3B7YA

Crystal structure of the c2 domain of the e3 ubiquitin-protein ligase nedd4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
151
structure length
144
Chain Sequence
ATCAVEVFGLLEDEENSRIVRVRVIAGIGLASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title C2 Domain of the Human E3 Ubiquitin-Protein Ligase NEDD4.
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase NEDD4
total genus 25
structure length 144
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3b7yA00
4URKA 4ANWA 4HVBA 1DJYA 1K5WA 2LHAA 3NSJA 3PREA 1DJXA 1QATA 3GPEA 5G55A 3F01A 3HHMA 4WWNA 1W15A 2V4LA 3L16A 1GMIA 2A5UA 2ISDA 2WXHA 4FHJA 4QAMB 3TWYA 4FULA 4PS8A 5KJ7E 4JPSA 5JHAA 5H4ZA 2A4ZA 4WWPA 4KITB 2UZPA 3PRZA 3SD5A 3QK0A 4ANXA 3L54A 3QARA 3PS6A 3RDJA 2CHWA 4NPJA 3T8MA 2Q3XA 3L17A 2NSQA 5CCGE 4ICXA 3ML9A 3W57A 2CM5A 3IBEA 4TV3A 1DJGA 2YOAA 3ENEA 2K3HA 3PFQA 1BYNA 2Z0UA 4FHKA 3L9BA 1E8XA 2DMHA 4XZ4A 3APCA 1RH8A 4Y1TA 1E8WA 3APDA 3HIZA 3TJPA 2WXFA 4G11A 4BFRA 2K8MA 1DJZA 4QJ3B 2FJUB 1DQVA 2YRBA 3L4CA 2WXPA 2R83A 4NP9A 1WFJA 4A55A 2CHXA 4F92B 2Q0ZX 3APFA 3QR0A 5G2NA 3CSFA 3QAQA 4F91B 2FK9A 2ENJA 3OHMB 1HE8A 1E90A 2DMGA 3DPDA 3L13A 4LT7A 2RD0A 4L2YA 4QJ4B 3QJZA 1TJMA 1RSYA 2WXRA 3DBSA 4WWOA 2X38A 5CCHE 2WXQA 4FJYA 4LDCA 1YRKA 5H4YA 4F93B 4FJZA 2JQZA 2N1TE 2WXKA 2WXJA 2QZ5A 3NZSA 2WXIA 4ICWA 1UGKA 2CJTA 4FLHA 4OVUA 1RLWA 1CJYA 3M7FB 4MJJA 3JZYA 4QJ5B 4LCVA 4J6IA 4EZKA 5T8IA 4FA6A 3KWTA 2QZQA 4GNKB 4FADA 3HN8A 4HLEA 3W56A 2CHZA 3F04A 3ZIMA 3B7YA 2K4AA 2WXLA 3R7RA 4AJWA 3OAWA 4BGDA 4NS0A 3KWUA 2K45A 4L1BA 4L23A 3LJ3A 3ML8A 3F00A 1DJHA 2WXGA 2D8KA 4F1SA 5JHBA 3F05A 2CHDA 4KZCA 2KI6A 3N5AA 3P2BA 4TS6A 4Y1SA 3NZUA 3FBKA 3IM1A 3MJWA 1UOVA 2ENPA 4ANUA 3FDWA 1BDYA 2CJSA 3L08A 4ANVA 1E8ZA 4TUUA 3TL5A 2EP6A 2WXNA 1W16A 4EZLA 1E7VA 4IQHA 1E8YA 4OVVA 2Y3AA 1TJXA 4DNLA 4WAFA 2ENQA 4PS7A 3PYCA 2ZKMX 1BCIA 4EZJA 3QR1A 3R7QA 1A25A 1UOWA 4XX5A 1DSYA 2WXMA 3ZW3A 4PS3A 4XE0A 3ZVVA 2WXOA 3S2AA 1DJWA 4GB9A 4KZ0A 3RPBA 1E7UA 1V27A 5CCJA 4L1LA 2CM6A 3CSTA 4IHBA 4AOFA 4V11A 2B3RA 4WEEA 4NPKA 2BWQA 4DK5A 1WFMA 2NCEA 2NQ3A 5EDSA 1QASA 1DJIA
chains in the Genus database with same CATH superfamily
4IEFA 3CXHJ 1E67A 5T5FH 4U1NB 1IFRA 4IU2B 3W0WA 1J0YA 1KB5H 4DN3L 3D2UD 2CUMA 4GIOA 3RFZB 1EAQA 1B4LA 4RFOH 2A38A 1YECH 5H37H 2FLBT 5A2BA 1BQUA 2YAEA 3BVNB 4E2OA 4L05A 4X4ZA 4LASL 4DP4X 5C0IB 4N5ED 1OPOA 4X4KA 3ETTA 1IAOA 5CSZB 1GSMA 1FZKA 1QRKA 1XB3A 1JS4A 2W0FB 3EFFB 4TV3A 5AW2B 2VT0A 5KS9A 2IV9A 4MAYA 2EIDA 2UXGA 2AAAA 1BM3L 3U7WH 4Y1TA 2XN9B 2X6UA 3CFCH 3BAXA 1KGWA 1Y0LB 1B0GB 3IXAB 4Y2NA 5BV7L 4Y19D 2CHXA 4GMSL 3ABGA 2NTSP 3RQ3A 3MRHA 4WEUD 5JNYA 4Q9BA 3BT2L 3NJVA 4FQHA 1CT8B 1T0PB 2VZVA 5ENWB 3KPOB 1ED3B 4WUKL 3PY9A 5D5MA 5E24E 4EI5B 3A21A 3TH2T 3FTWA 3MUGB 1SHMA 3REVA 4ORGA 2CPCA 3QO0A 5TD4A 2WINB 2M8XA 4JL1A 3QG6B 3ZTNH 3LD8B 4L3EA 1R3KB 3RDTD 1IBZA 5I1HL 3HRZB 3D85A 3H85A 1K9TA 4JG5A 4Y16C 5EC2B 1NEZB 2Y5TB 2X1OA 3NACH 4I77H 1UT1A 5K33A 3IAGC 4FADA 5HYEA 4AMKL 1IM9D 5CLTA 1R0AL 1TZOA 2PO6B 4B9GA 4XHQA 4J2QA 1VCAA 4NLAA 3QUYC 2O6PA 3GBNH 1MRDL 3SDXF 3V5DB 3C6LC 3UGXA 4N0YH 1MAML 3HI5L 1E5BA 4M8VA 4O02L 2FJGB 4QPEA 5C07E 3DARA 4IDLA 4MHHI 2ITEA 3D6GA 3MRNB 4K94C 1SUHA 1UWFA 2Q20A 3N1PC 3MKGA 1A8JH 2IQAB 1FL6B 1EK3A 1I7TA 1TXKA 1KGCD 1UD2A 2YD0A 1KJVA 1NC4D 4TVPD 1JE6A 3VXRA 3GMOB 3SDXA 5IEHA 5I6XB 3ZDYF 3NABH 3WFZA 5KSAB 4KXZH 5C9JA 3JVGC 4JRYD 4PJFA 5F7LB 1QEXA 1WC7B 1YCSA 1LHZA 3DX0A 4HK0B 1ODAA 5IR1A 2HFFB 1KCLA 1JYVA 1IT9L 1QHOA 3L9YA 4R7XA 2P7TA 3VFRA 3ZR6A 5I76A 1NGQL 5FGBA 4IHBA 4L4VE 3BP7A 2DY2A 2F7QA 3GSQA 4X4XA 5D8JL 4YQXL 5BVPH 1EHLL 2P45B 3LIUA 2IAMB 3PGDB 4IRJC 2AV1B 1OIOA 4R9HA 4WFEE 4Z0XB 4LLDA 1ZPLA 2XZAL 3GZPA 4CVWA 2CIKB 2DZEA 5B1JA 4UDUA 2CR3A 3RBSA 5L9DH 5F93C 3QZWB 4YHLH 1N10A 5C3TA 5LCVA 3TVMA 2XPGB 4ERSH 5AUMB 5CP3A 4G42B 4YUEL 3ASNB 5FWRA 5BMFH 3ULUH 4PTTA 3HMXA 2XYBA 3BQUA 2DI9A 1FV1B 4ODBD 5EZJA 3WKQA 5I1AB 4M1GH 1PDKB 3ESPA 4JFWA 1P7KB 1MVFA 4FNRA 1JRHL 4LFHD 5AYUL 2EIEA 5IY5B 1MQKL 3QDJE 3T4AA 2B59A 5DMJB 1QBMH 3MV7B 2FRGP 3O3EB 25C8L 3F7LA 3UL4A 3DTUB 3I6GA 1NL0L 4S1RH 1FLRL 3QO0B 5ADOH 4G9FE 4ZO8A 1EHXA 3FUFA 3OHMB 2AJSL 3VGEA 4AUYA 1BQHG 3WU1A 1B4JH 1N0XL 4FJYA 4LLYA 4QHLB 5GGQL 4N8VA 1SHXA 1X5AA 3MX0A 4GUPB 1OAZH 4HJGB 3MA7A 3O3BB 5JIKA 1JN6A 1GOFA 4JFPA 2GYSA 4PSRA 1CK0L 1OTUD 1ZDSA 5AAPA 1UUNA 4S1DC 3TFKD 1DL7H 3BUPA 2QDVA 3KL0A 3OXRA 4MNHA 1S8DB 1PLGH 2O5XL 3DROB 3PV6A 1JV5B 2PWEA 1QR1B 2AAVA 5H37A 5DD5L 4GNKB 4N8VG 3QE5A 1B0GA 3IXAA 5IFHH 4JFZH 1GC1H 3ZKSD 1D3CA 1GPOH 3GTNA 4ANKA 2HJLA 2JCCA 4JRXA 4YIQA 1ZKAA 2VUKA 3UTSE 4PJ8B 5LLIC 1OTTD 1E9QA 1E3XA 1F6AB 4LKCB 1TCRB 3JVGA 1GCYA 5FDWA 3TZVD 4JFDE 4JDZA 1NFKA 2SODB 2O6CA 3OMZA 4L4TA 3HI5H 4O02H 2P48B 2K8QA 1QVOB 5CBEA 3W2DL 5B7FA 2OW6A 4OJAA 2VE6A 4ETYA 1BWWA 2X3AA 1Q1JL 2DYPD 3LD8C 3ZTNL 3NSFA 4HWZB 3VRLF 1JHLH 4KHXL 4CVXA 4J8RB 5I1JH 4OJFL 4WV1C 3D4ZA 4D0DB 5L2KB 1QA9A 4MXQC 4M3HA 2LU4A 4OW6A 3NACL 4QYOA 4XNBA 3S2AA 2VKWA 2WKOA 2YEZB 4YNYA 1H8NA 5GS0H 3WFHA 5E1QA 5I24A 3V5DA 2YR3A 3QDHA 