3FF7A

Structure of nk cell receptor klrg1 bound to e-cadherin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
97
Chain Sequence
MDWVIPPISLPKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion/immune system
molecule keywords Epithelial cadherin
publication title Structure of natural killer cell receptor KLRG1 bound to E-cadherin reveals basis for MHC-independent missing self recognition.
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 97
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3ff7A00
5DZVA 4ZMWA 3K5RA 4ZMNA 3K6FA 4AQAB 2WD0A 1WYJA 4ZTEA 2OMYB 4NQQA 3PPEA 4APXA 2OMUB 3LNIA 4ZMYA 4NUPA 4AQ8C 2QVFB 3K5SA 3QRBA 2WHVA 2WCPA 4ZMXA 3FF7A 2A4CA 3LNDA 3LNHA 4AQAA 5KJ4A 4XXWC 2OMXB 2OMVB 2YQGA 4ZI8A 4ZMOA 4AXWB 3UBGA 1FF5A 2EE0A 3UBFA 1Q1PA 1O6SB 4ZMPA 1L3WA 5JYLA 1NCIA 4AQEB 4AQ8A 1ZXKA 3FF8A 2OMWB 3K6DA 4OY9A 2OMZB 5CO1A 2O72A 2QVIA 4ZMLA 5JYMA 2X2UA 3MVSA 3LNGA 4NUMA 1SUHA 2WBXA 4NUQA 4XXWA 3Q2WA 4AK1A 4AXWA 1NCGA 1ZVNA 3UBHA 3LNEA 1OP4A 4AQEA 4ZMVA 1NCJA 2A4EA 4QD2E 3Q2NA 4ZT1A 2OMTB 3K6IA 4ZMQA 2V37A 4ZMZA 4APXB 4ZMTA 1NCHA 1EDHA 3Q2VA 3Q2LA 1WUZA 2YSTA 3LNFA 5CZRA
chains in the Genus database with same CATH superfamily
1R5IA 2R23B 1NLDL 3KPSB 1HYSD 2W59A 5C0FA 3A6CL 4X6EA 1B0GB 2KZ1B 4KQ3H 2ZKXA 3MMEB 4LLDA 4YSAA 4WI6A 4XO5A 1G9EA 3FTZA 2OTUA 2NR6C 3SGDH 3V0AC 1DQML 3S8WA 1CIDA 3I6LD 3KLSA 4AT6B 4IEFA 1YN7B 1ADQL 3ALXA 5LDSA 4B96A 2HUEA 3VXPB 4Y5YB 4N85A 2DM7A 3SDAC 1OO2A 3G5WA 5GGTL 3WS6A 4U2YA 4G6KL 3BEVB 4PI0A 2I69A 3TU6A 1NBVH 3FPXA 4AJYV 1M4KA 3Q2CA 2ZXBA 3ERXA 1Z5HA 3HG0A 4E5XA 1QPPA 1RJZA 1TQTA 2Y0SA 2L7UA 3TCTA 3STBA 2WPGA 1P4IH 1KJVA 3IS0X 4Y4FD 3EOBB 1U8LA 1RLBA 2WTPA 1A21A 2A83A 2WQWA 5D1XD 1ZV5A 4KJYB 4XN7A 4UT9H 2WO4A 4LCUB 4L2LA 2FBOJ 5B8CB 3CFMA 4E9LA 2HH0H 2XWEA 2XPGB 2YXMA 1M05B 3FPYA 3LSOA 4BQCA 4KQ4L 2FD6H 4NCDA 3ESUF 4UB0L 4O51B 2FSDA 4XC1H 1ZVSB 2B77A 3W0WD 3ULSA 4JFDA 4K55A 4MSWB 3VJ6A 2R9HC 1DDHB 1TJGH 3UZEC 1JPGA 3S4SG 4A04A 1C8PA 1FAIL 2VR8A 3BDBA 5DJCA 1A7PL 3B2UC 2YK1H 3K80A 5DEJA 2BSED 1NUDA 1AMYA 1TUPA 3RJDA 4WCYL 5HI5C 5ADOL 1PLBA 3LEYL 2F15A 4AQZA 1KTDB 4U3SB 1PZBA 3IVKB 2VLJE 2FNBA 1UB5B 4XPGH 1XIWA 1Z32X 3EIFA 2GJJA 2G30A 3G5YB 1G9HA 4CU6A 3FO0L 2MPVA 1UJ3C 2G2RB 4PLOB 4NZ8A 2BS9A 6TAAA 3FRPB 1GYWA 3O8XC 3EF4A 2FATH 2XWDA 2PPFA 4MMZB 4K5MA 3O2WL 1OPGL 2R4SL 3K1DA 3VTMA 2WZPA 4ZG1A 4AYID 5K1JA 1KN2H 4S2SA 3C60A 4BA8A 3HUJE 2W38A 1XGRB 4KKQA 3G6JA 5PCYA 1CG9A 4G8EB 4JFYA 5KZCD 3FFCB 3TBVB 3WFEH 3DX8B 5AW4B 1EEQA 3MLSH 4G6ML 2W65B 1IGJB 4WLCA 5LN4A 4AM0Q 2K3TA 3D0VA 1NFKA 2X1WL 1M56B 5CFHA 1RJCA 3BRGC 3OXSB 2VAAA 3HI5H 2FQDA 4YL9A 4JVWA 1J1OH 5EN2B 1FH5L 4X5PA 2EIKB 3VW3H 5EO9A 3PPEA 1IGYA 3PNWA 3FS9A 1BM3H 1A14L 3MV8E 3NJVA 3P3YA 3RPKA 2HCZX 5CJ5A 1NUNB 3MA7A 5BCAA 4PS3A 3IGUA 3VE0A 1RK1A 1WA1X 4BSVB 4DF9A 1L7TH 4YNYB 1WPCA 2D4FA 1PEZA 3HE7D 3M45A 3MV7A 3NMEA 5LNGA 1SFHA 3FF7A 4YHML 1E8YA 4ANXA 2Z7ZA 3T1FA 4P2OD 1FZJA 1K3IA 3T2OA 4LRNL 4RNRB 4FA6A 1I1AC 3RZCA 2WUCH 4KK5C 1F90L 1I8LA 5I71C 1Z9PA 4BCXA 1EAPB 3KLQA 3H53A 3QUML 4Z5RA 2BVTA 2DB8A 3FN9A 3GTTA 3R1GL 4LPYA 3DROA 2VERN 4YXLL 2BS71 5IB1B 5AVXB 3ZY7A 4KRPB 1N0LB 1DN2A 1B90A 1JWSA 1HSBB 3BAEL 1M71A 1WD9A 2F6AA 4R7DB 4AGPA 4CGTA 1KN4L 5HGDB 3GSVB 2X9ZA 3HCVB 3LEVL 2BOCA 3TNNA 3IAPA 5EZOH 4Z1PA 2XN9D 5E9DD 5GJTL 1IL1B 3UJJL 1NGZA 5I18H 1ILUA 2X1XR 3SBQA 2NDFA 1PZSA 1BYPA 1DJSA 1M2VA 2ZG3A 4BH8A 4TV3A 1KXQA 4YDVB 3I3EA 3TBTB 4E9QA 5EPMA 4ISVA 4G42A 4HUUB 1HSAA 3TBCA 1QVOA 1RIUH 3ULVL 3HE7B 4QXWA 4KDTA 1K8IA 4C59B 4DP2X 3QJFB 3FT2A 2EP6A 3QIUC 1RFDH 1S7XA 5DJDA 5FHAL 1UA6H 4X0NA 5C08E 3JV4A 1FG9C 4P2OB 4YGAB 2OYLA 5HVFB 3P11L 4DAGH 4FABL 4HS8L 5FFGA 4BKTC 4XPTH 2GJ6A 3GRGA 2EEFA 5F71A 1KLUA 5C1MB 1DVFC 3R06B 4MXQD 4CNIA 4NWTH 3QPKA 2XKUA 1L7IL 2GYSA 4HKZA 5KVGH 4N9GA 1SZNA 4HD5A 3BW9A 5E8OA 1KBVA 1UWYA 4IDJL 3ROOB 4JW3A 3GUFA 5TK2A 4QRFA 1PLAA 1CE1L 3GI9H 3QIWD 4XMZA 2UWEE 2BVUA 3A3YB 4P06A 2EZ0D 3US1A 2WNKA 4N8VG 3VFRA 2OSYA 1SFDA 3B7SA 3N1MC 4OZHE 4R7NB 1NM4A 5D93B 4XWGH 3GPSA 3P4NB 1OGPA 1P53A 2BWQA 2V2WB 1S7RA 3KCWA 1SNRA 1OTSC 3W9EB 1PEWA 5AVSB 2Q76A 4ZX5A 32C2A 3Q5TA 2VC2H 1BJ8A 1BYOA 1IAOB 4P46C 2AV1B 4XMXA 2NXZD 2CBQA 3GMRB 2F1EA 4L8BA 2C7FA 5FFOA 1HVXA 4FFZA 4XPAH 3AMKA 1BD2E 3MRNB 4BFGA 3CFUA 3SSGA 2EAEA 3ARPA 4WI5A 1RZFH 2R0WH 3BKJH 3ZZLA 2O5XH 1IM3D 3TT1H 3QYMA 4Q7DA 1L3NA 4PGZA 3RX9A 1VACB 3PWLA 4IOIA 5EU4B 3L48A 1XR9A 5GGUB 1EHLL 3FO1A 4YDLC 1S5HB 2VR4A 5H2BB 4X5WB 4DUXA 5MEQB 2OCJA 4ZOAA 3X12A 1EMTH 4I3SL 4NKMA 4ELDA 3VXSD 4S1SH 1CYXA 3DJTA 2OULB 2Y69B 4MKMA 3ATAA 3U2JA 5B7FA 1DCEA 1MIMH 1OHZA 1E4XH 3O2DA 3V6OE 4YHLL 4JQVC 3OMIB 2ADIB 1RZJL 1WTGT 4K3DH 2AV7B 3BSZL 5DRNA 1PD1A 2X1QA 2O61A 4PJBE 5BUGA 3O9WD 3WUWB 3FUIA 1R19A 1XTMA 2OJEA 3EYVA 2XRAH 3TJEH 1OP4A 2YPLB 5G4OA 5L2KD 5IBTL 5GISL 5FWQA 4JNXA 1G6RH 4KRNA 2Z4QA 2Q1EA 3ARQA 4MNQA 4PJEA 4TLUA 5CCGE 1I85A 3OKDB 1CGWA 5IMMA 3NZUA 3WFHA 3X1NA 2R1WA 1BAWA 4U7MA 4S0TD 1HHKB 3KL0A 1TETL 5F96H 1NCHA 4JPKH 5CZVL 2B3IA 2HLFD 2ZYHA 2OLDA 4QYOA 3CQQA 1MQ8A 3FT0A 