3FF7A

Structure of nk cell receptor klrg1 bound to e-cadherin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
100
structure length
97
Chain Sequence
b'MDWVIPPISLPKGPFPKNLVQIKSNKDKEGKVFYSITGQGADTPPVGVFIIERETGWLKVTEPLDRERIATYTLFSHAVSSNGNAVEDPMEILITVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Epithelial cadherin
molecule tags Cell adhesion/immune system
source organism Homo sapiens
publication title Structure of natural killer cell receptor KLRG1 bound to E-cadherin reveals basis for MHC-independent missing self recognition.
pubmed doi rcsb
total genus 18
structure length 97
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00028 Cadherin Cadherin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.60 Mainly Beta Sandwich Immunoglobulin-like Cadherins 3ff7A00
4ZMPA 1OP4A 2WHVA 4AQEB 2OMWB 3K6IA 1WUZA 4AQ8C 1SUHA 3LNIA 4NUQA 4APXA 4ZMQA 5JYMA 3Q2VA 4AQEA 3LNDA 1FF5A 4AXWA 4XXWC 1NCJA 2V37A 4ZMLA 3LNFA 4ZMOA 3QRBA 2OMXB 4ZMZA 4APXB 4AXWB 4NUPA 1L3WA 3LNEA 2WBXA 5KJ4A 2YQGA 4XXWA 2O72A 2A4EA 4ZMWA 3K6DA 3MVSA 3LNGA 4ZTEA 2OMUB 5CZRA 2EE0A 1EDHA 2YSTA 3UBFA 3K5SA 3FF7A 4OY9A 3Q2NA 4NQQA 3K6FA 1ZXKA 4AQAA 5CO1A 4ZMTA 4ZMYA 4QD2E 2OMTB 5DZVA 3PPEA 4AQ8A 1O6SB 3Q2WA 3UBGA 1ZVNA 5JYLA 2X2UA 2QVIA 4ZMVA 3Q2LA 4AQAB 2WD0A 1WYJA 2OMYB 2WCPA 1NCGA 3K5RA 1Q1PA 4AK1A 3UBHA 2A4CA 3LNHA 3FF8A 2OMZB 1NCHA 1NCIA 2QVFB 4ZMXA 4ZMNA 4ZT1A 4NUMA 4ZI8A 2OMVB
chains in the Genus database with same CATH superfamily
2WUBH 5KSBE 4EIGB 4EUPB 2LVEA 2F68X 2DYPA 1LE5A 3T8VA 1OPOA 1T1ZA 3FQRB 4UOW1 2FX8L 1YYCA 3KJ6L 1OD9A 5IVXE 4P2OA 1W72A 4YDIH 4KX7A 2E9WA 4Q7DA 2APTA 1G7MA 2BS8A 3CVHL 4DKFH 1AXSB 4LDCA 4U7SA 4KH2A 4L2LA 5EB9A 5EF2A 2E7LC 2VZOA 4ABUA 2EYRB 4XXWC 3MV8A 3OB0K 5HHNA 1I85C 5FYLL 3RNKB 1FJ1A 3SKOB 4GQQA 4P5TB 1YY9C 2ZNXA 4LCCB 2AZUA 1DSFH 3HC2A 4O9HL 1S5IH 1X5YA 1P7QD 4IIQB 2X4OA 2DZEA 2FJGB 1N8OE 4HD9A 4K94L 4R3SB 3L4CA 5E4AA 5ISZA 2CGZA 3V5KB 4X80H 1KXVC 1OVZA 5AAPA 5JHBA 4CVZA 3JV0A 3ATFA 1TTFA 5E8DL 2P7TB 3E38A 3BDYH 3CN4A 4B9CA 4P5MB 1A9EB 3MR9A 2IMNA 2Y6SC 3KD4A 3KCPB 2ITDA 1ZOXA 5FO7B 32C2B 1CFTB 4R84A 5LGKA 1DQLH 2Q7YB 5DK2B 4FLOA 4O5LL 4A37A 5DFVD 1JUFB 3DV6B 4NQTA 2PXYC 1QSEE 2QEJA 2Y07L 3O3EA 4FP8H 2XYBA 4LOEA 4NJAH 4IKKA 4XODA 2BXYA 1NCTA 5D6DC 4YEFA 3LKQB 2XVBA 3AXLA 4GQRA 5G4NA 1PQZB 4P05A 3VFVB 1KULA 3CSGA 5KUMA 4AOFA 2JF1A 5JW4M 1FG9C 4RDQG 5CWSA 2X2YA 5PCYA 1GYVA 1N5YH 3UTTD 5J1TC 4M4RB 2NR6D 4OQTA 3ISRA 1UA6L 2VH5L 3HG2A 4CADB 3T71A 1A1OA 2Z31A 4NO3A 2AQPA 3W0WD 4P3CH 3BZEA 1B4LA 1B2WL 5F3BB 3A24A 4L3EE 4OLYH 4N2DA 4GLRH 5IWLA 2EVFA 4X6DA 3BPNB 4UZGA 5I1HL 4KK8D 2NNAA 2J73A 3X11B 1N0LA 1RLWA 1SJEB 3F01A 3EBGA 4OB5H 5IHHA 5EH1A 1CLOH 3S35H 1P7KB 1RFDH 3WN5A 3KYAA 4NYLB 5C0BD 5L4JA 1TQCC 2ICWA 3KPRA 3KHQA 4PRHD 1UYWH 1TTRA 5B3JE 5KSUA 4HKJB 4UILH 4HD5A 1D5ZA 2XWDA 1TSRA 3K2IA 3SQRA 4Q9CA 1IGFL 5B3JF 3MV7D 3K8MA 2IGTA 2VQTA 4JM4L 3T4AC 1SN5A 3UTSB 4AQ8C 2NX5E 3ARGD 1XCQB 3L9RB 3RFZB 1BX2A 3R7QA 3ZMNA 2IAMC 1JD9A 2YIHA 1BZ9A 1TQTA 4YSSA 5LXGL 3RDJA 3ZL2A 4AM0Q 3SCMB 3DVNB 1UB5A 4G6AC 2X1WL 2I7OA 3VXNA 1OHZA 4P2YA 2V17H 2BPBA 3X1BA 2JFCA 3T8XA 3MSPA 5DYFA 4HS3A 2VO5A 4BH8B 2R59A 4FQXB 1VENA 4G8AC 5DZNA 2UYLB 5E2TH 2ITDB 3O6KH 2ICEA 3A21A 4BFIB 2C9VA 1IBGH 4AIEA 3LQAH 2AK4E 1NANI 1JTPA 4OZHE 4BA8A 5E1QA 2XICA 4NOBA 3TA3D 1H5BB 5EZJB 1DEDA 1YUHA 3C5ZC 1MRDH 2WWMC 3V6OE 2OXGB 1CICB 1UTDA 4DK6A 1XGYH 5BZWB 1FNGA 1E3FA 2BSRA 3LPFA 4HJIA 5I0XA 3T4AB 3GPEA 2ZSWA 2ZXDA 1BFSA 1J7VR 4XCCL 4H2CA 4CNIA 3NEXA 1UUNA 4U2YA 1A4KB 5J13B 4X5XA 5DO2D 1KB9J 2Y2TA 5GIRB 2RQ8A 2BY0A 4X6FA 3B2UD 2RD0A 4U6YA 3AS3A 1MCJA 5HVHB 3D34A 4EEEA 1OAZL 2P5ED 3NA9L 2MNWA 2Y25A 1AGEA 3RVUC 4QD2E 5MHSD 1RERA 3QBTB 4TUJB 4FRWA 4OCYL 4G8GB 1G87A 1JAEA 1N6UA 1YAIA 2OCJA 1HYRC 2J88H 4B95C 1V55B 2BY2A 4IKLA 4MFHA 2VLKB 1NDTA 3OZ9L 4E9VA 4X7FC 4LSVH 4HULB 1J0IA 1JNLH 3IFPB 2I5YH 5L0QC 4AH2B 2EICA 1SHWA 4NP4H 5BUAA 1GOGA 3Q05A 2Z4TA 4S2SA 4Q56A 4TUOB 4B9KC 1K6QH 1FG2B 1V54B 1PU0A 4P2OC 5C3TA 4P99A 5BQ7A 2FLBT 2NUPB 4FLSA 1AAJA 2HVKA 4F3FA 1E7VA 4UTBL 2Q0ZX 4J8QA 3D2UB 1OSPL 5JHDD 2N0MA 3FCTB 3AWFA 3VXRE 3F58H 4FFZH 4NP9A 3VTMA 1YSOA 2JKXA 1QRNB 3DX4A 3PV7A 3ZIMA 1QBAA 4C4BA 2O6PA 5ID1B 4Q74A 3HNSH 5IFHH 1J9QA 1F4YH 4U1HB 4X9GA 1J12A 1L6PA 1XF2B 2D4DA 5GRWA 1KEMH 1HKLL 4GKNA 1AG0A 4M3HA 2DYRB 1FP5A 2OLDA 4KO9A 3RI5F 1BVLA 4KJYA 3V8CA 4BIKA 4ZUSB 1KJ3L 2C3XA 3LPGA 3BUBA 3K0WA 4FZ8H 4P4KC 3MRHB 1TLMA 5IHLB 1KTDB 3UTQA 1I7TA 3QCVL 3CZGA 3E7JA 4RISL 3NCEB 3UX9B 1BZDA 2DQFB 2UZIH 2XBZA 4GKZB 3BIBX 3TA4D 4X8XA 3WXVL 4BKLA 4DOHE 3IN0A 1E5YA 1OWRM 1LP9F 5C2UB 5GGQL 4PJAB 1WBXA 3PWJB 2O6EA 2X3AA 5EOTA 5E1AA 3SGDI 4MJHA 4DKEH 2O72A 1M2VB 1IKNA 1E3ZA 2UZYA 1A8ZA 3PP4L 4V1DA 4M48L 4PVNA 2GI0A 3SPIA 3M7OA 1CTOA 5CZRA 3VFUB 3K81A 2P80D 3NJXA 5I16B 5DHVA 5H2BA 2PP8A 4F9LC 1T0NA 5F7HA 1KYFA 4MAYC 1J48A 1HEHC 1E4XL 4G8GA 3L81A 3I75B 1GW0A 1NGZA 2CNYA 4R97C 4TNEA 2YAOA 2WNKA 3AM8A 1PZUB 1ZLSL 3TWCL 2YC1A 1GYWA 5ENWB 5FGCE 3T09A 4EDWH 3DJZA 3ZRFC 5LGJB 3DGGB 1OAYH 5HHOB 5FLVA 4ZRGA 2NY2C 4YWGH 3AB0B 4KROD 1V7ML 