO1B 1I85C 3RWFB 1CVRA 4L4TD 3BJ91 3WMPA 3KGTA 1FO0H 4GSDH 4WGKA 1DANT 3R8QA 5ANMB 43CAB 4LCUA 5HHMD 5E8NA 4MX7B 4W6YB 4LLAA 3STBA 2X9XA 2OJEA 1M7DB 1L5GB 5F7DA 3W9DA 2ORBL 4R0LB 2VDOB 3AAZA 3F7LA 1F3RB 1MIEH 2JKTM 2KLTA 4Z0BH 4FLSA 4B95C 2F1AA 3B2UD 4PTTB 4UV4L 1YYMH 3OC5A 5AWNH 4A2MA 5IP4A 5KBPA 4CU7A 1X7QA 4KK5D 1I1AD 4G6MH 2EYTB 3RZCC 4G7QB 5CFAA 1GY2A 2DM4A 3IAPA 3PWPA 4Z9KB 2OBGA 2R8SH 1DVXA 5MENE 1MQKL 1YEJH 5A7BA 2VXSL 5I16B 1GYVA 3NABL 4QRRB 2FEDD 4EI0A 4MCYB 5CMAA 4Y9EA 1IKFH 3AT9A 1BECA 1NGQL 3F65A 3P3SA 4PB9H 4AQ1C 2EEFA 4HJJH 3QEGH 3V7AE 3LNEA 3ULVL 1KLFB 4M3KB 1IEBB 5EFIA 4NN7C 5CLTA 4JRYA 1MLBB 3NFNA 3QUXD 4FMVA 4WCYL 2NY1D 2KH2B 5D1XB 1FA4A 1VLXA 3W5NA 2X9WA 2LFGA 2ISDA 3GZOA 2P26A 3X3GH 2Z31A 3LOWA 1WZKA 4JKPH 3WYRA 2DLFH 4KU1A 4JE4B 5FGBC 5IM7B 3ZRSA 5CD5C 3VFOB 1H9VA 4GS7C 1QI4A 2FO8A 2WAHA 2CBMA 1JXJA 3BP6B 4FQ1H 4YDJB 5EIIG 2A2QT 3AQZA 3ULVF 4N9OB 2GCYA 1J7VR 1T7XA 1FFPB 1QR1B 3KPOB 4XVJH 3RG1C 5E94B 3ZRFC 4WFGE 2P47B 3UABA 1Y6NR 2J8UB 3VMNA 1DQTA 4DZ8A 3KWWB 4OGYL 2VLKD 4K3EH 5DRXB 2EXTA 4HJTA 5HI3C 1FV1A 1SBSL 1JHLH 5D1QC 4IKIA 4XMLH 4FHBD 1F90H 3JWNE 4PJDE 4YEFA 5ITFA 2D73A 1XZ0A 3RKPA 3HZMB 1PY9A 1ZMYA 5I1JH 2PYFA 4NAJA 5ESVB 3GHBL 4NN5B 3GSUB 4Z78B 4U1HB 4ZUWA 1TF4A 2LLNA 3SD5A 3LRKA 1KIPA 4YHKL 5DRNA 4L4TB 4ZODA 3QULB 1J0HA 5T3ZL 3VSTA 4ZOAA 5DEJA 1QUPA 3RWIB 2W59A 4PV1C 1M05B 2FHFA 3U4BL 5HHMB 5TE7H 4PI0A 2I7OA 2V7HB 3MLSH 4WI0A 2E9GA 3QCTL 2Z0UA 2CMRL 1WT5C 2BOCB 2NW2A 5J9PA 1BJ1J 1MCJA 1BYNA 4FFYH 1UM6H 1BGXH 4U6XB 3MYJA 3FCBA 4WI2A 1R0AL 4GBXB 3QWOB 4HEME 4LF3B 3CZEA 1PU0A 3VB9A 1K5NB 3L1FA 4A7TA 5FECB 1HZLA 3O2DL 35C8L 1UZGA 3K91A 1UC6A 5EZLB 1I1AB 2ZPKH 2YKLL 1EHNA 2R56H 5KSBF 3RI5K 4NWTH 1QTPA 2ZUXA 5CP7A 4L23A 1VFBB 3PWNB 3AABA 4GEIA 3KEDA 3MBEC 2FQEA 3NZUA 4KX8A 5DJZA 1MPAL 3U48A 1EVUA 2QPSA 2YPKB 2B2XL 1OCCB 3FFCD 1GVIA 4LEXL 5FA4B 1D5IH 5AOIA 4QYOB 1FPTL 2IAMD 2IOOA 4AL8L 3QUXB 1IBFA 4H8WC 2NY1B 4ZTOL 2EDXA 3OJDB 1NAKH 3TC9A 4EXPX 4A2EA 2XOTA 4XX1G 3WN5C 2BP3A 3FSVA 3FDWA 3PAZA 5AW7B 3GBDA 1YEHL 3MGAA 3EADA 2AQNA 4GRWB 4R97B 1K4DA 4ZBJA 3C5ZC 3MV7A 2A6JB 1Z9PA 3QG6B 3DDGA 4PYGA 1BXVA 5FK9B 2CIIB 3WFBL 3S88H 2AEIT 3EFOA 2JKIS 4K2UH 3A21A 3ARBA 3IMSA 4K9EH 4UU9B 3LB6C 2VTFA 3CDZB 4LHQB 4J7RA 2DMBA 2OK0L 1MJ7H 4J6RL 2NY3C 4Z3FA 3WNMA 3L95A 2VLKB 3QJQB 1A3RH 4NGHH 5K39B 3FJTA 3L7FA 5CN2A 1RHFA 3FO9B 5GGTA 4EI5D 4FHJA 4H25B 2J8UE 2IDFA 3T0EA 1J5OL 1TZGH 2CBOA 3GBNL 5BQDA 1TVDA 5I66A 2F54A 4JHVA 2XN0A 5GGQH 5A43C 5I23A 3ZE2B 1V3KA 2X4OA 2VN3A 4ZMPA 1UJ3C 3S2CA 2ZT9C 4OJYA 1CPUA 1MWOA 2DH3A 4G7VL 3AB0B 4L4TE 3D39B 4FDWA 1BJ8A 1IGFL 2NY2C 4U0RB 3EOAB 2WC7A 1H5BC 4UDTA 3HOGA 2XFXB 5HHME 5HGAB 2X7LB 5IROA 4O51B 5T3XD 3BCDA 3OPZL 4M6MH 3KH3A 4NM8L 5C71A 4KX7A 1ILSA 1IE5A 2AITA 4X4YA 1J0ZA 4RWYL 3QQ4B 2ZJSL 2XG4B 3ZE0B 3QC5X 5ICYA 1B6DA 1MSPA 2EXWC 5BRQA 4UI2A 1YEGL 3QJUB 1ZGLM 3WLBA 4M7LT 1QR4A 3JT2A 3KLAB 3HI6H 2YPVL 4B97A 2ZKHL 1X4XA 1WICA 3CN0A 2C1PB 3FU5A 2G3XA 1FP5A 2HN7A 4GT7A 3VGAC 5TJWK 3TTSA 3O6MH 1ZIAA 1E9OB 3HMWH 1DBML 4X5RA 3V4VH 3FFCB 4KJPD 2ZICA 4FG6D 1PBYA 5DUBA 4S11A 1JXDA 2IAMB 1GHFH 4A2FA 4HBQA 4XP1L 2CJSA 1H3XA 4IU2B 5HVHC 3IFNH 3RTQA 4CMMA 3P3YA 4JG5A 1G87A 3DC0A 3BMVA 3N44B 1A6UH 2NMSA 5GS3A 3VMPA 1WV7T 4N3TA 1FL6B 1UWXK 3D85D 2BVTA 5GIRA 2Y7QA 1IAIL 1O6TA 4GLRH 4Z7AA 5I8KH 4BXSV 2VLLB 3DTDA 2QKIC 5CHNA 3I9AA 3MROA 4JCLA 1JYVA 3SDXB 4NUGL 4X80H 2QDVA 3EHBD 1OAJA 4JG9A 5CKAA 3RURA 4LRIC 4JO3H 5A1AA 3K46A 3MXWH 2C3VB 4CNIA 1E6JH 1MIMH 4BKTC 1HQ4A 5E03A 4Z3EA 5HYFA 3B2PA 5BVPL 1VA9A 1Q38A 2HRHA 1M6OB 2AC0A 1CVSC 3KPRE 1F4XL 3AQYA 4UQDA 5G4OA 5SX4I 3V52H 1E7UA 3SEPA 4UQ2A 4JQVA 3WLWC 1UQSA 4XBGB 4EI5B 2NXZD 3LD8C 1MKFA 1CMOA 2ETWA 5D7IA 5B3JE 1JRHI 1MRCH 2H0FA 2V5YA 4CJ0A 5CIPB 4PB0H 5JIQA 1NDTA 1P6FA 4W9LC 4F58L 5BQ7B 2P5PA 2APVA 4G82A 4YJZL 3MRPA 5KVFH 1CFQB 2IFGA 4NIYE 3ZDXF 2E6JA 1PCXA 3IS0X 3RB5A 4OGXH 3VQLA 5GQBA 5HGGS 5EHFA 3D7PA 4M4PA 1G7MA 4B41A 3QO0B 3UTQB 3ZE2E 1VCBC 