3B7YA

Crystal structure of the c2 domain of the e3 ubiquitin-protein ligase nedd4
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
151
structure length
144
Chain Sequence
ATCAVEVFGLLEDEENSRIVRVRVIAGIGLASDPYVRVTLYDPMNGVLTSVQTKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRLERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase NEDD4
publication title C2 Domain of the Human E3 Ubiquitin-Protein Ligase NEDD4.
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 25
structure length 144
sequence length 151
chains with identical sequence B
ec nomenclature ec 2.3.2.26: HECT-type E3 ubiquitin transferase.
pdb deposition date 2007-10-31
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.150 Mainly Beta Sandwich Immunoglobulin-like C2 domain 3b7yA00
1A25A 3W57A 1TJXA 2CJTA 4WWOA 2Q3XA 2WXLA 1W16A 1E90A 1V27A 4FLHA 2K45A 2WXFA 1DJXA 1E8YA 3HN8A 4BFRA 4KITB 1DJGA 1E8ZA 2WXGA 3APFA 4LDCA 4FJZA 3NSJA 3CSTA 5G55A 2R83A 3F01A 2WXHA 3R7RA 3MJWA 1HE8A 3TJPA 4QJ4B 4F93B 2A5UA 2ENQA 4IHBA 2WXJA 4PS8A 3KWUA 2BWQA 1YRKA 2FK9A 3LJ3A 2N1TE 4TS6A 2WXMA 3F05A 3GPEA 3F04A 3HIZA 5H4YA 3APDA 1UOWA 4PS3A 3R7QA 2Y3AA 1DQVA 1E7UA 2LHAA 1WFMA 4KZ0A 4MJJA 3L13A 1DSYA 5CCJA 4DK5A 2WXOA 5EDSA 3ENEA 2QZ5A 2RD0A 4OVVA 2ZKMX 4ICXA 2K8MA 3N5AA 5JHBA 4XE0A 3L4CA 3M7FB 2K3HA 4F91B 3QR1A 4BGDA 3ML9A 3QK0A 4QAMB 5CCGE 2A4ZA 3JZYA 4QJ3B 3IBEA 2ISDA 4HVBA 4EZLA 1E8XA 4XZ4A 4KZCA 3ZVVA 3QJZA 5KJ7E 3T8MA 3RPBA 4PS7A 2CHXA 2CJSA 3RDJA 3B7YA 2WXRA 3F00A 3PS6A 5G2NA 2CHWA 1BDYA 3L08A 3TL5A 4WEEA 4NS0A 3PRZA 3CSFA 4EZKA 5JHAA 3S2AA 1K5WA 4G11A 4V11A 4FADA 2WXIA 2B3RA 1UOVA 2WXQA 4J6IA 5CCHE 2QZQA 2CM5A 3DPDA 1TJMA 2DMGA 4NPKA 3W56A 3SD5A 3FDWA 3QR0A 3L17A 4QJ5B 1DJIA 1RH8A 3QARA 2NSQA 1QATA 3APCA 3PFQA 4Y1TA 2NQ3A 4F1SA 2V4LA 1BYNA 2Q0ZX 3L54A 5H4ZA 2KI6A 4FA6A 3OAWA 1DJZA 3ZIMA 4L23A 2EP6A 1W15A 3HHMA 4Y1SA 4ANVA 1WFJA 2YOAA 3DBSA 4FULA 4L2YA 4NPJA 4TUUA 1E8WA 4AOFA 4FJYA 1E7VA 4ICWA 4ANUA 4JPSA 3ML8A 1DJWA 4ANXA 4URKA 2WXNA 4AJWA 1BCIA 4NP9A 1DJHA 1QASA 1UGKA 4GB9A 1RSYA 3NZSA 4FHJA 4L1LA 1CJYA 2WXPA 2ENPA 3NZUA 3L16A 3PYCA 2ENJA 4ANWA 4FHKA 4XX5A 3ZW3A 3IM1A 4EZJA 1DJYA 2JQZA 2FJUB 4GNKB 4TV3A 4A55A 3P2BA 4IQHA 4F92B 1GMIA 2UZPA 2DMHA 3QAQA 3TWYA 5T8IA 3KWTA 4OVUA 4HLEA 3L9BA 3FBKA 3PREA 4LT7A 4LCVA 2K4AA 2YRBA 4L1BA 3OHMB 2NCEA 4WWNA 2CHZA 4WWPA 4WAFA 2CHDA 2D8KA 4DNLA 2WXKA 1RLWA 2Z0UA 2X38A 2CM6A
chains in the Genus database with same CATH superfamily
4GKNA 5INCA 3ARYA 4MDRA 1RERA 2P3YA 1JYVA 5EORH 4G1MA 2PW2B 1L3WA 3PXJA 5CWSA 1G5AA 5DHDA 3AM8A 4LSDA 3ZGHA 1BBJA 3JUZA 2XUWA 1CFTA 4RAVA 3SPVB 3VQLA 5MEOA 5AD0A 5D1ZD 3GI9H 3HE7B 5BRPA 2W9LA 1BXAA 1TVHB 2WLIA 1BFSA 5HGAA 1ZHLB 2X70A 4GXVH 4UMSA 1RK7A 4OB5H 3UGEA 1HHJA 4Z7UA 1SEQH 2WLZA 3Q9PA 1AE6L 2O5NA 4MVBD 4S1SL 2B08A 3Q0HA 3VMOA 5KS9F 1E7UA 1PZUB 3OXSB 1FNEA 1ZDSA 4TLTA 2ADGA 2DQJH 4N8CH 3RDTA 1ZLUH 1BVLA 1X5HA 2BIPA 2WIIB 5CKGA 5A3ID 3HMXL 1AYRA 2CAKA 1WAAA 3SIKA 1DFXA 4A7QA 1IM9D 2LE9A 3LRLA 5KW9L 3S88L 5CIPA 5HYSA 4L9LC 3RKDC 2OI9B 2IALA 2CA3A 4K3GA 1RZJC 2HMID 3QWNA 4N2OA 4QJ3B 1F90L 5LKNA 1B0GB 3E6HA 4D8OA 2AHIA 3INOA 4IJ3C 3E38A 5DYOB 3P4MA 2JKWA 4RFEB 4TVSa 3S9DB 4OCNC 2AI0L 4KI1A 1TTBA 4NS0A 3JWDL 4WEEA 1JRHL 5ALBL 1MCWW 1X7SA 3BN9D 4PV8B 3QJFB 1XGUB 3LKRB 5EEWA 5EMYA 4YSRA 5AB2A 5T5NG 5DRXB 2YKLH 3EJYD 3UZEC 2ZKHH 1CFQB 5I8KH 3QP3A 3FPXA 1M2VB 5CSBA 4ZAKD 5AL0A 4PCKA 2XCMC 2NSQA 2BRQA 2AJZB 2V4LA 1NZRA 2R29L 4M43L 4S0SD 2CO7A 2CMRL 4I0PB 2W88A 1JCKA 4TNWF 2OXHB 2CRMA 1WWBX 3H56A 4NPJA 4PJAA 3PWJA 3X1BA 1FE8H 1SRDA 3JQOB 1BXXA 4BKSC 3MRJA 1KXQA 3SODB 5I1CH 4WJG3 2WGXA 1P4IH 1UGKA 4LLWA 3RNKA 2X7LA 3B8SA 4NQCE 2OFQA 3WEXB 4HOMA 4PGJA 2IWGA 3QW9A 4E0RB 4WFFD 5E6ID 4HKZB 4X5WA 2YWYA 1PNDA 1P84J 1WG3A 4YFDB 4YLCA 5F0JB 3O3AB 4XH2A 1JGUL 4ZUTA 2DB8A 4UYQA 3TBTB 1QNZH 2WBWB 4RNRB 4HGWA 3U0WH 4Z8FH 2HX7A 3E8UH 4Z7QF 1DZBA 5I76A 1ZT4A 2NYYD 3MJWA 1G0XA 4AMKL 4DAGL 1I1RA 1DVXA 43C9A 5CF3A 5IJBC 3K6OA 5A2KH 4YEEA 4MQTB 4Y19B 4KJQD 2J1KA 2WXFA 4WEUD 2QQQA 2Z4QB 3K4DA 5CP3A 4PRHD 1L3NA 4XB3A 4NX0A 1N5YH 3ARSA 2W60A 5IVOA 3ELAT 1KB5H 5C6WH 1BJMA 1X5MA 1E50A 3WAKA 3UYPA 4JPQA 5AVZB 4N1HB 3IDGB 2DI8A 3T0EA 3QHTC 3HBQA 1KBGL 4J4PA 4GUQA 5HDRA 4N26A 4PGDA 5JIKA 3MROB 2HFFA 2JQMA 4APXB 3ZRFC 4B9YA 1YEJL 3BSHA 3VM7A 2J1YA 3QEHA 4GXUM 4L8SB 4Y5YA 4ZD3L 4AQZA 3WKMH 5ILTH 4X4YA 2YD3A 1ZT1B 3ME0A 2QHRH 2EDEA 2QSCL 4X5XB 3IFOB 4JCLA 4TPRH 1FBIL 5C08E 1TCRB 4KK9D 3DOSA 2K8MA 3OV6A 4BHUA 4XBPA 3OKMA 2P8PA 1QSZA 1QSFD 1DYZA 3M1CA 4UT6A 1JF1A 2KQNA 2XN0A 3MV7A 3OQ3B 4XPHL 3H7BB 3KS0J 3HB3B 4OLWL 3MJ9H 3C5XA 3DJSA 2GFBA 1MI5A 2Y69B 5DEFB 1SGKA 3KLHD 1UKTA 2DQUH 2QVMA 5B39B 2EDWA 2JLLA 5FDYA 5B8CC 3B9KA 1NUNB 2LAGB 4GY4A 3I9AA 5BMFH 1WC7A 2VKWA 4Y4HA 3WCYA 4KRPD 1JGLL 3TNNB 1DP0A 4YDIH 4DETA 5E4EB 4M6MH 3FB5A 3RU8H 1MFVA 4FQPA 4QHNA 3QJSB 4PJFE 3X3FH 1J8HB 2WMPA 5EO9B 5BOZG 3TV3H 1B3IA 3NCXA 5IOPA 4RMUA 1TJHL 4NO3A 3IDUA 4C56B 4P8QA 3WV0A 2B77A 4MWFB 3GXUB 1T7ZA 4JQVA 4PJIF 1UD3A 1RJZB 1CDIA 1T04B 5AVTB 3IFLH 4CVXB 2DWTA 2DD8H 3H9HA 4G7YL 2VLRE 3LN9A 2VSDA 