4CMMB

Structure of human cd47 in complex with human signal regulatory protein (sirp) alpha v1
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
120
structure length
120
Chain Sequence
ELLFNKTKSVEFTFGNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords TYROSINE-PROTEIN PHOSPHATASE NON-RECEPTOR TYPE SUBSTRATE 1
publication title Polymorphisms in the Human Inhibitory Signal-Regulatory Protein Alpha Do not Affect Binding to its Ligand Cd47.
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2014-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4cmmB00
2ZSWA 5AYUH 4TUKH 4ODBD 1U8JB 4PB0H 5IBTL 4PJDE 4OFKA 2YSSB 3NCCB 4U1GB 5JW5B 3ZDYE 3QWRD 3ZLQC 1TPXB 3O9WD 4YHPA 1MJ8L 2GFBA 3M8OH 2AXJA 2XPGB 4IMLA 5E2UH 2EDJA 1IM9B 5FGSA 1FVCB 3P9LB 2OL3H 5DLMH 2DIBA 3OGCA 2OXHA 4JFFB 1KXQE 3QUYD 2DB8A 4Q2ZB 5DQDL 4L8DA 4YWGL 1X5IA 2NW2A 5I1JH 4GRWE 3G04A 4DQOH 4S10A 1NGWB 4MCYA 4X6DF 1EMTH 1Q0XH 1IGJB 3F6LA 4NM4H 3WFBH 5D71L 4UDUB 2XA8L 1SJHB 2G75B 5F9JB 1JZ4A 4IRSC 4M7ZC 4CJ1A 3CDGA 5A1AA 5IVXB 1EDQA 5GGRA 1RK0A 2FGWH 2H41A 3TC9A 4XCCH 5DJ6A 2X4UB 1YEEL 1RUML 3FO9B 1UWGL 2BRRH 5D1ZD 5HHXL 5CEYA 4DGVH 2RGSA 3BQUC 1XCQB 5D2NA 2IAMD 1Y6MR 3K0WA 3EYOB 4JJ5A 1HNFA 2DQDL 3QA3B 5BQ7A 1IGTB 1TVHB 3RX5A 5MENB 2E9JA 1ADQH 4RX4D 4OZGB 4ZUTA 4JREC 3ARFA 2XG5A 4NZRH 2OS7A 5CEZD 5J89A 4L9DA 4AG4L 4NWTL 4QRPB 4F57L 2BNUB 1IC4L 1UFUA 4I4WB 4C54A 1OL0A 5F44A 2R1XB 4ODXB 4Y4HA 2VLJA 4DW2L 1KPVA 4MAYB 1F90H 1JPGB 2BNRD 2IC2A 5AEAA 2R9HC 3U4AA 4Y5YA 2BVTA 1LGVA 3MRKA 4OLWH 4HUXA 2QADC 4Q9RH 2FB4H 2VERN 4LPWA 2HAZA 2OQJA 2HLAA 3MLXH 4MSWA 3GSOA 4MQXC 1CIDA 1P9MC 3EJYC 5TDNB 2BXYA 3ZTNL 4O51A 2VXUL 1S7WA 2J8UB 3H3BC 2IPUG 1NCDH 1QEWB 3QO0A 1MJ7H 4IJ3B 4JG0L 3MJ8A 4S11A 4XC3L 3JV5A 3I02A 5FF6B 5J12B 4LASH 4N0FB 4OCMC 5FV1L 1FL5A 3ZT7A 3QXDA 12E8H 4MS8D 4PGEA 3OQ3B 3VXSB 3TT3H 4OIBA 2VKWA 1B88A 2BY1A 3T2NH 3JWOL 2XWBB 2X40A 2OMNA 3ULVL 2IFGA 4CMHC 1UQSA 5D7SL 3P30H 3WXVL 1TZIA 2GY5A 4PJGF 5HDQH 5B39A 1IGYA 2OX5A 3F12A 4P9MH 4AY0A 1I8MA 1EV2E 2ZUYA 4HWZB 2E7MA 4V1DB 1WUNT 3MUY1 4I18B 4LFHG 1I8IA 4UZGA 2H2PD 1TETH 1MHEB 5JDJA 4NSKA 1KT2A 3MXWL 1PG7X 4LK4A 3O81A 1M4KA 1KCLA 1QBML 4IRJB 2HFEA 3HFMH 3HR5B 5KSAB 3WLWC 2HFGL 3FZUC 4MB3A 4N1HB 5KVGH 1G7HB 3VXRB 1BQHB 1WBYB 4U05A 2F8XC 5JUEL 3CD4A 1JGEB 4FQ1L 4ETYA 2BSSA 3MBEB 3ZHDA 4EDXB 1CICB 2D7TH 2PUQT 4KXZI 1CXFA 4PJ9A 4K71C 3C60D 5F93C 1JCKA 4JANA 4AT6B 3I50H 2D3VA 4YNYA 3DROA 5K9KB 3MO1B 4H26B 1H5BA 4XWGL 3HTLX 4UOJA 5JA9A 1MFCH 5IQ7H 1OT1A 1LE5B 4LLYB 4PJHF 1ORQA 2WWKT 5IMOB 1U8KA 4MJID 5DUPL 2VJXA 4Y16A 1WBXB 1EAPA 4YFLI 4IOIB 2EDDA 3S37L 2PCPB 5HGBB 5CZKA 5IVOA 2ZG1A 2NYYD 2PXYD 3GJFA 4WTWA 1PKOA 5KS9B 2E7HA 3HG1B 2NXYC 5I1IL 1KJMB 2XN9B 2Z31C 3L9RA 5ETUB 3VG9C 3MV9A 3FO0H 5ERWB 4ZAKD 5F6IB 3JV6B 2JCCE 4BZ1H 5IEHB 4WI6A 3ES6B 2JJVA 4LFHD 4GW5B 3B5HA 4X4XB 2BMKB 1Q9KB 4OM1H 3U0WL 4RAVB 3MRPB 4G9FE 3RKDC 2NY4C 3VGHA 5HI5D 4WHCA 1OW0C 3PL6D 5HYQB 4NQCB 1N2RB 1V3MA 1RZIA 4K2UL 4XPHH 3I75B 3V6FB 3SDDD 3ARWA 3WKMH 5SX5K 3GSUA 1E27A 1YUHB 4M8VA 1MHCA 4JHWL 1MCFA 4NQDA 1K4CA 5DI8A 3RY4A 4FABL 1MJJA 2DTSA 2IMMA 4PJXB 3RGVB 4LQ1A 4Q97A 3CC5A 1P2CB 4HIXH 5J11B 4PTUB 5GISH 1I1AB 2NY3D 4IMLB 4WV1A 3V4PH 5EU6B 1P7KA 1CLZL 3C6LA 3V79C 3IETB 3HKFA 1F97A 2DWEA 4ZFGL 3DUHA 3SGKC 4WNQB 5HYJA 2NW2B 4L1HA 1EEYA 4XT1C 3RZCB 3TO4D 4KTDH 2MKLC 3MX0A 3NACH 5FYJE 1MFDH 3V0WL 1R5IA 2Z8WC 3OX8A 2OBGA 4FQXA 4C56E 4EN3A 1BM3L 5I19L 4GRLA 1S7SA 4OZFB 1KJ2A 3MLZL 2ARWA 2DQIL 3EO1B 5CINH 3QUMH 4U6YB 1PEZA 3HMWL 3MZGB 1DBJH 4GKZA 3QRFM 3UTTB 4HC1H 4XMPH 3RWIA 3DSNA 4UV7L 1KLUA 3U9PL 3ARGB 3N1FC 2VSDA 1DN2A 3NBNA 1IAOB 1UKTA 3EYSL 5D7KD 4J12A 4RWYL 4Q9QH 1BQUA 2BCKB 3Q6GL 4R90H 2IH1B 1FYTD 3ARFB 5GGSB 4RQQA 2AABH 5L2KE 1K9TA 1AQKL 5L0QB 3ARTA 4NWUL 3WS3A 1ZVSA 4UBDC 2VAAA 3QFJD 2BOCA 5DMJB 4NKMA 3GSNA 1MUJA 2DKSA 1LO5B 3DMMD 2EXYD 3ZE1F 4YQXL 4W6WB 2NY6C 4PRHD 1KIRA 4Y5YB 1IEAB 3HG1E 3U36B 1AIFA 3R06B 3HS0A 1TQBC 4IRSA 3VWJB 4RNRA 3QG7H 4N8VG 4P5MA 3C2AL 2R39A 4XPFH 3VXTA 5JR1L 1I7RA 3GHBH 1BFVL 3C5SB 2FR4B 1F4WH 4QHKJ 1BVLB 2Y6SC 4KJWD 3JXAA 4MA1C 4PRIE 3M45A 4AQ1B 3SJVD 2BFVH 4XNXH 3MLUL 3KYAA 4GT7A 5TE6H 3BZFB 5JDSA 1ZGLB 3STZA 1MWAA 3LH2L 3TPKA 2R56H 1UG9A 4Z7UF 1QD0A 1MLBA 1ZT7B 2W0FB 4LRNL 3QAZB 2C1PB 5EN2A 3UZVB 4P2OB 4L8SC 4NZUH 4OGZA 3VFMB 1G6RB 2NW3B 4ODTH 3F12B 5DK2A 3GUTA 3D39A 3LVEA 2B7DT 4CADA 1E6OL 4BKLA 1A7QL 1F4HA 3BD5A 4QXWA 4XVUC 5SX4I 1BLNA 3RWHA 5DWUH 2M1KA 4UUJB 4UV4H 1HINH 3NABH 3A67L 3ILQD 1KTLB 2FZ3B 1JF1B 5MI0C 1KOAA 4M4RA 2A83A 4U0RB 2LV4A 4PTTA 4KZDL 3ZL4L 1D6VH 3K8KA 1IZKA 4F33B 1DE4A 4KJYA 5TDPA 1SVZA 5F9DC 3CMGA 3LHPL 4PJ8B 2IADA 1JI2A 2CLVB 4KK5D 5D2NE 2ZCLH 1W0YT 4F3FA 3V5DB 5E8NA 4J3OC 4B53A 1OTSD 4H8WL 4UU9B 3KLHD 2ID5A 4N5ED 2WUBH 5JOFA 3LOWA 4BSWB 4D0DB 3REWA 1X4YA 1VACA 4UIMA 3BP6B 2F8OA 2OZ4H 5HYSA 3H7BA 3MJ9A 5CBEA 1OHQA 4ODWB 1SYVB 5DDHB 1DDHB 4KRPD 2Z92A 4TSBH 1B0WA 1D6EA 3EJJX 1U92A 3PHOA 5INDA 2LAAA 2VLJE 2ZZUT 4RA0C 5E9DA 4Q7DA 1FNFA 4MWFA 3ULSA 4IIQB 5DD0H 1S78D 1T1YA 3TO2A 2D7PA 4ZXBB 3NTCH 