1UWXK

P1.2 serosubtype antigen derived from n. meningitidis pora in complex with fab fragment
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
211
structure length
211
Chain Sequence
GIVMTQTPASQSASLGESVTITCLASQTIGTWLAWYQQKPGKSPQLLIYAATSLADGVPSRFSGSGSGTKFSFKISSLQAEDFVSYYCQQLSSTPYTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGKERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Variation and Immune Recognition of the P1.2 Subtype Meningococcal Antigen.
pubmed doi rcsb
source organism Streptococcus sp.
molecule tags Immune system
molecule keywords PROTEIN G-PRIME
total genus 50
structure length 211
sequence length 211
chains with identical sequence L
ec nomenclature
pdb deposition date 2004-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uwxK02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1uwxK01
1NFDE 5GS2D 5IK3A 5I76A 4J3SA 1KN4H 2HTLD 1ZE3C 4DFIA 5IOPB 2HFGL 1KCVL 5I16B 2F53A 4TNVK 4JY6B 2BNUA 3HMXL 4KK5C 1AHWB 1B0RB 5FYKE 2EH8H 2HLAB 1U3HD 1Q9WB 3TH4T 4JQXC 3VXUB 3QNXB 4UOJA 1FCGA 4ZYKB 4UILH 5C6TH 3RUGF 4NOFA 3X13B 4GUPA 1KN2H 3DGCR 3H7BA 5A2KH 1RUMH 1MPAH 4FQQA 3DECA 4XRCB 1KIPB 3GJEB 15C8L 1P7KB 3IXAB 3KNBB 3E6FA 3NCYP 2DQFB 1P4LA 3TA3D 1N5AA 4PS4L 3GRWH 4YHKH 5J11C 1CGUA 6CGTA 4WCYH 1BOYA 4YFLI 3BW9A 2E9IA 3U6RA 1J0JA 1OGTB 4RFOL 1K5NA 1ZHLB 4N0FB 3QXAB 5DK2B 4D0BA 3LQZB 5CGMA 4PJIB 1I9RL 3CFCH 2DLEA 3RTQB 3B9EA 4TUJB 3HB3C 4U1HB 4MNGE 4QOKD 5FM5M 3IVKA 2AEPH 5ICXB 3QAZC 1NUDA 3T77B 1JF1B 4Z8FH 3HN3A 2OR8A 5C0CB 2I5YH 3OXSA 2VXQH 5EZIH 5CGYD 3T0AA 4ZUTA 4P2RB 5FGBC 4LVEA 4FQ2L 2MMXA 5E2UL 5HD8C 5ICYB 2CO7B 4EDWL 2EIDA 3ARVA 4HCRL 1LO2H 3VXRE 2BSTA 1K85A 3EDEA 2DLFH 4KUCD 4N5ED 2C4XA 2ZUVA 1S3KL 2OSLB 3UYRH 1RV6X 3HI6H 3BPCA 2E6JA 3C5ZA 1ZEAL 3MBXH 2DWDB 2ZG2A 3QG7H 4JFEA 5HDOA 4HHAB 3B5GA 3TN0B 1MREL 3L6FB 4LL9A 2ZZUT 4RIRB 4ODSL 3S96B 3E6HA 3UTTA 5KVEL 1KPVB 4ESKA 5T5FL 