2YJLA 5C0IB 3RGVC 4QCIA 4IOIA 2HWZH 4JR9H 3QJQB 3B34A 1U2HA 5IMMB 1PPIA 1NGZA 3UXFA 2G2NA 5C6PB 1DSFH 1WRFA 2AK4E 5CJQL 4HJSA 4JO1L 2VDKL 4L1TA 3UPAA 5IJKC 2Q3AA 4JN1H 4U1HA 4QXUL 4ZO7A 3ALXA 1OXYA 4HIEB 3K72B 3RKPA 4OGAD 4F9PA 4MMZC 2OP4H 5AVXB 5LB1A 5LBVA 4Y0GA 1D3CA 1SQMA 4KNUA 4XR8C 2X0WA 3TCLB 3G5YA 4I18A 3UYRL 1FNSL 2NR6C 3F12B 4KMTH 5EZIL 2YA2A 2OL3B 2CGRH 1CBJA 4R4ND 5D2LA 3DC0A 3HNSH 1TETH 1IBHA 3CVHH 4R26L 2PN5A 5F3BB 4LSRL 5D7SL 1NC2A 1YEHL 3EAKA 4OCMC 4ZMAT 5JIPA 2DF3A 1IL1A 1J1XL 3Q8CA 3RVVC 1EAQA 1F45A 1DQQB 3BPCB 4F80A 4WW1B 3DRTA 4Y2DB 3OB0K 3KPRD 3ILDA 5C0CD 4MD5B 25C8H 1ZDQA 2QEJA 3K4AA 1E67A 2XWRA 1TQSA 2HUHA 3ARGD 2GBTA 3H0TA 4IRSD 1NUFA 3DYOA 3U7WH 5DO2C 3NIFB 4L9DA 2GIMA 1OQXA 2DWSA 5AVYB 1DBMH 2WB1A 3DRQA 3EYSL 3QIUB 3VG0H 4LSTH 1NM4A 2IAAC 2I5YL 1N0XH 2HT4D 3U9PH 4WCYL 5C3LD 4J7RA 1G7PB 5DJAB 3MNDA 5F0LB 5EU5B 2OV0A 3WS3A 5D6DA 4APQA 1OP3K 2OLDA 3L6FA 5F7MC 3T3PF 3BZFB 1A1OB 4M1DL 2AABH 3S8FB 4Y1AA 4CJ1A 4P4KC 3HNVL 3O3BB 3DX8B 3E9UA 2UZIL 1CFVH 1QW9A 2X3AA 4Z7UF 3VXTB 1RXLA 5IESH 1T22A 2BNUB 4PRPD 1Q1PA 2BSTB 3QXTA 1B3JA 1EFXA 2NY1C 3ABZA 3QJXA 2IWEA 5BRZA 5L88H 4NDMB 4XP5H 4Y2OA 1TNMA 4X99A 3WN6A 1JGVH 3L3IB 4UM8B 3GTTA 1CLVA 1H15B 2FJGB 3G6AA 4X9YA 4F1SA 4A1RA 4HUVB 4JS7A 3B83A 5CJXA 1KCUL 4M02A 3ZY7A 1OT4A 1YYML 5DEJA 3EHBD 5EO1B 4RZKA 3K6DA 1BGXL 2YUZA 2VL4A 1JWMB 4BZ2A 4J27A 1ZA6B 5MI0C 5EU7E 3U6XA 5DFVC 2IGFH 3MZTA 4IOSA 3QI9C 2ZWKA 4GW4B 4G8GB 1WS7A 4GW1A 4PD4J 1G5GA 3C5JB 4H0GA 4HF5L 4OT1H 4XXCC 3V9FA 1H6FA 1E40A 2J6EL 1F2QA 2DM2A 2VDMH 3ARDC 2AJYH 5IIEB 3S36X 3SCMD 1I8KA 3MBEC 3NVQA 1CE6B 2VDNH 2VERN 1RUPL 3TH2T 3VRLF 3SYOA 1T0PB 3VXRD 4ALAC 4QRRA 5F89A 3QRBA 5FPIA 5D1QA 1AGBB 2YAFA 3CMOH 5IBUB 1JK8B 1TTFA 5F70A 3U25A 3BZ5A 3CN2A 1I85C 2V9UA 1EHLH 4PG9B 3RWFA 1L7IH 1MJJA 2SODB 4NJAL 1MDTA 4PJAF 3Q5TA 1U95B 2ZXWB 3PP3K 4X8XA 4RGNE 1C5DB 3PHQB 3JV4B 4ORZC 5D4HA 1RVFL 5C0EA 3UBXB 2HT3C 2IFFL 2X87A 5BV7H 4P57A 2ZUYA 4EN3B 1KCVL 3J07A 4Y2LA 3JT0A 4K7PX 4AG4H 3SE3C 1U8JB 3UJIL 1K4CA 4R0LC 5E95B 2VZVA 4N2LA 4GAYA 3RUGA 1OEZW 1NGYA 2VLJA 4MNQE 1JZ5A 1OV8A 4OBRA 3Q8AA 2NX5E 2OJEB 3V5KA 2Z35A 4M1CD 3HUJE 3IFPB 2B4CC 3NQKA 4PCTA 1JZ3A 3JTTA 2D2CC 4WQOA 4YHKL 3QCUL 1YA5A 2J55A 5IFAH 4ES9A 4QHKJ 1G0YR 5DHMC 3TEZA 3QULA 4M7ZC 3X1NA 4U05A 3MRHB 4BE6A 3N43B 3NJLA 5J1TC 1FZMB 3NJIA 1N7ML 4MZ3A 2K4WA 1TU2A 4Q2ZA 4G9DA 5CNHA 5HHXH 1H5BC 5K69A 2JKIS 4B9CA 1NBZB 1UOLA 3D1MC 3EDFA 4FXLA 4BCZA 2K7PA 1UH4A 1QFWM 3KPTA 3HMWL 2QSTA 4P2QB 3KNBA 4DPAX 4JPIB 3V8CA 4NC1E 5AOKA 4J6IA 3EYQC 1F3JB 6FABH 5GZOC 3UYOD 5I1JH 4XI5D 2VE6B 3DXAB 3CDZA 3FT2A 3SGDI 2QJDA 5CBAA 1S9VA 4XVJL 4HH9B 2X42A 4K7PH 4KRNA 3VXMD 1U8IA 4AGLA 5I15L 4AC2A 3CXDL 5D7JD 3DMMA 4K2UL 3V0FA 3HCVA 4N4YB 3RWHA 4RRPG 4MS6A 3QFGA 1BECA 3BO8B 1WCBB 3CZLA 3DTXB 3MRIA 4E9SA 1LE9B 1QLRB 4JFDA 1MCPH 2CIKB 4JPSA 4QGTA 5IW3A 4D7BA 3GMOA 1ID5I 1AQDA 5E1IA 1IEBA 1YEGL 2NY4D 5CZKA 4G80B 4QR7A 4BH7B 5DUJA 3MQIA 1OSPL 2YXMA 5DI8A 2OMXA 4TL5A 3SDDA 4GRMA 1DDHB 2Q2EB 4PVLA 1L9TA 1YEEL 2VABA 3MRLB 4HJUA 3TO4D 4DOHB 1FFQA 2HJKA 5KVMC 1K5NA 3BUTA 4PCYA 5HI3C 1F6FB 2EIMB 4OF8A 4GAAA 5LUMA 1GH7A 1WVZA 4HPHA 1S4IA 4PHXA 4IW4C 4ZQKB 5IB1B 1A2YB 4FNQA 3OHXA 4FTDA 1OAZL 6CGTA 3HZ3A 1AGCA 2AEIT 5I1IL 1AJ7L 3KE0A 1CDUA 3N42F 1NCDH 2FBJH 5C0RH 5E1AA 1ET7A 2D3VA 4QRPD 2E9JA 2IQAA 5F7LB 2YSTA 1AH1A 4AH2B 5C0BD 3LH9A 5KN5B 3FQ1A 5AUMA 1NANI 3F8UB 3L7EB 4UAOB 5ECGA 4NQDE 5A1AA 3IJ7A 3MCLH 3HBPA 2AQSA 3HNTL 4G1MB 4RMQA 1PZ3A 3Q8BA 4Y16C 2X41A 2WKOA 2WWMD 5CWSB 1UWGL 1BBJB 1MY7A 3QRGL 3BVXA 1U8CA 5D93C 1CFTB 4RAVB 5LBGA 4YBHA 1RIVH 4ZSOE 3HMXA 2H4EA 2MQ0A 5AD0B 5MEOB 5D71L 3LKNA 3DGGA 1FNFA 1W2KT 4BZYA 3P3RA 2WLIB 3QUMH 5HGAB 2G4EA 3MLXL 3ASOB 2YIHA 1CL7H 5D2LF 1FAKT 2X70B 5E5UB 4AVKA 3LEVL 2GJPA 1HHJB 2OMTB 1PY4A 4GLRH 4LQ1A 4QXGH 4V1DA 5EPMA 3W3BA 1Q0XL 2AJXH 2R23A 2ICWA 3BE1H 5DZLA 2I9LA 3NG5A 1MELA 3ZE2E 3QISA 5JHDD 3NFSL 1FAIH 1FNEB 3BGFC 3KPMA 1E2VA 4K3EH 2ADGB 1HH6A 3SGKC 4AJVA 1BVLB 2VJXA 3IDYC 3NYKA 5FO2A 4GG6B 3V4PA 2ZOKA 1MG3C 1T5WA 1HS6A 1URLA 3VXQA 4XVTL 2O61A 4NSKA 3HBZA 5TD4A 3T04D 2BOBA 1THAA 5E99L 5CIPB 5HYSB 1CICC 2IALB 1GOFA 1N4XL 4N68A 4YLBA 4YDLC 2UXGA 3QG7L 1HDMA 1S9KC 4C47A 2R29A 3MV9D 3SO3C 1UKSA 4OQ1A 4PYGA 2XKSA 1E2WA 1X7QB 2Z7ZA 3P4MB 3SE4C 3WEAA 4BFNA 3S3JA 4L5FL 4NQTA 4NZJA 3P0VL 1HILA 4JKPH 4S0TD 4MJIA 4L23A 5T33H 4EMZA 1T89A 2JKTM 1G1KA 3V4UH 4JVPA 5LBSL 4NJ9H 1CURA 2YGNA 1IKFL 4RMBA 4XC3L 5K1VA 1XTLA 2QGBA 4KI5C 5FFLA 1BJ8A 2CO7B 2ZOUA 1OP5K 1QP1A 2K6WA 4PJAB 1X5XA 3KEDA 3PWJB 4QXTA 3V4VL 2VXQH 4K9EL 1MWOA 3MRJB 3W5MA 2QMKA 4LLWB 1OLZA 3RNKB 3AG4B 2X7LB 4WWNA 4PP2A 1F6AA 5JUEH 2VGLM 3LZPA 2YEZA 4KHXL 1MFAL 2X6BA 3GRWL 4X5WB 1FPTH 3NCYP 4AQ1A 4F7CA 5KSVB 3ZL4L 4JB9H 4XH2B 2MTAA 4ZUTB 4HGWB 5EBLA 4KGLA 3VNYA 1WAEA 4NC2B 5D2NE 3T6XA 1NAML 1I53A 4P2YA 5I76B 2XVKA 1AXTL 1ZT4B 4LCWD 2FWSA 2J3SA 2VSKB 3HPJA 4P04A 4QHLA 2Y6SD 1PG7L 2ZYSA 4LVEA 43C9B 2V9RA 5EU6E 1C08B 4NGHH 2FX8L 2OW7A 1VPOL 4PB0H 2MKWA 3MV8D 2W60B 4H0HB 1V7MH 1RUQH 2AJUL 3C5ZC 4LL9A 4D0BA 3K8KA 1A21A 4OUOA 3QC6X 3UYPB 5K9JH 1ETJA 