3MR9B 1FFPA 2F53D 4GEJA 1UKQA 2LHAA 3A4AA 1GOHA 2WK2A 2VZTA 1XF3A 4PRHD 1UD8A 2I07B 3TH3T 4BH7A 5BS0D 4S0HA 4PD4K 4WGKA 2DTMH 1Y0LA 2VN6A 4ZQKB 2ICWJ 2VN7A 4ZUSA 1SLUA 3QI9C 2G3ZA 5GGSA 1ASQA 2YAPA 3DVGA 4MX7B 2YBGA 2QEJA 3V6FB 4K8RD 3TPKA 2O5YH 4M7ZC 2VDPB 2VL5A 3VXSB 2BVQA 2IPKB 4JPIB 4OF8A 2C9XA 4ZUUA 4GSRA 2NUTA 5BZDB 1KB5A 5C71A 4DSYA 1IGTB 5I76B 4GO9A 4PVMA 2J56A 4L9LA 3E8UH 1IEAA 1P4BH 1UD3A 2WAHA 3F7LA 5DQ9B 3QJZA 3TCLA 3W9DA 1MHHA 1SOQA 3CZEA 3DSFL 5TQ0H 4TTGA 1A4JA 1OIOA 4JFPB 3CFKA 3DMMC 4LVHB 3I3BA 3PG2A 2DQFA 3V7AE 4WHYG 3QO0B 3SO3C 1XH1A 3POHA 4Y5VB 4UQ9A 1CXFA 5IBUB 5KVDH 5IVXE 4ZD3H 1AZCA 3GGWA 2NYKA 3FH5A 3FTGB 4M6OH 3BYYA 2NNRA 4OF5A 4GKOA 2GSMB 5KBNC 1AXIB 1O7VA 1U3NA 3IU4H 4ANUA 1MJ8L 1JZGA 1UD5A 3H3BC 5LBSA 1ZHBB 1XBRA 4NQEE 4QAWA 3EHBB 3FRUB 4XRCA 4F7TA 5I8CA 1F6FB 4BKSC 3WFBH 4XZ4A 4W9EC 5G4MA 5IM7B 3MRCA 4RMWA 2F53B 3D09A 4JJHA 3AQZA 4OF3A 4QHLA 5IJCC 3ARBA 3HJ0A 4JRFA 4HWZB 4LSSL 4PRHB 3VFWB 1N7ML 3SKNA 2AW2A 4PQXA 3IPEA 4GW4A 3FUNA 1I1FA 3MRQB 4X8GA 2CLZB 2BVOA 1RSFA 4K7PH 2CO6B 4OTXL 1YUHA 4G7VL 3AS1A 5E0QA 3RDTD 2WVVB 1NDMB 4TF4A 3WN5A 4KTEH 1K4CB 3B9DA 5K9KB 1E9PA 4FQCH 1MW0A 2X3AA 2YD8A 5JTWA 4FQIL 3N3EA 2ZCKL 2X5PA 1FVEA 25C8L 2MNJB 2WGNB 5E2VL 5C0BD 1JPTH 4JGUA 1EEZA 3MBWA 3V4VA 5EEVA 5EIVA 1GZPB 5G55A 3HNTH 5B7MA 1GS7A 1KBWA 1N0XL 2I24N 1DVZA 3WENA 3TFKC 4AUYA 5JQ6H 2IALB 2R69A 4NKDA 1U8IA 4WHTA 1SBSH 4FQPA 3GRWL 4GAFB 2PW1A 5E1AB 4PREA 2DLTA 2WXPA 5MP6H 5L7XH 2V0AA 1D9KD 3ZR5A 4NQDA 3NJFA 5J6GB 3V5HB 3CU1A 2ADFH 5J4MA 4YE4H 4LESA 4B7IA 2VRKA 3GJFH 4YDJA 5FUOL 3T2LA 1M1XB 3UTQA 5ITFA 2N3JA 1L5GA 3FOMB 1FP5A 3A4DA 3DVNB 1KV3A 2LABA 4GRWE 4OM0H 5CKGA 1KIUA 4QLRA 3QDGA 4PRDB 2AEQH 2M26A 3F6IA 4YVUA 2AABH 5CU5A 3WSQH 4PCYA 3PREA 4AMXA 1DQDH 2YD3A 5I6OA 3RTQD 4U0RC 3HS0A 4XVSH 2OMUB 1GH7A 5C3LD 4WIQA 1HH6B 1FL3A 2WIMA 3DXAD 4FERA 3ETBJ 4P5MB 2MTAA 1LMIA 3P54A 3MREB 4AH2B 1UENA 3QYCA 1MXGA 1BXAA 2JKSA 4L8SB 2BCMA 2DQHH 5C0BB 3HMXL 1PZ5A 5L4IA 2IBZY 1S3KL 2B4CL 2EEBA 3UAJC 3GUTB 2EO1A 3RWDA 1U3ZA 2V7NA 2DWEA 3U7YH 1AY1L 3CCHB 1ILSA 1G9NL 1ZGLA 2OKMA 4ZFGH 1ERNA 1QSEB 4YX2L 1EEUA 2JKRM 3VXMD 1KMGA 2ITDB 2QPEB 3E3QE 4JBSA 1YY8B 2GSGB 4QRTA 2QDVA 2HT2C 1JGUH 4H1LG 2AQNA 1GJIA 4B60A 1E67A 2Z31B 5CBAA 5JO5A 3RP1A 1QABA 4BFOA 2ZOUA 3IJEA 1XT5A 4QY8A 2HWZH 1SN5A 3GBNH 2WZAA 3SYQA 3AG4B 3V52L 3QUXD 1L9NA 3EJZD 4YDZA 4YL4A 4WFHD 1NFIB 1YUKB 4IMLA 2AJVH 5TH2B 2OXGA 3GM8A 4N2KA 1VFOA 4WI0A 5AW8B 2H5UA 5DURB 5H94B 1QR1B 3PXJA 3ARFC 1EHXA 1I9RL 4JFVA 3UPCA 4M1CC 4P5RA 4WU5A 4NNXB 3R4RA 4ZTPL 2EIJB 3MJ9A 4S1RH 3WEMA 2HRPH 1MPAH 3VVWA 1G9MH 4FMKA 2W9LA 2VO5A 5FYJE 3PWNB 4PJ5E 3G5XA 1RZQA 1IV8A 2A4EA 2HTLD 2Y36H 1GZHA 2WKOF 4W70A 1UQSB 2KERA 1BWMA 4YE0A 3QZMA 5GSRB 2ZAHA 2OZ4L 3GIVA 4LHUG 5BOPA 2P8PA 2H3NB 2AK4D 2ICWI 1DVTA 3ES6A 3U7AA 1Z9SA 1BBDL 2G75A 3PU7A 3DYPA 5EIIG 4JB9L 3HUJF 1QA9B 3CVHB 5DMKB 1ZPUA 4LP4A 4H20H 3NSJA 4HK3J 5MI0B 1A25A 4FNRA 1Q0YL 4G7SB 5E2WH 5CGMA 4Z0BH 3LRHA 2NW3A 4XAKE 4PGCB 4H26B 3P4MB 1QHPA 3CD4A 1UCTA 3QJXA 4PRID 1UJ3A 2A74A 2XY2A 3WFZA 4RGOL 1XMEB 5C07A 3ATFA 4MMXB 2UXVA 2YFOA 1FFNB 1NEUA 3UBXA 3OKKB 3OB0H 1U8KA 4N2GA 1DVYA 1KZQA 4NNYA 1O0VA 3FHAA 5DHVA 1ETA1 4YBQD 1VCBC 4A38A 2Z65C 5FKPB 1AD0B 1NUGA 3DETC 1D5IH 1IAII 4X7SL 3HTLX 3J27A 3U6XA 3NABH 5LWYH 4HIJB 5A6IA 3LS4H 1CBVL 2LOEA 2DS4A 5CEXA 1FGNH 4HZAA 4P4KD 4DW2L 5IW1A 1P7QA 1Q9KB 4H0GA 1IAKA 4RFNC 1DO6A 1JNLH 2GUOA 1QLFA 2HVKB 1X5ZA 4RRPA 4YHPA 2AK4B 3EOTH 2HRLA 4YXKL 4Y9EA 3H56A 1AHWB 3WJJC 3AXLA 3B1UA 4JY5H 2ZQKA 4GQQA 1W16A 4QHNB 3DUUA 4RVBA 3SDDD 1UEMA 3OWRA 4JFUA 5JW4N 5FO8B 1JZ8A 1L0PA 1QTPA 3L3JA 2AK1L 3PFQA 2DMGA 1JHLH 4G83A 3C6LC 3VXUD 2X2UA 2D31A 4JDZA 4OCYH 3QWOA 4XB8A 5DYOB 5B39B 2OI9C 2L8AA 4WKZA 1ETB1 3MV01 1QRNA 2FECI 5HHMD 1RK0A 3TN0D 3I75A 2J20A 4OQTA 3MRPB 2LU4A 4JY4B 1J8KA 1I1AA 4HWEH 4WUUE 4Y4HD 1JZ2A 4OFDA 3BLBA 2FBJL 3P69A 4IDLA 4KK6C 5IIEB 3WEBA 3WO3B 5L9DL 3BZEB 2DAVA 4DO4A 2ZSWA 3KCPA 2Y9RT 3II2A 3L7EB 2L7QA 1B2YA 4KNQA 2NY3C 2QGEA 2OW6A 5CNHA 3VB8A 4NPJA 2C9PA 1CT8B 4U3XA 1MJUL 3DYOA 4J4PD 4OLUL 4XCNB 3BSHA 5D7KE 4DQOL 3GI8L 4Y16D 2I60L 3VWKB 1TQCB 2A9DA 2BK8A 2OL3B 3QORC 4PVLA 3FUDA 2CO3A 4PY7A 1MAMH 3EBGA 1S9XB 4PB0H 3OB8A 1ZEAH 3NQIA 5FECB 1U3HC 2VXQH 1FHGA 1NLBH 2XWCA 4POZC 2UVEA 2DQIL 3L5XH 3UL4A 3T6VA 2E4FA 5TE7H 2VN3A 4PGBA 1QZNA 3T0DA 3KXFB 5IROD 3QZLA 4HAFA 4DHLA 2M8XA 4JDEB 1FWXA 4XZUB 1UASA 2XWBB 2FK9A 4N0FA 4IRSD 4KGLA 2OMYB 2UWEF 3TS8A 3WKYA 2BNRA 1SOSA 3VI3E 1Q94A 3TN0B 5HY9B 5FXCH 2D2CC 4XCYA 4LBEA 1EZSA 3S5LG 2DIBA 4ZS7L 4OZHF 4DPRA 3LN5A 4RMVA 2JNZA 3MNZA 1QTSA 3P3RA 3H55A 4HJ0D 4NHCL 5SWZB 3TIEB 4XWOC 4I18B 3I6SA 5JA8B 5GIRB 3BD4A 1CVRA 5HHOB 4OGXH 3IETB 3QZWG 4FLHA 4LSPL 4XXDA 4Z78A 3I02A 4NXKA 2YHGA 5GZOC 1PYWA 3CV5A 3AACA 4X9GA 4Y16B 1Z0MA 4F37K 5KSBE 1ROCA 2E86A 2VITA 3UOAB 1A6ZB 5CN2A 5C70A 1A1MB 3U4BH 1TFHA 1KSRA 3CFEB 3SD2A 3DDGA 4ZXBA 1GHFL 3MBXL 3MLXH 5T3XD 3VGAC 4KBPA 5C0GA 4FG2A 4IJ3C 3NIDB 1U8PA 4P46A 4UOZA 1DSFH 1ZLDA 5A7EA 4JG1H 1NQBA 3T0ED 1FLRH 2GI0A 5IESL 3GBEA 1XF5B 