1UCBH 4HCRL 3D3VD 1AC6A 3QEGH 3KLAA 4QHNB 5IBUG 1D3CA 4YHNB 4HIJB 2ORBL 1KJ3H 3P4OA 2X4SA 1BAFL 1G7PA 5FYKE 2EYTA 1YEJL 1INEH 2P48B 2AEQH 3UTPD 4XP6L 4W4NA 5ESQA 4CMMB 3L6FA 4RMVA 1UACH 1I1FA 2ICCA 3RY6A 2A9MH 3O6KL 4GKNA 2EYRB 1FGVH 3VFVA 3O2DA 1T7XA 4CU6A 3AS2A 3VXUD 1BFOB 1AGEA 3S3SA 2HJLB 1BBDL 4OBRA 4H5SA 5F89A 4CN4A 1N6QL 3KAAA 3IS0X 3MPCA 3BMVA 4ZNEA 3RPIA 1E27B 5KOVC 3VFTB 5C1MB 4NQDB 3ABZA 4YBHA 1FNAA 3L3JB 2XKNB 3RAJL 1YJDC 3HRZA 1MJ8H 5I71C 1LVEA 4FFVC 3SDAB 2OCFD 3CNKA 3S4SA 4C4KT 1RZJC 2ZOLB 5FDYA 5BZWB 1JWSB 1DJSA 3E8UL 4YWGH 5CJ8A 1L0QA 3PWPA 5D6DC 4UTBL 4OLYL 5F9WB 2FATL 1Q38A 2Z31A 1GGTA 4KH2A 2BSTA 1RUPL 3UMTA 2DWEB 2AGJL 4BQ9A 5D71H 3DV4B 2XA8H 1H8OA 5FM4A 1NDMB 2ICWA 5I8OH 3U7AA 3WLBA 1T5XB 3CFJB 5D5MA 3MBXH 1AKJB 2P7TB 2A38A 1EBPA 5DURB 4N1EA 3GSQA 1T3FA 4KUCF 4LGRB 4FQXB 1OTTD 4GRLB 1UYWL 2DAVA 1KJ2B 1UWGH 5D2LF 3RI5F 1QSFD 1OW0A 5FUCC 5F3HA 2Y72A 2APTA 5DRXA 2CIIB 3ZE2F 5IB3B 3E2HC 4Z7QE 2Q76A 4GKZB 4PJAF 1UWEH 4JDVA 5H94A 1ERNA 2YD4A 4TOYL 3WD5L 3L3IA 2DQDH 1ORSB 2ZJSL 3HNVH 2CR3A 3TN0B 3KNBB 4PRPB 4LVOB 1FZJB 5J1TC 2NY2B 1CCZA 1T2JA 2ATKA 4AG4H 4NWTH 2XTJE 3QCUL 2DYPA 1IC4H 5GGUB 3RU8H 4PGJA 1NBYA 3WFZA 1N5AB 4Z8FL 3PJSA 1Y18A 3B9EA 5DUBB 4LPYA 3SGKA 5C0NC 2AV1A 2VAJA 3PG2A 3MRDA 35C8H 5T1DH 3LPWA 4YEEA 5EU4B 1MCNA 1WAAA 4EVNA 1Y0LB 3MV9E 5FO7A 4CRPA 5FECB 4NRYA 3LZFL 2AXGB 1JHTA 1A6TB 2VXUH 4R96A 4DUWA 3O8XB 3MLRL 1NUFA 4JG0H 2VXVL 1K3ZA 1G0XA 3RNQA 3LSOB 1QRNB 2X4NA 4XC3H 3LQZB 1CDYA 4GXUM 1KCSL 2HN7B 1YA5A 1I1CA 3IDYC 4P23C 5EZLA 3SQOH 2DD8H 5JDSB 4JCLA 3STZB 1BQLH 1MWAB 1Q0YL 3JWOH 3V6OC 3P9MA 3ULVH 4I0PD 5D7SH 4KZEL 3WXVH 1QP1A 3IRPX 4NQDE 1D5XB 3RUGB 1MLBB 5AZEL 3UYRL 2B0SL 3F7YA 4YAQB 3QDJB 1NCCL 5E2VL 3U7WL 3T0VA 5EN2B 5KSAC 3CDFA 1Z5LA 4M7LH 1AD9B 4YDVA 5TF1H 4NBYB 5DHVA 4ORZC 2DLGA 2FL5B 1FSKC 3P0YL 1U41A 1QBMH 3G5YB 2W07A 2B20A 4TSAL 3MBEC 4NO0D 2Q8AH 5HYJE 2HFGH 4JRYA 5AYQA 3RNKA 1XR8A 4NQED 3QXTA 4FQ1H 3QT2A 3HE7B 1JZ8A 2GITA 4MAUL 2DWDB 4X7TA 3QQ4A 1F8TH 2ERJB 3MGOB 4PV8A 5CGTA 3C08L 1URLA 2KUTA 4E41A 4ZPTA 5ANMA 1G9ML 4NQVA 5GSRB 1EEZB 2WBKA 4XRCB 2OM5A 3QCTH 1W0VA 25C8L 3O6FB 4XWGH 5HGAB 4DZBA 2CXGA 4V2CB 5T3ZE 5MP6L 3ECBA 4FXKA 5I1CL 5E8NB 1DEDA 4GAFB 1HXMA 5DUPH 3O9WB 5K9JL 2GT9B 3REWB 2LAGB 2E6JA 3IFPB 4DFIA 5DD6B 5F6IC 5GGVY 5HXMA 4G8FA 5IOPB 4HUUB 3IU4L 3QUYB 4LARL 5EU3A 4BUGA 4JPIB 3CZFB 4F2MB 5CLTA 2VLKA 1TNNA 3PHOB 4LPTA 3HC0B 4WU7A 3VGBA 5D72L 2LTQB 3SEPA 1WLHA 1FZMB 1HXYB 1JPFB 3RL1A 3TV3L 4OKVA 3X14A 4UTAL 5DR5L 5F8QC 2FHBA 1A1NA 2EZ0C 1DN0B 2JELL 1ZHBA 2OK0L 5H2BA 1T1WB 3TZVC 3U0WH 3MV11 2R0ZL 4GRMA 3ULUD 3C5JA 3ROLA 2UWEB 5D1ZB 5FYKL 3L6FB 4ONFH 2IAMB 5GGTL 1NGYB 3WO4C 1I1FB 3RVVD 4X4ZA 1P4BL 2AVGA 4LKCB 5F7DB 5I6XB 4GKNB 5F7FA 1GGIL 4OLXL 1KB5A 1F45A 4TVPD 1I1AC 2WP3T 4JHWH 3GIVB 5MHSE 5I66B 1JPTL 4FABH 4UIKL 4F7MB 4MDJB 3MYJB 3C2SA 3T77A 1KGCD 3BPLB 5EOCH 4HFWB 3RBGA 4HX1A 4JE4B 3EOTL 4KKAC 2P8LA 4KKLC 2VXQL 3QG6B 2XRAL 1G7LA 1CLZH 4ZUWA 4XTRC 4MLSA 1FIGH 3BN3B 2GI7A 2BNRB 2AK1L 4PP2B 5IK3B 3VH8A 3D39E 5JHLL 4DJMA 5DVMA 1KUMA 1AO7D 3WHE1 5GIRA 3MNVA 5BJTB 1CD0A 1N59B 2BSTB 4GRWH 4G7VH 3V0WH 1AGCB 3PQYA 2DI7A 1LO2L 5I19H 3OB0K 5D5MB 2ITCA 2FGZA 3Q5TA 1PX3A 3O2WL 4H1LB 2F54D 1F4XL 3ARGC 4OF3A 3A6CL 3B6SB 1F02I 3H9SD 2FBJH 4M5ZL 2R0KL 3HMWH 1RZ8B 1R0AH 3IGAA 4HEPG 4DGYH 1T22A 3MRBA 2YK1L 3F5WA 5DK3A 5I75B 3T0DA 4HZLB 4PJBF 1WF5A 3OJDA 1XF5B 4UV7H 5GSVB 3U9PH 1XH3B 1XGPB 4R0LC 3WBDA 3MQIA 5L0QC 2EDBA 3I84A 1CFNA 1BBJB 3EYSH 2QSCH 3S8WA 5CLWA 3NCFB 5FHAL 1OAYL 3Q6GH 1EGJA 2F5BL 4U1SB 1ZGLP 4K23L 4L3AA 5INCB 3FT2B 4NWUH 4F7EA 4K8RD 4WEMB 4I2XB 3TA3D 1VGEL 1J0IA 2BVPA 1KB9J 4NC1C 5D6DA 2W91A 4XGZA 1UVQB 5IFJB 2P1YA 1P6FA 4LNRA 1FLRH 1IQDB 3BJ91 4OTXL 3JTTB 1Y18B 2JB6B 3BZ4A 3MRGB 3BUTA 3BW9A 2UY7A 1ZGLM 3CPLA 4U1HB 5ESAB 5E9DE 4YDLB 1FNGA 5DJCA 4PRBB 3MRDB 3C2AH 5JR1H 1A7OL 3VGEA 1BFVH 4HS3A 4JFOA 5JO5B 1HILA 2FJHA 5FO7B 1RUKL 2K7PA 1TCRA 2ESVA 4MCZB 3UTZA 4AEHL 4K7FA 1WEJL 4IEFB 2PTTB 2R2BB 3ROOB 3C60B 1U8PB 5C0CD 3FFCD 2OTWB 5T5FL 4MQSB 1MFBL 5D1QA 4PLKD 2AXFB 2VZUA 1N3NB 1KBGL 4MD5B 2XKUA 5IB2A 1J0JA 3UDWA 2NY0D 3P9MB 1X9QA 5JZ7C 4LRNH 5KG9B 4ZNEE 5D9SB 4MJIB 5AUMA 3K80A 4JDTH 3C5ZD 3B2UC 3IDGA 2EEAA 3FQXB 1IAII 1P84K 2NY5L 3MRFA 4ODUA 5F9OL 8FABB 1J0HA 1A1MA 1YECL 2W9DL 2E27L 3ETBF 5GJSL 1H3TA 2QHRL 3D85A 1I4FB 2PXYB 2AV7A 2H6PB 2F53A 1CFBA 1EFXD 3BWUC 3INUL 3C87A 4YDVB 4HXBH 3PWPE 4EI6A 4ZAKB 2F58L 2C4FT 2DTML 1VA9A 4JN1L 3BEVA 5C3LD 3BN9C 3WIFB 3AMLA 4GW4B 4UT6L 3TT1L 2JB5L 5D5ME 3ZL4H 4AJ0A 3RWJA 3MRNA 3HE6C 3WSQL 1XR8B 4YXLL 1J18A 2X70A 4R9HA 3LDBB 2Y07L 5DJZB 3CFDA 4KJPC 3KPMB 2VZTA 1OAKH 1VERA 4P9HL 5TJWK 2VN4A 1RZFL 3PL6B 4P23A 4HW6A 3LD8C 4NO5B 4U7SA 2B8OT 3SDDB 1JYWA 3ALXA 1M6OA 3P0VL 3W0WD 4PGCB 4H8WH 5JPNA 2X4QB 4L3CA 3GHEL 5TQ0L 1FFRA 5DD1L 2YA1A 4FXKB 2WWMD 5CP7B 4WO4A 5T3ZL 3SKMA 2ADIB 4CNIA 3FQNB 1DTUA 3VRIA 3MV8D 2NY3B 4U31A 5TGBB 3FRUA 1T4KB 3VXPA 4X6CF 5IBLC 3FO1B 1XF4B 1CWVA 1WJ3A 5DJAA 3WFHA 5ENWB 1OF2A 1MNUH 1AXSA 2YUXA 3QEQD 4NC2B 3TO4B 3OAYH 4YPGA 4OD2A 3FOLA 