3FF7A

Structure of nk cell receptor klrg1 bound to e-cadherin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
97
Chain Sequence
MDWVIPPISLPKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epithelial cadherin
publication title Structure of natural killer cell receptor KLRG1 bound to E-cadherin reveals basis for MHC-independent missing self recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 18
structure length 97
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3ff7A00
2OMVB 4AQ8A 1OP4A 1SUHA 2QVFB 3Q2VA 2OMXB 5CO1A 2WCPA 3UBFA 3FF7A 4AK1A 3LNIA 2WBXA 4ZMQA 1NCJA 3K6IA 3QRBA 4ZMTA 4ZMYA 2OMTB 3UBGA 5DZVA 2A4EA 4ZTEA 1ZXKA 3UBHA 2V37A 4AQEA 1WUZA 1NCGA 1Q1PA 4AXWA 2OMWB 5JYMA 3PPEA 2A4CA 2QVIA 2X2UA 2WD0A 3K6DA 4XXWC 3LNEA 4ZMOA 4ZMVA 4NUPA 3K5RA 2WHVA 4AQAB 4AQAA 5CZRA 2OMZB 4AQ8C 4NQQA 3LNHA 1NCIA 3Q2LA 4ZT1A 2EE0A 4ZI8A 4APXB 1ZVNA 2YSTA 3FF8A 4OY9A 3MVSA 5JYLA 1NCHA 1EDHA 4ZMWA 4NUMA 3Q2NA 3LNDA 4NUQA 2OMUB 4ZMZA 2YQGA 3Q2WA 3LNGA 1FF5A 4QD2E 4APXA 2O72A 3K6FA 3LNFA 4XXWA 4ZMXA 4AQEB 1WYJA 4ZMPA 5KJ4A 4ZMLA 1O6SB 4AXWB 1L3WA 2OMYB 4ZMNA 3K5SA
chains in the Genus database with same CATH superfamily
2LAGB 4Y9EA 3FOMB 3DV4A 2FHFA 2Z31A 5IQNA 2WXOA 1I9JL 3HHRB 3G5XA 5E2JA 3QWRA 4LEOA 4YR6B 1G5GA 4NUGL 1ORQB 1N6QL 1U58B 2FATL 5GRJL 2YD8A 5B3JF 1OO2A 2ZOTA 3CBKB 3S5LG 3GXNA 2YN3A 2EIKB 4LXFA 1TJMA 5T1DH 1UACH 4F7KA 3LKOA 3QQXA 4IRSC 4HAFA 4G8GD 2JKWA 3A4EA 4JFEA 1HKLH 3O4LB 1NUNB 2ITDB 4PD4J 5AYUH 2FE0A 3TPUB 2WVVB 4BUGA 5C6PB 4PJHB 4K8RL 3I9IA 3LS5H 2IWKA 1V7ML 1QFWM 3QT2A 2CLRB 2ZF9A 4QGTA 5AEAA 4XOAA 5JOFA 4GFXA 1K3ZA 3ESPA 1TZ8A 1PZBA 3F2LA 4J3OH 4H4NA 1AFVH 1IAIM 4N3TA 3MSPA 2R27A 4UQ2A 4CN6A 2F7IA 5CJQH 3UG5A 4PQXA 2GUYA 2JB5H 3FB6A 4ZFGH 4UINL 2BSRB 4IOSD 5LBSH 3U0TB 2AK1L 5SWSD 1KPRB 4E9WA 2XVKA 5ADPH 4N5EC 1EXUB 1LP9E 5B39B 1I1YB 4QCIB 2EADA 4M8UA 1A9VA 4DOHE 5B38B 5T3ZL 3K6SB 4Z3JA 2X87A 3FUKA 3H9SD 1A7NL 4B3EA 2FWSA 3OC5A 1XHHA 1DO6A 1TQBC 3NSXA 3WKYA 1LDPL 5CN3A 1AP2B 3WIFB 3BESR 4N9OB 4DCQB 5HHOD 3D2TA 1BZ8A 1KEMH 2AI0H 4WJKB 1A4JA 3DRTA 3BDYL 1E8ZA 4HJUA 4JN2B 3O2DH 5DHVA 4JJOA 4KNSA 1EJFA 3O6FA 3RJQB 1IVLA 3QZOA 4ZQKB 5C0DA 4E42A 1L9RA 4L3CB 5TDNA 1GGIH 3IMBA 3IMWA 5DMYA 2F53A 2Y7OA 2BSBA 1U6AH 3MFGB 1D7FA 5DJ2A 5AVYB 5D6DC 3M45A 4K3DH 1A6UH 1NMAH 1O9ZA 4O02H 4PJAE 1M56B 4WWPA 4Q8BA 5EEYA 1SJHA 4GRWE 4GKNB 4TVSa 3C2AL 4M9OA 4PB9L 4ALAL 4QTFA 3KLQA 5I71C 4IGBC 3VVWA 3QQ3B 5DRWA 5SWZD 5T1KA 3SO3C 3L3HB 3U0PB 1O6SA 2WP3T 3V5DB 1CL7H 1WZ1L 2ZCZA 4Q9BA 5F7HA 1LK3L 1KGJA 5AG9A 1MJ8L 4HUNB 2ZUSA 2X6CA 4L3EE 1TMCB 3X3FL 1OL0A 3OVUB 4QLWA 3OJDB 1KCRL 1IV8A 4EN2A 1VGEL 1U8IB 4DGIH 4LQFH 4XWGL 4JQIH 5IHBA 2Z91A 4Z7NF 1YC8A 3VE0A 3E1ZA 1YEFH 3DX2A 3MLTB 4NQUA 5FGCE 4POYA 1S7VB 4NO5B 1GC1L 4Q89A 1DL7H 4L8BB 2HH0L 4FCHA 4U6YB 4ZO9A 3D06A 4WUUD 4RGMB 5INCB 2B20A 5IFHH 1JTPA 4J6RL 2CIIA 2NZ1A 3DJZA 1QLFB 5I19H 1CS6A 1GSMA 1D5ZA 5IQ9A 3TJHC 4AQ1B 3GM8A 5KYUB 4N2DA 1U92A 2XY1A 4OZFB 5HYJA 3ZRFC 5H94A 2GY7B 4I18C 4ODSH 1G1YA 3HZYA 3OXSB 5D7JC 4P5TD 3VUAA 4CN4A 4P3WA 4XVJL 3FSZA 5AW2B 1FCGA 1I3VA 3Q06A 5C0AE 5JIHA 1MFAH 4YXKH 4LLYB 2WN2A 3NAAH 4MD0B 3G6AB 2B9BA 5AB9A 4CVXA 3LH9A 1PJWA 2A9ML 1GZPB 4XN8A 2X1QA 3JWOH 4TNFA 4WHDA 2H1LM 3MRNB 4LSRL 1KTKE 5AL8A 1MVUA 2D7TH 1I4FB 1JK9B 4S1SL 2D0FA 3POHA 4MA8H 5IHZA 1MI5D 1UB6B 1UXWA 2VIRB 3CZFB 4TKWA 4U1NA 3WJMA 43CAB 3ZKNC 3CVHA 3MACL 1QFWH 2Z4QB 5AVTB 3GJEB 4BFEA 4LZKA 4PV9B 3QXAB 3HE6B 4NBXB 4UQAA 4JFZL 3TBTA 3ILPB 3K81A 5CXPA 3L9RB 3STLA 1QTSA 1YJDC 2Z92B 1SGKA 4MXWL 5L4IA 3ZTCC 4KY1H 1P6AB 3O3EA 5SX5K 4K4KA 4I48B 1R3IL 2FJHB 3IK2A 3OKNB 1HK6A 3H1ZA 1VFOA 1L0PA 2ADYA 5G2NA 3Q43A 2FLBT 5MHSE 3EZJB 1EO8L 4L18A 3FU5A 2WSKA 25C8L 2NT1A 1MFEH 3NPSB 1A14L 5C92A 2BVTA 3Q5OA 5HDQH 3KWUA 2OMYB 3ETSA 4Z5RB 1QUPA 3L4ZA 1SMAA 3MRJA 4PG2A 3PREA 4Y16D 2AQ3A 2Q7NA 1D5MA 4L8SC 2QVFB 3I3EA 1WBZA 1W0YT 4S1RL 3T3MF 4BZ1A 3DBXB 1IC7H 3RWIA 4BQ9A 4ZO8A 3LIUA 3WJJC 1QR4A 3MLUH 3P9MA 1U2CA 2AJZA 3ARZA 4G8AC 5E1AA 2IANE 3KEHA 3GMMB 3CHSA 4NAMA 4PU2A 1T2JA 2LFEA 3G9VA 3KG5A 5JW3H 1LMKA 3QB7C 3RL1B 2GG1A 1MFBH 4PCYA 1HN1A 2VXQL 1JDAA 1OW0A 2VABA 5IBUG 3S96B 4FDWA 3VDAA 2XPZA 2YAPA 3ZVVA 4XC3L 2MOQA 2BWQA 4M3KB 4HF5L 5HHXL 5PCYA 3RUGB 4CVWA 2OTUA 5B4MD 3BISA 3LRSA 2W38A 3IETA 5DC0A 1G6RB 4MA1C 3T0EE 1HINL 3BH9B 5IUCA 1IAOB 1DBAH 3I9GL 2BVQA 2EIMB 5JHLH 1T83A 4BFIB 3VXPA 4OFPA 1N9PA 4FABL 4AYGA 4OLXL 1LE5A 5F88A 1H15A 4LCYB 4U3SB 1J86A 3T0EC 1FCCA 2TSBA 1AI1L 1GYWA 3D2UD 4HLZH 4MYWB 3UERA 1QEXA 4BSWA 1F4AA 4P46A 1F13A 2VR3A 3ESVF 5K9JH 2P4AB 1LE9B 1RK7A 4BEIA 3MREB 3X12B 1RUKL 3ARFB 5HPMA 2VNCA 1MIEH 5I2IA 4W9ZA 2LABA 4RWYL 4QNPF 3SE4C 4HBCL 4FLRA 3B7UX 5EUOA 4HIHB 1DCLA 2IGFH 1Z5LB 3PQYE 3W5MA 3OZ9H 4AGMA 3CFTA 3CQFA 5F8RC 5AAMA 5J6HB 4JM2B 4ODBD 4I77L 3OAUH 4JHZA 1V3KA 5FO9B 1E6JH 4ELMA 2FRGP 1H5BC 2DQEL 3CHRA 1A7RH 1SBBA 1KLGB 3C5ZC 5EU6D 4N0UB 1EWHA 1YHPA 4R5XA 1VSCA 4LB8A 4KZEL 2H2PC 1UA3A 3NCFB 3L4VA 1F97A 1NCAH 3D52A 3BWUC 3IDJA 4AYMC 1MCBA 1XSIA 2FJSA 1TNMA 4PJEA 1EDYA 3KVDD 1CYGA 2WQRA 