3FO0H 1KPUB 3RJQB 2CR3A 3KVQA 4E0RA 4J1UA 1EERB 2Q8AL 3HRZB 4JQXA 3VWKC 5D5MB 5F96L 3UEZA 2IQAB 3QUXA 4M7JL 4WU7B 4Y2DA 4GW4B 3P11L 4G80A 4MA1C 1C5BH 3P30H 1OP5K 1FNHA 3T0EE 4LCYB 1Q9OA 2PTUA 1Y0LB 2YUVA 4PJ7B 4LMQI 1HOCA 4OZGE 5ESQA 2OLDA 4BELD 3WLWC 5DHVH 4XNMB 3PWVA 4LVNB 3SGEI 1EK3A 2ZCLH 1DFBL 1F3DH 2BOCB 4L29B 3MO1A 4KMQA 4OLVL 5K9JH 3WLBA 5F7HA 3K46A 1KJMB 3ALPA 2R1WB 1FC1A 5HYIA 3DVIA 5DRXA 3QNYA 2C9AA 3MFGB 4MJ2A 1TJIL 2VAAA 4EBQH 2VXSL 1PQZA 3KS0H 5T3XE 3OKYA 4NQCE 1ZHNA 1RURL 4AIZB 1DZBA 1Z0MA 5BQ7A 1IGYB 2R29L 2YD4A 3MLUH 5C09B 1JWMA 2P4AB 3FFCA 4N90E 4F9PC 4NQXB 1YY9C 1A14H 3PHOA 1J1PL 4P4KB 1IAMA 4M8VA 4MSWB 2Q6WA 4Z95L 4PJAA 4S1QL 2H32H 1FGNL 4HG4J 2X4SA 2OMBA 4JLRA 5IB4B 3IU4L 5K9OB 3Q3GB 4JN2B 1AD0A 2KZ1B 3NBNA 2GJJA 4U6YB 3H3KA 3C9NB 4PR5A 3PWUA 4KI5F 1NDGA 2ICWJ 4ORGB 5MEOA 4GBXA 1NFIA 4OF3A 2NY4D 3NIGF 1KTLA 3P73A 4LCWD 4NQEE 5MEQB 4PJFA 5ID0A 3O3AB 2XN9D 5ISZE 4PJDB 1UB6B 4K3DL 4WUUD 3PWVB 2WIIA 3C6LB 3V5DB 4OLXL 4CAGA 3EDJA 1FORH 4Y8AA 4BYHA 5AZ2L 3BGMB 1KIRB 4JFZH 5ICXA 3T77A 1FGNH 2DB8A 1LK3L 5I15L 5HHMD 3TPUA 1J0KA 3HE7D 5JW4Q 4JEGB 4UQ3B 5D93C 2D7OA 5D7SH 1L0YA 3RL2A 4AL8H 5D1ZA 3P0YH 1QRNA 3U79A 1TZGL 3HE6A 1QYGL 2GJ6D 1P4BL 3ET9F 4ZTPH 1D6VL 2ZKHH 4EN3A 1IGYA 1OARL 1DVFA 4HXBL 1IE5A 1KCRL 2Z93B 3DX7A 3NZ8B 2FX8L 5GGTL 5FO9B 2PW2B 4ZNCD 3UX9B 2FJFB 3EZJB 4P99A 4KHXL 5J7CC 2DM7A 3BKCH 5M7QA 1LD9A 3TZVA 1M71B 1HXMA 1KLGA 3MGTA 1VACA 3L5XH 1DN2A 4NHUA 1DQJB 4PJEE 2Z91B 1TTUA 4HKXB 4RMVA 2AJZA 1XGYH 3VXUA 5F72S 4NJAL 1LILA 1MCPL 5EZLB 1AY1H 4KAQL 4CVZA 3KYMB 1S7UA 4LRIC 3C8KB 4WFGE 5J1SC 4P2RA 2DLFL 2GSGB 1CQKA 1W0YT 2WP3T 1JGDA 3JWOL 4PG2C 1ND0A 3O6FB 3RA7H 4PYHA 5GS1C 4OTXL 5EOCH 5LXGL 1RZGB 1S7QB 4I4WA 4KTDH 4ODUA 1INDH 1BZQK 4QNPE 3HPLB 5ID1A 3SDYH 3OG4B 5EZIL 1HQRB 3ECBB 4WUUE 3WV0A 5E6ID 4PTUB 2VLRA 2VZUA 1MHCA 2XPGB 1T83C 4ZAKA 2J5LB 1ZHLA 4N0FA 5EA0H 4Y0GA 1R3KB 3FO0L 1HNGA 