3EJSA 5A2LH 4PGDB 2HFFB 4JFHD 1RIUL 4U1SA 3KVDD 5EEVA 4U2YA 5CBEA 4X4KA 3KPNA 3QEHB 2XTJD 4MJ5A 3BPOC 3K6IA 4X4YB 2FO1A 1W8EA 4DEWA 5CD3A 1NCBH 3ME0B 2EYSA 1UD6A 3BSZL 4TQEL 5IUSA 4E41D 3RUGF 3A6BH 2CO6A 3DOSB 4KAQH 4XBPB 3OKMB 2P8PB 3QRLA 2BOLA 3WFEH 5H37A 5FO8A 2YSSA 2A0LC 2X4QA 1BM7A 3E6FA 2GFBB 1MI5B 3GKWH 1L6ZA 5F2FA 3IDIA 4UIMA 1AS6A 4JHUA 2HLFD 3GRBA 5JHLL 4AGQA 4HK3J 4GUPA 4MHHI 4KJPC 1WC7B 1QACA 4HALA 4FFZH 4Y4HB 3MGAA 4KKRA 1A7OH 3OWEA 3FB5B 2EVGA 2BNQA 3RVWC 4QHNB 4I77H 2WMPB 4JPVH 2WWKT 4XP6L 5AW0B 5IOPB 4TNGA 5MEND 1UGNA 1P5UC 3FU6A 3BKJH 5EULV 3X2QB 3EOTH 3NZSA 4XB8A 3P73A 5CZXC 4ZW7A 43CAA 5CJOL 2Q1EA 3B1TA 3F7QA 3N42B 3H9HB 4LKXA 4TV3A 3BAJA 1N68A 4K7PY 1HL4A 3EJCA 1J8SA 4M7JH 4TLUA 4KMQA 4QCIB 4IOIB 4R9HA 1NGZB 3DJZA 4O00A 2EVHA 5B4MD 4H2AA 2WNGA 2IWFA 4NLHA 1MFEH 3DHMA 1XR8A 4CUCA 1OCOB 3U82B 2W9EH 3LVTA 1IBYA 4U1HB 2D0HA 1MRCH 2TSAA 4TQPA 2H1XA 5J1SC 4NQUA 1BP3B 2IVFC 1WZ1H 4LVOC 2APSA 1SVBA 3KPSE 3JTBA 3DOIA 2WV3A 3G5YB 5I23A 1Z2KA 3H7LA 4IGBD 2WVUA 1EGJH 4J3WA 4ZTOL 3A6CH 2J25A 4JMNA 5KAQF 1CO1A 5D2LB 4I13B 3OAYH 2FWLB 3ZZQA 4NQEA 4AEFA 3N04A 3PLYA 5L0QC 5FIEA 1NC2B 1B6UA 1IL1B 1Q9LA 3GZKA 2J20A 3KXFA 1ZSHA 3F84A 3OZLA 2Y5TA 3BCDA 1GJWA 3P0YH 2PYED 3DRTB 4PLOB 1KB9K 1YJDC 1G43A 1O6VA 4ICXA 3KDPB 1T2XA 1JK9A 2YD1A 5CGTA 4GJTB 3C2AH 3MLWH 1CFNA 4HWBH 1O6TA 1QHQA 4QYOA 2EO7A 2ZXBA 1ANUA 1RUML 4LDEB 2Y7NA 4HOXA 1IILE 5EV7A 3LZRA 1NCWH 2QPSA 3DRQB 4KUZH 4LB8A 4ZW5A 3P30L 5I19H 1L9RA 3VMNA 4JJHA 3ETBJ 2MCPL 2V37A 5DSCA 2WKOF 1PJ9A 3CVIL 4HIIA 1KJMA 4HJIA 2WBXA 5D5MA 1JXDA 4FQIH 3TT1H 2W0FA 3BVVA 1MWAL 1VESA 3WS3B 5GS0L 3T09A 3FTUA 3CQFA 2VDQB 2EADA 3P3SA 3APMA 4Y1AB 2WTOA 3RTLA 1M53A 1DJIA 4ONGL 2ZOLA 1YNLL 3JWNC 1QAWA 2W81C 3ZZLA 1T22B 1OL0A 1EK3A 2DAVA 3SB3A 5H4ZA 2AAAA 3KPOA 5BRZB 5A6IA 5EU4A 5GIRA 4WHDA 1E5UI 4JKNA 2EDKA 2L7QA 4QDGA 4Y2OB 4MJ4A 2ADFH 3C8HA 4X99B 1CMOA 3GBEA 3GLAA 2VRAA 2J6EA 3QHZL 4JFED 4HIPA 5EIIG 4RFOH 5HI5D 1BCIA 3G6AB 5CINH 2EZ0D 2F19L 4YDJA 2WLNA 4XP4L 2OR9H 4YBLB 2OJZH 3OG6B 2ED7A 3QAZB 4R96A 1XB8A 1KTKE 3D0VB 3TS8A 2ZYIA 4A6YH 3QEQE 4Z23A 3RFZA 3VXUD 2GQHA 4OD1H 4FFWC 3TFBA 5E5RB 4A68A 5KANI 2X1QA 4GW1B 3TCXA 4ODHL 4IK7A 1FF5A 5CILL 5KOVC 4XMTA 3HC3L 3V52H 3HLKA 1XF4A 1I8KB 3ZOAA 2X6UA 3GSNA 5F89B 3I50L 4WFFE 4MQXD 2X4SA 5HI4C 4HSQA 1IB5A 4KITB 2DWDA 4K8RH 2YRLA 4UZSA 2R2CA 2IV8A 3O8XD 1YYLH 4MJ6A 3Q5YA 3RWFB 3U4EA 1MJJB 3EUDA 1BF8A 5E2VL 1IFHL 5D7IE 5HI3D 3A3YB 3L5WA 5CN3A 1N8OE 2J88H 3QXDA 2PXYC 1MDAA 4N0YH 3UC2A 3GMLA 3QPQC 5C0EB 2YAEA 3FQRA 4P57B 5KUMA 2IMMA 2Y2WA 3QDJD 2VISA 4KZ0A 5DD3L 5HJ3A 4ZMYA 1IGIL 1MVUA 1K3ZA 1Q4NX 1K4CB 4PRHE 3LZLA 2FATL 5ECJE 4GAYB 3RUGB 2OSYA 2ZKMX 3PV6A 2VLJB 1GMEA 1XGRA 5AW8B 4CGTA 3ZR6A 4RMRA 3BVDB 4G2AA 2Z93A 3V5KB 2Z35B 1NL0H 1CIUA 3NGBC 5IVXE 3JTTB 5JIQA 1KT2A 1E8XA 2APWA 4FCAA 3HI6L 1JDDA 2GIYA 3QULB 1KJ3H 3F00A 4JHAL 3L08A 4TLSA 3V0VA 4HUXA 5I82A 1TU2B 2PF6A 4KKAD 4UINL 1FGVH 1NFAA 4Q2ZB 4NN6B 4EUPG 4G9DB 1SJXA 2DBLH 1QLFA 2CXKA 2YPLD 3DUHA 3HS0A 4QIRA 4NP4H 1HEJC 2IDQA 3S8WA 4MZIA 2FLMA 4IBQA 4CC4C 2DTMH 3KNBB 4TNVF 3B2PA 4TSBL 1LP9A 5KBPA 2D7QA 2WBJD 4JRYA 3SBWC 1OSZA 2EH7H 1JCVA 3FT2B 4F37F 3CDZB 5HYEA 3D09A 5CBAB 4HSCX 1OIOA 3W81A 1S9VB 1E6OL 1II4E 2VQUA 3B1UA 3UJJH 3KGRA 4WGVB 1U8IB 4KROC 1F11A 3DMMB 4GT7A 3HCVB 3RWHB 5T1JA 5D70H 4LASH 3IU4L 4E9LA 3MRIB 4L1HA 4JFDB 1I1CA 4W9HC 3VWKD 3D9AL 1SN2A 3RY6C 5KEZA 3CZUB 2ZXCA 3GMOB 3CFBA 3MXVL 2J56A 1AQDB 4HWZA 1IEBB 2RH0A 4KC3B 5LN8A 4N6RA 2VMDA 1T7WA 3FB6A 4UZUA 4BELD 4P9ML 1MREL 1MHPH 3SDDB 4PLJD 5DI8B 2OMXB 3VFPA 1FNGA 1HSAA 2VABB 1WICA 4OCYH 3O4OB 2F8IA 4WNJA 1KG0B 3QQ9D 2CKBL 1ILUA 2HJKB 1OAKL 3FF7A 2EDDA 1K5NB 3BP4A 3L5JA 4JO3H 1QUNB 2WIMA 2VXUH 4HKXA 4OLUH 1Z9PA 4KX7A 1JHLH 4BEIA 4N2KA 3BSGA 1AGCB 4LFHG 1SY6L 5FF6A 4DQAA 4CKVX 5E1AB 2F0CA 2IQAB 4N0FA 4AK1A 2WXMA 3F05A 3UDWA 3EYUL 2P7TA 5AUMB 3T4AA 3CLFL 3J2PA 1TCMA 2Y22A 4KTGA 4AQEB 2QSQA 1DSYA 3MDJA 4KXCA 3MLZL 2XN9E 4EI5D 2H9GA 2WPGA 1EBAA 3CBKB 5E5MA 2YS4A 3WY2A 1VEPA 3O6KL 4OTXH 1S7XA 3BX7C 2NW2A 1U8CB 3KPRE 1FSKC 3AGWA 3F58H 3ML9A 1BZEA 3UAFA 5C0CE 3BT2L 3U9UA 2ALWA 4N85A 4EUPH 3LKNB 3DGGB 5GSVA 2E7BA 2HXAA 3IPEA 5E9AA 3ESVF 5BO1H 4Z77A 3BZ4B 5DURD 4ZS7L 4WK2B 5TPWL 3NP4A 5AW3B 3ATEA 5EPMB 4U1LA 4V1DB 2DDQH 1QFWH 2R23B 2ICWB 2I9LB 1GZHA 1U8PA 3IF1A 4WEBL 3GINA 1P6AB 1HH6B 3BH4A 2AJVH 1EZSA 3DPDA 3RPIA 5T5NF 3FDWA 2ZOKB 2VRQA 1T5WB 3BP7A 4ENEC 3VXQB 4UCFA 2O61B 2AGJL 3KWVA 4NSKB 5GGRY 3ZE1E 2BOBB 3PWPD 3FTXA 1PX4A 4MSWA 5C2BH 1J1PL 1HDMB 4KK5D 2LLGA 3F65A 2GK2A 4PRPE 2DY2A 2IQ9L 5FGBA 1Y6KR 1L7TH 2PPDA 2IH3A 1BVKA 2H32H 4GO9A 4R2GD 3V4VA 5D5MF 3NPSC 1HILB 1YCSA 4XCCL 2HTLD 4MJIB 3IK2A 2A1WH 1NMBL 3BIBX 4CVZA 3K2MC 3F6JA 3I9GH 3U4AA 4L4VA 3GRWA 3WEOA 1KCLA 3FSWA 3P69A 3A67L 4DN3L 4ORGA 2ZCLH 3Q2LA 4WTZG 1NAMA 2QFRA 3W57A 4U7SA 1RUAL 3SBPA 4HBCL 3IJEA 4M4RA 3PV7A 5AEAA 5FYLD 1S6NA 3PDDA 1CR9L 3BPNC 1D2PA 3CPLA 4PP2B 1F6AB 3R4RA 3S2CA 3DECA 5IMKA 3VXRE 2BFVH 3GZQA 2X2UA 2VDRL 2YEZB 3LH2H 1L9OA 3GUTA 3O2VL 1JYNA 1X5AA 4R97B 4F7CB 1A4CA 1Z5HA 4PJEE 4XMPL 5EBLB 4PJ9C 3EJUA 5FDWB 