3LMJL 4S1DD 4WU5A 5GS2H 2O61B 4I0KA 1Q9LA 4UNUA 4KRLB 3ZTJH 1BHGA 1BAFH 3IFNH 4PRNB 3RL1B 1WAAE 4PJCB 1JN6A 4XP6H 1H0DB 1H8SA 4XCNA 1ZHBB 1CS6A 1I85C 2D03L 1GGCL 5H2BB 4DK6A 3O6KH 2DBLL 5I8EB 1HHHA 3IDJA 1OGAD 2HT3C 1NGQH 1RK1A 1WQVT 1QFWI 1IKFL 2A6DA 4OZHA 3C8HA 1RI8A 3WIIH 2BRQA 1BBDH 4IS6A 5ACMA 4GUPA 1N6QH 1ROWA 1D5MA 4MX7A 2C3VA 4X7CC 1JRHH 3GBNL 1RIHL 3GMLA 4NNYB 5FOBB 3MV7A 3QIUA 4TUOA 5F9WC 1XIWC 4WDIA 1QSZA 1JE6A 3T77B 2K9UA 1FYTB 4XHQA 1ZLUH 4LLVB 1C16A 1NCUA 5FUOH 5A43C 2P8LB 5HHPB 1KLGA 3E8UH 1FL3A 4RFOL 4OLYH 3DMMB 1LNUA 3G5XA 2FATH 1AD0A 4NRXA 4PRHB 2AGJH 2CLRB 3D9AL 4RGND 1CGTA 1GSMA 3EHBD 5CZXD 2Y9RT 4L4VA 5C6TL 2R0LL 3SGJC 2ZUSA 3K8LA 4PBVC 1L0XA 2HG5B 2VB5A 3V8CA 1DEEB 2VIRA 4QY8B 5C71A 1CXLA 3TZVA 2N4IA 4D8PA 4PGBA 5FYJH 1CFVL 5GZND 5DRWA 3C8KB 3OR7A 3S35L 3SJVB 4LOUC 4JVWA 4WUUD 1OP9A 3Q48A 3TWCL 1YPZB 1FVDA 1WICA 4X0KA 1VEOA 4NHUB 4LVOC 1AGDB 4E41E 1JGVH 4PJFF 2PN5A 5CSZA 5ANME 3IGAB 4L29A 3BO8B 1R3IH 3WD5H 3F5WB 1NJ9A 3DO3A 4MXQC 1GOHA 4OCLC 4XXCC 4RAUA 5F96L 1MPAL 2GTWB 3DX6B 2CRYA 2R1YB 1TMCB 3L95B 2QQQA 1UA6L 5B22A 4AL8L 3DX7A 1RJZA 3KJ6L 1QNZL 3SDCC 1A4JB 3P4NA 3VI4E 2GCYA 3TLRA 3KDMA 1BEYL 3ESUF 4KJQD 3EGSA 5B8CB 3AVEA 4P48A 3GNML 2BVPB 3L3DB 5T3XE 5I8CA 1OAUL 2DMCA 5CJQL 4YHLL 3MJ9L 4TPRL 2VLKE 1F2QA 4HS6A 3NPSB 4L3ED 1RMFH 5DJCB 1DLHA 5EBLB 3LZFH 5C86A 4ENEC 1LILA 3BIKB 1CT8A 3V2AR 1X5JA 4RGMC 1TCRB 2ESVB 1JVKA 4KQ4L 1FO0A 1A6VH 1KCSH 1GC1C 1NFIA 5FKAA 4N8VB 5FYLE 3IDXL 1EPFA 2BOBA 3EDKA 2ATPB 4R0LA 1OAZH 1RURL 4KMQA 1N7ML 1J86A 1NEZG 2JJTC 1CE6B 4ELKA 4PUBL 4KV5E 2E3VA 4NFBA 4ZS6C 2CKBB 4M03A 1KV3A 1YZZA 1EZVX 2LU7A 1CQKA 5AZEH 4NQSA 1QQDB 1R5WB 2A1WL 1B90A 1KPUA 1ZA3A 1NCCH 4CN1A 3A0OA 1OGTB 4KI5D 5IMKB 2FIKA 1A4KB 4Q9BA 1MLCB 2GUOA 3ARBC 4K94H 5C08A 3X3FL 3OR6B 5EG6C 4KRPB 2AJVH 3K2UH 1ZVYA 4Q6YA 5HGDB 4EUPA 4M5YL 2IPTL 3HE7C 4NBXB 2FEDD 4YIQB 2DQUL 3O6MH 3C09B 3D3VB 2ERJC 3VXQB 4K9EC 1JHKH 2EXWD 4UDTB 2V17L 1HKLL 4FXLA 5C07D 1M7DA 5GZOD 3PQYE 4JGUA 3BP4A 3O6FC 1CDJA 5KVEL 1Q94A 1U95A 2ZSVA 1NSNL 3QDMD 3C08H 3MRNB 1KC5H 3MYZA 2X4PA 1G9MH 3IDMA 4U6VH 3VXUB 2CK2A 3MREB 25C8H 3T4AA 5BV7B 1T04B 5C2BH 1SYSB 5MP6H 1KEML 3WEXA 5JPMB 1ZLUK 3V5KA 3MROB 5I1CH 1JGLL 2GEEA 4WI5A 1QBLL 2XY2A 4PRAA 3LN5A 2NR6C 1WIUA 1EVTC 3U46A 5EFIA 1WVZA 2XIDA 3T0XA 2LTQC 4EI5C 1BWMA 3T1FB 3IU4H 4L8CA 1BWWA 4IDJH 3FRUB 4N90D 4OFVA 2H2SC 5M95B 1YEGH 4YC2B 4ZUUB 1K85A 3QNZB 3T3ME 2X7LB 4A6YL 3VCLA 1X7QB 3WFHB 5DJAB 3RWGB 3H6JA 1AXSB 5D72H 5D1ZC 4HKJB 3B9KD 5I1LB 3DPBA 2Q7YA 5CWSA 4ZFFA 3U0PB 3IB4A 1UXWB 5IB5A 5J6GA 3IDNB 4CU8A 2NMSA 3FMGL 5DR5H 5IM7B 2O5XL 2OK0H 2B2XL 5CAYB 1OT2A 1DBAH 2R0ZH 4HQQH 4Y5VB 3DHMA 3FT3A 5CEXA 1AR1D 3ZSTA 3I6KA 1PD6A 5FYKH 2ESVE 2P8MA 3CFEA 4HK0B 5I9QC 4PLJD 3RTQD 2C4FU 5DRNA 3BPLC 1GGIH 3GK8H 1MY5A 4OLXH 1HHHB 2Z93A 1VGKB 3KYNB 2EDXA 4FP8H 4GKOA 3FOMA 2A6DB 4Z76B 4UILL 3WNKA 2YD1A 4WENB 5M94B 4UIKH 4E0RA 4CVXA 4JQIH 2M8XA 1XGTA 1DZBA 3BPOB 3EYUL 1JNHA 1C5CL 3AY4C 2OTUB 3EOTH 4ZO7A 1MCQA 1G0DA 4HZAA 4WDIB 1CYGA 3VW3L 4XPAH 3VGAB 2YUWA 1U8MA 1DANT 2X4TA 3OZ9L 4JVUA 4YHZL 1I75A 3FCTB 1XEDA 2EDYA 4QF1B 1I7UB 1A02N 2AK1H 4FFWD 3GKWL 4JKWA 5ID1A 1LP9B 3HZKB 1CVRA 4JR9L 1T1XA 5F7HA 3G5XB 3TNMB 3LQAH 1U8HB 5EOQL 2F53E 4JM2F 1LO2H 4K3EL 1F58L 4O58L 3QR2A 2Y4SA 1Z0NA 5HI3C 3QHZL 5I75C 4QCIA 4KAQH 3LPGA 1S9KC 1I85A 3CGTA 1R3JA 4HJGA 4FA8A 2VIRB 4J8RB 4WJ5B 3WN5B 3A6CH 1X5KA 3W11C 2PYFB 4LHQB 1HH9B 2R0KH 5I1EH 1IC1A 3DX9B 2YK1H 3LEVL 3KLSA 4LPVA 4CDHA 4EOWL 4P3DA 3GM0A 3L5HA 4OGYH 1AGBA 1BOYA 4PFEA 4F15B 3ZT6A 5CSZB 4BELD 4MNGA 1U8QB 4OZIB 1BZ7A 3NN8B 1NJ9B 1PEWA 2G60L 4I0PB 1JZ5A 2RFXA 1XIWA 1P53A 3KPRA 1W72A 4J3VA 1OAYH 1S7QA 1U3HD 3GGWA 1BOGB 2NY1C 2YOCA 1ZXQA 4K23H 3BHBB 4OF0A 3H3PH 3DX7B 1VGEH 1MI5D 1LMKA 3CK0H 4A2MA 1KG0B 3SO5A 3GO1L 3O3EA 3Q3GB 3QYCA 4MXWL 3OAZH 5CD5D 4UNVA 2A74A 1TTFA 3MNZB 4NO0B 4B41A 3CFKB 3F65A 3SGJA 4NOBA 1A7OH 4ERSL 5F1KC 2IANA 5T3XL 3RQ3A 3GJFH 3EYFA 4NQEB 2EDWA 1O7SA 1DLHB 3L5WB 2ZG3A 1UZ8A 1BGXL 1WEJH 3BPNC 3X11B 4E42B 3N9GL 1MQ8A 4JLRA 2CRZA 5A2JH 4YBQD 5MEPA 4BK4A 1VFBB 1MFBH 1TVDA 2E7LA 3UJJL 3SDXF 1P84J 3RVTD 4OZHE 2KZ1B 4NO2B 1MCOL 4GXVL 3L7FB 2V6HA 4OZ4A 4FXGA 5FYLL 2NYYC 2PXYC 3UYOD 5EO1A 5J9PA 3SDCA 1KB5L 3MV7E 5EC2A 3O3UN 3TF7C 4P0DA 1EHXA 3GIZH 3GBLA 2VLLB 3UTQA 3IFOB 5F9OH 3WFCH 2W9DH 2E27H 4RDQG 5KTEL 1E6JH 2G9HA 5GJSH 5C08B 2QHRH 4CBPA 2ED8A 3EYQC 4LCUA 4OD1L 4OFIA 1AP2A 4RFNB 1MFAL 4MJ6B 1J8HD 3INUH 5JORB 4FQPA 5DO2C 3LKQA 4X7SH 3QSKB 2F58H 5SWQB 4QRTB 4M1GH 5KSBB 3EOAB 4XC1L 4IOSD 3ZZ1A 4UT6H 1UENA 2BERA 3TT1H 3PL6C 3FQUB 1PX4A 1XFPA 2UYLA 2JB5H 4J3UA 5BW7C 2OI9C 5EOCJ 3PXHA 1T7YA 2E9IA 4J4PA 2Y5TA 4KKCC 5ESVB 2P47B 5IR1A 1IAKA 1LO4L 2Y07H 3I85A 2Y5EA 3HN3A 4WHYH 4X6DA 1TJIL 4OGAC 1X5ZA 2WBWB 2X4OB 4NN7C 3MLTA 4P9HH 2H8PA 1LK3L 3AS0A 3NFNA 4Y7MA 1KJ2H 1NAMA 3OXSA 1BZQK 3P0VH 5D7JC 1G6VK 4QHMA 1AFVL 2NY3C 1K8IA 3C9NA 4JFZL 3X13A 3GHEH 5TQ0H 5DD1H 1QBAA 4QHLB 3EO0A 5T3ZH 3E1F1 5BVPL 1YYLL 4Y19D 3TYFB 3TBWB 4O2CB 3VGFA 5GGRY 3ARBA 4IM8A 4BQ6A 3GJEA 2AJZA 4P4RA 3RX7A 