3FF7A

Structure of nk cell receptor klrg1 bound to e-cadherin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
97
Chain Sequence
MDWVIPPISLPKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epithelial cadherin
publication title Structure of natural killer cell receptor KLRG1 bound to E-cadherin reveals basis for MHC-independent missing self recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 18
structure length 97
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3ff7A00
2OMUB 4ZMZA 1WUZA 4ZMOA 2A4EA 5CO1A 3LNEA 1EDHA 4AQAB 3LNFA 5KJ4A 3K5RA 2WCPA 1SUHA 2WD0A 4XXWA 4ZMTA 4AXWB 5CZRA 4ZTEA 2OMWB 3Q2VA 4QD2E 2WBXA 4XXWC 2WHVA 1NCIA 2OMYB 4ZMXA 4NUMA 4NUPA 2EE0A 4APXB 3LNIA 2OMVB 2YQGA 1ZVNA 5JYMA 4ZMNA 1O6SB 1WYJA 3Q2WA 3PPEA 4ZMWA 3FF7A 3UBHA 1NCJA 4ZMQA 1NCHA 4AK1A 3FF8A 4AQEA 5JYLA 1ZXKA 4ZMYA 2O72A 3LNHA 3K6DA 3UBGA 2X2UA 4NUQA 3K5SA 3LNDA 3Q2NA 3QRBA 4OY9A 5DZVA 3K6FA 3K6IA 1L3WA 2QVFB 4AQAA 3LNGA 2OMXB 1FF5A 1NCGA 4ZMVA 2A4CA 4AQ8A 4AXWA 2OMTB 4ZMPA 4AQEB 2QVIA 3UBFA 1OP4A 4ZMLA 3Q2LA 4AQ8C 4NQQA 4ZI8A 1Q1PA 2OMZB 4ZT1A 2V37A 4APXA 3MVSA 2YSTA
chains in the Genus database with same CATH superfamily
4ZMZA 5GZOA 2WPGA 3UCQA 4XWGL 3QZPA 4MDJA 3A5VA 1SEQL 4GY4A 1N5AB 4OU3A 1T83C 1AQDB 1YEEH 5HDRA 1H3XA 2MNJB 4Z7VF 1XF2A 3FRUA 3BIKA 5KBMA 5I0XA 1UURA 3VW3L 1FNGA 2AGJH 3GKWH 5EPMB 1G7PA 5AOJA 4I48B 3U30C 5CNHA 1U8IA 4HLEA 3A47A 5HJ3B 3R4RA 3PP3H 2V4LA 2WBXA 4ZDHA 3RIAK 5KWYC 1CYXA 2H0FA 3VXOB 3ZYOA 2PYFB 3N44F 1X5KA 1UUNA 4XNUL 5BW7C 4GOSA 1LP9F 4G9DB 2WQAA 4E5XB 5SWZE 2AEQH 4P5KB 4CGUB 1DQQA 5GXBB 5E0QA 3B2PA 5T3XH 2MPVA 4NP4L 4Z77A 1N67A 1QFUL 4MCYA 1H5BC 3KEDA 4KMTL 2WVVB 1OB1A 1CFNA 3F7YA 1PQZA 4JREB 5EBLA 4QNPF 3D05A 2NT0A 3IJYA 3RX9A 3WLBB 4OCYH 1L3NA 3MU3A 4XN9A 2NTFB 4M00A 4U1HA 1UWXH 3FOMA 3J8F7 1MFDH 4JFDA 1EWHA 3EYVA 3COOA 1H3PL 2BY2A 2ZXBA 1Q8MA 1FZJA 4JLRA 4C56E 3PWUA 2WO2B 4IMKC 4P2OA 4N90E 4ZAKD 1ZSHA 2NYZA 1I4FB 3L2MA 5PAZA 1N9PA 5DHXB 5E7FA 4IKNA 4CC1A 5KSAC 4FQHB 1N10A 1YEHL 4JZOB 4MHHI 2D4DA 4LVHB 5H4YA 3ZRCC 4XBMA 2IALB 1M7DA 4KKQA 5FYJE 1M71B 5FOBA 2F8XC 2FE0A 1BM7A 1T1WA 4DP9X 2ARJB 3KXFB 2YO3A 1BFVL 3BSGA 3GRWA 3QGVA 1ECZA 2JTDA 4E0RB 2ZKXA 4IOSD 3UG4A 3OJDB 4FKKA 5I8EA 3VFRA 1YG9A 4DK5A 4E42A 3MA7B 1T89A 2C9AA 4OAWB 1LGVA 3GXDA 4HUUA 2CGYA 4PY7A 3Q43A 5CCJA 5D7JB 3T1FA 1A66A 1FFNB 1IC4L 4NSKB 3TV3L 1F3RB 2WP3O 1Q9LB 1VGKA 3R06B 3FO9A 4S1SL 3RHWK 3X13A 5HHQB 1Q0EA 4OJYA 3RU8H 5GS0H 3ARVA 2LTQB 3IXAB 3FHEA 4CC4C 1ADWA 3CFBB 4BHUA 4UAOC 1C5BH 4YE4H 5F9JB 4QHNA 4DQAA 3RZWA 1G84A 4P5MA 3GDCA 1OAYL 4J3VA 2DQHL 2W0PA 5BRQA 3H3PH 2GK0B 1FHNA 3BISA 1D6VH 1IC5H 3D85B 5F9WC 5F7YC 3V6OA 5DT1H 5IB4A 3VXTA 2VN6A 3HE7A 4QOKA 4G7VH 1V3LA 1XH3B 5CKAA 3NJKA 1E4KA 4HWUA 2BVTA 2DM7A 5C0AB 2JF1A 2BSTB 2VL4A 3T4YA 1K9TA 2X4RA 3E1ZA 2OBGA 4P2RA 4HK3N 5E8EA 1AP2B 2PYED 2YPKB 3VGDA 1G9NL 3V5KB 5C0FA 2ZG1A 4RGND 3LH2L 5EBMB 2WSPA 2B4CC 2V2XA 4XRCB 2C9PA 1ZCRA 5E6IB 1G6RH 2QQLH 4GAJH 3B2MA 3HI1A 2NQDA 4JFQB 2EDQA 1A4CA 5I1HL 4FP8L 3VWKC 5KEZA 3GJEB 1RL1A 3OAUH 3VH8G 3TNMA 3UZVB 2R27A 2MIZA 2Z91A 3L9YA 3LRLA 4HX1A 3T3PE 5IMKB 1M4KA 4APQC 4S2SA 1HXMA 4M62H 4CVXB 1QBLH 2A6KB 2AP2A 2D0HA 3ZL4H 2RQEA 3BP5A 4HT1L 1MQKL 2FQGA 2ZOUA 4M7KH 5CP7A 4A6YB 4X7DC 4ISVB 5E7BA 5K9OB 4I9WD 5L9DL 3I84A 3L3JB 4R8WH 5E4OA 4W9CC 6FABL 3JYCA 3A23A 4NN7B 5FUOH 2HMIC 2WMPB 3CVHH 3VFVB 3DURB 4DPBX 3ZKQD 3C8KA 4F24A 1CGUA 1RZ7H 1DEEA 2A2QT 4PRBB 1LD9A 1OTUD 1AANA 3QHZH 2X89A 1ZTMA 2P7TA 2BNRB 1UT9A 5D9SA 5I8CA 3UFIA 2J5WA 4KDVA 1NCCH 3RBSA 4Z7OB 3OD3A 4XN8A 3EJCA 1QEWA 3QWNA 2XBTA 4KKLD 5ALCL 1FGVH 3DIFB 5G5DB 2H9GA 4W9GC 4NC1E 5TDOB 3ZPDA 2FSDA 3P77A 35C8H 1F4WH 2KHAA 4TVPD 5AAMC 3IJEA 3FB5B 1NCTA 3KYNB 3B2UD 3WFDH 2A4CA 2FO4B 5ITFA 3CDGA 1ZE3H 5AL8A 4O2FA 3FSVA 4FTVB 3CPLA 1IEBB 3QPKA 1JGVL 5KYYB 1KCRL 4DPRA 4X99A 5HYSG 1C5DB 1P84J 3CVBA 3RX5A 4OV5B 5EU4A 3CUPA 2ZZUT 4J3UA 3CMOH 4WW2A 3OKKA 3PHQB 1MCQA 2BIIA 1GZPA 2W94A 2Y6SD 3VI3B 1I7ZB 3DHPA 3GRBA 5T1DH 2ITCB 2ICEA 3SGEI 1ILSA 2DYPD 1UD4A 4JFTA 1CFQB 1ZHLA 3FTUA 2H47C 2XWZA 4HIHB 5KJ7E 4F33A 4Z3GA 5C0AA 5KSUB 4EOWH 2UZYA 2EH8H 2Z31B 1MJUL 3NTCL 5B1BB 4CMHB 1HNGA 1AO7D 1J1OL 1UQSB 5IP4A 1OT4A 4IKIA 4X4KA 5C0BB 5DEFB 4K8RD 1QYGL 3WHXB 2VM9A 4W9LC 4DP5X 5C86A 3US1A 2VRKA 4ZAKC 3NZSA 4N0FB 5AKSA 1FFRA 5BRPA 3EOBA 2XN9D 1TCRB 3K1KC 4JVWA 3KL5A 1EBPA 1FL5A 1T0NB 5I30L 1H0DB 1NFIB 4K3EL 2YPLB 2W80C 1IAKB 4PRPA 4XMPH 1JPSL 5DD6A 4L0ZA 3WSQH 2QSVA 5B22A 2J12B 2EXYD 4PPTA 2X6VA 1TVBA 4XP1L 2A6KA 1QFOA 3C8HA 3NCMA 3KPSA 4POZD 2X0VA 1WA1X 3EYFB 1X5LA 2NY1D 1L7TH 4RGOL 5DZ9A 5EIIG 3BKJL 3PG2A 3KLDA 2QVMA 1SBBA 3QT2A 3NEEA 4YDIL 4XO4A 4CVUA 1XIWA 3LZQA 1OTSD 1HH9B 1PLCA 2J72A 3K2MC 4XNZC 4KUCF 3TO2A 1J05A 1U95A 4OLZL 3VI4F 2CRYA 4Y1AA 5BRZE 5L8JB 4AIZA 4NAQA 3VTMA 3QQXA 5DO2D 2C34A 1HCFX 1IBFA 3TIDB 4WI2A 5FHAL 2E7MA 4S1RL 1HC1A 3LV3B 4X5PA 3GZOA 3OKMA 5KSVA 4NNYB 2I69A 4UT6L 4NCC2 4RDQG 5DO8A 4AE1A 4X6CF 3FB6A 3D9AL 5K9QG 5B3JF 4AKQA 3CH1A 2BSED 3RPIA 5JOPD 1ZLUK 2C9SA 1CE1H 2VLKB 2CIKA 4NGHL 2WQSA 