4YZFF 1U8QB 1BVKB 4TULH 3VXUE 5INDB 4RIRA 3O6KH 4F9LC 1ED3B 1TTFA 2EO1A 4S2SA 2Z8WC 3FZUC 1JNLL 4S1SL 5TQ0L 5FB8A 4X8XA 4Z0BH 3C08H 3EYVB 4JFHD 4ALAL 4BFIB 4P2OC 4YH6A 4Y4KC 5C07E 1KUMA 3FFDA 5A2LH 5JXAL 4I2XE 2F54B 2V2XB 2R69L 2BNRB 1RFDH 1HKLL 3P4OA 5L7XH 5ADOH 5AWNH 2CGRL 5IHUL 1P84J 4PP2A 2R8SH 1IC4H 4LCWA 4KDVA 3O8XC 2CK0H 1FCCA 4X4XA 3PWUB 1F97A 2C1OB 2XN9A 3KPSD 4Q7DA 3VXRB 1GAFH 1P7HL 4K7PX 3QQ4B 1P9MC 1CFVH 3HS0B 3WNNA 5JXEC 5IR1A 2B7DT 4BQ9A 1NUGA 5D7KD 4GW1A 1RQ5A 1A9BB 4EIGB 5C92A 1AGFA 3GIVA 3EDKA 5BQ7B 5D72H 5E9DD 1X5ZA 4Z0XA 4ZUSB 5CJQH 3O4LB 1NAML 2APXA 4PGJA 1ADQH 2WLYA 4Y19E 4PGDA 3RVXD 2VDPH 1WT5A 4YHYB 1AXSA 1WBYA 3VGDA 1NMCB 5TE7H 4MA1B 3LD8C 3PV6B 3BE1H 4KVNL 4NO0D 3CXDL 1KB5B 3CX5J 1P1ZA 5D7LB 3V7AG 2CD0A 3LS5L 4PRDA 3T4YB 4HF5H 4WY7L 1JVKA 3B4NA 1MHPH 4Z7UE 3VU2A 1GCFA 1GC1H 4QCIB 1RK1A 4UMGA 4MD5B 4YBQC 1UYWH 4L1DA 1DBKL 5FA4A 4XPFH 4FRWA 4HWNA 4PRPA 1C7TA 1DBKH 2GFBB 4JO2H 3PQYB 5F7MC 3UPAA 4Y1AA 4HZLA 4OLWL 3SE9L 3PWPD 3GSOB 5E6YA 1HHHB 2AVGA 2DQIL 4GMTH 4HX1B 4QGTA 3X11B 3ZKQD 1KEGL 2E7HA 2PW1A 4LSVH 3L5JA 3FONA 5DRNA 2EEBA 4IHOB 1E6OL 4NBYB 1A6PA 1JZ4A 4M03A 4OLUH 3OB8A 4FQCH 3RNKB 4R4FL 1YEJL 3KPPB 3MLXH 3G6JB 3OKLA 4KC3B 4Y88A 1IZJA 3ILPB 1JHKL 4IMKA 4TOYH 5JA8B 4ZTOL 2VYRE 1P1ZB 3BD4A 4UNTA 4PY8I 4QRQB 2XA3A 1LVEA 4M9PA 2ENSA 3MXWH 3P9MA 3MRHA 1I1AB 1IBGL 2CLRA 1AO7D 4JRXD 1R3IL 2H8PA 4FQPA 1UH2A 1XMWA 2WSKA 2EDWA 1ZLWH 1J7VR 5LCVL 1NCAH 4YHIA 5BRZE 5SWSA 2LQRA 3RY6A 1RULH 1LK2A 1V3KA 1MCOH 1MFAL 4J3OC 1WAAE 2GJ6E 2J3SA 2ESVA 1N7MH 2QV2A 4B53A 3RVXC 1CGWA 1MOEA 5KSAD 4DJMA 1ZT4B 4DKEL 2EIZA 5IEKB 1DBMH 3I6GB 3QIBB 1MCKA 3VFGH 5T1LD 3KYAA 1CDGA 1O5DT 1QACA 2V2TB 5F21B 1T66D 2V7NA 2IALB 4TSCH 2HT2D 2CQVA 1P6AB 4PJDA 5I1IL 3GJFB 3OZ9H 5F6IC 2HVKA 3QULA 1BEYH 3DLQR 5J12B 4XI5C 4MJIA 4FFVC 4Z0BL 3OAUL 4P5TC 3H3BC 3MYJA 1OAUL 2IGFL 4XPAH 3PGCB 4XBEH 1NAMA 5F7FA 4HPYH 3GSNB 2H2PD 