3N1FC 1TU2B 4G72B 3ZKMC 5CS7A 2BY1A 1HHKB 2ZNWA 5HP5A 2FDBP 1VFMA 4Y19A 2OR7A 2YPVA 2XN1A 2YXWA 4OCLC 4UQ3A 1JZ2A 1IQDA 2NUPA 3FO2B 1BLNA 3MCYA 2X3CA 5DURD 4R2GB 3P11L 7CGTA 3EOAB 1EEQA 3U83A 4A66A 2DQJH 1Y18B 1SF3A 1MFCH 4WEEA 2CBOA 3BN9D 2XIDA 1FDLH 5CZXD 1G1OA 5LLIC 3ZYIA 1YUHB 3QCTL 2XCMC 2E7MA 2AJXL 4P4KC 4Y9BA 4FL4B 2A74A 4W9LC 3TH4T 3IF1A 3ROOB 3R4RA 5A3IC 3LN4A 3PGCB 3TZVC 3VRJA 3H7BB 4R96A 4J39A 4AYDC 4CKQA 4N26A 3BEWA 1RMFH 1KXTA 1NGPL 2X53A 4A7TA 1JMXA 2VJXA 4LLWA 2KI6A 3U1SL 1W0VB 4I3RL 2HP4A 5EZJA 1ACZA 3A21A 3MLWL 4TOYH 1CICB 3DIFB 4OB5L 3OR6A 1W8EA 1IQWL 3AXLB 4ZS7H 2Z93B 5AAWA 2BJMH 4DEUA 1ZVSB 4XNQA 4WUKH 3L95A 2OK0L 1LD9B 1O0VA 2E56A 2CO7B 4ZUTA 3L5HA 3BZEA 4PB0H 5FM5M 4ODWA 4HGWA 5DUMH 3T1FA 4EJ1C 3SOBH 4ERSL 2QZQA 3S35X 4QRBA 4QXUH 5EC1A 2VLKA 4UU9B 2R29H 2XWEA 1E5BA 1VDGA 4ZBJA 1YEEL 3ILDA 4Z7WA 3DUUB 4NQXB 3O4LD 4ZW7A 1I9IL 4HVBA 4PJ5E 1QWUA 1EZVY 3CVBA 4DPRA 2QQKL 4JGUA 1OGTA 3GGWB 4L3FA 3LEXB 3SGJA 2JH2A 2JTYA 3AT9A 3OF6D 5IB5B 2K6WA 1BZQK 3B1UA 3DV4B 3DXAA 2Z31B 4W4NA 3AY4C 2YD5A 3LVEA 1NDMA 4XOEA 4LEOB 1UA7A 5EU7E 3LEVH 2EYTA 1FNAA 4AYID 3CDGA 3HE7A 3ELAT 3HI6L 4X9FA 3KS0H 3MO1A 1S7RA 4GQPH 1JFHA 3FYIB 4JFDB 5E4OA 3QGVA 4G70B 2J6EL 1AS7A 1X3DA 4OZFH 1QWNA 5F7FA 4DSYA 3TNMA 4QOKB 2G5RA 1MXDA 5EU7C 2VM4A 4WSJA 3L3OA 5IGXL 3WFEH 4FXGB 2GIMA 1WFTA 4H44C 5ELIA 4E9LA 5FO8B 4WW2A 3H4HA 3MRMA 2VN6A 3ZRSA 1FL5B 5DXWA 1FFOA 1J0JA 1B2WL 1E2VA 1HC1A 2AXGA 5BRZE 1OAQH 2CO3A 3WJLC 1Z5YD 5C07A 4F7MB 2GBAA 2BFGA 3D1MC 5JOFB 1JGVL 2I27N 5ICXA 2OXHA 2ADFL 4YHZH 4YDLB 4PJFA 3ZZQA 3WDIA 4WTQA 4AEIH 3GI9L 1UYWH 4TQIA 2WGXA 3GMOA 2Z34A 1T5XA 1XGPA 3QNFA 4UQ2B 5F7WC 4EF3A 4ATWA 3QZWA 1LILA 2OI9C 4JG5A 3FPXA 4Z7UB 2XYCA 4TUJA 4YAQB 1MCSA 2ZX9A 3HB3B 2HTKD 1OP3K 4RFNC 1AMXA 5MENA 3DLQR 4RBPH 4OCWH 3WKNA 3NA9H 3UIYA 2B1OA 2AQ2A 4HIJA 4QMEA 5E95B 4JEGB 3BPLB 3P0YL 1OEZW 3FT2A 5DEGA 3D4ZA 1MVFA 4JDZA 3RGVB 4BSJA 3ABMB 1OAZH 2ZP0T 2EDWA 1M05B 2ARJB 3OHXB 4F15B 3DRTB 3ZE0B 2VO5A 2ZUWA 2P5WE 4PCKA 1DBBL 2PO6C 4QRTA 5C0CA 1MLBA 4IDJL 1S7XA 1U8JB 2Z65C 3O6FB 1OVZA 4DK6A 3GKWH 2ZP8A 5TDNB 3THMH 1MQKH 2XRAH 1WCBA 3D0LA 3MV7A 4WVRA 3T8XA 3HMWH 5DJ2B 1XFPA 2HFEA 5HDRA 2F54E 1SJHB 4PJXB 1QLEB 2X41A 2A6DB 5IM7A 1ILUA 1D5BA 3VGAC 2KLTA 3P3YA 5KBKA 1BZOA 5FW7A 5DRWB 5T1KB 4ONGL 3T6QC 2H9GA 5DA4A 1BVKA 4E41E 4TS6A 1WQVT 3DHJA 5I30H 2BVYA 3MC0A 4D8PA 4DTGL 2AJUL 1BYPA 1WC7A 4NQDA 2DQHH 3BFQG 5DD3H 2R0LH 3MRRA 3X3GL 2UXFA 4X6BB 2V33A 5BZWB 3QJXA 1U9KA 4JO5A 2X1XR 3D3VE 2Z91B 3UROR 3SJVA 4QJ3B 4WHTA 4P4RA 3BAEH 2F19H 2WCSA 2YEZB 1W2KT 2H1XA 4F8NA 4LPYA 1MXGA 2Z8RA 3BMWA 4IRZA 1J8SA 3GXMA 4ZMLA 2F68X 2HRPL 1TF4A 5F7EH 1OARH 1VJSA 4HS6A 1NFDA 3LEYH 4FP8L 5GRWA 4U1JA 1OP9A 1DJXA 4JS7A 1JZGA 2CIIB 4TN9A 1TO5A 1HS6A 2FL5A 1TYJA 1E4XI 4C4UA 3AROA 4JRXA 1TTCA 3RGHA 5IQ9B 2XV2A 4PSPA 2WO4A 4AEFA 4NLHA 3N55A 4F27A 5CJOH 1ZV9A 1MRFH 1F11A 4ZS6D 1XCWA 1U92B 2OZNA 2VLMD 3S37X 3RZCA 2VLRA 5H94B 4DGVL 4GG6A 2QQLH 2X6BA 3HZYB 3UTSE 1M7XA 4LAQL 5FHBL 1T1ZA 3HE6D 4J3OF 2UXTA 2QPSA 2F5BL 3QEQE 1GJWA 2XZQH 3VM5A 1BF2A 3JT2A 4K2UL 5J9PA 4XVUD 5EOCJ 5FHAL 3EUUA 3I6SA 1IGIH 1YYLL 1AQMA 1FL6B 3BUYB 1IT9L 1KLFA 2Z1KA 1YEGL 4XC1L 1J9QA 2A2QT 3PWJA 4H7VA 5F8QC 5TK2A 3QFJB 4ZQTA 3CHPA 1MH5A 3QHFH 1OT4A 3RA7H 1P4LA 4NPJA 3RJOA 5IHZB 1I7UB 2UX6A 4XP6L 3RWGA 4U1NB 1RH8A 3VD0A 4YC2C 1T0NA 3V7MA 3CVHB 4I0PA 1T7XA 3T4YA 2JI2A 3HNVL 3C8KA 4Z0BH 4U1HA 3T65A 3SDDB 2EO9A 2CKBA 1WHPA 2VERA 2CLZA 4HG4K 1N5YH 1JV5A 2DJSA 3TBTB 3RVTC 2XC8A 1BBJA 4GSUA 5DC2A 3STLB 4MA3A 3ATEA 3O3EB 5GZNC 2O4EA 1I8AA 3PHOA 5DQDL 3L4UA 2JJSC 4FFWC 4HCRL 4N90E 5A2KH 5IHLB 3NIDE 3HC0A 4ZW3A 1QYGH 4X5QA 3ZE2B 1KB9J 1CJYA 2RIKA 3GSVA 3OKKB 5KVGE 4HXAH 3ILQD 3KWWA 3SPIA 3TM6A 2E6PA 4OD3L 1NM9A 3D87B 3QZLA 4AGLA 2ALAA 4ONFL 4N2NA 4CVUA 3BAJA 2WWOA 5LN8A 5DGQA 1ZTXE 3RWIB 1YPZB 1P6FA 3P9MB 3WIIH 3S36L 1G9NC 4L2YA 5E1AB 4APXA 2BY0A 1GYAA 2FZ3A 2ZUVA 3FFCA 3QCVL 4XN5A 4B96A 4FEMA 4Z0XA 2DLHA 5TGBA 2YXMA 2NTSP 1BEXA 1I3GL 1MJUH 3HIZA 1QR1B 2GAZA 1N59B 3JWDH 2YD4A 3BLPX 4QRQA 2HWZH 5DTFA 2VABB 3WDJA 2BIHA 1R5IA 2PPAA 1RZ8A 2VAJA 4OJEH 3ARFD 1RJCA 2ZD0A 3DGCR 3KYMA 4QO1A 3U1PA 1AQHA 3NJJA 1OOAA 5K33A 3LRSB 5FK9A 4EIUA 2EJ1A 1NCOA 2PCXA 1TIUA 3P54A 5A7EA 2W07A 5CSZA 5GS2H 4WWID 1D2PA 2BVQB 4L1HA 4JM2D 4HK0B 1OM9A 3V7AE 2QADC 3WY3A 3VXPB 1CL7I 4YK4B 4R97C 1LE5B 4GMTL 5F88B 4HIQA 2A1WL 4N1CA 5HHMB 1N6VA 4NM4H 1DVSA 4D7PA 1YEIH 4BSWB 1J87A 5INDA 1W9XA 4GIOA 3PL6B 4JY6A 4ODTL 2EUZA 1WWCA 1KFGA 5EU3B 4LGRB 3B9EA 2QSCL 3QDJA 3VG9C 4F24A 3PPEA 1R5WB 4ORGA 5HPMB 2AQNA 5I2IB 3BFWA 2O5YL 2ZUXA 2QLYA 1TETL 1F4YL 5FYKD 4N4YB 1CFVH 5KG9B 1YNLL 2KZBA 5EUOB 1OCCB 5J57B 2VM9A 3HG1A 1E42A 1MZZA 4KK5C 3JXAA 3GSQB 4WFHE 3UAFA 4FFYA 3WFBH 2FJFB 3RQ3A 4AZUA 1RZIB 4GRLC 1C16A 2VGLM 2E75C 3QIWB 5IROA 2MEJB 1GJIA 4R2GD 1JPTH 5IJKC 4ELMB 4Z7OF 2VITB 3X11B 3QJRB 1UC6A 3TV3L 2GSGA 1IFGA 1NC2A 1WZAA 4RAUA 3VQLA 4N8CH 2X88A 2NLJA 3ZT6A 3IDJB 2HSIA 4GAAA 1JHLL 4PJEB 5DQ9A 4Y4KB 5A2LH 3X13B 4MJIA 3FZUC 4RISH 5FCSH 3EYUL 3M8OL 1QUNA 4LCWE 3D39E 