4K3EL 4PGCB 1KB9K 2O6FA 4NQDB 2V9RA 1YYLH 1JWSA 2I9LA 3MTRA 3L4ZA 1CGUA 3C87A 1JDAA 1EO8L 4I0PA 4KY1L 2QKIC 3QXUA 3VGGA 4OLWL 1FYTE 1NFIA 1USQA 3U1PA 2E46A 5DRWA 2FWOA 4NO0B 4CN1A 5CEXA 4GRWB 1BD2E 2QLVB 3CWGA 4A7GF 4AZUA 3JT0A 2CBTA 3LS4H 1TVHB 3THMH 1QTSA 5BRPA 1AI1L 4DIXA 5C70A 4WKZB 1Z7JA 3WV0A 1MHHA 2F53B 2QJDA 4HFWB 4JHAL 3MRLA 1RZ7H 1FVEB 5EBLA 3VSUA 4UQ2A 4MHHI 2VITB 3CXHJ 4R97B 4QRQB 1UFUA 5KOMC 4DT2A 4HOZA 3MV8D 2ZCLL 2GJ6E 4EUPG 3RIAK 3L1GA 1ZTXE 3P9MB 3P30H 2UZPA 5IROC 2O93L 3DUSB 3TJEL 5C09D 3IETB 5DMIH 1YN7A 2HTKC 3D4YA 2PW2B 4ZBJA 5GZOA 1I8MA 1BEYH 4YAQA 4YHLL 2P5WD 3LKRB 2PR9A 5KSUB 1VJSA 3REWB 1YMMB 4PWGA 5FYLD 1HHHA 1KC5L 1N6VA 1RK0A 2XQYG 3HUJB 3MJ8A 3MRKB 4N1HB 43CAA 4B6ZA 4G6KH 1F6AA 4GMTH 3KM1A 4J7RA 3HZVA 3MLRL 4P4RA 4HEME 1KCLA 1HHIA 3ULAB 3DBSA 1X9LA 2N7SA 2G9HA 1AO7D 1TLKA 1XD1A 4RLDA 1G0YR 1U93B 2WO2B 4XNDA 3T04D 1ZK5A 1U8LB 3QWOB 2IQAA 1U95B 4W1TA 3FB7A 4F7PB 5DHVB 1SMOA 5A2BA 1ND0B 2XG5B 3I02B 4LLMB 5EU5A 3TTYA 4ADGA 3PGDA 5ETUA 5FW7A 2DJSA 1JNHB 1RK7A 1ADWA 5JMRA 1KB5H 3ML8A 1INQA 2ERJC 4H25A 4MB4A 4DESA 4LLQA 1RZ8A 4ANWA 1F3JB 1NWPA 1SEQH 2H32A 4MS8C 2VLRB 3SYOA 4XMLH 1HAUA 3V4PL 1FNLA 3VI4A 1Q9LB 1BPLB 4QNPE 1RUPH 2FHCA 1BG1A 1MQKH 3UBXG 4AQAA 1H8SA 1XV8A 4XN1A 2OJZL 4KMLB 2IADA 2OBGA 1EZUA 4YJZL 4X9FA 5B3SB 3KWWB 1O7VA 1HI6A 3I9AA 2Z65C 2ZPKL 2VQ4A 3UFIA 4BE6A 2BSRB 2EH7L 5F7DB 3DGDA 1E2ZA 5BPPA 2YBRB 3WFZA 3MRJB 1FYTA 5K9OA 5DFTA 2ZCKH 3NAAH 2AV7A 5HYJA 4HMCA 1JGUH 1X4XA 1GTNA 3QR0A 1UATA 4XHQA 1FYHB 4F15B 2NCMA 4ZXBB 1CFQB 3O6FD 5I0ZA 5I5RA 3QK0A 4OGAD 3RNQB 2P45B 2NYYC 3DJSA 4UWQB 4ZFFA 4GO8A 5A2AA 3FCUB 4M5SA 4ZFOL 2IPUG 3MNMA 4A7QA 1H3VA 5C0AD 4FQLL 3TBWB 1R5VB 4U33A 3DSNA 5AWNL 1HCYA 1B90A 3SQOL 1EXUB 5JPMB 1JRHI 4MCZA 4OLVL 5HHPB 1RSFA 1IARB 2DI7A 2TAAA 4KMTH 4EZLA 1DLFL 4BFGA 4HGWA 5IQ7H 2NXZD 1XTLA 2GIMA 3BSZA 3ESPA 1CO1A 2FD6L 2R0WH 4KK5D 4PJ5B 5KS9A 3NSDA 4GXUM 1DANT 2PW2A 1I8MB 1MLCB 4F5CE 5DZAA 1T7ZA 3PHSA 4JRYD 3OL2A 5C08A 4P5TA 4FMKA 4OLVH 5TPWL 3LEYH 3ULUC 4Z7UB 3T3MB 4KX8A 1YQVH 2I07B 4UUJB 1XMWA 2ICWB 1HHGB 4URTB 3LMJL 3T77A 4B9GA 1QW9A 2VABB 4UB0L 2PMZA 2KMWA 4Q2ZB 4AIZA 1YVLA 1ZHBA 3K6IA 2NY4C 1FNSH 3OKOA 1P9MC 4A2MA 2VQUA 1NZRA 2BNQA 2BNUB 2DM3A 3MRCB 3SBWC 5B7FA 1BZOA 4LKCB 5GS1A 4JN1H 4PJ7B 2GK2A 3Q1SL 4YHZL 1EK3A 2WQ8A 2C26A 3QVAA 2BVOB 3IBOA 2O5XH 2F54D 3AQDA 2CJUH 3FQ1A 1BXAA 4J3TA 2OR9H 4KAQL 4QR7A 4XPTL 1D5MA 4N0UB 1QACA 3IJ7A 2A6JA 2F1EA 5FW6A 4ONOA 5JNYB 3QUYA 4H26A 1VFBA 3BZ4A 3EZ8A 4MNGA 3VXSD 4XNAA 2VT0A 4NLAA 3TASA 3FAXA 2UYLA 2E75C 1QRKA 3TT1H 2DQMA 2OV0A 3B2VL 3BHBB 1CR9H 1HINH 1KOAA 3CCHB 2FE0A 1QYGH 4XMZA 5JIKA 3UEZA 4X5RA 1ODAA 2NNXA 4Y4HD 1ZAGA 5EF0A 4UTBA 4WWKB 2R1YB 4G6ML 3T5WA 4ODVH 3N41F 3NJGA 1BQUA 3L3IB 4QHUB 2XTJE 4MZIA 4P23D 5K5YA 2M26A 3RA7L 3NPSC 4I9WD 4AC4A 3UMTA 2Y24A 4YPGA 2GVYA 2EE2A 4RZCB 3RBSA 4KK8C 5C0NC 2OSLA 3V6BR 3PUCA 2R15A 2XWEA 3WD5H 3HB3D 1RZKC 3ZL4L 2YPVL 5B7MA 1KBGL 3HI1B 5J11C 1L9MA 2F5AL 4S1DD 2YGVA 1F02I 3NRQA 4TPRH 3AY4C 4MAYB 3LSOB 1JHKL 4P2QD 1RV6X 5M95B 3VSQA 1LEIA 4M62L 4M5TA 2H6PA 1HZHL 1NEPA 1MPAL 4XBPA 3CSFA 4U05A 4BCYA 3RVVD 1S9KC 3EH2A 4WENB 2GQHA 3ZYOA 4HCRH 5FO2A 4KPHH 3GMRA 4QGYA 4HUWB 2D7TH 3QH3A 1RIVL 4MMXC 3EJQA 5HI5D 3VI3A 4EN3D 2CHDA 1P2CA 3PHOB 1MHPL 2IBGA 2ATPA 3L5WB 1EFQA 4LGRB 5CBAB 2XZQH 1IAKA 2IWEA 3C2AH 4Z7QB 4P9MH 4PJ9A 3WS3A 1KY7A 2RALA 2XN1A 4LCWD 1XR8B 5IBTH 2HG5B 4U1KB 4FERA 3WSQL 5C0BE 5KSAB 3VFGL 4RIRB 5EUOF 1CDCA 4YHPA 1CGWA 5IK3A 5T1LA 2XKNB 2K78A 3D3VA 1D5RA 4Z7WA 2BVOA 4OD3L 1BBDH 1DVFB 3C75A 2NLJB 2VDRL 1BIIA 4WHDA 3RE0A 3BOVA 1MVUB 2VR3A 3GMMA 5BZWA 4EQ3A 4K8RL 2UXFA 4AXWA 3FT3A 1PY9A 4Z95L 4TNVK 1JZ8A 4ZMOA 2FYYB 2IH3A 3A67H 4ZDHB 1C16A 4L1TA 3KBPA 4M43L 1R5IB 4GS7B 5CZXC 1T04A 4RAUA 2GBAA 1ZA6A 4ZSOB 3BHBA 2CK0L 2VB5A 1GKEA 4KHTH 4QTHA 2OPCA 2J1YA 3C60B 3BI9X 1MUJA 3N40F 3P77B 4HGKC 4PJFF 5AYUH 4GAGH 3BQUD 5DGQA 4QRAA 1CC3A 3NTCL 1PFCA 4WTQA 3U30B 4Z7VA 4M1GH 4LSUH 4H88H 3SYQA 3QG6A 3QI9A 3SE8H 5DR5H 4B97A 3ULUD 1X7TA 4U4IA 4G59C 4MNQE 2DEWX 4UYQA 2BVQA 3MBXH 3IJYA 3MLXL 5I1AB 4E2OA 3P0VL 5F93C 3X3FL 4JO4L 5DFWH 5C7ZA 1IC5H 4KI5E 3ARPA 4G9FB 3FQWA 4BFEA 5H94A 5IW1B 4IMKC 1IQWL 4V11A 1BQ5A 2OMZA 4HWBL 4WHTA 2FB4L 1IQDB 2G75B 3UIYA 2B4CH 4HU2A 4K94C 2CBPA 3EDFA 3W57A 5EZIH 5IM7A 2B1AL 4W9EC 4GG6F 3NBNA 3WUWG 4DP7X 5DMKA 2IQ9L 4PJ7F 4QT5A 2DQGL 5KJ7E 3LY6A 4QRSB 5ACMA 1Z6JT 2X4RB 4ALAH 2WKLA 3NJJA 3FQNB 3QCTL 3CPLA 1RUQH 1RHFA 3O2WL 2XTJB 3NCXA 4KKBC 4NQCD 4QNPF 5I6PA 2VKWA 5IMOA 3MCYA 1N26A 4GQZA 3FC8A 5C2BH 1F1DA 2AKRB 4NO2B 4WK0B 2VDOL 5C9JB 1MWAA 4JQIA 3CHRA 1WITA 2WLLA 1RUQL 1Z66A 4K8RH 3S96B 1LYQA 1WFTA 2WXHA 3KYKL 4N2GA 4JRWA 1EJ6A 4NQDE 4Y8AA 1ZIAA 1R5VA 5CJOL 3KPSB 3D85A 1PD1A 1HHJB 5CN1A 3UXFA 4U1KA 5KSAA 1V7NL 3U9WA 3CFQA 2F15A 4ORGB 4IBUA 2XV3A 1XCTA 1NGQH 4LNRB 2P5WE 4LL4A 4YHIB 1WZKA 2V2WA 4JHZA 1F1GA 1C5DB 3NDZE 4K9EL 2ZYSA 2N01B 3N41B 4R7LA 4BD4A 4LESA 1KJ2B 2E7HA 4WEUD 1EDYA 2X1OA 3C2AL 2UVFA 2EUVA 1DBML 1RP9A 4OFYD 5DJAA 2HP4A 4WJG3 4KJQD 2IH9A 4N0CD 3VGAC 4LSVL 3OAZK 5JZ7C 1ZVYA 2HRPH 2YARA 4FGMA 2N1KA 