2BSTB 1YN6B 1A4KA 1XR8B 2QQNH 3ETBF 1YA5A 2E3VA 3BYYA 4JHAH 1E40A 4MA1B 1HSBA 5SV3A 1IV8A 3NJIA 5I76A 5T8IA 1IGJA 1U8LA 1GGBH 1N7ML 3LQMA 3QJHB 2GTQA 2RALA 4AVIA 3WHXA 5BS0E 1LEIB 4HPYH 5D1ZC 2I60H 4YHYC 3FCSA 3CFCL 4KUCD 3ZJAA 4CADB 3RHWF 5EOCH 1USQA 2GK0B 3IDGA 3V0WL 4N2AA 2NZ9D 4WUKL 2JE8A 3RDTC 2AJYL 1WZ1L 4MAZA 1NH6A 1AI1H 3T8XA 5JNYA 1OAYL 1HILA 3L45A 1HJBC 3LRSB 2FBOJ 1XCTB 3CZJA 1XGRB 3HZVB 4LGSB 4W9IC 1E5UI 4P0DA 4PJIE 1ZHNA 1R6VA 3JZ7A 2RB8A 2D2OA 4HIEB 4DGWC 2ADGA 4EAEA 1LEGA 3RDJA 3UYPA 5FM5O 2BY0A 3KHQA 4X98B 2J25A 2YAEA 3Q13A 3WJLC 1J12A 3KL0A 1MFAH 5D72L 3D85B 2FECI 3QAZC 4LCCC 1MUJB 4JFQA 1IC7H 1MI5A 2EIDA 2EO7A 4LSRH 4PVMA 3V9FA 2RMNA 3L4CA 5KN5B 1HEZB 3ZLQC 1RJYA 3AFLA 4I2XB 3SDDD 2OMYB 3MRJB 5F7EL 4FYSA 1LE9B 3NOIA 1PY4A 2LU4A 5DUML 3D3VE 2DQCH 4JGNA 1EK3A 3JTBA 2L7QA 3S5LB 2XC8A 1JG9A 2Z93B 3FU6A 4F9PC 4BSVA 4A2LA 5BOPA 4HUUA 2H9GA 3HI5L 5AYUL 2CCVA 2NSMA 4O5LL 2EDJA 1QUNA 2XZCL 3DVFA 2ZUUA 3V5DB 3ML8A 2NXZB 1YCSA 1WHPA 4IMKC 2Y7NA 4OGAC 5EC2B 1EZLA 4JN1H 2FO4B 4FHKA 4XTRD 5DJ2A 4TVSa 4W6WB 2IC2A 1LO2L 3KGRA 1LP9F 4DVRH 3BYTA 5ICZA 4HCRA 3BUTA 3EH2A 2GG1A 5FHAH 4PV8A 5IKCB 3V4PH 4LCVA 2UV3A 2Q3ZA 1O7DC 1SVZA 3L3HB 1Z3GH 3CXDH 1VSCA 1SLVA 2J8HA 2X12A 1PDKA 1I9IH 3FBKA 2PPCA 4NFCA 1N9PA 2X4UB 3TH2T 1JYWA 3IPEA 3LXBA 1GPOL 1TJGL 3PUUA 5I30H 1WWAX 4JM4H 1MCPL 3ISYA 4X6DA 2XKSA 1N8ZA 4PWGA 2BS71 1GZQB 3MRKB 1AXTH 3GLEA 3KWVA 1HXMB 4ELMB 3BOVA 1SF3A 4ZUUB 3SGEI 3FO2B 2OYPA 4JQXA 4O58H 3HHRB 5DTFA 5SWZB 4HV8A 2OMVB 3H7BB 4BHUA 1FORL 4JFPA 4Z3JA 2J2ZB 3GSQA 4TUKH 4B9ZA 4OJEH 2EKSB 2AJXL 5F0PB 2J12B 4IRZH 2WN2A 3PUCA 2ID5A 2DBJA 4X9GA 3A3YB 1LGVA 3A4FA 5CSGA 5E6IC 3VTTA 5DHVH 1LD9A 4MA8L 3BPCA 5IBTH 3N1MC 4CN4A 2DWTA 2WUCH 3I6KA 1JGLL 4XWGL 1I3GH 3V0DA 2GABA 4XBMA 3I3DA 2CDEA 4OW6A 4L4VE 1WFTA 2NNAA 4GMTL 5FDYA 5CCJA 2EXYC 5CSZB 3CFBA 2NY5H 2QSQA 3WIHL 4NQUA 2K9FB 2VE6B 5JLZB 2J3SA 4TSBH 4BCYA 1XF2B 1EUUA 4QDGA 4HMEA 4KRPD 2F1BA 4I77L 1AHKA 1EXHA 2DI9A 3FT9A 1V7NH 1LYQA 4UYPA 2R2BA 1I7TA 1ZANH 3I6SA 5DHEA 1NLDL 1VCAA 5K9OB 3QDJA 1HHGA 2Y3NA 1RVFH 4NNPH 3WTTA 3LRLA 5FYJH 3HUJA 3BN3B 2CHNA 2CCWA 4UTAH 5F6IB 3PQYA 2XZAH 3CBJB 3U9PH 1UA3A 2VDOL 4YHZH 4UQ3A 1ZT1A 4FQCH 1T1ZA 3KYKL 2WXGA 3ULUE 2E7HA 1ZWIA 1FL3A 1GYCA 2QVTA 1S7WB 4GG8A 4D0CB 1I53A 1KELH 4KV5F 5HHNB 3FFDA 5KVDE 3NRQA 1DBJL 1W72B 5CR8A 4DGVL 1BBDL 3FT2A 4HAGA 4P3DA 3LZPA 4QMEA 4U1SB 3VGDA 3CPUA 2VN5A 4N8VB 5D4HA 3SKMA 3W38A 1X5XA 4LHJB 2X89D 3N04A 1WYJA 2SEBA 2Z9TA 4TULH 3WEBA 1URZA 3M88A 4WJ5A 1A7NH 1HWGB 2OCCB 2P24A 1WE5A 5A2LH 4FNPA 3S3PA 3GSXA 4XO8A 5D71H 4M1DL 1NCBH 4RGMC 2EDYA 1E4XL 1SQ2N 2WIIA 2CK0L 5DFWH 3C60C 1Y7VA 1NMAH 3T2OA 4XCFH 3QI9C 2H2SC 4M7JL 5C6TH 5FFGA 3NH7H 2OTWB 1F45A 2MOVA 4ELME 1K3IA 1KCKA 2DF3A 3CHOA 5E4OA 1A6VL 1BIIB 1QBLL 4HFWA 3PGFH 1CK0L 4WUUE 2IV9A 5IBUB 3WI9A 5DMIL 3NQIA 1LK3H 4P5MB 4FNRA 1KTDA 1I31A 2J43A 4OR1A 3HHMA 1TR7A 4XI5C 1DJXA 5AVWB 1Z66A 1FYTE 3G6DL 2A73B 3MV9D 5AB0A 2GW5A 3UPRA 2FWSA 1R3LA 4KK6D 4KRPB 1MRDH 4JB9H 1INQA 4ZW6A 1K2DB 5GZOC 1OE2A 2MOGA 1NCWH 2J1KA 4P46A 4WHTA 4PLKC 3BX7C 1DUZB 2EECA 4NERA 5ETUB 4JMXA 3BPNC 4LCYA 3CH1B 4AE1A 2C4FT 4J3OG 5H35B 2J8UF 5KEZA 2NY6D 5IVXB 2K45A 3PHSA 4FG4A 2GT9B 3UEZA 2X2JA 3AJ7A 1RLWA 1SJXA 3H9SB 3VXTB 2J73A 1PFCA 4NRYB 5EB9A 4FL4C 4YC2C 4Y0GA 5CINH 1PZCA 1A7BA 2VZ3A 2YPLE 5FUOL 1CS6A 5DRWB 4LHUA 1ZLWH 3WFHA 1A9BA 2DQDH 2FJUB 2GTZB 4OV5B 5EO9B 1NSNL 2WANA 4ABVA 5BUAA 1OOAA 2AQQA 3QXAA 1UACH 3GS0A 3GSRA 4N24A 4OJFL 4ZW5A 3HN3A 3NCJH 2O26U 5M95B 2WOBA 1ANUA 5GSVB 5EU3B 5GS0H 4ONHB 3IAQA 5CKGA 3WAJA 5HHXL 1NCNA 5CEYA 5FHBL 3L3JB 4B9CA 4OZIB 4XNUH 3QZWA 3ZUCA 2DQJL 2GJJA 4IW4C 3L5XL 3DO7A 1F56A 4IIZA 3QIUD 3L08A 3MJ9L 5DHMC 1GW6A 1ZXKA 3ZDZB 2ZUWA 4J8RA 4OZHA 1YMMD 4POUB 2IANB 4JHBA 3D18B 2HH0H 5IEHB 1ZVHA 3MRDB 5CD3A 1P1ZB 4K94C 3TT3L 2OL3B 4PJGA 2Q5BA 3QFGA 4XCEB 4DW2L 4BK4A 5FLUA 3RAJH 3KGUA 5IY5B 4PGBB 1UOWA 3O4LA 4ELDA 1NJ9B 25C8L 1NINA 4QAWA 2EIJB 4ZFZA 2B1AL 5IHHA 