3KBFA 2FCBA 1A7RH 4Z7WE 2B39A 3HS8A 4LGSB 1MJJB 1N59A 3VYNA 4QKXB 3BZEA 3IJ9A 4U1KA 5C09A 3TOPA 2GUOB 2X42A 1AYRA 3ASNB 1NLBL 2YN3A 4PG9B 3ELQA 3I6KB 2O93L 3CMGA 4GP4B 1RULL 1ZD6A 1AD0B 3LHPL 4JRXA 4DAGL 1YEDA 2CWRA 3WXWH 1QLEB 2X7LB 1WBYA 4RX4D 3TESA 1CQYA 3NJMA 1N26A 5BQDA 4H25B 1NINA 3I85A 4HIHA 2EDBA 1GS8A 5FAAA 3EGDB 1NGXA 1NBYA 2AFNA 5I9QB 4E41A 4K55A 3EJQA 5J12C 5D2LA 3VU2A 3ZDZE 1OHQA 1NPJA 3PS6A 3CTTA 2ZWZA 4IHOB 5DGRA 1I82A 5C0GA 5AFAA 3U2SA 2VDQH 1TCRA 1OTUC 3OKDB 3PREA 4P4RB 4MA1B 2ED9A 3OV6A 4PJFF 3QEHA 1KYOJ 4YHPB 4WI5A 4HYTB 5DD3H 3QI9A 4LSUH 2F2HA 4GUQA 1A22B 5KAQF 4KKLC 4K3JH 4ZX4A 4YSUA 4GRLA 4PVLA 4OZFH 1OW0A 2BCKB 3BZ4B 4DEPC 4PTUA 3W9EB 1NPUA 3B2UC 5GPRA 3PE9A 1U9KA 1D5MB 4N3UA 1EXUB 3ZHDA 5HHOE 2X6MA 3KPOB 1ZA6B 1A9BB 3RKDD 1U8HB 4JJOA 4U6YB 1RAMA 2FJHA 4YZFF 1OP5H 3MUY1 4MXVE 1JZ2A 3UIYA 3U30B 1WISA 1BD2E 3ARXA 3KWUA 1T1YA 4FKHA 3EADA 4WCYL 3QVAA 5A1AA 5B7FA 2EKJA 1XQ4A 4HKJB 3SJVD 2GJ6A 4WDIB 3H42H 3TX4A 3PAZA 4F7CA 4I3SH 1NCBL 1DL7H 4UTCA 5FFLA 4OQTA 1NCNA 2Y6SC 4P2QA 3S6CA 4UCFA 2W9DH 1J88A 2DAVA 2VR5A 3O2DL 1OAZL 3BUPA 3X3FH 4OZIF 1GH7A 2ZXEB 2UXGA 4N0YH 3F7QA 1P1ZB 2OMUA 4XN2A 1E43A 3SDXE 1H5BB 4N25A 1ED3A 4YMPA 3FL7A 3IRCA 4L3AA 4K8RC 1KGJA 5JORB 5L7XL 3C6LD 2VZVA 4TNGA 1AGBB 4LIQL 2QPEB 1KV7A 4PG9A 1NCGA 3RDTD 3ECBB 3W1ZA 4BFGA 1GTFA 2XPGB 4JKKA 4P8QA 4GS7C 1HL4A 3BX7C 1CLYH 4OIIH 1Q90A 3SYOA 4EIZC 5KW9H 2H3NA 2QVIA 4DUXA 4H25A 1MVFA 4ZNCD 5IUSA 5AVVB 3JVGC 1XDTT 5KSAB 2XC8A 2EXYC 2FEDD 4POZC 4ZUVB 4HUCA 4FDWA 1Q4NX 2EADA 2ZT9C 2BC4A 1EUUA 5I17A 1EFXD 1M42A 2JKTM 2WLJA 1BMGA 3TO4A 1T4WA 4S0HA 1N8ZA 3K0WA 5GGRY 2OXHA 2XFXB 1T7YA 2VR8A 4ONFL 1QRNE 4NIYE 3ZDYB 2GHWB 1IM3B 2BIMA 5IW3A 1V7MH 1IAOB 1U8LA 2W9EL 2O6EA 5GGTL 1OM3H 4XOCA 4PYGA 3BIBX 2VGLM 3GM0A 4WFHE 4F2FA 2E7LA 5DJ2B 4ONHB 1II4E 3QEQE 4E9RA 5LGJA 2AJXL 1LDSA 2QVTA 5EDSA 4GQ9H 5JIMA 1G5GA 4XR8C 5GRUH 5BOJA 2VSMB 2J8UE 3D39D 1T21A 3HA0A 4YHLL 2A9CA 2FBJL 4LOEA 5AL0A 2X4QB 4AMKL 4UINH 1ZA6A 1CBVL 3CCHA 4OGYL 4ERSH 4LHUB 3MV8A 4OGAD 5D7IA 3QFJA 4UT9L 3FH5A 1LJMA 3O0RL 2WXFA 1KYAA 1ZT7A 2X4OA 3HC0B 3X3GH 1ZGLA 4H8WH 5I1CH 1FWXA 1K6QH 1C9SA 3VRIB 3TS8A 4YXLH 1JHTA 2WVTA 5B38A 5FO8A 3GUFA 1ADQH 2HWZL 3NCBB 4YSCA 2WKGA 2LV4A 3CU7A 1XAUA 5BW7A 1OANA 2WOYA 4NZJA 3FCBA 3MGAA 4UIMB 3VSUA 5HVFB 1YN6B 1S8DA 1KN2L 3B9AA 1DQMH 5DZPA 2C3VA 4PB0H 2AXGB 4HIJB 4CADB 4LLYB 2OS7A 4GKSA 3B43A 2XFGB 2O5XL 4G8GA 3PHAA 1TXKA 2O26U 1LQBC 2L04A 4WUUA 1M7IB 4X4MA 2BRRL 4ABQA 1MJ8H 3LEYH 4NNPH 4R9HA 3VWKB 2G4EA 5T1LB 1MREL 5ECJE 5EG6C 1E28A 3HNTL 3E38A 1ZOXA 4APQB 3MRFA 5K9KA 1X5HA 2ZNXA 5DVPA 5AW1B 1XGQA 2AKRB 2PW1B 1JZ3A 2YMXH 4JFWA 4N6RB 4YSDA 1FO0L 4ODHH 2NOYA 5IMLB 5ABAA 4XE5B 5KVMC 5KSAA 5F9AC 2MQ3A 4Y2OA 4H13C 4LHQB 5CGYC 3K71B 4BD4A 5CN1A 2WB7A 1GS7A 1BVKA 1WDAA 2HXAA 4IRJC 3UC0L 3HFMH 3NZ8B 2OCFD 2Y07L 3EFDH 5ESAB 4UTBL 4HU8A 4M56A 4F57H 3RKDC 3PY9A 4Z3EA 5DFWH 4NAMA 4HOWA 2OMVA 3C08L 3PNWB 1LLAA 3QQ4A 5IB3B 4HHGA 1ZDSA 1IAOA 4KWUA 3IJ7A 2EO1A 4N85A 1N6VA 25C8L 3D07A 1KTBA 4PM1A 1R33A 1FL6A 3L3HB 1DP0A 5KJ4A 1CBJA 1TKWA 5CMAB 5B8CA 5IKCB 3CZGA 3GSVB 4ZO6A 4RH4A 1HHJB 3ME0B 1FCGA 3IJ8A 1U8PB 2P5PA 2DBLL 2YD6A 4M6OH 2YZ8A 3TBVB 1FDLL 1KXVC 2YSSA 2HRGA 2BY1A 3EFOB 5CZRA 1BEYH 2YD9A 2DWDA 2BVOB 3GMPB 3L3IB 4HLJA 1OARL 2ADFH 4TYUA 1ET8A 4LVEA 3A67L 1A4KB 4JM4L 3NK3A 4UOW1 3V5DB 4OTXL 3K8LA 3ISWA 1U92B 3AMLA 3FK3A 3L3GB 4YLQT 4PRHA 2BOLA 3EYUL 5DHYA 4O4YL 3RDTC 4PGCB 4HSCX 1CU4H 4JY6B 4HIEB 2HJLA 1XD1A 2Q76B 3GNML 1ERNA 1G7HA 2JCCA 3NIGB 3W0WA 2IQ9L 2Y72A 1RZFL 4ZAKB 4B0MM 4LLYA 2VLLB 3TM6A 3U7YL 4JFEB 2YMTA 1G1KA 4YPGA 2FEDC 2IV8A 3GT6A 2J57A 1F11B 4NFBA 4LCVA 4DGIH 2WBKA 4ONGL 1AZUA 5D1ZI 5FKPA 4R26H 4ZUUA 5MERA 1JVLA 5MEQA 1IL1B 4I0PD 2YUZA 5SWSE 1AE6H 2P49B 5GS1A 1RZIA 4WJ5A 12E8L 1MIMH 5CM1A 4GKOA 2J1YA 3PGFL 4BK8A 2WNWA 3O3EA 2L7JA 3FQRA 3TBYA 4QYOA 3ZVVA 1PDKB 4CMMA 2P8PB 2FWLB 3QIBD 3JV6B 4HUXA 4MAYB 5C3LD 3MACH 1R19A 5ESQB 1MVUA 4TSCL 5FYLE 1HHKA 2JMRA 4JFHD 1HIML 4XNZB 4L4TD 4R0LA 5I8OL 2R4SH 1NICA 1NGZB 1KGUA 4Y4FA 5B39A 8FABB 1GGYA 1XF3B 2DZEA 4WHCA 3GMQB 5F72S 1PJWA 4JDVB 2H6OA 5IOKA 4EIUA 2Z8WC 4ZMAT 3CLEH 4OGAC 5KOVC 3DVGB 5TDPA 2XZQH 3U9WA 4G83A 1Q9WA 5EEUA 1Q0YH 2E59A 4FFZL 1KGCD 3V6OE 3WIHL 4HIIB 3HR5B 4QOKE 4KJYA 1FJ1B 4J3OF 1OAXL 3WN6A 4K23L 4Z7UA 3D50A 3IN0A 2JB5H 4GAFB 4FABH 3ME0A 4RFOL 3V6ZA 1IBGH 1PKOA 3B1TA 3FFOA 4I18C 2VLJB 3P0YH 1RSYA 1YEIL 3AW5A 4IU3B 4YZWA 4AENA 1CT8B 2C7UB 3UTPD 4I5BB 3T2PA 4RZCA 4KVPA 3L6FB 1VFBA 4ZQTA 1WS7A 3VM5A 4ZMTA 1E30A 3V5DA 3VGBA 5J56B 2D7QA 1U92A 3BW9B 4Z7NE 3TEYA 5DRXA 2FECI 2PWDA 1HN1A 4R7LA 5KVFH 2X3AA 1PEZA 2BP8A 1UYWL 1WJ3A 2QDVA 1JI2A 3H85A 4CVZB 4LP4A 1KY7A 4OIFA 5EUKA 3GC3A 4FFVD 5J12B 3QA3B 4CBPA 4YGVB 2J2ZA 4JR9L 3MYJB 4I77L 4ZAKA 2CIIA 3QJXA 2COQA 4PRNA 2IOOA 1GS6X 1HSAA 5JOFA 5IT2H 3MLRL 4ZMWA 1LL1A 1YNKL 2IGTA 1RK7A 2OMTA 2DN7A 3VFUA 2D3VA 4ESKA 4Z3IA 5EF1A 1NCDH 4QGYA 4XODA 5TE7H 5EF3A 1WEJL 1XMWA 3VE0B 1A6WL 2B16A 3O8XD 3JWDH 3LAFA 4HGWA 4MJJA 1XD0A 4DEPB 4HALA 1PKQB 5MHSE 3T6ZA 1F3JA 1OL0A 