3FU7A 1Q94A 1EDHA 2VR4A 4ZSOA 1FNGB 4X5QA 1DJYA 1HWHB 2ARWA 4JB9H 1WA0X 4OF0A 2EADA 3UC2A 3PQYE 3T1FB 1UM6H 2NY7L 5GJTL 4XO8A 4MQ7A 5K9JL 2AKRA 4HFWA 1Z32X 4P46B 1DQQB 3QQ3B 1RUPL 1YEJH 3FKUS 5IQ9B 5F3BB 1E4KA 4TPRL 4G7RB 2OZNA 4WU7B 3BZFA 1INQB 2Y7MA 2MWCA 1UWGH 4OFYD 5E2WL 4Z7VE 1GY1A 2GIXA 3BXNA 3KXFA 4LLMA 1QSEE 4P4KC 3IN0A 3P77A 3QUGA 4U6VL 1RZQA 4IRSD 4YHMH 2CQVA 3P9LA 1NPUA 2IIJA 2Y9RT 2VLRA 4KKLC 5C08E 3TPKA 3LYRA 3OR7A 5C6WH 1INDL 3CN4A 3MJ7A 1KNOB 4LPVA 3TC9A 4XAWH 1F4WL 4AE1A 1VFBA 3QA3B 4N1CA 4OCRL 3WUZA 4C4BA 1RSYA 4XBGA 5C7XL 1HHHA 3VGBA 3VDCA 4KKQA 1H0DA 2XZCL 3IT8D 2HFEA 3UC0L 4LEBA 5I1AA 4JJOA 43C9A 1RFDL 2QQQA 2X87A 3VRJB 3QDMA 1R3JB 4GW5A 1J0ZA 3NFNA 4GRLA 4A2FA 5PCYA 3QUMH 1YJDC 4X80H 4E9VA 1KZQA 1M1SA 4NC1C 3A6BL 5DJ6A 3OKMB 3QQDB 1U4FA 3WEBA 1SN2A 4WI0A 3MFFB 4MXVE 1BZ7B 1A0QL 1NMAH 1MCBA 3QPQC 4JO2H 2V9QA 4AJWA 3G5WA 2CZNA 4JQIA 1FZOA 5KS9E 4P23C 1MI5E 3BKJH 4ZXBC 4EDXB 3OQ3B 3RPKA 2AXJA 4WW2F 2FATH 5TDPB 3BESR 2QKIA 5F7MC 3OX8A 1HYRC 5ADOL 1FG2B 4PCKA 1WUZA 5ES4B 3X3GH 2HTKC 1B0RA 4YHIA 1PJ9A 1Z5LA 2HT2D 3C6LB 1GJIA 3GLEA 1X5ZA 4JM2A 1QA9B 4YK4C 2C1PA 1MNUL 3BSHA 3EUDA 5HGAA 4MB3A 3ZT5A 1FIEA 2WAQA 1D5MA 3Q01A 4ZO9A 2I60L 5T3XH 4IGBB 3PP3K 1X5MA 3CFJB 1UJ3C 5EU4B 3PGFH 5HHMB 1D5ZA 2VQ1B 3OHXB 5D5MF 4RGNB 2J25A 3LPGA 4YSAA 5TE6H 3AXLA 4X0KA 1OV8A 3RWJB 3A4AA 3MLWL 4S1QH 3DV6A 1K85A 4K2UL 3K46A 1W80A 4P2RD 1YYLH 4DP5X 2R29A 2EO9A 5C0JB 1J9TA 2JKTM 3QORB 5I15H 3TEZA 1HH6B 3PUCA 3EDKA 4G9DB 4NZTH 1V8HA 3CZKA 3AG1B 1HZHH 2IBGA 1A21A 4ANWA 1JZFA 5E1HB 5L2JA 3ESVF 1NGYB 4W6WB 3TBYB 4MNQB 3VYPA 1A02N 2DPKA 4F15B 2A9NH 4M5ZL 2B0SH 1JPEA 4K9EH 4IHOB 3F84A 2ICEB 2W0LA 4DGYL 2EDDA 3D3VA 1PKQA 2H6PA 4HIXH 4M00A 3VXMD 1X9RA 1KGUA 4KWUA 5LGJA 1MVYA 5DMKA 1UWEH 3MRBB 2H3NB 4U0RB 5BQ7A 3DPBA 2NXZD 4KXZI 1S5HB 1UWGL 5BS0B 5E2WH 1XIWA 5HDBF 2FL5B 1JGUH 2JI1A 2XNAA 3L4CA 2P80A 1DVTA 1UXWB 2CR0A 2GB2A 1IGMH 5F9OL 4A6YL 3GUTA 4ONGL 5B3SB 1GAFH 3ZU8A 5EZLA 1HJCA 5IVNA 4OIAA 1ANUA 3VFVA 4BH8A 4LNRA 4M4PA 2J73A 4TNWK 4Y4KB 2WXQA 2C34A 3WN5C 2QVFB 4FL4C 3SQRA 4LSVL 12E8L 4P46C 1SMOA 5HDQH 1UD5A 5F1IA 3WI9A 4ISVA 2VDPB 3QIUC 4KY1H 5DI8A 3W39B 3WS6A 43CAB 5AVSB 4F2FA 4RMBA 3ZXAC 1U3ZA 5LQBH 3S8GB 2B1AH 5I8EB 4C4KO 1FN4A 2FBOJ 2HKHL 4ZMWA 4OGAD 1SOSA 1A6UL 3B7YA 1DVSA 1KN4L 4PRPB 2OL3L 1T0MB 2F2HA 4G80B 2IH8A 2VC2B 4U1MB 3U7YL 3D05A 5FB8B 1JNJA 5ID1A 1MIEH 4OZHF 4YDLB 3DYPA 3TYGL 1Q1PA 4AYFB 3U2JA 4FQCH 3E80A 4X7CC 43C9B 4J28A 5MEND 2YMXH 1JZDC 5DMIH 1KJ2B 5D6CB 4NKDA 3I6SA 3DGGA 3N0PB 2A74B 4UZSA 3UZVB 1RZ7H 5CZRA 3WXVH 1QBAA 1E8YA 4IMLB 5EO1B 5E9DE 2DQEL 5CF3A 1E3FA 5LKNA 1WBYB 5AFAA 4IDJL 4U2YA 4DPAX 4AYBA 4NUJB 1MWOA 4A6YB 4I7ZC 4EOWL 1CVRA 4J3BA 2WXOA 4FFTA 4W9KC 3WLBA 3MREB 1YYML 4GLRI 2NPLX 1CLZH 3MLZL 3LS4H 3LIZA 3FTXA 4DWHA 3AC0A 3TBCA 4AW4A 3HZYA 2XWDA 1GVIA 2VZ1A 3V4UL 5ECJE 5BVJA 3DXAB 1PNCA 3VGAC 2ZONA 3D7PA 1HZHL 4LB8A 5CJXC 5KVEH 4JHZA 4JCMA 2V8LA 1G7PB 4L3FA 4W9DC 4AV0A 1PGRB 1U93B 1J9QA 1M7UA 2IJ0C 3V5KA 1S9XA 4QWWC 4C4KT 2XVGA 4WY7L 3LNIA 4TSBH 1G7LB 1DJGA 2YOCA 1I53A 5KS9F 5T3XL 4FD0A 4P23B 3VFTB 1G9ML 4KU1A 1HH9B 4J23A 4RWYH 1Q0YH 4YOKA 3B8YA 4Z3TA 2VM9A 2TSAA 1B2WL 4BRVA 3TO2A 4OI8A 5F3HA 2XWJB 1MCPL 4PJ7F 3VXQB 3CDZA 5K9OA 2FBRA 5KSAA 1E9PA 3NA9H 2OMYA 2VO5A 3OKNA 3GSWA 5TDNB 3RUGA 4AC4A 3OZKA 2CLZA 3KD4A 4DETA 1FGVH 4N87A 3L5JA 3SY6A 5HHVL 2C26A 5HHOB 3L2LA 1JHTB 1XZWA 2YMOA 1NUFA 3A22A 2A9CA 3UTTA 2ICES 3UTPE 2B4CH 5LGYA 1Z7JA 4JFUA 4LLDB 4U1SB 4FLHA 3DO7B 3EOBB 3EJPA 4HKZA 1QABA 4BWTA 3CFQA 3KWVA 3C8HA 4WUKH 3SDAD 4Z7UA 4DH2A 5DUBB 4L8SC 1HIMH 5F7NC 2ESVE 4PJFB 3OL2A 1INEH 5EUOE 5EC1B 3UPCA 3P02A 5CUSH 1MCHA 1KXQA 3CFMA 3HE6A 1KLUB 1OP4A 2AK1L 5EEYA 1TUPA 3JYBA 1BW8A 3P11H 4PGCA 4OZGE 4X99A 1VKXB 1JTOA 1AGFB 2FQGA 1VLXA 1YEIH 5DWUH 4ONGH 1QSEB 3KPRD 2FIKA 1F5WA 3MJWA 4OCXL 2BNUA 3GD1C 3LEXA 2FCBA 1PZSA 1G5GA 5B4MD 2KYIA 3RLSA 1JWSB 4MQXC 4LGRB 4X5WB 3FQ2A 2R1YA 3GM8A 2ZG3A 2X6BA 3WIAA 3BW9A 4P5MB 2ZKMX 1QWNA 4DOHE 2F61A 4EZJA 5K69A 4TQEL 5E1GA 1FZMA 1BP3B 2AABL 3FQNA 3LQAL 1A9EA 2F74A 3CDGB 3O0LA 3S5ZA 4OFKA 4A68A 5CJXA 5LQBL 1DQIA 4G8FA 3MKKA 3GSOA 5I66A 3KG5A 2YZ1A 3QISA 1CXHA 4I48A 4OIBA 1A7RH 4R90H 4DEPC 3QEQE 4L9LB 3X11A 2Y1ZA 1KLFA 1AHWA 3MN8A 4TTDD 4XPTL 1J18A 4MAZA 4YDKL 3G3LA 1R0AH 3O2DH 1NEPA 4QOKD 2BVTA 4QY8B 2OYPA 1U36A 4KMTH 1J1PH 1ZT7A 2XG4B 5GISH 5AW9B 3UP1A 1JXGA 1P5VB 2A9MH 1IKFL 4QUOA 5T1LB 4I3SL 4OTXH 4L3CA 2UY7A 4NX0A 2OYLA 1UOLA 5DZOA 1ZLWH 3OKDB 4L4TB 4GO8A 1HNGA 3IKKA 1LO2L 1E8WA 2GEQA 3HNTH 4M6OL 1UURA 2YBGA 3FSOA 4UDTB 5I71B 4QJ3B 4PGZA 4UTAL 2D7NA 5DVKA 3TT3L 4NXKA 3GMPA 2X6CA 5GIRA 1X44A 2W0KA 3BISA 1NMCC 3NK4A 1F45A 1ZLEA 2ZOLA 4LGPB 3DX7B 3Q2CA 1MWAL 4NWTL 4DN3H 4YWGL 1EDQA 4P59H 3PNWA 5KBMA 4EF3A 2OMWB 4M3KB 4W9HC 3LIZH 2BW5A 4NQSB 3TCTA 4RMTA 1P1ZA 3RFZC 3DX9B 1MLCB 5J06A 5F1OB 3ZYZA 1KENH 2VSKB 3HLAA 3MLVL 4OJEH 1K4DB 5HGDA 2NY1B 2OTWB 3HN3A 4B7IA 3KWWA 4R5XA 1LO3L 1W6LA 2ZSWB 4PJAA 2HJLB 1ERNA 3QJUB 1OAXH 2ARJQ 2WLYA 3VFMB 2D4FA 3BP4B 1DUYA 3US9A 4YE4H 1G43A 1NDTA 3OPUA 5SWSA 