2YD6A 1MWOA 4O2EA 5D7SH 5TF1H 3RG1C 3S3PA 2ZIDA 5BOZG 4RDQF 1TQVA 2Z93B 2RFXB 1N26A 1J9QA 3NZ8B 4PJBF 3KLDA 1M6OA 4WWOA 2LLGA 3CTTA 3UBHA 2IH1B 4MCYA 3PGCB 4M02A 5AW0B 3CSYB 4Z77A 4AVJA 2BH0A 2WC7A 3ZHNA 3CLFL 5DWPA 3QULB 4LCWA 3UYPB 5J8OA 3P0YL 1UVQA 2QLVB 2WWOA 3O3AA 2VZ1A 2Y7QA 4OD2A 1LM8V 4XN4A 1WFUA 3P0GB 2XVBA 4KKCC 2R0ZH 1T6BX 3VFPB 2IQAA 5GGVY 1AQ8A 2WVUA 4NQSA 1KIQA 1KY7A 4M1DH 3WAKA 1FNSL 3U30B 3UZVB 4G43A 1AJ7H 2R0KL 3ILDA 3BVDB 3SDCA 1Z6JT 1UH3A 1DJIA 3KM2A 2KHAA 3B43A 4I3GA 2A1WL 4LQ1A 3NFSL 4TUJA 1RUAL 5HHQA 1OZTG 2G60L 3IN0A 4IRJC 4MA8H 4NM4L 1A9EB 2WNWA 4ODUB 1JZ4A 3MGTB 4PJGE 3MBEC 5JHLH 3AT0A 4OT1L 5CJQL 3HZYA 6CGTA 1FFOB 1EZVY 1NWOA 4KO6A 4TLKA 4G8GA 4X6FB 2EE3A 5KBDA 3IMSA 2P5WA 4GRLC 3EDEA 1KLGA 4PEEA 4HCRH 4P9MH 3PDGA 3RGHA 3LEXA 3UADA 1GY2A 4XI5C 4TNEA 4MCZB 4F7KA 3MV9E 1I3GH 4CADB 1F8TH 3U6RB 3DOSA 5GJSL 5IGXL 1UB6B 3QI9A 1PBYA 5IVXF 4KJPC 4PJ9B 3IJ8A 4F57H 5J3HD 3WTSA 3WXVH 2IAMC 4N5ED 2Q86A 1DVSA 1DBJH 1Q90A 5KJRH 4R90L 5FUZL 5I1GL 1PSKL 1LE9B 4N28A 4KKLD 5G2NA 2FNWA 1MXDA 1R5VB 3ZDXE 4ABUA 2QR0A 5DJ0B 2A9AA 4NB7A 2JB5H 4JDVA 4PS7A 5EZPA 5DLML 4M8QA 2XN0A 3BHBB 3TBWA 3VFSA 4L1BA 3T5WA 1FZOA 4JUSA 3DMMA 1JNNH 4OSUH 2VLJD 2BSTB 1UM4L 1EJ6A 1I9IL 2C3VB 3LV3B 3FHEA 3FTXA 3EJCA 1E7UA 3HMWH 4TLSA 3MRMB 5HDQL 5FYKU 1H3VA 2ZAIA 4EXKA 4MLSA 3L1OL 2B0SH 4MZIA 2OMXA 3BT2H 4GXVL 3KG5A 4HJUA 1MCOL 5IBLD 1CGUA 1AO7B 2N1KA 4APQC 3I6KA 3WNLA 3N1PC 2BNQB 4HULB 4LSRL 1HH9B 4OZFH 5CUSL 4PJDA 1FO0L 3HHMA 1U8JA 1YNKL 2Y1YA 5C6TH 4LKXB 1CXLA 4M56A 1CMOA 4TNWK 3WLBA 3D25B 2A6DB 2SODB 4OB5L 3TGXA 1W72H 1OAQH 4H2CA 2Y6SD 4G59C 2C4XA 1OP5K 2ZUQC 4QXUH 4OLYH 5D7LA 5GGVH 2ADGB 5AZ2H 4WQOA 5HVHB 1G4RA 1QD0A 1X9RA 2IANB 4LLUB 4CKQA 1G0YR 1YY9D 3EOAA 4KY2A 1J0IA 5LXGL 4PJXE 5DS2A 5K1NA 2IIJA 2A5UA 4BE6A 3DTXB 4JLRB 4HS3A 1JPSH 4MD4A 4F15B 5KSVA 3BGMB 1BVKB 2Y7SA 3LMJH 4M4RA 1NGPL 4H0IA 2E7DA 3ZLQC 1A6PA 3MN8A 3CH8A 4Y1SA 5CLYA 3CFQA 4GRWF 1BGXH 1BBJB 3V0JA 1FCGA 4UINL 2HP4A 2E6PA 3V4PA 2CR6A 5D71L 1OGTA 1I8UA 3M07A 4I2XB 2JJUA 1T7WA 4XP9H 4MD0B 3BPNB 1AI1L 3R18A 1XSIA 4BD4A 4JFQA 4EN3D 2DQMA 1IBDA 3MODH 2B20A 3INOA 4EUPA 1BQHB 4XP6L 1T0NA 3ULVE 5DC9B 5CN1A 4EE2A 4ZUVA 5IMOA 3L6FA 5IWLC 2Z7WA 3L4XA 3ZR6A 4ESKA 5ITBL 1Z9LA 5E1GA 4EI5D 4NZRH 3TWCH 3QJHB 3IMRA 2DYSB 4AENB 1DE4B 2WVSA 3NIGE 4EXPX 1DSWA 1NMCB 3WY2A 5I9QB 1NAKH 4MAYA 1S6NA 3PWUB 4FFZL 5D9SB 2ZCLH 3QG7L 1JPST 2I5YH 1UTDA 2VJ0A 2P8MB 2EDJA 1U42A 3EGSA 3FTWA 5BRZA 3KYNA 5I1IH 5IEHB 2NT0A 4OVUA 3L4UA 4K5PA 5DMJB 1X7QA 3PCYA 1OAUL 2WP3O 2HKFL 3MRFA 2WXLA 4HIIB 3MV8B 4HCGA 4EDXB 2XBZA 1GGYA 3RGVC 1TZ8A 2EDOA 2NZ9C 2WZ6A 4V1DB 5EU5A 4P5TD 4RMBA 5GGRY 2W07A 4ZMLA 1WE5A 4H8WL 4KKNA 4AIXA 1HAWA 4IS6B 1WDAA 2UV3A 4HPYL 5C9JB 5I1HL 3O2DL 4QYAA 3S96B 4I88A 2PO6A 5DD6A 1NPJA 5EZLA 5B38A 1NCNA 2AEPL 2E75C 3L5WB 5C08D 1ZLUK 3O4OB 4XH2A 3ZPDA 3OKNB 4M62H 4R26H 3BWUC 4TL5A 4GSUA 3QEGL 4HIEA 2ICEC 2UX7A 3KL3A 1NDGB 3O3EB 2YQ3A 3U48A 4Z95L 2GTZB 3QXDA 3SCMC 1XB8A 3TEXA 3WJLA 3OJ2C 4OLXH 2YEQA 1IM9B 2IFFH 3KBHE 2GK0B 1XBDA 2K6YA 3VFMA 1SJEB 5ETUB 1OCRB 1HESA 3MCKA 3OF6A 5KYYA 2LLLA 2WYHA 4FQXD 3PJNA 1GPOH 4I0PC 3SDXB 1LK2B 3MRBA 2KLSA 2G5RA 2D7TL 4IKIA 1B0RA 3HC4L 3MLTA 4GP4B 4LLVB 2WIIB 3EH5B 4JQIA 4C83B 4FXKB 4F8QA 3BP7A 1E5UI 3HRZA 4YO0A 5JIIA 3CG8A 3RFZB 4XNDA 5EU3B 1YEKH 3BDYL 3ILPB 1XGZA 3L3OA 5J56B 5FW7A 4QNPE 2NY5H 3MA9L 2OP4L 3NESA 1G7MB 3DX7A 1UZ8A 2GJZB 1KCUH 3WTUA 3IF1B 3ZYOA 1NOLA 1A7BA 4BRJA 5D72L 4R97B 4PMFA 3EYFA 2FEEI 3KWTA 2B9BA 2DLEA 1XX9C 2V33A 3T4YB 1N8OE 3STZA 3A6BL 1KB5L 1BD2D 4BSWA 5KG9A 2YZ1A 2Q10A 1T66C 2NY0C 1BLNA 4X4ME 3UTPE 4U6XA 4PTUB 4JHZA 4YSRA 5JORB 4ZPTA 3D39A 3PHAA 2OBGA 5L4JA 1C16B 5I1LB 1EFXA 2HXAA 4F58L 1YJDH 1LQBC 2Y22A 4GP8B 5KYUA 3U1SH 4Y1AB 4NCC2 2MPAH 5F70A 3GSQB 3W37A 1KBBA 2D7OA 3PDOB 1MCDA 1NC4D 4X8JA 4MZRA 2YBRA 3DV6A 1FL5B 4J3XA 2HLAA 5EU7C 4PWJA 1NCIA 4UT9A 3ZQXA 2X53A 5EFIB 1YEWA 4U0QB 3H8NA 3UG4A 4A7QA 1G9MC 1REIA 3RE0A 1MCPH 2HVJA 4OZHB 5D2LF 5A3IC 1I9EA 3QFJE 4Z7UE 2F74B 1NAMH 4XBMA 5GRJH 2Q2EB 3KLKA 2P24B 5JXED 1QPKA 5MHSE 4OGAD 4UT7H 4W9ZA 3Q2WA 2ROXA 1PDKA 2RR3A 5AOKA 1BG1A 2GTQA 5C0CB 1ACYL 1AGDA 2CH8A 2WQVA 3FXIC 4J6RL 3QUYB 4EMZA 2OJZL 3GMPA 3HN3A 3V4UH 4NRZA 4K71B 3WL9A 4XXCC 3DHPA 2Z92A 3C5ZD 2EYSB 2DI9A 4YSEA 1A3RH 1ZTMA 3OAUH 3WJJA 3DC0A 3DHUA 5E94A 4FTVA 4F9PC 1N64L 2MOVA 2CK0L 3BUTA 4XTRD 4UDTB 4L4VE 3V4VL 5TPWL 3EJJX 3QDMD 2CUMA 5DRXB 5HJ3A 1H6TA 1TTAA 3C6LA 1E9QA 2BIMA 3ZE0E 1QEWB 5EDXA 4N26A 1W72B 2R69L 4P99A 2K0RA 3HA0A 4D3CH 3BVWA 4GLRH 4XBPB 2FYVA 3BAWA 4D0DB 1URZA 2NY1B 4E9WA 1DL7L 1NCDH 2CGZA 2AF2A 4HKXB 1NC4B 2XY1A 2BM3A 2NRDA 3T4AC 3FU6A 4QRRB 4JJ5B 3TH2T 5MERA 1M9WA 2IDSA 1VENA 2PTTB 2XA8H 4WV1C 4IU2A 5HDOA 4BXVA 1N2RB 4PJBB 5A6MA 5I8KH 4XPHH 1C1EH 4L0YA 4ZMNA 4UNIA 1RIHH 2XN2A 4LLYA 1QWNA 1JGDB 1AR1D 3S2AA 5F9WC 3FZUD 4MWFB 3RY6C 2YJLA 5T1KD 3P40A 5F72S 3AT9A 2K70A 5GRXG 3VI3F 3ILQD 4ES9A 2H6PA 1O75A 3U1QA 3U83A 4NQED 4PGJA 2VR9A 5CJOH 2Y4SA 2ED9A 1EEYA 3FB7B 1U3HA 3UCQA 1A6VH 4AQ8C 1ZIBA 5IT2H 1YEJH 5B4MD 3FO2A 3PF2A 