1SMAA 3QYCA 3SN6N 1K4CA 2IG2H 3GMMB 1QHPA 1WZ1H 4LQFL 5DD0H 4NHCL 3CVHB 3D5OF 4MCYB 1Z9OA 1KV3A 3EHBD 5HVFB 1IGIL 4LU5H 5EOTA 2XWTB 4KK9C 2YD9A 4AQ1B 1H3GA 3IDYB 3VFOB 5L8KB 3M1BA 5HDQL 1HQRA 1X4ZA 3HPLA 3RGVC 2D0FA 4UIMB 1YUHA 5L6YH 1HWHB 1JJUA 3OPZL 4O58L 3RUGE 3DSFH 1L7TL 1FFOA 4R7NA 3DRTA 4JZOA 4C59B 4M93C 4PJ8C 1S7UB 4UT9L 4LIQL 4LSRH 2HKFH 2AV1B 4YO0B 5BZDA 2RBLA 3GB7B 4NRXB 5FYJL 4D9LL 1CICB 5A3IC 1ERNA 4KU1A 3WUWA 5DA4A 4XNMA 4HS3B 4Z9KB 1NMBH 3H3PH 1FL3B 1FE8H 5JIKA 3F7PC 1AO7A 3PNWA 4CVXB 1BD2B 4O58H 1XF3A 3NH7H 2V9QA 5D6DC 3CFJA 5JDSB 4APQD 5TE6L 2DYPA 2AXJA 4KTEH 5EPMB 3CDYA 2AK4A 3BPOC 2CUIA 5EORH 2DYPD 1T04A 5GZOC 4Y4FC 4YXKL 1LK3H 2XA8H 3U4EA 4YR6B 3LKSB 4DEPC 5KANI 4UU9B 2I07B 2DAVA 3BO8B 1M6OA 1OB1B 2CIIA 4WWKA 4X6BA 4LRNH 3BP6B 2XRAH 4U1KA 1RJLB 4GKZA 4L4TD 2JLLA 5DT1H 1MIML 1RMFL 4G9FE 2XTLA 2HP4A 2APTA 1HHKB 2EDTA 5I66A 4X4YB 3GJFH 1WUNT 3CSBA 1BEYL 3DTXB 3ES6A 4HD9A 1SJHA 2F5AH 1AR2A 3HR5A 1IQDA 1FZOA 3INUL 3QUYD 3DURA 3KYNB 1LO3L 1IEAA 4ZXBA 5I8KH 1T5XB 5E00B 4P4RA 3RUGB 3HG1D 2BNRA 4ODTL 4UT7L 4JFOB 4M7KH 4OZGB 4NRZA 2FATL 3HUJF 1TPXC 5DK0B 3RPKA 4S10A 1OGTA 5IFAH 4E5XA 1MCOL 1MFAH 4MJ5B 1CLYH 5FB8B 2A74A 4GBXC 3RQ3A 3WSQL 1RK0A 3N9GH 1A7OH 1CT8B 2PW1B 4UTAH 2G2RA 4I9WE 2B1HL 3RL1A 1FYHB 3BUYA 4UBDD 4OB5L 3V9FA 2QSQA 1YYML 2G5BA 2WLZA 3MBEC 4IBLT 2EDHA 3IDJB 5FCSH 2YEZA 3ZKND 4HBQA 3ALXA 3V79C 2N7AA 1JN6A 2AXGB 2C5DC 3NIDE 3F58H 3H8NA 1FNGB 1NBVH 4XMLL 3QDHA 5FKAA 5DVKA 3DX9B 1E6OH 4TUOB 1XGUB 4PJ7A 3UBXB 2Q3AA 4KDTA 4WW2B 1HZHL 3KJ6H 3NFSH 4MWFA 5B38A 4P5TD 4EN3C 2OXGA 4Z7WB 1DVFC 1FYTA 5F9AC 3W5NA 3DSNA 3R4DA 4YK4B 3PWNA 1FHGA 2M8XA 1Q94A 5T3XL 1RK0B 2PW2A 1HNFA 5MP6L 1HEZA 4MJIE 5D96C 2DLIA 3SKNA 4LARL 2CMRL 3NIGE 1JRHH 4ODHH 5IBLD 2CJUL 5I73B 4PJDE 4G8EB 5GJSH 5BOPA 5HPOA 1I1RA 4BUHA 1FGVL 5KG9B 5CJOH 2FL5B 2NY5L 2JK5B 4KV5F 3QIWC 5EPMA 3L3HA 1BAFL 5EU3B 3B43A 4S0SD 5C0AE 1T21B 5SX4I 