3MOQA 4YBLC 1UT2A 2EABA 4OJCA 1H3TA 3IDIA 2H1LM 4UQ9A 2A3TA 3CFIC 3U0PA 3RZWA 2F8VA 4F7CA 3EYOB 2R2HB 4NQVB 4YO0A 4PS4H 1DQDL 1AFVL 2R0KH 4NB7A 4PR5A 1XH1A 1ZT4B 1W0VA 3MV9B 3S8WA 2XI9A 3Q8CA 4GRWF 4KZ0A 1JWUB 3F7VA 4UINH 4S10A 3ZKSD 1M2VB 4ZMNA 3U6XA 2K6ZA 1OTUD 1WSST 4OFIA 2ENQA 3Q06A 4NZUL 2EEXA 4GXFA 2L4OA 3L4ZA 1XSIA 4HZLA 2JLPA 4R5TA 5EV7A 2JKJA 5F1SA 4BRVA 1QFWH 2OW7A 2NY6B 3HNTL 5IMOA 2HT4D 2ICWI 1ETB1 3FN9A 1OWWA 3AACA 2NR6D 5D8JL 3QJSB 4OZGE 3EO0B 1E4XI 1Y1UA 3QNXA 4JPKH 3OLIA 5DMJB 3KAAA 2AAVA 1XF3B 3BJLA 2G60L 3U30C 5EU6D 3OZ9L 4V2CB 4Y1AD 2QPDB 4JLRB 4ZDHA 4YHLL 3HG5A 4X9HA 5MERB 3NESA 3IN2A 1VKXB 1Q9WB 4LPUA 1RUPL 3O3DB 5ADPH 4QRTB 4PSRA 4AQOA 4KMTH 2UY6A 4U7KA 3EYQC 1P4BL 4OQTH 1MF2H 3ZE2F 3US0A 1ZVNA 4FZ8H 1KGJA 5EA0L 5BUGA 3BT2H 1UD3A 3MO1B 5IFJA 3IXTB 1QEXA 3KYNB 2XYCA 3HHSB 3M1BB 3HE7C 2R7EA 3JWDC 2ZAIA 1MREL 4PW9A 4LLWA 4RMQA 2DLTA 1EEQA 2VIRA 2CIKB 3QIUB 4F8PA 4KZCA 4CILA 4W4OA 4PAZA 1CQKA 3WMQA 4V33A 4PW4A 3WOVA 4W9KC 1YMMB 2AKRA 1IGCL 4N6RB 4YHPA 3RVUC 1TU2B 2ZOKA 3MCYA 3ARBC 3RTLA 2ORBH 3ZE0F 1ZA6A 3B3IA 3FB7B 4N28A 1FZKA 2FB4H 2V5TA 3FPXA 3P4NA 3EF4A 3UCRA 3BE1L 5ACMA 2WYTA 4GP5B 1KT2B 2CDGB 3H4HA 3C6LC 3ZDZE 3B83A 4F2FA 3B34A 1ACZA 4AENB 3OXRB 5D93C 4AKOA 1QTSA 5DJDB 4OZFB 5DWUL 1GOFA 4QJ3B 2NY0C 1NBYA 7PAZA 5C3LD 2Q6WA 2DJUA 1SN0A 3L8QA 1MQKH 3MRHB 4BFOA 1Z9SA 2CO2A 3Q1EA 4YAQA 1P6WA 1I7RB 4TQHA 4WSKA 3NABH 2F53A 5CEZH 5C7ZA 5J4MA 1I9JL 4K9JA 1NGQH 3N44F 4FQJH 5KYWA 5E4EC 1KB3A 4D9RD 3GMMB 3X2QB 1N10A 3K72A 3MNWA 3U9UB 5KZCD 1N59B 1NC2A 2D3JA 2ZP8A 3IMRA 4A2DA 4RRPA 1PNDA 2NY7L 1YECH 5AW0B 4HIHA 1JPSH 1F3DH 3SDXF 2CXKA 5J11B 1ZK5A 5HTSA 3OWEA 2ROYA 3ZKXB 3Q8AA 5CN1A 5IROC 5FO2A 4DO5A 1UUSA 2OV0A 5JORA 2BSED 1S7UA 3T65B 1F0LA 3KH4A 3OKLB 2CPCA 3GXNA 2F5BL 2JKNA 3QZWG 4FCAA 3HTLX 4ORGA 4QHMA 5BJTB 1OAKL 3TYFA 1XSKA 4K07A 4XODA 5TFSL 1H8LA 4FI8A 1L9OA 4F7PA 5EU6B 4FXGB 3FBQA 4WI7A 4YGAB 4N2IA 1ZKAA 2E7CA 3LZLA 4I5BB 4OGYH 1JN6B 2QADD 2AVGA 5T3XL 3IE9A 3KBPA 3DGGA 1SBSH 1WHOA 3CFJA 2NUPB 4IMLA 4QTFA 1MLCB 2FX7L 1L3WA 3UAEA 3VFSB 4W68A 2VABB 4P9HC 2C1OB 3C75A 3GHBH 4OF8A 1S7VB 3NSDA 3RTQC 4GUPA 4K3DL 4OFQA 3LKOA 4IBUA 3CDFA 1XCQA 3SQBA 4PWKA 3IK2A 4LIQL 2AXGB 4YHKH 5JO5A 3CCHB 2Y2YA 1A9EB 5DD0L 1UB5A 4P8QA 5T3ZH 5DD5L 5EDXA 3F12A 3U4BH 3RYMA 3NCMA 2R1WB 3DX6B 4FQQB 4KKLD 4MRBA 5KVEE 4L0PB 1EZVY 1UM4L 3QCTH 1A66A 4P2RE 2CMRH 2YQGA 3BKJL 3G9AB 1M9SA 4P9ML 2IAAC 1HHKB 2ICEC 4WWNA 2NTFB 4B9KC 1UOVA 1R0AH 3PXJA 4LVNC 1HAWA 4ZQKA 3GSWB 3LKSA 3O2DH 4F9LA 35C8H 3OG6B 3F84A 4EDXB 1NBZA 2OXHB 2ZXDA 1RL1A 4MQTB 4N26A 3T6ZA 2BY3A 1AC0A 2WZ5A 3ZKQD 4AKQA 5J3HC 1KTCA 1WAAF 4JQVC 1LVEA 2BXZA 3MDJA 2YKLH 3SQOH 3LHPH 1FZOB 4BBWA 3OB0K 5E95B 2JKRM 1TPXB 3JVGC 2A9NH 4TVPE 1JGDB 4U1NA 2XDHA 3GO1H 1JMXA 2YRZA 1KPVA 1MHEA 1ZLEA 2HWZL 3KYOA 1MPAH 3X12A 4WEMB 3FTGA 4TXVB 2B2XH 2RD0A 3QUMH 4R7LA 4LP8A 4LEXH 4UANA 5KZCB 5MENA 4P2OD 4DIXA 1A3QA 1KACB 4Z7UE 2NNXA 3MREB 4ZTOH 3L2NA 3D69B 1KIUA 3UBXA 3PG2A 2QT6A 1PD0A 5DJCB 3MLVL 3HE6D 2QQQA 3ARXA 5JW4N 1AG6A 3NT0A 3RGHA 3MUZ1 3QEHA 4WWKD 4XP6H 5EOTB 5AVTB 4EE2A 1GXEA 2E27L 3HN8A 3GMNA 1YEHH 1I8KA 2DQMA 1W9XA 4L8BA 3IEAA 4GAFB 1BJ1H 1SMOA 1J5DA 4F37F 4QGYA 1PX4A 4PLOB 5HYQB 2D03L 4QTHA 2OK0H 4J6RH 2HYMA 2J6EL 1MRFH 1U8OB 2N56A 3ISWA 2K0RA 2QADB 3BI9X 3SO3C 2V2TA 1D9KC 4MD4A 3RX5A 3OMNB 3LS4H 1U3NA 2AXHA 2LOEA 2YKKA 3OKOA 4Y1AE 5IT2H 1CD0A 1J5OH 3BH4A 2G3ZA 4JPIA 4J39A 3UZQA 1NCTA 2VC2H 2MQCA 4XMPL 4PJDA 5F8RC 3W11C 5D2NE 2UX7A 5C0AA 3VW3H 1ZV5A 1Z9OA 3IMVA 2X6UA 1XMWA 4DPAX 1B0WA 2W07A 4FERA 4NHUA 4ZO8A 1KTLA 1UB6A 4HLJA 3B43A 5GS1A 2FD6L 2N0KA 3WMSA 5JW4R 1AQDB 1EEZA 1JPST 3D05A 3E2HB 3WNLA 5I1DB 3D2UA 4KUCF 1B4JL 3BLKA 4TL5A 4V1DD 3WDJA 4BH8B 3VAEA 3KDMA 3L3DB 4RRPG 4XVSL 2B1HL 3DDFA 5MI0C 2JXMB 3OPZH 4NM8H 5JOPD 4JO4L 2ZWZA 2AXWA 4GT0A 4IIQA 1QFHA 4RWYH 1TZIA 2VL5A 2ZJSH 4QHKI 2JCCB 2VB5A 5DS1A 4HEMA 3NRFA 1JPFB 3ZDYE 3BRGC 4G8GA 4FXKB 2FQFA 2YPVH 4GFXA 1QD0A 4YVUA 3VD0A 5DC4B 