1QFPA 2NLJB 4J23A 3U46B 1YJDL 5J13C 5ICYA 1IFHH 4MJ5A 2VLRA 2LFGA 4AH2A 4WFFD 3WMSA 4OFYA 1FNLA 3HCVA 1RZJL 1PW3A 3W9EA 5JXEA 1AO7B 1T66D 3QPXL 5C0RL 1QO3B 3U2SA 3LMJH 1F3RB 1AI1L 1FDLH 3DOSA 3GSNH 4QEGA 1DCLA 1TDQA 1CFSA 3PWNA 4GSDL 4XNMA 4C57C 1F13A 2F54B 1GGCH 3H9SB 5HHQA 2DBLH 5EUOF 2IALB 2DQGL 1M7XA 2CPCA 2Y06H 1G7QB 1OM3L 1IKFH 5F72S 1MELA 1OARL 4IHOA 4N0CD 2XZQL 5DA0B 2KH2B 5F70A 1T2QL 3FOMB 3GBNH 5EOTB 1P1ZA 5BZDA 4QGTA 2Z8RA 3DMMC 5DF0A 2VZSA 3BVNA 1SHMA 3D1MC 1T0NB 2FD6L 1RD6A 1K6QL 1FJ1A 3HMXA 3OPZH 1S5HB 3VFRA 4EI5A 3OAZK 3O3DB 2VZ3A 4RFOH 5C08E 1QRKA 3D18A 4NC1E 4X80L 3O0RL 1LEGB 3GFUA 4XP1L 4KDTC 3SCMD 3D9AH 2J5LB 5C6TH 2VDKH 2R0WH 3DO7B 1EJOH 2R0LH 4APQA 5AAMA 5EBMB 1A0QL 5ITBL 1ZHLA 5ECJE 4X8XA 1NC2A 5GRJL 1IGMH 1Z3GH 2BX5A 5KSUA 5HGHB 2JJWA 3IXTB 4JPKL 4U1IA 2UUDH 2PR4L 4QCIB 2V2XB 5DHYB 2VDNH 4YR6A 5C0CB 3FFCB 4HPYL 1EEQA 5J4MA 1JGDB 1NCWH 2ZOKB 2HFFB 3K7UA 3O41B 4KK9D 1UJ3A 4P2RD 2FDBP 5BS0A 3OGOE 3ILPB 4WTXA 5E7FA 3WFDL 3BZEA 1U91A 4X6EA 5HVFB 1UXSB 4OV5B 5C92A 1D5BB 2MHAA 3MODL 5HBBA 2R69L 2NY0B 4P2CG 4KFZC 1ZSDA 3CMOL 4AL8H 4TNVK 3VD5A 4I5BB 3GEWB 3C5ZB 1CZ8L 5EIIA 1PYWB 3CFCL 4JFDD 2H45A 2P42B 5FK9B 2KKQA 5F7WC 1JYNA 4M62L 3MRHA 3E6FB 1ZK9A 1EFXB 1OAUH 1J9CT 4PJHA 4YHLH 4KUZL 3MJ9H 4TPRH 3NCBB 1HOCA 1YNLL 2KPNA 3AXLA 3RVXD 1R5VA 3ARSA 2C9AA 3WFEL 1HHKA 5IIEB 3VFNB 3DV6B 1A8JH 3D25A 4UQ2B 3GRWA 4NDMA 3QHFL 3MUHL 3WUWG 3KLHC 4N5EC 4KQ4H 3SKOB 4LF3B 4QHUA 2O93L 2ITDB 1NMCC 4X4MA 3U48A 3IDXH 3NGBB 3S37X 1P7HL 1A6UL 1MFEL 5K9OA 4K3DH 1RURH 5BO1L 3L7EA 4EZMA 1NBQA 3W0WB 5JOPE 2V2TB 4HHAB 2VDOH 3QUXA 4OM0H 4PUBH 4PJ5D 3L3HB 2P5WA 5FDWA 3O2DH 3G08B 4U1LA 5DGRA 4MLIA 3IF1A 1S7XB 4O9HH 2NZ9D 5DJDA 5DC4B 3U83A 5J9PB 3MV8B 3QXAB 3P9WB 1NBVL 1JNNH 5IQ9A 3B83A 3EFDL 4QO1A 2HWZH 2A73B 4O2FB 2V7HB 4M5YH 2IPTH 3QWQB 1H3UA 4Y4KD 5DXWA 1A1OA 1ZHNB 1B0RB 3QEQB 2DQUH 1YNKH 2DJSA 1LWRA 4WFED 4JFQA 4H0HB 4GAGH 4XBGB 3ZKMD 4M7LT 3BISA 5KSVA 2R2EA 2C3XA 1FC2D 5FGRA 5MEOA 2O26U 2YKLL 1RJYB 1MQKL 1NSNH 5DJYB 2JJUA 5E2TH 5HDBF 5HHNA 3G6JB 1OGAB 4L9LC 1IQWH 4I9WD 4PYHA 1NFDB 5C0DB 2X44D 3L1OL 3OWEA 3IRZA 4RSVA 4P2QA 1KEMH 3NFNB 3I6LD 3CFBA 4QT5B 1UM4L 2FO1A 1C5DB 4LIQE 4NZTL 3TBVB 3DVGA 4MNGE 1QBLH 1IBGL 2Z91A 5DVLA 4P46A 5I16A 4ETQA 1JUFB 1LO3H 1I9JH 2X1WL 5J8OA 3KPRE 3WNMA 4NN5B 2IPKA 5F1OB 5IP4A 3GJEB 1D9KA 1FZKB 1KIPA 4PV9A 4WI4A 4PJEF 2EE2A 4PY7B 4WFHD 2VRAA 4A6YH 4NPYA 3PUCA 5F88A 5C0BD 4RGNB 3V6ZA 3ULVD 4JFHD 1DLFL 2UUDK 4JRXA 2DQTL 4UB0L 5BW7A 2B2XH 4ELMA 3CLEH 2IANE 4WW1A 2Z0BA 2LU3A 3PWNB 2PTVA 4CVZA 4ZSOA 4BSVB 4WUUB 2HTLC 3IAQA 1T21B 4Q9CA 3AM8A 1RHHA 3O4LD 3CXHJ 1OOAA 5D7JA 4HKBA 5E2WL 1A6ZB 5I15L 2GSGA 3JV4B 4F9PC 4X9FA 4OIIL 1NH6A 1W0WA 3BPCA 4G80B 2FRGP 3QIWD 4X6BB 4GG6A 1C5CH 1KACB 1NGPL 4XCFH 4FQJL 4P5TC 1AHWC 2GJZB 3KYOB 5TH2B 3MJ6A 3VW3H 1IARB 3OZ9H 5H35B 2AK4A 5IUSA 1ZMYA 3U30B 3P73B 3HZMB 1YEKL 1CLCA 5GJTL 4Z7UA 2GAZA 3O3AA 2NTFA 4TQEL 5EPMB 2IBBA 3WN5C 1NGZB 5EOQH 4Y2OA 3V5HA 4ALAL 5JNYA 4L3EB 4O58H 3HUJB 5JA8B 5DHVH 2WQRA 4LSUH 1Y6KR 4BZ2L 3FL7A 4NHCL 4JG1H 3V7AE 1FQ9C 1YN6B 4V2BA 5MEQB 4F15C 3MRMA 4D0CB 2OL3B 3PXJA 1YEIL 1FRGL 1P4LA 1BFSA 1NKOA 5C8JA 4I0PC 4X5WB 4EOWH 3LEVH 2HKHH 2VDML 4X6DE 1RZGB 1VADA 5E8EA 2XZCH 3U7YH 4JQVA 2ADGA 1EAJA 3B9VA 5E99L 2G60H 4F37K 1K2DB 3FO2A 1U91B 4MJ2A 2DLFL 1A3RL 5B21A 4XI5D 4O5LH 2UVEA 1NBZA 3F62A 4BA8A 3HZYB 3T2OA 1WBZB 1G6RL 1P7QD 3QUMA 4F8TA 4UAOB 1TJHL 3PWUA 1BIHA 5IWLC 3FQWB 3AB0B 1EX0A 3I2CH 5DRZA 3K46A 3WHXB 1QA9A 1G7IB 4KDTA 3GO1H 4RIRA 4MXWH 1A9BA 2AKRA 1PQZA 4GS7C 1YEDA 3SDYL 5HYFA 2VLRE 2XZAL 4JM4H 4X9BA 2I07A 5T3XH 4G7YL 4PJIB 1IGIL 5C07B 4DCQB 5B38B 1QFUH 4NN6B 3EUUA 5SV3A 4FRWA 1S7VA 1LDPH 4ZUVA 3KYKH 1NLBL 4Z0XA 2DKUA 2A2QT 3QDMB 2FLRT 2PO6D 3EJZD 3N9GH 5CBAA 3PP3H 3QNYB 2PW2B 1T5WA 3UJJH 5DS8B 4U1KA 5JTWA 1F3JA 1K8DB 1VPOL 2KL6A 4YPJA 4LLUA 3OKOA 3PDDA 4N0YL 5IW1B 3QQNA 1YMMA 2EDRA 2B39A 4IMKA 5EA0L 5FYLH 3CX2A 5KW9H 3QUZC 5FA4B 3FONB 1CDIA 2BVUA 3H0TA 4P59H 1KB5H 1ZA6B 1TZGL 2AEPL 3NFSL 2GQHA 3CZJA 3QIBD 3HPJA 1RJLA 2YD6A 3LKOB 5KTEH 1JZ2A 1S7RB 1PG7H 1VFUA 4ZYKB 1ZLSL 4OD1H 3T3PF 1NEZB 1BVKA 3SPVB 3VRJA 5AZ2H 3MXVH 1ZT4B 3QUKA 3ULUC 5HHOA 1M71B 4IDLA 4WEUD 4XC1H 1VESA 3B9KB 1IM3A 4L3EE 2J8HA 3RVVC 3QWOB 3REVA 3IXAA 5E6IA 1AGFB 3L3KA 3KJ4B 4Z5RB 3NZ8A 1FCGA 1TJIH 5IG7A 3NA9H 1A14L 2DL2A 3SGEI 3OKEB 1RVFH 3BT2H 3RTQB 3G6DL 1IVLA 1YMHB 4GO6B 3SGDI 5I1KL 3ZDXF 1QSEA 3MRIB 3FT4B 3NCMA 4GG8A 1AFVH 5FIEA 1QR1A 3KPPB 5BS0E 2XWJA 4JFZH 3T0AA 2GHWB 2ADFL 2IPUK 2VNCA 4PJDF 4PPTA 2BC4B 2VR4A 4YBLC 1NDGA 1WFTA 3SBWA 1A9EB 4X5LA 2DQJL 5D2LA 2AI0L 5BVPH 1YYLH 1T6VN 1HIMH 3ZT5A 2E7CA 3HRPA 4GMTL 3FQRA 4LIQL 1VHPA 2BVQA 3SY0B 2MFNA 4PJAA 1EHLL 2ICEB 2A6KA 3IKCB 2VLME 4R4ND 4S1RH 4ZUSB 1QUNA 1EGJH 2VR9A 1RZJH 5C0RH 3P11L 4QYOA 1M7IB 1T1ZB 1C7TA 2BSRA 2ICES 2YD7A 2D31A 1AI1H 5F88B 1DQLL 4PJHE 3LV3A 4C83A 4I3RH 1BX2B 3NIGF 4Y2DC 1I1RA 1YYMH 4GSDH 1BF2A 3ZTJG 1S5IL 2DMBA 4ELMB 4N9GA 4YH6A 5IMLB 3SN6N 2CDEA 4L9LA 4PLNC 3DVNA 2DQGH 1R3LB 1OM3H 1JV5B 1IGFH 2BDNL 1NCBH 4LLMB 1DVFC 1MCHA 