4TVSa 2H26B 4KZDH 1IAIH 4WHTB 4OFVA 1AD9B 2AEPL 3PWPA 2HFFB 5DD6A 3A6BL 2DTMH 5DJZB 1K4DA 4HV8B 4KK5D 3QUZA 1QFHA 3W2DH 2GJ6A 5EG6C 1NFKA 2NY0D 3U46B 1BGXH 4WI6A 4PJXB 2YD2A 1S5IL 3ME0A 2E7CA 3IKKA 4JM2A 2VJXA 4QHNB 1YC7A 3MPCA 4X6DE 5DQDH 5M94B 5E6ZA 3PP4H 2HRLA 4MA8H 3TZVD 3QPXL 4XNYH 3BKYH 3MUGA 3V6FB 4IIQB 4AG4H 1KJ3H 1WZMA 5HGDA 5I1KH 1EGJA 1LO0L 2DBLH 3SKJH 5F9JB 2NY2C 2QQNH 1YEEL 3J7HA 3PP3K 4JY4A 3TYFB 1FNAA 3MXVH 4XP6H 2VL5A 5FGRA 4FABL 5DD5L 1O7SA 4WDIA 1J8HA 1DUYB 5ICZA 3SE8L 1NUNB 4PFEA 1Y6KR 5HI5D 1YY8A 5JW5B 4YUEH 1I8KA 3OX8A 4ZOCA 3ZE2F 4Y5XA 1EEYA 3U9UA 3RGVD 4Q6IA 5CKAA 2Y5EA 4LSTL 4EQ3A 3PP4L 3SDCB 2D9QB 4PRHD 4RGMB 4ALAH 4Q9QL 1S8DB 5IESH 3QUMH 4MXVE 2EKJA 3DETD 4M6NH 1IKNA 2WBKA 4OZHF 5CWSA 1TCRB 4M6ML 5CZXD 5IOPA 2AJVL 1MLCA 1IJ9A 1FIGL 4IRJB 4G6AC 5GQBA 4NN5C 1XF5A 2VDLH 4KMTH 3VFWA 1W8NA 4GJTB 1Q0XL 2E7LA 5EIQA 4YXHL 2G5BB 3V4VH 1Z9LA 5C07B 5LXGH 4NZTH 1U8JA 4TTGA 4HIIA 3RDTD 2ICEB 5CZVH 1WBXB 1TJHL 2DQGL 1MRDL 2BMKA 5B21A 1CLOL 1AXIB 4LVOB 5HJ3B 1ZT1B 3DOSA 2R1YB 4Z78B 4UOW0 4L8DB 1SM3H 4Y16B 3UYPA 1JGEB 3KAAA 4QRRE 1H15A 1ZA3A 1IKFL 1U92A 4QTIL 2ADFL 2PYED 1BJ1H 5DD6B 1T2JA 5EN2B 2K7QA 3D0LA 4HGWB 4RAUA 5DJ6A 1ZWIB 4XNXH 1IQDB 4NZDA 3LEYL 1JZ8A 5CBAB 4WNQA 1CXHA 2PR4L 3GMQB 5CEZH 4JPWL 4WW2F 3MOAL 2ARWA 2D7NA 3KS0J 2KBGA 4OZHE 3GJFA 4RGNE 1WFTA 1Z3GH 1VADB 3TN0D 1WT5C 1FFNA 2ADFH 3O4LE 2EDRA 3VXSE 2P5ED 3ROLA 2EECA 3DSFL 4NO0A 4HIEA 5K9OA 5DMKA 1FORL 3S36L 2NQCA 3MUGB 4Z7UB 4OFDA 3T3PF 4G8GE 3HLAA 3RWJA 1XF2B 5TDPA 4KKBD 1L0XA 5ITBL 4PJXA 4G6AD 3KPSB 4UUJB 4M5ZL 1F4WH 2DIJA 2YD1A 3WDIA 5DJCB 4UZGA 5DJ6B 5I19L 4XXCC 4KRPC 4MXQD 3V4PH 3GI8H 2OYPA 4F9PA 5DF0A 5I74B 2WMPA 3O4OC 1KCUH 5K9QI 3K7UA 2GAZB 4K3HA 5LJYH 3P9MB 4ZS6C 4M6MH 4F8TA 3MV9A 2BY2A 1BVLB 1IAKA 4XPBL 3EYSH 4YLQT 1T7ZA 2BOCA 2XWJB 2VDMH 5IIEA 3TA3B 1TFHA 3HUJB 1N6QH 1YEKL 4KPHL 4UUJA 4GW5B 4LSUH 2BNQD 1DE4B 5GS1A 3ZZ1A 