1RI8A 1HL9A 5DRZB 5C07A 2WVVA 2YMOA 3TT1L 2Z7WA 4KJYA 1OCOB 2X09A 1DBMH 4MXQD 4D0BA 4O02B 1D5ZA 5IHUL 1CXIA 4RIRA 3ZX1A 3OAWA 2E7BA 5MEPB 4P2OB 2W94A 4XP1H 1FFQA 4J3OC 4Y2DA 2CGYA 5MEOA 3HE6B 5T1MB 3SYQA 4D9RE 1KMGA 2CPUA 1LTXA 5F96L 3DX7A 1IAIH 2H6PB 1MQ8A 1OAQL 1W72L 2R2EB 5ISZD 1CFTA 5C0IB 4YBQD 3ZMRA 4NO3B 5DFVC 1FQ9C 4NUGH 3S8GB 5JW5B 3BWSA 1U3HD 3E6FA 3NAAL 1SEBB 2HJKA 2M8XA 3DGDA 2C3XA 5E8PB 5BVPH 2HCZX 1L7TH 1M7UA 2VQ1B 1F4XH 1G5GA 2V4LA 3KNBB 1RPQA 1QAWA 4QAMB 4DUWA 2MFNA 4LL1A 5E2TH 5DO8A 2YC1B 3CIAA 3GSNA 3BAXA 4FKKA 4A1RA 4QY8B 1BEXA 1LO4L 1NMCC 3PIQA 5MEQB 4A04A 5DT1L 3MLUH 3OD3A 3QXDA 4BSWA 1G6RA 1CG9B 3AWFA 2P8MA 3B2XA 2MCPL 2EDBA 5C8JB 2EUVA 4IBWA 1NUFA 3Q6FB 4MAUH 3WUWB 2CO6A 1QBAA 2BP8B 4JHWL 2H32A 4FLOA 3V6FB 3ECWA 4M3JA 3L6FB 2X4RB 5C7XH 3GIZL 1HZHL 3TLRA 4V1DB 1AGCA 3ZIYA 3FQTA 1KB9K 1TIUA 2H5UA 2WWNA 2Y07L 3BZFB 3H0TA 3IJ9A 3OV6A 3H55A 5E1AA 2A74B 4K7PL 1IL1B 3GMRB 4E5XA 3GBEA 3S37H 3V7AG 3B3BA 2BNUA 1YEFL 1N7MH 4JO5A 2Q0ZX 3PRZA 1NMBL 2K9UA 3MRQA 3IJEA 1AKJA 3IS1X 2XTJC 4CVWA 3CXFA 3N1PC 3SCMA 3D4CA 5K9QI 4BCZA 5EULV 3V0WH 4WUKH 5I1KH 2AJYH 1W0WA 4N9GA 3EGXB 4KTYA 15C8L 2YJQA 1BOYA 4F8LA 1OAYH 1DQKA 1AS6A 1ND0A 4Y4FA 1TQUA 4APQD 3SD2A 2YFOA 4RISH 1TSHA 1FG9C 4JQIL 2EYSA 1CWVA 4OCSH 2ERJC 3QAQA 5DK0A 1DJSA 5DQJB 5D72H 3S98A 4ZS6D 1PQZA 4CVXB 1A21A 3LPFA 4KY2A 4B9PA 1HL8A 5IVXF 4KZEH 4OJAA 2CNZA 2HLAB 2GFBA 3JWNG 5D7LA 2FUTA 3V9CA 2CALA 3GJFA 1PF3A 4OSUL 5DUMH 1DFXA 4OI9A 1XL6A 1HEHC 1U3HB 4G9DA 4E36A 3NP3A 1DEEB 2H1PL 3CZKA 1ICTA 1IJ9A 3ROLB 3HI5H 2WMPA 4RAUB 2W0PA 4O5LH 4LLQB 1N64L 3TCLA 1KULA 4Y9BA 1PAMA 1UWEL 2OW6A 5EEXA 3IGKA 1MNUH 3GI9L 3N43F 3AREA 1TCRB 3NSJA 1QKZL 2OL3L 3HG1E 1HN1A 3K7UA 4OZIF 4ZUSB 4DQOL 2QELA 2EDFA 1AANA 1LO2H 3FAXA 5E00A 1ZE3H 2P7TB 3KLHC 2RR3A 5JPNA 4NC0B 5H94B 4W4NA 4GEJA 1C9SA 5I19H 1J5HA 1IX2A 2WQWA 3IETB 3CDCA 1BZ7A 4JVUA 3WXWL 1J18A 3ZDZF 4MMYB 2CDFA 2Y6SC 5E6ZA 3A6CL 1DQQB 1JPGB 4FFWD 4P46C 4BA0A 4EUPA 4F8QA 4G43A 2F58L 4XPTL 1GPOH 1TJGH 3CQPA 4HHWA 1W15A 1M3JA 1USZA 2CLZA 1A6TB 1JNHB 1RUQL 1IGTB 4PRDA 4PJ5D 4N25A 4GRMB 3U0TA 2ZWNA 3KPPB 1J5IA 3V4VA 5BZDB 3BW9A 1F00I 2OMXA 1VPOH 4JR9L 5F9JB 4MZ2A 4Q6IB 1OARL 5K33A 5ILTL 5F97E 3WSQL 1OGTA 3O4OB 3CC1A 5G2NA 1PCSA 4R4BB 2AJXH 1UASA 2ZOLA 2GI7A 3U7YL 1NCUA 3IU4H 4HAKA 4JDTL 3DOHA 2VERN 3IN0A 5DK2B 4JFXA 5BXFA 3L2LA 1ZPLA 3B7TA 3RL1B 4GG6E 1KJ2B 2PXYD 4MA8H 4M29A 3F7QA 2ZXBA 3S37X 2YEQA 3PDGA 2RQ8A 1JGLH 1PVHA 3MA7A 4XWGH 1D6VL 5LXVA 1JNNL 1DQLL 3UDWA 4HS6A 2Q8BL 2WWMD 2Y5TA 1JFQH 4HUWB 1YMHB 4PJIA 2MHAA 2DJ4A 4PLJC 1M2OA 2FL5A 5E9AA 3WIHH 1XHHA 1D6EA 1H19A 4N0UB 4OM0H 1CXLA 3T8VA 1U92A 3C6SA 4MD5B 4NO5A 3V6OE 4FADA 3EGSA 2PP7A 1TYJA 4K8RD 3S35L 1VGKA 3H56A 2PW1B 2GPZA 1NLDH 1U41A 4BFGA 4PV9A 3GMLB 4LLMB 4PJBA 3BGFC 1B88A 5AVQB 5ISZE 2HTKC 3ESVF 1Q0XL 3I6GB 3OLEA 3QQNA 43C9B 4FQXD 4GIOA 4D9LH 2F8XC 4CMHB 3H4FA 3D3VA 4ZW8A 1WD8A 4PEEA 1P9MA 4PRPA 4PUBL 3BLBA 2VDOH 4E5XG 1R34A 2QLYA 4WHYG 4WWID 4M7KL 4FLQA 1KLUA 3KYKH 3QHFL 5FYLD 4P5KA 2VM3A 4D0DA 3DYMA 4KDWA 1QLFB 2XSKA 1DBJH 3QSKB 2A4EA 4OBRA 1BBDH 4ZUVA 3VO0A 2JNZA 5EG6C 4PJEE 1M71A 4RMVA 4QO1A 4BDVB 3U2SB 1OSPL 2WQ8A 3A4AA 4NUMA 4ODBD 3ULSB 4HJGB 4MNQD 4IGBD 5IQ7L 1R5WA 5HHOB 4XCYA 3D30A 1C5DB 1I3UA 4OKVA 1M4KA 1NFAA 1T1YB 2BLFA 3QDME 4PJ5B 4HW6A 4TV3A 2BHUA 4HWNA 4MYPA 4HIIA 5JXAL 1HVXA 5DZNA 1MCNA 1FDLL 4I3RL 3KCPB 3P4MA 4M1DH 3UZVA 1EBAA 3QS2A 1N6UA 1S7XA 2VSDA 5F9WC 3SY0B 2CK0H 2ZG3A 4KI5E 4YQXH 2FX9L 4EI6A 1IZKA 3U4AA 4ZFFA 1OIOA 3NACL 2DQTH 4J23A 4ATWA 5B1BB 1A6VH 1QBLH 3QEQD 3NCYS 5C2BL 3F6LA 4DZBB 5A2JH 1CK0H 3G5XA 1IFGA 3EG9A 1UADC 2PXYB 1OALA 1QYGL 2UWEA 4XX5A 2V9UA 1CFNB 1BPLB 2XG5A 5DMIH 3SPVA 1JV2A 5CCGE 4U1LB 5AVSB 1T7VA 4EZKA 3C12A 2EVHA 4W4OC 2QV4A 3G6DH 3DXAE 1OZTG 3G5ZA 4U6HB 2Q87A 4Q97A 4RAHA 4OU3A 2ZUYA 3RY4A 4QGTA 2WLIB 4ZAKD 5I1AA 4QHUA 5FKPA 3SGDI 1OSEA 2IDTA 4WFHD 3NPSC 4LEOB 1IQWL 3LJ3A 4X99A 2YRPA 4HD5A 4FN0A 4KKPA 2VR4A 3BUDA 2A6DA 3L3KA 5FUCC 