5FA3A 4EQ3A 3DLQR 1UD3A 3N9GL 3HHRB 3FO2A 1WFTA 1XCXA 1SXBA 1DVFB 3LN4A 3ZDXB 1J18A 4GB9A 5GGUB 2ZAIA 1EHLH 5D7IF 2K1MA 3TA4D 4FD0A 1RK0B 2X4UA 3CZEA 2PTTB 3MLUH 4WEMB 2XT1B 3KPNA 1BAWA 1NGZA 1TMQA 4UT9A 3SKOB 4F9LC 1P5UC 5F1SA 1MCWM 5DEZA 3KDMB 5E2UL 4PS7A 2QV4A 2VITB 3M1CA 5FFGA 1QW8A 3QNYB 5HGAB 2BFVL 2QADB 3I02B 4D3CL 4X98A 3VFNB 1A9VA 1T80A 3EDEA 1D7FA 4IIZA 3HR6A 1W72A 3V4VH 3THML 4HJUA 2N01B 1UACH 5CLYA 1JZFA 1EZVY 8CGTA 3H6JA 3K8MA 3KPRD 4JM2F 5I1IL 4DOHB 3GRWH 4TPRH 3ETSA 3TC9A 3WOVA 3ISYA 4PY8I 4XAWH 1WFMA 4N22A 1WA2X 5C0AE 2GBUA 5F7AA 3D6GA 4ORGA 2PWHA 2ZPKL 2PYEA 3B1UA 1YAIA 4AL8C 1PZCA 1QHOA 2QT6A 1SYVA 5I1AB 2XYCA 4NZUH 3QHFH 4WV1B 4GS7B 5FYLH 1U8QB 2HVBA 1HHHB 1H15A 4XO8A 1GY2A 5BQ7A 2F7IA 4BRJA 4PMFA 3BW9A 4Q9QL 3OKNA 3R7QA 5FKAB 3ZN6A 4X8XA 2IMMA 3G6JB 2FHBA 4I0PC 4PRPE 2AQPA 1SZNA 2XWXA 4F27A 5FA4A 5BS0D 5LGYA 3GSNB 2XG4A 4OVVA 4UQ9A 3QFDA 1MLBA 2BXZA 4FE9A 3KPSE 3L9RB 1RIHL 3UTQB 1R3KB 1T2QH 4PBWD 1ETB1 2Z0BA 5EOCH 1EV2E 3NQIA 2YQ3A 3QIBC 1YYCA 3FUMA 1S7XA 1ILUA 4KX8A 2VJ0A 2FIRT 2BZ7A 3KCPA 2N59A 1QBBA 1Z9SB 4NRXA 2P8MB 5LN8A 2BNRE 2J43A 1I9JH 5LCVL 2MCPL 4L18A 2VT0A 1BXAA 3WTWA 1I7UA 1XGTB 4Z7OE 5ACLA 2GBTA 2WCGA 2GT9A 2DQEL 4FQXD 5D93C 4DGUA 2YAFA 1DFBH 2Z6FA 1NCHA 3SDDB 1FNEA 3VA6A 2PWGA 3BKCL 4TNWK 4P9MH 3AVEA 1JVOA 4HIXH 4M8QB 1ZHBB 4PJ5A 3IE9A 1H6TA 2WWNA 4HH9B 4HCFA 4IMLA 1U8NB 4KY2A 1CGWA 1SDDB 4Q6KA 2DL9A 1NWPA 1LP9B 4JRWA 4JL1A 4HWEL 2VLME 4XMWA 1YNTB 2E9GA 3DV4B 4N2MA 1UC6A 2ZCHL 1UJ3C 1KPVA 1P4LA 1ZRUA 1GMEA 3OQRA 5F7KC 3V0WL 3P4NA 4OGQC 4RWHA 5C09E 3L7EB 4MMXA 3VFNA 1Q9OB 2AJVH 3OWRA 5T1JA 1EO7A 3CHQA 1JWSB 1NGQL 2ZUYA 3G5WA 3QC5X 4IS6A 1TZ8A 3A6OA 2VABA 1HL9A 3D4CA 2DYPA 2YIHA 3QZBA 3CFJB 1KPUB 4FI8A 1FNFA 1Q94B 3G6AA 4NBZB 3L7FA 3DBSA 4JHZA 3WFCL 1QTYT 3KDPB 1IGJA 1YY8B 1BBJB 5CKGA 2EDJA 1AO7A 1WA0X 4P23A 4W4OA 3SQOL 2YKKA 4QRSB 4FFVC 2WXRA 3CQPA 2XQBL 4KQ4H 4E41E 5C0BE 2XG5B 3R1GL 5D2LE 4HK0B 2HTLC 3HCVA 1G7QB 2Z7ZA 3HS0C 3VXSD 1N6QH 4KKZA 3MRRB 2XN9A 4W4NA 5HXMA 1I8UA 1HSBA 5MI0C 2D7TL 2HCZX 2G3NA 2R0LL 4QAMB 5EZOH 3RLSA 3ZKMC 4F1SA 5IB2B 2YD0A 1AIFB 2YPLE 2YEZB 3ILEA 2BHUA 2VC2L 5IIEB 2CD0A 3FRPA 3V7MA 2CUHA 3HZKA 3LKSA 2KBGA 5A6MA 3O8XC 5ID1B 4EKJA 1MWOA 5CIPA 1PS3A 4MS6A 1CLZL 2CG9X 2BP5M 4NHUB 1AOHA 5JW4R 4KV5F 1MUJA 4A2LA 2X9XA 4FLOA 4R7NA 5E08L 4IRJB 4GG6B 1KENL 3IFOB 2P24A 3MR9B 4NFDA 5DD5L 1N68A 4X4XA 2H41A 3TVMD 1S78C 2Y5EA 3MGOA 5E00B 1UXLA 3U1PA 1S9WB 1A9EA 3F7VA 5B38G 1JGDB 4K2UH 4HKXA 1CR9L 3K72A 5E4IA 4F3FA 5GS2D 3LNIA 4TQEL 2D7PA 2PABA 2DLFL 2YAMA 2GJ6E 2C9QA 1FFTB 5DJ0B 4MRCA 1FG2A 2E76C 3EHBD 2I9LA 3SHSA 4P2QE 1BVZA 1JHKL 3WJMA 2A9ML 3QZWA 3VXMB 5IWLC 5C2BH 5ISZD 2C3WA 5DSCA 1CIDA 2BSEA 3C5ZD 3EDDA 3PWPB 4UDTA 4E9VA 3HNSH 1U4FA 3JWOH 1YVLA 1CFSA 4GQRA 2VLKE 4LZKA 4Z6AT 4OVUA 2YK1H 4Z78B 2H8PA 3IVKB 2EC9U 1QHPA 3RL1B 1SY6L 1AD9B 5E5MB 3EW3B 3FUIA 3ROLB 1KFAL 4P4KA 4CGTA 1C5CH 4GJTB 2E0PA 3L95B 5KYNA 1X9RA 1W8NA 3BP7A 1TVHB 3K5SA 3D2UB 2A0LD 3NCJH 4NUJA 4KTGA 2QVKA 4QHMA 2ROXA 1M05B 5GJSL 4HHAA 5TQ0L 4DN3L 2E74C 1HOCB 3AZUA 4H8UA 1DQTA 4ZFZB 4L8BB 1M9SA 1D6EA 2WLYA 5TQ2H 5JUEL 1HI6A 2ZUXA 3Q1SH 2P26A 3CSFA 7TAAA 1TSHA 4M7ZC 4YEFA 4MZ3A 2EUXA 1EFXB 1RHFA 1U36A 5AYUH 2DH2A 2V5TA 1WC7B 1HWWA 3JV5A 4KI5E 5JIKA 2XZCH 3V0AC 4IEFA 5FB8B 2FB4L 4K5OA 4NP4H 3L5JA 1C16B 1JPTH 1JXFA 4OJFL 1LWHA 4J5VA 2Y7QB 1P7BA 1O9VA 1ZT1B 4DP4X 5CLXA 4MX7B 2FECL 2NYYD 1PZDA 3FB7A 3ZO9A 1JK9A 4FQXC 4PW3A 1A7OH 3ZU8A 3L4TA 4AG4L 2NXZB 4PJ6A 2ITDA 3P9LA 2IAMD 4P3DA 3D39B 4LHUG 1SJXA 1T5WA 2Y7MA 2ZKMX 4TULL 1BZ7A 5IEKA 3WIAA 2FX7L 2FYYA 5KVDL 1IGTB 1NEZA 5C07D 2EILB 1LO5B 4P99A 5DQDH 4DO4A 1S9WA 3MV8E 4GKZB 3UTZA 1R5WA 4M5ZL 3QFJE 3SD5A 1ZKAA 1CD1B 4A7TA 3CVCA 2XICA 2GAZB 3SJVA 5HHMD 5GQBA 2J71A 4LQ1A 4CSTA 1BQHB 4E9LA 2B14A 1VHPA 2XPYA 4IKLA 1ACXA 4QXVA 1CB4A 2WUBL 4I18B 3B2VH 4HS8L 4K7PL 1KCWA 4OF0A 1JGIA 5ACZA 5I8KL 3B2DC 1QSEB 4A39A 2CMRL 4MZRA 4PR5B 4ETYA 4EZJA 2WLMA 1OHZA 5A2AA 4J4PA 3EO1A 4PJ7A 2CNZA 1E6OL 3PPEA 4XP9H 1BZ9B 3O3AA 2DI9A 3MMEA 2PTUA 4G8GE 3WJLC 2BNQB 3WHE0 2XKSA 3C6LA 4WUUE 3SDCD 2VLRB 2CO2A 4LAQH 3NN8A 4X4ME 2F7OA 4Z95L 2E4TA 1CGTA 3QAZC 3RDTA 4A1RA 3GHBL 3MRIA 1TJMA 5GGSA 1M1XA 3NZHL 2FYVA 2WB1A 1PAMA 4X7TA 2DMGA 3MRJB 5HHPB 3L95A 4JMXA 1ACYL 2G60H 4B53A 4JZNA 1UD8A 1KBPA 2ZQKA 1OLLA 1ICTA 3ELAT 3FQ1A 1NA8A 3FTVA 1HL8A 4U1SA 5F0PB 3C12A 5D8JL 5B39G 4E9QA 4BCZA 2MSPA 1FN4B 4KFZC 2Z9TA 5EH1A 4HFWB 4OQTH 5DD1L 2JJUA 2VQ1B 4PRIB 1CE6A 3NABL 2F1EA 4J23A 4R5XA 5LCVA 2CR6A 5F1KC 3F84A 3TVMC 3MRGA 2UV3A 4G71B 4NPYA 3BO8B 3QCVH 4PTTA 5J13C 4J3OH 1L6PA 2JH2A 2MOGA 2VN5A 4LCIL 4UYQA 1G7MA 3WE6B 3C5SB 3ZDYE 4K07A 5BMFL 1T0OA 3TJEH 4NQCD 1GAFL 4FQQA 4XNXL 3HHSA 4NRYA 3BPNB 4CJ1A 4X0NA 5J0BA 4FP8H 2PCFA 4LSVH 3M8OH 2XBDA 2VMFA 4BEIA 4GBXA 4X8JA 4F7TA 2W07B 4Y19D 5DUPH 2X5PA 3KE0A 1OKEA 1P5UB 3ZHLA 1QLEH 1FA4A 1K4CA 1T3FB 3QDGB 1VEMA 4OUUB 3C5ZC 4ENED 1EJOH 1WITA 4JGJA 4TQ8A 4YS4A 4Z7QB 5EU3B 4H2CA 1KC5H 1HYSD 1Z9OA 4XPGL 4DP8X 4QHLB 3AU1B 1J1PL 3BI9X 3CFEB 3IJHA 3SKJH 4R84A 3MROA 2X87A 1HNFA 