2MMXA 3OLEA 1E6JL 5FCSH 3QT2A 1J18A 3ARED 3RA7H 3ECBB 4P23B 5ACZA 1CE6B 1CFNA 2FJFA 5FUCC 1LWHA 1FYTE 5AYTA 3TA3A 4GPVA 1SXZA 1KYFA 1V7ML 4J3OD 1U93A 5C0EA 5B1CA 4TSAL 1FIGL 4EKXA 4G82A 4HWNA 1YHPA 1DVUA 3U46B 1JS4A 5KSBF 2MSPA 4BGDA 1KFGA 4P49A 3JTTB 2PABA 5F0LB 5EZJA 4X7CC 12E8H 1NIDA 3MZTA 3O3BA 2WWMC 3CDGB 2NUPA 4JO2L 4R4ND 3L4VA 4L2YA 5DK0A 4FLRA 1J0JA 3W11D 1BZ7A 3DX9B 2CJUH 4L3EE 3JV6A 3N9GH 4R5TA 4HIHA 1PFOA 3PLYA 1LD9A 4RWYL 3U0PB 4JZNA 4PJIA 5FW6A 4DO5A 1YA5A 5T1KB 3TJPA 1KFAL 5BXFA 2DYPD 1B4JL 3D4YA 2NW2B 2WLMA 3OKLA 2J88H 3ZL4H 5ICXB 5A2AA 5E8PA 2BO0A 3RAJH 4LP5A 1W0VB 4XVJH 2MNWA 1ZGLM 2CNZA 4KX7A 1I3UA 4KTDH 2XVLA 2B1HL 3C09C 3BKYL 3PWPB 4DETA 3D30A 4XMTA 1VERA 4AQOA 4NKOB 3CHXA 4OCMC 4PY8J 4O00A 3RVUC 5TF0A 1W0WB 4KVPA 3E2HC 3JUYA 4WY7H 2K4AA 3BAKA 1E27B 5HD8C 3OGCA 3OZLA 3QISA 4NM8L 4JO4L 3OXRA 3ZRSA 4BFJA 4F7EB 3IDMA 1SOKA 1PJ9A 4PLJD 3H9HA 3P9MA 4I9XA 3IRCA 1ZA3A 4KH9A 4NHUB 4Z7VA 5AVRB 3ZTEA 1J9SA 1JK9A 1Q0XL 4WFEE 1N12A 2C7UA 3P73A 4PJ8D 4GW1B 1YQVL 3NCEB 3AJ7A 2L04A 4P2QA 3U79A 2R1YB 3CN1A 4O2CA 5I1JL 1YCSA 4PJGF 4I85A 5I0DA 1OCCB 5C0DB 3M1BA 4H5SA 1LYQA 5FO7A 4A2MA 3APFA 5HDWA 4KZEL 2LR4A 5JHDA 4NP4L 2DQCL 4JRXA 4D9LH 3ABLB 4YMPA 3DX3A 2NNAB 5IW6B 1SYVB 4XP5H 4NYLA 1DFBL 3RTLA 4EIUA 2FO1A 1EJFA 1FHNA 3FO9B 1Z5YD 5T33H 2W0FA 1H8SA 3HLAA 3WJMA 5K9OA 3EOYG 4WK0B 2QPSA 2MCMA 2BVEA 1H5BB 2EDWA 1QZ1A 1ZPLA 5ADPH 2P5EE 3K1KC 1HE8A 3JV5A 3FSOA 4P9HC 5FYKH 3ZU8A 3X14B 3MBEA 4AEHH 3NSXA 1I7UB 4GRWB 3HLKA 2VMCA 4X9FA 2UYLA 1RZ8A 2YN3A 4C8XA 4M6NH 4N0UE 3LAFA 1YYLH 1AH1A 3D07A 3O0RH 5T8IA 1H15A 3ZDXF 4U1GC 4JCLA 4GXFA 3Q43A 4WO4A 3IPBA 3ZTJG 4KVCL 3JWNE 2YN5A 3REVB 2XT1B 3BP5B 3D69B 3TXAA 3CH1B 3GSOB 1JDAA 5DMIL 1ZWIA 1WA2X 3IFLL 5ISZE 1J5CA 1RULL 1U8CA 2OMZB 3EG9A 1AZZC 3CHQA 3LKOB 4PJ5D 5FYJD 3BLPX 3KR3L 3LQAL 1N8ZB 4ENEC 4UTBA 4WJ5B 1NEZB 1ZGLP 3QR2A 4HFWA 4PJ8B 2PYEA 5DS1A 4HETA 3PUCA 2BP0A 3MROB 3EDKA 3KLHC 3SJVA 2WXGA 1WRFA 2XTJC 4U1LA 2F54B 4MQTB 1TEGA 2FH6A 2DQGH 2WWKT 4K3EH 1EVUA 4UOW0 4X9BA 5CIPB 4DOHE 2JQMA 3TX4A 1F2XK 3GJFK 2W94A 1NANI 5DC4B 2AQSA 5H4YA 1AQDB 3KWUA 4M1GL 1KENH 4XAKD 2OSLB 1G6RA 2Q5BA 4NNPH 1AGBA 4RRPM 2WQSA 3VXTA 3RNKB 1PQZA 4HEPG 4ABVA 3IDJB 2Y06L 4DGYL 3D9AL 5CP7A 3A4FA 1KXTA 3CC5A 4Y9CA 4PJXF 4PS4H 1XGUA 1ACCA 2ITCB 4PP2B 1ZRUA 1CTOA 3MAWA 1LO0L 2IH3B 1J1XL 1YMHA 4AZ8B 4Q0XL 6PAZA 5DSCA 2H2PC 3QHFH 2W95A 1XH3B 2FR4B 3HPJB 1PZDA 4P4RA 2WQXA 2EXYD 43CAA 3K46A 2NTFA 3B9EA 1Y7VA 3SPJA 1OAYL 4EOWL 1GVIA 2YXFA 1GA2A 1IU1A 1ROWA 4C4KT 3BWAB 4X4YA 3RWFB 4M48L 1ORQA 1TZIA 4DK6A 4HP5A 3S35X 2JIXB 1ZHLA 2PCPA 2H26B 4LCYA 1U4FA 4ZNEE 4C4UA 1JV5A 4F2FA 4N9OB 3CZFA 3DWTA 4FULA 3ULVF 5I6XC 4QHPA 2DQTH 5EHFA 3MRGA 3S35L 5BVPL 1KELH 4HS6B 1IGFL 3T04D 1KTKE 2A9ML 2HG0A 4N3UA 2X12A 3ABZA 3D6GA 4EVNA 2G3NA 4XXWC 3NIGF 4E9VA 1LO5A 2QTEA 1SXCA 3RPIB 5ICZB 2WLLB 1AGEA 4JX0A 4PJHE 5KVMC 3BPLB 4A6YH 4OCWL 2EDFA 5CINL 3BUBA 5TDNB 1NANH 4W9LC 5IJKA 1OTUD 5FV2A 4PUBL 4MRCA 1HFUA 4RAHA 4WUUD 3IFPB 3SHSA 3BVNA 2E0PA 5E6YA 3G6DH 5IWLA 4F7MA 3LVEA 1A7RH 3AU0A 4B9CA 4FYQA 4GG6A 5F1NA 3FTYA 3B9VA 4ZBJA 2AZAA 4QR7A 3VUAA 2X4UB 3ULUH 3LKPA 5I15L 1JBJA 3KEDA 4JO5A 1NL0L 2VDQB 3NTCL 5D7KD 2EDNA 3RWJB 4JN1H 4MJJA 2HVBA 3G6AB 2QQNH 4S0SD 3AS3A 1F3RB 3SKJL 3I74A 1CXIA 3RGVA 4PY8I 4XNZB 2BS8A 1T1WA 2Z3FA 1A8JH 5AWNL 3CFCH 2YEZA 4M61A 4WNJA 1IIIA 4WW2F 3F7KA 4N0YH 4OCXL 4ZMQA 9CGTA 5D2LB 1UXWA 2BSSB 4NO0D 5DTFB 1MSPA 4L3CB 1BDYA 1RJLB 1E4WL 2F5BL 1RUQL 1RV6X 4W9IC 3FK3A 2IVFC 3US0A 1YEEL 3WDJA 3E6FB 2CGRL 2F0CA 2FT6A 3OB0K 4IMKC 3CN0A 5JPNB 3OX8B 1FA4A 3QUGA 4KROB 1FQ9C 2IG2H 2KPNA 4WUUB 1RZ7H 2ICEA 3LN4A 1CDYA 3C9NA 4LLAA 3SCMA 3JWOC 1MY7A 5IK3B 4QNPF 1BMWA 4MRBA 4KAQL 3GJFA 1ZT7A 3K6FA 1YPZF 4OIBA 1HCFX 3L1GA 2ENSA 3QNYB 1X5LA 1QSFA 4RZCB 2CKBH 1SMAA 4A7GA 1WCBB 1FZKA 4I0PA 4JM2F 4LCCC 4FFTA 4HKJB 3ARDB 1VFBB 1F5WA 1WK0A 3TESA 1A9BA 3RL1A 4AOFA 2BHFA 2DWSA 4G1EA 3WIFA 1ADWA 1HEZA 3MTXA 3LS5H 3IDUA 3KPMB 4ZUWB 4XN9A 3PHSA 4AL8L 2O1AA 1RIVL 2CHZA 1NGWB 2V2XB 4RMUA 3K2UL 4PFEA 2APTA 1OD9A 4X6BA 4MLIA 1J8RA 3TP4A 4FNLL 4UI2A 3N6YA 3CGTA 3ZL1A 1U91A 1A3LH 1D5BB 3MLWH 4C56A 2HMIC 3VGFA 4IBSA 1F11A 4E41E 4YHKH 4CVXB 2A73B 4LSQL 4P5KA 4HAGA 3QPQC 4Z3EA 3EFDH 3HNVH 4TVPH 5LAXA 4Y5YC 4MNGB 5F89A 1T03H 1JK8A 3ECWA 2Y7MA 4ALAH 1PF3A 3VFTA 4FXGB 1TTRA 4UBDC 1E3FA 5H37G 3FQXA 1SEQL 3VGGA 1P1ZA 1BZ9A 2EIBA 3CBKB 2D7PA 3AQXA 4Z7UF 4A55A 5F7HA 1TITA 4MS6A 3L16A 2L7EA 1KLFA 4LMQI 3MYJA 2JJSC 5MENB 2GHWB 1NA8A 1PZ2A 4IK6A 3OAZH 5DHXB 1W15A 1N9PA 2VNCA 2NLJB 3HBZA 4KVNH 5EUKB 4TTDC 4IGBA 2KI6A 4QUOA 3NJMA 1MCHA 4JZJA 2FEDD 5B8CC 5MEPA 4EI0A 3MV7E 3HOGA 3BAXA 2BSCA 4HXBL 5KSBB 3ARXA 5CR1A 3QNZB 3CZJA 4JDTH 2QKIB 5D1QA 2AXWA 1HINL 3F12B 2IDTA 3VD4A 1HYSC 4UV4L 4KHTH 3O8XD 5IB3A 1R3IL 3ZE0F 1OSPH 2J7LA 2RH0A 2RAMA 1ZIAA 3Q2VA 4WI4A 3UBXG 1AXTL 2CDFB 1OARL 3A21A 4L05A 1MJ7H 1F6AA 3QCTH 3C08H 1ZLSH 3ARYA 4TVSa 4TVUA 3GS7A 2NOYA 3WNKA 3AS0A 4DKTA 3HI1A 5DZVA 1A6WL 2A2QT 2JWYA 4LU5L 4EI6A 1N18A 1MF2L 2XV3A 3V0VA 4HGKC 2X0VA 3MV9D 2B7DT 4BGLA 4KX9A 