4M48H 4YZFF 3T0EA 4ODHL 2HLFC 3KYMA 4X4ME 3OTTA 3CCHA 5DFTA 4K8RC 3TA3C 1UB5B 2EO1A 2H26A 2FBOJ 3CUPB 3O11B 2KQNA 1QLEH 3LS4L 1GRWA 2HVKB 4LLWA 3HPLB 1U3HB 2DF3A 2P5WE 3RWFB 4GG6B 2FO4B 2J5LC 5BRZA 4X5XA 2HTKD 1KXVC 1RIUH 5AD0B 1OY3B 5HJ3B 5I18L 3S88H 3EYVB 2AQ1A 4X80H 3O0RH 3DRQB 3U4EB 4XP1H 4JO4L 2F15A 4AM0A 3GMMA 1FNEA 4HUVA 3RP1A 1HHJB 3I9GL 1ZWIA 4HUKB 3MFGB 5GPRA 5GRJH 3STBA 2E9WA 3DETD 2YRPA 4IRZL 4JPKH 3S96A 1MIEH 2WIIA 4MA7H 3RVWD 5HD8D 3IJSB 4U1JB 1GPOL 2G2RB 2MKWA 4OV6F 1BQHG 3WFDH 4OUUA 1AR2A 2EDTA 3C5ZC 1OD9A 3GMQA 1UADC 5GS2D 3QFDB 1I8KA 3MODH 1GC1L 2OSLA 4P2QE 4MNHB 4UINH 5ICXA 2WAHA 4HWNA 2W1NA 5I1HL 5FM5M 5E4IA 4P5TA 1AHWA 3CMOH 2BY0A 1NAML 5L6YL 1CZ8H 3BGMA 3CFCH 3QUMB 4OLEA 3TYGL 4PRDA 2HMID 4M62H 2ZKHH 4NUJA 4G9FD 3G9AB 5LAXB 2F74A 2XXMB 1J8HB 2HVJB 4BJLA 3MRQB 4JO3L 2LABA 5BCAA 5EUOB 4KUZH 3DIFA 4Z7WB 1YNLH 5C0EA 4UNTA 5JHDA 4JEGB 4TNWF 3QPQD 1UM5L 3ALWA 4OF7A 5IVXF 1XGUA 3KPLA 3LKSB 4OCRL 4RBPK 5C7XL 4HJ0D 3TPUA 2QHLA 3PWJB 4JRXE 2W59A 3ZE0F 3JSSA 2R29L 4K9EL 1S7VB 4ELME 5D1XC 4ODSH 3QHTC 3ZE1E 1WCBA 5GXBB 4ZSOE 1EXUA 4M9OA 2I9TB 3SKJL 1MFEH 4U1NB 1J1PL 4KMTH 3H9YA 5DYOA 4XZUB 2I9LB 2QSTA 2HP4A 3MJGX 3BKML 4P2YA 3KXFA 4OZGF 4ZQKA 4R4BA 5EO0A 5FYJD 1IC7H 4Y19B 4QNPF 3VFPB 2BVOA 3WDHA 2EKSB 5CD3A 4C56D 5IWLA 4GG6E 1T83A 4KWUA 2R23A 4M9PA 3FN0L 3RHWK 2O5YL 1JPST 3Q5YA 4AMKL 1KTDA 2AK4E 1BZ9A 3HPJB 4HS8H 1QKZL 1XGQA 4JZJC 3HLAA 5SWSA 2MCPL 3HMXL 4Z7UE 2HJKA 1LEKB 2UZYB 2CD0A 1Q9WB 4FG6C 2R2CA 2GTZA 4JHAL 2XOTA 5DQ9B 2C3HA 1IM3B 2J8UF 2VISB 4HIHA 1DUZB 3C6SB 1MQKH 4J3SA 3O6LH 2QJDA 1NC4A 4FZEH 5L2KD 3VFUB 2PW1B 5AG8A 5DQJB 1KCUH 1HH6A 4WTZG 4G6KH 4G8IA 2ZCKL 3KPOA 5E00A 4GQPH 4NN5C 3QIWA 4JKPL 1O0VA 3HG1D 3QUZA 3F8UB 1IBGH 3PWLB 5CEZL 2HT4D 2A6JB 3D5OF 5IB4A 4Y8DC 1MJUL 1XF3A 3MR9B 3X12A 3JBG7 4BH7A 2V5SA 1ZHKA 1A22B 1MCWM 3EHBC 4PJBA 1MH5B 2BVQB 3D2UD 2YZ8A 1D7FA 4PRID 2Q6WB 2VDLH 3BRFA 2J88L 2CDGA 4XBPA 1HHGA 5C0AA 1U93B 1HZHH 4P5KB 3MA7A 3SCMB 5GZNC 4S0TD 4U6HA 1RV6X 5D7IB 4HXAL 5E5MB 1DLFH 3HZVA 4I3SL 1YC8A 1ZLVH 4HT1L 4QTIL 3NFPB 5DFVC 1LDSA 3R4DA 1R3HA 3LV3B 1DQDL 4ZFOB 1C1EL 5DD5L 5J1AB 5DEFB 1U8IB 4ZTPL 3ZSSA 2HKFL 1RUQH 1CI5A 2CDEB 3HI5L 4F7CA 4P2RB 4JB9H 1ONQB 4QRUB 3GRWL 1NAKH 4HDIB 5HDOA 4YE4L 2JE8A 4LPCA 4OIIH 4ZOCA 5GS1A 1FO0H 4F7TB 3QEUB 4MD0B 4XH2B 1YMME 1NGPH 2YD9A 3LKPA 4GBXA 5EU5B 2EYSA 4M7JL 4JZOB 4JFDB 4R3SA 1YY8B 5KS9F 4RFEA 4I77H 5K9QG 4OCXL 4TQEH 3ZMRA 1QPPA 4B0MM 3OG4B 3IU3A 4ALAH 5B39G 5B3JF 1F3DH 5D93B 2VXTL 4Y2DA 5HHOE 43CAA 3P4MA 4LAJH 4BZ2H 4NHCH 4EUPH 2EIZA 5C09A 4D9QE 4KDWA 1Q9OB 4FQQA 1FRGH 5F7UA 4MXVF 5JIPA 3ARFD 2YR3A 1DVFA 4OCSL 1FV1B 1GZPA 2J3SA 1CG9A 2GJ6A 3EKCA 1DUYB 2P45B 4Y4HD 2VLJD 2APBA 5E99H 1QSEE 4PJ5B 4TVSa 2DLFH 4LEOB 4Y5XC 3MOBL 4PJXF 1HHIB 1IZJA 1A7NH 2W9LA 1B2WL 2IFFL 5GRVL 3V52H 5E95B 1TJHH 1GIGH 5D2LE 1U58B 3VXNB 2FEDC 3AAZA 5FYKD 4LMQI 4R7DA 3EDEA 4U33A 2ICWJ 3A6BH 3ZE2E 3AMKA 2I60H 4NJAL 4PJAE 5I0DA 1VFOA 4D0BA 2J8OA 4Y4KB 5D6CB 1KNOA 4NJ9L 4EJ1C 2HJFA 4G7YH 5IV2B 3LRHA 4R2GC 1FPTL 5F7MC 4QTHB 2F19H 1IKNC 3UTSA 4X6CA 1NLBH 4HMCA 1KULA 1B0GB 4LRIC 3JTSA 1DBKL 4LCIH 2V7NA 3GSWA 5AWNL 4WWKA 3D0VA 1AXTL 1HQRB 1GYAA 5FFLA 4NCDA 1ED3A 4LNVA 1I3GH 1VPOH 3TFKD 4N0YH 3MRJB 5L7XH 1FVEA 2VZOA 2DIAA 5EA0H 3T8XB 3T0EE 4PGDB 5GHWH 1CGSH 4OAWA 4Q6IB 1NMAH 1TZGH 3NFSH 1I3VA 1U36A 4Y1AA 4POYA 1DL7L 1IEBB 1GJIA 5DEGA 4XB8A 5EO9B 1P6AB 4QWWD 3B9KC 4KROC 4E9LA 1QFHA 5BRZE 1ZLVK 4G8EA 3B4NA 5C0BB 1AR1C 1XGQB 2D7QA 4PJ9D 5IHLB 2OJEB 5J1SC 1TZHA 2P44B 4FMFA 4PREB 3AU1A 4PLJC 3RTQC 3LIZH 3FB7A 4LSQL 1EK3A 4LBEB 1AJ7L 3GSRA 1SEQL 5HY9B 5D1XA 3BKYL 4XXDA 4ZFZA 4Z0BH 3N50A 2EICA 3ARDC 1A14H 2XTJD 4YO0B 4P4KC 3G6DH 3LEYH 2XACC 4Y16D 5F7EL 3VWKA 5I1KH 3O4LB 1JWUB 4G8GA 3IS1X 1CGUA 4LDLB 1EVUA 4DVRL 5GRXG 1T0PB 1I7TA 3GSXB 4FQ2L 4CGTA 1KELH 3T09A 3QIWB 2AI0H 3UC0L 1FL6B 3KHQA 1FC1A 4LCYB 3MV9D 2VO5A 5E8DL 4LIQH 3D69A 1KPRA 4WW2B 4PJFA 3VFOA 1S9VB 2ARJA 1EHLH 4JY5L 1U3JA 5CJ5A 1W72H 3G6AA 4JZJA 3S35X 1BJ8A 1Z9LA 2CJUL 2FX7L 3P11H 4NNXA 5GGQL 4HKZA 1MHPH 3H3KA 2CDGB 4G43A 4X4YB 5DMYA 2RHEA 1DQLH 3MRCA 3IDIB 3FQTA 3MNWB 5JHDE 4OJFH 1F5WA 1H9VA 4XB7A 3QRGL 1S5IH 5C0GB 3RWEB 4NQDD 1HEZB 3T4YB 1RQ5A 3UTOA 4MD4A 4YHOL 5ADOL 2FWOA 1XR9B 2EDKA 1ES0B 1T0MA 2BK8A 3M17A 4HCRA 2BDNH 4YHIB 4FQHB 1TTUA 1YN7B 3O4OC 4MA8H 5E1AA 5K33A 2W60A 1TQCC 3D6GA 4S2SB 3TEUA 3C6LD 4M02A 1R3KA 3FTGB 2DM4A 3G5VB 4MDIB 2VKXA 5HYJD 2VC2L 1ULVA 1AE6H 2I5YH 3KXFE 1JWMB 1P7QB 2D0FA 5CD5C 4KRMB 4LAQH 4CKVX 4HK3N 1R24A 5LBSL 3IVKA 3GB7A 4EN3D 5I18H 1HSAA 4GRLD 4WI8A 2I24N 3S97C 2E5EA 2CUIA 4JO4H 1UKQA 3RWDB 4WGWB 1QG3A 5CGYC 5DJ8A 1LK2B 3LN4A 5GGSY 2EDLA 2DIJA 4HWBL 3I9GH 5SWSE 2HRPL 5DEZA 5T3ZD 3QI9A 4LSRL 4YBQC 3TH3T 5E08H 4W81A 4IRZH 3IJYA 4FQLL 1OPGH 3RVTC 4O00A 3UBXB 4OLZL 4ISVB 2PO6B 2X9YA 1WC7A 3DXAA 2GSIA 1GPOH 4M3JA 4GW1A 4NYLA 4P57B 5KN5B 1F6AB 3BRGC 3DURA 4J1UA 1LE9B 3FN9A 3NCJL 1T20A 4TULL 4LKXB 4X83A 3G5ZB 5GRUH 1XCTB 4GRWB 4WEBL 4R7NA 3VFGL 4EDWL 2CKBL 1HCFX 1GC1H 2DBJA 2VR5A 5BOZG 1IT9L 3MUZ1 4KK6C 5I1HH 1NANI 