1KN4L 5ALCH 5HYIA 3I3DA 2NW2A 1HT6A 1P7KB 5HHVL 4XCNB 4RMSA 3CGTA 1JNLH 1L9MA 2A0LC 4R5TA 2JCCE 3NDYE 3VRLE 3I6LD 3IDXH 5EF0A 3PUUA 1ZHNB 5C0RL 1HQ4A 1BZ9A 3OWEA 1R46A 1T22B 2QKIC 3MGTB 4UU9A 1G4RA 3T2OA 3GMMB 4NJ9H 2EDFA 3A4FA 5FK9A 2EO7A 4HZAA 1KCVH 4PJFB 4R7XA 4WFGD 2OJZL 3PJSB 3GXUB 3GXFA 1YNLL 2X4TA 3WEOA 1ZEAH 3W9DA 3U4EA 2AJZA 4LLAA 2RFXB 2QEJA 3QWQB 1WIPA 3H9YA 4M7LT 2X88A 3BSZL 2XA3A 1HHIB 3O0LA 3QIBB 4J39A 3LDBC 3IBOA 2ATKB 2AXFA 2ZOWA 4M6NL 4L4TB 3AABA 3IMBA 2IAMC 2VDOB 1QASA 4M61B 2R56L 5CWSA 4H5SA 5F1IA 4U3XA 1SEBA 2YD5A 2DQFA 5BXFA 1OCZB 5CEZD 3WNMA 3MKGA 5EC1A 5D93B 2E8YA 5EA0H 2Y1ZA 3VFMB 4AC2A 1DLFH 2JKWA 4ALAL 1NGPH 1IZJA 3QUML 3JTSB 3A4EA 4YWGL 3WXVL 2NY6D 2VDNB 1NOFA 2AQ3A 1FGNH 1WTLA 3PAYA 4RDBA 2BHYA 2WBJD 3NACL 2ZOKB 3DNKA 5LAXB 1RV6X 3P0VL 4NOBA 1GGBH 1AQKH 1MWAB 1XTMA 3L3DB 3NH7L 3NGBB 4XCCL 1YYLL 5DHVA 3OXRB 1YN7A 2VERN 4Z7UE 1MRCL 1U6AH 3HUJA 4UNIA 1A6ZA 2FO8A 4YK4B 4F9LA 5EOTA 3UX9B 2ENSA 4OZIB 5DDHB 5H35A 1ZHKA 3MODL 3SQBA 4JM2C 3SPCA 2C1PB 4ONOA 3U7WL 3VMOA 1L9SA 1KF9B 4JFFD 5JPMA 1KLGB 5J9PA 1KTRL 3CX5J 4A68A 1E4WL 2XJKA 3VXQB 3RBGA 3GM8A 4E2OA 3SDCC 1FLRH 1WUNT 1KXHA 1NCOA 1OF2B 5DJ8B 2EVHA 4MGXA 5AWNH 2B3IA 4KKRA 2D73A 4UANA 4YNYB 1U2YA 2HG0A 4RGMC 1VKXA 3INUH 2NQCA 3ALPA 2UZIH 4YL4A 3SE4C 4GH7B 5BVPL 2SEBA 2EE3A 3WFBL 3V0JA 4L2LA 2W60B 4LGRB 4NO2B 2WJ7A 3HS0B 5B4MD 4MDIB 4YBQD 1WK0A 3M6DA 1NCWH 5MI0B 3T65B 3H53A 3WELA 3CFDA 4B41A 3O6FD 3KLSA 2P28B 3KD4A 1TOXA 4ACTA 1A2YB 4D0BB 2DLTA 3E6FB 4I0PA 2FQDA 5I1GL 3O8XB 1GHFL 2OR7A 3QNXA 3GMNB 3IM1A 1LO0H 1FNAA 2V5RA 3AG3B 3DX2A 4N2BA 3ZRSA 1X4XA 1MFEL 1JMZA 3FQNA 1E8XA 4YHML 2XWBB 3FCGA 3HRZC 3AGVA 5JXED 4JPSA 2YQ2A 2DJ4A 1UH3A 1EJ8A 1KT2A 5ICXA 3WKNA 4IU2B 5TF0A 1PG7W 2A73A 3P54A 2IQAB 4F80A 5F96L 5IMMA 1KIUA 4KO9A 4RMQA 1EO8H 3PYCA 4Y4KA 1RZGB 3K0YA 4ENEC 4YOKA 5HDBF 1LEGB 4BQ8A 1OK0A 2B4CH 1ZS8A 5C3TA 3AAZA 4AJ0A 2ZP8A 2IIJA 1N64L 1S9XB 3VX0A 1AS8A 1NUFA 2J4WL 1HYSC 2WINA 5MP6H 3P30H 2OYLA 3E8VA 3LEVH 4PJ7F 1W8OA 5KZCB 3KLAB 3HG5A 1ORSB 5CZVH 3ZE0F 1EHXA 2D03L 1CDYA 4J2XA 2RB8A 2A9BA 4H20H 2ATAA 5TJWK 1UJ3A 3HC2A 5TH2B 2EIZA 3WG7B 4HOZA 4ZMPA 1WQVT 2CKBB 3ROOB 3ZR6A 2PYEE 3AFLA 3BEWA 4HUWA 3UYPB 4A63A 4WEBH 3M7FB 3BAEL 2BNUB 4RGNE 2E56A 4IOIB 1DUYB 3O6LL 3CXHK 4HJ1A 1M2VB 1IILE 2OTUA 5I18H 1Q1PA 1P69B 1S7SA 3HE6B 3WGVB 5DEJA 5L2JA 2PO6D 1D5IL 3J27A 5D1XD 5KVGE 2VKWA 1KLFA 5EU6D 1PD0A 5D7HA 4XH2A 4YNYA 3T6VA 1EERB 4QY8B 5IESL 3SDAD 5BS0B 1X5AA 3LKNB 3ULVL 1SPDA 1SXCA 4JDEA 2R0ZH 2UZXA 4LLMB 2BMKA 2FT8A 3S36L 2AK4D 1JDDA 3HS0A 3MJGX 4R83A 2A1WH 3B7YA 4I9WE 4M7ZB 4D9LL 2R9HD 2UY7B 3Q6FB 2WWKO 3G6DH 4WGVB 1NL0H 1UD6A 4XP4H 4HAGA 5DYFA 2DICA 4XNMB 5D7LB 1FZOB 4KITB 2IWEA 1G0XA 4MMZA 1XGPA 2F5BL 2DQDH 3TF4A 1D5XA 1IM9B 1BOYA 4TUKH 1I9RH 4XB7A 3FYEB 4JRYD 1N0LB 4LKCA 4M48L 1EPFA 4MNGA 5I76A 3FQUA 1INQB 3QZWG 1QSFD 5CZKA 3V52H 4ZFGH 5JR1L 4EN3D 1PKQE 2E6PA 1BXUA 2NY6C 1A0QH 3T0ED 1HAWA 1AJ7L 1I8KB 2DQGH 2B1HL 3E6HB 5T1KA 1ND0B 2WBJC 3F58L 3BD5A 3RWEA 4PWHA 3ZDXE 1MEXL 2QHRL 4UDUA 2F53B 2ZCLH 1ZTXE 3ABGA 3RWGA 5C08D 4Y1TA 5GSRA 2UWEA 2KL6A 2WM0A 1T5XA 4K94C 4G6ML 4YGAB 3A6CH 1I9IH 4LSPH 2ESVA 2P44B 4G6JL 3GGWB 2HT2D 3QORD 3FMGL 4RAHA 3QUKB 1AYOA 2CAKA 4UUJA 2VL5B 5IHUL 5C70A 1J9CT 1SM3L 2F1AA 1KEMH 4HFUL 4MLSA 2Q2LA 3AG1B 2ZP0T 4L3CB 3KPRA 2VQ4A 3QG6A 1MCOL 3AADB 2ZUWA 3NIDF 1YMHA 3VAEA 5A6IA 1VLXA 1S7VB 3F12B 4MQXD 1AO7E 3F7PC 2YUXA 3U6RA 1MKFA 1U3HB 1JRHH 2XWTB 3QAZB 5B4MC 2WC7A 2UX7A 1MHCA 4N1CA 4YBQC 1GZQA 2XHNA 4MCMA 2XN9E 4ZO8A 3UBXB 3V7AG 1N4XL 1NIEA 3RWIA 4AQ8A 3O6FC 2A6JB 1CBVH 4XMKL 3LQZB 5ECGA 2WQWA 1OIOA 4X4ZA 4KQ3L 2OX5A 4DN4L 2KMWA 1X7TA 2VN3A 3B3IB 4TOYH 2CE6A 1KZYA 4BGLA 2YR3A 4NDMA 4X6BA 2A83B 3CZLA 5KVEL 3JBG7 3FQTB 3U1SL 4XN4A 1BREA 1HU8A 3K8KA 3QRGH 5D6DA 1K3ZA 1UH2A 4XBPB 4IDJH 5IVXF 3VFTB 5GSVB 3QULB 1W72H 4AZ8A 1U8MB 1KEGH 5LDSA 5JXAL 1G7IB 2IBGA 4J3XA 3TVMB 4G1MB 2P47B 4I7ZC 5I15H 5JXEC 5J13B 1J0YA 2DKSA 5GGVH 2YC1A 3K5RA 3S34L 2FLRT 4Z5RA 3QUMA 2DW5A 4DPAX 3MOAL 3F2LA 3N04A 4RRPG 5K93A 3LPGA 2EE6A 3QDJD 1HZHH 4E9SA 4FQXA 1J5DA 4MKTA 1QLRA 1LO4H 1JZDC 4ZS7H 1FH2A 1GZHC 1T2XA 3DX6A 3VXUD 5LG1A 4NKOB 1TSRA 2IFGA 5I1JL 4PJHA 5KVGH 3CDFA 3VFGH 5ISZB 4IW4C 1USQA 3BJ91 2Q7YA 4DP2X 3P2DA 4XNDA 3OB0H 2OI9B 2F6AA 4X6EA 1X5XA 3TCLB 5F7DA 3IKCA 1J8HD 2ZUQC 5CCKL 5JOPE 1JF6A 3BPCA 4S1QL 3ZQXA 3NRPA 4OD2B 4FFWD 4HCRL 4ANUA 1KCUL 5I1KL 1JG9A 2QSQA 3RNKB 3C6SB 1CICA 4W6WB 4QHUA 1QKZL 4HEMA 5HHNB 5D1QA 3OQ3B 2IOMA 4DQOL 4FLQA 4PW9A 5AZEL 1C08A 4QXTA 1GYWA 3ZW3A 4W9JC 1ZXKA 3OR7B 2WQ8A 2PO6C 4AYID 3G04A 4PV9A 5D1XC 4AKOA 4BH8B 4KC3B 5GIRA 1TTBA 2VZSA 1KG0B 2CBPA 5F3BA 3LYRA 3SDAC 3TTSA 3WJLA 3BCFA 3QAQA 4JRFA 2EYRA 2QKIB 3BWSA 1NUGA 3Q2NA 4PAZA 3NVQA 5DJAA 3VXSA 5I6NA 5GRZA 2R9HC 2GCYA 5IHZB 1EEQA 3FN9A 4IQHA 4MASA 4TRPH 4FNQA 3N43F 1ZTXH 4JFZH 3SBRA 1NLDL 2HKHL 1A65A 4X6DF 1NZRA 2CDGB 3KWTA 1U91A 3V7AE 4AXWA 1J5OH 1A8ZA 4B9ZA 3V4PB 4UV7L 3LDBB 4OZGA 2OV0A 5DYOB 5AKRA 5CR8A 3WO4B 2GITA 3TEWA 2CK2A 4NPJA 3UJJL 4EN3C 3CLFH 4XNYL 5ACMA 3M1BB 4QCIB 