1X4ZA 1NGQH 2ERJB 1JP5A 3V4PL 2VDKH 1LEGB 1VGKB 3ARGB 1AS6A 4GRMB 3U4AA 1BF2A 3HAEG 2BXYA 4MMZC 2YMXH 1ORSA 1KXQE 4G1MA 5AAWA 3S8FB 1WBZB 3B7TA 1RMFL 5EO1B 5D1XC 4GUCA 4HK0A 2WB1A 4JKPH 3WY4A 3K5SA 2DQJH 4YN3A 3S6CA 2FIKB 8PAZA 5J7CC 4AKPA 1SDYA 2WINA 1PKQA 1I8IB 3L13A 3WIIL 1H9DA 4HUVB 4KFMA 1KBPA 4WHDA 3FN0L 3IJ9A 3F85A 3LRSA 3MLVL 1BZQK 2A99A 1GSMA 1AVAA 4OD3L 3L1FA 1N19A 3F05A 5FGCE 5E0FA 2GJ6E 3GLDA 4UNVA 4Y5XB 4XN5A 4ZFFA 3RY6A 1AC6A 1TCRA 1D5XB 3OKEB 3D1MC 2E5EA 4GIAA 4HPOH 1P5VB 4TPRL 2X41A 4JHWL 4PJGB 4XNYL 5F3HA 3QQNA 3ZSSA 5LGKA 3NPZB 2VM9A 4AMWA 3APNA 1T7ZA 1LL1A 4WI9A 4AQ8A 4S10A 3VD5A 1HZHH 1LP9E 1U8NA 4OY9A 1YLBB 5I6MA 4QT5B 3WFDH 5FO2A 1TQUA 3NRFA 5KOVC 3GMNB 3IGKA 1GIGL 3KH4A 3LNGA 4FQHB 2V5SA 4Q6IB 5D1ZB 2AQQA 2FJHA 2F58H 5IUSA 3CUPB 3HHSA 1AKJA 3B9KB 1KJ2H 4ZPVB 1IEBB 2ICWA 2XYBA 1UM5L 5TJWK 1BF5A 3UZQB 1XHHA 1MFBH 3WNOA 2CHWA 1DJZA 1IGMH 2H8PB 1O7SA 3H9ZA 3DRTB 3TVMD 5JW5A 3ZDXB 2VL4A 1BFVH 4TSCH 3PABA 4KKZA 2BVYA 4H0LC 2AXFA 2XG5B 3QIUD 1VJSA 1EIBA 3BAYA 2X4SB 4PWHA 3NJIA 2G4GA 1BZEA 4D0BA 1MCWW 4G8FA 4HIXH 4RWHA 1RJYB 5C0IB 1T5XB 1UXMA 1TTBA 3ZTCC 2QQKL 3QEQA 2W88A 3GXIA 3STLB 1X6NA 4AMKH 3MYZA 1W0YT 3ELQA 4OBSA 5FM8A 1ZS8A 4Z7QB 2LVEA 2XWJA 3APDA 2O6DA 4N6RA 2FJGB 3HRPA 1E5AA 1NWPA 5T1LA 3NP4A 3WG7B 3W2DH 2UX6A 3EYQD 2VXQA 1I3RB 3Q8EA 4JRYE 3T0WA 4J3SA 5DI8A 2VABA 3MRDA 5D2NE 4ICXA 4NN7B 3HE7C 1N4XH 1HJBC 5AOLA 5KVFH 5GS0H 1H8NA 3MLUH 4KQ3L 4XNQB 1SXBA 4P2OC 2J8HA 4N2NA 2N0KA 5DUMH 3SY0A 4MNQE 4PJEE 4FA8A 3MPCA 4L4TA 3LKNA 1CLZH 4IIZA 1M3IA 3R4DA 4PJXB 3MJ7A 1HXYB 1MUJA 2BSBA 2ALWA 2Y3AA 3AZUA 3TVMB 3VWJD 5HYSG 4Z0XA 4O9HH 4H0HB 4R4FH 3HPLA 1XGQA 3QSKB 2DIEA 2R2EB 2QVKA 2WBJA 3MLZH 1IILE 5IB2A 4LHUD 3GSXB 1EERB 1NBVL 3PWVA 3QP3A 1S78C 4GKLA 1P4LB 1NMBH 4YUEH 1OXYA 2GAZB 3OSKA 1XCTA 5FPIA 3MNDA 5EC2B 4OJCA 2EVHA 4IKJA 1P4IL 1AMXA 4ELME 1CYGA 4H1LB 5GS1B 2NQDA 1QYGH 1P6AB 2GITA 2XBDA 4XO8A 4AI7A 3IDXH 3QO1A 4R3SB 1J9RA 2QMKA 4UT9L 2WN2A 1QASA 2FL5A 4HJGA 2HH0L 3BUYA 4MKTA 4URTB 4JREB 4U4BA 5E03A 3ABGA 2BOBB 3II3A 4DVBA 7PCYA 1SPDA 3CIQA 2FD6L 5EU7E 4M5ZH 3GZQA 2NSXA 4ABWA 5J5EA 4XC1L 3HI6H 2G0LA 4P57B 1Q9WA 4B95C 5CWSB 1TJGL 3NIGB 3IMTA 4N8PA 5BZWB 5C7XH 2XVKA 2EYRB 1FFTB 2HT4D 5INCB 2YK1L 3K71B 1HEHC 3ROLA 5J12B 3UTTB 4DEPB 5HYIA 2FYYB 2AXGA 4MXQC 2J8OA 3VWJB 1EH9A 4LF3A 4WTXA 4XPGL 5D5MA 5BJTA 5MEOB 2XX0A 5DK2A 2NMSA 4WRLA 1NICA 2WTRB 4Z7OB 4FNSA 3SQBA 5A2LH 4LHUB 5EORH 4OD1H 1TENA 3UTSE 1A2YB 3QIWC 4JM2D 5JPMA 5FYLH 1EXUA 4G8IB 1J8HA 2EZ0C 1MFDH 2FATL 4CILA 3KPLA 5CSZB 1KN2L 4D0CB 3UTPD 2YGVA 1LLAA 5E5RB 1OT1A 1JD9A 3LKQB 1H9VA 2EO9A 1WLHA 3WFEL 3KEHA 3GO1H 3QGVA 3MLSL 4XOAA 2CE6A 2VQ1A 3NCJH 2NXZC 1ACZA 5EBGA 3B2VH 4WFFE 2CRZA 2DBJA 3HI5L 4DP0X 3FQTB 5DEGB 4UIKH 4ZYKB 1J1OL 1VA9A 2VDKB 5JHLA 3VW3L 2OR9L 5IHWA 1CQYA 5HGAB 2ZJSH 2IQ9H 2F19H 1MOEA 1OE3A 1BM3L 1HTYA 3D0AA 4X5XB 4XOCA 4WF7A 2DLHA 1V7NH 1P1VA 3SE3C 4AVKA 4XR8C 3BPCB 5F1KC 4HUWB 3WE6A 1HHJB 4JR9H 3QEUB 4D94A 4YHYC 4XN2A 2ZWLT 3BZFB 1L7TL 3DPDA 3QFJD 1EUTA 4NC1C 3UAFA 4B9PA 5HP5A 3K4DA 5MHSD 4H13C 4PWEA 5E8NA 4B97A 2G2PA 5EO0A 2RB8A 3GWJA 1YPZB 1R24B 4L3AA 4E9XA 2GK2A 4PJHF 4F2MA 1DQKA 3JTSB 1NGYB 5DQJB 2G5BA 4JM2B 1JERA 5KJ7E 4CW1A 1IKNA 2I9TA 4U4IA 1QNIA 3ZGIA 3OAWA 4YZWA 3ZDYB 1NCOA 2ESVA 2WUCL 1KJ3H 7TAAA 5IQOA 2IPUG 3LPPA 3O9WC 2WXMA 2PW2A 3QDGE 3U25A 3WFCH 5CLWA 4ZW6A 3TT3H 4JL2A 4Y5VC 2CAKA 2EIZB 2XG4B 3FQYA 2MTPA 4L4VD 4P05A 3OR7A 2Y5EA 1HZKA 3V5DB 3FRPG 4P59H 4XXWA 3PE9A 5EV7A 1UWXH 4NO2B 3TYFA 3GT6A 1Q0YH 2WWNA 3PRZA 5EZOL 5L8JB 2HLFC 3EH1A 2XU9A 4QGYA 4F1ZA 3O41A 4RMSA 4OZFA 1C5DB 5I18L 2NY6D 3EXJA 1R3JB 1JF6A 5FYJU 2CHXA 5D7JD 3GHEH 3ZDZF 3SODB 4EZJA 3AU1A 2IV9A 3G9AB 3BPOB 5I16B 5I6NA 1CFBA 3PAVA 5AVZB 2ZOWA 2Y5TA 2G3MA 3EF7A 2P43B 3O6LH 3BOVA 2XOTA 2QTVA 4L8DA 4HZLA 1A5FH 1RY7B 4ADGA 4M8RA 4K8RC 4Z7UB 4CGUB 1RIUL 3O6KH 3RB5A 4HBCH 5DZJA 3GHBH 1JTTA 4W9HC 5FO9B 5C97A 4NDMA 1RFDL 4OZIB 3C8HA 4JAMA 5I6LA 1UA6L 1R5WA 4NO3A 4AJVA 4XVOA 4Q14A 4DAGL 1LEIA 4FEMA 1A1OB 1XEDA 5SV3A 4OBRA 4XPTL 1INQB 4OFQA 1NEPA 1N3NA 5JLZA 3EGXB 3QIBD 1WBXA 5DD1H 4NWTL 1GS8A 1VEMA 2CRMA 5KVGL 3ME0B 3MOBH 1OGAB 4L4VB 1FYTD 2MKWA 5ANMA 5C0AA 3PGDA 3LH8A 4MTMA 3I50H 3K7UA 5C09A 3ZE0B 4UMSA 4KNTA 5A40E 1TSHA 1LEKA 3GI9L 2D3VA 5FC9A 5GGQH 4IMKA 1U92B 2B59A 4EAEA 2A3TA 2J12B 4BFIB 4L9DA 1BOGB 2NY6B 4G6AD 4QXTA 5I19H 3D85A 4QOKE 4XWGL 1NGXB 5E94B 3CNKA 3NVQA 3EFOB 2XNAA 3IYLW 4Y19B 5JMOC 4AKOA 2YMOA 4L3ED 5HHXH 3QQDA 4U6HA 2VERA 2YSSB 2CWRA 2DBLH 2H6OA 1TU2A 2VC2L 4YOKA 3G6JF 2HN7A 1XF4A 3RDTC 4L1HA 2X9YA 2H3KA 4GBXB 5SWSB 2XFXA 4XPAL 5KN5B 2VWEC 4TQIA 1M6UA 1S7UB 1MWAH 2NX5B 1IQDA 1ZY9A 2LFGA 4IBWA 4IJTA 4MQ7B 4Y4KD 4E42A 3C8KA 3IJYB 1RZFL 1L6PA 1KXVA 2R0WL 3BKJL 3MRRA 2O5XL 4WW1A 5ENWA 1CL7I 5HJDA 3TT1L 2BC4B 4I48B 3LKRB 4L8SC 3GNMH 1BQSA 3MRKB 3QNFA 4NQUA 2H1XA 1PIGA 3U36A 1MHPH 3RUGB 1DQQA 4JN2B 4U1IA 3QIBB 2BJMH 4PPTA 1QR4A 1HDMB 5IUCA 1EMTL 1KNOA 4TUUA 4B9GA 1HK6A 5ES4B 4MJ5B 4S1SL 4ATTA 1TOXA 2DQIH 2X1PA 1EWHA 1MIML 3IRPX 4JRWA 3ZHFA 1E4XL 2H1PH 2X0UA 1JIBA 