3T1WA 1X7QB 2VL5B 1GHFH 1UACH 2C1OB 3H0TB 4P2AA 4ZS6D 4CVZA 5D2NA 1BZOA 2QQNH 2X4SA 3FTYA 4YFEA 4ABQA 1KBVA 1Z5HA 1F18A 2DKUA 3GMLA 4X5WA 3G6JE 2X4RA 1S7WB 1P5UC 4L4TE 2XJKA 3QIBC 4QIRA 3MLWH 3BGFC 4OLVH 4S1QL 4X4YB 3T3ME 3GF8A 4AITA 1BOYA 5DRNA 2L7JA 3FTZA 5GGRY 1R5VB 1TTRA 4OSUH 3S3JA 2PTTA 4LEXL 1DQMH 2QV2A 5TE7L 5JQ6H 3H4HA 1TIUA 3DJ9A 3GZOA 3H3BC 2BPBA 5CEZE 2JJWA 4U1NA 1JFHA 3QZWG 3PAVA 4F1ZA 5CIPB 1CGXA 2N3JA 5AW4B 3ZMNA 4NUPA 2IF7A 2ZUUA 4KDTC 3K1DA 2YD4A 2FEDD 4ZAKC 4ZFQA 1T20A 2QPFA 5D7IB 3VXME 2XPZA 5AAWC 4H8PA 1OALA 2I85A 2DLGA 2WBJD 2E9WA 2Z65C 3AB0C 1ORQB 3ILPB 4HA1A 4X7EC 4FZ8L 1IGYA 1T7YA 4PJ7B 2QJDA 3S2CA 2XWCA 3L54A 1AP2A 3D2UA 3L2MA 3RJOA 3VFGH 3P77B 4KK8D 1IBHA 2G75A 3LS5L 3OD3A 4WV1B 1A9EB 3CDGA 4KQ4L 4NKQB 3WKNA 2LVEA 5C0DA 3RNQB 1U8NB 2CGRH 5LJYH 2O5ZH 3MV8B 9PCYA 2MTAA 4PJEB 3TBTA 4UM9A 4ILDA 1O0VA 2J1YA 3SPCA 3RL1A 3T0BA 3W2DH 1LE9A 3T0XA 4CW1A 3NUKA 1D5MB 2AXGA 2EXSA 3VMOA 1WK0A 2X9YA 3M8OL 2DH2A 3CSFA 1QKZL 3BKCL 1PW3A 4OLYH 4HP5A 5CZVH 5AZEH 4TUKH 4WHTB 1N2RB 1CD1B 2I26N 4LLVB 4J8QA 3S37H 5MEOB 1YPZB 2C3HA 5KW9L 1TPXC 2YPLB 5E8OB 3SCMB 2VMCA 4HGWA 2XETA 4GI9A 3PGCA 4KVNH 2HT3D 2LGNA 3HS0C 1B90A 4JFHE 4FQPA 1NPNA 3GSNL 1NCWH 3D30A 1RK1B 4BA8A 1I1AB 1T3FB 4MMYA 1YEJL 1K72A 5CMAA 2OPCA 5T1DH 7CGTA 5FKPB 3MBXH 4AGNA 3MTRA 4X9BA 2CKBH 4KI1A 3RGVA 4XNUH 1OPGL 3SGKC 5I16B 3KXFE 3VG0L 5DJ0B 3MRBA 2B1HL 2J8UF 3QEHA 4W9IC 3V6OE 2XFXA 2UZXA 4PJEE 2FB4H 2GKIA 3RZCC 3VD7A 3WIHA 4MDIB 1TQBB 4OD3L 5TF1H 1R19A 1ZTXE 3SGEI 1M1XB 1O9VA 1OB1A 2J3SA 3IM1A 5HDWA 3EDJA 4P4KA 4JRYA 4N6RA 3SZKC 4IU3B 1IIKA 1LDPH 2AI0H 4E41A 2UZYA 3AAZB 1WAAA 3MAWA 1DQJB 4LOEA 5FPIA 3P40A 3MXVL 1JZ2A 4CU7A 2ARJB 1I7TB 4JR9L 4PWJA 3C5XA 1F8TL 1A3QA 2AXWA 1XF2B 4EDWL 4FJ6A 2IDUA 3ZTEA 3ZHLA 3X3GL 1R3HA 4F8NA 3DK0A 3GDCA 4ZW6A 3FHEA 4JFVA 2KHAA 4AMWA 5CGBA 3TXAA 4ZPTB 7FABL 5JO5A 2VDNB 3UAEA 1XDTT 1NAML 2PTVA 1C7TA 5B39B 3FO9A 5IW1A 4POUB 2V7HB 1QG3A 3KPNA 1NZRA 3ULVD 3DETC 3ZY7A 2XTJE 3FFCB 4B9YA 2GJ6B 1HCVA 3K6FA 4LLQB 4NQED 1PSKH 1ES0B 1JZHA 2ICCA 4PLKC 4ETQB 3QQ9C 4M8UA 1F11B 2VXSL 5HYSA 1E42A 2PTTB 2ZIDA 3D9AL 4L3ED 3X3FH 3OKEB 4KHTL 2QVMA 2HZHA 2TAAA 1N19A 4U6YB 5DJXB 4KO7A 1TEYA 4PLOB 4UM9B 2CO6A 2PXYC 1T21B 1TDQA 1T5KA 2BCMA 2HT3C 1S9WB 5DA4A 1IKNC 3EO1B 4JFQA 3WTVA 1CFTB 3GI9L 4FF9A 1FV1A 5EZJB 4Y4FD 5CINL 5CGTA 3GMMB 3V95A 2YPVA 4ZD3L 5HYSG 1RK0B 4FQIL 1JP5A 1Y6NR 4P57A 4HS8H 2HFTA 3Q8AA 3AWFA 3TCLA 2IH1B 1AHWC 4HXBH 4FFYH 4HKBA 4X7TB 4M8QA 3FT4A 4HETA 4G80A 2E59A 4I18B 4TMPA 2ENJA 1I1CA 1ORQA 3ILPA 3LKSB 3O45B 4BK4A 2CSPA 4OCMC 3CZFB 1LK3H 3PDDA 4U3SB 3PJSA 3Q48A 4XMPL 5AZ2L 5FW7A 5C09E 3VU2A 5JR1L 4P9MH 1TLKA 5H4YA 1P4UA 2WZPD 3UAJC 1A5FL 4MZRA 1QR1A 3OLEA 4U6XB 2AFNA 4UUJB 1WUNT 2CJTA 4JN2B 2MPAH 4YPGA 4H0LC 3FU8A 2G3XA 3PJLA 2WLMA 4GXFA 5GGTL 3ZTDC 5KVFE 3W37A 4HT1H 5HI5D 4HOWA 1U8KA 1IZKA 4J4PD 2B7DT 4N0YL 4PJCF 4XZUB 2DMKA 2YWYA 1MEXH 2YSTA 4PBVC 2CMRL 3DX8A 2HLFD 1NCDL 2OJ1A 3FQUB 4NWUL 1XX9C 4PHXA 3VI3A 2WNXA 4PS4L 5GGUB 3VFTA 4Z78A 4RZKA 4G43A 4FQ1H 2HKHH 2YGNA 5C0ND 2FNBA 5EOQL 3RWDB 4K3DH 4Q52A 4YVNA 1GTNA 4P48A 3D34A 3VE0A 5TE4H 3TNNA 4YSDA 4TUUA 2NY1C 3GI8H 2K3TA 5FDWB 2K9UA 3G5ZB 3TA3B 3RHWF 1J5DA 4DGUA 4DP6X 4Y1AD 1UZ8A 5IJKC 5A3IC 3K2UH 5ISZB 2L3BA 4X42A 5K59E 1OKEA 1KPVB 2PF6A 3L1FA 3V6BR 1PZ3A 2BS8A 2X2JA 2YMXL 3GSNH 4WDIA 3FN0L 3TVMC 4XBPB 1T89A 5C0NC 1X5HA 1KYFA 5CCJA 2V33A 2ZWLT 4PEEA 1EXUB 4WHDA 3BN3B 5HY9B 4NM8H 4NN5C 2EDOA 1PIGA 3S4SG 4NFBA 1HQ4B 1DJXA 1OPGH 5A2AA 1MCQA 3CFKB 4XTRD 3F01A 4K7FB 4X5LA 3A4DA 3EYUL 2CBQA 3BWUC 1V7MH 2PP7A 2YQ3A 5TQ0L 2NX5D 1EFXA 4Q4EA 3WFBH 2R4RL 4HH9B 3UGEA 3WEXB 1F90H 2PR4H 1P6WA 3KDPB 3TBWB 3WGVB 1CE6A 4OIIL 1A3LL 4K94L 2WVSA 3AG4B 3QQ3A 2HVJB 1QLFA 2YOAA 3O2VH 3GS4A 4G7YH 2VLRB 1FFNA 2XKNB 4N20A 4PJHA 4L18A 1DFBL 1XSIA 4NZRL 2EO1A 2FYVA 4KPHL 3I50H 1A7QH 2CXKA 3MRKB 3FYIB 3ZSSA 4HS6A 3RY4A 4AM0A 4C54A 4FG0A 4ZUSA 4DESA 2WGXA 1N6QH 3OMIB 3VXOA 3QDMB 1ZLSH 1CLCA 3MUZ1 2DIAA 2X38A 2GSIB 4NIKB 1EUUA 2QEJA 4W1TA 4NNXB 1CDCA 3MI6A 3AXHA 5FUZH 1MWAB 1QW8A 3V5HA 1JXFA 1MFAH 3K6NA 1FQ9C 3ELAT 2I9LB 3B7TA 5DD5H 1F00I 1FNAA 3COOA 4OF8A 3UTZB 4UNTA 5EBWB 1KV3A 4U1KA 3B6SA 4R0LC 1NCUA 4R4BB 2FX7H 1YNTA 2IO5A 4JFFB 5BXFB 4GRLB 1XIWD 2K4AA 1HWGB 3CXFA 2J20A 2NT0A 4JN1H 4CU8A 3DVGA 1RAMA 3BWAB 3MLTB 2K45A 1DCLA 1WCBA 4WUUE 1G6RA 4Z3GA 2X4QA 4E41E 4ZW5A 1O5DT 4Z76B 4FEMA 4PJBE 3U1SL 3MRDB 3SBRA 4K5MA 4L8SB 2R2HA 1FF5A 1V3KA 3CE1A 3SKUD 3CFUA 4ANVA 4JN2A 2ZKWA 2YWZA 5FFGA 3KNBB 4XMTA 4RLDA 4ZFGL 3WEOA 2DL9A 1L7IL 4YZWA 2JMRA 1RZKC 5E70A 1NLBH 1FL6A 4UT6L 1KXQE 3QO1A 4LF3A 2JNZA 3GEWB 1FRGL 1SM3L 3HJ0A 2BO0A 3O6KL 3FQWB 2EDXA 1N8OE 1IM3D 2BSRB 2BVEA 2V5MA 3IKCB 3PXJA 4JO8A 5C0AE 1KJ3H 4QRFA 4WKZA 4WJKB 1SQMA 3RWJA 1K5NB 3QUKA 3VXNB 1R3KA 1MIEL 3MZTA 3PL6B 3NQIA 4GRWE 4HVBA 2V17L 1ZVYA 4UILL 1FBIH 2P8MB 3ARYA 3MCG1 4HUNB 5D1QE 4FA7B 5AYTA 4WI8A 1N3NB 4A7UA 1G9MC 3A23A 5BZZA 3NIGF 4NPJA 5FAAA 2GI7A 3QDMD 3RUGE 1H6UA 3WNJA 4L8BB 2WWKO 3L4XA 2MIZA 3K4ZA 3LHPH 5JHDB 1YNTF 1N5AA 4IDJH 2F0CA 4Q97A 1DEEB 