1KPUB 4B6ZA 1OWRM 3BKMH 1L9OA 4Y19B 3K6OA 4FEIA 4JM4H 3WNIA 3PFQA 1IQDB 2NUPB 1BLNB 2HAZA 5L2KA 3EUDA 1T22A 5B8CB 4PJ8C 3VI4F 1DJSA 1KYOK 1N10A 4DNLA 2E46A 4NN6B 4GH7B 1Q72L 1URIA 2WANA 3GSNL 3GSUA 3MRCA 1VFUA 1EEUA 5C2BL 1CICD 1JDDA 3JWNE 4EDWH 2NY4B 1A7QH 4WI2A 5B7EA 2ICCA 1QFWI 3QZNA 3VXNB 3T77A 4JR9L 4W9FC 4ZD3L 2B8OT 3IF1B 1CD1A 2I9TA 4CGTA 1KJ2A 1KXVC 3C6SB 3VRJB 2YZ1A 1NCCH 4QXWA 3S8GB 5E8EA 3FUDA 1ESOA 4WW1A 1MFDL 3JWNC 4B9GA 3MRPA 3FRPA 1YECL 3ESMA 1IAII 3BEWB 4QAWA 2R0WH 1M6UA 4NENA 1KXTB 2ZAHA 4JE4B 4KI5F 5DHVH 2V5SA 1U8MB 2IWFA 1GZQA 1KACB 4NZJA 3TWYA 2PXYA 5IEKB 1TDQA 4X9YA 3KWVA 3S2CA 5F21B 1A6TA 3INOA 3PJSA 5EZJB 5I1GL 2WUCH 2F8OA 4FHKA 4OCSH 3UFIA 3V0FA 4F5CA 3CFNA 5B1CA 3OR6B 4DN3L 2GI0A 3FN3A 3UJTH 4HQQH 4HCFA 4R4BB 3T9WA 5HVFB 4HEMA 3DTXA 3H3PH 2Z31D 2YARA 1GH7A 3ETTA 2EUXA 3NSJA 4KNTA 3BZEB 3T1FB 3NCYS 3QXTA 4RRPG 1TITA 2JI1A 1H3GA 5EC1B 3FCTB 2DQTL 1DVQA 2VLKB 3LCYA 4JFDD 3S5ZA 3VQ2C 4D9RD 5C9KA 3BD4A 2VLJE 4BK8A 5SWSE 4Z7WB 3I2CH 4FD0A 2KPNA 4QOKD 4WEBH 1FNSH 1I9EA 1BIIA 3Q8EA 4LGSB 4V11A 1PLAA 2D7OA 1OGTB 4JO2H 5CZRA 2QSQA 3E6FA 1PZ5B 2V0AA 4XP4H 4EO5A 4QKTA 3H9SE 4JREC 5DLLA 2JELL 4MNQE 3Q44A 3FU9A 2XX0A 3DXAB 2V5MA 1O9VA 4LLVB 3FU8A 4CC0A 3CMGA 1G84A 4Z6AT 1QBLH 4KV5E 2VWEE 2VDQH 2HX7A 4FQ2L 4U2ZA 1A6ZA 3BP5B 3MUZ1 4PJHF 4MNGE 3HE7B 1CFBA 1KIUA 2P24A 3CWGA 3A6CH 3MO1B 1TUPA 2WY3B 5FA3A 1A6WL 1KCLA 5IVXB 1JWUA 4OCMC 1I75A 3HB3D 3RVUD 2Y36H 3TNMB 1U8KA 2VWEC 3ES6A 5D71L 2APWA 2IFFL 1AHMA 2ZQKA 4GQZA 4NUMA 1Q90A 4WW2B 1S7SA 4YSAA 3MRMB 1EANA 1WEJL 3GSXA 4ETQB 1J9SA 4NBYB 4HIPA 4ZTOH 4F58H 3V6OC 1J18A 1D5IH 1EZVX 4Y89A 5C07B 3RGVD 2I85A 1Q1JL 4WEUD 5ICXB 1UT2A 1WA2X 3LNGA 5GJSH 1PZDA 2FYVA 3QO1A 4PJFB 4Z7VA 3ARTA 2O72A 3OXRB 4Z7QF 1S9KC 3ATDA 3GMOB 1XGPB 4EMZA 3N06B 4IK7A 4P2QA 3QZWB 4NUJB 5C6WH 5HSFA 3O6FD 3WTYA 3ZHNA 4TUJB 3LB6D 1QEWA 4D0BB 3VTTA 1XR9B 3O2VH 4R7DB 1NWOA 5DJXB 2H3NA 1KENH 4LSQL 4NN5B 4HIJB 4YFLF 3KPRE 4KROB 2FWOA 3BCDA 4KKNA 5T1KD 5DEGB 3I6KA 5IEHB 4E5XA 4JDZB 3T0XA 4C55A 5JTWA 1H8LA 5FOBA 3P9LA 4P23A 5D93B 3STZA 4TNVK 4WFFD 3QZBA 4DO6A 3MOAH 3ZRCC 2Q1EA 3B2XA 3WKQA 4AQEA 3FQWA 3L3JA 4QRTB 3S4SB 5C0CB 1MLBB 1S7XB 4NOBA 3ARBA 3ISWA 4UZUA 1TTBA 1Q0YH 3MV7B 4JG1H 5I1DB 4PJDB 5C0RL 4H0LC 3CBJB 2WXHA 5EWIL 1KJMB 2HFEB 2P48B 5J0BA 1EEZA 1OTTD 5KUMA 3STBA 2RCSL 4X83A 4OGAC 2UWEF 5BO1L 1D5BB 1G7PA 4X8GA 5E8DH 3MZTA 3GXTA 4FFZH 2IH3A 2R4SL 1YN7A 3FC8A 3RWFA 2H9GB 2J88L 1CYXA 4A6YB 2YPLA 2WHVA 3Q0HA 3C08H 5JUEH 5ERWB 5K1JA 4AQ8C 3V0DA 1Z3GH 4A2MA 4D8PB 4YFLI 5F0MB 4FADA 5JXAH 1UT9A 3E6HA 5E70A 1DQDL 5GRVL 4UM8A 4Z3EA 3GEWB 3CPLA 1SOXA 4CRPA 4TNWK 3A24A 4ZXBA 3MRRB 1NGWB 3C60B 4LMQI 4TMPA 1VENA 3LPFA 3QA3A 3QI9D 4JFYA 3ZR6A 3RP1A 3SJVB 3B9KC 1HHHA 2PP8A 4X8XA 1W80A 4UCFA 3OKLA 2P8MB 4EDXA 1PKQE 4HH9A 1EO7A 1PX4A 1RK1B 4V2BA 5KW9H 4CAGA 2X4QA 4EPSA 4KH9A 1Z9NA 3QFJD 4P9MH 2DD8H 5DHXB 1XH3A 1ZT7A 4ADJA 3FQNA 4C59B 4YL4A 2FECL 1ORSA 4TYUA 4KHTH 5FYLH 1AZZC 2VDKH 2BRRL 4K3GA 3J07A 5IOPA 1F11B 1B4JL 3Q5TA 1I85A 3RZCB 1XMEB 1U3HC 2VLRB 2ZXDA 4WJ5A 5A43C 4J3UA 1QASA 4GG6B 1MRCL 5J6SA 3SDDD 1T1ZB 2JKNA 1MHCA 4B9YA 2W9DL 3DBSA 1X5FA 3X2QB 1JUFA 3R06B 5LBVA 4HLEA 3K2UH 2ATAA 3PV7A 3DETD 4PS3A 2EO1A 4XX5A 5DFVC 5J3HC 4H8UA 4YPGB 3TX4A 2QQNH 4FX5A 4IJ3B 5IMOA 3WFDL 1INDH 3RWGB 1IGYA 1T0NB 5FLUA 4FI7A 4I0PB 1I1AC 4ANUA 2A6KA 3T65B 2YPVH 4BWWA 2VJ8A 1J9RA 1H0DA 2CLZB 2ZOKA 3ATBA 1JV5B 2EECA 2FEEL 4P49A 4HETA 3FH5A 2UUDK 1MVYA 3NK3A 1CE6A 5IWLC 2X6MA 3DRQA 1NGXA 3W39A 4OAWB 5ICZA 2RB8A 3AREA 3D25A 3PHOB 1TJGL 2BY3A 2NNAA 3B2VH 1P7BA 3HC3H 3HC0B 3L7EB 1II4E 1BXVA 4OZGE 4YHNA 5H2BB 1KN4L 1H3UA 4Q0XH 1OM3L 2OZ4L 3GSVB 3MXVH 3DJ9A 1MIMH 1PEZA 4MBOA 3BYTA 3LTVA 5LCVH 3KWWB 3MNMA 3NFNA 2O6PA 2WLHA 1HAUA 4FNUA 4GS7B 4MGXA 4TNEA 1IEHA 4JVPA 1KLUA 5DRZA 4NC0B 2ATKB 3QIUB 2VZTA 1BAFH 2E7HA 3EGDB 3T2NL 4PRIE 1MSPA 2R0ZL 5IESL 2DQGL 4RGNE 3RUGF 1KZYA 5AVSB 4APXB 2FZ3B 3FFCB 1KJ3L 1BBDL 5GS0L 2PWDA 1YYCA 5TGBB 3MLZH 3VH8A 5HHMD 3A47A 3ZPDA 2C4XA 4YBQD 4GP8B 4DQOL 2VKXA 2GAZB 1RFDL 1YMMA 4QRQB 4AY0A 3PL6D 5DTFB 1R4XA 4N8VG 3S9DB 1IM9B 4RGNC 4NQCB 4FNQA 2R7EA 1NPNA 3KYMB 4NKIL 1N4XL 4X9GA 2WQXA 3PY9A 4W6YB 5D1ZI 4IBZA 4RFOH 2DQDL 3BUTA 3Q2WA 3MV9A 4H20L 3IJYA 2Q6WA 5IMLB 4LSTH 1CF8H 3OWRA 5F7MC 3UACA 3T3PB 3R7QA 3CN1A 3QIWD 5IFAL 2IH9A 5G4MA 2NYZA 1JZDC 1ONQA 4UUJB 3CZUB 5ANMB 1YNTA 5B3SB 1BZEA 2BSCA 4A7GF 5TK4A 3CX2A 3DROA 4KI1A 3RBGA 5INDB 2HKHL 2GJ6A 1AG0A 2JMRA 5BS0E 1WZLA 2Q20A 4Y4KD 5CMAA 3ECVA 1OPOA 3OAYK 4ORGB 4AVKA 4G6FB 1QI4A 1RZKL 5CZXC 4OGXL 1G7HA 1M6OB 4UILH 4Y19D 1G5AA 2XJKA 1OLZA 4GKLA 5H37G 1ZHBB 3O6KH 3OKDA 2CRIA 2CDEB 1C16B 3AG3B 4PRDA 4HG4J 1L6PA 3HRZC 5GGVL 1ILSA 4MAUL 1NAMH 1PIGA 2Q7YA 3SQOL 4HUVA 1PY0A 1NC2B 2J6WA 5LDSA 2NLJB 1EGJH 3F65A 1GS7A 4GW5A 1RAMA 3BIKB 1ZVYA 4PJGE 3HS8A 4FQCL 2NY4D 3RI5F 1OAXL 3RVVD 5EC2A 4L5FH 3DX0A 4MJIB 3BRDA 4LDEB 2FSDA 4WI9A 3EYQD 8PAZA 3WNOA 3S98A 2BS71 1QUNB 2D0GA 5GIRA 1NGQH 3RVXD 4QHKJ 1ERNA 2Y7SA 1PBYA 3HPJA 5DMIL 5L2KB 3BUPA 4PFEA 3OPZH 5GRUL 4C83B 3BPOB 3QAZC 4OIBA 