4M00A 5DC0A 3BUYB 5D7LA 5FB8A 1NAMH 2H9GB 3VE0A 3OKNA 4IRSD 2DN7A 2JIXA 1VFAA 3QIBB 3QISA 4G6JL 1BQSA 4PJBE 3WNPA 1MCBA 4Y4FC 1E4KC 3QDHA 3ZKNC 2EDOA 2V2WA 4D0BB 1I9EA 3FAXA 3O2VH 1XGRB 5C0AE 1SJVA 5TQ2L 5ACZA 4PBWD 1KIQB 1CE1L 1KNOB 4OCRH 5MHSD 3LN9A 5E94A 2H3NB 5J6HB 2WK2A 3WE6A 1E28A 1XF2B 1ITCA 2R29H 4JRWA 3MLSL 4LLQA 3CJJA 4M8QA 4HJJH 3LKRA 1DFBH 4KQ3L 3BXNA 2QQLL 4Z18A 3SKJH 4XPGL 4HH9B 2NXZC 1YNTB 4NBZB 1F00I 4WWKB 3B2VH 2FJFA 3L3GA 3D39D 5F1IA 2R9HD 2VL5B 5EC1B 4Y5XA 3DRTA 3BKMH 2P5EA 5EZOL 1DQJA 5JW3L 2QADD 4LCWA 2ZUQB 2Z35B 2VABB 2PETA 1T66C 4NCC1 2BNQA 5F3BB 5D70H 4MQXD 5H8DA 5DZOA 1CFQA 2IBGA 1E4WL 3EJYD 3FN0H 3I6GA 1J05B 2RJMA 1KN2L 1V3JA 5GS0H 1Q72L 5IVNA 4LSPL 5IMMA 5IROC 4JZNA 2CIKB 4XNZB 1OQOA 1S9XB 3HMXH 3W2DL 1I1YA 1N8ZA 3B8YA 4GMSL 3S3JA 4F9LC 3BI9X 3EOBA 2GK2A 4OD3L 1TZHB 3ARPA 1IKNA 2DLTA 1SEBB 5E5RB 1FBIH 2VSCA 4N0CC 3TM6A 4BZYA 5C09E 1JGUH 1GZQA 3NCYP 1TJGL 3ARZA 1RFDH 5DTFB 3HNTH 1S7UB 4JM2A 1EUTA 1TVBA 1HI6A 2ZCKH 1CU4H 5GRZA 1I3RB 5I1DA 1M05B 1G7MB 4H1LG 5CMAA 3NZHH 2GJ6E 4M6AA 5I30H 2EE3A 4HAGA 4X98A 3VGDA 5DFWH 5A16B 5E9DD 4MZ3A 1KJVB 5HPMB 3RUGF 3U0TB 3W39B 1MJUH 1X5HA 4HSQA 2N1KA 4R26L 1RPQA 5FEBA 4UT7H 3FZUD 1A6PA 3K4ZA 4F58L 1OB1A 3UJTL 5IJVB 2J88H 2VDRL 2UZIL 3SE3C 5E5UB 3G6AB 1CDUA 5L88H 1FGNL 1UT9A 2JK5B 4M1DL 4I3SH 4HKZB 4HT1H 2YS4A 1MREL 5F1NA 3WJLC 3MUGB 3QO1A 1HK6A 1H3PH 2YA0A 4HV8A 1ZANL 1C1EH 5FHBL 3ARDA 2QR0B 3UTSE 3LKNB 4X6CE 2CLZA 3DTXB 4P4KA 4ZTPH 1KTKE 2FJGB 2IH3A 2Q20A 2XFXB 4GKSB 5I8KL 2HKFH 4GAYA 5C9JA 1OTUC 3ISWA 3DBXB 2FWOB 3HI5H 2O5ZL 1TFHA 3SKNB 2AJSL 4LSTH 3M17B 1CD1A 1GHFL 4ZS7L 2B1AL 4H20H 3GRWH 2VMFA 4MMZC 1RAMA 2QKIA 3T2QA 5IFHL 3QXWA 4TUJB 4QRRA 5IF0B 3PWPD 1IAMA 4J2XA 3MJ7A 3OL2A 2Z31D 2JCCB 4PR5B 1SM3L 5GGTA 3FKUS 5HGGS 4M7JH 2A6IB 4MMXC 4YK4B 2VUOA 4Y1AE 3SDXA 1V3LA 5D93C 4G9FB 3HNSL 3S34L 3KR3H 2BJML 1JYVA 1E4XI 4B50A 3HI1A 2NY4D 2BY3A 2FECL 2NNAA 4OCXH 3RKDD 2QQNL 1FH5L 4Z6AT 1DQQB 5A2IH 2WLZA 1HDMA 4M93C 4O2EB 4KHXL 3D0LA 3SKUD 5KANI 3OF6A 5F71A 5A2KH 4FFYH 5I2IA 5ISZD 3STLA 1S7TA 3FB5B 5BXFB 2BZDA 1OSZA 4LCCB 4KHTL 2EKJA 1XGYL 4G42A 1H3WM 4G6FD 2UWEF 4QOKA 1W8NA 1ZOXA 3OKLA 2YD8A 4JFEA 1IAIL 4OFDA 2NZ9C 2FX9L 3K2MC 1QLRB 2DYPD 3B5GA 3KPTA 1WZ1L 1C5BL 1DBML 3RGHA 5SX4H 2LE9A 4G8GE 2EE9A 4ACPA 5EBWA 4F37F 4CDGC 2ZUWA 3VMOA 4M61B 3PABA 1B2WH 2IFFH 3BEWA 3OAUH 4DKFL 1GH7A 5IVZA 4C56B 3FB6B 5FB8B 5DMIL 5EZJB 5E8OB 1FN4A 3CH1B 4X6FA 1B4RA 4JFXB 4QRQA 3AREA 4PJFE 5EUKA 1HSBA 2XY1A 1FFPA 1SJEB 5DSCA 4H88L 4MNQA 3QQ9D 1QVOA 1U8NB 3FFDB 1K4DB 2V9TA 1HWHB 4WUKL 3DVFA 4EKXA 4HIIB 2V2WB 4QRSB 3MACH 3EFFA 2DJ4A 5ACZB 1FPTH 3O3BA 3ARUA 5D5MF 2E6QA 3PGFL 1PKQA 4AIZA 2Q3AA 1LD9B 1CGVA 3T65A 3ULUL 1UB6A 2AEIT 5IB1A 43C9B 5DVOA 1MCRA 5B4MC 1A6AB 1E28B 1ZS8A 3RL2B 5KVFL 1DBKH 4Z78A 3BH8B 5L2KB 1L4IA 1AXTH 4YHKL 5FKPB 5FA3A 1MOEA 2E8YA 3V0VB 1Q8MA 5MERB 4UBDD 4DVBB 1QBBA 3AC0A 4JCMA 4XCEB 2Q86B 5E8PA 2NY6D 3DX8B 3OKYA 3ZYZA 5DJXA 2P5EB 1DQJB 3LCYA 4JQXA 4U6XA 3S5LB 3TH2T 4YXHL 4FQCL 2LVEA 4JRYD 3D2UB 3RDTC 4PRIB 4OB5L 2Y6SD 4DZ8A 5HTSA 5DK0A 4Y4FA 1OAXH 2FX8L 1BIIB 4HKXA 2XV6B 3FB8B 1QFWL 2QBWA 2AJUL 4HGWB 4E41D 3S36L 4KMLB 5IKCB 1ACYL 1EIBA 2DKMA 4X8JB 1CDBA 4DEPB 1C12A 3OKMA 3KGRA 1A2YB 4NO3B 4BH8A 1MHHA 2GKIA 1AJ7H 3QH3A 1RIVH 2X4RB 1SEQH 3QZWA 1T7ZA 3TCLA 2ZSWB 3BKYH 3Q0HA 2ZUUA 3VH8G 1SVCP 4GLRI 4PG2C 4LLDA 1SJXA 1CDHA 5FUZL 4YHPB 2GFBB 3SO3B 2DI9A 4U3CA 1INQA 1GZQB 3HR6A 3ZDZF 1CFTA 3ARRA 4BFIA 3DXAE 4YXKL 3H9HA 5DA4A 4JY6A 1J1OL 4DVRH 4WW2C 1TVBB 3DGCR 3OGCB 1WZMA 3L5XL 5T3XD 4L8DB 5I1DB 4FQ2H 2VE6A 4XVUD 2C26A 1RUAH 2VLKD 1F3DJ 3G04B 4FTVA 3UC0H 3MUJA 2WINA 3BESR 4MCYB 4L5FL 5CIPA 3S98A 5L9DH 5E8DH 4K8RL 1QYGL 5D7LE 3CDGB 3K8MA 5GGRB 4LHUA 1RK0B 2P8PA 3GMNA 5IROA 5LG1A 3BP7A 4NRZA 5EORL 5DJ6B 1MAJA 3MGAA 2IEPA 4Z7VA 5GGQH 2E6PA 2OJZL 5CEYB 4HAFA 2OR9L 5F97E 5FYLD 5D2NB 4F9LA 4JJ5B 3MGTA 1EO8L 4O02H 3RIFF 3Q2CA 3HAEA 5J57B 4DAGL 2R1WA 3O45A 3QRGH 1MRCL 3IT8D 4TTDD 1O5DT 3TIDA 5BQ7B 1X3DA 5ADOH 4HWEL 2OP4L 3P4LA 4ZUTB 4Z7OF 1YEFL 5JLZA 1MEXL 4PJ7A 1JNLL 3TVMC 4K7PX 3MOQA 2WMPA 3OKKA 4Y4HB 4EQ2A 2VLJB 1KPVB 1CLOL 2YWYA 3P77A 4RZCA 2NX5A 4NKDA 1CR9L 2V5MA 3MRKB 4HUXB 2XQBL 2P5EE 4NT6A 1A7PL 4LCWE 4TSCL 2OQJB 1KB9K 5JW4Q 1F6FB 5LBSH 5C0FA 2HLAB 3PQYD 4QXTA 4MSWB 3GSOB 2J6EL 3BDYL 4KY1L 3VG0L 4Z7NF 2BNQE 1J12A 3MRRA 5T1LD 1HKFA 4O51B 5K59F 1S7WB 3L3OA 1RZ7L 3SE3A 3BQUA 1RU9L 4OQ1A 4X99A 2M2DA 3QO0B 3NVQA 5JIKA 2VH5L 5CUSH 2W65A 3MJ8B 2PO6C 4HWBH 5DMKA 1HDMB 3EJZC 3BX7C 3I02B 2IJ0C 2YPKA 4LSRH 1FL5B 1GL4B 1H3GA 4R4FH 4MQTB 5CJOL 3QXDB 4A2LA 5C0IA 4PJCF 5I2IB 4PGEB 4FQLH 5DD3L 5E4EB 2CDFA 3U1SL 1BD2A 3CSYA 1UQSB 3RRQA 1TZIB 2XWTA 4FFVD 5B39B 2NCMA 3OKDA 1IGYB 5CKGA 3OKLB 3MMEA 3RWCA 3NCJH 1I8MB 4TULH 5ALCL 3PIQA 5I1AA 4WEBH 3VFGH 2FYYA 3TP4A 1I8IB 3U9UA 5ICZA 3QEHA 3UPRA 4NSKB 1KT2B 2C1OA 3A6OA 4KGJA 2DICA 4NP4L 3KPNA 5T1KD 5HDLA 4YHYC 2HFEB 2QEJA 2VDPH 3GMPA 3B3IA 4RMSA 1NLDL 1P9MA 2E9BA 1IGCL 2DDQL 5GQBA 3WNNA 3R1GH 2PYEA 4JO2L 2ESVD 1FFNA 2BSSB 3AREB 1JHLL 2QSVA 1MRFH 2EH8L 5GGVH 4PJ9B 