4U3CA 4EN3A 3OTTA 5D1ZD 2H2SD 3WY4A 3MMEB 3O2DL 4AUUA 5C8JB 4JDTL 3D4YA 2NXYD 1EH9A 1L9MA 1AGCA 1F4WH 2FX9L 1B0IA 2A6JB 4QHMA 4M56A 1KACB 2HMIC 4TL4A 5F9DC 4M93C 1N67A 1F41A 5HVWA 3RJQB 4J6RL 4KKCD 4X9GA 4NEHB 4K8RH 4KI5E 3HG1A 3SO3B 3HNTL 4M6OH 5B3NA 1SOQA 1ZLSL 4NHCL 1RPQA 5D4QA 3ISRA 4AYEC 2OR9L 3N85H 4XB8A 4GKSA 1A1NA 1RLWA 2RAMA 3AWEA 3KPSE 4XC1H 4NQCA 2BJML 4GG8A 4BQCA 4ADJA 4ZX5A 3LHAA 3ZQWA 3DMMD 4PRAA 2I07B 4MJ5B 2FB4L 4TLKA 5T33L 2C8NA 1I7ZB 2AZAA 3RL2A 4POZC 1U92A 4R3SA 3DI3B 5E0QA 1QSFB 1AFVL 3BMVA 2H9GB 3CUPB 3EAKA 4JKNA 1YEGH 1ASOA 4ODTL 4NKDB 2PW2A 1N12A 1KSRA 1E5YA 2IDQA 4FERA 1RIUL 3ZKMD 4TL5A 2OTUB 2BK8A 3B2VH 4DVBB 4PJDB 3KS0J 5C7ZA 4ZW7A 2JJTC 3GWJA 4JE4B 3DHUA 4I9XA 1E65A 1JMXA 2IV8A 4PU2A 5E6RB 5ID1B 2ENSA 4DCQA 3AUWB 1W0VB 2EEBA 2FJHB 5DQJB 1Z9MA 5TE6L 2E47A 3QC6X 2WCSA 1LILA 3VFPA 5EORH 1A22B 1UUSA 5FUOL 3EJRA 3K71B 2IQ9L 3N0AA 4R4ND 2X28A 5IHBA 4WHTA 5JLZB 1BD2B 5DLML 4ZFGH 2W81C 3L3OA 1HOCA 2E46A 1USZA 2VGLM 5L4FA 4Q9QL 2EEXA 3P9MB 3V2AR 1DL7L 1FJ1B 1UXSB 4L48A 4UDUB 1CD0A 5J6GB 3EJYD 3HE6D 4NPKA 5D1ZB 1LE9B 3FB6B 2VOTA 3LQAC 4PJFE 2AK1H 4URKA 1T1WA 3LB6D 4OJDH 4C8XA 2O72A 2GJPA 4CBPA 2R0KH 2I25N 3D2UB 1RIHH 1KB5B 4OB5L 4XOEA 5KUKA 4FXGA 4XCNA 4TQPA 4ONOA 2GQHA 4OD1L 2VLJB 3RDTB 2W9LA 4DUVA 4AJ0A 2MOVA 2ROYA 4HHGA 2JCCB 2QQKL 4YIQB 3VU1A 3O9WC 4BKTC 1TETL 4I4WB 3WOVA 3ZHKA 4RRPG 4AJVA 5L8JB 1ECYA 1AZRA 4X9FA 3NGBC 2A6KB 1OM9A 3GHPA 4HJJH 2WLHA 4F15C 4OZ4B 4E42A 2JELH 1NLBL 3KM1A 4XXDA 4X6DE 4N25A 1A4AA 1MIMH 4AEIH 3KLHC 4MMYB 2UZIL 3SJVA 1Q9OB 4H8QA 2PWDA 1XR9B 3ARGC 3QORC 4N8VB 2B1OA 1PPIA 3SPVB 1IRAY 3T2NL 1ZSDB 1TJGH 1XF5B 3DSNA 4P3CL 1XGRB 3TO4D 4LT7A 1TYJA 2QVKA 1PLCA 2CIIA 4H88L 3HHRB 3OAUH 4AEEA 1H9DA 5I73B 2V17H 1JPFB 3OHXC 2O61A 3QWRD 2JXMA 3CHXA 4LCYB 3WSQL 2WXIA 3FO1A 2LQRA 2IFFL 2Y06L 2W9DL 5HJBA 4XN8A 4QRUA 1CD8A 3FB8A 2F53D 3S8FB 1G7JA 3L3JA 4LNVA 2W80C 1AS6A 1HYSC 2BOCA 5F3FA 1U4EA 2BSEA 3PWJB 3I9AA 3OKEA 1UEMA 1WWAX 4A7SA 3GLZA 4EXPX 3VH8G 1G7MA 3LJ3A 5FV2A 2ZOOA 1OD7A 5DJ2A 4PJGF 2C3XA 5L4IA 1NMCB 2ZYSA 1WGOA 1FZJA 5AWNH 4F7PB 1EO8H 5JYLA 4HX1B 4JHAH 2FGZA 2Q8BH 1D7FA 1ROCA 3QEUB 1ACCA 4JRWA 4PY7A 3NYKA 4KO5A 3MLVH 2OSXA 3QHZH 2MHAA 1KFAH 3EBHA 5DHDA 3CFBB 1XCQA 4TOYL 3STLA 3HCVB 1CXKA 5I1KL 4HIIB 4QXUL 4PP1D 1YYMH 2AV7A 3PWLB 3S37L 5KZCB 2VDQH 1NFIA 4G6ML 1CD9B 4HH8A 4XE0A 4MA3B 1PEWA 4PRID 5LAXB 5LXGH 4DT2A 3FPXA 4IBVA 1GGCL 1YMMB 3B7SA 5TDOB 1M42A 4FQLH 4Z7OB 1B2YA 3LXAA 4QOKA 1NIAA 1T22B 2QQLL 2O4EA 5EPMB 4M6NH 3GPEA 4JRLA 2IH1A 5G55A 4M7LL 2I5YL 4OFYA 4AIEA 4LL9A 5EU3B 1KJMA 3T4YB 3WFDH 3ARSA 1JBJA 3G08A 5F7HA 5DC9B 3RIKA 3L45A 4ES8A 4PD4J 1IQDA 1SN5A 3RGHA 4JUTA 3RX5A 1FFPA 1RVFH 4MS6A 3TO4B 3KJ6H 2JQMA 3Q1SL 3KYMA 5AVWB 4F9PA 2Q3XA 5DSCB 2VLLB 2OK0L 3UCQA 2NQCA 5C2BL 3CFNA 1M7IA 2DWYA 4RBPH 2ESVD 3I2CL 3IDJA 1XFPA 1F0LA 5EORL 2XWBB 5HDBE 4K5LA 3VI3F 5HHXH 2EKSB 3NTCH 5GGSA 5F7KC 2OXHA 4X6CE 4NQDA 3EOTH 2WLNA 1V10A 3LKSA 3O45A 4C4UA 3DX7A 2OP4L 1N8ZB 5IKCA 1U3HA 5AZUA 2HT4C 4NM4H 3UTSB 4DQOH 4JPQA 1FH2A 3EZJB 3ROLA 4QRQA 1DBMH 5HGBB 3HLAB 1JCVA 1S7QB 3O81A 1NEZG 5E99L 1OCWL 1IQWH 1PQZA 2HWZH 4XWOD 5GGUA 1HSAB 4FJZA 3CD4A 5AYQA 4CMHC 4EUPB 2IPKA 3U9WA 3WJLC 1M05B 4JO4H 3UBXI 4DAGL 3FU9A 4WZ9A 2ZOLB 3Q2VA 4EBQL 4PCSA 5D5MB 5D1QB 5DK2A 3HUJA 4H26A 5SWSD 4Q6IC 2BHZA 1HCZA 4LCVA 5F89B 2P1YA 5ICZA 1GOGA 5I6KA 3BPNC 2Z93A 2W9DH 2G0KA 4NKOB 2IWEA 2HT4D 5CM1A 1AE6H 2XQBH 1XR9A 1YLBB 4R5VA 3LSOB 3CAFA 2DJ4A 1PTZA 4IS6A 1MIML 2G3NA 5H2BA 3TF4A 3T0WA 2OBGA 1R3IL 2R9HD 1AD9A 3ZTJH 5GQBA 1CGUA 1AXTH 3LZOA 2ID5A 4TS6A 3KPTA 5IMMA 2VR5A 2JXMB 5HDBB 4WY7H 2Y07L 4G6KL 5FK9A 3D25B 1RQ5A 4Z7OE 4DGVL 4AVHA 3ZBMA 4OLXL 1EMTL 4RRPM 1EAPA 5AVTB 1CR9L 3B1UA 2I7SA 3ASWA 3SCMD 1NMBL 3VXOB 2MCG1 1VCBC 5T1JA 3ISWA 2HJFA 3IDGB 2J4WL 1AS7A 4FTDA 3MNVB 3CIQA 3UYRH 1NC2D 3PWNB 1F13A 5BJTA 2P8LA 3C60B 1MHPL 2IADB 3CVIL 4N28A 3RGVD 3RVVD 2I7OA 3V0AC 2OMXA 2BXYA 2P5PA 3Q8BA 3CK0H 2BY3A 4N85A 3BI9X 5D7JD 5I76B 3ILEA 3RI5K 4IKLA 1FNFA 4ZYKB 1G87A 1OCOB 2OL3H 2BRRH 4KXBA 4E9LA 4OZIE 5E94A 4LARL 1W0WA 3MGTB 2QADD 1NBVL 5F2FA 3VFUB 1H3GA 2RGSA 3BH8A 4JMNA 4MJIE 2BSSB 2HTKD 1CICC 1S5HA 2OMTA 4J3OD 1SHWA 2YKKA 3TFKC 1QFOA 2FGWH 4HKJA 4JR9H 3R8QA 1F8TH 1U95A 4PTUA 4ZFZB 3MRKA 3C5SA 4P46D 1FPTL 4UAOC 1FC1A 5CAYB 1A6AB 3U6RB 1WBXB 1WBZA 1S9KC 2ZCLL 1A3ZA 3MV01 1HVXA 4DGWC 4HCFA 4HUWA 2OJEB 5GGVH 3FCSB 5AOJA 1GGCH 1INDH 3DVGB 3FO0H 3C2AH 3DPDA 4K7PL 3PF2A 3U6XS 5JYMA 5ICUA 4CADB 4GQ9H 3V0DA 4Z7QF 3ALXA 4Z76A 2AXGB 5HYQB 1NFDE 3K2KA 2CCVA 3HPJA 2VDLL 3EIFA 1ASQA 3IETA 1I3GH 4TQEH 1MVUA 2VLLA 2J1WA 4MNGB 5IT2L 3ZKXC 3MLUH 1VGEL 1VEOA 5BXFA 4NZFA 1E0OB 4MD0B 2A83A 1CFSA 4NP4L 5KVDH 2Y7QA 3SDCD 4F57L 3AREC 4NXSA 4JZNB 2NY2D 4WFFE 1BG1A 3LY6A 3MNWB 4U6HB 5MEQA 1X5YA 3CVDA 4BQ8A 2BZDA 4JLRA 4HUUB 1KC5L 1FORL 3GS7A 3GUFA 3P54A 1XD1A 4LZKA 4PJEF 4XP6L 2YGOA 3ULVH 4IRJD 2BOBB 4QRPA 1KXTA 3VFOA 3D1MC 3HNVL 4C56A 4Z77A 1PX8A 3BIKA 4E9QA 3RWHA 3JWNE 2V3EA 2YBRA 3L2NA 3O9WD 3TONA 3H2QA 4MBOA 1FSKC 5EUKB 3WIHH 1SXAA 3NEEA 1IAKB 3EBGA 