1DZ0A 3K8LA 1PMYA 1IM3D 1PY9A 2MJWA 2WWKO 2X4OA 4QHLB 3HPJB 4YGVA 1A7QH 1NBYA 3EJRA 1CLOH 2VZOA 5C09A 3EJPA 1JI1A 1NLBH 2H1PL 4ZI8A 4NZRH 4JZJA 1QUPA 2VR6A 4PJGA 2Z31A 3QYCA 5JMRA 4N0UA 1OE2A 1LEKA 3UPRA 1JIBA 2BK8A 4D0BB 3C6SB 4UOJA 1OM3H 5JQ6L 2Y1VA 4HC1L 3F83A 4KZCA 3L3JA 1P0SE 4ZYKB 3M86A 4PR5B 4U1SB 3ARUA 4Q97A 5CBEB 3MC0A 1KYOK 3GUFA 3KPNB 1UADC 4WO4A 3WNIA 4LARH 3KWWA 5CD3B 5JHLA 4DKDC 2EYSB 4IDJH 5AW2B 1PZSA 4F2ME 3B2VL 1HT6A 2GJJA 5JMOC 1DLHA 1NA8A 1XZ0A 2CO6B 4LRNL 3LZOA 1FP5A 2EXYC 4KBPA 1HK6A 4POYA 2PLTA 2CLZA 2YSSB 5FO8B 5HYIA 2BP8A 3HKFA 2OX5A 2X4QB 1CPUA 3MACL 3MOAH 4PJBA 3QUHA 3U6XS 1I8LA 4Q7DA 2EDRA 3IDIB 5L4FA 5IP4A 3UTPD 2HFGH 1WSST 1NCOA 3D39A 3FSAA 4MYPA 3LMJL 3OKKA 3IB4A 4LSQL 1GW6A 4GUPB 3LRGA 1WA2X 4FYSA 4GMSL 5IMOA 4D0DA 2KMWA 2J5LC 2D7MA 3IJHA 4NKIH 1KEGH 4EQ2A 2NYZA 2BNQB 2XPGB 4P3CH 1G1YA 2ARWA 3IS0X 3D33A 4QO1A 4F58L 2VDKB 5DR5H 1M6OA 2R56H 1BYOA 1AAJA 3MBWA 1LO2L 3MA7A 3OJVC 4H8PA 4L1BA 1C9SA 3QUXA 1YNTA 3P73B 4WUUD 1I8MA 3VGAB 3CH1A 2JJSC 2VXSH 3MKGA 4MX7A 3SBRA 4JX0A 3TBWA 3PJNA 3PQYA 3FUKA 3HR6A 1WBXA 4WUKL 1OP4A 1JF6A 2WVTA 1HCFX 4TVPH 4JY6A 1HJBC 4NUGH 3US0A 3UZVA 3NIDF 1OCWH 4CMHB 4XMKH 4PHZA 1XR8B 3W0WD 3L81A 3U1SL 1CYWA 1G9NH 4PS8A 3UEQA 2F58H 5EZOL 5AOLA 5FUOL 1WD9A 5F7EL 1B4JH 2X0UA 3HFFA 2HJFA 4A7TA 4O9HH 3CXFA 2QQKH 5ES4B 2F74A 4G8EA 4QRPE 4XP9L 2RHEA 2CPUA 4FDWA 2X1PA 5C0BE 4WVRA 5DLMH 1T7VA 1DVZA 3FZUC 5EOCH 1NAKH 5HDWA 4IRJA 4NQEB 3GK8L 3PXLA 3HE6C 2H0EA 1SFHA 5LCVH 3MODH 1Q9LB 5M95B 1R0AL 1IGJA 1USZA 2Y5TB 2CALA 2BWIA 4HVBA 2PO6C 4IKKA 5C0ND 1MWAA 2WKGA 3PUUA 2RACA 1JK9B 1JGEA 1MFCL 1UYWH 3FTVA 1E4JA 1HC1A 1CFNB 2EINB 1ZLEA 5DQDH 5CD5D 1W72H 2BVQA 3SGJC 4QYOB 3WNPA 4LOEA 4PJXA 5ESAA 3B8YA 4WTXA 4BK5A 5F44A 1LHZA 1NCNA 5C07A 3RVTD 3S3DB 1Z6JT 1AHKA 3GBDA 3QWRD 4IM8A 1WFNA 3STZA 5DSCB 3BFWA 4X6EA 3TF7C 3O6MH 1KJMB 4Y1TA 1X4ZA 1YEKL 3OZ9L 4L3EA 4U2ZA 5D55A 3U4BH 2EDTA 2KL6A 1KPRA 2W0FB 4UB0L 3RL2A 1T1XA 5IQOA 1KULA 4Y5XC 3QZWG 3FB8A 4U0RB 1VCAA 3U36B 1E8WA 2R2EA 2GPZA 3ZDZF 4PRID 3ARFD 1C1EH 5KTEL 1UA6L 3SDCD 2O4EA 4ZTEA 2ZOLB 4O02H 3MRMB 2NY3B 2IG2H 4X9BA 1BAWA 3MV9E 1UM4L 4NKQB 4I3SL 1VHPA 3KPOB 1NEUA 5EU4B 5GIRB 5I5IA 3SKJL 3PPEA 5ANME 4C57C 1H8SA 4WZ9A 1YEIH 3AREA 5IK3A 4QEGA 2Q3ZA 3H2WA 1JZ2A 3T0DA 1I9RL 4TVPE 4YDJB 4ZQTA 3V55A 2HP4A 2O6PA 1SXBA 1BMGA 1X5FA 1K6QH 2VZ1A 2DQEL 4R96B 1ZHNA 5CSZA 3KJ4C 2WUCL 3ARPA 1BM3H 4OIIL 2VZ3A 4ONHA 1AR1B 4XBGA 1HAUA 3QIBA 4OLXL 3HG5A 2OR8A 2GHZA 3TPKA 4GSDH 4W81A 1G6VK 1MW3A 1SOQA 4M29A 4J3OD 5F88A 3LXCA 3UTSD 3WIFA 1XF4B 4UBDC 5JPNA 3VWJA 4Y5VA 4U1IB 1XH3A 2QT6A 3IMRA 5I24A 1BBDH 1D5MA 4B27A 3BRFA 1KJ2L 2X4SB 1A65A 2ATPA 4D94A 2DWDB 1OY3B 1AXSA 2XBZA 2ZXGA 4DGVL 1QVOA 4YEFA 4HXAH 4MJ6B 3QEGL 4X6CA 1UKQA 3K6NA 3BAKA 2ZWLT 4MZ2A 5DQ9A 3U4EB 4ZUSA 4OQTL 7FABH 5IQ9A 5KBDA 3L5WB 1P69B 3INUH 3JZ7A 5J11C 4W68A 5LQBH 5F1NB 5GGRA 1GC1H 3GMLB 2K3HA 1HIMH 4NO2A 4DESA 3FQRB 3SKMA 2VISB 5HJ3B 1O75A 2MTPA 2PETA 3AY2A 1OD7A 2ISDA 2F5BL 4CMMA 3MA9L 3MV8E 4G1EA 3ZVVA 3ULVC 5F9WB 1J12A 2BSSA 5ICZB 2GC4C 5BVPH 3PV6B 2Y7LA 4DQOH 1XGRB 4ALAH 4JO4L 1QO3A 2CCVA 4Z0BH 1QSVA 1TKWA 5EORL 3SKUD 4JFHE 4EI0A 1XGYL 2PCFB 4XPBH 2VCOA 5E6ZA 3ESMA 2HN7A 1R33A 5JPMA 1KT2B 3I02A 4IIQA 5SV3A 5FECA 2XTJE 3HS8A 2PPEA 3APCA 3GI9L 4YPJA 2FL5B 2P42B 3V0VB 1RULL 5DTFA 4HUXB 4PJGF 5AW9B 1CK0L 1FVCA 2X88A 2XV2A 5SWSA 2CH8A 4K73A 4M6AA 4DIXA 1RURH 3IDXH 1Q0EA 1LO5A 1AQMA 3RG1C 5F8RC 4TQIA 1QLFB 1Y7VA 1SEQL 4GS7C 5DVLA 1XIWD 2CA4A 3LOWA 5EG6C 2PP7A 3CK0H 1IKNC 5JR1L 1JN6A 1RPQA 3RIAF 2BJML 4E5XG 2XXFA 5TQ2H 2F53D 1QTSA 4FP8H 4ANWA 3QHFL 4K71B 3M45A 3IMVA 1LP9B 4GKLA 4ENED 4JRYB 1OSZB 5DD1L 4AVHA 5K1NA 5FX3A 4O58L 2OYPA 1T7YA 1E0OB 4Q58C 1A0QH 4LCVA 2K4AA 2J1WA 4EDWH 2CKBA 2B5IB 3OKLA 3NIDB 1F11B 4ZZKA 5MENE 2JH2A 3JWOH 2HG0A 3SPIA 2BS9A 1MCBA 1L9MA 1L0PA 3FF8A 3GMMA 4PJBF 4AGMA 1IKOP 4KZDH 5SX5H 3OKDA 4PJ5A 5JW3H 3CFBB 2EIEA 1AYOA 2QDVA 4HWZB 1E8ZA 4N2DA 3UMTA 4I4WA 3ZHLA 3C6LC 1A14H 2Z3FA 3FB6B 4N6RB 2P5EA 3OPZH 4AJ0A 2HLEB 1CVSC 1FNGB 3CAFA 1HSAB 3IRZA 4L4TD 4UTBH 2JKXA 2KHAA 1RIHH 4HWEL 3BP4B 1NMAH 1NGPH 4HKXB 1OPGL 1YNTF 1NIDA 4NQQA 4MA8H 1FE8L 4QY8B 5FF6B 3JV5A 1P4IL 2Y36H 3WSQL 2HKFH 1XT5A 2HLAA 1HESA 3WTXA 2MNUA 1EZUA 1UQSA 1QSEA 4JFUA 3CH8A 1UZ6E 4A2MA 3L3DA 1VERA 3T4AB 2FEJA 5ITFA 1E30A 2AC0A 4HUWA 3HC2A 3J7HA 4BFBD 1IQWL 3KBPA 3GM8A 2NNAA 4GBXC 4Z8FL 2H9GB 1PCXA 2DWXA 4OF5A 5HJBA 1MOEA 2B14A 3HE7D 4I8DA 3BKCL 5E5MB 4F57H 4MCZA 5EEUA 2PYEE 1S7XB 2WXRA 9PCYA 4ZXBC 5JHAA 1AG6A 3U9UB 1KLGA 5GSVB 1R3KA 4NIKB 1Y6MR 4Z77B 4PB9H 3ZDZB 1D6VH 1S5IH 1N5YL 5AQ0A 1JWSA 3VFRA 1L6XA 3I9IA 2CBPA 3CIQA 1TFHA 3L5XH 4JM4L 4U1LB 5DFWH 4NZTH 5EIVA 5BS0A 2W8CA 1GYWA 3X13A 1U8PB 3C60A 7TAAA 1PFOA 2EECA 2YRPA 1A4JA 3ULUC 5TFSH 1I1YA 1PZ5A 4GI6A 4OKDA 3HHSA 2IPKA 2IOIA 4YHOL 4IKNA 1O5DT 1RFDH 2MKLC 3BP7B 2ZWNA 1Q9OA 2QHRL 1LWJA 2W0PA 4I2XA 4ZOAA 2DYSB 3NAAH 2F08A 2KC0A 5DFAA 4HOZA 2C26A 4MSWB 3U0TA 4F7TA 5AALA 1FRGH 2V3DA 4AYMC 4PJHE 5B1BB 4NM4H 1XXDC 3GXFA 4M8QA 2X10A 3KWTA 2AMUA 3PREA 1T0MA 1BVKB 2IH3B 1KPVA 3BPLC 4UDTA 3V4VB 2Y9RT 