3T0EC 3LKPB 3SEPA 5IFJB 3DUUB 1ZPLA 4QPEA 3QXDB 4G1MA 2N1TE 2DIAA 3ML9A 1K5WA 4GAAA 3HB3B 4PMEA 3TWYA 1IVTA 2FR4A 1BQHG 1S7QB 4ZFFA 2O6PA 5AG9A 5HHMB 5KTEH 2X10A 1UWEH 3CZUB 2HT2C 4ODUA 3SJVE 4ONGH 4UQ2A 2C5DC 1UXSB 1JOIA 1AXTH 5C0CD 5DF0A 1ETA1 4NCC1 1SJHB 3E0GA 1KJ2L 5DR5L 1MCFA 3C60A 2YLHA 3MA9L 1FAIH 3GSRA 4JDTH 4YBLC 1BVNP 2RD0A 4JM2B 4QRUB 1RLBA 3C5ZA 3B34A 4I4WB 2FJUB 1V3MA 1RJLB 3DROA 3S3PA 2QQKH 2FX9H 4CJ0A 2HG5B 5CIPH 5B1JC 3X12A 3K2UL 2O5YH 3GSNH 4MQXC 3SDCB 1RFDL 3FUDA 3ZE0E 1A6UH 2ICCA 4OLXH 4BYHA 5CEXA 5L6YL 5C6PB 3NJNA 4ZPTB 1DR9A 1E3XA 2VXTL 4HKZA 2AITA 3ZE1B 1P4BH 4ZJ9A 3VD7A 1D7BA 1RIVL 4RGMB 5TFSH 1KJVB 3KWWB 1WYJA 2Q7AA 1F90L 3HAEB 3F64A 4MKMA 5DURD 5IG7A 1UB5B 3CN1A 3MOBL 3VCLA 1B9ZA 2GQHA 3ARQA 4XOEA 2NDGA 4PJIA 2D0GA 5DRZA 3IXTA 5CJOH 1N0XL 5EFIB 3MBED 4Q2ZA 1I7RB 3QIWA 2VDRL 1CFTA 5JNYB 5J6GA 3HZVA 3HIZA 5F7EL 4X5XA 4BUHA 3RGVD 1A1OB 3NJFA 2G75A 1MFUA 4BH7B 3S96B 4BUGA 3BKMH 1X5IA 2A99A 5E9DA 5F1OB 2WZ0A 3G5ZA 2VO5A 1DQJA 3RZCA 3DA0A 1EAPA 1IEAB 2Z65C 2R1YB 4FHKA 4UYPA 4Q0XL 3IETA 2I60L 2R0WH 3EO9H 5KN5A 4GINA 4AH2A 1PF3A 3HRZB 2CLVA 3NSJA 2X70A 1QSZA 3KPQA 5HPMA 2UWEF 4Y19B 2IAMA 1W15A 5FPIA 2CU9A 2YMOA 3RA7H 2OR9L 5EWIH 3BVTA 3D39E 2RJMA 4PRAA 4ZTPH 2R2HB 3FSZA 4JDZA 3AT9A 3X1GA 1IGYA 5C07A 4FXGC 4O2EB 3QYNA 3KPMA 4FQIH 3K4ZA 3DGDA 4RSVA 1A3LH 3PV6B 4FFWC 4LESA 4J6RL 3ARDD 3DTDA 3SE8L 3J07A 4WENB 3T8MA 1MCWW 1NC4A 1E2ZA 4L37A 2FIKA 3ULSA 5K1NA 4G6FD 5AVZB 2YS4A 1ASOA 1CWVA 2JQZA 3D12B 3HZYB 3OAZK 3CAFA 4LPXA 4FQ1L 2GBAA 4MCZA 5F7NC 5TE6L 4LLVA 5EBWA 1A3RL 4G8FB 3TT3H 5AAWA 2KPNA 5DEGA 4DHLA 5AEAA 3MLPA 4KK8D 3O6MH 3PWLA 5F97E 1DN0B 1MCCA 5J3HD 2B9BA 1XF4B 4HMDA 3BH8A 4W81A 2A74A 1B0RB 1ASPA 3BH4A 2PPCA 2W92A 5D7SH 3NIDE 1U8JB 5F21B 2ZSVA 4R4BA 3S35X 4IKJA 4L1SA 1XGRA 2C4FT 5I1DA 1UCBH 4K15A 1ACCA 3L1GA 1FBIH 1VA9A 3S37X 3BXNB 1QLFA 2Y6TE 3SE4A 3P9MB 1CGSH 4NLAA 5FIEA 4D3CH 3RUGA 4GT0A 4XO3A 1KOAA 3K91A 4R90L 2LAAA 1ZVYA 4PJEB 3IPEA 3BVDB 4LOVA 5JA8B 1A7NH 1MCRA 1OAQH 2PP9A 1K5NA 1Y6NR 2NZIA 1SJEB 2H32A 3GHPA 3UGXA 3VMNA 2F8OA 1F86A 1B90A 2EC9T 2P5ED 1R3HA 1MY5A 5DTFA 3CN0A 1IEAA 4NQCA 2NY6B 3UBGA 1P7QA 3IFPA 2WBJB 2XN1A 1OSZA 1V7NL 5JHBA 4HXAH 3V5HB 4Q9QH 3NCCB 2RHEA 2F58H 3TJHD 5D4HA 3Q8AA 5MEPA 2VNCA 4PSRA 3HUJE 1J9RA 1BGXL 1MAML 1WPCA 2B59B 4J2QA 2EDOA 2GBVA 2ICES 2QTVA 2BINA 4HCRA 1WD9A 1TTRA 1YQ2A 3P3TA 4LOUD 1HXYA 5BV7L 5E8DH 1RIHH 2Y06H 1FSKC 3O3DA 2J21A 1N18A 1WO2A 2XUWA 3WHE1 4PVBA 2H0EA 2IF7A 4Z7QE 4TQHA 2Q5BA 4IIQA 1LMKA 4MZ2A 3VB8A 2MCPH 3HN5A 3FN0H 3FU6A 1A3ZA 3HZYA 4FZEL 43CAB 5ICZB 4LCUA 4DZ8A 1JGLL 3L08A 4XP6H 4M7LL 1F3DJ 4N8VA 4QRAA 4XBEH 4YDLC 3V0GA 1MW0A 2X1XR 2ZXDA 3IDGA 3UAJC 4PGBB 3MBEC 2WGXA 2ZXWB 4N2NA 4RMUA 5EMYA 3Q1EA 3FBQA 1ZLWH 3SOBL 2VDLH 4TUOA 3A22A 3O6KL 4XC3H 3N3EA 4OIBA 1QTPA 3LRSA 3RGVC 3U2JA 2BSRA 4PV1C 4H8VA 3SPHA 3L54A 2QL1A 4N68A 4Z0XA 3MRKB 1MZZA 4ODWA 1ZJAA 4QD2E 2AJYH 4YR6A 5JHDB 1YY9D 1KYOK 3BVNB 3FB8B 3H1ZA 1IZKA 4PWJA 2VOTA 4P5TA 4U1NB 2EZ0D 5C0DB 3QUYD 2FJFA 1UA6L 3ZBMA 4TLUA 4WK2B 3UJIL 5LGKA 1Z1WA 2KUTA 2MJWA 3OGOE 4LSRH 4X5LA 4Y4HD 2EKSA 4JFHE 3KL0A 3LQAL 2DQUH 4L4TE 5GRJH 1IUZA 3EJTA 3US9A 1TQVA 1XCQB 3KPPA 2YD2A 4XMLH 4NHCL 3PQYB 4JKPH 1U3ZA 4AW7A 3SY6A 1HK6A 1HH6A 2V7NB 4D94A 3ARDC 5HJBA 3RJDA 5EO9B 2GJRA 5GZND 3WS6C 2VXUH 1KGCE 4PLNC 4TNFA 1IC7L 5SX5H 3EJZD 5GISL 2ZUQB 4K7FA 2NQ3A 1GGIH 3GJFA 3UC2A 5KG9B 2J3SA 3PABB 2NY7H 1UM6L 4YSOA 6TAAA 3NFPA 3IF1A 3N42B 2WO4A 5LO7A 4MD4B 2OTWB 4CA4A 5INCA 5I66A 3VD0A 4U6VL 3BQVA 2LLNA 3G9AB 4KK8C 4JFFA 2NX5B 1NGWA 3B7UX 3B37A 3TYGL 3UTPE 4JB9H 1VPOH 4LCCC 5KYUA 3ZMEA 4Z7AA 5J3HC 3ZO0A 5DD5H 2GC7C 3EOTL 2CM6A 3NP3A 5AVWB 5AOIA 1BW8A 4YHIB 3ULVF 5DC2A 4JN2A 1FO0B 3R8BB 2PO6B 4PJIF 2CBMA 5EZIH 4AK2A 5IFHH 5D1XB 5TE4H 1DCEA 2AQRA 2FGZA 3X17A 5LWYH 1TTUA 3LXAA 1CR9H 2LAGB 2KQMA 3FTXA 2NXYD 3FU9A 2X6AA 5JHLL 3EDJA 4JY5H 3O41A 3MZTA 3O4LD 1XZ0B 3PRZA 3QNZB 3DX8B 4KVNL 2VH5L 2FK9A 5CZXD 5L88H 1URLA 4RIRB 2I5YL 2BY3A 3CDYA 2R1WB 5E1HB 5I2IA 4BKTC 2V37A 1YSOA 3WY2A 3GI8H 1J5CA 1SMOA 1UZGA 3S3DB 3MRNA 3N85L 1HCVA 2G2PA 4PP1D 1QFWH 1XEUA 1BOGB 2HVKA 3O6FA 1VZIA 4JW3A 5DHVH 5DRWA 3L5IA 4KHTL 4HWZB 4M93C 2Y1VA 2DMKA 4MD5B 2EDEA 4P59L 4R4FL 1HHGA 4HISA 1YMMB 4TL4A 3UJTH 4HPHA 4PP2A 4N9GB 4P06A 1F1DA 1J1XH 1JN6A 3FTGA 1RY7B 1A3QA 1J0ZA 1JFQL 1YLBB 4OLYL 4JRYB 1RU9L 2MTAA 1WCQA 2BVQA 2Z4TA 3WLWD 4ILDA 5J06A 4Q74A 2ZJSH 4EN3B 1QO3A 1KFAH 3ET9F 4ZNEA 4AJWA 4C83A 3T0EB 3V9FA 4QRPA 3DO4A 4PUBL 5CF3A 3IT8D 3T2LA 3DPBA 4MXWH 5JXEA 3GZKA 4Y0GA 3A4DA 4UM8A 4HW6A 1DLHA 4GW1A 3NIFF 2VZTA 2OP4H 3RVTD 3TJHC 1ZPUA 4HEPA 4OKDA 4MQTB 5ANMB 3N1QC 2J6WA 4IK6A 5LLIC 2V9RA 4NJAL 5A2KH 3RFZC 2F8IA 1QR1A 2GTZB 1U33A 4WKZB 1JGEB 2ESVE 4R2GD 2MCAA 1XSKA 5AOMA 2CK0L 2E5EA 3KR3L 4D9RD 1A14H 4AV0A 3GINA 4GW4A 3JSSA 3G5YB 1VACB 2EE2A 2VISA 4LLUB 5D2NC 3O45B 2ZYRA 3D69A 3WU1A 4DKEL 1PLAA 3RIKA 2HSIA 3RL2B 4O00A 1F8TH 3M17B 1MH5B 1TJHH 3CU1A 1W2KT 3KPRE 4KMLB 4F58H 3NA4A 3MZGB 1MFVA 2AXWA 4M5SA 3PDDA 5F1NB 1XXDC 3OB0K 5E2TH 1B0GA 4LBEB 1BM3H 4PRDB 4MD4A 