5D9SA 4Y4HB 1ADQL 2B9BA 2YKLL 4PJ8C 4WFED 3QYCA 4MTMA 5LGKA 1I8MA 3QR1A 3EH3B 4WFHE 1C1EH 3NCEB 4YHNA 3TIEB 1JK8B 4B41A 1N0XH 4CMMA 3ZVVA 5EO0B 3NJGA 2W59A 1QPKA 5DC0A 4TVPL 4IBLT 2QFPA 3L7FA 2OKMA 3QFJA 2PWHA 2BZCA 5SX4I 2VDOH 5INCB 3QPQD 2WVVA 1DYZA 3E6HA 3HHSA 2LTQB 1ZVNA 2YC1B 3U7AA 4HULB 1RZIA 3ILQD 4PW9A 1XGUA 3FFCA 1G0YR 3L3GB 7PCYA 5CWSA 5C09B 4Y16D 5K1VA 2VABB 4OT1H 3X2QB 4RFOL 4U4IA 3O8XD 3WO3B 2X6MA 1ZTXH 4N0CD 2DMHA 4UILH 1DO6A 4R6UA 1F1GA 1HOEA 4KBPA 3FQTB 4PWHA 4FABH 1RURH 1T1YA 2BLFA 3K5SA 32C2A 3PJSB 2ZP8A 3IMRA 2WXPA 2EQDA 3S36L 3G6DH 1E30A 3AQXA 2X70A 2KZWA 1MJUL 4Y4FA 3SHSA 8FABA 1RIVH 5HYJA 4ES9A 4ZO6A 5TF0A 3RFZA 4GFXA 4OCLC 3O6KH 4PG2C 4GUCA 4URTB 2JJVA 1DVQA 2YO3A 4X80L 4YFLI 5KYUA 4S1DD 1NKRA 1A4KA 1A6WL 5TE7H 4AI7A 5JQ6L 3SJVD 3Q6GH 3DMMA 3IBOA 4BQ6A 5CCKH 3P3YA 1DBAL 4D9RD 1SJXA 4XE5B 4K7PY 1AGEB 1YNLL 4UOJA 1KLUA 5I6OA 3CNKA 3D39B 3ZK0A 2X4UA 4H1LG 2WWNA 4HQQL 2IBZX 1ND0A 4J4PC 4X8CA 4YDZA 2Z8WC 2HH0L 2H3XC 1HKLL 4PRPD 4HG4J 1F4YL 1FNHA 4JQIH 4FXTA 2BERA 4Q9RH 4JW3A 5DEZA 3JVFC 5KVGH 2GFBB 1W72L 3WDHA 3U7YH 4G6FB 1EJOH 4LP4A 1BVKA 2HPTA 1KIQB 2R2BB 5DA0B 4XB7A 4WI0B 1XH1A 1GYUA 4H8WC 3HPLA 5I0DA 1HL5A 2D8KA 2WYIA 4L1TA 1ZK9A 3KYNA 4HD5A 4NCDA 3EFFA 3P2BA 2C9XA 5GJSL 2ENPA 4L0YA 2HVKA 4AQAB 2FH8A 1U8QA 1J1OL 4JY5H 1ZHNB 1ZGLP 2DIEA 1ZHKB 2P5ED 35C8L 3ARGD 4W9CC 4H2AA 1X9UA 3BAYA 3RY6A 3X17A 2XWEA 2N7SA 5FKAB 4DN4L 2BSDA 1R5VA 2IAMC 5HHME 4KZ0A 1J05A 4ATTA 1C1EL 3AREB 3C75A 2BDNL 2D9CA 1KCKA 1RFDH 2MEJB 1WFOA 5DD1H 1CXFA 1G1YA 3F7VB 3HAEH 2D7QA 4U2ZA 5A43C 3V4LA 3S88H 3QP3A 4PJ6A 3TBWA 4BZ2L 1KCUL 1K6QH 2MNWA 1NFDA 2F5AH 4P5RA 5I1CH 5IF0A 5TGBB 4XI5C 2XBTA 1DSWA 4G7SB 3B2UC 3FQ4A 3FH5A 4RNRA 4BK5A 4PV9A 4IBWA 4AK1A 4UTAA 4K7FA 3UBXA 4QRPE 3F6LA 1T1XA 4AKOA 1EAJA 3L4WA 2YMTA 4Y5XB 1VFAA 1T1YB 4OM0H 1CO1A 1PL3A 1RJLB 2ZX8A 1XQ4A 3WTWA 1LP9E 4LLUB 1NFDF 3DSFH 3WCYA 2ROXA 4PN6A 4F9LA 2Q9OA 2JCCE 3LZLA 3MXWL 3MBWA 3PHOA 2RFXB 2Z0BA 4Y5XC 1IO4C 4J39A 1BMWA 3BFOA 3WBDA 5FYJL 2QELA 3TV3L 3QIWB 5DWPA 1EZVX 3APFA 3ARRA 3BSZL 3TJEH 1WLHA 1QLEH 1I3VA 3SDXB 5IEHB 2DQFB 3O6FB 4MWFB 2WUCL 2JCCF 2EDYA 4XI5D 4OLZH 1ZEAL 1OZUA 3ZYOA 3VFWB 3WUWG 2WBWB 2AQPA 2EIKB 3VXSD 5IGXH 1U8MB 2WQWA 1ZLVH 5CHNA 4KVPA 1KJ2A 5DURB 2EDRA 4BSWB 1GGIL 5BO1H 5IOPB 1RUMH 3ZRFC 4R97C 2ADIB 3T2LA 2YPLA 2DLFH 4QLRA 4I0PA 3STLB 2VLRE 1BVKB 2C5DC 3B7UX 1AQMA 32C2B 5LUMA 3NCCB 1H3VA 3FRUA 1J0HA 5DD6B 3P4MB 3OC5A 4HIHB 5C0BB 8FABB 4U1KB 4BELD 4KQ4H 4X7FC 3BP6B 3AM8C 5MENE 1UZ6E 3TN0C 3GZQA 1KIUB 3NA4A 5IFAH 1VZGA 2XC8A 3IDJB 3ZTJG 3NPZB 2HN7B 1TKWB 3CH1A 4XVSH 2R15A 2AEWA 5DRNB 3SE8H 1CBVH 1YEDA 1JDAA 4LBAA 1DN0A 1JN6B 4HCGA 3OPZL 3WTUA 2RJMA 3KYKL 2WTRB 2X4QB 3OWRA 3QEHB 1ETA1 2J4WH 2YAHA 2G5UA 2NY0B 1E7VA 3JV4A 2XQ0A 3A6OA 3ARDA 1AGEA 4PRIA 4NBZB 4NO0B 5JNYB 5K5YA 2VN6A 1CFVH 1I9IL 1XGPB 1O5PA 1A25A 2XZQL 1QLEB 3V9EA 1SQ2N 3K1KC 1Z0NA 2F5BH 4GB9A 3MOBH 2O26U 3DC0A 4GKOA 4M1DL 5ITBH 3CCHA 3KPQB 2WJ7A 1VESA 4YSUA 2RR3A 3E8UH 3HUJE 1I8UA 4HGWB 4P2QE 1J12A 2XZZA 4WNJA 1R3HB 3MR9A 3SE3A 3TIDA 3MUUA 3Q5TA 2X0UA 5ABZA 1SN0A 1NC4B 1UKQA 1JWMA 1QVOA 3BHBA 1IGFL 4ODXA 3PP4H 4OGQC 5AL0A 4NJ9L 4V1DD 2AJUL 5FF6B 4E0RB 3S7GA 4XX1G 3HG0A 1OP3K 4OUOA 1W6WA 2WBJC 4MMZA 4OF3A 4AQ8C 5D7JA 1F6AA 4LKCA 3IBEA 5BZDB 4X6BA 3B9EA 4LVOC 3W5MA 3L48A 5J8OA 4BH7B 2ZKYA 1N7MH 4LPXA 3ERXA 1C12A 4MMXA 4NJAL 3QXDA 4UQDA 3PIQB 5BOJA 4JO5A 1G7LA 4LPTA 4LSRL 2EABA 5I8KH 3ILQC 2Q3AA 4CBZA 4X8JA 2ZX7A 1BBDH 2MSPA 1UZGA 4HZLA 3IRCA 2VITA 3KGTA 3MA9H 3ZDZF 3ZYIA 4GRWB 2R0KL 3LNDA 1KPUB 5E6IB 5LG1A 4BE5A 3STBA 4LDOB 2H4EA 4MA7H 4YWGH 3WNPA 1IAIL 4PJ5D 1EV2E 1RL1A 3K2UL 4HF5H 4E5XB 5ICZB 2DJSA 1O6TA 3BZFB 4TM9A 1LEKA 5JA9A 2CO2A 2XI9A 3D18B 2WB7A 3MLZH 4XCEA 2J5LC 2O6DA 4DKTA 4ODVL 4LLUA 3BZ4A 1JSYA 4LCCB 1IAMA 5D1XD 2E7HA 3ECVA 1A1OB 2VAJA 5I16A 4G42A 4MQ7B 1NANH 3P9LB 3SOBH 4F5CA 5IIEB 4KQ3L 2HJFB 3BJ91 3RUGF 4LLQA 3H7LA 3FQNB 1GZQB 2BSSA 1I85A 3EYUH 1JD7A 5SWQA 2JJSC 1FVEA 5F3BA 1T0NB 3WIHL 4P5KB 4HKJB 3L6FA 4MS8C 3MCLL 4LOVA 3D25A 2UXTA 1W0VA 3GXUB 2EH7L 2HLAB 2VDRH 1VADA 3M6DA 4ZQKB 4BHUA 2WLJA 3GEFA 2F8OA 1SLWA 3EO1A 4WFHD 5I1IH 2OP4H 4XMXA 4ZW3A 4N1HB 2AABH 1MRFH 4RFEA 1XF2A 4EJ1C 2XKSA 3U0WL 3WNOA 1YEEL 2I9TA 1SM3H 3RVTD 3S3BB 2IFFH 4F3FB 2XT1B 3W0WE 2CAKA 3TCLB 2ENQA 2GI0A 4YL9A 2VWEC 2CRMA 2YUZA 5A6LA 4N9GB 3TNNB 2FO4B 3SKMB 1D7DA 4C56D 4EN3D 5EIIA 1HHIA 2OMXB 1BSIA 1ZT4A 1T5XA 4OF7A 4BFNA 2VDPL 5F0PB 3V10A 1SDDA 4DOHB 1NDGA 3BCDA 4G6KH 3RILA 2V7HA 2E7DA 4L1LA 3TZVB 1YEWA 4FXKA 5E8EA 1XL6A 2P46B 2VLKB 3N1GC 1QX1A 4JO1H 1NTDA 3BH4A 3VD2A 3FT3B 4PJGE 5LG6A 3ZMRA 4YO0B 3DTXA 3HRPA 3GIVB 3LDBB 5C0IA 1U58A 4XGZA 1JI2A 3VMPA 5E0FA 3QQDA 1AE6L 2XQBL 3L5XL 4UF7C 2VUOA 3LHPL 4LPWA 1XB8A 2C9VA 2Y23A 3KEHA 2O93L 1BGXH 1JV2A 2VQ1A 3HMXH 3O3UN 4B6ZA 1CI5A 1TJHH 4OV5A 4ICXA 4FXGB 3FUDA 4NQCD 4UQ2B 1Q9OA 1ULVA 3BC9A 1RERA 1CFVL 4WW1B 4X6DA 4PLJD 4Y8AA 3QUYD 1U6AH 2EDWA 1DBBH 4QRRD 2FJFA 4XNYH 2FVNA 5E4IA 4BFRA 1CQYA 5F88A 4XVJH 4F2MA 3BN9D 1SMDA 2YEVB 3OMAB 1JNNL 4GRLC 2EH8H 3T77A 4M1CD 4XAWL 