5KBMA 4OFYA 2EDJA 3FYEB 4M6OH 4XCNA 4HWEL 2P1YA 4Q14A 5EHFA 1HL9A 1RIHL 4KXCA 2PNDA 3MRCB 4XZ4A 2YD1A 4NO2A 4QGYA 5D7SH 4MNHA 2NW3A 3GM0A 4FNSA 3GRBA 4ISVA 2QKIB 4I9WE 3T77B 3V6FB 2I9TB 3M1BB 4GBXA 4G1EA 5AOJA 5DVPA 3LXBA 4O5LL 3JWNG 4O2CA 5E8EB 1EH9A 4WW1B 1VFAB 1PSKL 4HJ1A 4NENB 3KM1A 4X5XB 2XX1A 4J3BA 2VLKD 3V5KB 3CC5A 2YBRB 1GZQB 2PXYB 1UM5L 1KDJA 3RDTB 1ASQA 2WWKT 3ECBA 5JDSB 1TVBA 3SCMB 1QRND 1MHPH 2YGVA 1T2QH 4PTUA 2IMMA 1PG7W 2VCOA 2Q76A 2ZXEB 1X5YA 3LDBB 3AITA 2AQSA 3LZNA 4KU1A 3GIZL 1L0YA 1EX0A 1WYJA 3INUH 4F2FA 1UACL 1DBJH 4NCDA 4PRPA 5IZ7A 3DXAD 4NWTH 3B4NA 4JW3A 4E9QA 2NY5H 3DOIA 3TS8A 3HW7A 5AYUL 3PAVA 1RJZA 1R9FA 3JSSA 5MEOA 3KR3H 4RESB 3L3GB 1U42A 1R47A 3QJUB 2AK4A 2ZG3A 3NEEA 4AK1A 2VH5H 2F74B 5FEBA 4RQQA 4POZD 3HBZA 4MDJA 1BIIB 1AHKA 1O7DE 1OB1A 3HKZA 3MRFA 3QFDA 4ODXA 4ZX3A 2BX5A 2UXVA 4IRZH 1DLHB 4A55A 5CJQL 3VSQA 5KWYC 1C5BL 1N70A 4AL8H 1T80A 5C07D 1DDTA 2HTKC 2LLLA 4IBVA 5I6KA 4HD5A 4FTVB 3DDGA 3LX9A 1KG0A 4WF7A 2B2XL 4LOEA 2PP9A 1O7DC 2UY6B 4PW3A 4RAVB 3BGFC 1A6ZB 4ODVL 2EUVA 5FGBC 1KC5H 4UMGA 4TV3A 4BINA 4FRWA 4XPGH 1KIUB 5E0FA 5B22A 1O6TA 3CTTA 1L9NA 3T09A 2NW2A 4EUPG 1X4XA 3U0WH 2EIZA 3CG8A 4U05A 1C8PA 3W0WE 5C0ND 1KYOJ 3D48R 3ES6B 1BQUA 3DOHA 2J57A 4R4FL 3FQ1A 3GHBL 1KEML 1VZIA 1S7SB 4M56A 1SVCP 5EUKA 4KROD 3PWPD 5EDXA 1GGIL 3LKSA 4NPYA 3HNTH 5E08L 4FQIH 4Z7VB 1LEIB 1HYSD 2OXGA 3HR5A 5KVFH 1JPSH 1OE2A 1I9RH 4K3DL 1NMAL 2OSXA 4JFTA 5C0CD 2C3XA 1KV3A 2BMKA 4P2QB 4QF1A 5T5FA 4ZTPH 2H0PA 3U7AA 2ICWJ 4WDIA 2MFNA 1YCSA 1QEWB 3BKYH 4NHCH 3VWKA 4H88L 4JDTL 3MV7D 3TO4A 4LQ1A 5D7HA 5GJTH 2BNQE 3CZLA 2CKBH 1XEUA 4QTIH 4FE9A 1F3JA 2LV4A 2H3NB 4N20A 5DMKA 1K9TA 3N85L 3U46B 3KZ8A 3FBQA 4X7DC 1FZKA 4UOW1 3ISRA 5TE7H 3ZO9A 4LDOB 3I6KB 4NX0A 4E5XB 5AZ2H 4LKXA 3STZB 3P9LB 4P23B 4AIZA 5FOBB 1X4YA 3H2WA 4X80L 5L0QC 2VXQA 3UJIH 4ZMXA 3P2TA 1BQHA 1QVOA 3COOA 2Y07L 3QWQB 2Y7MA 1JNNH 1UCBL 1XF3B 1DQMH 5E9DE 4WHCA 4AQEB 4F8QA 2D73A 1YRKA 3P3TA 2DKSA 1L0QA 4A67A 4M61B 3TA3C 1EAPA 2WVSA 3FAWA 3C60D 3MMEA 5JQHC 3ARBB 4GSDH 5FF6B 2VLME 5FB8A 3ZKXB 3VGDA 1U8HA 4LU5H 4RA0C 4V1DE 3DVFA 1HH6A 4G1MA 2CG9X 4OVUA 1YY9C 1YY8A 1EEZB 5I1HL 4GKSA 4X4MA 5EOQH 4OUOA 1U4FA 3RWFB 3APMA 1THAA 2OV0A 4G7VL 5K59E 3JBG7 2X4TB 1UM4L 1T66D 3HE6C 5FIEA 4OI9A 4OM0L 2Y22A 4MZRA 1ZOXA 4XVUC 4DK3A 3E6HB 2WGNB 4X6FA 1U95B 2G2NA 4X2UA 1ES0A 4ZXBB 1MFAL 4YXKL 4A2DA 2AAVA 3NAAL 5T5NF 2NT0A 2X2UA 4LSVH 3RZCD 2VLRD 1KGYE 1VPOH 2ZTBA 1HHHB 3KMDA 1DE4A 2C1OA 3MDJA 4PJ7E 4ATTA 2AV1A 3NPSC 4HMDA 4MA8L 3ARGA 4F20A 4KZ0A 1RVFL 2EDKA 2X4QB 4PJIB 5B3NA 4FULA 4JPSA 1XH3B 1PG7X 3BPCB 2YEVB 1ZT7B 3KD4A 3P77B 2DH3A 4P2RB 2YS4A 3FQNB 1I7RA 1UXSB 2C7UB 4PHXA 5I1AB 2QPUA 1ORSB 2ZUUA 4EN3B 5I74B 4LCIH 5AG8A 1OGAE 3GDCA 3VXQB 1E43A 5IOPB 3RWDA 4I0PD 1GHFH 4PAZA 3NVQA 3PHAA 4L3AA 1PLGH 1DQQA 4ZSOA 3DI2B 4AVHA 1GW6A 1DCEA 4LFHG 4QHUA 1LEGB 4WRLA 4ANKA 3W9DA 4AUJA 2VSKB 3NGBB 5SV3A 1AACA 3IGFA 1Q94A 4UT9H 3S5LB 1MFEL 1NDGB 5A16A 5IHHA 5HDQL 5L8KB 4IRSA 4OJYA 4YDIH 3NIGE 2MNUA 4DUXA 5KTEH 1JWMB 4XPAL 1EJOL 2EH8L 4XE5B 5IMOB 1XCTB 3IWVA 2NTFB 1QBMH 4KX7A 4MZIA 1V7NH 2BERA 1BG9A 2QEJA 4AKQA 5HJ3A 3K6FA 4FMFA 3HG4A 2KZ1B 3ATFA 4B9CA 3FCUB 2A6KB 4KRNA 3QIUD 1MFBL 1IBGH 1INEL 1ITCA 1H0DB 4OLVH 4U3CA 4Z78B 3OMZA 3GHEH 4KFZC 3ZE1E 1M7UA 2CR3A 4WTZG 1FZJB 2Z6FA 5DWPA 1CE6B 4C4KO 5E4IA 3W39B 2J2ZB 3D8MA 3FFCD 1NLDH 5BRQA 5DVNA 5IKCB 3Q2VA 3SDAC 4TRPH 3EJYD 5A2CA 3CFKB 5FX3A 4JM2C 4BHUA 1NCNA 2XKUA 5JHLL 4B9ZA 1IM9D 5HPOA 4NQCD 4UV7L 1LYQA 2VJ0A 2WVTA 4PMFA 1QPXA 3APNA 4U0RB 1ZSDB 4HGMA 2X2IA 1KJ2H 3OZLA 5E99L 1T4KA 2XA8L 1KLUB 3VCLB 1H19A 1JVOA 3B9DA 2FO1A 1LP9A 4X5PA 1D7BA 2JWYA 1MG3C 3M88A 4NLAA 4LHJB 1KCVH 1X5XA 3VXSA 5DRNA 4QHPA 5K9JL 1M7DB 3QRGL 2WLZA 3IFOA 2CK2A 1MWAA 1MIEL 2YOAA 2P5EE 2NSQA 4G6AD 1CGXA 4X8CA 3VH8B 4BFFA 1QW9A 4TL5A 4OGYL 2BHUA 3ET9F 5C70A 2EDRA 3OZ9L 1YMMB 5D6DA 4KPHL 3DO7A 2HFTA 5J6GA 2C3WA 1WIUA 5KS9E 4HDIA 3OAUL 5IQ7L 1D5XA 4LCUA 4G6FD 3OD3A 1IEAB 5DZOA 4IGBA 1YAIA 3V0JA 3P0VL 1A7RL 2WZAA 2R83A 3AM8C 4WY7L 4FGMA 1BFVH 3VD5A 1QFUH 4KBPA 1SY6A 4PP1C 1P84K 4OQ1A 4PJAA 2YWZA 4U4BA 5I1EL 4FL4C 2CRZA 1HH9B 3EYSH 3FHEA 4LHUG 4OR1A 2J6EA 1MOEA 3ZOAA 4WI0A 1ONQB 3Q05A 3OMNB 2QSTA 4XNYH 2WYTA 4XMLL 5DEFA 5BMFL 5C97A 5HGBA 4NZUH 5EUOF 4F3FA 3D9AH 4AYFA 4E9TA 3U2JA 3FTZA 1SXSA 3RKDD 2R69H 1ZD6A 5JDJA 2B08A 2GJ6B 4GB9A 4UDUB 1NANH 5KANG 3BC9A 1E0OB 4L3EA 3K8KA 5CMAB 4MJID 4ELMF 1T6BX 2WQ8A 5D4JA 5MEPB 5EIIG 1EV2E 2BIQA 1G7HB 1UH4A 1FDLL 3U6RA 3TWCL 5EZIH 2WYIA 4HT1L 2VISA 3QQ9D 1BXAA 2XETA 3OKDB 4PJEF 5L2KD 3TT1L 4PRDB 2X4UA 4TSCL 3AG1B 1J5IA 1N67A 2YXFA 4WI4A 2QGCA 3WO4B 4HUVB 3RTLA 4RNRB 3ARXA 1XSOA 1FE8H 5DJCA 4GW5B 4I18A 4Q58C 5D7JA 4ZMNA 4TTGA 4W9DC 2I25N 2GTQA 2LTQC 1GPOH 3F7VA 4Z23A 3DSFH 1JGDA 2N1KA 2X2HA 1FA4A 3SE6A 1N7ML 3LS4L 3QDGE 5EC2B 3K71B 3IN0A 5DDHB 5DA0B 2YN5A 4XOBA 5F7BA 1WH0A 1U41A 1CG9A 2ODIA 1SBSL 5GIRB 1ZSHA 3BHBA 2E5EA 1DVXA 2HYMA 5LDUA 4I1NB 3C12A 3HPJB 1WPCA 2P8PB 3OLGA 4TOYL 1DBKH 2PYFA 1VACA 4HWUA 4KQ0A 1IFHL 2UZIH 1WWBX 2H41A 3BZ4B 3NJNA 4D9RE 