1IU1A 2VR6A 4HKZA 3L08A 5D4IA 1DCLA 1GZPA 4NFDA 5HHME 1UZ8B 4TMPA 1VACB 2NTFA 2CE6A 4Y19B 3LNFA 3MJ8B 43CAB 1KWKA 3VFPB 2KDYA 4XPAL 2GTZA 1W8OA 2J57A 3QSKB 3V9FA 5FO9B 2IANB 2C1PA 3ILPA 3SDCC 3T3ME 1P5VA 5E9AA 4ELKA 1BVKA 4IDLA 3SY0A 3U6RB 4KHTL 3NOIA 2CK0H 1FFTB 1NEZA 1G5AA 1RJYB 2VXTH 3GSVA 3QCUL 4TPRL 2DIAA 4MWFB 3DV4B 4PJBB 4YHOL 1EGJH 3QEQA 3B5TA 1LILA 3QQ3A 4TL4A 5SWZA 3K5SA 1MN4A 4KDWA 4HWZB 3S35X 3MV7E 1BF2A 5D7JD 2GSGA 1XT5A 3PL6B 2HT3D 3HNTL 4OZIB 4HJGB 4WWID 4BQ6A 1XWVA 1FH2A 4WHTB 5AKRA 3NIFE 2ORBL 3B43A 2BERA 3I6LE 4JANB 4PD4J 4TVPE 4XC1L 5A16A 5KZCB 1ZHNB 3E1F1 1ACZA 4PLOB 3IU3A 1X5XA 4WW1A 2PO6C 3L3JA 1E42A 4NHCL 3ULUL 2CKBA 2H3NB 3H42L 4ZFGL 1XEUA 4G5ZH 1I9RH 1R5WB 1WIPA 1RUKL 2Y7NA 1G7JB 1PKQE 2PCPB 1HE7A 3F6LA 4YFLI 4YHYB 4P9ML 4M9OA 1Q0XL 4XPFH 3PABB 2ISDA 2XZQL 4BKSC 4C55A 4FN0A 3KPQB 4XVOA 1R24A 4J3BA 5DD1H 4XXDA 2NR6C 2G3XA 4OZIE 4FXKA 4B96A 3RGVA 3STLA 3FHQA 5DRNA 5E0QA 2DQTL 4JLRB 3VFWB 1M71A 3CMOH 1E8ZA 1FUNA 2CJUL 3EZJB 2JJWA 3X13B 3CHQA 5JHDB 4ES9A 2DY2A 3NZ8A 3ZTEA 3U1SL 3DIDA 4JFEE 3MACL 4JFZH 1JNNH 4QKTA 1IC7H 1WICA 1EJOH 1JV5B 2YR3A 1AE6L 1LMIA 1IGMH 3CFBA 3ZKND 1U2HA 3K91A 2Q86B 3QJTB 5I1CH 5IEKB 3PNWB 4G82A 5DS8B 2C9XA 2AK1L 2WP3T 3DK2A 4NO5A 4UB0H 4HVBA 4ZMPA 4WY7L 1KPVA 1MG2C 3K6SB 2GUOB 2FATL 5AKSA 4E0RB 4KXCA 3BAJA 3U9UB 1BWMA 2V33A 4EE2A 3OMZA 1A1NA 4P06A 4JRLA 3HBZA 5B4MC 4PJ9B 5CFAA 2YFOA 4AYGA 2VDLH 2QPSA 3AAZA 1ZLVH 3UTTA 2WTOA 1ETA1 1W72H 1J5IA 3ZMRA 3NN8A 2YS4A 2XKUA 2D2OA 2HJFA 4MXQC 3DIFA 4XOAA 4AW7A 4F7EA 1QASA 5A43C 2GBVA 3EGSB 1QLRA 1U8NA 4PGDB 2R1WA 4PJIB 5D2NC 5HHMD 3WHE0 1CD1A 1RUML 3BPOC 3GMMB 5E2JA 4X6DF 3EGDA 5FUOL 2K6WA 3QUXD 2J7LA 4IQHA 2BSSA 4XMPL 4QHKJ 5BV7H 4PRIE 2PPDA 2HKAA 4PWEA 4DVRH 2BFGA 4TVSa 2LABA 3OBAA 4J39A 4HJSA 1JWUB 1M2OA 3HJ0A 3FUNA 5ALCL 5F7MC 1N6QL 4YVNA 2ZPKH 1ADQL 1BD2B 5EU4B 1URZA 1KBWA 1JRHH 1KJVB 1QFWH 2AJSL 4PWIA 2P5EE 3LEXB 5D7KE 3VH8A 1C5BL 3P40A 1PG7X 1MWOA 3FFOA 4NRZA 1OM3H 3BZFA 3V2AR 4AL8H 5F1SA 3LMJH 4L2YA 2DQ6A 4WV1A 5LHDA 1HJBC 1UKQA 4KK9D 1O9VA 5I5IA 4RSYA 5E2VL 1KBKA 1E50A 3CVHH 3QI9D 3QZWA 5FHBL 4UAOC 2IF7A 1SJEA 2BRRH 3T3PE 2MPAL 2DS4A 4FXTA 2PPAA 3Q8AA 1XH3A 4ZOAA 2B0SH 1GKOA 5IVZA 4FI7A 1M1SA 3W1ZA 4RGNC 3CFIC 4KUZL 2ED8A 3FRUA 3KHOA 5J89A 3QEGH 2H3KA 1P7QA 4XP6L 5H37H 2EP6A 2HLFC 2W0FB 3EYSH 3D3VD 3O3AB 5DGRA 3ZKNC 1A4JB 2Y69B 3MLPA 4GUQA 2DQJL 4FNLL 4JGJA 4XNUH 5C0ND 3G6JA 1FO0H 2HXAA 3I6KA 1KG0B 4NO2A 3ZIYA 1LD9A 4XP9H 2AQSA 3BAEL 2ATAA 4X9HA 1NMAH 4FL4B 4UM8A 4ODTH 4NWTH 2YD8A 2V6HA 5H35B 3QXDA 2ATPB 3L5WA 3CX2A 1I53A 4BFIA 3P30L 3N04A 3SYPA 1CDJA 1NAKH 3KCWA 2EH7H 4U7MA 3QQXA 4GXVL 2N0KA 4MNGB 2YZ1A 2BOBB 3NIDE 5AG8A 4QY8A 1SLUA 2CR6A 2EEDA 1ZJBA 3LDBC 1RUPL 4M5YH 4A7UA 3V0WL 5K1VA 4G83A 4CDGC 1SEQL 1FO0B 3K0YA 1RZGA 3VM5A 3GSUA 1TJIL 5CP7B 5AB9A 3OGCA 4R8WH 1FAKT 4S10A 4JG0L 4NIYE 2J6EH 4XH2B 4M6AA 1RZJH 1U4FA 4H0HB 3O9WD 5TD4A 5F7KC 2B5IC 4P2OD 4N90D 1TZOA 5C0CB 1S7SA 1FRGH 2Z8RA 2A1WH 1FSKB 3B3BA 2L3BA 2JXMB 4CW1A 1S7RA 2FO4A 1KIRB 3FL7A 5FV2A 3EYQC 5F6IC 2OZNA 3QJRB 1GL4B 2KPNA 2C3WA 5T1JA 1IC0A 3EO9H 3S8WA 4YHLH 4LCCC 1UOLA 3CGTA 2JCCE 3EUDA 1J9RA 1U8MB 3BKJH 1LQBC 4U1MB 4Y5VA 5DC0A 3WY3A 4NXKA 2PYFA 5DS1A 1W2KT 2IALA 4KU1A 1XGQB 2C3VA 3I9GH 3SO3C 2XA8H 1C7SA 3PFQA 5FYKE 1OZUA 2XZAL 2JIXA 2YAQA 1PGRB 3O81A 4G9FA 4JPWH 4ENEC 2CRIA 2NY4B 3O3BB 2C5DC 3GIZH 1IB5A 3TV3H 1U8IB 2ICES 1NINA 2PO6B 2GJRA 5FUZH 1YY9D 2HTLD 2MCPL 2VM4A 5HXMA 4DKEL 5HBBA 4CAGA 3D0LB 1S7WA 1T1WA 2EEBA 2ZJSH 5GHWH 4JM2D 5ABZA 1CGYA 3N0AA 4K23H 6TAAA 4PRPD 3VYOA 1RVFH 3UERA 4HUXA 1TQBB 4W4OA 3QUMA 1NC4A 4X5QA 2H2SD 1CE6A 4PRPB 3W56A 3WXVH 3FTZA 4UF7C 4K23L 4KOCA 3V0WH 5DSCB 1EDQA 1PF3A 1PAMA 3F5WA 4KJYB 1XH1A 1OAKH 2OZ4L 4AQ1C 2XXMB 2ZYRA 3QNFA 4XPHL 2BX5A 4G1MA 3UZVA 4TVPL 4GXVH 5IG7B 4TKWA 5ESVB 3NFSL 5JPNA 1D7CA 2GY5A 4F7MA 1EEYA 5HPOA 5J6GA 3MOAH 2K0RA 5KVEH 3B5GA 5EC2B 3ULVC 4TTGA 4A2LA 1DVTA 2W0LA 2WQRA 4EI5B 1ASOA 3BKJL 1R3HB 1NGYA 2IAMD 4ODTL 3W3BA 4ODBD 5BMFL 4HLJA 1BZ7B 1SUHA 4TN9A 5E99H 3NSJA 2W95A 3TWCH 4DP0X 3FYEB 2FNWA 1A7OH 4JFEB 3PQYD 1KCWA 2YOAA 1TETL 3VDBA 1INEL 5F89B 4ANKA 1RL1A 4AQEA 1HILB 1II4E 4ZX3A 2EIZB 5EU7C 1W0WA 5E00B 1DQTA 4D9LL 1NGZB 4KI5F 1ZTXL 3QRBA 3T1WA 3VD7A 3E8VA 4Z0XB 2J8HA 1P0SE 4S1RH 5LBSL 1DQQB 3O41B 1HHIB 3IDGA 3PNRB 5E5MA 1VSCA 4CW1B 1Q9KA 1SDDA 2IDFA 1DBJH 1NM4A 1U8HA 2BJML 3GGWB 3RL2B 3VFOB 4JG0H 3H0TA 4WW2A 3QJOA 4FFZA 1RK1B 1WHPA 5ICUA 4PRHE 3D9AL 4YR6A 1PEZA 2RCSH 3V7AE 1UD6A 4Z7WF 1AP2A 1FDLL 1CZ8H 3L4WA 5CHNB 43C9A 2BHZA 4HOWA 3ML9A 3LHAA 2X4RA 2ZOKB 3I3BA 3N06B 1XGRA 4OLXH 2W92A 5T33H 1J5CA 5HJGA 1XGQA 1OAZH 2C3VB 4BSWA 4Z3JA 3OX8A 1C5BH 3U6XS 5DD3H 1JRHL 3H2WA 4GOSA 5E0FA 1B2YA 2AKRA 1BZQK 3WNLA 1RURH 1C7TA 3F7RA 1D7FA 4H7VA 1N6QH 3KH3A 4PRPE 1NGPH 1HKLH 1Q38A 3H9SA 3OKDB 3UYOD 3BP7A 4R7VA 4I18A 1SM3H 4PHXA 3VI3F 2BWDA 3KPSE 4UIMB 1J1OH 1FLRH 2VDPB 1DP0A 3ESOA 3GMPA 5EUOE 1X9RA 1G9ML 1U3JA 4WWNA 4UQ2B 4XMPH 2DQIH 4Z76A 2APBA 2GKIA 5CEZL 4OJEH 4N4YB 3GHBL 5DURB 2KZ1B 2V5MA 5AENA 2VDNB 5D7SL 1NCGA 4Z7NE 3ZRCC 5DJ8A 4XVUC 1OP5K 3EYSL 4JM2F 