4BZ1A 3FZUD 3QWRA 1JWMB 4HBCL 2BC4B 3BVTA 3N40F 2AJYL 3CHPA 4CSPA 5EF3A 1FE8H 4ZXBB 1LO3H 1KG0A 1EVTC 3PHAA 4I1NB 1MFVA 1S7WA 1P7QB 1FG9C 1IAIM 2NR6A 1UGKA 5TK4A 4G83A 5DVMA 5BQ7B 1JZ8A 1NH6A 3A6BH 1B3JA 3QRGL 5E03A 1UYWL 1YPZE 2F7RA 4O9HH 3BDYL 1X5JA 4Z7UF 5LNEA 3Q06A 4LSUH 4F9LC 5I2IB 1G94A 5IB3B 5LBSL 3QEGH 3F04A 3IS0X 4KO9A 3LX9A 5T5NF 4XHJC 3BE1H 4G7VL 3UXFA 1FL3B 3LKNA 1IC4H 1ESOA 1FVCB 1OK0A 3UJIH 1NCTA 4F20A 1E4KC 2W65B 2MCPH 4X9HA 1DBML 4FTVD 2BNQB 4APQD 4X98B 4AQEB 3G6AA 1NIFA 4RMVA 2EYSB 2CIKA 4W70A 3QS2A 2IPUG 4TTGA 1TMCB 5GRUH 3D69B 3VTTA 2R9HC 1DVUA 5DQ9A 4XP4H 3NJXA 4HAFA 2DWDA 5GS2H 1YEHH 3C09C 4K71B 1FORH 4Y88A 4PJGA 4Y2LA 4FYRA 1PG7H 1SBSL 2BY2A 4LSDA 4P2QA 2IAMA 3GXIA 2FSEB 3S88L 2OFQA 4Z3IA 4QXTA 2AEQH 1DHKA 1B6DA 4QXVA 2I69A 1JGLH 4HEMA 4AOFA 3SOBL 1NCBL 3LPFA 5L8LB 5D4HA 2B59B 4LFHG 4WRLA 4OB5H 1OE3A 3E7JA 2J12B 4XP1H 2X4OA 4K3JL 3IDNB 3KBEA 3J27A 4MA3A 3V0WL 4XNZB 5C0RL 1CICD 3FFCD 4AYMC 4PW4A 3ZE0F 2ZCHL 1I75A 4JGUA 2VZ3A 4JRXB 3D0VA 1XD0A 4KKNA 1TYEB 2OMBA 4O58L 5JXAH 3ZR5A 3FCBA 1FHGA 1TTCA 3R4DA 3C8KA 5EUOF 2F8IA 3QIBD 5E8OA 3T4YA 5GS0D 4OZGA 3EKCA 4MSWB 1U91A 4NQEB 1E8XA 3WLBB 1E5ZA 1WRFA 2ZXGA 4X6FA 4YSTA 2WIMA 2Z91A 3IMTA 4C59B 1KEMH 1TCMA 3H3KA 5E51A 5T1KB 4DVRH 4N5UA 2ESVA 5EUOA 3WD5H 1NCCL 1TSRA 4ADGA 4R83A 3UZVA 4KKAC 3ZE0B 1BJ1H 3L9EA 3SKOA 3OAZK 1EA9C 2AGJL 4NC0B 3QYNA 4GXVH 1HILB 2C3WA 4J5VA 3CVHA 4P2OC 4QHUA 1SY6H 4LCWB 5IKCB 3C5ZA 2IFGA 5GS2D 1MCNA 1R75A 3MACH 2G2PA 3IB4A 1SHSA 2XY1A 3TA3D 4N2DA 3F65A 1TVBB 3QYMA 4OV5B 2AF2A 2DEWX 1JV5A 2BVQB 1AKPA 4FNTA 4RGND 3QRLA 4NDMB 5B1KA 1QR4A 1WIUA 4MHHG 3WJMA 3V4VH 2WW8A 2GJZA 3QUKB 3VXNA 3QIUA 3V0GA 4ZMAT 1KDJA 4TVPE 1ODUA 4J3UA 3ARVA 3P0YL 4IHOA 4I88A 4GAFB 4OZFB 4UT9H 1G7IA 1OE1A 2EECA 1UGNA 2G4GA 5EU6E 5DC4B 4M7ZB 5DS8A 1NAKL 4ODWA 5EBGA 4YNYB 3K7UA 3EHBC 4H8UA 1MFNA 2NY4C 3L9RA 4AQ1C 4M9OA 3FUIA 3KNBA 4I89A 3N5AA 5BS0A 1NBZB 1RZFL 1ZS8B 2G9HB 2AJZB 3FTSA 5JOPE 3AT8A 3MMEA 3MRGA 4JFXA 4L37A 4YMPA 4P2QB 3ZHNA 4GT0A 1TMQA 1UXWA 2WXNA 4TUOB 4C55A 4JQIL 3IDXL 2F8VA 5DQDH 5A7BA 4MWFA 1WJ3A 3B5TA 1O7DC 1E9PB 3H2WA 4WENB 4OGZA 2VDLB 5DJ8A 4Z7OF 4QAWA 5B38B 3SDCC 3CV5A 4MGXA 1AO7A 1RKRA 5H35A 1S9WA 1TEGA 2J88H 5MP6H 1E7UA 3CSTA 3DX1A 5CCKL 1JGDA 4HUKB 2ZD0A 3QI9C 3FTUA 4X98A 4ZQTA 1BF2A 3TBVA 2HX9A 3F62A 4QCIA 2CUHA 4N2FA 3VVWA 4GP4B 3MPCA 4YHOH 4WO4C 4P2RA 2BY0A 2B15A 1UKSA 4Y5XA 3RTQA 1AKJB 2R29L 3CZFA 1OP9A 4AM0Q 4WUUB 5DJYA 1S9YB 5AOZA 3SE9L 5F7EH 3SKJH 3EYQD 3RFRA 3IMBA 5HYJE 2WO2B 4CL7A 2H7WA 4FQIH 2X0WA 3ML9A 4Y4HD 4GW5B 3JWNH 2IAAC 3C87A 2DLHA 4LU5H 5KSAC 3NABL 2FR4B 3GDBA 1GZHA 3WEAA 5EFIB 2CALA 2K8MA 1LK3L 4HWBL 4KPHH 1I9JL 4N2HA 3GQFA 3R1GL 4TVPH 5KVEE 4ZO7A 2EZ0C 5DD3L 4YFLF 2ZX5A 4JZOA 5CHNB 2VR7A 1G9NC 4QJ4B 1H3PL 1HHJB 4Y8DC 4YDJB 4CN1A 2E7CA 2F19H 3JWOH 5D1XE 3W1ZA 3F6JA 1KYUA 2VJ0A 1LDSA 2IOIA 2XV6B 2ZCHH 3L7EA 1PLBA 4GS7B 3TS8A 1GY2A 3WHE1 4ATWA 5E6ZA 5DZ9A 3IEAA 2Y5EA 3O6ML 3OGCA 5I1EL 2YD2A 4I5BB 1J8HA 1N6UA 2H26B 3FUHA 3QAZB 4OLZL 4MCZB 4ODXB 3EBAA 2OW7A 1A6PA 1NBYA 3D85D 2WANA 1A7PH 1F56A 5C92A 1IUZA 4BFEA 1LEGB 2QBWA 1RUAH 3TT1H 4YEFA 1LP9A 4KUZL 4PSPA 4U1GB 1MRFL 3CCHB 2QGEA 4G6FD 1Z5LB 2ZUYA 2Y24A 4U31A 3RVUD 3UJTL 1KN2L 2IWKA 3W0WD 2BHUA 3B43A 5MI0C 1HNFA 4NN7C 1KCRH 2BVQA 1DE4B 4QTFA 4HJ1A 1IE5A 3CHOA 3S34L 4H8WL 3V0JA 2R4SH 1I1RA 1OO2A 4Z78B 4FKKA 3WG7B 3ARUA 3LRMA 2VLJE 3QZMA 4LXFA 1XEUA 2WM0A 1Y18A 5IVZA 4Z7WB 1BX2A 4RESB 4ZX6A 4JPWH 1QLFB 4KKLD 2MHAB 3MOAH 5AZ2H 1RULH 1I85C 4Z5RB 1NGXB 1VACB 3O8XC 1AVAA 3FT1A 4IRSC 1YDPA 1DQLH 1RMFH 1QSED 3QXDB 4XPFL 4LCYA 3HAEG 4LSSH 4DP2X 5HYFA 2R1XB 3PP3H 4L5FH 4YDKH 5EF2A 4JG1H 2OR8A 3D06A 3TA3C 2XVLA 2IXQA 3GKWL 3IMUA 3BJLA 3ZDYB 3V4PA 5C09A 3LEVH 1NCAL 4YBLC 5E2VL 6FABH 4LLWA 2R2EA 3EOAB 4NQVA 1MCSA 1I7RA 3FU0A 3PS6A 5M7QA 3Q5OA 1RZJH 2WVVB 4NCC2 4EE2A 1L3NA 4TQIA 4JHWH 3JWNG 3WNKA 1HINH 1MHHA 3CXDL 1J10A 1KUMA 1LEKB 1OT1A 2G5BA 1NANI 3BWZA 3SE9H 2P80D 3ARGB 1HEZB 1T83C 3BIBX 4L8CB 1UM5L 1SLXA 1OAJA 5E4OA 3APCA 2Q1EA 2CO4A 2ZICA 4NO5A 1R3IH 3VSVA 4D9RE 5HVHC 5EOCH 1ILSA 5CJ5A 2VITB 3IRPX 4IIQB 5TE4L 3NCYP 4BH8B 3C2AL 4F3FA 3FSZA 5F21B 1T6VN 1NGWA 5LDUA 3V0VA 2EYTB 3QIWD 2YFNA 2XN9A 3CLEL 3UZQB 2AERT 4N2AA 4BUGA 3II1A 4PWEA 4U1LB 5IG7A 1S7VA 1VADB 1DDHA 4MAUL 3GSOB 3KW7A 3UOAB 3DROA 3PV6B 4OCYH 1KENL 4JK0D 3HZYB 2YD5A 1PCSA 2XZCH 2DWEB 3QGVA 4MJJA 4MQSB 3ULSB 3WO4C 4RSVA 4KJWC 1U3JA 4PJ8A 4XGZB 3CN0A 2OCFD 1E2ZA 1JPGA 4P4RA 5JPNA 3SYOA 3FU6A 3S5LB 4GQRA 2VLMD 2ADFL 2IALB 5I0ZA 1IBGH 1A0QH 4H40A 1ICTA 3SDAA 1EEUA 4K7PX 3T0VA 5B8CB 2N01B 2PKDA 3MBXL 3FFCE 2OULB 3O2VL 4G7YL 2E7BA 1AXSA 2KQNA 2R69H 1KCSL 2XLLA 5TFSH 1EHAA 1JPTL 3PGCB 2XV3A 4ENZA 1ADQA 3TL5A 4ZX3A 3GMPB 5GGSY 4G59C 5KYXA 1G9MH 3QZNA 4XP9H 1DQML 1CB4A 4LKXB 5BQDA 5CLYA 4MCMA 3RWCA 1HL9A 3QS3A 1LO5B 2PYFA 4ODSH 4X7SH 2XV2A 3ME0B 4AQAA 5I8CB 4APXB 2XOTA 1QBBA 2R0LL 3KPRA 4P5TD 4F7EB 1DSYA 3V0WH 4HIJB 3ZKNC 1ZLUH 2YEQA 3CVHL 3F12B 3AGWA 5T5FA 4N0UA 2VMDA 1YPZA 3DVFA 3R4RA 5B1JC 4QWWD 3BKYL 3KPRE 2O6EA 2WO4A 3QNXB 3U36A 