3GDCA 4JVWA 5I0ZA 3MCG1 3TYFA 1QKZH 1KB3A 1THCA 2QV4A 4YFEA 3NCBB 4G7SB 1AGEA 4CVZB 1MCJA 2UXTA 3Q2VA 4NWUH 4I0PD 1RMFH 4KKCC 4L4VB 1HWWA 1IAKA 5ISZA 3U83A 4G6AD 1QWUA 4QRTB 2M26A 3NSXA 1GPOH 1RK0A 3EBHA 4XRCB 2F1BA 4ORGB 3VXUE 1CDYA 1NAMB 1EEYA 3EYVA 4MAYC 2JKNA 4HJTA 3ZK0A 1E4KA 3IJEB 4M4RB 4RWYH 4K3DH 2AKRA 4YSAA 3WNLA 4S1DC 5IMKB 2AQ1A 5HYJA 2AW2A 3T2OA 4W6XB 1VKXA 3TWCL 3GUTB 2ZCZA 4WI8A 5EBGA 3AM8C 1R3IH 2Z8RA 3BUIA 2VMEA 3QUGA 4WFGE 3D2TA 1A02N 1TJIH 2R7EB 3VYPA 4HC1A 4YN3A 1N6UA 4HMEA 2BVUA 4Y19D 2QPUA 3PL6C 3PU7A 5SWQA 1URIA 2X4OB 5E08H 4YGVB 4A37A 1NBYB 3BQUA 3VD4A 4YL9A 2OP4L 5CR8A 1FH2A 4I1PA 5C09B 3RY5A 4EQ3A 5EB9A 4ISVA 1GSKA 3MRPB 4JZJB 4Y4KC 2O1AA 3PNWA 3DUSA 1EAPA 3QZLA 2Z31B 4PJGB 4QKXB 1BWWA 4N0UB 1LEKB 4FLQA 3ARBC 2KDYA 5GSRA 3FT9A 3KCWA 3RDTC 3SE9H 4YHLL 1KN2H 3UPRB 1N0LB 3TP4A 3HNSL 3UC0H 3LQAC 1TETL 4X6CF 3FN0H 1L0XA 3MRQB 3D18A 3L3JB 5TK4A 3CC1A 4MAUH 5BZZA 4L05A 3HAEA 1XCQA 4HHAA 1ZMYA 4RIRA 4ZUVA 1JNHA 4WO4B 2ZPKH 3KWWB 4FI6A 4ABVA 2Y2TA 4PJDA 2MPAH 2FDBP 1DLHB 1XZ0B 2TAAA 1E7VA 1QABA 5IVXF 4YSUA 3ZTJH 4FQCL 1KELH 1U30A 5IQ7H 1A4AA 3MLRH 2YD7A 1SF3A 2YPLE 1XB6A 2NXZC 1IAOA 2YLHA 1C16A 3GGWA 3FJTA 2CLZB 4JJOA 2XY1A 2B1HH 2BP8B 2OX5B 3U9PL 1G9MC 1A3RL 4KDWA 4F9LA 1OOAA 4EN2A 1E65A 3D39B 1V8HA 1J8HD 4N2HA 2GT9A 1JGDA 3OKKB 2XQ0A 1A4KA 1FVEA 2L8AA 4D0DB 5IMOB 4X0KA 4C56D 1M3JA 1DL7L 5F3FA 2CM6A 3TEYA 1IJNA 1CFVL 1NEZA 1GIGL 4FQJH 2ZUQC 4TRPH 4QO1B 4DCQA 1S78D 4PPTA 1E9OA 3EH3B 1IVTA 1M6OB 1UUSA 3TU6A 1E28A 5L88L 3MBWB 4F8PA 3MA7B 1YNTB 3D7PA 5F1OB 1XZWA 4JEGB 1I8MB 1OAQL 3CH1B 3ZTNH 2HRPL 1JGVL 4X4ME 5GGQH 1ADQH 1BFOA 3QC5X 2NMSA 2FGWL 4MNGE 5E8OA 3TBWB 3PQYB 4JM0A 5TTRA 3EFFA 1WBXB 5AWNH 1I8IA 3VXPA 4MA1B 1RJLA 1ED3A 4LIQH 4J1UA 1EEQA 3UZVB 1PKQE 3CHQA 3OAUL 5LXGH 1ZJBA 2G0LA 1PAMA 2JCWA 1O9ZA 2WUBL 1A5FH 3TA3A 5FEBA 1X4XA 1B2WH 2RCSH 1CLZL 4P2OA 2XT1B 1FLTX 3ECVA 4MXWH 5I5MA 1CZ8L 5GZNC 2HJFB 4NKDB 4F8OA 3T0EC 3IN2A 4WDIA 2F74B 4G8EB 4BFEA 2VDNL 4X5LA 3CBRA 5FYLH 2EABA 2N0KA 3CMOL 3RGHA 2EACA 1MCNA 1M57B 2B16A 2KLTA 4Y2DD 2V2TA 4IRJB 2EDFA 3B7YA 4FXKC 5FS5A 1L7IL 4FL4B 3L3OA 1G7MA 1P9MA 4GSQA 5JQHC 5IHUH 2E7MA 1PZDA 1IGJB 2WYTA 2C3GA 2P5WE 4B6ZA 1L0QA 2FT6A 1MWAB 1MCHA 3I84A 4HCFA 4Q56A 3ALPA 1JGEB 3QIUD 1U8HA 4HWUA 4AG4L 3TASA 1S7VA 5IB3A 1FFPA 4H8HA 2DIBA 4EE2A 2BVQB 1V3KA 2Y07L 3QS2A 4M56A 4BM7A 5I9QC 3J27A 4NN7C 2YRZA 4M7LH 4PJXB 4XNMA 5ESAB 1AG0A 2VQTA 5C07B 1J1OL 3GIZH 3B9KC 2ID5A 4JQIL 5H2BA 3STZB 1QLEL 4NQXA 4X6EB 2I60H 3ZL2A 4L3EB 2MCMA 4ZO8A 5IFAL 5AENA 1KPRB 1AFVH 1OAUH 3RL2B 1T1XB 4E9RA 4CADA 1KCRL 2EYRA 5ERWA 4PBWD 3OKYA 4JRXE 3FB8B 2X9XA 4LCIH 4PFEA 1YJDH 2R2EB 3PWPE 5E2UH 3NJNA 1QFUL 3KVQA 4DO6A 5I1KH 3O0RH 4RZCA 3P3YA 3M1OA 4A2GA 1XF1A 2Q5BA 1KGJA 2L7UA 1Z3GH 1Q8MA 3UTQB 4W9EC 2Z0UA 1GCYA 5HDBE 1U92B 1S7TA 5HGDA 4LGSB 2J72A 2ATKA 2OMWB 4ECNA 2NY5H 3HI1A 3AREB 4UNTA 5IK3B 1J87A 1T2JA 4AWJC 4DEPB 2EE3A 5L2JA 1T1ZA 5TE4H 3H42L 4LIQE 4X6DE 5I1JL 4IIZA 1YAIA 4B5ZA 5HPMA 1LWHA 5I5JA 3AROA 2YBGA 2WXHA 4G8GD 1KWKA 2EDMA 1KBVA 1ZHNB 2WCPA 5CSZB 2V17L 2CCWA 2EUVA 3ARVA 1AOZA 4ONHB 5JXED 1QRKA 2VDOL 4XBGB 4OQTA 3QIBB 4OD3H 3AWFA 4I18C 1F4WH 1KGCE 4XNUL 1XDTT 4IKJA 3NTCL 1HCZA 1ZIBA 1A6VL 4B9IA 5FYLE 5F88B 3SDAD 1JZGA 5JPNB 3VWJB 4Y5VB 1MCLA 4PG2C 1KIQA 5T3XD 1XH3B 1F42A 3AB0C 3H53A 1D5MB 2CSPA 3KR3L 3R4DA 4JRLA 2XETA 4LCWA 4AQOA 4ELME 1AXSB 1PDKA 1QVOB 4WFHD 1TJGL 3HZMA 2BHFA 3QQXA 1BQSA 5DQ9B 4ZUSB 4EN3D 1AHMA 4NT6A 3G3LA 4HXBH 5IQ9B 3FTGA 3UP1A 2G75A 4XOEA 5I6XC 4D7PA 4WWKA 1E43A 2LLLA 4GAFB 4Z95H 5GRJL 3FHQA 1BVNT 1PYWB 2QKIC 1OGAA 5TF0A 4PJEF 3SKMB 4YZFE 4R83A 1YLBB 4TTDD 1DVUA 2FBJL 2WXQA 3STLB 4CMMB 4G1EB 3K6FA 1MRDL 3FU9A 3WELA 3ZXAC 1IC4L 4AYEC 1KEML 4EIZC 3N50A 2QADC 2R4SH 4M3HA 4Q52A 3NJVA 1VFMA 3TEWA 1U8OA 4APQC 2V2XA 1QO3B 2VC2H 5LXVA 1MUJA 2WB7A 1TKWB 3ZHDA 1PLGH 4XTRD 4M4PA 2X9YA 2HN7B 5JPMB 4IIQB 3I02B 5DJXA 5FECB 1SXAA 3DBSA 1B0RA 4OM0L 5E1QA 1ESOA 3ESOA 2JV6A 4XCFH 1XBDA 3S96A 5IVNA 1RSYA 4M48H 1F02I 5DTFB 4Z7AA 1FVCB 4AV5A 1IIIA 1HAWA 5SWSB 3A22A 1HX0A 1JZEA 3ZSSA 4HPOH 1LO5B 5DD5H 2IAMC 3AQYA 3O45A 4P2QD 3BUYA 4QXGL 4AYID 3IS1X 3BE1L 1UD8A 2WTRA 3IXAA 5CJXC 5DT1H 4QWWC 4HLEA 1FAIL 1H0DA 4LNRA 2EEXA 3DXAD 5DMGD 5AZEH 4IMLA 4NRYA 2B7DT 4U1MA 4U7KA 4WENB 4B7IA 5I71B 1NGXA 3UTPE 1RLWA 2B20A 4B9JA 5JXAL 5FKAA 4PJDF 2R4RH 2V9QA 1LO3L 5ESQA 2X1XR 3ZQXA 4BUQA 1MW0A 2DICA 2AZAA 2XG5A 4Y9FA 2CKBB 4UT9L 2EEBA 1JNLH 3L1OL 2FUTA 3N85H 3RVUC 5EA0L 4WO0A 3F01A 1LMKA 2E86A 4S1RL 3DBXB 4OM1L 4AEHH 5D1QC 2P8MA 1FORL 3GMMB 2OZ4H 2WD0A 3OKDB 4PJ5B 5EH1A 4UQCA 2EUZA 1VRSA 2O6EA 2R51A 3D69A 5AOMA 3H3PH 4I4WB 2O30A 2K9UA 2VLLA 4KTYA 4RQQB 2ERJC 2P5EB 4FKKA 4B60A 1I31A 1GZPA 4KVCH 4W4OA 1DO6A 2B39A 2IC2A 4WEMB 3U30C 1AZNA 3QCTH 1WFTA 3VMPA 3W0WE 3HKZA 4M7KL 2CLRA 5LGJA 2CG9X 2PTVA 4UQ9A 4P59L 3VH8G 4FI8A 3TJEL 3QDMA 4KV5F 2HYMA 4U1JB 4M8RA 1INDH 1KBWA 4EZLA 3QZWA 3ZDYE 2Q7NA 2HLAB 4BIKA 4JW3A 5GGUA 4WTQA 3WIHH 1CE1L 4J3OH 1UQSB 1QSEB 1GS8A 5FGSA 1H19A 4AUUA 5F9JA 4AIZA 4U3SB 1FPTL 3L3DB 4JFSA 5F0MB 5ITFB 2ARJQ 2WXIA 1JFQH 2NNAB 1UXSB 