3C5JA 1AOZA 3K6OA 5IVZB 1D9KC 4K3DL 3TTYA 2I7OA 2GG1A 3FKUS 5F8RC 4BE5A 1EXGA 5F93C 3FTSA 3SDYH 2ICCA 3N41F 4AYBA 2AMUA 2X6UA 2XRAL 3TJEL 1IMHC 3PL6D 1HU8A 2CO7B 1JF1A 4WFED 1G6RL 2XTJE 2JCCA 5E8DH 3CMGA 4YH6A 5FF6B 3QR0A 3BQUB 1S7QA 1BVZA 3BKCH 1CC3A 3TO2B 3DO4A 1CICB 3PIQB 2ATPB 5I1AA 4OI9A 5DUPL 5F96L 4HUXB 4WK4B 4AGMA 4YIQA 4JPKL 5EF3A 1JFQH 3FCSB 1OCOB 2BMKB 5ICUA 2I27N 1K5WA 2GEEA 4WTZA 1KEGL 4AUJA 5HYJA 1KPUA 3POCA 2QPFA 1D6VH 1W8EA 2PXYB 4TRPH 1KIRB 1NBZB 1ASPA 2DTML 4FRWA 1MAJA 1CFVH 2O5NA 5EZIH 3O6FD 3MNWA 1I7TB 4ONHB 1NJ9A 2GUYA 1WWBX 2P5ED 3FUKA 2DW5A 1J0ZA 2FO4B 1CL7H 2WMPA 2O5YL 4X2UA 3GXDA 1FL6A 2IADB 1UXLA 3R19A 4W4OC 3S36H 2NT1A 3P30H 1QFWH 1I31A 1X5MA 1UM6H 4HSCX 1ET5A 1NC2D 3QQ4A 3E8UL 1P4BL 2DZEA 3IXTA 3OG4B 3TV3H 3SN6N 5LGJB 1SQ2N 4OUUB 5TQ0L 3L3KA 3TO4A 5ISZD 3A47A 2P7TA 1QUNB 1X44A 2A4CA 1SEBB 3FB6A 3OLIA 3N1GC 3PL6B 3QUXC 5KVDL 3EJZC 4ZD3L 4M4PA 4M6OL 4X80H 5B1AB 5AYUH 1BZ8A 4MD5B 4Q52A 4YEFA 3RWEB 4Y4FA 4DZ8A 2E4TA 4QRUB 5E51A 5AVWB 2IFGA 3IU4L 2PYFA 2KDGA 3WUWG 1U6AH 5D1XA 5L6YH 3S7GA 3C5XA 4GS7C 2W60B 3L5JA 4OR1A 3HC0B 3ZBMA 1QUPA 3FCBA 2JELH 1EDYA 3WFBL 1LP9F 5GGRA 1UKTA 3HC3H 5C9KA 5HXMA 1N6UA 3IGAB 2Z0BA 2HTLC 3HE6D 3OHXB 4PRNB 4X0KB 3W0WA 2LVCA 3E80A 1NAMA 4OF0A 2X05A 4Z9KB 5CU9A 1TCMA 2P8LA 4PV8B 4ZO6A 2XWXA 4HIQA 1AXSA 1K5NA 4Z76A 1HILB 4IOSD 2VYRE 1PMYA 2CK2A 4KTEL 2KC0A 3QDJA 1U95A 4NJAH 3UABA 3FT4B 1AHWC 1QBAA 3MNVA 3VX1A 4FQCL 5F0PB 1MH5B 2A77H 3O11A 1QI4A 4GQRA 3MDJA 5IQLA 3V6ZA 1OLZA 1OSZB 1GJWA 4YDNA 3BIKA 1RZKH 3OZ9H 5DC2A 3V0WH 3C6EA 1MCFA 1V3JA 5CBEA 5ISZB 1VESA 1JPTL 2UZXB 3EDDA 2VAJA 3QORD 4Y2DD 5E5MA 3APMA 1T5WA 4K0OA 1T4KA 3HNTL 1JWMA 2WLIA 2YA0A 2XDHA 4POZD 2L0DA 3CAFA 1KZYA 5JQ6L 1SBSL 5JOFA 3CDZA 1JV2A 4JZOB 4UZSA 3FU8A 5L7XL 1DO5A 5MP6L 2TSAA 1FJ1A 2Z0UA 4KTGA 5JNYB 1NCWH 3P2DA 4OLEA 3VH8B 5HGGS 2PCFA 5FUZH 5IBUG 4YBQC 4UM9D 1URLA 2JV6A 3SOTA 2ADFL 4H25A 1EAQA 4C4BA 4YE4L 1ZLWH 1G7JB 1FDLH 2Y6TE 4QO1A 4P3WA 1KACB 3ZXAC 1UD2A 2XN1A 1U30A 4I1RA 4NBZB 4B9ZA 1N59A 4AIZA 5BRQA 2XXFA 4RESB 4OM0L 4UU9B 1VFAA 3VWKC 5HJGA 1GMEA 2FUTA 1AYRA 5EULV 2A6JA 1I4FA 2AEQL 1MFEH 2B5IB 2AABL 3WSQL 1YEDB 1DQDL 1RKRA 1AS7A 4PJEF 1CGSH 4XVSL 4XWOD 4M7LH 4I1NB 1L9PA 4XBGA 1G7LB 3DIFB 5IKCB 2H1LM 3VQMA 3P4OB 3EBIA 4OGYH 5JW4Q 3VQLA 3D52A 1MFNA 3PP3H 3SDDC 5GZOD 5ELIA 4QRAA 3BAJA 1QHQA 5EUOE 2DQHL 4J3OH 1BG9A 2ZZUT 3GS4A 1UA3A 3ZL2A 3LKSA 3JWDH 4Y2DB 3U7YL 3KPSE 3TN0C 1IUZA 1K4DA 4ELMF 1E65A 2PWGA 3NA4A 4GAJH 4ZFGL 1MJJA 2EDBA 4Y4HC 3IDNB 4L29B 3G7TA 1IE4A 4OW6A 4GKZA 3T6XA 3I3DA 1X4XA 4CKVX 1JGUL 1E28A 3AADB 4JKNA 4I18C 5DQDH 4OZGA 1XXFC 4UM9B 4G8GE 5E4OA 4FC3E 1ETJA 1EZLA 2HWZL 3SZ6A 2M1KA 3GBNL 2YKLH 3CFJA 4A39A 2P5WE 3RGBA 4DTGH 4J4PC 2J8UB 1BFOA 2XIDA 4B0MB 2ENQA 4YWGH 4PJAA 4M7LT 2AP2A 4FJZA 4LPTA 2AJVL 2XFGB 1NCGA 4Y16C 3CFBA 1S9WA 1GC1C 5K33A 3VACA 1WFIA 2JJTA 2KT6A 2XN9A 5E9DA 1P84J 4P04A 3ILEA 3WV0A 1KOAA 3VXOB 5FB8A 1C8QA 2VW4A 1JRHI 4NQCA 4PJHB 2OSXA 1R5IB 2W91A 4UQBA 2FWLB 2PPCA 4X6EB 4S1RL 1S9VA 2HRPL 3MRHA 1MPAL 1G9ML 4LLDB 3VDCA 1TTFA 3ZZ1A 4NCC1 3G04A 5SX5H 4GFTB 5L8KB 4M03A 1R3LA 2OTUB 2Q0ZX 2UZPA 5IROC 3GXUB 2Y36L 2XQ0A 4IEFB 4A7SA 1A1NA 4IRSC 1FH2A 1IKOP 1ZOXA 3WS3A 5D7IA 3IDGA 1D5MA 2AC0A 2VM4A 1PLCA 4BBWA 1FAKT 1TLMA 3VQ1C 4Q56A 2EEAA 1E8ZA 1VB9A 3QUZA 5HGHA 2VR3A 2ARJQ 1JCVA 5LG6A 4K94C 4DKDC 2XWRA 4H20L 4E5XB 1RJZB 5G5DA 3B4NA 5E2WL 1HIMH 4Z0BL 3ZDZB 1KJVB 3AB0B 1KYDA 4RMRA 2WZPD 3NT0A 1I1YA 3A0OA 4GRLD 4LOFA 4B5EA 2R7EA 4NBYB 2A83B 3C60D 2RIKA 2C9RA 3QIWA 4KTYA 4E41D 4Z18A 4UILH 4XI5D 2IBZX 2P45B 3RBSA 3NCWA 3ARWA 3RI5K 3U30C 3NCMA 4PJ7A 4PU2A 4K9EC 2XLLA 4UZUA 3LSOB 1YAZA 3QYNA 3DX1A 2IAMD 1AANA 3WTTA 2A38A 1BWWA 2DICA 2X2YA 3DSNA 2WQAA 2RD0A 5AKTA 3V8CA 5BMFH 3ULSB 2GBTA 4JFDB 3VI4A 2ZF9A 3VJ6B 3LNHA 4A2LA 3ETTA 1JPGB 2ZOOA 4CAGA 1TO4A 1UG9A 3ALPA 1X5KA 1D5IL 3H9SA 5DJCB 2ETWA 5B3NA 4F8LA 4K3JH 3FFCE 3NABL 1IJ9A 5TE4H 3UACA 4F1SA 5LWYL 1F97A 3LS4L 1S5IH 2JKXA 4HOXA 1FGNL 4BFFA 3IN2A 5LB1A 2UZYA 3L3DA 5CAYB 2V3EA 4FHBD 1IM3A 1XIWB 2YLKA 1DN0A 1JNLL 4LASH 3MV7D 3TBSA 3SE3A 3EOTL 2EDMA 5FYJH 2C3GA 1H0DA 4FFWD 1OWWA 1A6UH 2DIAA 4JY5L 1WIUA 1MY5A 1L9RA 4BFEA 4L1SA 3A4EA 4YFEA 1PD6A 1KTLA 5KBLA 2O5ZH 3QXAA 4A67A 1JHLL 3DBSA 1PX8A 2EILB 2P9RA 4OCYL 2XZZA 3T09A 3IMWA 4S2SB 4J12A 3C60B 4AIOA 4AVIA 2EJ1A 2IMMA 3M7OA 3L4ZA 4HLZH 2H32A 3G6JB 1G87A 1CG9B 4JFYB 1DBKH 2J5LB 5I66A 3WTWA 1MI5A 2YOCA 4HWEL 3O9WA 2DLIA 4CRPA 1UZ6E 5L2KA 1TR7A 3D0VB 5AENA 3L9RA 2G9HA 2VAAB 2PUQT 2HX7A 3O3UN 4ZMZA 3QXUA 5EO9B 1FVCA 1L6ZA 3T6WA 1IGYB 3PNWB 5I8EA 2WNXA 2NSMA 4AYGA 4Z3JA 3TCXA 3MA7B 3FQNB 2W81C 3FAXA 1CTMA 2V7HA 5HI4D 3ATEA 1HL9A 1EA9C 1IT9H 4AYSA 1TQSA 1JZJA 3VE0B 1RK1B 2F53A 2FDBP 1MAML 1Z5LA 3T0BA 4PB0L 1SMOA 3FMGH 1ZEAL 2BP8A 5BS0A 3MV7B 3CX5J 2JKJA 2VXQL 1NLBL 3H4FA 5LBSH 2YRZA 4GKSA 3L5XL 4QRPA 4PRPA 5TE7L 4AQ1A 4ZTEA 5HVHC 3T1FB 1T83C 4HV8A 1OAJA 3VM7A 1FZJB 4N5EC 2QQQA 5K93A 3RZCB 2WYZA 3I9PA 3ISYA 2WLZA 5BV7H 3VO0A 3AAZA 4D8OA 2ZG2A 4QRSA 2X4NA 4Z5RB 4X8CA 5AL8A 3HG3A 3CBJB 1KGCE 1VLXA 1R9FA 