4IBZA 4I87A 3QJHB 3W37A 5ERWB 3KPNA 3LZFH 4PJDF 4PY8J 4RWYL 4CVUA 4RQQA 5CU9A 4LVHB 4DK5A 1OV8A 1O75A 3VCLA 4LCUB 3QJQB 4GRMA 2LLLA 4XO8A 4FFVD 5DCCA 5ALBL 2PPEA 3EJZD 1BXXA 4NPYB 1I8AA 3QDJB 3RAJL 2IC2A 5E2VH 2IANA 1YEHH 5TQ2H 3QWRD 2L7JA 3JV6A 5EN2A 3QIBA 1BFTA 2UZXA 1F2XK 1HCFX 2ZX8A 5T8IA 5IEKA 4XN4A 3UDWC 2H8PA 4MJ6B 4F33B 3P73B 1F11A 4P4KD 4IRZL 3VFUA 4A38A 2YJLA 2UZYB 2OXHB 4L3EB 2XHNA 2AJSH 3L1OL 2DRUA 3H7BB 1DN0B 1ECZA 1P6FA 1O5DT 1TT6A 5TDOB 3VW3L 3PHAA 1HEJC 4X98B 1RXLA 3DI3B 5H2BB 5L4FA 1XH2A 3S4SA 2Z7WA 4JM2C 5G5DA 1PX4A 1CE1H 4ICWA 1E8WA 4MQXD 3X1GA 4WEEA 4MJIB 3QUML 4XBEL 1NBYA 2YD2A 5FEBA 5KVMC 3CMOL 2MTAA 1FHGA 4HJ0C 2Q6WB 3QDGD 4WW1B 5E8NA 1IBGL 4BKTC 3SY6A 1X5JA 5IEHB 1KFAL 3AUVA 1JWSB 2I9LB 2JK5B 1YNKL 3WBDA 1FO0A 2KKQA 3RY6A 1A6TA 4PGCA 2ZXGA 5L2KA 4PW3A 3OKKB 1RU9L 3PHQB 2AVFA 4OVVA 5DC2A 2NY1B 3V6OA 4H8PA 4N2FA 5TF0A 4A2DA 5FYKD 3PIQA 1KYOK 2CMRH 3UAFA 1XL6A 4GP5B 4Q6IC 1RUKH 1UD2A 1UD3A 3BEVA 3DETD 5C07A 5FGBC 3VXUD 1HSAA 2X4QA 5GSRA 5A7EA 4NJAL 3N1GC 4WJ5A 3T4YA 2QGEA 4EZKA 2PCXA 3GMPB 4LMQI 1BF5A 2FATH 3MNVA 5DMGC 4ZG1A 3HC4L 2YD4A 3JV4B 2V5TA 1KJMB 2GG1A 4F58H 5EEYA 2HB0A 5CD3B 1RIHL 2VC2H 1EXUA 4UILL 4ENZA 2GYSA 1R3KB 4LARL 3PGFH 3EHBB 2B39A 4L29B 4Z5RA 3S5ZA 3S36X 1KXQE 5DJ8B 1WP6A 1A6ZB 1KCKA 3Q2WA 4PW4A 1WAAE 5F8RC 1C8PA 1PLAA 3BT2H 5EO1B 3NH7L 4B7IA 5GRVK 4K94H 2AMGA 1BP3B 3T9WA 1J1PL 3TPUB 3L3HA 1EJOL 2R0KH 3VU1A 4JFZL 4DVBB 2YPLA 2MWCA 1KB5A 2A9CA 2LTQC 3EAKA 4GIAA 4O02B 5E8OA 5FF6B 4KXBA 3PWVA 5SX5H 3GLZA 2J1ZA 2X2JA 1AXSA 4LKXB 1H3PH 2E9JA 2FT8A 4CJ0A 4IBVA 3F12A 3IVKA 1E2VA 2BY1A 2NRDA 1GOFA 1QLFA 3EHBC 2CDEA 5D7JB 3SKMB 5IROA 3LTVA 1VZIA 4I9WE 3EO0B 2VLKE 3QWOA 4MASA 4MJIE 3S9DB 5B7EA 1HK6A 1OTTC 2DF3A 5FB8A 5EUKB 2IXQB 1NCOA 4L9LA 4X6CA 1LK3H 4NPKA 3IDUA 4QXGH 4ZS6C 1GC1C 3GMNB 4KNTA 4Y1AB 4OGQC 3VXQA 5JHLA 1JZ5A 1BSIA 1E90A 4X98A 2YMXH 4XNMA 4L8SA 3IDIB 4ZFGH 4UAHA 1VEPA 1XGUB 4JHVA 1XR8A 1FH5L 2X88A 4N6QA 4OCMC 1NBYB 2ICEB 2WVVB 3DRQA 4RIRA 4XWGH 1MCIA 5F9AC 3CN2A 4EVNB 3TNNA 5GGVH 2H1PH 3DV6A 4KJPC 4Y9GA 2JKRM 3HAEA 3DX8A 3RBGA 2ZZUT 1JGLL 2OMXB 1V3LA 4RESB 5J3HC 4AUUA 1HDMB 4BZ2L 1S3RA 3WEAA 3RWHA 3L9YA 5DJXB 5JOFA 3OKKA 3VQLA 4JAMB 1HILA 3L5XH 2QR0B 2WJ7A 4AQZA 4QHKI 4QO1B 4KK9C 3VD4A 4DSYA 1LM8V 2WZ5A 4A04A 1PNCA 4WVRA 4XC3H 2BNQD 4PJDB 3ZPDA 5T3ZE 1DJHA 4OIBA 4CUCA 4M4RA 2EE6A 1P4BH 3OWRA 3SE4C 1GGBL 3SJVA 1KB3A 4RGND 5FYJD 1KJMA 1UM5H 1AKPA 1M4KA 5T3XD 1VERA 4HKBA 5SV3A 2F61A 5FAAA 2HKHL 4BINA 1HC1A 4K71B 3CX5K 3DSNB 4HGMA 4KRMB 2QFRA 2OSWA 4RX4D 1G9NC 2NMSA 4PJIF 2WVSA 3MNDA 2IH1A 2A0LD 1UM6H 2YKKA 1ZLDA 4YHNB 2X44D 1X7QA 5ILTH 1NC2D 2QBWA 2WXOA 3K8LA 4CGUB 1U8MA 2HZHA 4PCKA 3O3UN 3JBG7 3VO0A 3FZUC 4HUCA 1IKOP 5T1DL 5AKTA 4Z7UA 3UTTE 3TXAA 2B8OT 3DX0A 3KWVA 3SGEH 4WZ9A 5F9OH 2HKFL 2R9HC 2RIKA 1UT9A 3T2NH 4FLHA 4XNXL 3QUZD 5LCVA 2FQGA 2Y5TA 2LR4A 3PG2A 1H15A 2DWSA 4J1UB 1OM9A 1QD0A 1YMME 1HXMB 2K3HA 3EH1A 2DLFL 3OMNB 5EUKA 1IL1B 4GW1B 1OTSD 5DF0A 5T1LB 1NCIA 2XKNA 4YL4A 2LFGA 5LCVL 4HCRA 4KHXL 5LGHH 3NSYA 1RZIB 1GCFA 2GI7A 2HFTA 4UOZA 5EZIL 5A3ID 2BIMA 2EEAA 3MRIA 3QP3A 4YSQA 3VFVA 1YNLL 4S11A 5I6MA 2QKIA 3HZMB 1A7PH 1KCUL 1OP4A 5LWYL 2HYMA 2F8OA 3KPMB 1W6WA 3OPUA 3EJCA 4MMZB 5KVGE 4D8PA 3RPIA 1FIGL 3ESNA 2QGDA 1NPNA 3X3FH 3QIBB 1UXSA 3CDZB 3IGAB 1M2VA 3MLXH 1R3HA 4P59L 1QSZA 4L4TD 3WNJA 2A6DB 4R4ND 2SODB 4FQIL 4E9YA 2A74B 3LH8A 1I1FA 4LIQE 1HZHH 2J8UA 1A4KA 3M07A 4M62H 4AC2A 2X2IA 5EBWB 4ADJA 5JA9A 2O5YL 3LXBA 4NHUA 4P46B 4BQCA 3VSTA 3ZGIA 1J10A 3W39A 3PXJA 4WWOA 3TBSA 4PRBB 2AFNA 1XO8A 5I2IA 4HAFA 5CBEB 3FW6A 5GS1C 4OZFB 4MCYA 1CL7H 1CQYA 4MJ5A 1HH6B 2WKOA 1RMFH 2VDOB 1N10A 4PRHA 1NIEA 2D9CA 3RRQA 5JIHA 3BKML 2EH8L 4H8WH 3UTOA 5J12B 2L7EA 3E0GA 1CXKA 4I0PB 4NNPL 3MA7B 1M1XB 1QBBA 3OC5A 1ZA3A 5DD0L 3ESVF 4U1GC 4F92B 1B4RA 2N7BA 5IFAL 4NO0A 2V3FA 4LPTA 2PYED 4HF5L 4WSKA 2KLSA 1MWAB 4C4KT 1FL3A 5EZLB 2IDTA 1I3VA 4OIAA 3SDAA 4C56B 4DETA 4GBXD 3INOA 2EZ0D 4KJQC 1BG9A 5J6HA 2WGXA 3TYGL 2X4OB 3EOYG 2CIIB 2VTFA 3QZOA 4B9YA 4LRIA 4GEJA 5DWUH 2X4UA 1XXFC 4UNTA 4AIXA 1T03H 4XPTH 5K39A 2GK0A 1XIWB 2X7LA 3GDCA 4GRLA 5K59F 1SFDA 4N24A 3BH4A 5HDRA 3FCSB 2Q76B 4LOFA 1U58B 4NCC1 1EMTH 2X4PA 1WA1X 2YMTA 1FFOB 3ZYJA 3KR3L 2P8MB 4FOMA 5INDA 2OL3B 2IH3B 3N9GH 4YDKL 4ZDHA 1C08A 2EIZA 4JCMA 3V0FA 1RK0B 3HUJA 1FO0L 3MRKA 4N25A 2H26A 4XNUL 3ARFC 1A7QH 3OJDB 4F5CA 1M7DA 5FFOA 2K6ZA 4MDJB 4NPYA 3LRSB 3LH2H 3QO0B 3DJ9A 4HSQA 3K6OA 4FS0A 2QVTA 2VN7A 1MSPA 5C1MB 1IGTB 3GJFA 2VDMH 1FSKC 2D7OA 3DX6B 1OANA 5C09B 1MKFA 5FHBH 4AK2A 1A6WL 1RUAH 4Y4FD 1MFAL 4LGSB 1VPOH 1TVDA 5F9WB 3RIFF 3AU1B 4DQAA 4BSVA 3IDYB 2HLAB 1UWYA 4OZIA 1RI8A 4N0FA 2WLYA 3MXWL 5IMLB 5TGBA 1QP1A 5DHXB 1NLDH 2WAHA 3VWKD 3WHXB 5KWYC 1MJUL 1JVLA 5GQBA 1HDMA 4BWUA 4EI0A 2YBRA 4Y9CA 4KROC 4W9JC 5DD6B 3S88L 3UC0H 2AVGA 1K72A 3BVNB 1EGJA 2R2CA 4XN8A 5SX4H 5D9SA 2FWOB 1H8NA 2GJJA 1E7UA 3C5JB 3QORD 4I4WA 4FXKB 4HJJL 1Z5HA 4LSPL 4CU8A 1VCBC 1CD9B 5KYWB 3VXRD 1FVDA 1QUPA 2EIEA 2OJZH 5D7IA 1XB8A 5JPMC 4R4BA 3OXSB 2BS9A 1P4LB 2OMYA 4UM9D 1D5IL 3II1A 3HNVL 4XP5L 4WTZG 3TEXA 4QRPA 5IIEA 