2AMGA 1I7UA 3D07A 5FKPA 5D8JH 3QQDA 4JZOA 4O4YL 4MCZB 4N25A 2BSRA 2XQYK 2YFOA 1SJEA 4OAWA 3G6JE 3LAFA 4GXUN 4OZIE 3KHQA 2KI6A 1KLGB 1R19A 3HW7A 4OZFG 1KBPA 3DIVA 3HHMA 2WY3B 4GIPD 1R3KB 4NGHL 2HT2C 1ML0A 3FTYA 3VI3E 1X9LA 3B2UC 2RQEA 1XX9C 3D4GA 1JWSB 3VFRB 4CC0A 2YGPA 4XNQA 4Z7NE 2QMJA 2MQ3A 3GKZA 1F1AA 5BS0B 1C5BH 3X13B 3C60B 1MNUL 1F4XH 1PKOA 4FFVD 4XO8A 3E3QE 1O0VA 1MJ7H 2CXGA 1A6UL 3O6FA 1A4JB 2J8UE 1PZ5B 1BAFL 2IPKB 2DEYX 2OSLA 2VT0A 3HHSB 4HWNA 3GO1L 4HK0A 3WIAA 1Q9OB 1AY1L 2YEQA 4I2XB 4WAFA 3OKEA 3PF2A 4PRIE 5EC1A 5EU3A 5I5RA 5D72H 5MEPA 3L4TA 3A6BL 3U0TB 3SZKC 3BMWA 3MRCA 5KSBE 4F7TB 4KAQL 3FCUB 1P7HL 4NNPH 4OLZH 4JKWA 4AQAA 4JFEA 1TZHA 3KPPA 3H55A 1F3RB 4H8WL 4UQ3B 1SMAA 3SOTA 3BWZA 4M8QB 1N70A 2ZAGA 3DDGA 3IE9A 1N67A 4S11A 5CU9A 5TH2A 3RI5K 3SOBH 4YDKH 2YN5A 4UDTB 3BAEH 1ZK9A 1A9VA 1AD9A 3TN0C 2E46A 3Q06A 2D7NA 1ZPUA 3TYFB 2I9TA 4IBWA 1K85A 1HE8A 1IGMH 1AGEB 4PWFA 2W9DL 3QUZC 4B95C 1LM8V 2VDRB 1T1YA 1CLYH 2BW4A 1IAKB 1I1AC 5ISZB 4S10A 3ZE0E 3OHXC 5FYJD 1NUDA 1VIWA 1RK0B 4HISA 2P46B 1JS4A 2A83A 2FJHA 3LS5H 5SX5K 4R84A 3S8GB 1IT9L 4LVNC 1EEYB 1EERB 3EYVB 5DC2A 4M93C 2RD0A 3D05A 3EOTL 5DO8A 2B0SH 1SJMA 4JHVA 3NJGA 3L48A 4ZO9A 1JPTH 3UTSE 4XC1H 1BEYH 5KVDE 5FYKD 2AKRB 5IQNA 2ZSVA 5HHVL 1HWHB 3IDNA 3VFTA 4FAAB 3CZJA 1NICA 2BDNH 5HYJB 3FAWA 4M7JL 1VKXB 5J57B 1TQBC 4OJFL 1R9FA 1CG9B 5L9DL 4HS3A 2YLKA 3ZGIA 3GJFK 2GTWA 1MFEL 4DTGL 4B9GA 5E51A 3TVMA 2VUYA 3TBSB 4RISH 1MHCB 4NNYA 5SWQB 2XYBA 4D0CA 4UM9A 1YEDA 5BUPA 4E5XA 1HZKA 3LXUX 2D9CA 3NUKA 3BQUB 4AYSA 2YOCA 1WZ1L 3VRJB 1DQDH 3CVCA 1Q90A 3WJMA 4ISVB 4ACPA 4RAHA 1SYVA 4U3CA 4J4PD 4U6HA 3PNWB 3DUSB 1EAPB 4UANA 3MRNA 2P5PA 3T0XA 3DARA 5E8DL 1OARL 5GSRB 3RVXD 3T4YA 5J3HD 4F5CE 1OOWA 5IEHA 1F5WA 1CDBA 2XRAH 2ROYA 3D18B 5HHPA 1BMWA 2PP9A 1FCGA 4P9HL 3E7JA 1WH0A 3HAEB 2O5YL 1R3HB 1XCQB 3Q48A 4HHAB 4JM2A 3NA4A 2W38A 2H2SC 1LMIA 2FQEA 3P0YL 3NOIA 4ZUVB 3T77A 1JD7A 4J3XA 1JNHB 3DJRA 2VJ8A 3GHBL 4L3FA 1U3HA 4PJDB 3MV7D 1CD8A 4KXZI 4XO3A 4DGIH 5EWIL 1IGYA 4JVUA 2LTQB 1KPUA 3MUHL 1MI5D 2X9ZA 1FFOA 2OA9A 5J8OA 3WBDA 1ODAA 4MCNA 2ZNWA 3O11A 4NHCH 4WSGA 4JFVA 4BCYA 3I2CL 3AS3A 4KUZL 1IAOB 3EGSA 1C16B 1MCQA 3GGWB 5I19L 3TT3H 2ODHA 4XOBA 4Y4HD 3EGXB 2V7HB 4YMPA 4HSAC 2Z1PA 4OZGE 3OSKA 4FLHA 2F53E 2ZICA 2MNJB 3EJQA 3NSDA 4MQ7A 1AANA 1FN4A 2GT9B 1JGDB 5LGYA 1A4KB 1FVEB 4N5UA 4OCWH 3T6QC 4D9LH 1MW1A 4X0KB 2AXWA 4LSPL 1GGTA 4JDZA 3VFGL 2NY0B 4CVUA 3F2LA 3JBG7 3C6EA 5EF2A 4MB1A 4IHOB 1DVFC 2VYRE 1NEZB 1ID2A 3C09B 5C0GA 4JFPA 1E9OB 2J4WL 1E28B 1B90A 4AQ1C 2ZYRA 1PZ2A 2F7RA 2LHAA 4FQXA 5HTSA 5BW7C 5C0AE 3G5WA 2NZ9D 4KJWD 4E9QA 4O51A 3KYKH 3GJEA 4K5OA 1EQWA 1BFOB 2OMYA 2ZG1A 3IPFA 5E8OB 4M5YL 3EFFB 5B39G 5SX4H 1I8IB 3VXPB 1YPZA 3DI3B 2EDJA 2OJZL 1RJLB 3LY6A 1U4FA 1ED3B 1R24A 4EIGB 4J1UB 3CXHK 4KKLD 4FADA 1TYJA 2CUIA 1T0OA 3CFQA 4FQ2H 1G1CA 5ACZB 2C1OA 3TA3B 3ET9F 1CTNA 3TZVC 5L8KB 4P2OB 3AS0A 4ZUWB 2W92A 4HIXH 1EZVX 1UT9A 5B7EA 3CZSA 4I88A 2CUHA 5EZLA 5I2IA 3VSVA 4WDIB 3S2AA 5FGCB 2OXGA 4URTB 1NC2D 2BC4B 3F6LA 1S7WA 3DIFA 3OL2A 4K8RL 4X7CC 4ZNEE 4JPWL 1YYLL 4GO6B 4BV1A 1G7MB 4F7PA 4JQIA 3SGEH 2ZAHA 4OGYH 3DVFA 4WK4B 2P24A 2AXGA 3OX8A 1UZ6F 2QQLL 1GS6X 5E7BA 2R69H 4JKLA 2BXYA 2XZQH 1H3UA 4JBSA 4M5ZH 2C9AA 3HHRB 1M1XA 1Z7JA 1U8HB 3RZCC 5IB3B 2K6ZA 1AGFA 5CGYC 4H5SA 15C8H 5I8EA 1XCTA 3OTTA 4HG4K 3F5WA 3S37X 3SEPA 3MLSH 4BKLA 1M71A 2JIXA 2Q7AA 5L6YH 1B4LA 4APQD 1UB5A 4PP1D 5H2BB 4XNXH 4NKMA 1MHEA 4NQXB 4ZFGH 5GGSY 4Y1AD 3QNXA 3MPCA 5KSAC 2CIIA 3DX9B 1HOCB 4PJ8C 1NCCL 1PLCA 2X3CA 4OZHF 4YE4L 3JYCA 3UO1L 4CADB 3ABLB 2EYRB 5ERWB 9CGTA 2CJTA 3I6SA 4MJHA 4RA0C 2XA3A 1EFXD 5BRZD 4LSSL 4FABL 4K5LA 5ICUA 3R1GL 4UQDA 1KLFA 4RZCB 2C4FT 5LGKA 3APFA 3BW9A 12E8L 4BQ9A 4R4BA 2EIBA 5BXFA 5IGXH 1S7TB 4UQAA 3KJ6L 1S9XA 2YPVH 5GGTH 2ATKB 3L4VA 2A6IA 3ZKNC 3HI1B 3VD9A 2YO3A 3WFBL 2F61A 1FDLH 1SOKA 2MWCA 5L2JB 4MCYA 1T1ZB 2EDNA 2IDTA 4PJHF 5DS2A 4OFVA 1OE1A 1TLKA 3KYAA 5HPMB 4IOSD 5FOJA 1E5ZA 4KX8A 4PVNA 3HVDA 2X09A 3UJJL 1T7XA 4A66A 2UUDH 2ZUWA 4JCMA 4JFFA 5DMIL 1NLDH 5IR1A 3P4LA 4LASL 3NZHL 1TMQA 2Q8AH 3RJQB 4LSUH 3K6SA 3KLAA 1KXTA 1J05B 1KN4H 1NMCB 4LDLB 3BC9A 5HYQA 4BFGA 3GBNL 4JZNA 1DBBH 2GAZA 3MV11 4PJ6A 3UCQA 3AGVA 1IM3A 1IAIM 4DKFL 5T3ZD 1DANU 1PDKB 2V5TA 3MNVA 1KYDA 1V3JA 1N2RA 1T20A 2BVOB 2BY3A 2EXWC 2Y4SA 3HZMB 4X7SL 5E2TL 5AAMA 3RWDA 3FHAA 3HG4A 1C5CH 4JO3L 2AJSH 4NT6B 2FR4B 2QZQA 3FTGB 4Y19E 2G75B 3KEHA 4WWKB 3L17A 4OJDH 2OM5A 1RH8A 1LQBC 4KRMB 4WRLA 2P26A 1OGAB 2FWOA 2VLJD 4M5SA 1HH9B 5JA8B 4YAQA 5IBLD 1F97A 1NBVL 2OL3H 1F4YH 3X17A 1SLWA 1RQ5A 5TE6L 2E47A 4Y4FA 3WTSA 5EU6A 5CEXA 4H44C 2FD6H 4ANXA 1V7NL 3B9VA 1U8OB 3T3MF 2V2XB 4YK4B 2R0KL 1MUJB 3SYPA 1EHAA 1KIUA 1T4WA 3PYCA 3QORC 5CMAA 3WJLA 4P23C 5IVZA 4DGIL 4OTXL 4ESKA 3VACA 2G2RA 2BPBA 1G6RL 4JK0D 2VLME 3S96B 5D4JA 5LWYH 1M7DA 1UWFA 4N8PA 3M7OA 4JHZA 3GQFA 3ZDXE 3CUPB 4J8RA 2J2ZA 4LEXH 5HVHC 5J0BA 4UT9A 3O45B 3BUBA 3BUYB 3SDXE 2OW6A 2D0FA 5KVGH 4BRVA 2X1WL 5GRUH 3TO2A 2WTRB 3IXAB 3B9EA 4TOYL 5EU7C 1JYXA 1OQOA 4JG1H 1H0DB 1QFHA 4LNRB 1DBJH 4MRCA 1DJGA 2UX6A 4AL8C 2J44A 4IMLB 4NRYB 1DFBL 2HX8A 