4NRXA 3DROB 3BYTA 4F15C 1YN6A 1A02N 4TQ8A 5LDUA 1OP9A 3QVAA 3T8MA 1JWSB 2EUWA 3EJRA 4F8PA 1M71B 3OKOB 3UDWC 3F7VA 5B39G 5T1MA 5AVTB 2FECL 2BOCB 4Y2OA 3TNNB 1CXEA 3N91A 4GMTH 2EVGA 3S37H 3LZFH 2ED8A 4PSPA 1NGZB 5E1AA 4LIQL 4OGXL 2OK0H 2M2DA 2C1PA 3NQKA 1FO0B 3OAZK 4F7PB 4AV4A 4UCFA 4NO5A 1M2VB 1Z2KA 4BH8B 5J6GA 4A6YA 3V0GA 4F9LC 4F33A 5EPMB 4ISVB 4XOEA 5F88A 4G42B 1B0WA 2A6IA 3U4BL 1HSAB 5FHBH 1QVOB 3N1FC 5F1OB 2QPDB 3MO1A 1C7SA 3WGUB 5CCHE 3MLXL 1K8IB 4MHHG 3RWGA 3FT2B 2AITA 3L9BA 2O4EA 5I9QC 3QA3A 1S7XB 5DJDB 4FX5A 3EFFA 3JV4B 1UA7A 2AJSH 1DSFL 2EC9U 1YY9C 3RDTA 2VRAA 3VXRA 4JG1L 2G3XA 4DUWA 3L3IA 1NOAA 1FLRL 2GJ6B 4KXZH 2X1OA 1RZGB 5D7SL 4G6JH 1KLUB 5GRVL 5TF1L 4QIRA 4URKA 4CNIB 4E9YA 3G5ZA 4HKZB 1QOKA 5FCUH 2MQ0A 1JFHA 2YZ8A 3LH2H 3HB3D 4N9GB 1TMCB 4QD2E 2P52A 3BW9B 5E8OB 2WSPA 5C0BA 4JRYD 2H9GA 5EEWA 1WQVT 3UGEA 3TV8A 1LP9B 1JXKA 1JPFA 3N5AA 2QELA 3KVQA 3ARUA 3VX0A 3WEAA 3LY6A 5HPOA 5IOPA 3VFRB 3H4HA 2WWKO 3DJ9A 4R5VA 2GSGA 1O5DT 2R0ZL 4GKNA 2YOAA 2HRGA 4EN3C 1D9KA 3IAQA 4MNQD 2DMBA 1S7RB 2CA4A 2JTDA 4Z3FA 4Z3HA 4M1DL 2MJWA 2Q76B 1AJ7L 32C2B 4IRZH 1FIGH 4U33A 1RCYA 1GYVA 4O58H 4F8TA 5BO1H 4PBXA 4L8BB 2WD0A 1YRKA 3CE1A 3ZO9A 1XCWA 1QATA 4QTFA 4B9FA 2QZ5A 2ARJA 2BP5M 2NY0D 4MA8L 2YPLE 1HT6A 2ZOLB 2ZOKA 2CKBA 4EQ3A 5JHLL 4O2FA 3RTQA 3PWLB 2J57A 4IOIB 1XR9B 4FXKC 3FO1B 4LSTH 4JQXA 3DXAA 3EH4B 4POUB 4YHOH 1USQA 3QRBA 3X12B 4NKMB 4WEEA 5FGBC 2JB6A 4HCRL 4P9ML 3BD5A 2CHNA 1X3DA 3DRQA 4GXUN 1BEYH 4C4KO 3AXIA 1I3GL 2P42B 1B4JH 4AEFA 2EKSA 4R97C 3RIAK 3MJ9H 3D50A 4F57L 5LVEA 3WXVL 2GIMA 2Y72A 5K39A 1EJ8A 5DRNB 5KJRL 1DBJL 3HKZA 4ETYA 3UBFA 5DVNA 4AW4A 1OSEA 4F8OA 4W4OA 4ZO7A 2OJEB 3EYVB 3VXMA 2ZOTA 3WD5H 3ECQA 4WNQA 2NZIA 4S1QH 2ATAA 4NC1E 1EK3A 2CUAA 4B3VA 2JB5L 2Z4QB 4MNQB 4PJEB 5IMMB 2QVIA 3WFHB 1NFDA 3LOWA 5C6WH 4OSUL 1JNNL 4Z7WA 3QS3A 3QUXA 2FX8H 3HMWL 3NN8A 3LPFA 2C26A 2YR3A 3IM1A 4QYOB 3UTSD 3W3BA 1FFPB 2B0SL 1CD8A 1UGNA 3BT2L 4R2GD 5BRPA 1WISA 3L3HA 5FX3A 3OR6A 4BH7B 1ED3A 1XF3B 4WHYH 2IGTA 2YAOA 3L4CA 4XB3A 4PCSA 4XMWA 1Y0LB 3DUSA 3BGFB 5CD3A 3LJ3A 2VTFA 4ZUSB 1NCJA 5GGSB 3QQ9C 1GL4B 5C6TL 3DVGB 3SYAA 2QL1A 2VL5B 3QR1A 2CUHA 4KI5C 1C5BH 1TVBA 2BVQB 4ZAKA 1W72L 3AS2A 3TURA 1OAQL 4HF5H 4HMCA 3MCG1 3EGDA 4ZUUB 2NUTB 5J1SC 1KB5B 2APBA 4K73A 1OCZB 3LCYA 4QXUL 5DHVH 1YMMA 4OLYL 5GGVL 5AZ2L 4L9LB 2PP9A 1IEAB 3QUYC 3QZBA 4WFFD 3W9DB 3TCLB 1YC7A 4IK7A 1MHHB 2CRYA 4K71C 2BDNH 1LO2H 2KUTA 1J05A 1A4JB 1IC7H 2MQGA 3CFKB 3US9A 1WC7A 2AJZA 2DQFB 4CMHB 2P44B 4IBUA 3C5SA 1EZVX 4QHNA 1AG0A 1SHWA 1JPSL 1L0YA 4L5FH 3GGWB 4PJIE 4F92B 2Y07H 1CDCA 2EDDA 4B53A 3LMJL 4KV5E 4LOEA 1DLFH 1WAAE 3OGOE 4MNHA 5DO2D 3MNMA 4Q97A 2NCMA 2D7QA 3T9WA 4KZCA 5CSBA 1BGXL 3QC5X 1D7CA 4PRIA 2WAQA 5KAQG 1RU9H 2E76C 2F8IA 3QZPA 1LNUA 4XRCB 5I8CB 3Q6FA 3L08A 3FW6A 3PYCA 1ANUA 3MRCB 1U0QA 4QHLB 2FGWH 4XP9L 5JIPA 3ARBB 3QNXA 4R2GB 3GINA 5JOPE 5BV7B 1UYWH 3RVWD 3Q0HA 3GBLA 4WTWA 3SKNB 1FIEA 4H8QA 3MODL 1R4XA 5ALBH 1I75A 4GW4B 3QDGD 4OGQC 4UQEA 1I1FB 4OQTH 2CO1A 3KPNA 2K7PA 2BVOB 1CT8A 1PNDA 4ICWA 5EUOF 1YUHB 4TNVF 4XCFH 4NZRL 3LB6D 5CSGA 5DWUH 3TWCL 3WN5B 3CDFA 4OGAC 4HQQH 2K3HA 1I8KA 3VRIA 4ZMOA 1E9PB 2B15A 5E08H 1FZMA 3GK8H 1NAKL 1A0QH 4P4KA 3T08A 3VXQA 2ZCLL 4NLHA 2I5YL 4Z7VE 5DC0A 2WWMD 5AB2A 1FVEB 4HEMA 1MG3C 5I1IL 5KVGE 4HDIA 4P2QE 3FONA 4O02H 3BT0A 3TJHD 1EEZB 3MBWB 5ESAA 3V4VB 4NI3A 1YNTA 3QRFM 5I0YA 1Z3GH 2HTKD 3SDDA 5I74C 4XTRC 1HEJC 2Q6WA 3FSVA 4NKDB 5ESVB 5JHDE 1HXMA 1U8IB 4WHTB 1A4AA 1OB0A 2PW1B 3VXUA 2AAAA 4PREB 4P5SA 1E5BA 3E9UA 1JZ6A 4IHOA 1U8HA 2W8CA 3CXHJ 2AEWA 3CFDA 1DUZA 1KJ2A 1OKEA 4NQDB 2X3CA 4U6YA 3IFOA 2GW5A 5ERWA 5T5FA 4YDJB 3OM3B 2BOLA 3EDJA 4Y4HA 3UTQB 5ITFB 1L5GB 3D2UD 3HNSH 4U1SA 1MFCH 4M62L 4KXDA 3L5HA 4R26L 1BJMA 1QSEE 3N2JA 1KIUB 4IBTA 3QDGB 2GB2A 4K5NA 3RVUD 2DKUA 1OAKH 2DD8H 4OLXL 3VTTA 2IFFL 2OMBA 1CQKA 4KKPA 1CDUA 3ZKMD 4J4PA 3HS0B 7PAZA 3FZUC 2X4TA 1FL3B 2A6KA 3D7PA 1GPOL 4QHMA 1GRWA 4KUCF 4ZW8A 2XKNA 2QADD 3D18A 2QSVA 5E5UB 3KGRA 5FEBA 2VN4A 1R17A 2PYEE 2OJ1A 1PZ5B 5B4MC 4TULH 2VDLH 3RWDB 2V7NB 2TAAA 1WGOA 1YEKL 2DWEB 4BWWA 4C47A 4QOKD 3AREC 5JIQA 3QXWA 2MRYA 2NY5L 1XXDC 4PJDF 5DCCA 1ZGLB 4F37F 1H3XA 3JVFC 1FCCA 1KCUL 5F1IA 4OJYA 4IRSA 4LDOB 4U49A 4QRTB 3QJTB 2VM3A 3C2AH 4JFEA 1N10A 1AAJA 5CBAB 5JO5B 1JGVH 3W81A 1VCAA 3IJEB 5DJ2A 5EU6D 2X4RA 3V0FA 3OD3A 4QY8B 3DX2A 3IU3A 2X2HA 4X6DA 3BN3B 2HT3D 2CIIA 1HOCA 4UF7C 1ZSHA 1WFOA 1JGEA 4GIPD 1U2YA 5ABZA 2EABA 4IMLB 2OXGB 4WI0B 1HCZA 4Q58C 4XPFH 2CDGA 5HVWA 1OANA 2VZUA 4EZKA 1WBYB 1YJDL 3U1SL 2WXNA 3HEIB 4WU5B 2MPAL 2JLPA 5E2JA 2PPDA 3CSBA 4IIQC 1MRCH 3G5XB 1WJ3A 2NTSP 1KPVA 2APVA 2QADB 2XI9A 4FLOA 4TUKH 1OW0C 3ETSA 4TNFA 2AI0H 4XCEA 3MGOA 1MCPL 3GIVB 3H7BA 2AJUH 2XTJD 4ZFZA 1NAML 3TOPA 5GRJL 2P8PB 4JY6A 4HU8A 3ES6B 2P48B 1Z9SB 1ZLEA 2G75B 2F7IA 4UT7L 2C4FU 3ESMA 3T0EA 3DURA 4HJJH 4ONFH 4I8DA 5CILH 3K6SA 3BMVA 3V4UL 1M7UA 1PX3A 2NW3B 2OMWA 3TPUA 1MRDH 3BXNA 4TUOA 3J2PA 1A3RL 1UZ6F 2NXYD 4L37A 4QHUA 4N1HB 3OAUL 5F0JB 1THCA 4I4WA 1ZHNA 1UJ3B 2A74B 2AQPA 2DMCA 2J44A 4MA3A 1MFMA 2IGFH 2ZXDA 