2JK5A 3EYSH 3ECBB 1MCDA 2L8AA 3HS0B 2H45A 4BKLA 1FFPB 3ESNA 2Z7WA 2Y6SC 5IT2H 1JV2B 2Q6WA 1BM3H 4G1EB 4GBXA 5ECGA 3U7WL 2EXTA 3L1EA 4UTBH 4UQ9A 1JG9A 2R23B 2DLTA 1P84J 5J6SA 3ZGHA 5ESVB 4IOIB 1UEYA 2C3VB 3JZ7A 3I6KB 3VW3H 2FHCA 4DVRL 4NQDB 2UVEA 1NFDB 5L88H 3GBNL 2YA1A 3GSUA 1CICA 2X7LB 3OQRA 1PAZA 2H41A 3VO0A 1SVBA 4NNYA 5KSAD 5EZOH 3BPOC 4NQQA 5A2FA 3TTYA 1F97A 1OHZA 3HBQA 4BBWA 3IDYB 2WNWA 2CLZB 5I5MA 1VFBB 1PS3A 3QA3A 3LH2H 3IRZA 2NZ9D 2F9BT 5KS9B 1BFOB 3MRIB 1I7ZA 4OCXH 3Q43A 3V0EA 3VH8A 1CPUA 3BDXA 2I32A 3SGEH 2XACC 2YGPA 1HXKA 3GXMA 1IJ9A 1DDTA 3KHQA 1VKXA 4QHMB 3K80A 5HSFA 4BK5C 1H15A 3G6AB 1SMAA 1BZDA 3QUZD 3GSRB 4CADA 2XQYG 4I85A 4YSPA 4H5SA 4XCFH 4NOFA 4FKHA 3VM5A 1MRCH 4KI5C 2P8PA 5EC1A 3VG9B 5DVOA 3IFNH 5T3ZH 1B9ZA 4Z7VB 2NW2A 3TASA 1UADC 1FBIL 5DCCA 5CD5C 1KWKA 4ERSL 5IOPA 4HKBB 4X7TA 4XPTH 5C0GA 3QULA 1DQKA 4MJIB 4FYQA 3UYOD 5HYSB 4IRZH 2ILLA 1BAGA 2J6EH 1B0RB 1WZAA 2H47C 2H5UA 3MGOA 3QIUD 4YHIB 1NCGA 4X6DF 1XH0A 5DQDL 3SYQA 4A6YH 1AGDB 1O6SB 1Z5YD 2V5RA 3X1BA 4M5SA 4PR5A 3TX4A 4TNVK 5GS1A 2IG2H 4UUJA 2O30A 2NNCA 4XVJL 2CMRH 3UEQA 3IDGA 1QBML 1TKWA 3CH1B 3EHBB 5C07A 4QY8A 3T3MB 1MHEB 1KIPB 1VB9A 2OJEA 1OT2A 1L9NA 1KJ2H 2W5PA 2YD9A 5JHLA 2QHLA 2ZWYA 2OYMA 3CSYB 4JM2D 1M53A 5L9DL 4I18A 4MKTA 1BG9A 1K2DB 5HI5C 3ARDD 3WNIA 3JTBA 2VAAB 3NCWA 4JJ5B 3RIAF 4PRIB 3IDNA 4N2OA 5JIDA 1XGTB 4XXDB 5CLWA 2AEPH 4YUEH 4CDGC 7FABH 4J27A 1E6OL 1PYWA 3C6SB 1S4IA 4RGNC 4OI7A 4KJYA 5E08H 2ZSWA 4RWHA 4W9GC 1LO4L 2WYTA 2R23A 1G6RL 2Y69B 4JFOA 3ZL4H 1CF8H 3T0EE 2WN2A 5DDHA 3EJQA 1U21A 1JYNA 3QEGL 2VCOA 4JPSA 4KRLB 4XX1E 4UCFA 4U7SA 5IHUL 1UZ8B 4A7TA 2DM3A 3MNWA 3GXTA 3KJ6L 3K6DA 3Q1SH 2UZXB 4ONHB 2Z8SA 1FNLA 3CZUB 1UACL 1TZIA 2YPLD 3WFBL 2H2SC 4PV8B 4YHLL 5DHYA 1OSZA 1KCBA 2WQRA 1ADQH 4I4WA 4AL8L 2C9RA 4RDQF 3VFVB 3BP4A 1U41A 3S97C 1CL7H 1KPUA 3WE1A 2BOCB 2BSBA 1ZEAH 5E1AA 5KSUB 5CN1A 5ID0A 3QAQA 4PIRF 4CVZB 5FCSH 3LAFA 4MX7A 3L13A 1I8MB 1C8PA 5ADPL 1FO0B 3GMLB 5DLMH 1SJEB 4C57C 4DERA 1KEML 3FHAA 4Y5VB 5KBNC 4CMMB 3QIUB 1A1OA 3P4LA 1Y1UA 5D1XA 4GW1A 3HC0B 5AW1B 3VWJB 3X14B 3O4OC 5SWSB 1U8LB 4OD2A 1ITBB 1DQTA 3T0EB 4EVNA 1AR1C 4I0KA 3GC3A 3L3DB 2PPDA 4HJ0D 4IRJA 4XCFL 1NC2B 4DZ8B 5I71C 4M03A 1MFAL 3E6HB 2X40A 5E1IA 1KN2H 1WCQA 1U30A 4GS7C 4JAMB 1BBJA 5AVZB 3I02A 1KCUH 2VZTA 4HCRL 3IJHB 4A2MA 4DKEL 2APXA 1C16B 1PF3A 1FDLH 1J8HD 4L37B 4RFEB 2NUTA 4X4YA 3BGAA 5D96B 3RNQA 5HHMD 3TWCL 3K2IA 1LE5B 4PVNA 1FZOB 1IFHH 2YRLA 2X4PA 3HG4A 1OGAD 4NB7A 3TO4C 1KJMB 1XXFC 2COVD 2OTPA 1AO7D 1A1MB 3NH7L 5TPWH 4L4VB 2K7QA 4W4NA 2E7LA 4R4BA 2Y7LA 4TVUA 5EA0H 3KLLA 4D9QE 5DO2D 3ECWA 3KPLB 3C6LA 1UWEL 2F7IA 4GT7A 3OMNB 2QGDA 3TEUA 3AU1A 2CWRA 3OAUL 1ZJBA 4YO0A 4LIQE 4LAJH 5D7IA 1QUPA 4WHYG 2VR9A 4OLYL 4X7DC 2RIKA 3O41B 5DDHB 5FOBB 3QFDA 5DRXB 2EACA 1N6VA 1P4LA 1XT5A 5GXBB 3FF7A 1IGFH 3QC5X 5I5IA 3ZRCC 4FMVA 1MREH 3DBXA 4FTVA 5HDRA 1HH6A 4K71C 1P4IH 3QJTB 5JHAA 2WMPB 1TQSA 1YEIL 4PCTA 4PJ5A 2ZPKH 5EPMA 5C0DB 1ND0B 3N9GH 1BFVL 3QUMA 3GIVA 1A7OL 5K9QG 5I30L 4KTEL 4HJUA 3SDCB 3ENEA 3FB7B 4AYDC 1X6LA 1OCCB 1P84K 1VAHA 1MJJB 1CFQB 3TF7C 4OAWA 5EOTA 1PY9A 2Z64C 3UO1H 5EIQA 5IQ7H 5HYJB 1BXUA 2XIIA 2X1WL 4FXGC 4JZJC 4LVEA 4PW3A 2J6WA 3CXHK 4HUXA 3MA9L 4NKOA 4XVUC 3VXTA 4M4RA 1I8KA 4LLVA 4TN9A 1J8SA 3U25A 5KYUB 4WI3A 1W8OA 4RFNC 1E6OH 3JBG7 1OAUH 5ISZA 1BIIA 1LP9B 3KPSA 2K78A 1J0KA 3WO4B 3PV7A 4S10A 3X14A 4HUCA 4YHYB 4S11A 1TENA 4WTZG 1MW3A 3T6WA 4M7ZC 4U6VH 1Q9WB 4HHWA 3IKCA 3EYFB 3L3OC 4KJQD 4Y4KA 2WSDA 3LIZL 3NJMA 2BMKB 3MOBL 4PM1A 3T2QA 5F7DA 2X5PA 4JY4A 3AQZA 3NPSB 4F33B 3VRJA 2IPTH 2FT8A 2V37A 5FM5M 2R29H 5IBUG 2WZPA 5IWLA 3EFDH 1IAII 4HH9A 4HFWB 2VJ8A 1RXLA 1BX2B 1MCKA 4HLJA 4LPYA 4J3VA 3TN0B 4AC2A 4F37F 3KR3H 5FO7B 1DE4A 3F00A 4P4KB 3WL9B 3MCKB 2DM4A 4FNSA 2VRKA 2NX5B 4KY2A 1TZGH 3B9KB 4PUBL 2EDFA 2YRZA 5IW1B 5HHNA 1YEEH 1GGTA 3IFPB 4PJGB 4Z0BL 5F0MB 5EIVA 2ZX6A 1L9TA 4FQQA 4P2QD 5D7HA 4WSKA 1CDGA 3AU1B 1XBDA 4GG8B 1S78C 4I3RL 3OB8A 4ZMTA 3QUXA 4HIEB 1T89C 2GSMB 4FFWD 4I48B 3FOMA 3FOLA 5TPWL 3QT2A 1EAPB 2FSDA 4N2GA 4P3DA 3B5HA 4PTUB 5D1ZC 1BEYL 4ELMA 3DBXB 1JNLL 3II3A 3MBED 1QSFE 4MFHA 5DS2A 1TVDA 1OSPH 4DAGH 3EF4A 3IYLW 5D7KD 1QFWL 5TGBA 4NQXB 3QI9A 4PIBA 5I9QC 2QR0A 4PV9B 3V0VB 1NIEA 3X1NA 4Z95L 5FO8B 2PNDA 2G5BB 4PRAB 3L1GA 3F7YB 1AKJD 5ACMA 4MD5A 4IBUA 3AGVA 2ODHA 4FFVD 3SD2A 3CVCA 1GAFL 1KBGL 1TQBC 1UD6A 2OAAA 4KHXH 5I1JL 3D39D 4W93A 4KH2A 1J9SA 2BIQA 2HJKA 5DK0B 5SWZA 4JL2A 1BXXA 5BV7H 1CDBA 2W92A 1T6BX 4CC1A 2PXYD 2R4SL 1R9FA 1AZCA 3OKKA 4B9FA 2TRHA 1JMZA 1ONQB 5D7LE 4M6MH 1CDIA 5I0XA 1A2YA 2YXMA 2BFVL 2WMPA 3RB5A 1E90A 4Q9CA 1S5IL 1XR8A 3QDGD 3UAJA 1G6VK 4FL4B 4WWOA 4Z3EA 5EF1A 3GNMH 5F7DB 2Q86A 2PYED 4OLWL 1S7XB 4GQQA 3HE7B 5AZEL 3AB0B 5CZVL 1E9OA 4PJ9C 5EF0A 4PJ9D 4LNRB 5DEJA 1UCBH 2WAHA 1OGTB 2GUOB 2F15A 2JQAA 1CFQA 5LGHH 1MFDL 2A99A 3VFGL 4WI7A 4NZJA 1TZHA 3GMNB 4D8PA 1RU9H 2GG1A 5FO7A 4KVNL 4G6JL 5GZND 3ZLQC 1PZDA 5EO9B 3SJVB 2XXGA 4MVBC 5B38G 3AT9A 1OM3H 2VZSA 2WQUA 1JZ5A 4LCCA 4Y9EA 2VLJA 4LAQH 3EUUA 2NY5L 1T2QL 2Y7QB 4L1BA 1N5AB 2NY0C 1A8ZA 1MUJA 