1HEZA 3UJJH 2AV1B 3BO8A 3B9KA 4M03A 4HSCX 4Y16A 3S36H 3IMRA 4CL7A 4I88A 4JRYA 4BZ1H 4Z7OF 2OMWA 1A6WH 4JUTA 5CXPA 5E4EB 1S9VA 3HFFA 3CFJB 3FQ4A 5IGXL 1GZHC 4XCNB 4DP5X 4KKLD 3SHSA 2NXZB 2W9DH 3GXDA 2BMKB 4P49A 4Y1AE 2YA2A 1PLCA 3K5RA 5DMYA 4LCWB 5ID0B 3FBKA 1DANU 1S4IA 3SQOH 1F6AB 2ZX5A 1PPIA 2CCWA 2Z1PA 5DUPH 3WXWL 5C0AB 4X5XB 3FJTA 1GZPB 3VB9A 2AK1H 5BRZA 1VACA 2NTFB 3GD1C 2XXGA 5EBMB 4X4XA 5IV2A 4Z8FH 5I1CL 5C92A 3E1ZA 2XSKA 5D7KD 4AMKH 1EJFA 1G7LA 2CRYA 3EH3B 3PAUA 4KX9A 3N9GL 4TUKL 4TVUA 1NANH 2BP0A 4NQXA 4XP4H 3PWLB 4ZXBD 1MNUL 3AM8C 2G2RB 5FO9A 4L48A 5IFAH 3TYFB 3MRRA 2YUXA 4LEOA 4M00A 1TITA 5FA4B 4DEWA 1CYXA 2VERA 3O3DB 2DTML 2EJ1A 3HRZC 3WNKA 3GWJA 1OQXA 3FU9A 3HC0B 5B1JC 1MF2H 2NT0A 2AJXL 4IEFB 4IKIA 4PJGF 5C8JA 1T03L 4OQTL 5JNYA 2GB2A 3N43F 5TE4L 1LO3H 2BWQA 4YHKH 3GNMH 1H6EA 3KEHA 2X6BA 5IB4B 1U21A 3KWWA 5C6TL 4L3FA 4Q0XH 3LS4L 2EDFA 5I23A 3BD5A 2QADC 1F97A 1PDKA 4NZDA 2ZSVB 1U0QA 3VXMA 2MQGA 2WN2A 1KB5L 1JI1A 2MEJB 3KLLA 4JREC 4KV5E 4EI6A 5D2NB 2YPKB 2R2BA 1EIBA 2GAZA 4LQFH 1N9PA 2FIKA 5DURD 3ELQA 2AABH 2DDQH 4BQBA 3DUUB 5MP6H 4NUJA 2WM0A 4OFYA 4HYTB 1U6AH 4YDJA 4U7KA 1OPGL 4XAKD 2IG2H 1ONQA 3QS2A 3QC6X 1K4DB 4L4VD 1SOKA 4UTAA 5CLYA 1CL7L 3L3HB 4MGXA 1EGJL 4Y19E 3E6HB 4PY8I 3C5SB 4JZNA 2ZCHL 3ULVH 1NLBL 1Z3GH 4OCLC 2H7WA 4WEMB 4OI7A 4I7ZC 2PLTA 5FF6A 4WNJA 2F54B 5HGBB 3F6JA 3VM7A 4MAUL 2I24N 3ETTA 1BV8A 3I6GB 4HGWB 4P4RB 5I8OL 1MDAA 3MKGA 4MCZB 5HHPA 5AOJA 2V7HB 2RACA 4UT6A 4GS7C 1MLBB 3L5JA 2YQ2A 3IRZA 4IGBC 4GW5A 1LE9B 4X8CA 3FB6A 5EOTB 5GRZA 3V4VA 2BW4A 1AO7A 3HFMH 3QIWC 3TIDB 3DO7A 3CVHA 1DVFC 5J12C 4UT6L 5TH2B 3DBXA 1NGXA 1GMEA 4QAWA 1EFXA 1AGBB 1JI2A 1RIUL 5H35A 1A3QA 4PPTA 4PJ7A 1D6EA 2CO6A 3VWKB 2BOBA 4JDTH 1T5KA 4RISH 4AEIH 4EAEA 1NPUA 2I9TA 5H37A 1MDTA 2HPTA 3WELA 4G6JL 1ACCA 1SGKA 1CL7I 3MUUA 3GINA 4PAZA 4EVNA 4GG8B 2DICA 1DVFA 4HJTA 3WIIL 3CBJB 1KJ3H 3C9NA 5MENB 2VO8A 2JJTC 2NXYB 2FX7L 3RZCB 1YY8A 4JY5L 3DI2B 2HX7A 2A6JB 4LLYB 4PRIA 1FYTB 4FYSA 3GTTA 1RZIA 3LQMA 4RZKA 1V7MH 4TF4A 4YWGL 4LCVA 4GRWE 5HHOD 4LFHD 1G94A 3N1FC 3WS6A 1GS7A 1NH6A 3ZDXF 5BRQA 1SXZA 4C58B 2R29A 4A6YA 1GYUA 2BCKB 3O0LA 1G7IA 5JDSB 5KYXB 5L6YL 3P77A 4QYOA 2WCSA 35C8H 5I1LA 1BFOB 3BUYA 3GXUB 4Y5VC 1NDMA 3EYFA 2XWJA 4XCYB 1B9KA 4XC3L 4JB9H 4PGEB 2QQNL 5I8KL 3ME0B 3F7KA 5FYLE 4LSSL 1S7RB 2A77H 1A6PA 1ASPA 3NPZB 3V6ZB 3EFFA 1QQDA 1JZJA 3EOBA 1ONQB 3FKUS 4ISVA 2WW8A 3SZKC 1FV1B 1OP3K 2HKHH 2QPFA 1WAPA 4LPVA 3GTNA 5TJWK 4PJ6A 5CFHA 3L5HA 1TTCA 1A7RL 1MLCA 2W5PA 3LKOB 2FJHA 4YIQB 2VL5A 1B3JA 1OO2A 4OJDH 3IETA 5AALA 4U0RC 3SE8L 3B8SA 5F6HJ 7PCYA 3LXUX 5E1GA 4WO4B 3IDXH 1UFGA 4MQ7B 1OCRB 1H9VA 1LEKB 4QT5B 4UQIM 2YMXL 3MHZA 4G8IB 3CZKA 3BWAA 2VE6B 1USZA 4IU2B 2CGRL 3C5ZA 3VMPA 4FI8A 1D9KC 1LK3L 5F21B 3L1FA 1ZS8A 4HIXH 2XBTA 5FYJE 4Y2NA 1E5UI 2E4FA 2MOQA 4G1MB 3UZVB 2H1PL 4M7ZC 4ZD3H 1LNUB 4U0QB 3GXNA 1H19A 1KV3A 3S2AA 3TL5A 1TMQA 3S0PA 4EN3C 2KZBA 2Z31C 1YEDA 2A83A 2WD0A 4YSRA 1OCWL 2CXGA 2EACA 4G8GD 4ZUWA 4RGMC 3NACL 4HLEA 4HG4K 3B4NA 1D7BA 4F2MB 5DWPA 1G9HA 1I1AB 4NKOA 4YGVA 4R96A 4JN2A 3SJVE 4S1DC 1ULVA 1IUZA 4U6VH 1K6QL 1S6NA 4ZPVA 1NFAA 2DKMA 1N67A 1HE8A 2AXWA 1YPZF 2BW5A 3CLWA 3NK4A 1MFEH 3CBRA 5BS0A 3ATDA 3WUWB 1AY1H 1JPGB 2R7EA 4AITA 5ACZB 1MHPH 3MRDB 5GRYA 5I0WA 1IAOA 5IB5A 3BMVA 3RL1A 5GS2H 5GRJH 4G7YH 2Y7OA 4HKZB 4CMHC 4Z0XA 4N8VA 3RY5A 1DJYA 4JM4H 1YO4A 4GH7B 4XOCA 4MAYD 4Y16C 1CK0H 4N2KA 4NAJA 3WEXA 1XCXA 4L5FH 5JQIB 3L4VA 4MMYB 2Y72A 2F7RA 4PJCE 5CP3A 4GAFB 4PJDE 1V27A 2J21A 2ZIDA 3DDFA 3BT2L 3P73A 1W16A 5IQ9A 2Q10A 1WEJL 4NRXA 1AHWB 4ODWB 1T3FB 1N8ZB 4MCMA 2F5AH 2DLTA 3C6SB 3BC9A 3X1NA 3RPKA 3GBML 4BSWB 4QPEA 3MLYH 2UWEA 1YEJH 3QHZH 4YO0A 1S46A 3J07A 4P3CL 1MI5E 3UTSD 4PJ5A 1TZ8A 3D2TA 3LQAL 2IBZX 5KS9B 4N2MA 1C1EH 5E2TL 5I6NA 3GBMH 3AT8A 3POCA 3NIDF 2H0FA 3C09B 2FJSA 3MRMB 3PY9A 3QFJA 2N3JA 4ODVL 1YQ2A 3ARDB 4G6MH 3FTWA 4YFEA 4HHWA 1NBQA 1CQKA 3F7LA 3B2VH 3CPLB 1E28A 1AFVH 1A7BA 3QJUB 4ZUSA 4N22A 4Z76B 3V4PB 3WG7B 3U0PA 1QNZH 4TQ8A 4ZMYA 2XOTA 1OE1A 2NLJA 4N86A 4NKDB 3HLKA 1KXHA 2B59B 1NKGA 3T8MA 3KPNB 1TCRA 4N8UA 2NQ3A 4OH2A 3U36B 3UTZA 4HXBL 3IKCB 1TFHA 5DRZB 5EA0L 5A2LH 4GAYA 4GRWH 5AB2A 5EBGA 4LPUA 4TTDC 4XB3A 1IAIL 5E6IC 4L1DA 4OGXL 1R3KA 3WTTA 4K7FB 5GXBB 5E9DE 5I1EL 4OB5L 3HVNA 3HMXH 4R9HA 2DJ4A 2UXTA 4OF8A 2VIRA 4HUVB 2RJMA 3ZKSD 1MNNA 2WWMD 2X6AA 3J27A 1R3IH 3ARGA 4HEMA 4PP1D 3JUYA 3IXTB 3WNOA 5E6IB 1QRND 5DJAB 4NKMB 4QHUA 1FNFA 5TQ2L 4Q8BA 4WU5A 4QHPA 1KIUA 5DQ9A 4MNQA 1MVYA 4HZLB 4Y16D 2R0WL 5DHMC 1NAML 5EZOL 3WYRA 4WFGE 4YVUA 3UTTB 5IQ7L 2JVUA 5CMAB 1QHPA 1QHOA 3KPOB 3T0VA 1MI5B 3TPKA 3B7SA 3BD4A 4Z7IA 1WISA 3JWOC 4KTEL 3V4LA 1T21A 3VX1A 3VE0A 5IQ9B 3QR2A 1X5MA 2EIMB 3L6FA 1TO4A 3GMNA 2FVNA 1F3DH 3FHAA 4FKHA 3BEWB 2KS0A 1SUJA 2VXVL 1GR7A 1A5FH 4LOVA 1KLFB 2E0PA 1PAZA 4Y2OB 3WNMA 4U3SB 2JQAA 1CB4A 1XTMA 3AXLB 1TJMA 4X6DE 5FYJH 3DNKA 5IMOB 3C5XA 4PS7A 3PQYE 3CK0L 3GLDA 5KVDH 1DBJL 2BJMH 2FUQA 2P5EB 3H7LA 3PIQB 3O2DL 5DK3A 3SPVB 4DN3H 2D31B 3NIGF 4OGAC 3KS0H 1CS6A 4ZUTA 3VD1A 3VI3B 2Y1YA 2A77L 3GPSA 2VITA 2EDTA 2O6CA 4NQEE 4UIMA 5LBSH 3V0AC 5DD3L 