1TTFA 3RJDA 4AT6B 4ZS7L 2PXYD 1L7TL 3CFCL 1Y07A 4NKOB 1IL1A 3RDTD 2W60A 5F1NA 43C9B 3SCMD 4NNXB 1B0GA 2K9FB 3AMLA 4WWOA 2O61B 1J1PH 2NYYD 3AT0A 4RMRA 4PB0L 4NO2B 4XRCA 1UENA 3L2MA 2UVFA 3SOBL 4M62H 3MV01 1CGYA 2HMID 2J44A 4XPHH 1FVCB 5CP3A 3AGWA 4UTBA 4GBXB 1U8PA 3QHZH 2XA3A 3BDXA 3LAFA 3MUHL 2L7JA 3WMSA 4K7PH 2DTMH 4FXGC 4O2CB 1NL0L 2HT3D 3L7FA 4N2BA 3IJEA 5EO9B 1NCWH 4EBQH 3FCGA 2YAHA 4Z7UE 1NCIA 3EKCA 2C26A 4QLRA 3KPSB 5AUMA 5I24A 2CJUH 2FT7A 3TL5A 5M94B 4KUZL 1WA1X 3ZHKA 1E6OL 3RU8H 3ECBB 1TVBB 3JQOB 1JRHH 3DX7A 4PTUB 4M6MH 4ADIA 4L8SA 2XBZA 5I6XC 1A21A 4X5WA 3ZX1A 3NN8A 1RIVH 1H6TA 3WJJA 1P4IL 3ZZSA 1KN2L 3RNQA 4Z7WF 4PRPB 1N12A 4LL9A 3MU3A 3CLFL 4FTVD 4M7ZC 2IG2H 1UD6A 1DANT 2EICA 1IFRA 1O75A 5DMJB 2BVOB 3CK0H 2AMGA 4XVSL 1HZHL 4LT7A 3WFEL 5MEOB 5CIPB 5BXFB 3H9HA 3BPLC 4OM1L 1ZANL 2K0RA 3GTVA 2AK4B 3CJJA 5IBUB 2VW4A 3RGVC 2G30A 1OAQL 4FG4A 3IU3A 3KGSA 1R3JA 4HWZA 4KVNL 3OHXC 2IO5A 1BM3H 4RQQB 1DVFC 1WDAA 2V5TA 1OB1B 4MDJB 1WICA 4ODXB 4AEIL 1UWGL 1CDUA 4IEFB 2B4CC 2VDLB 4LLUB 4PLNC 2OJZH 4M5ZH 4Z3TA 4DUWA 2BIIA 4L4VB 1E5ZA 3GLAA 2MKLC 3FUMA 4AW4A 2IPKA 4DF9A 3LZOA 2VUYA 5FW8A 1W8NA 4HJJL 1AZCA 3T0EA 1KB5B 4QTHB 1FFQA 3PDDA 4IMLA 4K73A 2V4LA 4WW2F 1QBBA 1HIML 3A6BH 2XV0A 2F61A 2Y6SC 4P2QD 3NA9L 1FORH 1RZFH 1HHJA 2NW2B 2EIZB 2ODHA 5F96H 1F8TH 4WLCA 2KDGA 1J5DA 4MKMA 1Z9LA 5E9AA 5F71A 1A1NA 3SE4A 4PJFF 3MBWA 5F6IC 3RWHB 1DFBL 1KIRB 4L05A 3MRDA 1SVZA 3TJEL 2CO4A 3BW9A 1FYTA 3GPEA 2MQGA 3OJVC 1RQ5A 1RIUH 5EUKB 3SY0A 4PGEA 1M9WA 1A7OH 4E68A 3LN5A 1H5BA 4HCRA 1PCXA 3LKSB 4P23D 3C5ZA 3EYVA 1MQKL 3THML 1UCTA 3CSBA 3WV0A 4AVJA 1TJIH 3ESNA 1QWHA 3HMWL 1UQSB 3NSYA 4MD5A 3EJUA 2X9YA 4YDMA 3HZKA 3F85A 3GMNA 2BS8A 4OZHE 4XMPL 4TLTA 3PV6B 5F6HJ 1H6FA 4WDIB 1DUZA 3ARBD 2H1PH 1FG2B 3GJFA 3R19A 5C2UB 3TO4B 3NCJL 2R1YA 1MQ8A 4JUSA 4MJ5A 1W72B 2WMPA 3BUBA 1FYHB 2BY2A 1F3JB 3B9AA 1E9QB 3JYCA 1FZKB 2WLNA 2Y3NA 3MLYH 3QI9C 4LIQL 3MLVL 1OAUH 2ZYIA 1IC0A 4LKXB 4RLDA 3BSHA 3LYRA 1G6RL 1QVOB 4RX4D 4JHWH 1OCRB 2H2SC 2Q8BL 1LO4L 1QO3B 4P4KA 3KDPB 4P2OB 5A7BA 1U93A 1EDHA 3ULUD 5E2VH 1J0YA 4ZXBD 3MMEB 1HEHC 3F7RA 1VEMA 5CF3A 5FB8B 1U2HA 3NA4A 2CRYA 3C75A 5DI8A 4PWFA 1A0QH 1SEQL 4L4TE 1HH6B 2AKRA 4G1MB 4QAMB 1LM8V 3TZVA 3ATAA 4TSAL 1G9ML 4H0GA 5HI5D 5C0GA 1A1OA 3SHSA 1UXLA 4OVVA 4HX1B 1MEXL 1KYFA 3KDMB 5D6CA 1E40A 1E3FA 3GMQA 3RL2A 1MRFL 3VXME 4CU6A 3EDJA 1JGIA 1XAUA 4J12A 5K39A 3K1DA 1OQXA 1NBCA 3SDDC 5AFAA 1AXTH 1DQJA 1XF5A 1PCSA 2IPTH 4P2RD 3ZE2E 2NY6C 4JKNA 4X6FB 5IK3A 4EN3D 4EUPH 5AW6B 5FM5O 5L2JA 1ES0B 1IGIL 3DETC 2VN3A 2ENYA 4EKXA 5E6UB 1NFDF 2YGQA 1I9JH 3KHQA 3FN0L 1KZQA 1G6VK 1F45A 3UBFA 1P7KA 2FATH 5GRJH 4N8UA 1CFMA 3B3IB 5DD6A 2C1OB 3RA7L 1YPZE 4GW4A 2DJ4A 2AV1B 4XN9A 2XV6B 2C8NA 3ARGB 4XPBL 4RRPA 3N1MC 3NZSA 2MPAL 1K6QL 4HZ1A 4YVUA 5FYKL 4GG6F 3N40P 5CJBA 5KVDE 3UH8A 4GAYA 3UAEA 4IYKA 1I7RB 3KLKA 1N5YL 3WN6A 2EEBA 1V7MH 1ASOA 1UHVA 1B88A 1K4DB 4HEPG 3SYOA 1A9EA 3WE6A 1SXNA 5JLZA 2PW1B 1CC3A 1UD5A 3RWDB 3MYJA 4P04A 3ZZ1A 5KYXA 3MJ9A 1AQDB 1QABA 4QHKI 1DQQB 3UIZA 4ZSOB 1CT8A 3AY4A 2NNFA 1TTUA 4QHUB 3BUQA 3W9DB 4WI3A 1ETB1 1Q94B 4X7EC 4UINH 2AK1H 3FW6A 4RGOH 4BKSC 1RUML 4FA7B 5A16B 3OX8A 1QP1A 1NMCC 2V6HA 1NCDH 1DZBA 2X4RB 2H7WA 2GW5A 2H0EA 2XG4A 3UBXA 5T3ZH 3VFMA 4IHOA 1CLOL 2UZYA 4YK4C 5HJ3B 4CC1A 1Y0LA 1LDPH 5ID1B 3WJLA 3QYMA 3CSGA 2HB0A 3VB9A 5C0JA 5GGRA 4EZJA 3B3BA 1EBAA 3KJ6H 2QMJA 3ZYZA 5J4MA 3PL6C 3BDYH 5DJ0A 2V2TA 4GSRA 1E7VA 4UB0L 2DI7A 3H55A 2HWZL 3UL4A 4WI5A 3K1KC 2XQBL 4MD4A 2CXKA 3LNDA 2FYYA 2YD3A 1XX9C 4G5ZH 5BRZA 2JQAA 3QE5A 4PRNA 1H9VA 2ZSWB 2D3JA 4X6CE 3ETBF 3N04A 1DUYA 1ID5I 3TF7C 1IAMA 3ZGHA 2KL6A 4OW6A 2XWTA 3A0OA 1YMMD 5FYJE 3RX5A 3QIWC 3C2AH 4PB9H 5DLMH 5DJZA 3ZKSD 3MYZA 5DJDA 5CLYA 4HUMB 4HMCA 1HHGA 3U4KA 1TQBB 1A2YA 1WZ1H 5CU5A 3U7WH 5TE4L 3GZPA 5B7MA 1LP9B 5FKPB 2XHNA 1YEIL 3G3LA 2HLEB 1G7LA 3APDA 4BXSV 3K5SA 4Y4KC 4DP7X 4WFEE 4DOHB 5GISH 1J88A 1KCRH 4N0YH 5DRNB 2PO6A 1XL4A 3LV3A 4N1HB 1MWAB 3RX9A 3EO1A 1T5KA 4M1GH 1CFVL 2OJ1A 3QARA 2FR4A 4HD9A 4JUTA 3VW3L 2H32A 5KSBA 2XKNA 4L0ZA 5B8CC 1GC1H 3VG0L 3DO7B 4WENB 2ZX5A 2HH0H 1O7SA 5I6OA 1QQDB 1QSVA 2DEXX 4J6RH 4N8CL 3WS6C 2YD0A 2NY0C 4PJAB 4BBWA 4HJSA 2F54A 4GRWB 2Y24A 3MRBB 3QUMB 2Z1PA 4WI0B 2FAUA 4B5EA 3NCMA 3NBNA 1TVHA 1GXEA 1ZPUA 5KVEE 1YDPA 3RVXC 4E41A 4JMNA 4F3FB 3J7HA 3MV11 3WNLA 4AYFB 2NNXA 2X0WA 1FPTL 3EFFA 4XVJH 3BWAB 4EZLA 1KBPA 4KKRA 2I5YL 3QEUA 1BJ1H 4L3EB 5T3XH 1HVXA 5IBLD 2EO7A 2VDPB 5DK2A 2WKOA 1A6AA 4OT1L 1UEMA 3D3VA 2NXYB 3U6RB 1BYOA 5FUCE 3ULVD 3VA6A 4CMHC 3JTBA 4S1SH 4LEEA 5FGCB 4IKLA 5L7XL 1U8OA 2X4UB 1HI6B 2CMRH 5CEZE 5I6MA 1A7QL 3DHMA 2EDLA 2TSAA 3MACH 1TJXA 4H26A 3VXSD 4AG4H 1CFSB 2WK2A 1QRNE 1G4MA 4JG9A 1NCCL 4OZIB 4I18B 3CLEH 5D7JB 4URKA 3QDME 3CSFA 5CGYD 1ZLDA 3LXCA 4MXWH 3CFUA 4Q2ZA 5I26A 2HJLA 6TAAA 1XL6A 1IE5A 1CG9B 3QR2A 4GBXD 5AOIA 5IW1A 2F1BA 4O00A 2RAMA 4C57C 2PN5A 3VFVA 3WTWA 1U36A 3BHBB 4OH2A 4XR8C 1IGTA 3OTTA 1CQYA 2WUCL 2YZ8A 3OQRA 4JANA 4OCSL 2XWBB 5FC9A 1K4CB 1MCWM 1SZNA 1VACB 2PYFB 3ARVA 3QEQA 1EO8H 1QLEL 2HVJA 5T5FH 5C0AB 4G8IA 