3B2MA 2V9RA 5IW3A 4EUPG 3GQFA 4UNVA 2H3NB 1DVFA 4I0PB 1QHQA 3V4PA 4MA7L 1XF5B 2IG2L 3BWAA 2Y7OA 1IM3D 3MJ6A 5FUOH 2JB5L 3I75A 3KPLA 4F92B 1SJHA 3CC5A 4A7UA 3LN5B 4U2ZA 4YBHA 3VSQA 4CC4C 1AH1A 1NSNH 4ELKB 3QA3B 4OJFH 2EEDA 4H2AA 5CZXC 5KS9E 4F91B 5CLWA 2ZYIA 5KSVB 3LV3B 3FU3A 3FQ1A 2W81C 5I75B 4J4PD 4TYUA 2J4WL 3HN5A 4JZOA 4NFBA 5HHXH 4IOSA 2BDNL 3WFEL 4HZ1A 1LLAA 4O2EA 4MNQB 3ZZLA 4IGBB 1DSYA 2DQJH 4YXHH 1JVLA 2XWTB 3CG8A 3TBVA 4NXKA 4JFFE 2OJZL 4PJ9A 5FEBA 4NQCE 2NNRA 5HPMB 1BF5A 4I87A 3FONA 2GEEA 3T3PB 3QYMA 4IRZA 4AM0B 2N7AA 1GGTA 5CJBA 3QBTB 1DJHA 3M17B 3TT3H 2Q86B 2XKNA 4BWWA 3VFNB 4GUOA 1D2OA 3AUVA 2BNRA 3PABA 4YL9A 4DW2H 1RZJL 4TNGA 5HDBB 3VXQB 4AC2A 4R96B 2IH1A 3N50A 4Y5VB 5I0DA 3FCTB 1VFAB 25C8H 1TTAA 3TVMD 4A67A 3RFZB 4HWBL 4HGKC 1OM3L 4I3SL 3QEQB 2PO6A 2B1AH 3BPOC 1OP3K 4IOIB 3PWJA 3WS3A 4JGJA 5AZUA 4FJZA 1ROWA 3BP7B 5B22A 2QDWA 1YG9A 3V0VA 5J6GB 4XE5B 1YQ2A 2IQ9L 5AZEL 1QFUL 4YLQT 2A6IA 3DVGB 5CO1A 4F57L 2IGTA 3SO5A 1DQDH 4TNEA 5F6HI 3RILA 2CHZA 5CD5D 4JFEA 2P5EA 1XF1A 5GZNA 5I24A 2IPTL 3ARFC 4MXVE 3WN6A 4ATTA 2Y24A 4BH7A 4QJ4B 4ZAKB 2P28B 1F41A 1CZ8L 3EO9H 1TVHB 2KDYA 1IT9L 3UBHA 4P2YA 2E0PA 3RBGA 4MJ2A 4NZUH 4UTAA 5J1SC 1H3UA 2QLVB 4PD4K 1S7TB 3HFMH 4KXAA 1G1OA 4WK2B 1Q72L 1KSRA 1I7UA 4MDJA 4MHHI 4F9LC 5DSCB 3HNTH 2J55A 4IJ3B 3KPQB 2R1YA 3OJMB 3NBNA 4BWUA 1EDHA 2HT2C 5D1QD 3P77A 1QNZL 2WXMA 3BKMH 2ADYA 2DM2A 3RNKB 3KWUA 1ZHBA 3GRWA 2XACC 3QCVL 4LFHG 1K8IA 3QXVA 4OFKA 1OANA 1F1AA 3DX8A 4IJTA 3X11A 3CFQA 3ZBMA 2J56A 1BD2A 1IM3B 1RK0A 2OX5A 5L6YL 5AG8A 1UCBH 5GISH 2IIJA 1EV2E 1NDGA 3LKPB 4P07A 5IR1B 3AM8A 5LGJA 1LMKA 4ZXBD 4YHLH 1GZPB 4HUCA 4QXGL 4WKZA 3FF8A 2I07B 3IU3A 4QCIA 1RMFH 2AV7A 1AGDB 2YPLA 3P3RA 4HWZA 4NCC2 2W0LA 2X5PA 4U49A 5KAQG 5B8CA 1P4BH 2PCXA 3QHTC 1QLEB 4Q4IA 3GXTA 3O3BA 3QQDA 5EA0H 1IMHC 1E2WA 4DEPC 2Y36H 4M7ZC 1MHCB 1JYNA 5FYLE 5IUSA 5ICUA 5EZJB 3KXFE 3O6FD 2OSYA 5E4IA 1IRAY 1XEDA 5TGBA 3LKRB 5IJVA 1CBVH 1IFHL 1B0GB 3FZUD 4O02L 5E24E 1T22A 3ILDA 4NRXA 2WYIA 3EJUA 3VI3A 1ZD6A 1XGPB 1IGCH 4PG9A 4L8SA 3K5RA 3X1GA 4OT1H 2DMHA 2JCCF 4BFEA 2GJ6A 4ETQB 4TSAL 2F74A 3MBED 2ZWSA 3VD2A 3VGGA 3T1WA 2JKXA 4WFED 3T3PE 3ZYZA 3T0BA 2VITA 2JJTA 3TVMB 3NTCL 5HY9A 1NOFA 5DWUH 4PJFE 4LBAA 5FB8B 1CFBA 5LDSA 1ID2A 1XBDA 2DKMA 2HKAA 1IU1A 5JTWA 1NFDA 5BZWB 5HDBE 1SXAA 3SYPA 3ENEA 4KNQA 2OCJA 3N0PB 4EOWH 3R06A 2Y22A 4U3XA 4Z7VB 3TO4A 5TH2A 4HT1L 2I7SA 1LO3H 4NAQA 1IM9A 1U8PA 5TDOA 2HVJB 1YUHA 3MRFB 4ODXB 2NY7H 3RGVB 5GS1C 4RGNC 3GNML 3EYVB 1D7DA 2ATPA 4J3VA 4PJXF 1MH5A 3CFKB 5A16A 4F7EB 2IVFC 5ESQB 3H9HA 2RFXA 3BVNA 2HAZA 2D31A 5D1QB 2F5BH 2AW2A 2K1MA 4IIQC 4N0CC 4C47A 4E9WA 2X42A 4G8EA 1OAKH 4Z0XB 3DTXB 1OTSD 1UD5A 3HBPA 4LLDB 5EF2A 4KXCA 4N2HA 1KG0B 1L6XA 4LCWA 4R7XA 1BQ5A 1GCYA 1XF4A 2DYPA 4ZXBB 2YBGA 1ZS2A 5DVMA 3NZHL 4WI5A 1IUZA 1M57B 3AC0A 5T3XH 2XBTA 1EGJL 3VFVA 4H7VA 2VMFA 4Y7MA 1E2VA 2AJZB 2K7PA 3FOMB 2FX7H 4PG2A 4HFUH 4XOAA 3VI4B 4A2GA 2ADIB 2IALB 4HGWA 4XNDA 3SDAD 4Y2DC 4K3DH 3RWGB 1GH7A 3O6FB 2EC8A 5IFAL 3OGCA 2NY2D 3F01A 4XMTA 1I82A 3BIKA 5DD0H 3VQ2C 1XGUA 1DO5A 5C70A 1UM5L 5JMRA 2BZCA 3D9AL 4TQIA 1UM4H 5KSAA 4N90D 2QHRL 4Z7WE 1AYOA 4WV1A 3BKJH 1G9NL 2EADA 4P9MH 4FFZL 4IBVA 2BCMA 2BIMA 3U25A 4Y16A 3PXLA 1V3JA 3RJDA 1JF6A 4DAGH 1WQVT 3K6FA 2WLZA 1HX0A 1X4YA 4TSCH 5L88L 4M3HA 1YEKH 3EUDA 3VMOA 4U1MB 3K71B 1Q94B 2ADJB 3Q44A 4RSVA 3VDBA 1G9ML 3E6HB 3TBTA 4B53A 3MTRA 2DBLL 1A6ZA 2HRPL 2QGCA 4AXWB 1J48A 1NAMB 4TF4A 5JXED 2O93L 1EXUB 2VMCA 5D5ME 2FUQA 2HWZH 4U3SA 3RPIA 4HKJB 3QDGA 2BOBA 3RPKA 3AG1B 3MX0A 1X5KA 2WQAA 4QRUA 1U8KA 5B1AB 4UM8B 2B59B 2CQVA 1H0DB 1H3PL 2CBPA 4FGMA 3TBBA 1X6NA 3TCTA 4AIEA 3EBAA 3LEYL 2JKSA 3CN2A 3VWKA 2W5PA 2H8PA 1QW8A 2WBJA 2J71A 1NGZA 2VLJA 4PWHA 5D9SB 3SCMC 3CLFL 1R5VA 2ZCKL 2RHEA 4KK8D 2E27H 3AU0A 4YDVB 4GIPD 4XPBH 3GM0A 2R0LL 1U93B 3OAYK 4W9ZA 1Y0LA 5E8OB 4JZJC 3GMPB 1Z5YD 5IQMA 4OQTA 1L9PA 5HYJA 2M26A 3DUSA 2XPYA 5FYKE 3SGJA 2XT1B 2YXFA 3K8MA 1NANH 2J6EH 1CICA 4G6AC 2UY7A 