2F18A 1DSFL 1HQ4A 4XMWA 3PGCB 4I18B 4L4JA 4YSDA 5H4YA 5IHUH 3RWDB 1NSNL 2EE0A 5JXEC 1BQLL 5L2KD 4XXDB 1A6ZA 3KG5A 3CDCA 1VFAB 3KPQA 2VMDA 3JTBA 3BKCL 4TVPD 1UA7A 1I3UA 2Y4SA 3GXMA 3DX7A 1L7TH 1MRFH 1DJWA 3KH4A 1WA2X 3OSVA 4R0LB 5FM5M 1EZVX 2CCVA 3P9LA 4LCWA 4PJIE 3SJVB 4W68A 5ID0A 1XAKA 2D9QB 4DO5A 1IV8A 4HBCL 2OCFD 4LEXH 4FYTA 3E6HA 3V9EA 4N9OB 2FH8A 4OCXH 1QSVA 3NZ8B 1TTGA 2UY6B 5E5LA 5HI4D 4MD0A 1KN2H 4UT9H 1ZSHA 2LAAA 2WQAA 3I6GA 4D9LH 1GGTA 3QDJE 5A2IH 3CFTA 2X4TB 2ZAHA 5D96C 1X6NA 5DDHB 4N0YH 4PRID 2NXYD 3DYOA 4E5XB 4J8RB 5D55A 3LRKA 5D1ZA 4XNMB 3T0XA 1Q1PA 3IYLW 3PWPA 4NI3A 5IQNA 5D4JA 1LHZA 1RPKA 3OM3B 1RP8A 1WZ1L 2DW5A 3BQUA 5JIIA 3ARBC 2EXWD 2CXKA 3MUGB 5G5DB 2UVEA 1XGUA 4TS6A 4TVPH 4PG2C 3VE0B 4PJGE 1MREH 3CVBA 3SDCD 1HOEA 1WZ1H 1CD1B 2OZ4H 4XWOC 3HJEA 3LS5H 1DQKA 1UOWA 3T2LA 1W0YT 1SY6H 4NC1E 1QLRB 2J1KA 2NY3B 4JO1H 5B38G 4B60A 4MAUH 3UMNA 4FD0A 1DJXA 4PV9A 4M6OL 1AKJB 3Q6GL 5DD5L 2ZCHH 4LASH 3O6ML 4D3CH 3HG1A 4FLQA 1T4KB 2VM9A 4NM8L 4AKQA 1MRCH 2HUHA 2ZNWA 3AREC 2DQHL 1EZSA 1NICA 4DP4X 4XH2A 5D1QA 3P3UA 4GAJL 4LBEB 2CLVB 4G8FA 5CSZB 4UT9L 1BPVA 2R1XA 4DZBB 4Z77B 4JFSA 1MHCB 2G3MA 4DH2A 2J55A 1FZOA 4EN3A 1Z5YD 2ZYHA 1QRNE 1ZVHA 2IJ0C 5HVFB 1DUZA 2XA8L 1XF5A 5DUBB 4U6HB 3WLWD 3HE7A 4HBCH 4YH6A 3S96A 3NYKA 3G6JE 3SGDH 2ZG1A 5EEZA 5CAYB 2HSIA 4P57B 2H47C 4I2XA 4JZOA 4R8WL 2ZOLB 5KSBB 1MRFL 4WI9A 1VFAA 3B6SA 1GAFH 4HBQA 1N7ML 2XPGA 2XX1A 4GIOA 2TSAA 3H55A 1SBBA 2RBLA 1NAMA 5LN4A 1DL7L 4CVXB 1JPFA 1O7DC 5BW7A 4L1LA 4KJWC 2AANA 3T0EE 5GZNA 4A68A 4TUOA 3DDGA 2HMIC 1WFJA 2UY7B 3QIUA 1MREL 1LO4L 1IAII 2P52A 1A64A 3L7FA 4PBXA 4Q9RL 1EHAA 2G4EA 2CHWA 2K45A 3QIUC 3PWVB 2NTSP 2CRMA 3A4EA 1G1YA 3DK0A 3VJ6A 4G8IA 1IL1A 4JVPA 1NMAL 1TJIH 4HEPA 3FT2B 2YA0A 5C0FA 3T0EC 4EO5A 3VQ1C 4L18A 3PDDA 3T0BA 1QAWA 2PR4H 3B3IB 3U2IA 3GS4A 1H6UA 3MRPB 3S8FB 1UWGL 4M5YL 4V1DE 3IN2A 3SCMC 2XCMC 3FU8A 3GMOB 5E4OA 3BQUB 1MCLA 1CDUA 1ZT1B 1WIUA 5HYJE 1LNUA 3JWNG 3F7QA 4GYBA 4D8OA 1LO0H 1R3LB 3GZOA 4PJGA 1UT1A 2EXWC 2E86A 3I84A 4X9BA 3CAFA 5AW8B 4QY8B 4PN6A 4G6FD 1J8HA 3Q06A 3AREA 5IB2A 1AIFA 2P24A 4G70B 3HNSL 5IFHL 3UEQA 1U3NA 3TX4A 3MLVH 4DHLA 3RWCA 4NWTL 1I8LC 1IGYA 5BS0E 1L7TL 7PAZA 3FCSA 1NDMB 3EYFB 4IHOA 4YDVA 1JN6B 1I7RA 2BIHA 3FTYA 4JX0A 3Q01A 4MBOA 5D6DA 4LLDB 4KZDL 4XI5C 5F89A 3HI5L 2NY2B 4BQ9A 4AEHH 1I1FB 5AG9A 1S8DA 3NVQA 1XH0A 5CGMA 4D0BA 3VXUE 1BQLH 1U91A 4JCLA 3WKYA 3SEPA 2OS7A 1FNEB 3AW5A 1JNJA 3V4UH 2VLKD 5D2NE 2FT6A 2R1XB 4LDLB 5E2WL 2J8UB 2ARWA 4OGXH 3H4HA 4KUZH 4PSRA 3O9WA 3U1QA 3LDBB 2WBWB 1F58L 4J5VA 3MRQB 2BRRL 1K8IB 3DOHA 4WHYG 1KYAA 3SPCA 5CSBA 5EA0H 4PJDA 2JKTM 4DVRL 4G7RB 3HMXA 4ZQKA 2QKSA 3MFFB 4W6WB 3HCVA 3LNEA 4RBPH 4RGOH 1I85A 2QHRH 4UOW0 4W81A 5GGUA 3OKEA 4HT1L 1OAUL 4IYKA 2UY7A 3UBXB 1JHTA 1JCVA 2NZ1A 2X89A 4U1NB 3W5NA 1ADQH 4EPSA 1U8IA 3ATAA 3LKNA 3PJSB 5J6HB 4W9CC 2DIBA 5EN3A 1DBBH 1PMYA 2EXSA 3NEOA 1RHHA 3CN3A 4PMEA 3NFPB 4FYQA 4XT1C 1H15B 5IK3B 3L4TA 2YPLD 4NKOB 3FTGA 4YC2B 5F0LB 5A7BA 4F20A 1HVXA 3MLYL 1KN4L 5GS3A 4XPGL 2ED6A 2MRYA 2YAFA 4X99A 1JPTH 5F9JB 3C5ZD 5ANHA 3C08H 4MXWH 5SWQB 4N2LA 1ITBB 5E9DD 3T1FB 3AG3B 3SE3A 3RZCD 4X4KA 2BP8A 3OD3A 4MLIA 2XWCA 5F88A 1E65A 3D08A 1IC7L 3FQUA 1OGSA 2MHAA 1HEZB 1UCTA 4N8VB 3RX5A 1G1CA 1WAAA 3EYOA 2O30A 2L7UA 4I48A 3ARUA 4M7LL 4NCDA 3MLZL 1O7DE 3BSZL 3P4NA 4MKMA 4OV5B 3WMSA 1KXQA 2BVUA 3S6CA 5ICYA 2IAAC 1A4CA 1CDBA 4KV5F 1LK2B 1FJ1B 4AGPA 3BQVA 1EZVY 2FBOJ 4APQD 2XVGA 1IAMA 3RJOA 3VD5A 4G7SB 3V9CA 4LOUC 1UYWL 3Q9PA 3WJJA 3IT8D 2B77A 1MFEL 4RFNC 4TM9A 3LIUA 1VGKB 1AE6H 2XLLA 4OAWA 4U6VL 3AU1A 2V9TA 2CLRB 1Q9KB 4LSDA 5I1HH 4ZSOE 4NHCH 4DP2X 4QHLB 4X7TB 5DD0H 1DQVA 5K9JH 2BVEA 2Y7MA 2M2DA 4HA1A 3T0EA 2YK1H 1XF3A 3TA3C 4H8WL 2EH8H 4L05A 2Q7AA 4YLBA 1DBKL 4H13C 2O5NA 3LB6C 4FE9A 3HNTH 4JFFD 1FA4A 1H3GA 4ZODA 5AFAA 2QHLA 2YUZA 3ES6B 2PO6A 4NQED 4ZMQA 3ALXA 3X2QB 1TEGA 3VX0A 1HI6B 2K70A 5EIIB 4W93A 2WYZA 4PRDB 1YPZB 2ZXAA 5F7DA 4HXAL 1HCZA 1ED3A 1IBZA 2GFBA 3ULUF 4GSQA 4I0PD 2ZUTA 3BRGC 4JFED 1JZIA 4P0DA 1CWVA 4LEEA 4ADIA 1ES0B 3VFRA 2D3VA 1I9RL 4QF1B 3FBQA 2X6UA 4KKLC 3LPPA 5C0JB 2F1BA 5CIPA 1ZE3C 1F41A 3TESA 5I17A 1AR1D 3R1GH 1OTSC 3SPJA 1JFQL 2FQDA 2Z93B 3HE6A 3K6DA 3KLHD 2EYSA 2H32H 3M6DA 3ALPA 3SDAD 3SDXE 1N18A 4ORZC 4LXFA 1T0MA 2FL5B 2XTJC 4F57L 4JMXA 1BHGA 1CXFA 1SY6A 4P46D 3NJHA 3AXIA 1QUNA 3VYPA 4OIFA 2JLLA 3N44F 3P54A 5FOJA 2PF6A 3B9KB 3CZJA 4XE5B 5HJDA 1BAFH 2GC4C 3AFLA 3KL5A 3U46B 1EBAA 3ZYZA 5LWYH 4X80L 1U58A 2YAMA 4BK8A 2R2EB 4K9EH 2X7LB 1E4KC 1E9PB 3DMMA 5E94B 3GJFH 4JZJC 2ZT9C 3UP6A 4N2BA 3N42F 4U1SB 3ARFB 2QPDB 2MQCA 2WXJA 1FCCA 1HQRA 4KRPC 3VRJB 4PJ8D 1JIBA 1EAOA 4XPAH 5AVQB 1VFOA 3L7EA 3QDJA 5FYLH 2A3TA 3IFNH 4I9XA 3AS0A 3RUGB 5CUSH 3ARQA 2VUYA 5DHDA 4GRMB 4Z3TA 5KAQF 4LL9A 3D09A 4F7CB 5HGAB 2DLFH 2HRPL 4XN2A 3FU3A 4FFVC 3KM2A 3IMVA 4WI7A 4P9HH 1J9CT 3OC8A 2VDOH 1GOHA 4NJ9L 4A2EA 1PNDA 3VB8A 2H4EA 4Y5YB 1JMZA 3KAAA 4ONFL 5A3IC 2BFVL 5KSVA 2HKFH 5SWZB 4HW6A 3H6AA 1X9QA 3HIZA 2IQAB 2OI9C 5TE6H 3QG7L 2AQNA 2X0VA 3FOMB 2OMTA 4PBDA 1TNNA 5C0RH 1NM9A 1MCKA 1NGQL 4HALA 1F1AA 2MJWA 4HJGA 4U3SA 3CZLA 4BGLA 