3U6RA 3N85H 1N0XH 3UZQA 1CE1H 4H0IA 4JANB 2VITA 4MQ7A 4YNYB 3DROB 4HF5L 5D1QD 1TENA 3DSFH 5IEKA 5LWYH 1H5BB 4PJEA 2R2HA 1HE7A 3TBSA 2WUCL 5EWIL 4EBQL 4OSUL 3PHQA 1YPZF 4FFZL 1UB6B 2XTJB 4JJHA 2ADJA 4KQ3H 1ORQB 2YBRA 2EEDA 1U8KB 1D5ZA 2ZUQC 2YMXH 4Y16B 4NQUA 1I7ZA 1EAPB 1WTLA 1I9RL 5DUMH 3CXDL 4L8BA 5FA3B 5C0ND 1W8OA 4NIKB 4KGLA 3D85D 4JN2A 3GJFB 5ITFA 5JW3H 4R4NC 1QLFA 3KPSA 1FNHA 2F53D 5HHME 2WBJC 4QRRE 4YGVA 2MTPA 3L9RB 4DKEL 3MV9B 1K5NA 4G6ML 4HG4J 4U6XB 4YFEA 2QV2A 1E4WH 3P40A 1Q72H 1LO0L 3TIEA 4LSPH 3SDXE 5L2JA 2BVYA 2ENSA 1EZVY 5DK0B 1XT5A 3VFWA 3W9DA 4U1GC 4GMSH 4G9DA 1TPXC 3MFFA 2KZWA 4P23D 1RZIB 3PGDA 2P24A 5IBTH 3GSUB 1WTGT 3Q5OA 4MZ2A 2Y7QA 1MHCB 3QH3B 3HC3L 2VUYA 1K4CB 4CW1A 5DI8B 1Q1JL 1MJJB 2LVCA 3TCLB 3SQBA 1ZT1A 3WUWA 3CC5B 4WO4D 1C08A 5T1MA 3QDGA 4QOKE 1FZOA 4JFEE 2W9EL 5DQDH 1INQB 4WV1B 4HLJA 3TBYA 3R0NA 1P7KB 4XHJC 1TTGA 4B7IA 1MF2L 4DN4L 3C6LB 1MVUA 3BFOA 4ONHA 1MIML 3UAJC 4LEXL 3CSGA 2Z8SA 4GJTB 5HYJB 2PF6A 4WIQA 4XNQA 1EEYB 1T89C 3CVHL 4N68A 2VZVA 5F1SA 4PB9L 4F7PA 2EE6A 4W6YB 5TFSL 3GMOA 2AJ3A 4Q0XL 3RIAF 1R5IB 3OX8B 1YEEH 4EN3B 3MRLA 3UJTH 4OT1L 3U79A 1RUMH 3CVIL 1S7SB 2MPAL 5HHXH 4M43L 4EEEA 1KCKA 4U3XA 3DETC 3OB8A 5AYUL 1VKXA 4TUKL 1FGNH 5ISZA 4PB0L 3N1PC 4ODVL 4Z7VB 4MNQE 1MREH 5IJKC 5E2UL 3RWIB 4HLZH 4PG9A 4R8WL 2WANA 1KLUB 4MAYC 1ZANH 3HB3D 2OL3L 5DLML 5FHBH 1PKQE 4PG2A 2HH0L 5JXAL 5I8KH 4F57H 3MV7D 3QIUD 4A6YA 3FRPA 5DMGD 6CGTA 2FEEL 1EMTL 1Q0XL 4DW2H 3MLYL 2AJSH 2H32H 4RQQB 1GHFH 2EECA 4PJ7B 5FGCE 3WS3B 1ZVSB 5IFHH 2VAAB 4YK4C 2BOCB 5E1HB 2FGWL 4NKMB 3GSNB 2HMIC 1MUJB 2Z9TA 1KFAL 1KIRB 3Q6FA 1AIFB 4IJ3C 3HS0B 2ZCHL 3DGGA 4IRSB 4M7ZB 5BVJA 4DGVL 4L4VD 4RNRB 5J12C 1U8OA 2YPLA 3ZTNH 4P5MB 1FG2A 4HEME 3VXTB 1F11A 2EZ0D 1I7RB 2APVA 3HNSH 4NQTA 4NCC2 5FV2A 3PV6A 3TZVD 4HJ0C 4LCCC 4R97B 1FH5H 3KPQA 3P0GB 1QSVA 4KHXH 1ADQL 3IDUA 4XP9L 2N7AA 4NZRL 1WSST 4NUGL 3PNWA 3AUVA 2JJSC 5J3HC 1U8LA 4KHTH 3X3GL 5IW6A 3ZKSD 3HI6L 4I18C 1XGYH 2XXCB 4YDIL 2X42A 6FABL 1F90L 2VQ1A 4YHML 1OSPL 3W81A 1IAIH 3KHOA 4IRJC 1A7RL 1FFOA 4J3TA 4KKAD 3GMRA 4KKLD 2FX9H 3TVMA 2FB4L 1WZ1H 1C5BH 4POZC 1L9NA 3OKDB 3BH9A 4XTRD 4K3GA 5DK2B 3MXWH 5FO9A 3RWCB 4YX2L 3GUTB 3D39B 4L4TA 4YDJA 5E7BA 4CADB 1ZE3C 2A77L 4BKLB 1IL1A 2QADB 2HRLA 1BLNB 1NCDL 1CICC 2C1OB 2ZUTA 1CGYA 3RWHB 2MQCA 3QNXA 3KPNB 3FN3A 4FTVE 5DMIH 1OWWA 5JUEH 5A2LH 4LASL 2A83B 3WNLA 2XTLA 3JV0A 4TRPL 4PTTB 1LP9F 4XBEL 4OCYL 1YQVL 4H88H 1DE4B 4KJYB 1SBSL 2C3WA 5TDPB 1EFQA 1FFNB 1NGXA 4J7RA 3P30L 4Z7VE 4FS0A 2IADB 4JDZA 2N7BA 2VITB 2W0LA 4MQ7B 4F3FB 1PG7W 2XNAA 3F58L 2IBZY 4CMHB 5F21B 3MSPA 5JOFB 2R2HB 4LLAA 5KVFH 4L8SA 4I48A 5TPWL 3OXRA 1CN4A 1VACB 4UIMB 2HT4C 4YHKH 3S37H 2ADJB 3HFML 5HYSB 3H7BB 4NOFA 3BD3A 1UCTA 5C08D 5CBEB 3QQ3A 4PJ7E 4OZIF 1EO7A 3NMEA 1TNMA 2Z92B 3OHXA 1D6EB 1U92B 5SWZA 4BFEA 5I1IH 5INDB 5E9DB 3RZWA 5T33L 4MWFB 3ULSB 3TO2B 1T1YB 3S9DB 3MLVL 1SY6A 1G0YR 1G9NC 1PFCA 2NX5E 4YXHH 2EO9A 3KLAB 4Z77A 2FH6A 4U0QB 4I8DA 3P4OB 2MWCA 2X4SB 1G7PB 5IHZA 2EYTB 1CD9B 4BUHA 2OYPA 2FX8H 5ESQB 1KCVL 3VXOA 1QFWH 2XI9A 3RGVC 3KG5A 5IQ7L 4XVSL 2QQKL 4K2UH 1ACYH 3VFVB 5J11C 1H15A 2F5AL 32C2A 5HI4C 3N0PB 5C6PB 1AGEB 1KN4L 2FSEA 4H5SB 3DUSA 5F89B 4XNYL 4OLUL 3HHRB 15C8L 5C6WH 3RPIB 1YDPA 2HYMA 1SBBA 3DI3B 3HRZB 1BD2E 3RZCC 3ZKQD 5JIIA 3B2UD 5I76A 4YXKH 1UH3A 3FO0L 4JFPA 3S4SB 2CKNA 3VDAA 3E6HA 4E5XA 4BZ1L 4ZFGH 5DJ0A 2YEZA 3PWPB 2WBJA 2Z31B 3VG9B 4EQ3A 4L5FH 2X10A 1XAUA 4XVJL 4HK3J 2ICWB 2B1HL 3WLBB 2X9WA 3BN9D 5HDBE 1BM3H 5T1LA 3MLZH 4XPHL 2DQIH 5FCSH 3GSQB 3HE6D 1T3FB 2NY4B 2PYEE 4KC3B 3UO1L 4U1MA 2YSSA 2OJZH 4KJPD 1FIEA 1UEYA 1WZLA 4PY8I 5KSBF 2XPGA 5F3HB 1IM9A 5DRXB 1FVCA 5ISZB 3TJHC 3ARFC 5JOPD 3P9LA 1IILE 2Q76B 4JDVB 1PAMA 4JFFA 4PD4K 4DAGH 3QB7C 5H94B 2FHFA 4Q2ZA 1MRCH 3WDIA 3L3IB 3UPAA 1JL8A 3ULUF 4RWYH 4G6FB 4IOFC 1NGWA 4HWEH 2YC1A 4PJEE 1IGJA 4JVPA 4M1CC 4D2NA 1YEFH 2DLHA 4CVWA 4Y5YC 1SJHA 2G75A 5F9JA 1AQKH 1FE8L 2ATKB 1INDL 4A6YB 3UJIL 3VWJC 4KTDL 3F7VA 5IVXA 3NACL 2DYPB 4CL7A 3WKNA 2ZG2A 1NBYB 1CLOH 1N5YL 4YQXH 2X4UA 3PJSB 5T1KA 2V5RA 3AS1A 1LQSR 2AV1B 3N1QC 1NCTA 1T89A 2XQBH 1XCQA 3OJVC 4TSCH 3KPSE 2R4RL 2X6MA 4EVNB 4RA3A 3BDYH 3VG0H 4TYUA 4NRYB 4HC1L 5CJBA 1JHTB 4KKBC 3QA3A 4R96B 1AQDA 1IGTA 1TVHA 2WQ8A 5MENA 3MLUH 5ACLA 4OZGA 3VRLE 2FECI 4DUVA 1TXKA 1DQML 2HT3D 3RNQB 4QRPA 2X4NB 5IJKA 2BNUA 3QAZC 2BSED 3LH2H 1VSCA 4Q9QL 4P2OC 4I4WA 5CSBA 4X9HA 2R1XA 4ODXA 4R90L 1YEHL 5EZLB 2QSQA 4MAYA 1JPGA 4DGIL 3U1SH 3LQAC 3F7PC 4UT9L 1XIWD 3KPRD 5HSFA 3F7YB 3V7AG 1N6UA 1NFKA 3GMRB 5TDNA 3QDGE 1E6OH 4FOMA 1Z5LB 4U0RC 2J8UA 1A7QH 3GHBL 2EIBA 1QEWA 2X05A 2NY6B 5DHVB 4BK5A 1QHPA 4OIAA 1TQBB 3A67H 5JW4M 5FF6A 2BFVL 4N0FA 2Q3ZA 4PJ8C 4XNXL 5IT2L 4LSDA 2VQUA 4KZDH 4JRYB 2DDQH 5TE6L 2IAND 3VXSA 1ACZA 2YRLA 3RNKB 4ONGL 1F4AA 2XWBA 4MA1B 3WIHA 2GITB 1H5BC 4X7TB 1JHLH 3LHPH 1A6WL 3QQ4B 1L9MA 4PV8B 5JMOC 4E41B 1BP3B 4ZPTB 5ANMB 5A3IC 4NQVB 2R8SL 2JJSA 4HWZA 3W5MA 5ISZE 4V1DA 3V6OA 4RISL 4MXQD 4NZUL 1W0VB 4DZBB 1MHEA 1PJ9A 3EDJA 1ETZA 2A0LC 2Q87A 1ZLWH 3ECBB 1NQBA 1Z9MA 2WUCH 5EWIH 4EBQH 4OSUH 