1XH0A 1IFGA 1RL1A 2FH8A 3BFQG 2EXSA 4PJ8C 4PWIA 5C07B 3UBXB 3Q2LA 5DJ6A 1U8KB 3H2WA 4NUGH 1WV7T 3LN9A 4QGTA 3PJSA 4NNYB 4ABQA 4DWHA 3BJLA 4IU3A 4D3CL 4FFVD 4JMXA 4M5YH 5DHVB 1SJHA 4NZUH 1NCDL 3E3QC 5AOIA 2Z8RA 5DU7A 2WLJA 4PI2A 1EV2E 1UZGA 2N0MA 4YVNA 1IB5A 3ESOA 2OQJA 4KGJA 5GZND 1UOVA 3VYPA 4CL7A 2XA8L 4GJTB 2NY2D 5I8KL 4XPHL 3Q9PA 2ZUXA 3OWEA 1C1EL 1MHCA 5CEXB 4Q9QH 1RIHL 4H40A 3BWSA 4NQQA 1JE6A 5IW1B 2WKGA 2E59A 1IAKB 3N04A 2GUOB 1QLFB 3BUPA 4JG5A 4YHPB 4UM8A 3SYPA 4HSAC 5I1DA 1K6QH 1WIPA 5KSUA 3AXLB 2KDYA 3DUUB 3VD0A 3JT0A 3HKFA 5I5IA 3L3JB 2WBKA 1DJWA 1P69B 5CJOL 4F3FA 5IT2L 3G5VA 1A6VL 1BOYA 2D31B 4JDZB 3QWOB 3I84A 1YEJL 1AD9A 5D4HA 4WKZB 1E9OA 1QRNB 2X7LA 1SN0A 1EJOH 1RK0B 3I75B 5JDSA 3RA7L 3QCVH 1IFRA 1I1AB 1OE2A 4XE5B 1IZKA 3NSYA 1PNCA 5I71B 1HHIA 1OK0A 3KXFE 4LAQH 2AQTA 2XHNA 3FOLA 3QG6A 4GO6B 2D8KA 3H6AA 2ZSWB 3KCPB 1Z66A 4U7KA 4YFLF 2YD5A 4LCVA 1R0AH 3S8GB 3GSUA 12E8L 2JMRA 2VLJA 5FLVA 5E8EA 4ANKA 4M00A 1B2WH 2NY2B 3K72A 1JNHA 2OMVA 4OU3A 2CLVA 3FSWA 2CJUL 2G9KA 2XQBH 3N9GL 3BPLC 1XDTT 1HHGA 4N1CA 4PY7B 5SWZE 4NZTH 2V5YA 2VLRA 4ZOEA 2WW8A 4LOUD 5IB5A 1G5AA 1MW3A 4GG8A 3NZSA 5E08L 3B7UX 1WT5C 2KLRA 1EZUA 2N7BA 4RDQG 4HKBA 3WTXA 1N6QH 4G3YH 1OE1A 4PGBB 3ZL4L 2J88L 4UAHA 4XVUC 3ULAB 2UY6A 3HUJA 1ETZA 4QCIA 3Q3GA 3RAJL 1SY6H 3MFFA 4XVJL 4N0FB 2EXYC 1RMFH 2EC9T 4KTDL 2MEJB 1V05A 2BNRB 3WU1A 1IC5H 1Q94B 4DZBA 5SV4A 1IC4H 4XCYB 4LBEB 3HG1A 2HJLA 3T2QA 1HCYA 3SPHA 3BH8A 3LN5B 3QK0A 1A4CA 4FE9A 3NIDE 2VMEA 3F04A 3MNZB 4WY7L 4WWPA 3H2QA 4XNZC 4UQ3A 3LZRA 4KUZH 2YXVA 5DRZA 4XXDB 4M8VA 1LGVA 3I02B 4Z78B 3L1EA 4FI7A 1W2KT 3L9YA 5FK9A 4LLMA 1O9ZA 1PYWB 3KDMA 4YLQT 2EYTA 3UO8B 3I9AA 3CDCA 2Y23A 3K74B 2E9WA 3QJUB 2VITB 4NN5B 3SDCD 1X5FA 3W39A 4DEWA 1UJTA 5BUAA 3KPSD 2YGNA 5D1QE 3EYSH 1M2OA 4I87A 5JPNC 3D4ZA 4ZXBB 4KMTH 3L7FA 1OTUC 4EN3A 1EXHA 5CD5C 2ZXAA 4D9LL 5CJXC 1J11A 3WMSA 1XGYH 4XP5L 1V5JA 4QTHA 5C0GB 3VFUA 2HMID 1DSYA 2V3FA 1U8PB 4P46B 3QE5A 1TQWA 2YS4A 4G80A 2VKXA 3VFOA 4EI5A 1P6FA 2IWGA 3C75A 4G8GD 4ZOCA 2PWEA 3FQUA 5I28A 4LLQA 1AIFA 4O2EB 2P5WD 5ADPL 2GEQA 3EZ8A 3ARDC 4RFEA 2DF3A 2R83A 5FYKL 1JZ5A 4KJWD 4LP8A 5TFSH 4AEHL 2CRIA 1M6OB 4M6NL 1YYLL 3FT1A 3O0RL 4MCYB 1NDTA 3SE8H 5JW3H 3LZNA 4Z77B 1MWAA 2CR0A 5EN3A 4LCWB 3DI2B 3T8XA 5JYMA 1PU0A 1A65A 1PG7H 1UVQB 2OM5A 1JDDA 5FM5O 3O3AB 5D96B 2WBXA 2Y7QB 3DLQR 4OD2B 4P5TA 5B1JA 5IJDC 4JQIH 4PTTA 2VSDA 1P7BA 2XXGA 4NEHB 4JKWA 2IQAB 4NQSB 1KIQB 3HN8A 2IV8A 4UYQA 4G43B 2V6HA 2DM2A 3SDCB 4NWUH 2LU3A 5C08A 4KUCD 1G7IA 1QPXA 1W80A 2E9BA 2EKJA 2SEBA 4WSGA 1XSOA 1T3FA 4FXGC 2CM6A 4RZKA 2WXIA 3RILA 2DQGL 2E9JA 4TUJB 2IO5A 4Z7IA 5HHQB 4K3EL 4FXLA 5B7EA 2OW7A 3MOAH 1ZLWK 2OTWA 4HHAA 1UFUA 3HZYB 2FE0A 4BA0A 3RKDC 1EDHA 2W80C 1KENL 2HRHA 3HG4A 4FQXA 2P28B 3FQWA 4G8GB 2V9RA 4NNPL 4XHQA 1U2HA 2QQLH 4PJCA 3Q05A 4YZFE 2P5WB 3F5WA 2D3JA 2UWEA 1KLGB 3BI9X 1XF2A 3LEXB 5SWQA 3UJTH 3AY4C 5D4QA 4A7UA 4PS4L 3DOSB 4MGXA 2QKIC 1AO7E 5DEFA 2BNQE 4PJIF 1JYWA 3W1ZA 1NPNA 2QBWA 2Q86B 3UERA 4KV5F 1WAAF 2ZWZA 3PP3K 3DO7A 1D6EA 3NYKA 3QHFL 4M7ZB 3VGHA 3VDBA 4YDKH 5F7AA 1RLWA 4OCSH 2QR0B 4OI7A 3KPPA 3FFCD 4JDVB 2COQA 4BWTA 4M8QB 3RKPA 3CLEH 1K8DA 3TBWB 3MUJA 1BD2A 3VFSB 3B5TA 1F4YH 1FZOB 1OL0A 3DMMB 1C08A 5EBWA 2IANE 1R47A 1TO5A 3ESNA 3TTSA 1SVCP 3L4WA 3NGBB 1V55B 4M9OA 1F4WH 2DQTL 2BZ7A 4UWQB 2P26A 2ERJC 2Y5QA 4D8PA 1NEZG 3V8OA 1KELL 1IBHA 2OMXB 1NCUA 1ZK5A 2CD0A 3I6KB 3SBWA 3BZ5A 3F2LA 4MQSB 4ZFOA 5E9NA 4PJDB 4B6ZA 1U8JB 2G5UA 2H0EA 4HK3N 1DEEA 1NC4A 5F6IB 4N90E 4P2CG 3IS1X 4Z7VF 3V6OA 1QFHA 1Z1WA 3WLBB 4A6YL 2FEDC 2PCXA 3DGGA 1AE6H 4Y9BA 3VA6A 3LIZH 4CVZA 3PFUA 1WEJH 4I2XE 3INUH 1E30A 1CLVA 1OTTD 4MAYD 4P3CH 5D7LB 3V0HA 3G6DL 3QFDA 4Y2NA 1A7RL 3K8MA 5SX5K 3LRGA 3EOAB 1ZLUH 1BSIA 5JXEA 4MWFA 4BQBA 3ULUL 2ISDA 1YEFH 2EACA 2D0GA 3K2KA 4HS3B 1O6SA 4MD4B 1WZMA 1Q9OA 2H47C 4KRPD 2B1OA 4AYFA 4JN1L 5KSVB 1YC8A 3T8VA 2DI8A 2TRYA 3C5ZA 4M4RB 5FGSA 3WHXA 2QQNL 4WWID 4JFSA 2P1YA 5JW4M 4U1NA 2OCFD 1PAZA 4U1JA 5FA3A 3EJUA 3V4PB 1Q9LA 2JXMA 1OGTB 2OR9H 2X2JA 1JUFA 2IOOA 2PO6D 3QDMA 1JVOA 3B9KC 3CFCL 1JZDC 5DZLA 3GXFA 3ZK0A 3NOIA 3UCRA 5TE6H 3HW7A 4N0YL 2EVJA 35C8L 4JFQB 3F01A 4X7TA 3U9PH 4YJZL 4EUPB 4V1DE 2OA9A 3VRJA 1T0NB 2E8ZA 4ZUVB 5IMOB 4R0LC 3L6FB 1WZKA 1KGCD 1FC2D 3PHOA 1LDPH 4NKIH 2EIMB 3H85A 1NMAH 3MSPA 4RX4D 5F9OH 3FYIB 5EH1A 1KT2A 5AW1B 4K7FA 4QRQA 2IG2L 2BINA 1RZ7L 3C2SA 4WWKA 4A63A 4I5BA 1JYNA 4MAYB 2FTAA 2CCLA 2E56A 4ODWA 2YD0A 5IVXA 1GYAA 1NH6A 3EGSB 4U0RB 3LRLA 3U1PA 4DN4H 5BRZB 3KYNB 1BA9A 1MFVA 2CKBL 1X7QB 4GP5B 3MRFB 2OS7A 4JFHE 4UOW1 1EPFA 4HT1H 3KS0J 2WCGA 3GXNA 5D5ME 3S97C 3GDCA 4BV1A 4NQEA 3KGSA 1FN4A 5EU5B 3SDXE 1S78D 2CBOA 3LS5L 5AALA 2W07B 1IGCH 1JWUA 4DP4X 2Y1VA 3AREA 5C7ZA 4ZJ9A 1J8HE 5I1CH 4JFFA 3I2CH 5F3FA 1X5IA 2PO6B 5DD6B 5EZLB 3RWHA 5B38B 1A3LL 4HFUH 2COVD 2DM3A 1FVDA 3MLWL 4XH2B 3GBDA 3NSDA 3FFDA 4FKKA 5ANHA 2E7BA 2HFEA 1SJXA 2GI7A 1CU4H 2IBBA 4YHKL 5ILTH 2PPAA 3EFDL 3HNVL 4UQDA 4TVPL 4JFOA 3N42F 4HIEB 1ESOA 3QXDB 1ZXKA 3TVMC 4AGQA 1T03L 4OZIA 4ORGA 2E46A 3T0VA 1BVNP 2XWTA 3VFMB 4ALAL 2JKNA