4CC4C 2BS71 3V10A 4JDTL 2JE8A 2FB4H 5TE6L 4TLUA 3QHTC 5KYNA 4P5MA 3RG1C 3DYMA 5E2UL 4B9JA 2APSA 5A1AA 3HAEB 4BFRA 3VI4B 3L54A 2EC9U 3FFCB 5MEQA 2Q2EB 4W9LC 1RULL 1LO2H 1MIEL 2DPKA 1C5CH 1TKWA 1ANUA 3QYCA 3OQRA 1ZV5A 1UM4L 3VXME 5MEND 2WZPD 5JYMA 5KUKA 2JSFA 1ZHLB 12E8H 1FPTL 4Y4HA 4JB9L 3CNKA 5JIPA 4KKBD 3CMGA 5D7IE 4AZ8A 4J3VA 1A02N 4WJ5B 2B4CL 2Q7NA 4FG6C 2P4AB 3NGBB 1BMGA 1EEZB 3C5SA 3O6LH 4GAGL 5LGYA 4LHUD 3VXMD 4C59B 2JJSC 2XWJB 4ZO7A 3SGJA 3L5XL 4JCWA 3ZHKA 1Q94B 1SEBA 3FSZA 2ADIA 1HHJA 2VLKA 2RA1A 5BVJA 2WXNA 1NCCH 4XRCA 3FN0L 1T4WA 4LOUD 4JO4H 3P3RA 4NO3B 2UY6A 4QUOA 2IG2L 2CALA 4QKXB 3VGHA 3CSYA 3T3PF 2VL4A 4UZSA 5E2UH 1QI3A 2HLFD 4PHZA 1J0ZA 1OWWA 2IPKB 5D72H 1F00I 2I60L 3RNKA 1A22B 4ETQA 2DBLL 1UH2A 3ECQA 1UQSB 4MMZC 1WFNA 1WV7T 3VFGH 2D0FA 1NCWL 2B9AA 4WKXA 2FECL 2AQ3A 1TZIA 5IBTL 2YD3A 3ARBD 3OF6A 3QWQB 1L0YA 3L3OC 1Y6KR 3VWKA 1NJ9B 3FQYA 1YEIH 5FKPA 2AK4B 4NJ9H 4P2QE 1AHMA 1VDGA 4FEIA 5TE4H 5I1KH 3A67L 3ULUE 1XF2A 1KTBA 4J3OC 5FO7A 4GKNB 3TYFA 1SPDA 1A9EA 4X50A 3UIZA 3BVTA 3IWUA 1UT2A 3QHFL 3MRPA 5IEHA 4CSPA 4FA8A 2ZXCA 1QMUA 2GJPA 1TUPA 4MYWB 1WTGT 3WEMA 3AG4B 5LQBL 1SJMA 1WS8A 3LNHA 3JV5A 2OTPA 3GRBA 1KY6A 4MMXA 3MLWL 4WU7B 3BLPX 4QRPD 3QUYB 4H26B 4EUPH 4WO0A 2XKSA 2J72A 2YD7A 4KQ4L 4XAKE 5M94B 2NYKA 5DUPL 3WXWH 3RWHB 4J2XA 3RWCB 2K9FB 3GUFA 2QQLL 3QUKA 4C8XA 2D7TL 2GC7C 1KYDA 2NY6C 2YEZA 2OMXA 2MQ3A 4Z7VB 3SKNA 5BVPH 3VQ2C 3B7UX 1CT8B 1BFVL 4CKQA 1SXNA 1UH3A 5F3BA 2NSMA 4PJ8C 1BVOA 4ISVB 4JAMA 4NLHA 5DHYB 3EHBD 4WV1C 3OZLA 3H9YA 5AW9B 1ZANL 3ZE1B 3X11A 2QQKH 1QVOB 1JHKH 3ZX1A 1DO5A 1KTCA 5J1AB 2DJUA 2ID5A 3HC3H 1NA8A 1KF9B 4UTCA 4MJ2A 4OJFH 4TULH 2CBMA 5C0BA 4ZMLA 3PV6B 3QJHA 4ELME 2YPVH 5EU6A 1OP5H 1ORQB 3DTXA 3F83A 2CPUA 4OQTH 3VXRA 3DMMD 4LEBA 1ZT7A 1DEEA 5EIIA 1NCNA 1QFWI 3CFDB 4LGPB 2OR9L 4PJEE 1YG9A 1B4JH 2AJUH 4OKVA 4LL1A 2PYEA 5FECA 1Q72L 4C57C 5JR1H 1WD8A 4PV8A 4NC2B 3L4YA 4FA7B 4M9PA 1AZVA 3FT2A 1CE1L 5C0FB 5BUGA 2NX5D 2B15A 1Q0YH 4ZNEA 3RURA 1MFCH 1WFOA 2IFGA 1HH9A 2XY1A 4PR5A 3U4BL 3VXTB 1E5BA 1NJ9A 3QISA 1YEKH 2V8MA 3NESA 4HFWA 5L88L 4HT1H 4OT1H 1WG3A 4GI6A 2ROYA 4NPJA 3UAJC 4UIKH 1VGEL 4KXDA 3DVFA 4L8DB 4XVJL 2ZOWA 5HHXH 5TPWH 4PI2A 5HYFA 1IO4C 4POUB 2BVPA 5E5UB 4LAQL 3RILA 3IAQA 1F3RB 1SDYA 4M7LH 4W4NA 1WCBB 1ZTMA 4X2UA 2AQ1A 2XN9E 5E8NB 3CD4A 4NAQA 1OLZA 4DP1X 2BIOA 4NSKB 3D25A 5FYJU 4BZ1L 5CJQH 2AHIA 5EU6D 4QJ4B 1EAJA 3S36L 3VDCA 1HWWA 2J4WH 1FNEA 3O8XC 2V5RA 3GSRA 1CGVA 3D1MC 2C4FT 1NBZA 1MWAH 3FQUB 4HC1L 2G3ZA 1KGIA 4GLRI 4FQLH 3JWNH 1SN2A 2X0UA 3U7WL 3N50A 1KGCE 1IFRA 3MBEC 4MRBA 5AOZA 5ISZE 1U93A 5K1NA 3EOTH 1HSAB 2X4QB 3C60D 4LVOC 5GSRB 2CO1A 1MUJB 5CJQL 1QWUA 1YPZE 4HJJH 2NY0C 2QVFB 4OZGB 5F7FA 4LLMA 2P44B 1LEGB 4KKRA 2A6IB 4MJ4A 2JTYA 2BO0A 5C86A 2M1KA 2C1OA 2A9NL 1UJTA 1NC2B 1NGPL 1MJ7L 5EU3B 3A0OA 1PIGA 3EJSA 1RURL 4DERA 4CILA 2VLRA 2Z7YA 4WNSA 1VGEH 3RDTC 2YFNA 3MCKB 3NJVA 5DWUL 1WUZA 2QHRL 2ZWKA 2FSEA 3LH9A 2VZSA 1CZ8L 1XCWA 3AACA 4ONHB 2X6CA 1ZHNA 4FKKA 3TEUA 2QL1A 1VPOL 2WXIA 4L4VA 2FYVA 4OR1A 1MFAH 3WAJA 1VFMA 2V37A 4OCSL 1WFMA 4XNZC 3QUMB 3IVKB 5A2KH 3SGKC 1G7PA 1I1RA 1F58H 1PJ9A 1Y18B 2YO3A 4N2OA 4NOFA 5F1OB 3C6EA 3PYCA 5DMKB 2CZNA 5HYIA 5F96H 3KLAA 3QYMA 1BZ9B 3UTPD 4JO2L 4UM8B 4LK4A 2CDFB 3BDBA 4J23A 3T6WA 1U8KB 4QOKA 3ZE1E 3NGBC 2ITEA 3QZMA 2NZ9D 4GI8A 2H5UA 5GRUL 5DJ0A 1X5GA 5GPRA 1HHKA 3HI5H 4L1HA 4MD5A 1DL7H 1LP9B 1Q9OB 4M8QB 3KPSD 1A7OL 1LO5A 2ZKMX 4OY9A 3FQTA 1P1VA 3RWDA 3BFOA 4I48B 4YDKH 5BMFH 3G9AB 4JRFA 1ACYH 4E41B 1B0IA 1ZANH 5CGYC 3FN3A 5DMIL 1CLVA 2AXJA 3TJEH 5KVEL 5GS0L 4JN2B 4MQSB 3NJLA 4Y89A 2OJEA 5ACLA 4PGZA 1Q1JL 1KJ2A 2DM2A 3VDAA 3HZKB 2ESVE 2LT9A 4LVNB 2C3GA 1TZIB 3QQ4B 5JMOC 2LOEA 3FFCD 3L2MA 3TYGH 1IFGA 2X2UA 4JHAH 1KPUB 3QFGA 4X9IA 1EVUA 1E4WH 1AGEB 1UZ6F 3B56A 4NZJA 4P46C 5DQJA 5TDPB 1BEYL 1BXVA 2ADJB 4HEPG 1UXLA 1S9XA 3IJHB 2GTWB 5IMKB 3PJLA 3T2OA 5BJTB 4KHXH 1BREA 3ULSB 3GIZL 2ERJB 4BJLA 4F80A 4Q9RH 5SWZD 3VG9B 4PRDA 1CG9B 3ALWA 1RMFL 1TU2B 1S9YA 3B34A 4K3EH 3CFEB 2OW7A 3KXFA 1AGDA 4JRXA 5DEFB 3ZDZF 4HIHA 1YEIL 2CUHA 1JHLH 1S3KH 1MW0A 5IB4A 5IW3A 4GO6B 3DHJA 1D5BB 2P5EA 3MRMA 4JG1H 4J3OH 2ZONA 4KKCC 4J6IA 2Q8AL 2ATKA 4X8JB 1GHFL 4ERSH 1JP5A 9PCYA 3UTPE 3IDJA 3CU7A 3SKNB 2DBLH 3L2NA 4OLWH 1MW1A 4GRLC 2EDWA 3D3VE 4PJHE 4Y2LA 3WTYA 3VG9C 4KY1H 1J5HA 4FQQA 5D2LA 5AUMB 4UQDA 2VM3A 2CAKA 1J05B 4JY6B 1L9TA 2V2XB 4ZMZA 4XMKL 2HAZA 1BOGA 4X4ME 2XWXA 2CD0A 1N64L 4MD4B 4NQUA 4U4BA 1UM5L 3FK3A 4MAYA 3CHPA 5T5FL 1L6XA 1IGJA 1RZPA 4W9DC 1YMHA 3T0DA 4P2OB 3WKPA 3UTZB 4K55A 3QQ9D 3UBXI 3HHMA 4CRPA 1WD9A 2H26B 2QMJA 5AB0A 4JO1L 4W9FC 3KPRE 2AV1A 2EYRA 3BO8B 3TO4C 4ONGH 2PTTA 1G7HB 5ABAA 3MLSH 3MO1B 4WUUD 12E8L 3W0WB 3EO1A 3MJWA 5E7FA 3MV11 1JVOA 1NAKL 3FPXA 4MA8H 4QHMB 2JJTA 4NZRL 3DIVA 1LMKA 3A47A 3NFNA 4OF6A 1J8SA 4I77L 3T6ZA 3WUZA 2HFEA 3BT0A 2UUDH 1U4EA 5BO1H 5C0AE 3IFLH 4M1DH 5FFGA 4QTFA 5EO9A 3LVEA 3I85A 1A3RL 3HPLB 3TFKC 3P9WB 4IRZA 2DMHA 4N0YL 2F19H 3IFOB 4MNHA 3BUTA 3QDJD 4BZYA 3ECBB 4X6BA 4UQCA 2JLPA 2LLGA 4LLQB 4G72B 3Q3GA 3QCVH 5D2LE 2Q6WA 4UU9B 2QELA 3HB3B 4WW2B 4XO5A 5F44A 5BJTA 1FVCB 