1I53A 2EIMB 2OMZA 3L4UA 2WTRB 2ZX7A 2PCPB 3KCWA 3SPJA 4ZPVA 4J8RA 3RURA 1NDMA 2Y7SA 1ZSDA 2NY0D 4DVBA 4TULH 5K39A 4AYSA 1FVEB 5AKVA 5GGRB 2PKDA 1KB9J 3KLQA 2BP0B 3RUGF 5ITBH 4JFXB 1U93B 2VDOH 4LSTH 4U3HA 2ALWA 3SO3B 2I26N 1S7RB 3F05A 5EU6A 3LSOA 4DF9A 1BQ5A 1M3IA 3ULUF 4DGYH 3NA9L 3QW9A 4GRMB 4EE2A 3SDAA 1TT6A 3LRMA 4FYQA 2WY3B 4C54A 2F0CA 5DJDB 3B4NA 5BS0E 1NIDA 1KCSH 2HN7A 3CDCA 2NNRA 2AK4A 4OGXL 4F1ZA 1YY9C 2D31A 1TQBC 4U6HA 2VDNH 1S5IL 1SBSL 2WUBH 5F9OL 2DKMA 2EZ0C 3QUXC 4HWBA 1JPFA 2HP4A 3MAWA 3MREA 2PR9A 5CHNA 1JWUB 2CUMA 3LS4L 2FQFA 5D70L 1K85A 4CU6A 1PG7L 4Y4HC 5F3FA 3ZMRA 4O9HH 4APXA 1E6OH 5HYJD 1ES0B 4A04A 3MVSA 1I1YA 1R3IL 4RBPH 4A2MA 1UWGL 2Y5TA 3QDJB 4ATWA 2WOBA 2C8NA 3HVNA 3QWOA 3CZSA 3BEVA 1QSFA 4NN5B 3UP6A 2B2XH 1XGUB 3QDMD 1TCMA 1QATA 4G80A 1UZ6F 3FU3A 2FHFA 3ZZSA 1KGYE 2OW7A 5GZNC 1ACYH 3A6BL 2P5WA 3LN5A 4PJHE 2XXFA 4EZMA 3EJZC 3RNQA 2ZUUA 1J8HB 3UOAB 1CDBA 4YFLI 5I5IA 4FXGB 4KZCA 3WN5A 3L3OB 3C9NA 5C08A 4I0CC 4U6TA 1I31A 1FNHA 1FL3B 3L3KA 4MLIA 3ESNA 1YEEL 1RZJC 2JV6A 3CFCH 4PLOB 1QI3A 3GBMH 1RZPA 3QORA 4XB3A 1YEKH 3S2AA 1UZ8B 2P8LA 4HEME 3GPEA 3ZOAA 3DSFH 1CVRA 3REVB 1RMFH 2ZYHA 2AGJL 3DTXB 2WIMA 3GKWL 5J1AB 5IBTL 5T3ZD 2HJFA 1NJ9B 1S9YB 3CC5A 3DXAB 5BMFH 2WXJA 3IDIA 3ZK0A 3KYOA 2NXYC 3VFSB 3TWCH 4LNRB 1I1AD 5KUKA 2VE6B 1EA9C 1U8OA 3LKQA 2B1OA 5CZXC 4U3SA 2X0WA 1XBRA 1MDTA 4PWFA 1I7TA 2AEQL 2DM3A 2CPUA 2UY6B 5EOQH 3VXSE 5T3XL 1ID5I 4PP1C 2OL3L 4P46D 5IVZB 2N0KA 1JL8A 3QEUA 4UQDA 4AUJA 3S8WA 3BZ5A 5CJXC 2X4SB 3F5WB 5DJZB 3SY0B 3T0BA 5HYFA 1S7RA 5C7XH 4K3DH 2BY0A 4OCYL 3QJHA 2HFTA 4RQQB 4TLTA 3TCTA 3QPQD 5E6YA 2CKNA 5MEOA 3KJ6L 3ILPA 4NX0A 3WLWC 3VFOA 4OZGE 4O51B 1MFDL 3AITA 3B9KD 3S35H 5LBGA 4AZUA 3FFDA 5F7HA 3OKYA 1U41A 1HX0A 2XI9A 4B9CA 3S37H 2IH8A 3V0VB 1L4IA 5FECA 4XP5H 3RVTC 1GJIA 3Q5TA 2Q86B 5AZUA 3TEXA 2YA1A 4L3EA 2F61A 4RFNC 3QO0A 4ZX5A 1KGWA 2VMJA 4GG8B 4AMWA 1HYRC 4KPHH 1PX3A 2GJZB 3TA3A 4D0DA 1BYNA 4N2GA 4LEXH 5E56A 4R2GC 5IJDC 1Z3RA 4RRPM 2XRAH 3VXUA 1LMIA 1ORQA 4HP5A 3EBHA 2F8VA 4U4IA 2YJQA 5E8PA 2CH8A 2V3EA 2CDEB 3PU7A 4CNIA 2P46B 7PAZA 4NN6C 1YNLH 5HGDB 3VD2A 3ZE2F 2JKJA 3WUWB 1FSKB 3BN9D 4QUOA 1YECH 3P02A 3NJIA 4ZSOB 2WLKA 5IF0B 2W65B 4FN0A 4WHYG 2NSXA 3RU8L 2ZXQA 1ZWIA 4E9TA 2R2BB 1BJ1J 2E9BA 4E36A 5GS0L 3L8QA 5JPNA 1JZ7A 1Z7JA 4O5LH 3TFKD 1C5BL 3HAEG 2YPVH 4RMBA 4ADGA 4EBQH 4YE4L 2NY0C 4JL2A 4P05A 2LOEA 5DQ9A 1INEH 1OGPA 3EO0B 4UF7C 1J0JA 1CFVH 3H3PL 1P5VA 5DURB 1D6VL 4BWTA 1ET5A 4YDLB 1B2YA 1IC5L 2HUHA 4PCKA 3RPKA 3TNNB 5DT1L 1JUFB 3D08A 3B9VA 2XWJA 4G7VL 3I6SA 4UBDD 3BKYH 3WIIH 3M86A 5DVLA 1QQDA 3E80A 2UXTA 2F7PA 4XVOA 2P42B 1X3DA 3FOLB 3MOQA 3D0AA 1JYNA 4XN5A 4EI6B 5BUAA 5JW4Q 4TVSa 4D9QD 4EIGB 1Z66A 2BHZA 3CN3A 2ENYA 2JE8A 2ICWI 2V5MA 1V54B 2CJSA 3IGUA 4LLWB 3RGVB 2WTOA 1USZA 1YYMH 1L9RA 4XCYA 1R5VB 2XTLA 4C47A 2OMBA 3UTOA 4PJCA 4CU7A 4GQZA 5CINH 5GRVL 3TGXA 1G6RL 1XCTB 4GAJL 1UEYA 4WU7B 3NBNA 1E4WH 1F4XH 1SJVA 2CA3A 2VMDA 5CJQH 2NNFA 4I88A 3KHOA 2G9HB 4KXAA 5HP5A 1RVFH 7FABH 3OAUL 3PDOA 3VGEA 2AJUH 3WFEH 1J9TA 3FUHA 4XX5A 4B96A 1JPGB 1KCLA 3ARFD 4YH6A 4M62L 3I9PA 1QBLL 1W0WA 3WBDA 4JY4B 3ZL4L 3D25B 3LPFA 4M7KL 5I74C 3P2TA 1JERA 4R8WL 4RWYH 5IBLD 1EUTA 5IROA 5FUOL 4BJLA 3T2NH 3CVHL 5DZNA 2Q1EA 2BFGA 5C07E 3F85A 1RZ7L 3QHZL 3E8UH 3SBWA 5E5UB 4JJ5A 3RJOA 3ARDB 4MA3B 3SGKA 3MRLA 4FRWA 4DIXA 1LE9B 4OZHF 1NCCL 1X5ZA 1XZWA 5TDNA 1E6JH 3OAYH 1FGVL 4WWID 5EO1B 2ENQA 3IS1X 4G6FB 4MJID 2ZG2A 3D18A 2ROYA 3SCMC 5C0CA 4JQIL 5FWQA 5IOPB 3EG9B 5A40E 4OQ1A 4HQQH 4JO1H 4TV3A 5DK0B 35C8L 5DJXA 5IR1B 1F4WL 2C1OB 4QT5A 3DV6B 4LMQI 5DZOA 4DP6X 5LJYH 1EGJA 2CXKA 3WFDL 3ARUA 3WUWA 5EUOB 4LCCB 2FVNA 3WDHA 5J11C 1I1AC 5IJBC 2H4EA 4NO5B 2WZ6A 4U1IA 4O2CB 2XQYG 3E3QC 1X5YA 3TBSA 3IFLH 4C59B 2QDWA 3AY4C 3DECA 1N8OE 4NKDB 2IANB 4BSVB 3WMSA 3ZE1E 4P46C 3PGDB 4Z1PA 3CMOL 5EU7E 3GSWA 3QWRA 4OW6A 1EEZA 2MEJB 2OMWB 5T1DL 4NKMA 3EF7A 5GJTH 3P73B 5GS2H 3RUGE 3KVQA 4MHHG 1HZKA 1N64H 3MBEA 3U4AA 3QHTC 3QPQC 2J4WH 3STZB 2HTKC 3MUGA 4ZUWB 4Y2DD 2WHVA 5IVXB 2G4GA 2VUOA 4EOWL 4ICXA 2EH8L 3B9KC 4KRMB 4M93B 1P6FA 1W0YT 4OBRA 1JAEA 1EX0A 4KY1H 4AGPA 4Y5XC 5ALBL 2X2YA 3CHSA 4NPKA 3G5VA 2JQMA 3FQ2A 2ITFA 5D1ZB 5D4JA 1OGTA 3MRDB 5AW5B 1TG8A 5MEND 4ELKB 1KV3A 1WBXB 2A6IB 3DWTA 4EUPA 1KLUB 1QUPA 2ZWKA 1FI8C 7CGTA 5INDA 4ANWA 2OSWA 4NQCE 1KB5B 3T04D 4OKVA 4XMPL 1SXZA 3WSQL 1OXYA 4PQXA 1QFWM 2ENJA 3CH8A 1SRDA 1L7TL 3RWJA 5C0JA 3RFZB 3I2CH 2I9TA 1LK2A 1OP3K 1T20A 3UP1A 5FO7B 1D5BA 3GMOB 2GIXA 3D87B 5J57B 1H6UA 5DZVA 2UZPA 4NQDD 5KSBF 1QNIA 3K6IA 3QK0A 5D2NB 4GNKB 1DQKA 1AG0A 2CPCA 2Q6WA 3QH3B 3TFKC 2OMXB 1CGYA 1RHHA 2FEJA 3AREA 3DRQB 2X2HA 4EI5D 2ZTBA 1J8SA 1B4TA 1NIAA 3U4KA 4E9XA 4LE8A 4U1JA 2VMCA 3MRHB 1XF5A 1WE5A 1JTPA 3L81A 4UBDC 4ZXBD 3I6LE 3GMRB 1AHWC 4OFIA 5D6CB 4WVRA 3P4MA 3V4PH 2RGSA 1AGCB 3LVTA 3BWZA 3LH9A 1E9QA 1ESOA 3F58H 4RNRB 1CE1L 2OL3A 4HJJH 5CLZA 2LR4A 2VXVH 2R4RH 3KYKH 5EU5A 1A7RL 1AZCA 4KDTC 4OLVH 3U0TA 3N43B 5JLZA 3LJ3A 4DUVA 1KIQA 5F0LB 3LB6D 4WFGE 4X6DB 3TBWA 5FDWB 4BZ1A 4AEIH 4MTMA 5FUZH 1JWMB 3MFFA 4LF3A 4KZ0A 