5KJ4A 4Z18A 2Q0ZX 3KPSD 1GZHC 3KXFE 4MB5A 2PPCA 1IL1B 2CGYA 2D3VA 1YEHH 1ZV5A 2W60B 2VZ1A 5F1NB 4JY4A 5I1KL 3ESOA 1V3LA 4XNMA 5J12B 2P5PA 4S1RH 1CYWA 4XRCB 1HZKA 2JB6B 1MG2C 4NI6A 5B7FA 2CGZA 4JFPA 4YWGH 2Y06L 1JD9A 3DPBA 4K5LA 4PRPD 2KMWA 5GZNA 1U8PB 4BA8A 2IQAA 4POZC 1CR9H 2IGLA 5DF0A 2VXQH 2JJSA 1QSFE 2Y2TA 4NPKA 4WEBL 3VSTA 2R1XA 3IDMB 4Z9KB 1FNSL 1WUZA 3O41B 4JO2L 1P84J 1Q9WB 3D4YA 4XC3H 1JSYA 4Y5XC 4HF5H 5HHXH 5CILH 5AUMB 3G9AB 3CVIL 4ZUSA 3MNDA 5I16A 4G2AA 2A4CA 1WD9A 4RFEA 1HINH 1Z7JA 3V4VA 4ZFFB 1KGXA 1U0QA 5EORH 5BVJA 5F7YC 4KOBA 3HG3A 4X5WB 4HISA 3NN8B 4FABH 1PYWA 3NTCL 4OLXH 2YAEA 4L4VD 2VDMB 4CGUB 1JZ3A 3HCVA 3PWPE 3FONB 3SY6A 3LJ3A 1LGVA 5E03A 1JF1B 1AI1H 3HC2A 5D96C 2X9WA 1AR1D 3LKRA 2XIBA 4Y2OA 2ZX8A 2XWZA 1WZMA 3WXVL 3H9HB 4KROC 1RUKH 1ZWIA 3U4EB 3GMPB 3AWGA 5K69A 3IMSA 4N8VA 4RWYH 4ZTOL 2IANB 1D5IL 2YUVA 2BDNH 3QC6X 3EJQA 4HBCH 5D93C 2BW5A 2CNYA 2WXPA 4HWZB 5E23A 4CA4A 2IBGA 2ORBH 5CAYB 1HYSC 4I2XA 2J8UE 5JXED 4MA1B 1ZLUH 4I77H 1R3LA 5A1AA 1B0IA 1SDAB 2ZSVB 4KJWD 5HYEA 3EYOB 5JOEA 2DQEH 3KYKL 4YE4H 2W80C 2VR5A 4JY5L 3CVHL 4DAGL 4KZEH 2BSSA 4FLSA 5E6RB 5AOMA 1TQWA 3T0EB 1S9XB 5DFTA 2WBWB 4IMLB 4YDZA 3GUFA 1AO7E 3QUYB 5EF3A 1KENL 1CFQB 2CPCA 4MX7A 4JCLA 1HHJB 5J89A 5JA8B 2YGOA 5PAZA 5C3IA 4KK6C 3Q8CA 4OCRH 3TO4D 1A1NB 4Z7VF 3SSGA 4FTDA 1AZVA 1K5WA 3F6LA 3MBWB 2JIXB 4PMEA 3MOAL 1A47A 2GIYA 1CI3M 3L16A 1KPVA 3P11H 3C60C 2XFGB 4GRLA 3SY0B 4KFMA 5IJKA 1X5IA 3B6SA 1KTDB 2Y5EA 1H5BB 2OMVB 5GRVK 3EO0B 1Q0YL 3DX9A 2OFQA 3C5ZB 1ZK5A 2BHFA 3EYVB 1BZ9A 1CXHA 3II3A 4JG1L 4NQVB 3WE1A 3QCTH 3PQYB 1DDHA 3HAEG 2AJXH 5GS1B 4FAAB 1J5CA 5EEZA 4MD5B 5DHEA 1XGUA 4JPQA 4BZ1L 1JN6B 4P2OD 4CSPA 1E65A 3HZKB 2I60L 1A9BA 1KGCD 3GMNB 5E8DL 3KLHD 5AZEL 4PJCE 1DUZB 4QWWD 2N0KA 1T66C 2GJJA 5F70A 4LSPL 4MJ5B 3V9CA 1ZPLA 4XMZA 5BZDB 1ZEAH 2WMPB 2DN7A 3OMIB 4LDLB 5E56A 3LPGA 2BHYA 2DTSA 3U1SH 3VXUA 1F1AA 4AJYV 4PJ8A 3OR7B 3GBML 4LCWA 5IVZA 3D39A 3VFTB 2QPEB 2JF1A 2VR7A 3PPSA 3MLWH 1KIPB 2IQ9H 1YZZA 4OB5H 2I32A 5DHMC 1IQWH 1IGCL 5L4JA 1U93B 3K5RA 3IDNA 4TL4A 1FN4A 1QNIA 4GJTB 1HSAA 5DI8B 3GSOA 1KXVA 1ZGLA 2DD8L 2AKRB 3ILEA 4FQLL 2LU3A 2V9QA 4N0FB 1GJUA 3SYCA 4ERSH 4WO4B 2G3MA 4H0IA 1Q9OB 2YWYA 4M5SA 5I1LA 5FXCH 3ARGD 4KHTL 4NERA 1FZMA 3O9WC 4F8PA 5FYLL 2C9XA 2DI9A 5D6CB 4Q56A 1KFAH 3GBNH 4YDKH 4NXKA 3GMQB 3I6LD 8FABA 4JFFB 4TVPD 2R59A 3NJVA 3IE4A 3S5YA 1DQJB 4OJCA 1N0XL 1WJ3A 2QQKH 1B3JA 3US9A 1I1RA 2O6CA 4DERA 2C34A 4YGVA 5IK3B 2WZPA 4GUCA 4JFHE 4UQ9A 3K2UL 3NP3A 5FPIA 4NZRL 4QRUA 1SY6H 3P40A 1LMIA 3MODH 2QQNL 3HI6H 3WY4A 4M93C 3TBYA 3UPAA 4GI6A 4GW4B 3CIAA 2HRGA 1SLXA 4W9GC 4WK0B 5SX4H 1LO5A 3EJSA 2J6EH 4YDNA 4ELKA 3RIKA 5MP6H 3U7YL 3PLYA 1QI5A 2JTDA 5ACMA 1E7UA 4W6XB 2J1ZA 3QIUC 3HEIB 5EN2B 4YSTA 4Z7OE 2COVD 2X4NA 4AX3A 2PCFA 2ZCKL 5J1TC 2IWGA 2Z0BA 2X3AA 3AMKA 1B2WH 4NQCE 3VXTA 1S3KL 3KBPA 1LO2L 1EMTL 3WE6B 3T71A 5LAPA 5JLZB 4IOSA 3IXTA 5SWSA 2R0KH 3MYJB 3FT0A 5KYXB 5LGJA 1S78D 3BJLA 3QORB 1HX0A 1NA8A 2IAMD 4PJ5B 1YSOA 1OF2A 4PREA 4NZTL 3HC3L 1JIBA 4OLZH 4XCYA 3GI9H 2GSIA 2A73A 3QUZC 4FOMA 4GKZB 3T3PE 4BE6A 5FR3A 1C5CL 1CCZA 3H9SA 3PRZA 3K8MA 3AG2B 4FJYA 5ANME 3TBWB 2X0VA 3OX8B 2EH7L 2K1MA 4UV4L 3ZSTA 2DB8A 4UOJA 1CFTA 4I87A 3LPWA 1T5WA 3CFEA 5HHOA 3MR9A 2VDOB 4WZ9A 4N5ED 3KWTA 2XG4B 1BZDA 4MNGA 3H0TA 1BAFL 4IBSA 3FU0A 3VFMB 4IHOB 2WD0A 4NWUL 2UZYB 2H4EA 4C58B 3P0YH 2NZ9D 3SKNA 5LVEA 3L9BA 3NK4A 1Y0LB 2ID5A 1HU8A 4G6AC 4JDEA 3HBPA 5T1MB 1T6VN 2Q9OA 3V6OA 5GGRB 1CIDA 2ZOOA 3MLZL 2LE9A 4N8PA 5IMKA 5DJ0B 4K9EC 3V95A 4GP4B 2ICWB 3O3AB 4PP2A 4IDJH 1ND0A 1T04A 3T2PA 2Y69B 3KW7A 5BRZB 2OI9B 5DO2C 4OLYL 2V2WB 2FO4A 5BVPL 3WNJA 2MOGA 1I8MB 3T2LA 3ABZA 2XWTB 3UADA 4LSTL 1QHOA 5HJDA 4X9IA 4L0YA 5DJDB 1CGSL 1YJDH 4ONGH 4AITA 4XZUA 4RMQA 1HHGB 3BE1L 4UTBH 1KXQE 5CP3H 1N0LB 5IQMA 5BO0D 3RKDC 1MCDA 2Q8AL 2VN4A 2WPGA 4B3VA 5I0ZA 4GSQA 1RZJC 3AACA 4RMTA 4DTGH 2AJUH 3TBSA 4HSCX 2B16A 1PZSA 2EKSA 1UWYA 2PO6B 4G9DA 3N42B 4JQXC 4DK5A 3LV3B 3DJSA 5C0IA 1F56A 2D8KA 4M43L 2JXMA 3EO1B 4HPYH 1L9MA 1HEZA 4G42A 3MNZA 3UO8B 4NQEE 6FABL 5I1IL 4UILL 5L8LB 1NBVL 2FR4B 4N2IA 2JNZA 3PNWB 1CE1H 2XKNB 2P5WB 2H45A 4L3ED 3O6KL 2PWEA 1PZUB 1NKRA 2G2RB 4A7SA 2HRPH 3NJXA 4XAKE 9PCYA 5AVRB 4ZZKA 3VGAB 1PY4A 4HHAA 1YNTF 2VDMH 3ZKQD 1S3RA 4MVBC 4KC3B 2WTPA 4XN7A 1G87A 2NXYD 3EAKA 3EBHA 3A22A 3P4OA 1WUNT 1GIGH 3EBIA 1ZE3C 4K07A 1WITA 3UPRA 5C86A 3CUPA 3Q8BA 4AQ8A 1CU4L 3IDGA 4AW7A 2F54B 2QKIC 3DMMC 3LRLA 5F7AA 2MWCA 3QUGA 4U3XA 1C7TA 2W8CA 4L5FL 1KTRL 3EJTA 1TVHB 4MMZC 5EMYA 2E6QA 1YDPB 4DGVH 3QRBA 3LKNA 4E41B 4LAQH 3P3UA 3WNMA 3EFFB 2HA1A 2F5BH 3B9KA 5D7JD 1E4XL 1JPST 2YSSA 1KTBA 5CCJA 5I1JL 5FHAH 3QEUB 3B2DC 3P73A 5I76A 1MI5A 2W0FA 3R0NA 4G7RB 4DKTA 3CN2A 5AWNH 5DK2B 4HIIA 3RDTC 3N6YA 1M2VB 3SCMC 1FRGL 4ANXA 1Z2KA 2YPKA 2OMWA 3QJFA 4TQEH 3D3VB 2OJEA 4A2EA 2NYYC 3S97C 2ROXA 5J13B 1KY6A 5CKGA 1ZT4A 5I1CH 4O2FA 5D7SL 3L6FA 1PKQA 5C0AD 5F6HI 1AAJA 4BH7B 4Z7QE 4H26B 2YK1L 3DV6A 4N2KA 3HNVH 5E5RB 3F05A 1U3HA 4JMXA 4JAMA 1SN5A 5E4AA 3R18A 5I66A 3BP4A 3BWSA 3MRIA 1XF2B 2HJLB 4CSTA 2X10A 