3KPOA 4PTUB 2VLRD 3WHXA 2J12B 2FWSA 5HHOA 1Z0NA 3QEGL 1X5FA 4NN6C 3OB0H 3QIWA 4AE1A 3LKQA 5B38A 5FCSH 1BZEA 3UTSE 4RETB 4NT6A 4OZHA 4PGDA 2B0SL 4UT7L 3LQAC 4IEFA 2J2ZB 4R7NA 4ICXA 4FJYA 4Y4HB 2MOGA 3VFNA 2C34A 1GGBH 4RNRB 3HEIB 1J88A 1PZAA 4ZTPH 3BUQA 1BFOA 1JZ3A 3ULVD 4D94A 1UXMA 3MNWB 4IK6A 2VKXA 2NNCA 2QGBA 4LP8A 2AK4D 1ZV9A 5E8PA 3QI9B 1TEYA 3OHXA 1QTYT 2B1HL 4Z5RB 3ARXA 1K3IA 2K7QA 1YYML 4FC3E 1YDPA 3CG8A 4GIPD 3MTXA 3ILQC 5JPMA 3ISYA 5D93C 1P7KA 3WN5B 3CK0H 1JGLH 3LOWA 4NYLA 4BZ2H 2WINB 1K5NB 2SEBA 2VC2L 1I9IL 2WIMA 4HXBH 2NNAB 4F58L 3C8KA 2C9PA 4OFVA 1N0LB 5GGVL 1WF5A 3GSNA 5TDNB 2UWEE 2J88L 3OR6A 2VZ3A 3ZW3A 1EQWA 3EJPA 4HLZG 3UABA 1T1ZB 3FQRA 1HIML 4WSJA 3O6KL 3RU8H 2EXTA 2VABA 2WAQA 1LE5B 2N1TE 4TQHA 5ABDE 2R8SH 5FW8A 4F93B 2P8PB 4XOBA 1AGFB 1F6FB 4IGBB 2Z35A 4ZTEA 3BAIA 4YQXH 1XIWC 4XOEA 5EPMB 3DRTB 2OYLA 2P80A 1NAMH 3CZFB 5EZOH 3RDTA 3S34L 3FB6B 1DJIA 5FO8B 2WC7A 4GQPH 2WLLB 1ZT1A 4ODXB 4N2CA 4B5EA 3Q44A 2CO2A 3SKOA 4OFDA 3TBBA 3LZOA 4EOWL 2Y06H 3JQOB 3WENA 3FS9A 3KDMA 2Z8WC 1FL6A 3IFOA 4TSCH 3S98A 4XBEH 3TFKD 4HPHA 5HYQB 4E68A 2OKMA 1RZ8B 3GO1L 2H9GB 1JK9B 3GT6A 4H0GA 4UDTA 3K71B 4KKZA 4JO5A 1YHPA 2H3XC 5CJ8A 1CFTA 5F9JA 4BA0A 3AWGA 3JSSA 1CI3M 2WXKA 1CBVH 4AM0B 2HCZX 4XMXA 3FUIA 5LXGH 4GUCA 2PPCA 3AGVA 2Q5BA 4EMZA 4AYDC 3GZKA 3CIQA 1MIML 3KMDA 1L7IL 2FIKB 2GUYA 2H2PC 5DD6A 4FCHA 4IGBD 5F1IB 2OYMA 1XZWA 4KNUA 5CWSB 4QYOB 1IGFH 4U6YB 5I1LB 3VFPA 3APMA 2NW3A 2TSBA 3MNWA 1L9PA 4JM2B 4DWHA 4NUGL 4OLEA 3TCXA 3BQUC 2BLFA 2J20A 1MFBH 4LBEA 4K7PY 1AFVL 5CSZA 4ELKB 2QV2A 2YPLE 4ZT1A 4D9RE 1ZY9A 2WKGA 4QXUH 1RFDL 5AVVB 2CH8A 1CLOL 3HI1A 3K1KC 4NUMA 3TNMA 3Q1EA 1MW2A 3APNA 1QR1B 2G30A 3EXJA 4JFDA 3VRLE 1O7SA 3H42H 2JXMA 2MQ0A 4ZQKB 1DVSA 4W70A 2ITCA 3KPPA 5HHVH 2R56L 4OBRA 4OQ1A 4R5XA 4XC1H 1JHTB 5D1XD 4TSCL 3KGRA 2Y06L 1MCPL 3CFEA 1V3KA 3KXFB 1DQLL 3OLGA 3ULVE 4N2HA 2F1AA 4WFEE 3TJHC 4UI2A 1AO7B 2XN2A 4FHBD 3U6XA 4XMUA 2ZWZA 1G4MA 2LVCA 2ZUYA 3B9KD 1KUMA 2XWTB 3M1OA 4XBMA 1WEJH 1E4XI 1HTYA 3GQFA 2JCWA 5ID1A 1FFNB 4WGKA 5ANMB 1DZ0A 3KXFD 5C0AA 3QDMB 3L1OH 3TS8A 2DIJA 2HG5A 2W65A 2Y5EA 4BE5A 3V79C 5FYKU 2X89D 1KCRH 3EJTA 1NC4D 4ZUVA 2BNUA 4KTGA 4I5BB 2J6WA 4YS4A 4ZX4A 4KQ0A 1GCYA 4QHNB 5JXEA 3GBEA 4L9LB 1FFPB 2ESVB 1NGWB 3D9AH 3SBQA 3UAJA 1YEHL 3O3DA 1OF0A 3WL9B 1JGEA 2R51A 5F72S 3RAJH 3T8XB 5IT2H 5DSCA 3O3EB 5BCAA 5JIMA 4N8CH 3KJ6H 4OI9A 4JKMA 4D0CA 5BOZG 5F7UA 1U42A 4PJFB 3V6OC 4G5AA 2IANE 1E9OB 4NRYB 3AREB 3VCLB 5IB2B 3QORC 3Q13A 3ARED 4PRAA 3C60C 1V5JA 1ZTXH 3W5MA 4E41A 3BUYB 4JR9L 1LK2A 2JKSA 3WGUB 5BS0B 4RFEB 2VQ1B 1EUUA 4EI5A 1E5AA 3DUHA 4OJCA 1OCWH 1KTJA 5IFJA 4N0CC 5L6YH 2ZKHH 4M02A 1CICA 5D2NA 3D50A 5JYLA 1ITCA 4X6FB 1H8LA 3O4LD 1OE3A 3BVVA 3IJYB 1FLRL 4M1CD 3MLVL 4JM2A 3D6GA 2PXYB 3W9DB 3WMQA 1PZ3A 3MOBH 5C2BL 4N85A 1S7UA 5JO5A 3HR5B 3RIFK 3O2WH 4JY5H 1NCBH 4MB3A 3WU1A 2W91A 4O2EA 4ALAL 2RHEA 4UM9A 3VRIA 1O6TA 1LO0L 3RWJA 3BLBA 1U8NB 1QR1A 5D93B 3DTDA 1A6AA 4WNQA 5D1QD 3HI6H 5D2LF 1U3ZA 4XPHH 3UPCA 5BXFB 1BVKB 3S3BB 3SY0B 5T33L 2BRQA 3P4OB 1LLAA 3BUIA 2XACC 1P1ZA 3BEWA 3NCBB 3FO1A 2JK5A 2XV6B 3FB5B 3CLEL 2A99A 1NEUA 3ZT5A 3IFLL 1ZS8B 4FCAA 4DGIH 4R4FL 5AAMC 1MCNA 4QLRA 4YSPA 1R34A 1MEXL 5I71B 3ABKB 2RH0A 3UC2A 4MA3A 3RY4A 3QZBA 3OX8B 2BZCA 1RZFL 3PDOB 4K07A 4MA8L 3ZO0A 3TV3L 5CEZD 2I85A 5JLZB 1U8CA 1R9FA 4F3FB 1G0XA 4PS8A 4AQ1B 5LAPA 4U1LB 1NBCA 3QDGE 5I8KH 2Y5TB 1EO7A 5ADOL 3QDHA 1KIPB 3FOLB 4KO6A 1UGKA 3F85A 5I6KA 4GG6A 3U0PB 4YHIA 3RVUD 4MX7A 2J5LB 1H0DB 3OLIA 1PZDA 4ORGA 3WTUA 2X4PB 4U1HA 5I82A 1UVQA 4L9DA 5L7XL 3DWTA 4BH7A 1JPGA 2R7EB 3TGXA 3DVIA 1OAJA 4JLRA 3VFWA 3TPUA 3GBNH 4GSDH 4J6RL 5T5NF 5I28A 4NFCA 3ETBJ 2NDFA 4GT0A 1U6AL 4W9KC 2HVBA 3NJKA 3TH3T 3WLBB 4F1ZA 1BQRA 5E8OB 1ZS2A 1ZKAA 3T6VA 2I32A 3CUPA 2FR4B 1WBXB 3PWJA 2CPCA 4F7KA 1AGFA 2FBJL 3BP4A 2OJ1A 3RUGF 1FIEA 4OM0H 4R90L 1E6OL 1MRCL 4IRJB 4OZ4B 3SKJL 4DPBX 4JG1L 1S9XB 1WS7A 6FABH 5EOCL 4P4KA 1YN6A 2VLJB 4ESKA 4E9SA 4L8CA 2XV2A 3WJLC 2OMTB 3MCLL 4IJ3C 5B1JA 5IJVA 4H44C 2WUCL 1B9ZA 5C08E 1UWEH 3MNZA 5KSVB 2WLMA 1LO3L 2AF2A 1UXWB 3QXAA 1SN0A 3LS5L 4H5SB 5JO5B 4J4PC 4DNLA 7FABL 4JDVA 2GSGB 1PZBA 4L5FE 5FUZL 1R0AL 4YLCA 2AJXH 1EWHA 3QEQB 4N0FB 5IMLA 5LN8A 1JK9A 3Q2LA 4XVTL 4AQAB 5EHFA 1BLNA 4AJVA 2C9AA 4R26L 4DPAX 4CU7A 4Y4HC 3I9GL 4QWWC 5GS0D 4NWUL 3MBWA 2K8QA 1ZLVK 1NFDB 4URKA 3T08A 4XP9L 4TXVB 2WZ6A 3ULVL 1MFNA 2R69L 5E9DA 2VDNH 4UQBA 4X6CF 5HI3D 4Z8FL 3TEZA 1EEUA 2J43A 3GSXB 4L23A 3TJPA 5D7HA 3SPVA 3N40P 1UEMA 2JH2A 1KBVA 4G8FB 2FO8A 4P2RD 1EEZA 2A1WL 2R83A 5I0DA 5C0IB 1BGXL 3UG4A 1A14H 4AZ8B 4CC4A 1U3HB 1N59B 5DJ2A 4A7SA 3X13A 5BVJB 1EXGA 3ARBA 3OF6D 5DRNB 5IGXH 1OCCB 1TZHB 3LNIA 3TNMB 3TM6A 2WLKA 4W4OC 1N5AB 2DKSA 4R83A 3K2UH 1IEAB 5H37G 3PWPE 2EO7A 5C6TH 3IRCA 3F8UB 4AT6B 3S37L 3RGBA 5D7LD 3EJJX 1BYPA 1YDPB 5D5MB 4YHKL 4OD2B 3JWNE 3S7GA 3DGCR 4OFQA 1QFHA 4JDZB 3VMNA 1I7ZA 4AYFB 2WXGA 25C8L 1HJCA 2D7NA 3KLHC 1WIOA 2EUZA 5FGSA 4NO5B 4AY0A 1GPOL 2O5XL 5ALCH 4B7LA 1S7QA 4IMKA 3EF4A 2DTMH 4N5ED 1JF1A 5BW7C 2DQEH 4JZJA 4QXWA 4C4KO 3Q1SH 2XC8A 3FU0A 1U8OA 3BE1H 2XVKA 3MRRB 5LDUA 4ZMAT