3WXWL 1E27B 4P2CG 2AJ3B 3DHJA 2PP7A 4ODTH 1S7WB 3LQMA 3DX9B 3QUXB 2GKIA 1Q1JH 1PBYA 3U0WH 5FM4A 3T8XB 1TTAA 1MHHB 3TPUA 2NUTB 5D5MA 3KYMA 4Y4HB 5IW1A 4PJEE 1XT5A 3RTLA 3P3YA 4EF3A 1G4MA 4MJ6B 3TH3T 2WYZA 3PP4H 1TEFA 3CZKA 2MOQA 3EH2A 1IGFH 3LX9A 3P69A 1NCIA 4OF8A 4X5WA 5IBLC 3WS3A 5CEZE 3AQDA 4OD1H 4PWEA 3TN0C 2VDQL 2P5EA 3VQ2C 4RZKA 1KZQA 3VGGA 3QRLA 1AGFB 1PX8A 2APFA 4ZMNA 2YHGA 5DD3L 2FWOA 4LSUL 5E94B 5I1EH 3CN2A 4FI6A 4LRIC 2P80D 4K3JL 4EVNA 3FT9A 1EH9A 3CSYA 2E9JA 4WHYH 5JDSB 3HAEH 4WRLA 1FFPB 4NWTH 4R96A 4JQVA 2BW5A 1UUSA 3LCYA 1B0WA 4OCRH 2H45A 1PAZA 3HG1D 3DX7A 3QPXH 1FIEA 4FMFA 2BHFA 4GO9A 4JFFE 4X5QA 2IG2H 3ULUH 3BWAA 3MCLH 4NT6A 4UQCA 1WS8A 3ZE2E 5HY9A 3WYRA 4MB3A 2XTJD 2YARA 3IU3B 4ADIA 1ANUA 3OKLA 1JV2B 1SGKA 3O11B 4H0GA 4Z18A 5DXWA 1ONQA 2EYTB 1MCLA 2BOCA 4JKWA 1A4BA 5L8LB 2NXYB 2Y1YA 4GIAA 4J3SA 2VW4A 3H42L 3O4LB 2ZUVA 5JHAA 3PFQA 4I3SL 1DL7L 1X7SA 4G8IB 4HHWA 5C0IA 2FWSA 2VO8A 1KBVA 3D2TA 4PJGB 5AB1A 2WQRA 2VR3A 4WI0B 2W9DL 1XSOA 3DOSB 2QR0B 3X3FL 5F8QC 2ZICA 2ADGB 3MSPA 1MG3C 3K81A 5D6CA 2KC0A 5IHWA 2EP6A 4N0YL 4FNTA 4L29A 4PJCF 4Y2DC 4OCSH 3SE6A 4KZEH 4PJ9B 4LDCA 5IK3A 1IFHH 3QG7H 4R7DB 4PCYA 3WKYA 3B5GA 3K3QA 4QYAA 4EDWH 3ZYZA 3MXVH 4QXGH 4JE4B 4KZDH 4U6XB 1R0AH 1XO8A 4BFKA 3IDJB 4XHJD 4AE0A 2BW4A 2GVYA 3ARYA 3IJSB 4IM8A 1PZUB 1CLYL 4DQOH 4OIIL 2AZUA 5HJGA 2IPKB 4ZTOH 1YEJH 3B8YA 4ZNEE 3H54A 1F6AA 2BDNH 3QUYA 2ATPB 1AIZA 2L7EA 3KBHE 3RWCB 4C4KO 5AD0A 3FU8A 4YDJB 2NUTA 4F7MA 1G7JB 2JTYA 4BSWA 1L9OA 3ILDA 4AVJA 4XZUB 3KLHD 4Y5VA 2NDFA 2OYPA 1KPRB 4B9GA 4MJ6A 4PHZA 1B3IA 1YPZA 2CXGA 5M94B 1L0YA 2Q0ZX 5IB1A 3N55A 1BLIA 4R2GB 3BH9B 4N2IA 4IBYA 5EN2B 1I8LC 4NM8H 5D7KD 4JQIA 5DRNB 3MJ9H 4WJG3 1UVQA 5GZNA 1SLUA 1GJWA 2A4ZA 4NN6B 5DS2A 3GMLA 1OM3L 1NLDH 4PIRF 3G7TA 1MHPH 1AQMA 2JXMB 4X9BA 5FO9A 1WAEA 3BUYA 3GF8A 3QQNA 1LK3H 4EI5C 5E8OA 4MXQC 4F7EB 1B2WL 1FFPA 4GQ9L 3L45A 5LN4A 3ZZ1A 1HQRA 5GRUL 3SYQA 3UZQA 1NCUA 4D7PA 5E5LA 1Z6JT 4KRLB 5FYKH 3WTXA 1O0VA 1PZ5A 2NY0B 4X8CA 4NXKA 4UINL 4C56A 5H4ZA 1CD8A 1IKFH 4ERSL 2M1KA 4L8DB 5KBLA 1R34A 1MCBA 4LCWD 3REWB 2HT4D 4HJGA 3U9UA 3OHMB 2E6JA 4EXKA 4BHUI 3X3GL 4YAQA 3IFNH 1RUAH 2QQNL 4H8WL 5D1XE 3IRPX 4JVPA 5CEZH 1K6QL 1PNCA 4OV6F 4LSSH 5DA0B 5EU6E 2W0FA 4YXLL 5I1CL 3HZMB 1JYXA 3S88H 3VXPB 1ADQL 3LB6C 3R19A 4UMSA 5DFTA 2X0UA 4PI2A 2XX1A 3HS9A 3KXFD 5EB9A 1XX9C 5BZXA 1X7QB 5KYWA 5DC9B 2AK4E 4JRLA 2CLZB 6PAZA 1DQML 1L3WA 2NYKA 3T0DA 4TSAH 1NEPA 4PJDA 1BBDH 4YDMA 3H0TB 4ABVA 3RTQD 2AK1H 1FF5A 3AXIA 5EEVA 3GJFH 3IMTA 1QBAA 4ZX6A 4LL1A 3FCSA 5DLMH 4GUPA 4LL9A 4K94H 1MJ8L 4YHKH 3LEYL 2O4EA 4NNPL 5KYXA 3BVVA 4N28A 5J6SA 1Q72H 1BYOA 1SN5A 4JRYE 1E8YA 3IJSA 5BOPA 4ODVH 1QSFE 3QDMB 4AT6A 1D5ZB 1V10A 4UQ3B 1LM8V 2KPWA 2V8LA 2WGNB 2YMXL 5I74B 3KVDD 3T0EE 3MN8A 5KBPA 4GEJA 4JN1H 4XN7A 3GHEH 4ODHL 3UTTD 3D85D 3QC6X 1XWVA 1MCSA 2DEWX 3MNWB 1CZ8H 2HFGH 2XBZA 1FH5H 2R29A 3VD5A 5C08E 2V3FA 2YA2A 4JFSA 2EYSB 3EH4B 2WZPA 2MKWA 3ECWA 4OLUH 1AH1A 4RAVB 3HFML 4URTB 3EFDL 3SCMB 2X9ZA 2CHXA 4F57L 4F7PB 3GSOB 3H9SD 2AV1B 5D71H 4WEEA 2GTWB 1J8KA 2XTJC 1KNOA 1XR8B 4JS7A 1IQDB 3S3CB 3DVNB 1IBHA 3LXBA 2W91A 4JFVA 2B0SH 3RGHA 1FRGH 1ID2A 5JDJA 5L4IA 3Q8FA 4H8QA 3NRQA 2PUQT 4JFOA 3BP6A 3BVUA 3FN3A 3IGAB 5E6RB 3FO0H 4BFIA 5F6HI 3BJLA 4M6OL 4N4YB 4EDXA 4LARH 1BEYL 2EEXA 3KNBA 4P46B 1Y0LA 5LXVA 1GW0A 2YGNA 3F6IA 4N86A 1HWHB 3REWA 1DVYA 2ADFL 4XPFH 4XCEB 4GW5A 4MS8D 1FVDA 1R3LB 2K0RA 4YDKH 1NCJA 2BJMH 4NEHB 3MJ7B 4HDIB 1QFHA 1TNMA 4MA8H 4PV8B 2ZOLB 1E8ZA 2BWQA 2UVFA 1S7TB 3MBXH 3B6SA 3SGJC 1QR4A 3FT4A 1JZ8A 2AEPH 4LNVA 1ZA3A 3VNYA 2OQJB 5EO0B 5FM5O 1CU4L 3B9KB 1U2HA 4DKFH 1MI5D 1QA9B 4DH2A 2W0KA 3SKMA 3RWHA 3Q5YA 4Y5XB 4CW1B 4JX0A 1WD8A 2MQ0A 4R5VA 2IWFA 4BA0A 5DD0H 3GSUA 3FCTB 3NSFA 2R69A 3QRBA 3TTYA 1SOQA 2IMNA 4PGJA 1OD7A 5HYJA 3KLHC 5ICYA 3GSQB 4OJCA 3EGXA 1BAGA 4DGIL 4FTVD 2UVEA 2VW7A 2V17H 3AROA 2ZUSA 5CBEB 3OKEA 3QDJE 1KTLA 2NLJA 2AMUA 2Z92B 4R26L 2BIQA 3GTVA 1AE6L 3ZKXC 2NW3A 5IJKC 4H26A 1XAKA 1O7SA 2RA1A 3NJXA 3VXUE 3WUWG 1MIML 1GOFA 4PJAB 1OP4A 2Y0SA 2VDPL 4JREC 1I1FA 3KM1A 3FU5A 1J8HE 1Y07A 3MACL 1OK8A 4YO0B 2K8MA 2ZYIA 3DOIA 1OT2A 1X5MA 2R4SL 5DJYB 4M1GH 2LABA 1LEKB 2M2DA 2X4PB 1NAKH 4XB8A 3TZVA 4HWBH 5TGBB 3TBTB 1K72A 2PXYD 1NDTA 5GRXG 5ERWA 3KS0J 2DWSA 3CLEL 3X1EA 3OAYK 2HT4C 3DO7B 5BZDB 4J3BA 1FYTA 2XZQL 3CBJB 4ZOAA 1Q0YL 3H2PA 4H2AA 3MLTB 2BOBB 3NJGA 3QISA 3SKNB 3VUAA 3L13A 4PVMA 5IEHB 2JIXB 3UAFA 4YEEA 3DDGA 5F2FA 1I1AA 4XGZA 5D96C 1EZUA 4K9EC 2JB5L 3O9WB 5E1AB 4FABL 4FFYA 4JCLA 2F18A 1IBGL 2FJGA 2G3XA 3P0YL 1DEDA 3PAUA 4BUQA 1AR2A 4MD0B 2CLRA 3T3ME 3VH8A 2XTSA 3JWNG 3NAAH 5GHWH 3H7BA 1XL6A 5DFAA 3FQWA 5DMYA 4EXPX 3QJOA 3KZ8A 2EE0A 3RTQC 3MJ8B 3HNVH 4DO5A 4L9LB 4YLBA 1IC0A 4ABUA 4KNQA 1NBZA 3L5WB 4WKXA 5AUMB 1D9KB 3VD3A 2B08A 1WZLA 5KVFL 5ENWA 4UAHA 2GY7B 5DK2B 1Z9PA 4Q8BA 2LE9A 5K33A 1W0VA 3B9KA 4G9FD 3PIQA 4W6XB 3NFNB 3VFWA 3TYFB 1FNSH 3EJYD 4X0KB 1A6TB 2R23B 3MRCA 1JGLH 4BFBD 4X7FC 1G0YR 5BV7C 2ZSWA 3M88A 2WKOF 4B5EA 5AB9A 3RFRA 4A7SA 4M1CD 2ADJA 5AVQB 3TN0B 2LGNA 4HJEA 4XT1C 2GSIB 2HVJA 