3JV0A 5DQDH 4JRFA 4HCRH 4FTVE 3VFVB 1PG7L 1MHPL 3UTSB 2WTRA 3O8XD 5C0FA 1EEYB 9CGTA 4JANB 1UJTA 4U2YA 4Y2NA 4NEHB 5FAAA 3VFRB 3QO0A 4BFGA 3TNNA 3F64A 2C3VA 3LN9A 2HVJB 1OZUA 4LMQE 3OKOA 5D7LE 4F33B 1MW3A 1FLTX 3NJIA 3IMVA 3L4WA 3VX0A 4YC2B 3GJFH 4A6YL 4JY4B 4ONFH 2Y1YA 4OD2A 2NY5L 4Y0GA 1I8LC 1I1AA 4XBMA 3UC2A 1PQZA 1FH5L 4DP0X 5MHSD 5HYIA 4JFPB 3BLKA 4P2YA 4R4ND 3NFPA 2V5RA 4MAYB 1UEYA 2VE6A 3UG3A 1KCBA 3GC3A 5IWLA 2WSDA 2IQAB 3FBKA 2E47A 4YBLC 3ZDWA 2BP5M 2VMCA 3SE8H 5E00A 1I3GH 1S7QA 4N9GB 4N2GA 2R1XB 1FFPA 1EAJA 4FC3E 4TQHA 1CB4A 5H4YA 4MQSB 5D5ME 1FAKT 3CBRA 5KJ7E 3VJ6A 2Y2YA 1COBA 5FKAA 2IAND 3CNKA 1UWXH 4P5MA 2EXWC 5AQ0A 5I16B 3SQRA 3UTTE 4KGJA 3NIDB 5LO7A 3D2UA 1BA9A 2XQYA 1JI1A 5TH2A 1LTXA 1KC5L 3VM7A 2WWMC 2G75A 5LQBH 5F1OB 4JDVA 3SZKC 1PYWB 4FNRA 1RUQH 3F7LA 4LPCA 3MRLA 2A1WH 3U0WL 3HCVB 4G9FE 4JZOA 3T0ED 3L54A 1IX2A 3DWTA 4QHLA 1RJLA 4Y2OB 3FCSB 2QSCH 3QUYD 4PRIA 2GK2A 1S5HB 1ZWIB 5FO7A 2QMKA 4MXVF 1Q4NX 1TETH 1UZ6F 3GS7A 1F4YH 12E8H 4JFOB 4N8VB 1YNLH 3JYBA 4H1LA 4XVTL 3DYPA 4AUYA 5E6IB 4FQIL 4ADGA 2JIXD 1SPDA 4ZFZA 1JPSL 1R24A 4X7CC 1R3LB 3CXDH 5ALBH 1MJ7L 2OMTA 2CCVA 5CGBA 4OUUA 2QADB 2DMBA 2FBJL 2N0MA 5IR1A 3HUJE 3TV3H 1Q0XL 3KBHE 2BSSB 3BKYL 3K8LA 3C5ZD 3V52L 3PQYD 5GJTL 4ZNEE 2H2PD 3CVDA 2CJ3A 2CKBL 1JHLH 1AXIB 1KBGL 4QTIL 4J3OG 3U30C 4JHVA 1WHOA 4YSRA 1UB5B 2PPFA 4GUPA 3M8OH 4AJVA 4LP8A 2I69A 3MJ9H 2DRUA 1M57B 4MLIA 3BEVA 3C9NA 5AZ2L 3ZKMD 3UJIL 4ZYKA 1TTRA 5K5YA 2Q5BA 4BH8A 4YL9A 1JNNL 4M1DH 5BS0A 1H9DA 1XD1A 4UM9A 3ULUC 1KPVB 1BQLH 4XGZB 1JERA 2IXQA 4GRLB 5FYKU 3SZ6A 4I5BA 3HRZA 3B6SB 1PF3A 1RUAH 3DUSA 4YHPB 4GSDL 3S3SA 1UVQB 2I07A 4R6UA 4OF3A 3GSNH 1BZ9B 3VYNA 5KSAB 3K4AA 1YO4A 1ZY9A 5HI5C 2PR9A 4HFUL 1OSPL 2WB7A 3IDXH 1U3JA 2XPYA 1LWHA 1A9BB 5EOQL 4JR9H 4N2LA 4ZD3H 4LKCA 5FUOH 4QY8A 3FFOA 5ES4B 4R0LC 2APVA 5A3ID 3SDXB 1MFDH 3ZY7A 1JV2B 3KL3A 2DYSB 1I1FA 1SDDA 1YECH 2BIOA 4PJGA 2DWYA 4WO4D 4ZOBA 4EN3C 4YDJA 2QVTA 5EB9A 2LT9A 3ML9A 2XI9A 4OLEA 5IBTL 4ANVA 3RHWF 4PJ8B 3FOMA 5IJVA 1UFGA 4R8WL 1DSFL 2EDMA 4JFFD 2HVKA 5CBAB 4LCWB 1G9EA 4NFBA 1K8IA 5K9QI 1QZNA 1T1YB 5IFJB 1F18A 3GF8A 4YR6A 4DN3H 3KGUA 4K3HA 4JHBA 1CXFA 2PR4H 3K0WA 5KBLA 3IDNB 5A2AA 3MHZA 1FN4B 3PHSA 4XB8A 4ECNA 1HSAB 3AADB 4G8FA 1VF5C 3GSOB 3MKGA 2EVJA 4OLWL 4WCYH 2KC0A 3TPUA 3EH5B 1CLCA 4C47A 3IS0X 3D07A 1IC5H 1JXGA 3QPQD 4P5SA 2DIJA 4YHKL 2E27H 2XN9E 4K9EL 5I1LB 2Y2WA 1E27A 2CLRA 5GRXG 4LCIL 3HS0C 3AS1A 8FABB 2E9WA 2C1PA 4U3HA 4Y9CA 2EEDA 4AENB 3OG6B 3KM2A 2XSKA 4XPTH 5HHPB 2V7NA 2H32H 4WI8A 4MB1A 4FFYL 5FA4A 4BGDA 3QH3A 2J8OA 4R84A 3E8VA 3IFLH 2JELH 2DJUA 2BSRA 3U0TA 3QULB 1KPRA 4GXFA 3QORD 4PJ5D 3ASWA 4PG9A 4YDIL 1BVLB 5CHNA 1EXUA 4QRUB 5B39A 1J8HD 1V05A 2I26N 1A22B 1D9KB 4BZ2A 4ABVA 3TBYB 1E8WA 3K6SA 1QBML 1A6WH 5DS2A 1BWMA 1LO5B 3FUFA 5D1XE 4FHBD 2K45A 1X5KA 2IDCA 3ZTNH 2EAEA 1AP2A 1NFAA 5D71H 4BWTA 5LWYL 1B9ZA 4KUCD 2X4NB 1YEDB 1IBGL 1WEJH 5DZNA 1BVNT 1X4ZA 3GHEL 4JN2A 4JVUA 3LH8A 5F7DA 4RIRB 3RTQA 4KRLB 4ZQKA 4AIOA 2VLJB 1Q1JH 4L3CA 5SWSB 3RY6C 1ADWA 4FFVD 5LGJB 2J73A 4PREB 4IU3A 4A63A 1OF2B 5DZLA 3K74B 3GZOA 4XCYB 4ZMAT 3MNVB 2A73B 2VXSH 5EBMA 1HFUA 2VW6A 4XO3A 1O9WA 5TD4A 2Q2EB 4GKNA 4KDWA 5FGBA 1MCIA 3AJ7A 3H9SB 4X4KA 3LQAC 4UT6L 2D7QA 5BRZD 4ZPTA 3QEGL 1GRWA 3RZWA 4MNQB 4ZPVB 2CO1A 3VI3E 1F6AA 3RG1C 2YKLH 1EXHA 3QVAA 1CLYH 2B5IB 3GXPA 3MR9B 4J27A 1IAKA 2DF3A 2QR0A 2DEWX 4MNGB 3H0TB 2Z8WC 4LSQH 1KCVL 4QXGL 3KAAA 3OJDA 2HJKB 5AW5B 5GGUB 4UIMB 4MDRA 3WAJA 3W0WA 2MH4A 4S0HA 1WFOA 2AEPL 4KQ3H 5CSGA 4OF6A 5IMKB 3JV4A 1EVUA 3MLTA 1V10A 2HJFA 4PP2B 4WEMB 1ND0B 1T04B 1FLRL 2AQ1A 2LU7A 2PO6D 4FLHA 4RVBA 1WV7T 4WKZA 5C09E 1FGNH 4FZ8L 4U6YA 1VCBC 2FO4B 2YA2A 4Y4HC 5INCA 5C0RH 1AHWB 3Q2CA 1LP9F 2YBGA 4XX1E 5EWIH 5CEXA 1QFUL 3GZQA 5E4EC 1QLFA 2BZDA 2P5WD 1MCJA 4XBGB 5TF0A 5DJ8A 5BO1H 5AB2A 1QHQA 3FNKA 5IREA 3ZHLA 2XZCL 3UDWC 2R4SH 1T7VA 3WO4C 3HFML 2JCCE 4XZUB 5HHQA 1UWFA 3U4AA 2ED9A 1PNDA 4NRZB 4NZUL 4D9LL 1MY7A 3ULVE 2N01B 3TBSB 1D2OA 3RX8A 1DQDH 4Y88A 4P5KB 5IBLC 1E5CA 5JORA 1HNFA 3TXAA 4G9DB 3GB7A 4LLYA 3KPRB 5GHWH 5C0IB 3TA3A 3VXSE 4BDVB 2JXMB 2PYEE 4IS6A 4G42B 4E41D 3GYRA 1KF9B 1GZPA 3V4VH 4YPJA 3TH3T 4WJG3 5LGKA 3ULVC 4WGVB 2BXYA 4PJAF 3WTXA 4EIBA 5E9DA 1P1VA 1F02I 1CWVA 1JK9A 1IBZA 3ALPA 3F12A 4HLZG 4BCXA 2VIRA 3CZFA 4U1IB 3SKMB 1JP5A 43CAA 2IOOA 2ZXQA 4V1DA 3NJLA 3P4OB 4IRJC 2OW6A 3UPRB 1BD2B 3MZGB 3S34L 3HE6A 3CUPB 4A2HA 1KYDA 4JFEE 3KCPA 3RY5A 4HUWA 1ZTXH 2AANA 2IH1B 3L9RA 2Q2LA 2BRRH 2APSA 1VHPA 3KPSE 5TF1L 2ICEB 4I3SL 1B4JH 1WWAX 1R75A 5FDYA 4I48A 4C56E 2VC2B 3NCEB 2FJHA 2BOCA 3OKNA 1SXBA 3ZQXA 5I5IA 5LXVA 3K72B 1OAKH 1XVSA 2A0LD 3B9KB 2BIPA 3JTTA 1XAKA 2W9DH 4A37A 4YQXL 1NBZA 3N43B 1DBKL 3P73B 4OTXL 4BCZA 3LD8C 4U1SB 5CP7A 4HIIB 1MW1A 3BAXA 5C9JA 4GP5B 4TM9A 2OJEB 2WINA 1MREH 2JJUA 3UTSD 3VACA 4F92B 3HHSA 3PWNA 4E9XA 4B7LA 3CZGA 1ZT4B 3OJ2C 3WFZA 4ABQA 5DRXB 5HJBA 3WFDH 4O2FB 4M8RA 4PJ7A 3L6FB 1PKQB 4M62L 5EN3A 3U2IA 4AYEC 1K72A 4G6KH 3BRFA 4ZFOB 3EJCA 3DV6B 3OQ3B 3C6EA 4P99A 3OLDA 1F3DH 3Q48A 1GOHA 1U3HB 4K7PL 2APTA 2WN3A 1AD0B 