4FFZH 4HWUA 4IRJA 3HR5A 4IIQC 3SHSA 4ZXBC 1HXMB 3BDXA 5KSAA 4L8SB 5DWUL 3SDCD 3VMPA 1HINL 3VXRA 1WBYA 3CXDH 4G8FB 5EU3B 3RVUC 3MBEA 4EDXA 1CICA 4HCRH 2VLKB 4DTGL 4CUCA 4ZG1A 4G6MH 4AT6A 4CN6A 2ORBH 3VGGA 4WU7B 5MI0B 4XNUL 5K9KA 1YEJH 3MO1A 4H26A 2FCBA 4OKVB 3X14B 5GRWA 1LO0H 1A1NB 2YPLE 4J4PD 4GRMB 1LE5A 4LLYA 3C5JB 5IMOA 3ROLB 3CSBA 1WBXA 2I26N 4M6NL 3SDAC 4IOIA 4QHKI 3T0WA 4DN3L 1S3KL 1UWXH 5J06A 2OZ4L 2PCPA 2PNDA 5HGBA 1KB5B 1GGYA 4GFTB 4ZFOL 3JWDC 4XWOC 3WJJC 3HC3H 3GSVA 2FSEB 3RAJH 4ZS6D 1Q1JH 5KS9A 3C6LC 1KJMA 2XN9A 5ETUA 3T3PE 5ERWA 4Y0GA 5I73B 3JV6A 4HX1B 5IEHA 1UCBL 3ARBD 2W9EH 3QEGL 3ES6A 1G7LB 4JFPB 4UTBH 4ZUWB 4GW5A 4X4XA 4E5XB 1KJ3L 2BMKA 4M7KL 4DN4H 1Q9KA 4RAVA 1RUPH 3MRPA 4FQXC 3VH8B 2VLRD 4GRLC 4L4TE 3D87B 3OBAA 4OFYD 1IC5L 5JXED 3CVHH 2X1XR 5GIRB 3MNVB 3J8F7 4PB9H 5HYQA 4NQCA 2A9ML 1N2RA 2ED9A 4Q0XH 3V6FA 3I75A 2HT2D 3PQYB 4JRYE 1UYWH 1YUHA 4YGAB 5T1LB 3CVIH 2MPAH 2ITCB 3ZDXE 4LPUA 4M43H 2R15A 1KTRL 1UH4A 4PJXA 3RGVA 2VN7A 3TN0C 1P2CA 3WS6C 4ODVH 4U1MB 2NY2C 4PTUA 1OVZA 2DM2A 1I1AA 1T22B 3MRBB 2L7UA 4TOYH 5KZCD 4HFUL 1U6AL 5EU6A 4R8WH 2FH8A 2ZJSH 3OJDB 1T6WA 3IETA 4WNQA 5BOPA 2HH0H 5CHNA 5JXAH 5GS0D 3RZCA 1CFNB 5I71B 3G6JF 3QCUH 2NR6D 4MB4A 2YC1B 1NFDF 3MLYH 5B38G 3WYRA 5I8OL 2D7MA 4Z8FH 4L4JA 4WTZA 4EI5D 4F7EB 2WIMA 1MVFA 3F7VB 4MVBD 3MBXL 2H2SD 4OZFA 4X9IA 2WSKA 4XGZB 3EO1A 3NIGE 4LNRB 3O8XC 4HULB 1KFAH 3BZ4B 4U6YA 5T1KB 3BW9B 4R97C 1UGNA 5SWZE 3CPLB 2ZCHH 3NOIA 1FNGB 2ZUXA 3UTTA 2IMNA 4APQD 4JFOB 4HS3B 5C70A 3TGXA 3ARGA 1NC2D 1HILB 2FJHB 2X41A 4GQ9L 1UWEL 3MLRH 4YZFE 2VXVH 1MCJA 1AQDB 1IAOA 3UTZB 3PE9A 3HNVL 4K7FB 1V8HA 3MC0A 2BCKA 2K1MA 2IH1A 2DOCA 5SX5H 5GGSA 4XP9H 1ZLWK 4NUGH 3E2HB 1Q0YH 4YFLF 5D1QB 4PYGA 5BS0D 3X3GH 3RU8L 3OV6A 3HI6H 4KZEH 1UZ6F 4YDIH 1LO5A 3CAFA 6FABH 5IB2B 4YHMH 3UYRH 2B0SH 4HPOL 1QR4A 1OSPH 1IEAA 3U36A 3R06A 2DQFA 5E2VH 1A7RH 1QZ1A 3VWJA 3U7WH 35C8L 5AUMB 5T1DL 3BOVA 3IDGB 2VLMD 3OAYK 4Y88A 3MRFB 3C5SA 4ODUB 4YX2H 2FR4A 2AQ3A 1A1MB 1BVLA 3P0YH 2A77H 5HYEA 3D85B 4PS4L 2AV7B 4TSAH 1F6LL 1CXEA 2F53B 4YFDB 4EI6B 3BZFA 1ZGLA 2LQRA 4XCYA 3BEVB 5HI3D 4TRPH 4MAUH 4DOHE 4GH7B 3M07A 3SQOL 1UJTA 4XBEH 2DD8L 4OCYH 3RWJB 8CGTA 1BQLL 1YQVH 1ZT7A 3W11D 2X70B 1UWXK 4G3YL 1SBSH 2W0FA 4AEEA 3CFDB 2C1PA 2KQMA 3O9WC 4P2OA 1QTYT 3VFMA 1G6RA 3IDYB 2G5BA 3HUJF 2NW3A 4P23B 3H42L 2QL1A 5GS3A 3ME0A 4NFDA 3F58H 1M6OB 4OF8A 3SE8L 3QUXD 3QUYC 4M7LL 4N1CA 5JPNB 4JFFE 4L3CB 1ETZB 2P5WD 5K9JH 5TPWH 5TF1L 4UUJA 4WO4B 3SE9L 2NY1D 3SKMB 1KTLA 2FZ3A 1JF1A 4CNIB 1JZ3A 3VRIB 1J7VR 2Q8AL 4LARH 2YHGA 3GI9L 5IVXE 4PY8J 3VXPB 4O4YL 4LDEB 4F33A 1FSKB 3B5TA 5T33H 1OF2B 3ZE0E 3MLVH 4PJ8A 1F8TL 4YPGB 3TV3H 4KI5F 2IAMC 4OD2B 4UTAH 3FOLB 4NKOA 3RY6C 2CLVA 4WU5B 2WNGA 2JELH 1Q9LB 5I6XC 2UVFA 1KSRA 3HE6A 3V5DA 2V5YA 4UU9A 1JN6B 3QCTL 3EZJB 1U3YA 1KCVH 4XCNB 4U7MA 2GY7B 4BSWA 4D0DA 5GGTH 5IFAL 1P4BH 4XVSH 5FUCE 2QQKH 3BP6A 5MENE 3CIQA 4OZGE 3IDJB 2F5AH 1PZ5A 1RK1B 4PJIF 4OZHB 1F4YL 4QNPE 4ODWA 4QRPE 1KN4H 1SYVA 5DDHA 4IS6B 3THML 1DDHA 4DKAA 4GUPB 1JPTH 1L6ZA 1WIOA 2Z8VC 4XNYH 1D5MB 2X89A 5ELIA 4P2QD 4MX7B 2C3VB 4OLUH 15C8H 4IIQA 3V9FA 2ZUVA 2EDHA 4ZXBA 2MJWA 3GMLB 3GSVB 3CXHK 3MV7B 3QIUB 3OMZA 4P46D 4TUOB 4OKDA 2VXQH 1MRDL 2XRAH 4QHNA 4DFHA 4Q58C 1MFNA 2PKDA 4BSJA 4YHNA 4HIJA 1ZVHA 1C16B 3KS0H 2BXZA 3WDJA 4WI2A 3ARYA 1D9KD 1KLGB 5JHLH 1J0ZA 3EYQD 4RMTA 1FL3B 4CMMA 1LNUB 5DO2D 2J8UE 1AD0B 3K4DA 2NTSP 4NRXB 2EYRA 4XVJH 2B1HH 5CJXC 4L4VB 1BFOA 2B4CC 4ONFL 3MV01 2D9CA 2HJLA 4JRXD 2IG2L 1KXTB 3O2WH 4MS8C 3PV7A 1F4XH 3TZVB 4KKCD 4D8PB 4PGBB 4PD4J 3VXSE 4U2YA 4M5ZH 3VFTA 5DRWB 4UI2A 3UO1H 4CU7A 3L3JA 3OR7B 2XKNA 4OGAD 1QPXA 3WO4B 3SDAA 1FVDB 4X0KB 1BJ1H 2YWZA 5EOCL 2ZOLA 5BZWA 1JWSA 1JTPA 4L29B 5D7JD 1SQ2N 4LPXA 1E0OB 3WJJA 4V1DE 4LMQE 3V6OE 4RAUB 2H2PC 4QKXB 4QXUL 5F7LB 1FIGL 1A5FL 5FHAH 2F5BH 2P43B 3DV4A 5CHNB 1NDMA 1FE8H 4YDLC 1T5XA 1INDH 3UJIH 2FEEI 3CFJA 1SMAA 1AKJA 1RJZB 2P7TA 2AK4D 3P4NB 4G7VL 2GCYB 1N5YH 3KDMB 2IBZX 3LRGA 3EGSB 4OTXH 3VXRE 1WFUA 2DL9A 2UZXB 5LJYH 5I8CB 2R4RH 3C60C 2CIIA 2FBJL 5CILL 3QQ9C 3U4BL 3UEZA 5IB3A 4HS6B 1R0AL 1RUKH 3CDCA 4DGYL 1FLTX 1ZAGA 1ORSA 4AEHH 1CT8B 3NA4A 3TN0A 3KNBA 4PRPA 1SY6L 1FZJA 3WS6A 5HYIA 2BY2A 5T5FH 2KDGA 1DQMH 1PGRB 2QSCL 1FO0B 5GGUA 5KVDL 4XXCA 1NFIB 5FKAB 1YEHH 1B6DA 2XQYK 1F2XK 1KBGH 3MCKA 3T08A 2BOBB 1N5AA 4NKQB 4R0LB 4DGIH 4ZO8A 4NM8L 5DUBA 4ELMF 3BKJL 4ELKB 3K1DA 4UT9H 2Y25A 1FLRL 1SMOA 1ODAA 5KS9E 4NQSB 2YZ1A 4ZAKC 2NY5H 5EU4A 1KPUB 1ZA3B 2XN9E 1Y0LA 1YECH 2DQFB 2I25N 3LPFA 2FIKB 5FECA 3NCEB 2GUOB 3DHJA 2AXGA 1A6TA 5B3JE 1N4XL 3O8XA 5F7NC 4EUPB 2DTMH 3LDBC 3LSOA 1QRNA 4JN1H 5HI5C 4GG6F 5LQBL 1MCWW 3LQZA 2HN7A 5IT2H 4MXVE 4L4VE 3ARVA 3SDDC 4D94A 4NQCE 3WSQH 4YXLH 4ONGH 4XCYB 2IQ9L 4DWHA 1M7DB 3BP4B 2DQCL 4RMUA 5CIPH 1A6WH 2AJXL 1Q94B 1U95B 2ZSVB 2VL4A 1D5XA 3RUGA 4EIGB 1RZFH 4YAQA 2X4PB 3LS5L 3QDJA 4PJXE 2R8SH 4BM7A 3IDMB 1X5AA 4RISH 1QACA 3V7MA 2JJTA 3E0GA 2XT1B 4JDTL 2G5BB 3T4AB 2GK0A 3WL9A 1AD9A 2L7JA 3WEXB 5EU6E 2FL5A 3V5KB 1YMMD 4Z95L 3G5YA 1HYRC 3CU1A 4PRAB 3TO4C 5SV4A 4I13B 3LN5B 4HXBL