3GZQA 4QXUH 3L4TA 5D1QE 4JCMA 4BKLB 1Q90A 5DCCA 4GH7B 1TYRA 4MRCA 4LASL 3VFWA 3IRCA 1HQRA 1DJYA 4Y4FC 1E27B 3KW7A 1FNHA 2WUBL 4LQ1A 3FK3A 3PREA 4MQSB 3HRZB 3OXSB 3SDAB 1FG2A 1KN2L 2Q9OA 4B9FA 5C0RL 4XMKH 4S2SB 4IBZA 4XMPH 2XQYA 1ZHLB 1WEJL 3AXHA 3UTSD 2UZYA 1NLBL 3FH7A 3MNZA 3IGAA 4ODWB 4HHGA 2WBKA 5H2BB 2BCKA 5LAXB 5EU4A 3MRIA 1WZLA 4Y1TA 1KJ2L 5AOLA 4AG4L 1DANU 2FD6H 2Z1PA 5I17B 5KG9B 4EMZA 1HZKA 5DLML 1F6FB 3IFOA 3VRJB 4YHOH 2ITCB 3KPMB 3RI5F 1B4JH 1DVSA 1D5MA 2VM4A 5FW7A 4PRAB 1AZZC 3EGDA 3MFGB 4XVSH 3SDCB 2HP4A 3U9WA 2B1HH 4DPCX 4KQ4L 1B2YA 5JIMA 5EPMB 1YZZA 1KDJA 5FCSH 3V8OA 2AMGA 3LZQA 2NYZA 4KRLB 4RBPH 1TQVA 3GPSA 3BEVB 4JJ5B 3SBPA 1HI6A 2SODB 3AREC 3NIGE 2W88A 5JR1L 1NEZB 4YN3A 3B2DC 4MNGA 2IGLA 4AIZB 1NWOA 4ZSOA 5I1LA 1RK1A 1HH9A 3HMXA 4BH8A 3TT1H 1OQOA 3UMTA 5JPNC 1MEXL 4HPOL 1JDAA 1NZRA 3BVUA 4R4NC 4Y19A 5ALBH 5DZLA 5IHUH 4H8UA 2DIEA 4UCFA 5EO1B 4E9TA 5I2IA 3MGTB 4TPRL 1CFSB 1SJVA 3FCUB 1T83A 4KQ0A 5C08D 1XX9C 2ZYRA 4PTUA 3JV6A 2LTQC 1Q1PA 2PWHA 1JHKL 3TBWB 3QZNA 3SDYH 3SIKA 1QBMH 5MHSE 3F85A 5F96H 1YY9D 2MPAH 1OAQH 3LYRA 5AOKA 1W72H 5LCVA 3GBML 3RIFK 5FF6A 2GITA 3K2UL 3EYFB 4IOFD 5CBEA 2WP3O 3TBSB 2WINA 3MXVL 3ECQA 4X9IA 2VN4A 4OGAD 4OLEA 2XQ0A 4FC3E 1EHKB 3OMZA 4LSTH 2XVBA 4X6BB 4Q6YA 3UC2A 2P3YA 5CWSB 1S7SB 3DRTA 1FZMB 3SBWA 4MMZB 5DQDL 3L5WB 2Y25A 5IQNA 3TYGL 3V5KB 5KSBA 1Z9NA 1IGYA 2FEJA 3P9LB 5DVOA 3VXME 2LR4A 4NPKA 5KJRL 1HXKA 1N2RA 4F7TA 3FQRA 2D0GA 1CGXA 5C0CB 3W0WD 3ZN6A 4R7DA 1NDMB 3RA7H 5EO0A 4R90L 3UTSB 3UDWC 2YWYA 5I18H 3KPSE 2DM3A 3KCWA 4W6XB 2G9HA 2XPZA 3H3PL 4NKOA 2NXYC 5LQBL 4G8FA 4OCNC 4JHWH 3FQXA 4FTVA 2ITFA 2ZWYA 4XPAL 1NUNB 4LKXB 2VQUA 3EIFA 5D2NA 1LMIA 4RMTA 1CE6A 3K3QA 4I3GA 2Y07H 4H4NA 4DWHA 1BA9A 2KHAA 3NN8B 5D2LB 1JUFB 1G4MA 2IOIA 4K7PH 5C09B 1A2YB 1W0YT 3X14A 3UX9B 1N5AA 1YEFH 3NJMA 2YD3A 2E8YA 2A4CA 4DEUA 1J8HD 5AFAA 1MAML 1P9MC 2Z4QB 1TVBB 3N3EA 4K8RL 5DS8B 5SWSD 5CU9A 3F04A 5DQ9B 2UUDK 3FOLB 4W9HC 3NEXA 4GYBA 5HDOA 5IJDC 2DQIL 4MZ3A 1PPIA 15C8H 3NEOA 4JFDA 2IOMA 4H8PA 4X0KB 1NTDA 2EXYD 4BKSC 1RP9A 3LVEA 3WFCL 1A9VA 3DV4A 3PNWA 1K3ZA 2YUZA 4Q9QL 2DY2A 1H3VA 2FSDA 5ABZA 1ETA1 2BSRB 5C08B 2HKFL 3IWUA 2IDCA 4PJAB 4BGDA 1RZGA 5FYLL 5KSUB 3QQ3A 5C0DA 2HLFD 3NA9L 1WC7A 2MRYA 4TUUA 3M6DA 4H26B 5FA3A 4G1EB 4GW4B 2XQYG 4OSUH 1KCVL 2NSQA 3C9NA 1AHWA 1K4CB 4NNYA 4ZOEA 2VUKA 3AXLA 2VDMH 1E9PA 2X6MA 2ZF9A 5F1NA 2H1PH 4QD2E 2OMWA 1OT1A 1LWJA 3DX3A 3LPGA 3BDXA 4I88A 2X4QA 3PAYA 2WLLB 2WNGA 5DEFB 1N64H 4AQAB 3T0VA 1BZ9B 1EX0A 4GW1B 3WE1A 4F7MB 3M1CA 5L9DL 1QPXA 1J8SA 1UWEH 3GWJA 4AYEC 3P02A 4IDJL 4TLTA 1UT9A 4TM9A 2ZSVB 3G9VA 3GI9H 5IJBC 3WTUA 3OC8A 2VERA 1EA9C 1Z5LB 2PYED 2OL3H 3ERXA 1U91A 3W0WB 3ILEA 2X70B 2XA8L 4Z7OB 2YZ8A 3N85L 4NBYB 4AYSA 5I0ZA 1HL5A 4GAAA 2FYYB 2WLMA 1A5FL 3VE0A 3EJZC 4UBDC 3HBQA 4IBYA 1FE8L 3A47A 4FXTA 1CGWA 4PP1C 3T3PF 2BO0A 4JAMB 1W6LA 4G9FD 5TK4A 3GMQB 4XGZA 4ZZKA 1XIWD 4YFLF 1JV5B 4RA0C 3UGUA 2R23B 3BVVA 4XPTH 3DO3A 3R4DA 3CPLA 3VXUA 3QI9D 1DEDA 1RUQH 1EJFA 3ARUA 3H1ZA 1DFBL 5HDBF 3QPKA 3GB7A 2MCAA 2IH3B 1DVFC 1ZLUH 4RNRA 1J8HB 4RGOL 3RWHB 2B5IC 1A1MA 3MRMA 5BO1L 4YR6B 1YNTB 5H4ZA 5SWSB 2DLGA 3X1EA 1E9QA 3AS3A 4XCCH 1OARH 1JF1B 3D25A 3OKEB 3WSQH 2IPKA 1ESOA 1EDYA 2WKLA 3FHQA 3FO0L 4K71B 3VRIB 5CGMA 3K6SB 5CU5A 2DWDA 4ZX5A 3TS8A 3BP4A 1X5GA 4UZSA 2QVKA 2EE6A 4JDTH 4PCKA 1LILA 1MOEA 3MNVB 4QRQA 1SMDA 2LU3A 1MHHA 4NP4L 2N7SA 3HZKB 1TOXA 5DUJA 3UYRL 4Z7QB 4WW1B 4N5ED 1CE1H 1FHNA 1JNNH 1DQLH 4RZKA 4LVHB 5DEGB 4PJ9C 2Q8BH 4HOZA 1HL4A 3V0HA 5T5NF 5AUMA 4QHLB 3KM1A 2Y2WA 4NQDA 3SE6A 3MLZH 1QLEL 4QRPA 3HB3D 2VO8A 1JS4A 5C08E 3X1BA 3PCYA 2HXAA 3PWPD 3T71A 1JZ7A 4PRHA 5F1IB 3S35H 4Y8AA 1L9TA 4F15C 1AZBA 4FKHA 5L2KE 1EH9A 1JZ6A 1Q0XH 3VFUB 2JV6A 3QRLA 2NW3A 2VLRE 2HJFA 5GGSB 1K8DA 2NY5C 2PO6C 3CFDB 3RNQB 4NUPA 5CNHA 3ZK0A 2XPGB 4B96A 1P69B 1RAMA 2PW2A 5IMKB 1AO7A 4PPTA 3NSXA 3HC2A 5DZJA 2YGPA 4N8UA 2Z31D 4M7KH 4TVPH 3ARVA 5IF0A 3PHAA 3QHFH 3QUYD 3EH5B 4HJIA 3WTSA 5C2UB 1O7DE 4ZMLA 