2QPDB 3NSFA 2PLTA 1OIOA 1DVYA 2YJQA 1NCWL 3L13A 4Z3FA 1J5OL 3M86A 3B1TA 1SQMA 2X40A 3MRIB 5B38G 4L4VE 4MAYD 3WBDA 1OGAA 4Y1SA 1NEZA 1TJGH 5GZND 3CFBB 3K4DA 4NZDA 3IE9A 3HJEA 1G6RA 2F9BT 3BSGA 4FFWD 1JRHL 3BH9A 1KN4H 2WTRB 4NZFA 4EVNB 5C0FB 2GYSA 4YLCA 1TQCB 3E0GA 3MTRA 2F53E 3OSVA 4W4OC 4B53A 2VDNB 1JD7A 2C3VB 4BFIA 3OKOB 2FUQA 1RIVL 1X7QB 4LLDA 5DC9B 3PDGA 5IB2A 4L8DA 4U3SA 4N90D 3VNYA 3C87A 1AR1C 3RFRA 1I1AB 2D9QB 2IG2L 2ZX6A 3NACH 3O81A 1PMYA 3ZN6A 3W9EA 1PQZB 2R0ZH 5IESH 2DQGH 2BPBA 4WK4B 5F97E 4ZW5A 4FXLA 3NFPB 1A6VH 1A3ZA 3ULUL 2VE6B 1BBDH 4YFEA 4RBPK 3PG2A 3CDFA 3SBRA 5JXEC 4HIHA 4QRPE 2K8MA 1Z5LA 1S7QB 3SDAA 4DQOH 1RFDH 1AYRA 3II1A 4FJ6A 5J6HA 1VEOA 3DK2A 4JM2A 4KJWC 2OJZL 4NKIH 1N4XH 4NO3A 5FKAB 3MOBL 3R0MA 4W9KC 1M42A 4AIXA 5F1IA 1AGBB 5DD5H 5E6ID 4LVNC 4OZGB 1FVDB 5TH2B 3A6BL 3ZDYE 2G75B 4JDVB 2QADD 5LXGH 4R5TA 5BW7C 2MMXA 3MRLB 4YFDB 5F96L 3CN0A 5HGAA 4HHWA 2AQTA 3QJVB 4JZOB 1AKPA 4L1SA 1OB0A 5HYJE 5AVVB 4PRIB 4OZ4B 1L5GB 3QZPA 4N68A 5FO7B 4RGNB 3EOAA 4DZBB 1RZKH 3NG5A 4X50A 3W11C 5ICUA 1A7OL 2IDUA 4H1LB 2EVGA 3BGMA 2P5EA 4L1BA 3AAZA 4Z95L 4P06A 4OZFG 3AM8A 4JFVA 2FIRT 4P2OC 1R24B 4KK5D 4F2EA 3OMAB 3TO2A 4K5PA 2OMTB 2QHRL 3IJ9A 5GGVH 1CTNA 4GRLD 4OUUB 5KS9A 3NRQA 1GL4B 3SQOH 4LHUB 1JI2A 3TJPA 4BJLA 3ARYA 4EZMA 4HKXB 2Q3AA 1WA0X 3P4LA 5E7FA 2WZ0A 2DBJA 2GCYB 3BQUC 4F57L 1N68A 1SF5A 1NLBH 2WO3B 5KSAD 3L3KA 2Y25A 3G5VB 4FQCH 3SGKC 4JGNA 4WFHD 2BINA 5JIIA 5AENA 3WIHA 5BNXD 1OAXH 2VMDA 2GHWB 5JPMB 2NQDA 3QS3A 4G6ML 4ZUVA 3UX9B 3FZUD 3WEAA 3MLYL 1OAUL 5AB1A 1MELA 3BEVB 1M3JA 5EIIB 1KT2A 2QHLA 4ZYKB 2XXGA 1Z1WA 5DMIH 4X6DE 3BWUF 1KUMA 4K3JH 2ZXWB 5BS0B 5GRUH 4UM9B 5E6YA 2IXQB 3TP4A 2J56A 2DEYX 4I5BB 4H8PA 4HWEH 1IB5A 3MV8B 3HRZB 3BVVA 4PJ8D 4HCIA 1C08B 3DUSB 1SXAA 1LD9A 4TLKA 1XIWB 4TVPE 2Z7ZA 4OJAA 4B0MB 1M71B 2WTOA 3IFPB 3S3DB 1UGKA 3CXHJ 1IUZA 2ZPKL 3GIVB 3WELA 2EDFA 3QWOA 3SBWC 3HHMA 3DOSA 5EIVA 3SB3A 4LPTA 2CUIA 2YLHA 4QY8B 2CHDA 2VSCA 4NQXA 1X6NA 5BZWA 3GLDA 4O5LH 2XNAA 3PHQB 1R1CA 4TPRH 1SN2A 4RSVA 3WTVA 3WCYA 1I1FB 1SDDB 5D70L 1BREA 2GB2A 3GGWA 3KLLA 3WXWL 4CJ0A 1OE3A 2FH6A 4PWJA 4AEHL 1UM5H 4YVNA 5IB5A 3QAZB 3JV6A 5K1NA 4F37F 2QVMA 5IJVB 4G11A 3LQAL 4PYHA 4RZCA 2HVKB 3H9ZA 1K8IB 3RI5K 4ILDA 4JNXA 1UD8A 4HIXL 1TZHA 4WIQA 2W5PA 2WZPD 3GIZH 1A3LH 3PDOA 4JFDA 2YKKA 1M1XA 2FK9A 4N3UA 4NYLA 2IDTA 4G8FB 4HJGB 4QOKA 1BEYH 1FFNA 3TESA 2XFXA 5HDBB 3V0HA 2AITA 2F5AL 3HOGA 4FXGA 4FKHA 5FO8A 5LGHL 1D9KD 3P02A 3V8CA 4FJZA 2ZAIA 1FL5A 3MUGA 4HSAC 4ABWA 2BP0A 1SYVA 1E27B 5HHNA 3C8DA 4F7MA 1A4BA 1S78C 5K9OB 2IAMC 2C1PB 2OP4L 4MJJA 4QRSB 4NDMA 4NS0A 3PAYA 2VTFA 5A6MA 2NSMA 1HEJC 2K6YA 2XZZA 1PW3A 2DV6A 2V7NB 4L23A 2MQCA 1IBYA 2HT4D 5FA4B 5L88H 2W0LA 3QH3B 1C5BH 5KBNC 1JWSA 1X5LA 3DHUA 4Z7UA 3EADA 1V3MA 3FT3A 3N9GL 4Y7OC 4ZZFA 3IFNL 2VLJD 1ET7A 1NUFA 4YAQA 5DGRA 5ADOL 4RGOL 2B2XH 3DHPA 1ID2A 4PG9B 1NCDL 5CHNB 1QOKA 1JF5A 4ODVH 1P9MC 5SV4A 2R2HA 3QIBC 1EHLH 2GQHA 2NZ9C 2WCGA 3FQRA 4G8EA 3J27A 1JFQH 3QYCA 1OP5H 2FWUA 1P7HL 4MNQD 4X0KB 3RGVA 3BT2H 4R4FH 3DGGA 5JIPA 1D7DA 1M05A 2ARJA 3GHBH 2FVNA 3KJ6L 3OHXA 1ZS2A 4Q6IB 1INQA 1DVFA 4ZFQA 2W92A 1TQTA 4MS8D 1DJYA 1MPAL 1U8JA 3LKPA 3Q9QA 5F7DB 5BQ7A 3Q2LA 4AM0A 4G5ZL 3CMOL 5JPNB 1J11A 4X7SL 5E08H 3FO1A 1ULVA 4PBDA 2W81C 2Y6TE 4IU3B 1N6UA 3VFOB 3M07A 5A6LA 1HNYA 5EBMB 3CD4A 4CBZA 3B5GA 1KGWA 3BGFB 3FUIA 4PJXA 2A6DA 5DLML 4W81A 5HYSG 3X14A 1XBDA 4ZPTB 5HHVH 4H88H 4JDTH 4K8RD 1I7ZA 4BQBA 5FDWA 1MAJA 2YMXL 4PBXA 1F6AB 2WYHA 3CHQA 4MZ2A 1M4KA 4G71B 3U7WL 1IAKB 2EEXA 2QR0B 3N85H 4JB9L 1FV1B 5GISL 4N0YL 1AE6L 1PLCA 4X6BA 2JSFA 2GJRA 3AGVA 3VFGL 3W0WB 4M1GL 4HP5A 4X80H 1MN4A 3ZMRA 5CM1A 1G0XA 2Y07H 5K93A 1UCBH 3JV4B 5I9QC 2YEZA 1TJHL 2HJFB 3HAEA 4KGLA 4WKZB 1QBAA 1XXFC 4YIQB 3KPRD 2AJSL 2ZWLT 3Q6GL 2C4FT 2E86A 2NXYC 4XO8A 2FIKB 4XNUL 1B2YA 1TNNA 3UBXI 2OL3A 5E0QA 3CZSA 5JHDE 1XBRA 5CEXB 1OPGL 2QSVA 1G7IB 1DEEB 2X89A 5I1HH 4MRCA 2CO2A 3NRPA 1UZ8B 2Y0SA 1GS6X 2IAAC 5DJ8B 2A6IA 4HULB 3EGSB 4RMWA 3N42F 4IU2B 4OGAD 4OZHA 2ZUQB 5HHQB 4ZMQA 3ARWA 3LSOA 1RKRA 3Q3GB 1S9WA 4G7VH 2J1WA 3NRFA 4XX1G 5D2NE 1P53A 3QI9A 1UM4H 4PJBE 4IMKC 3L81A 4OM0H 2BSEA 1BXUA 3APFA 3WEXA 2BNQB 1BD2D 5L0QB 3MRKA 4FXKC 1IBDA 2OR8A 1BGXL 5KSBF 4PY7B 4GRMA 3BUDA 5JORB 2VDLL 5T3XL 3SPGA 1RLWA 1FL6A 3BUYA 3GB7B 3KBEA 3QP3A 1WGOA 5D2NC 3TA3B 2CSPA 2GT9A 2XWJB 5GSVA 4YX2L 3JV5A 4IS6B 3RILA 5T33L 1UH2A 3QFJA 1KB5L 3B9KD 1F1DA 1UOWA 2DLFL 2EDQA 1HESA 5E9DB 4O58L 3UYRL 2HRHA 2AJYL 2FLMA 3MLXL 1I7UA 3F12B 3TYFB 5LJYH 1KY7A 1FO0A 4WWNA 2CMRL 1RVFH 5EA0H 3WENA 4XTRC 3ZUNC 2HPOA 1H3VA 1P0SE 3QUXB 1S4IA 4X98A 4Y4FB 4YNYB 5J12C 4L4TA 4AG4L 5GZOC 2YLKA 3GS4A 4V1DB 4KVPA 5CWSB 3SDDA 3HMXL 1D6VL 3OB0K 3KCPB 3CLEL 4HUWB 3GTNA 3SQBA 2ZUYA 5KEZA 3QNXA 3RKPA 3S3JA 2EE0A 4GAGL 3TIDB 4M9PA 2WKOF 1Z9SA 4MCYB 5HI3C 1R46A 3RFZB 4H1LH 1PIFA 1W91A 2W59A 5LB1A 3O8XC 2BOCB 1SHMA 1WIOA 1U3HD 3DX8B 4MCNA 2J25A 1JXFA 3JTTB 2VSMB 4AUUA 3P30L 1ODAA 4FQJL 3S35H 4EKJA 3OKKA 1NBZB 4PV8A 4KRPD 4XWOD 2ZWKA 4LFHD 1EJ6A 5T5FL 1BMZA 1C1EH 3C8HA 2A9NL 4JO8A 4U1KA 5CP7B