1F02I 5IT2L 2D9CA 4JKNA 4AV5A 5H2BA 5IW6B 2NUPA 2VR9A 4W9ZA 2DQIH 3BDYH 5TE7L 4NLHA 3UDWC 2H6PB 1BLNA 4Z3FA 5C0CE 3SN6N 1C1EH 1LE5B 1N6UA 3PWVB 3HG2A 1H6FA 1BX2B 4ZK8A 3QEGH 3WFHB 1QVOA 2DBJA 4KTYA 4UNUA 3KGTA 4N2EA 2Y2TA 3LZFH 3P4OA 4L5FE 1UENA 3RYMA 1W6LA 2IFFH 2R2EB 1HILA 3H9HB 1EHLL 3CBKB 1F3DH 2V7HB 5HVWA 3MLUL 4FHBD 3STLA 4DJMA 4ECNA 1I3GH 2DYRB 1LNUA 3LQAH 4G6AC 4MNHA 4DGWC 5EC2B 4LDEB 4S0TD 1A7PH 4MJHA 2QVFB 1MSPA 4MS8C 5JIQA 2A4EA 5F93C 4TSBH 3VWJA 2VDKH 4JCWA 4MB1A 3V4VL 4HBCH 2JLPA 4KXCA 4NERA 4AYDC 1UACL 1AHWA 3MCG1 3ZHKA 4AQAB 5EIVA 4XCFH 3MLZH 1UT1A 3OR6B 1TU2B 4Y2DB 4ABWA 3DDFA 3GRWL 4TPRL 2FSEB 4H0LC 4ZUSB 1F5WA 2WIIA 4XAWL 2VW6A 3GUTA 1NDGA 2IXQB 1L9PA 3ARGB 3NYKA 4PS3A 1HEZB 4XBGB 2WSDA 5IQOA 5L2KA 4KOBA 4Z9KB 1OAUH 1DUZA 1I3VA 4WO4B 1KTDA 3SE9H 1OAKH 4NZUL 4IJTA 4CSPA 3QHFL 1S5HA 4F8NA 5MENB 3JTTA 1DO6A 2DWEB 1IJNA 5FYLL 1PGRB 4XXWC 1O9WA 3JWNE 3MX0B 5HGGS 3AGWA 3B83A 5BZZA 3X1FA 4NBXB 1BD2A 2FDBP 1ZVNA 32C2A 3BAWA 3ARFA 3FT2B 1EO5A 3CJJA 3NFNA 3WEXB 3SPVA 2EVIA 2F9BT 1U58B 4W93A 4FQCH 1ZT4B 1WTGT 5T1MA 4G8EB 5HI4D 4FJ6A 1BECA 1T2QL 1QFPA 3FQXA 5EOCL 3FF8A 1AKJD 5KANG 4N2HA 2GEQA 1J0IA 1IQWH 3SDXA 3OKOA 3TIEA 4NQDB 4HUVA 2BWDA 3PNRB 3LPPA 1I9JL 3ZQWA 2GSGB 3Q9PA 5IBUB 3U4BH 1A1MB 5IHLB 1U3NA 4OT1H 4MJIA 4PGEB 4N0RA 2PXYC 1K8IA 4FXKA 1CG9A 1DFBL 3MO1B 5A2IH 4LEOA 2FZ3A 4OLYH 3N1MC 3GBDA 5D4IA 4P9ML 3EYOA 2VIRA 4HIXL 3IDMA 4FQ2L 3BAYA 5J6HB 3L4WA 3VSQA 1MZYA 4KK5D 5EUOE 1AGDA 5E03A 3UACA 3IAQA 1P53A 4GO8A 2NCEA 2HFFB 3UAEA 3Q8CA 4Y16D 3D3VD 3R18A 1GPOH 1CXEA 4HD5A 5IMOA 5LNGA 4KUZH 4W9FC 1A6AA 1FZKA 5HDQH 2AJVL 1TYJA 1M3JA 4JO4H 3WJJA 3POHA 2OMYA 2OXGA 3V10A 4QO1A 4LLDB 3Q0HA 3BGMA 3SDYH 3ASOB 1DSWA 2YSTA 1TU2A 4Y9FA 1JGUH 3BMWA 2VSCA 2EEAA 4BKLB 4MMYA 5LG6A 5DS8A 3EJYC 4IGBA 5D5ME 4MQSB 4OFKA 4O02B 5ETUB 4YJZL 4KQ4L 5L4MA 4MA7H 1G6VK 2Z7UA 2F68X 1EGJH 4L5FH 1Z9MA 1N6QL 4M1CC 5F88B 4ZFOB 1NANH 4Q9RH 3DSNB 1MFBH 1KJ2B 3MLSH 4JO8A 2XZZA 3DC0A 2X53A 2P5EE 5EZOL 1VERA 4GAGH 5JQ6H 4L1HA 1DANT 3VFPA 1UD2A 4MBOA 3MV9D 2AERT 3KPLB 1INDH 1NGYB 5EEZA 4XVTH 1X9UA 4IRZA 4JPVH 2HLAA 5DCCA 1DJXA 3SBQA 1OPGH 4ETQB 1IJ9A 2RR3A 4WWPA 4OJDH 1A4JA 2IH3B 4TUJA 4ZBJA 2PTVA 9PCYA 1Y1UA 4TVUA 1KIPA 3HG1B 2CNYA 3KGSA 1RJZA 3AS1A 5EORL 3LTVA 1HDMA 3U25A 2CJ3A 1QUNA 2X9WA 2Y1AA 3TPKA 1EHAA 2QGDA 3EXJA 4NYLB 3LZNA 2WW8A 2P4AB 1YUHB 3FUNA 4KKAD 2D3NA 1A64A 3IMRA 3OXSA 1UB6B 3BSHA 3L4YA 4AK1A 4QR7A 4K2UL 3EOAA 5D2NE 3QQ3A 2AC0A 2I85A 2AV7A 2F54D 5LXGH 4ZO7A 1PYWA 1JF1A 2VDRB 4PBDA 3HPLA 1CO1A 4EI5A 5T1LD 1UJTA 4MNQD 4GSDH 2NY3D 5DQJA 3JWNH 1ZVSA 5FF6B 4QRQA 4MYPA 4Y5YA 3EFFA 4ZXBA 3LH8A 1TJIH 1UM4H 3BZFB 5C2BL 1CMOA 3BHBA 1A6VH 3PGCA 5K1VA 4LSQH 3HKFA 3HNSL 4LPUA 2G0KA 3JWOL 1WIUA 4OCXH 3OSVA 5HGHB 1FHGA 3ES6B 5I16B 1J87A 2XOTA 1G1OA 3W5NA 5I26A 2BVPB 3AWGA 2YK1L 3H56A 4XXDB 2CR3A 1G9HA 1EEYB 1SYSB 4HS6B 1AZBA 3IMUA 4AM0Q 3D30A 3G08A 4AYFB 2PWFA 3CZJA 3KLKA 3MNVA 5F44A 4BFOA 4XTRD 2QPFA 1R24B 3ETTA 1C5CL 2J44A 3PL6A 2EIKB 2ISDA 5B3SB 2BRQA 5IQ9A 4PJ8B 2HA1A 5D4QA 3NCJL 1JDAA 1RIUH 3LY6A 4G1EA 2MKLC 2Z35A 2VDMB 5IBTH 2R51A 4J1UA 3RPBA 1UASA 3PHOA 5JW4M 3BP4A 1FUNA 2HJKB 2GB2A 1YJDC 3VXRB 5TQ2L 1OCWH 4AEHL 4Z7WF 3Q1SL 4MJ5B 2QGEA 3FFCB 5HI4C 4D8PA 3CZNA 1YPZE 1EFQA 3W3BA 1J11A 5AYUL 4Q6YA 3ZKXB 2QFPA 2XZCL 1BZOA 4ZRGA 4OZHB 2OL3H 3FONA 1ETZB 1JPTL 1K4DB 3EIFA 2Z34A 5JMOC 2VKXA 4PU2A 4G59C 1U8CA 5CGBA 3QQDA 5FGCB 3S5YA 2P45B 1A7OL 3GPSA 1VFAA 2EQDA 4OCLC 2BSCA 2PR4H 3KJ6H 43C9B 2XXMB 1IGCH 4MAZA 4BZ1H 1KIRA 3ZDZF 3A24A 5A2BA 4PJBB 4KK5C 3K74B 4LCWB 4U1MA 3MUUA 4X80H 5JA9A 5DQDL 2H26A 4A37A 3S5LB 3GSXA 3UABA 4JFED 1UHVA 1DQDH 4LLQA 4Y16C 2WQXA 3V4VA 1F56A 1KXTA 3UTSB 5DHEA 4ELMB 2F74B 5CEYA 3D52A 5D96B 4NO0B 3O4LE 5SWSA 5KS9B 3OMZA 4U1GB 3B2VL 3V0FA 5HGBA 1SOXA 2HPTA 1KB5H 3OGCA 4JO3H 4W9DC 3FU7B 3KMDA 3T0VA 3S4SB 1F13A 5F7MC 5BJTA 4MWFA 3RTQB 1TDQA 1NFDA 2JK5B 4PJDE 1VESA 3W11D 3PCYA 4UQAA 3NSDA 4XP9L 4N0UB 1WFOA 4F5CA 4MXVF 2Q8AH 3BYTA 1NIBA 1TETH 1EAQA 4MAYD 1P2CB 4LAQL 1N5AA 2Z4QB 3EYQD 4XO9A 3SGJA 1YEGL 3VGAC 1AQDA 5FCUH 3GEFA 4Q6IC 1YDPB 3MNZB 3P11H 4KJWD 3BN3B 2G60L 5CBAB 3GXPA 1UWYA 2R1XB 5BV7B 3LN9A 5EPMA 3FSOA 5A16B 4I48A 3UTTB 1OCRB 5D72H 1TQWA 4P9HH 4JG0H 3SDXF 4FQJH 3VG0H 4RDQF 5HJ3A 3RAJH 3VXOA 4OQTL 4AI7A 4HETA 4F2MB 1CLOH 2PYFA 1XHHA 3IKKA 4G72B 1NCAH 4X9FA 4XNBA 4G9DA 2VLJD 1MVYA 4L4VD 4E5XA 4P5KA 2WXIA 5IJKA 3H9SB 1SHMA 3QCVL 4KKAC 2EVJA 1BJ1H 4KAQH 4D9RE 1CFMA 1K4DA 5K69A 2FUTA 3B7RL 3TJEL 2WVVA 1QRKA 2WXHA 5AW0B 4O58H 3LEXB 3QSKB 1TQUA 4Q56A 3H9ZA 3WLBA 4LSVL 4IRSD 3M8OL 2NY3C 2Y22A 3QIUD 2NTFA 5CILH 5DJCB 43C9A 1XH1A 5DUPL 3D7PA 1JRHI 1WFIA 1QLEL 3OHXB 5FXCH 2VSKB 4QTHB 1CXLA 1CXFA 1SLXA 1T7ZA 2XIDA 3DJRA 3T5WA 1F6LL 1EJOL 1D2OA 1I4FA 3MV7D 4NO3B 4NQEB 4HJTA 4M4PA 4Z3HA 4FQHA 1LTXA 2IPTH 3ZHFA 1WWAX 1GKOA 4JZOA 4DSYA 1KC5L 3ECUA 1J48A 2IALA 3VD1A 1M71A 4XTRC 2IEPA 1OOWA 3SKJL 4N20A 2ARJA 1MI5B 3KXFA 4OZ4B 3DGCR 1I8MB 3N1PC 5I19H 4M5YL 4JQIH 2JB6B 2CRIA 3MYZA 4TQPA 4E0RA 3T2QA 1JNLL 2J8UF 3OJDA 2A38A 1CTNA 4ZMQA 1WP6A