4JO2L 2XN9A 4PGEA 5GZNC 3ET9F 5L7XL 3HG1A 2VXQA 3DPBA 4NX0A 2ZUSA 3MBXL 4WIQA 2ADFL 3W0WE 2QPFA 4NLHA 2JQZA 1KJMB 1OSPH 2Z91B 4G9FB 4N68A 4PRNA 4UQCA 1UENA 1XIWB 5E51A 2NCEA 3E1F1 5IJKA 1GYAA 1TQCC 1UEYA 3CVHH 2XIIA 5IQ7H 1LNUA 1NFKA 1BVLA 3FQWB 4JM2A 3GDBA 4FABL 3ARDA 2F7OA 2HTLD 3HS9A 1FN4B 3ZTDC 4ZMQA 4XRCB 3TN0C 4PWJA 1HTYA 2V7NA 1GL4B 3BFOA 1OGAE 3GK8H 3L7EA 3VXOA 1PEZA 4LNRA 1ES0B 2OR9L 3FYEB 3CFTA 3AMLA 3BT0A 4KJWD 4S1DC 2UYLB 2FX9H 1RULL 1QO3A 1YLBB 5ERWB 4X6FA 4Z7VF 1UWGL 2A9CA 2FGWL 4HS3B 3NACH 1QSFA 1F4YL 3GUTA 4LCUB 2X6BA 3CVBA 5IBLC 1J9CT 2FIKA 2OJEB 3NVQA 3MV8E 2P52A 5IB1A 2Z8WC 4RFNC 3W9DB 3MUJA 5E6YA 4LK4A 4ZX3A 1ZVYA 4X6CB 2EJ1A 1IVTA 1QTYT 1KDIA 2LAAA 4JPSA 4PIRF 3MOAL 4ZO9A 3RVVD 3ATFA 4A7VA 2QSCL 1RIHL 4Y9CA 2YS4A 3HB3B 4HK3N 3UIZA 4PRIA 4RQQB 5E6RB 4NNXB 5IVZB 4YC2B 4BQCA 2EILB 4LPTA 3VQMA 4NP9A 3RKDC 1TLKA 1SDYA 5CEXB 4HAFA 2W1NA 2ALAA 4LBEA 3KJ6H 5DWPA 3U36A 3NGBC 5CMAB 2JQAA 1YJDL 2C9SA 4EF3A 5F88A 1HHJA 3QWQB 4POZC 1BVNT 4KKCD 2JJTC 4P2AA 2ZNXA 1NC4A 4XNXL 4YSRA 2ZUQB 2EUXA 5EFIB 1X4ZA 5LG1A 2IG2H 4IS6A 4ZYKB 2JB5H 3VI4F 1T6VN 2BMKB 4C83B 5SX5H 4Z3HA 2Z31B 5JPMB 3QUYB 3TO4C 3CBRA 4PP2B 1SMAA 5I6OA 4JG0H 5JHLA 1GZHA 1NGYA 4DN4L 4NRZA 2WXPA 1F3JA 2PYEE 3CU7A 1COBA 3H9YA 4XP4L 5EUOA 3RVUD 3GJFK 2BDNH 4TQEL 3WFEH 2GCYB 4RX4A 3TPUB 2ODHA 5F7NC 1NAML 1KYUA 2ED6A 4NJ9L 1IQDA 2BP0A 1BXUA 5KVGL 2OJZH 4JRWA 4L1BA 4NENA 2ITDB 2MTAA 1UZ8B 2EDHA 5EBMB 1YAZA 3LNIA 4DVBA 5ITFB 3BRDA 2WZ6A 2XWBA 3K80A 5C97A 1XZ0B 4QEGA 5GXBB 2WOYA 3F8UB 4R8WL 5GS0C 2PYFB 5HHQB 3T0ED 3KE0A 4JFVA 1G7PA 1UCTA 2D4FA 4I18C 1Z6JT 4H88L 5DJXB 3IXAA 1DLHA 4WAFA 1YDPA 1RZJH 1U8JA 2F61A 2W60A 2E47A 2IDQA 4MQ7B 4Q52A 1PAZA 2F7PA 2R9HC 3BVDB 2TAAA 4NHCL 4XX1E 5D6DC 2WQVA 2VMJA 2MKLC 2OYMA 4PG2C 1OM3H 3O8XA 2XWXA 2NYYC 3IF1A 4M5TA 2ENSA 3MRCA 4M5ZL 4NUJB 3K8LA 3Q3GA 4WO4A 2NW2B 4CKVX 5DYOB 3D0LB 1NCDL 2IQ9H 2P5WA 1QFUH 3MYJB 5AZEH 2X87A 3T09A 1IFRA 1HSAA 4BZ1L 3MLRL 1P4LA 1XGQA 3RWFA 3TEXA 4NKIH 2DYRB 3EFDH 2KZ1B 1T5XB 4OGZA 1WCQA 2IPTH 5ANMA 1OZUA 4MX7A 4UT6L 5KSAC 2C9AA 2X3CA 3CMGA 6FABL 1RZKC 2IDUA 1IT9H 2ZUVA 3QH3B 3DIFB 2PCFB 2BSCA 4W9CC 4NZJA 4R0LA 1F2XK 1T4KA 4MQXD 4Y16C 5E6UB 3CFMA 3QIBC 1Q72H 5ITBL 1AP2B 2D7PA 4JW3A 1BVZA 4PTTA 2D0FA 4YDLC 4CN6A 4MMXC 1JYXA 1M9WA 3REVB 2EDWA 3E3QC 3PWPE 4X9BA 1MNNA 2CRZA 3HAEA 1AR2A 4JY4A 4UUJA 3CGTA 4A68A 5L6YH 4HGMA 3K6OA 2WZPA 3FS9A 3RTQD 2R39A 4YGVB 1ACXA 1F6AA 1HKFA 1NIEA 1CLZH 4QRRA 4D7PA 2DQEH 1T20B 3WIFB 4KVNL 1RZ8A 3T4AA 1Q0YL 4JRYE 3OKNB 3SQRA 1YYLH 1KLFA 5LBGA 4EIUA 3FTSA 1O5DT 2K6WA 1MLBA 1EJ8A 5T1LB 4JO1L 2ICWA 5D1XA 2W9LA 2BHZA 5AKVA 3T0DA 1ZPUA 3JZYA 4RAVA 2K3TA 3MHZA 3BEWB 1IFHH 2D7OA 3KS0J 4F8TA 4Z76A 3ZT7A 3OMIB 3L95B 4O02H 4N8CL 5B38A 4GI6A 3L7FB 1OAXH 2MNWA 3N5AA 3PU7A 4YDJA 4JFTA 4ZO7A 4KI1A 3RX9A 2G75B 3DX9A 3T0EB 3SGJC 4NQCA 1IEAA 2ZX9A 3GT6A 1FUNA 4TSAH 3ECUA 1BF2A 1CICC 1UYWL 1DQML 5GGRB 5CR1A 4MS8C 4PGCA 2F1EA 3KWWA 3PNRB 4M48H 4N0RA 2CNYA 2TRYA 5DRXA 5E4EB 3GMOA 3SGKA 4HSCX 1QI3A 2EINB 3STLB 1FFNA 5BV7H 3COOA 5KYNA 4HUXB 3PE9A 4UNUA 2CBQA 4IYKA 3MRBB 1MW2A 1JZHA 1NIBA 1U36A 5ECGA 3VH8B 1X9UA 2RJMA 5ESVA 5T33H 3IJSB 1B2WL 1G84A 2HPOA 4XP9L 4XMUA 4YSTA 4Z78A 4U1HA 3H85A 4XB8A 2Z64C 1IAOB 4UDTB 3QULA 2ZUTA 1M1XB 1UG9A 3U79A 3IRPX 4HT1H 2YQ3A 4YEEA 4NC2B 3UERA 4GUQA 4K23L 4X4YB 2BIOA 2V7HA 4TLKA 1E4KA 5ICYB 2XXGA 2PMZA 3LAFA 4GSDL 3VSUA 4WNJA 2BOCA 2O5NA 3GNMH 4GI9A 5IGXL 3FFOA 3WLBB 2DWEB 1I7ZA 3MZGB 4XXDB 4GBXA 3G5YA 4LF3A 4N20A 2BC4A 2IH8A 3NJXA 4UILL 1HWWA 1BCIA 1AIZA 3VUAA 2GAZB 1BLIA 1S5IL 2FLRT 1B0RA 3B9KA 5EZLA 3SJVE 3MZTA 1I1AA 1KXVA 3VXRE 3NFPB 2C4FU 4AJVA 4AV5A 3ULVC 4Y5XA 5DUBB 4I9WE 3FQNA 1YYML 3NQKA 2AEPL 1BWMA 2L8AA 4OCLC 1BQHB 2E56A 3HPJA 4QWWD 1EGJH 3Q8EA 5GIRB 3WGVB 2R8SL 1YEJL 1MI5D 1QBBA 4YOKA 5GRXG 3AGVA 5FA4A 3HC3H 3MJ9A 2ESVA 1UD8A 1AKPA 4WEUD 2QQKL 3MROB 3WE6B 4HJJL 1T83C 3GPEA 2VM9A 3WIAA 5IWLA 2A9DA 5IFAH 4CNIB 3ECVA 3U0WH 1WWCA 2IH9A 4PJ8D 3FU0A 