2ICEC 4N22A 4U1MB 1ZLWH 1NGXB 3RFZC 1J8HE 5CLZA 5FKAB 1INEL 4Y9BA 4P5MA 3EZ8A 4IHBA 5IT2L 4Q9RH 2CZNA 3DMMD 3KWUA 5ESQB 4HMDA 3QIWC 4MKTA 3FN9A 4PY8I 4C56E 2N1TE 3ZHFA 2BRRL 1NC4A 4JFDD 5EUOA 4EDXA 4ZX3A 1BZ7A 2XG5B 1L9SA 3PJSB 1A3ZA 4YQXH 1I1FA 1A7RL 1X9UA 2SEBB 1BAGA 4R5XA 2MOGA 5DYFA 2P8MB 3G6DH 2AITA 2BWDA 2VITA 3SDDD 4DFIA 4RGNC 2G3XA 2DPKA 1BVNP 2ZUTA 4CU7A 4C58B 3K2UH 3D69B 3RTQA 1NFIA 2V5RA 2XPYA 2UWEE 3VGFA 1TEYA 4UTAL 2VLLB 4U6VL 3MHZA 2BW5A 1UM6H 3QDGA 5JO5A 3WLWD 4BFKA 2PW1A 5HJGA 1KGXA 4FG6D 3LVEA 1NPJA 3E9TA 3ZYIA 4D9QD 1SOSA 3M1BA 4HIJA 1OK0A 2OMUA 2CLRB 3VD7A 4LMQE 5KUKA 3WJJA 4LOVA 4IRZH 1RZJL 1WK0A 3OB8A 2AK4B 4EF3A 4EKXA 1FO0L 3FU7A 4JY5H 3G5ZA 3QZWB 1F86A 2APXA 1SBSL 5GGUB 4P48A 3NMEA 4U1KA 4TQHA 2HX9A 3WTTA 4PW4A 3WLBA 4AIZB 1YPZF 5F9JB 4RMVA 3ISRA 2R0WH 4H8QA 4HMCA 5T3XH 1QBML 1TFPA 2FYVA 2VQ4A 4WI6A 2NXYC 4JO2H 1TTRA 3QQDB 2K78A 3NRQA 4JZOB 5A7BA 2BSRB 2YMXH 2O5ZL 1SJEB 2XA8H 4OAWB 2BVPA 4B9PA 4WV1C 2MEJB 5D1XA 2EO9A 2QGCA 3NIFE 1XCXA 2AEQL 4JG0H 5CHNB 1JXFA 1T5XA 1NLBL 4V1DD 4NC1C 1MIEL 1CU4L 1Q72L 3FULA 3VFSB 4G7VH 3KBHE 5KVGE 5F9DC 2PPAA 1H9VA 5B22A 3SPCA 4XNQB 2AQ2A 1T6BX 3MRBA 2WJ7A 3N40P 4YDMA 3HVNA 4LGPB 3R06B 2YKKA 2R15A 4BWWA 1HQ4A 3B6SA 1S3RA 2PMZA 3O6FB 1YUHA 4U1GC 2ZCHH 3FUJA 2DWYA 1DBKH 2QVTA 3IRPX 1AIFA 4BFRA 4I0KA 3ZDWA 2VR3A 2Y06H 1FV1A 1WWAX 1DLFL 3AUWB 3OKEB 5EU3B 2HFEA 3FT3B 3P40A 4FX5A 3K5SA 3MRCB 2BS71 1BLNA 2YD0A 4I7ZC 3KDMA 5E2WH 3ZIYA 2JXMB 2WVVA 4AQAB 1TZHB 3KPPB 4MJID 4KX9A 2BFGA 1TMCB 2FBOJ 5TH2B 1ZGLP 5BV7C 5HVFB 3O6LH 2WGNB 2VXVH 1AD9B 4HJGA 3DVIA 1EZVY 2DQGH 5FR3A 1OKEA 4KMLB 5AKSA 4PBDA 3RGBA 2HFGL 4DW2H 2VDLL 2I9TB 4ZBJA 5J9PB 1TZIA 3QQ4A 3L2NA 3QNYA 1T1YB 4Z7QE 5KZCB 4G8GE 4HT1H 2DIEA 3S35X 1BOGB 1P4LA 5B3JF 2C3VA 4QAMB 3HG1E 4Q0XL 2XIDA 5HYSG 4I1NB 4OSUH 2FJHB 4ZTPL 3X3GL 2EEFA 2EH8L 4Z7VF 4X6DF 4J3TA 4PW3A 3QEQA 1NWOA 3HC4H 1F0LA 1LE5A 2ZSVB 3IDNB 3VFTB 2AVGA 4YZWA 3CSGA 5E8PA 5T3XE 3V0AC 5D96C 3SDYL 3E2HC 1G94A 3KL5A 4HS3B 5ABZA 4OBSA 4P3DB 4TVPL 2HKHH 4RVBA 3X11A 1M2OA 1D7DA 1OCWL 4J28A 4HAGA 2FIKA 4Z0XA 3T3MB 3TVMB 3TC9A 2JJVA 4NNYB 2DI9A 2ED9A 1UCBH 1FIGH 4UM9B 1YEDB 4E5XB 3OF6A 1DUYA 3JYBA 3W5NA 1LNUA 3ETBF 2O6FA 4ZMXA 5HY9A 1RPKA 3D4ZA 4LZKA 1AI1L 5LG1A 1G1OA 4R6UA 3WJMB 1SYVB 3WUWA 2Z9TA 3AY4A 5DFTA 3IKKA 4GKSA 1MFBH 3MRNB 1DO5A 4YDVA 3DPBA 4W9JC 3EJJX 4CSPA 3T4YB 4S0HA 1LXMA 3OLDA 1NAKL 4OF0A 4YZFF 5IEHB 1GHFL 1I9JH 2IADA 5HHPB 3V5HB 4XXWC 4PRAA 5LCVL 3MODL 3BUDA 3AMLA 3ROOA 2ZAIA 1YN6A 3S35H 1E4HA 4JM2B 4TNFA 3H9ZA 5I73B 1BG9A 4OV5A 3TYGL 4PWKA 3T77B 1LVEA 4FC3E 3FQ4A 4HZAA 4PTUA 5ALCL 1DBAH 1SDAB 5EIQA 1U3HB 4PGZA 4O5LH 3DOHA 3MXWH 3DVGA 1IGYB 2AXJA 3QRFM 2RFXA 5DHYA 1FFOB 3F7RA 2YZ8A 1ZPLA 2C7UA 2J8OA 3O11B 4P2QE 3T6ZA 4H25B 3EGSB 2X4UA 2R1XA 2FHBA 3OGCA 3VH8A 2ITCA 1IC0A 2Y24A 2ZOWA 2MCG1 4AGPA 3DXAE 5HP5A 1J0IA 1J0JA 3QUYC 4AW7A 5IJVA 1CUOA 3AITA 4RDQG 3ASNB 1W8OA 4MMYA 2BNQD 2VL5A 3WNJA 4MQ7B 1X5LA 3DGCR 5CIPH 5FHAH 2JKJA 4QRUA 3D52A 3U2JA 2EXSA 5TJWK 2NY6C 1AMXA 1OAYH 4ZFZA 4FNRA 2XWTA 5DVMA 5C0GB 1TQCC 5JLZA 3L4UA 5D2NC 2YARA 4HA1A 4XO5A 1GTFA 4ZMWA 1KZYA 4OGXH 2ZIDA 3AFLA 1NH6A 4FF9A 3BEVA 3M07A 4O51B 1ZVSA 3CCHA 3BD3A 3GJEB 4M61A 4BRJA 4OZFA 4HAKA 3VGBA 4WW2A 1ET8A 1NJ9A 4YUEH 1LJMA 3V6OA 3QFJA 4H20H 1YPZB 4N87A 5EUOF 1FL3B 4HLZH 2DQHH 4KJYA 3LZFH 1WZLA 2JB5H 1I9EA 2PCYA 2XBTA 5EBMA 4N86A 3L3HB 4MXVF 3VNZA 2R0LL 1FVDA 1WT5A 1GR7A 2I7OA 1R5VA 3TOPA 4K15A 5EZLB 4IMKC 5I2IB 4NQED 3CFEA 2H8PA 1I3VA 5DWUL 4HCRL 5F1IA 2OXGB 1D9KC 2EDOA 1D6EA 5FYKH 3CFJA 5C71A 3KXFD 4HUMB 1S7WB 2UVEA 5AYUH 3DIFB 1A8ZA 2B1AL 4YH6A 4XE5B 2ALAA 3ZDYF 4P5TC 4F7PB 1BZDA 1QLEB 3BLPX 1X5KA 3T3PE 4JGJA 3D85A 2GBVA 5LQBL 2OK0L 3UAJC 2XN9A 1UFGA 2A9NH 1VEMA 5IROC 5CEYA 5DJCA 5CP3H 4J6RH 3EBGA 3M46A 4Z7UE 4UI2A 1M1XB 4P2RA 1KDJA 2WLMA 2R8SH 4FRWA 1ZOXA 4H5SB 5I8EB 4A2EA 1XCTB 1PSKH 1XMEB 2WW8A 2H6UA 3B3BA 4G72B 3F5WB 1GGCL 2L4OA 3GB7A 4BKLB 1M71B 2JIXB 4KKPA 4JFOA 4XMUA 3SSGA 4ALAL 4OZIF 2FQDA 3A4AA 3O9WA 3BWSA 1UB5B 3MN8A 1WAAE 1Y1UA 4UV4L 4NKMB 2IJ0C 2BIIA 1MJ8L 3QNXB 4KGJA 4BYHA 4NOBA 2D7TL 5T1DH 5FO7A 3ZE2B 1J18A 4KTEH 4F7MA 3NDZE 3LPOA 3TPUA 2NY3D 4XX1E 4YOKA 1BJ1J 2VWEE 2WO2B 1BQKA 2AQQA 3QUXC 5BRQA 5JOPD 3MNMA 3DV6A 3AAZA 1KLFB 1JPSL 1RURL 3APDA 3IFNH 4GRLC 4XMZA 3U7YL 4NFDA 3BW9B 3WD5H 2VDOB 3WG7B 4R4BB 2AQNA 3NJHA 4K9JA 4XCYA 3VRLE 3ENEA 4ILDA 1S9XB 1NSNH 2OXHA 2A6IB 4O2CA 5KSBF 2WN2A 4JE4B 3DSFL 1NM9A 1U8KA 4OCRL 5C2UB 4FP8L 2B4CL 2XZAL 1AR1D 4XHJC 3ZLQC 3EOAA 1EX0A 2A4ZA 1A7PL 5ID1A 4Z3EA 4WI5A 5MP6H 4PJAE 3HFML 3WXWL 3FO0H 1H3WM 5EHFA 1KXQE 3TBTA 1OCRB 1ASQA 2KT6A 5J12B 1VZIA 2XHNA 4JFFB 1E4WH 5IR1B 4AVJA 4KZDL 4FZEH 1RLBA 2YD9A 4QF1A 2WO4A 3K6SB 4C55A 5FYKE 3KLAB 4LVHB 1KXTB 3K1DA 3SYCA 5C0DA 1GXEA 5D1ZC 5CGBA 1CGTA 3L9YA 5HYQB 1A14L 2ZWSA 4JZNB 2A9AA 2GAZB 4YLQT 1MXGA 5K9QI 2FUQA 4ODVH 1CGSL 2G60H 2E27L 1IEHA 3MNVB 1N2RB 1T20B 3RWDB 3ABMB 4M1GH 1RIHL 2WN3A 4MVBC 1RZPA 3BP6A 4ZX4A 2ITFA 3GMQA 3ILQD 4FXGC 4U7MA 1NCUA 3FB7A 5SV4A 4B7LA 4MA8L 4WI3A 1VFUA 3WTVA 2FWOB 5A3IC 1G6RA 4YAQB 4P46A 5LAPA 3N9GL 5EBWA 