2C1PB 2IMMA 2FGWL 5A2JH 3ECBA 4UIMA 4ALAH 4RX4D 2C9SA 3A4EA 3DPBB 3O2WL 3FO1B 4FFVC 5DD0H 2NQDA 3EG9B 1GYAA 3PHSA 1B2WH 5CR8A 1PG7L 2XN0A 2ADFH 1FIGH 2W60B 2R56H 3ARFA 1LEIA 4I2XE 4NRXB 4R0LA 4N2LA 1AZNA 5F7UA 1RZIB 3H9HA 3MGAA 1GCFA 4M61A 2X10A 1U8CA 2F58L 4KROC 5J4MA 2WZ0A 4FP8H 5JZ7D 1FGVL 5GHWH 1H15B 3L95B 4MNGE 5TFSL 3BRDA 2MKWA 3V7MA 2FECI 3FYEB 4HJTA 4O2EB 3QG7H 5E6SB 1H6TA 5AW7B 3GJFH 4LE8A 7TAAA 2DMBA 3CZNA 4JRFA 2NX5A 4QHKJ 2AJVL 5AW5B 3GLDA 4E0RA 5T1LD 3FCTB 3FH8A 4ZUSB 4CILA 4X4XB 1GR7A 4M9PA 5DFVD 1S78D 3SBWA 2V6HA 1TTAA 2ITCA 3C5ZD 4PRHB 5C0GB 2A1WH 1AQKH 4FGMA 1PY0A 3RZCA 3OB0H 1CLZL 2H9GA 5I73C 4NNYB 3DJTA 1A64A 4XOAA 1IBGL 2WQVA 4I9WE 3SGKA 1QMUA 2VXSH 5GRJH 3VXUD 1W0YT 3HE7D 2WBXA 4PR5B 3UJJH 2MCMA 5EOCJ 1NCCH 2K9FB 2Z8VC 5JDSB 4PREA 1TF4A 1TNMA 4HZLB 4NN6C 4QD2E 4DW2H 4N0FA 1YNTB 3MXWH 4GKLA 4PGBB 1N2RA 1MOEA 1WFUA 2AJSH 4GFTB 4PJ7E 3KCWA 2NY3D 4MAYD 2FUTA 4LSSL 3QULB 1JPSL 3BSZH 1J48A 4KVCL 3TJEL 2DD8L 3BH9A 3NPSC 3MRCA 1WBYA 5EULV 4AK2A 4DP8X 3QDME 3CDZB 1S7TA 2IGLA 4MQXD 5CZKA 5JA8B 5DJCA 4WFFD 2HYMA 1Z9SA 3PFUA 4LSQH 1D9KC 2H6UA 1N5YL 4H25A 4JM4H 4KRPD 3SY0B 4OZIB 4YHYC 3FAXA 1HINL 1E4WL 1BOGA 3CFDA 1OCWH 4P2OB 4BYHA 1A4KB 4G82A 1AGBB 2X89D 5ILTL 4CU6A 1RUML 3C9NA 3U82B 1I8AA 3JTTB 4YBHA 3RDTA 1CGVA 3KYOB 1V54B 5EZIL 2NY4B 3N40P 1G7PA 2D4DA 5CEZL 3CDCA 2E27H 2OJZL 4FQHB 1DQDH 5JW5A 1OM3L 3SE4A 4DJMA 4BFKA 3REVB 3VQMA 1CGYA 4BJLA 4M6ML 5ABDE 1E9OB 2VXVL 4LGSB 3K8MA 4YEEA 3GBMH 3EW3B 2OLDA 4PYHA 1I82A 4JJ5A 3B2DC 1CCZA 5I19L 2WO3B 1YY9C 1T7XA 4NI3A 3WV0A 3DUHA 5D2LA 3UTSA 1JDDA 1KT2B 2J44A 4OGAC 3R7QA 3WFEH 2EC8A 5GS0L 2FT6A 4ZMXA 4ODHL 5FV1L 5AG9A 3WIIH 3CHRA 4QEGA 5EIIG 4HT1L 3A67H 3UP6A 3DOIA 4KGLA 4W9ZA 1XTMA 4XP5L 1HAUA 3PAZA 2I24N 4AXWB 4M7LH 2ITDB 2H1LM 2I5YH 4J3SA 4NC1E 4AGMA 2A6JA 1J05B 2QLYA 2JB5H 3FT0A 1EGJA 4TUKL 5B7EA 2KBGA 5DO2C 4PLKD 4FULA 1T21A 1BBJB 2W91A 2LU5A 5CD5D 1RP8A 5J57B 1CFTA 1IZJA 4X5XB 3EH5B 4YJZL 1OSZB 2F53B 3V4PB 1U8HB 1F02I 2X3BA 4KJQC 5K93A 1KWGA 4XPHL 5JPMA 1WF5A 3L9BA 4EI6A 4KK9C 3QUZC 1XGQB 3HIZA 2XN9D 3AXIA 3OLGA 2CPUA 5IBLC 3Q6FB 4OLVL 3VFPB 5IG7B 5A16B 3IGUA 4OCRH 3B37A 1YJDL 1F3JB 2JKJA 3C60C 2Y4SA 2FUQA 4B3VA 3QCTH 2ZUQB 1KTBA 2Q76A 3MBWB 3NCJH 4G6AD 3KPMB 1OLZA 3BW9B 4NQTA 1CG9A 3GIZL 4KV5E 4AIZA 3WTXA 4OZIA 1QACA 4G1MA 3ALWA 4HKZB 3BEWA 3GJFA 4J3WA 1KIRA 1MZYA 1CLYL 4N2BA 5F7YC 5IHZB 1MHCB 3PPSA 4L5FE 2IOOA 5ERWA 1T4WA 1OANA 1EBPA 5E8PA 3RL2B 3BAJA 3FQYA 2ZWZA 2MNUA 2LV4A 4CC4C 4XODA 3WE6A 4X9YA 1DEDA 4N2IA 2H32H 1B0WA 3GSVB 4H8HA 3IE9A 3L3OB 4WW2A 1MPAL 3UJJL 3J2PA 4PJ8D 1PD6A 2WXLA 1RIHL 1I1AA 4JX0A 4AH2A 1A7QL 1FJ1A 3VFSA 5AVQB 1JZ4A 3RWEB 1PJWA 3EJCA 2WWOA 2ICWJ 5KAQG 1P5UB 2G4EA 5DT1H 1T1WB 1GW6A 4K8RD 1PSKL 4QHPA 4HUVB 2N59A 3FF8A 1PZUB 1XO8A 2ZOWA 4PB0L 1U3HB 1ETZB 2Z4QB 4P5TC 2X12A 2ESVB 5EUOB 1NMBH 4JVPA 4RMSA 4XBPA 3VB9A 4AY0A 3REWA 1M2OA 5I8OL 3FCSA 4YXHL 4CMHB 4JRYB 2JKXA 3NSYA 1PZAA 5IW3A 1LTXA 1YHPA 3QNXA 2EDBA 1MW1A 4NQUA 1X4ZA 5DLLA 5AB1A 2DF3A 5F7WC 1MLBB 3U4AA 1WZ1L 1D5IH 3F7KA 1P1ZB 3SE3C 3VD9A 3K0YA 3IMSA 4QRUB 4LL1A 2J6EL 1X5XA 4HIJA 1QEWA 1QATA 3U2SB 2EKJA 2XG4A 1VSCA 2QVIA 1JZGA 3F58H 3L16A 3SDXE 3KPQA 2W95A 1X6NA 3LQMA 3KVQA 5DZJA 4HWEH 5AL8A 3K4AA 3MUY1 4ONFH 1T7VA 2OA9A 3UBHA 1B4RA 4ZS7L 3PDGA 4HEPG 5D2LB 5HPMA 4E5XA 4FFZH 3A6CL 3WL9A 3L17A 1LWJA 4PJ7A 1EFXD 1HL4A 4F7KA 1P53A 1PNDA 1BFTA 2K3HA 5G4MA 4KK5C 5IMMB 4PJHF 4NQDE 3V9FA 2BXZA 5J6HB 4QRPB 1EJ8A 3MRNA 2NY6B 4MMZB 2A77H 3RKPA 3RTQC 15C8H 3BZ5A 3ABZA 4WFGD 3PG2A 4R7LA 5IHLB 4RGOL 2CIIB 1ETB1 3DRTA 1Y1DA 4EAEA 3BEWB 3CFBA 2N4IA 3FO0L 5JUEH 4GMSH 3CC1A 4HALA 1LVEA 3DXAE 1NCWL 12E8H 2FX9H 3H9SB 4CW1B 5HDQL 5GGTA 2DBLL 4DFIA 3N43F 5DJDA 4XH2B 1FZJB 2F53A 3F7RA 3LB6C 4OF6A 1YC8A 2KERA 4U3SA 3GBLA 5E6IA 1IEBB 1S7RB 2ZKXA 5BW7C 3TH3T 3VFSB 3UG5A 4ZPVA 5GPRA 2AV7B 3RAJL 3WENA 3I6LE 1ZT4B 2NZ9C 1CL7L 2BVOA 3BKML 4A7GA 4HFUL 4QHNA 4AQ1A 5KN5B 5GS1B 1YG9A 1IC4L 2X0VA 2X4NA 4UV4L 2EIZB 2JLLA 3HZVB 3SYPA 1PDKA 2C7UA 4GKNB 3TEXA 2VABA 4YDMA 4RBPK 2G3ZA 3US0A 2J8UB 2PN5A 4LCIH 1EJOL 3VQ2C 5HHPA 5IESL 1X7SA 2XVBA 3LRHA 1ZHBB 4ZQKA 4MKMA 2ZXWB 1AO7B 5HD8C 2Z31B 1IQDB 4YZFF 1VGKB 3E6FB 3F7PC 1JK9B 3EYOB 4P9HH 2CK2A 4PPTA 3CG8A 1UOWA 2AJVH 1S7XA 2ALAA 4IK7A 2Z1KA 2C9QA 4MQTB 1JNHB 3D12B 3QNFA 3RTQD 3NA9L 1AC0A 4MNGA 2BP8A 4BKSC 3ASOB 3VSTA 4KNUA 3B1TA 5E7BA 3RVWC 1XMEB 1QFUL 4Q9QH 3ARFC 3OX8B 3HW7A 4D0CB 4XWOC 3BLBA 3DKHA 4WWNA 4QRAA 4EBQH 2LU3A 4M29A 3FT3A 2UZPA 4JHUA 4WI5A 5DT1L 5FUZL 4PB9H 4R26H 3JT2A 2V7NB 4Z3FA 1GKOA 1OQXA 5DHYB 3H9SD 7PAZA 1E50A 1FNSH 3M88A 5IB2A 4OD1H 1KXTB 2AQRA 4L4VD 5JMOC 4JQVA 2AJXL 2BSCA 1FYTA 1H8OA 2GUOA 3QCUL 4XZ4A 1EVUA 3QH3B 4ZMVA 2VYRE 3BYTA 3LPOA 2FZ3A 4P9ML 3X13A 3K3QA 1NIDA 4EKJA 5C6PB 1DVFC 5I2IA 3FMGH 4NRXA 2G0LA 3WS6C 1NKGA 1RIVL 4HPYH 1ZHKA 4RVBA 2WLZA 2X2YA 3DIFA 1FUNA 4KKBD 4PJ9A 4P46A 4YAQA 3BAEH 5K9KA 4PWKA 2L4OA 5FDYA 4LCWD 4X4ME 4XC3H 4C83B 5JHDE 1E5AA 4PJIB 4M7KL 3H53A 5D7IF 2ZSVA 4AIOA 4D8PB 1P7HL 4ICWA 1WS7A 4F8QA 4Y2DC 4Q0XL 4QJ5B 5C0AA 1QSFA 4PRNA 2I