1G7HB 3O0RH 3MV7E 1UM5H 2FWOA 3D9AH 5D2LF 2CBTA 2X4NA 3ZVVA 5FK9A 2ARJA 2QHRH 3BZ5A 3LZFL 4I48B 3OQRA 5D7IB 1G9NH 1TEYA 3MNDA 1B90A 4UU9A 3KYMB 1VFMA 4KFZC 3AWGA 3CDZA 3UO1L 4MCNA 1A64A 3DYPA 4M93C 3N1GC 3QB7C 1A47A 4AIOA 1A3LL 1TTRA 2HUEA 2AF2A 3HR5B 3SBWC 5B39G 4M7LL 4YHNB 5K39A 1TQBB 1NQBA 2QZQA 3T0EE 3FO9A 4GQZA 4N2GA 4M5YH 4FF9A 4H25A 4K3HA 1F90L 3QVAA 2HRPH 2F54E 3D0AA 4AY0A 5K59F 1U33A 3HAEG 1G7MB 2JKWA 4Q6KA 5I1JL 4PJAF 1TG8A 4L1TA 2Y69B 4K5NA 4B7IA 1KXTA 4PJFA 4WDIB 2X0WA 1A4KB 4P5RA 5I73C 3MUGB 1I3RA 3DK2A 1HSBB 1TEGA 1YEDA 2DN7A 3FUDA 2WJ7A 3TZVD 5I76B 2MQ0A 3ZE1B 1U8LB 3RVTC 4ERSH 3WHXB 2XUWA 3T08A 1E8ZA 1BMZA 1H3PH 4Y4KA 1P5VA 2VR7A 3FCSB 3MBWB 3QPQD 4PS8A 1XMEB 5TE7L 1ACYL 1B9KA 3D39A 3IDGB 4IRJA 5JIPA 4JO8A 1JAEA 1ORSA 3CLFH 2ZCKH 3EOAA 4K7FA 2XFXA 1JWMA 3CX2A 3TFBA 3HG2A 5I6LA 2R0LH 2D3NA 2VZUA 3B9AA 4FG2A 1HILB 4WZ9A 1CT8A 2E6PA 3QQ4A 2H45A 2WWKT 2FHBA 2DM7A 3GJEA 1P2CB 1SY6L 5AB9A 2C5DC 4AL8C 2ADGB 5B38G 1KTKE 3UBXI 3UYPB 1OVZA 3FNKA 3KLAA 3QUHA 4LSSL 2NQCA 2WB7A 2ZPKL 5DEZA 2R56L 4Z7OF 3QUZC 3LRHA 3CZSA 3MR9A 4JFQB 4CC0A 1PNCA 4LASH 1MI5B 5HD8D 3FFCA 1MHPH 4LSUL 2WUBH 3VFPB 2IAMA 3MLYH 3RIKA 3EH3B 4N3UA 3X3FL 4QHNB 2WVTA 1KN2H 5C0RH 4PN6A 4BJLA 5FV1L 1S6NA 1RJCA 4BFIB 3UP6A 1WEJH 3FB6B 3FHAA 1NLBH 4HUUB 3IWVA 1A22B 3QDJD 1IJNA 4PJ8B 3CLEL 3FTZA 1FVDB 1NAKL 1QUNB 4HXAH 4S1QL 3BH8A 5L8KB 4LB8A 3HCVA 3QFDA 4AYFB 1I85A 1SUJA 1INDH 4UYQA 4AG4H 3SDXA 2XTJD 1AHWC 2M1KA 2ZCLH 4X7DC 3PQYD 4XXCA 5E2JA 4H0IA 4U4IA 4Y88A 5HP5A 1YNTF 3VD1A 2GTWA 3FL7A 4NPJA 5DJ2B 3GHEL 1PLGH 3S88L 1NKRA 1A3ZA 3V8CA 4KQ4H 3OVUB 3HLAB 3L9BA 3DX4A 4U1JB 4AIXA 2UXFA 1MJ7L 5D7IE 3DSNA 1S9XB 4MAYB 1IAKB 1J1XL 5J13C 2BOLA 1A3RL 5JR1H 4KDTA 5JZ7C 5SWQB 4Y5YB 3O6LH 3X1FA 1PDKB 3FT4B 5CIPA 3O41A 3ZZSA 2HMID 4MD0B 4GSXA 1FLRL 4CSZA 5D7JB 3VGEA 4Z7QF 2ZQKA 1HEJC 1KWKA 1Y18A 1MEXH 4HPOH 4N2EA 3VA6A 5IW6A 3EJSA 1N8ZB 1H6EA 3TZVB 2K4AA 3FKUS 3FTWA 4HX1A 1T3FA 3M1OA 1LDPL 4TPRH 5AKSA 4PFEA 2WXOA 5AENA 1WK0A 5INDB 4M61A 5DTFB 1JHKH 2J1XA 1LL1A 1CGVA 3MJ7A 3QO0A 2NRDA 4MKMA 3UTQA 1J0YA 4MDIA 2W0FA 2P48B 3IJYB 4EIGB 1AZUA 1JERA 5FWRA 1FNAA 4OF0A 3K2UH 4TUOA 2BX5A 2DWYA 3QJHA 4QXTA 5KYYB 2APSA 2J5LB 1BG9A 3UCQA 1LD9B 3RIAK 4H1LA 4UT9L 3TTYA 4ENZA 7TAAA 4E0RB 4OF6A 3G6JF 1WA0X 2PN5A 2CDEB 3GIVB 4HVBA 1OB0A 2Q7AA 2ZKYA 4L8DB 5DQDH 2NNAB 4NIKB 1WWWX 1WAAA 4QRAA 2ENPA 3BKCL 4ODHL 4KBPA 1F5WA 1REIA 1XCTA 1XGRA 1FGNH 5F71A 1FRGL 4Y4HD 4HIEA 2Y6SD 4JFYB 4LNVA 3BAKA 2G3MA 4P46D 4OCXL 1UATA 2BZDA 1OW0A 1UEMA 1CD1B 1I7TB 1PKQA 4R90H 1BG1A 2AVFA 3A5VA 3D85A 2R29A 2YMTA 4WFFD 1MUJA 4JRLA 1KOAA 5I6XC 2DL2A 5KN5A 1J8RA 3AG4B 3H3PH 4HJ1A 3FULA 4L8CB 1HEZA 5LQBH 4I2XA 2OMYA 1LE9A 3C6EA 2FO1A 1J5CA 1HWHB 3PQYB 1WS7A 2CRMA 1SXZA 4XPFL 1UWXH 1VRSA 3NJKA 2Z93A 5AW5B 5D4IA 1KB9J 1T1ZB 2DH2A 2IJ0C 4IRSB 4P49A 1FL3B 4JO3L 3MXWL 1YY8A 1BHGA 2OKMA 3ZY7A 4X2UA 1XH2A 3FSWA 3FT2B 1MAMH 3WKQA 4K8RH 3D33A 5EC2A 4BUGA 1EERB 2Y1ZA 1LDSA 5IEKA 2DQIH 2SEBB 4FMKA 4N2FA 5E4AA 3UAJC 1NBCA 4ZOBA 4X6CF 1ERNA 4WJ5B 4Q58C 4PLJD 5IKCA 3NMEA 3WFCH 4RH4A 3BZEB 4L9LB 4Q9QH 4TTDC 4FCHA 2FWUA 3L3HA 3C09C 3QNFA 2MCG1 5IUCA 4ADIA 1RZ7H 4N2LA 1CR9L 5JYLA 2HKFH 5LBSA 1TKWA 2FBJL 3FSAA 3NIDE 4PJ7F 5KVFL 5FYLH 3UL4A 2X4UA 2HRLA 2WIIB 2Z65C 4X6DE 4JM2C 3V55A 3AS2A 1B3JA 3NA9H 4OGXL 1Q9KB 3LX9A 4YDIL 2HTKD 3II2A 5H4YA 5A3ID 2NX5A 3O4LD 2AZUA 3CK0L 1GZQA 1U3YA 3IMTA 1K6QL 1HXMA 1NUDA 1KCVH 1TLMA 5ABAA 3DMMD 3FO2A 5SWZA 1BFTA 3L9EA 1AIFB 3C5ZA 1MZYA 4HH9A 1FZJB 3N0AA 4DO6A 5CLZA 4ENEC 2IBZX 2J72A 4HPYL 4CVZA 2VYRE 1KUMA 1ZY9A 3ZYOA 4XVUC 1QATA 4TKWA 5GSRB 2PWFA 4WTQA 1AQ8A 4XWOC 4IDJH 5TF1H 3VD4A 3UPRB 2J21A 1AR1C 4FXLA 3ZTJG 1KPRA 1AI1L 1INQB 4ODUA 4Y4HB 2FJFB 4YSEA 3GS7A 4F3FB 4P46B 4R3SA 2XA8H 1BP3B 2XWJA 3MVSA 3T9WA 3N85H 4NXSA 1MVUB 3QNZA 2D9CA 3OKMA 3TFKC 5E2UL 1HIML 4NCC1 5GRYA 3VXMA 5D4QA 1MAJA 3RFRA 3SE4A 4G80B 4HKZB 3F7YB 3CXHJ 1QHOA 1FE8H 2VE6A 2VR8A 5I71B 2C26A 2C3GA 4GQQA 2APXA 4J1UA 1NBQA 1HJCA