5F7WC 3T0EE 1IX2A 3DKHA 4HUUA 1YY9D 3DETD 5DHVA 4JHWH 4Y4FB 1IUZA 2J1ZA 5EU6B 5CEXB 4OVUA 1JNNH 5C8JA 2HMIC 2C1PA 5AVVB 4FNLL 4GSXA 2EIJB 1P4UA 1KIUB 1CTOA 3D0LA 4I85A 5CMAB 5J6GA 1BQ5A 4OCXL 4MKMA 1MFDH 4N0RA 35C8L 2G2RB 2X6VA 1WP6A 3BN9C 1V5JA 3EJYC 3MV7E 1QG3A 3FTSA 3LHAA 4NWTL 3NJMA 1M7DB 4ZAKC 5TE7L 1OT1A 4J2QA 5EF0A 2F9BT 4J8RB 2J2ZB 4HD5A 4PJ7A 1KFAH 3L5XL 4RMTA 4ZMNA 3RIFK 3TO2B 3LIUA 2Z65C 3WO4C 4JRYD 4JRFA 4KO6A 3KYOA 3UJTH 2A77L 4F7EA 4H2CA 1AZBA 1P7KA 5DD0H 2N7BA 2VDQH 2YD8A 4AUYA 1O6SA 4PLNC 3NJXA 4YC2C 5ESVA 4P5MB 4UTAA 3OC5A 5I75C 3NABH 5E6IC 2JSFA 2ICES 3WDIA 1FLRH 1NC4B 5EUOB 3V0WH 3W9EA 1WE5A 4EDXB 4NM8H 4G5ZL 1BZ7B 3VGDA 3RAJL 1I1FB 5AKTA 4AEIH 4NM4L 4DVBA 3MKKA 4L9LA 4TKWA 1JZ4A 4YXHL 4Q6IC 5IWLC 3D5OF 2A3TA 2VITB 2VXTL 3CFIC 2NYYC 1FO0A 3K72A 3CN1A 1IAIH 1JXKA 4N0CD 3PRZA 5HGHA 1NIBA 1RV6X 4NBZB 5CLTA 4CRPA 1XF3A 2C9QA 3QDGB 4KJQC 4R90H 5JO5B 4Z1PA 2PW1B 4CSTA 3BWAA 4BZ2H 3UZEA 2VB5A 1Q1JH 1R17A 3M1BB 3LXBA 4HIJB 4OV6F 5DJ0A 1NFDA 2V6HA 5CLXA 1VFAB 2OMUB 3OLEA 1OTUD 3WN5C 2E76C 2ZCKH 4KK8D 5FA3A 3QJOA 2PTUA 3FU7B 1OCCB 3BPCA 1UJTA 3G5ZB 4QTIL 5D2LE 4Y2DA 2APVA 4RWYL 4BDVA 4AV0A 4WW2F 1SMOA 3UTTE 4U1KB 4BXVA 3V0JA 4BKTC 3WFCL 2YGQA 3WLBB 3C8KA 1MQKH 3KPSB 2NUPA 4JDTL 4KK9C 1XAUA 3VSUA 1HJCA 1T2QH 2JF1A 2XV3A 3W2DL 4LSVL 3MGOA 5T3ZH 3LXAA 4OLYL 4GYBA 3UPCA 5BVJA 2BVPB 5D1XB 2OSWA 4L0ZA 2D8KA 5FUZL 1G4RA 2HFTA 3KLHC 4DF9A 3S5LA 1OZTG 1OPOA 1IBDA 1V3LA 3PAVA 4KRPC 1OM9A 4ODTH 1Z32X 4WIQA 1S3KL 4ZZFA 3CN0A 2F7OA 3MRBB 3FN0L 3G5VA 1TQVA 2YUXA 1DCEA 1HQ4B 2WYIA 4Y1AE 3B6SB 1QZ1A 1YUHB 1QZNA 1BFVL 3FN3A 3NBNA 1LO0L 1A8JH 4HJJH 1IRAY 4J39A 1S7UA 4H13C 1PW3A 1AIFB 1RUKH 2ZPKL 3S3BB 4I48A 1FV1B 4L37A 5HDLA 5BRZE 5C7XL 5ITBH 5LO7A 1FL5A 1H6EA 2HFEB 1ACYH 3C87A 4YHYC 3OAZH 1BLNB 4ONFH 3KDMB 4HX1A 4OIAA 5IQ7L 2YA1A 3LH8A 1YQ2A 2WYHA 3UTZA 1ZV5A 1DN0A 5E6UB 3FL7A 2ZOTA 3QBTB 4H8UA 2PABA 3AW5A 5DK3A 4L4VD 4XAKD 4L1DA 4OGAC 5B3SB 5CUSH 4EI6B 3IBEA 4LPVA 4M62H 3LD8B 4HW6A 1ACXA 1TZIB 4E42A 1DQMH 1MAMH 2WZ6A 3QQ4B 3QNYB 2EE9A 4TNWK 1HOEA 1U0QA 1Q0YL 1RZ7L 1RZFH 3MJ6A 2EE0A 4IBYA 1P4LB 4R4NC 2C3VB 5B8CA 5DS8A 1DCLA 5CEZD 4ZFFA 1QWNA 4TRPL 4PVMA 5F97E 1BHGA 4QRRE 1RZKH 2W1NA 3CHPA 3QEQB 5D1QE 3UERA 4BK8A 2X6CA 5HDOA 2GY7B 1EHXA 4AYBA 4XPGH 3VDCA 4R4FL 1MIMH 1LE5B 2FAUA 3L3GA 5AVRB 1JBJA 5E8PB 2ESVA 3BAIA 1JTTA 2FH8A 2X4RB 3ARGC 5B1CA 2E9WA 1NCJA 1CDGA 2C4XA 5T3ZE 4FJYA 3X11B 4CILA 2VO8A 3RGVA 1G0DA 2NZIA 4X0NA 2FIKB 4GB9A 4Z0XB 2VQ1A 3HZKA 5C09D 4TTGA 4Y8AA 3WYRA 4LLYB 3BOVA 2ENJA 2HT4C 2OJEA 4RFNB 2F54A 4QLWA 2Z31D 2ZXAA 2W07B 2Y5EA 3SHSA 3RUGE 1LNUB 5HY9B 2VLJE 4U49A 3T9WA 5IHBA 5IJKA 2WQVA 3OMIB 3WUWB 4PVBA 1SFDA 3FBKA 5CLWA 1FA4A 1K3IA 3OHMB 3Q8FA 4DH2A 4MMZA 4YDVB 3DPBB 4RGMC 2KZ1B 1AE6H 4S1SH 3VSTA 4FKHA 4PRHB 2R2BA 4WO4D 5HXMA 4W70A 5FGRA 2QV2A 2IADB 3STBA 2NR6A 4R5VA 4PRAB 4HKBA 4I3GA 3SJVA 3MFGB 3ROOB 1YN6B 4J3UA 1J5OL 3MV01 3HMXH 1OK8A 3P3UA 2BH0A 3RLSA 1KXVC 2CCLA 2VNCA 2ARJA 2ICCA 5KW9H 3S88H 4K3JL 2OMNA 4PWHA 3DVGB 4W6WB 1F90H 3NZ8A 2FK9A 5DHYB 3EHBC 1WUNT 2C7UB 4X7DC 3D39D 5EZPA 3CX5K 2AI0H 4XVUD 2X4UB 2R1XB 3VH8B 3JWDH 1JWUA 3OGCB 5ALBH 2YGVA 2AERT 2ITCB 5AW5B 1F00I 2I60L 3UP6A 3DTXA 3V4PH 5IJVB 2RBLA 5I1HL 4MMYB 2VL5B 2WVSA 4KUCF 4P07A 3SCMC 5DQJA 3C08L 5DJ8A 4MD0A 1IBFA 4GSRA 1YJDL 2LU4A 3O2WL 4JFDE 1IFGA 2R29H 3KLDA 4M43H 4NLAA 2CMRH 4ZFZB 5E6SB 5IKCA 5JLZB 4EIBA 4P4KA 3T1WA 4YXKL 3PQYD 2CR0A 5IOKA 2OAAA 3EBAA 2BY0A 3Q1SH 4M8UA 2YUWA 5IB1A 1UOVA 2CRIA 3BEVB 3CCHB 5J06A 4M61B 1XEUA 2GUYA 4MXQD 4OZFB 3TEXA 4WW2B 2DOCA 5TE4L 4HCRA 1YY8A 2I24N 3ZRCC 4J2XA 3NFNA 4FG0A 1ROWA 3D6GA 3QFJB 3RWEA 4OFIA 4AQ8C 1M56B 5J13C 3CG8A 5FM8A 2C3WA 4D9QE 1MHHA 3B37A 4KJYB 3TTYA 5I18L 4PWEA 3T2QA 5EBMB 1KV7A 4LAQH 4OD3L 4M1CC 1MQ8A 4H4NA 1FVDB 1KTDA 1IAMA 1PIGA 1R5VB 4AKPA 5D7LA 4JGNA 3QI9A 3NPZB 4IRJD 3SE8L 3CFEB 2H8PB 2XQYA 4XXCA 5F1IB 1KBKA 1D6EB 2XNAA 3CFJB 1ZS8A 3ARDA 1ROCA 2XICA 1HZHH 2ZTBA 3MBEA 1OVZA 5KYUA 5IFJA 3T5WA 4GQZA 2NY2C 1H3PL 5GS0D 1UD5A 5AFAA 2OMTA 1YEJH 4ZD3H 1JUFA 2VLKA 3D85B 5AOIA 1I85A 4PBVC 2O72A 1FL6A 3OMZA 5A2BA 4Z95L 2XN9B 2BLFA 1Z9SA 5CEYB 2O6CA 2QSCH 5DJCB 1A6AA 2DIJA 3LDBC 4V1DE 1WIUA 1W9XA 5C07D 4GG6A 4P2RB 1RZ8A 4NFCA 2H41A 4XI5C 4LDCA 4L3ED 5DLLA 4XPHH 2R4SL 3T08A 4OLWH 3GB7B 3NIFF 4JFOB 3SE3A 4BQ8A 4UYPA 4IRSB 4R0LA 3O9WB 2JCCA 3LN5A 3OPUA 5D7JC 5CN2A 1H9DA 2XFXA 1NDTA 2R9HD 4NQSB 1X7QA 1QNIA 2A2QT 3VGHA 5FO7B 1AHWB 4LESA 4F7MB 4UMGA 3TPUB 1EXUA 1JGLH 2IEPA 2NY4C 3QYMA 2COQA 2V5MA 4M48L 3I6KA 4WF7A 2NNFA 4DK6A 5CFHA 2G30A 3L1FA 1WGVA 3LPFA 3DV6B 3TM6A 1TJHH 3AAZB 3HRZB 3QR1A 3ARED 4HPOL 5H37H 3TO4C 4XN9A 3FYEB 4MJIE 2WJ5A 4Z7IA 3O3UN 2QLVB 4LPWA 4XCYB 3QPXL 2X1OA 1EVUA 3GZPA 3MNWA 4EVNA 4JNXA 1U9KA 1EJOL 4G7YH 4O2CB 1S46A 3Q6FA 1U8KB 1H5BA 1FZOA 4JN2A 4ZX5A 3MLYH 4M9OA 2A9ML 2R4RL 3EOAB 1WHPA 3QIBD 1DVYA 5ID1B 4L3AA 5I1EL 5CJQH 5KSVA 5TF1L 2VDKH 4R7LA 3EO9H 5GZOA 3BCFA 4QXUH 3VWJD 4DUVA 2VR8A 3H9SA 4TSCH 2ADIA 1CS6A 1GKOA 2WWMC 3GJFA 1AZRA 1CBVH 4QF1B 5GS2D 5F6IC 5KSUA 3K7UA 5J6SA 3UYRH 5C0DB 1FNSH 3L3OC 4GMTH 3LX9A 5F21B 5ACMA 5JZ7D