5SV3A 3P9LA 2QADD 2APVA 4GKOA 4U31A 3TT3H 1JBJA 1A1MB 3FAWA 2H2PC 5TGBB 5HVGB 1QBLH 5F1OB 3TM6A 3GBNL 1KPRA 1EIBA 2HVJA 3MRKA 4RGOL 3SDAA 1KXVC 2OJZL 3CVHA 3NCJH 2A73B 1WJ3A 2F74A 4N0UB 4G7YL 1KBGH 1XIWA 5F71A 4K3GA 3UO1H 1SEQH 3P0VL 2AERT 3SDXE 2ADJA 3F8UB 2KDGA 4JANA 3WN5B 1JPTL 1DN0A 1WEJH 2IJ0C 5T5FH 2DQCL 2NYYC 2JJSA 4LCIL 5DI8B 3TIDA 4ZO8A 4YBLC 3ZHDA 4H8WL 3TJHC 3CZFA 5C2BH 4X80L 4S1RL 1CL7H 2CJUH 4P2QE 1T1ZA 4XNUH 1ZANL 1MHCB 2XPGA 4ZAKB 1S7RA 2O5YH 1U8KA 1A2YB 1YDPB 5IR1B 1JWUB 1YPZA 2P7TB 4KK6C 1E27A 3ARGC 3JTSA 5D6CA 3HC4H 5KAQG 1EHLL 1MJ8L 2NY2D 1BQHA 4W4NA 4WUUB 3FMGL 2XN9B 5E7FA 3MV8D 1FFNB 1QA9B 7FABH 4FTVB 1A0QL 4RDQF 5KOVC 3VMNA 4MXWH 3B2UC 3HNVH 2CK2A 1TQCB 4DOHB 4FA8A 5HYFA 4ZOAA 1ITBB 1TCRA 4OLZH 1BQLH 4Z7NF 2DL2A 3SKUD 1OAXH 2X4OA 1JGUH 1I9RH 5AYUL 2PUQT 5FGCB 3FB8A 4PJHE 1HIMH 2D31A 4I5BA 3QUKA 4L8SA 4U1KB 3RNKA 1T1WB 4O4YL 1A7BA 4JDZB 4XVTL 2ZWLT 2NZ9C 4FQJL 2X4NB 1CFQB 4DOHE 5JPNA 5IB3A 1IGJB 4DVRL 4BZ1L 5I76B 5MENE 1CZ8L 4Z76A 5FM4A 4Z7NE 3N9GL 2XFXB 1KEML 5IF0B 4XP5L 4F58L 2HKHH 1KC5H 2W07A 4I2XB 5GRJH 3DVGB 1YMMB 1TCMA 4NN6C 2NY5C 5JPMB 5EO0A 2H32A 4I18A 4ONHB 4YDJA 4TVPE 4YPGB 4QXGL 1W8OA 1C08A 3ZTNL 2IMNA 2YBRA 3PL6A 1UB6A 2F53D 2RHEA 3MV01 2ESVD 3PL6D 4PRID 1IC4L 3C5SB 3OKOB 2X7LA 3DXAD 4PRDB 2YD3A 4WW1B 2APBA 3QT2A 4X7FC 2CLZA 1IBGH 3MXWL 5EOCJ 4PIRF 1DEEB 3QXWA 5HHXH 2IFFH 4HS8H 4D8PA 3RVTD 2Z8RA 5BO1L 3RVTC 3W0WE 4P5KB 1TITA 4WTZG 4NNPL 4UBDC 3JWOC 4GFTB 3ESVF 2J12B 3G08A 4ODVL 4AM0B 3E8UL 4L4VD 4XGZA 4OLUL 1MI5A 3TIEB 4ZO6A 3K2UL 2HH0H 2NY6C 1NMAH 1J1XH 1NGXA 2E9BA 3BH9B 1MCNA 5H8DA 4KGLA 1Q1JH 5C0BE 3EYUL 1JWMB 1UENA 5JXED 2X05A 3GK8H 3ZDXF 3SKNB 1QLFB 1VCAA 1E4WH 4HGKC 4Q6IC 1ZGLP 5IFJB 1CDBA 3RA7L 3HZKA 1OF2B 1YPZE 5FHAH 1FO0H 1DTUA 3F5WA 3NIFE 3EO9H 1TTGA 3NABH 5C0NC 1G9ML 4WJ5A 5ENWB 3SKOA 1AY1L 4KAQH 2BSTB 1MCPH 3BZFB 5T3ZD 1HSBB 3LV3A 1BM3L 1FV1B 2NPLX 1MJUL 1JHTA 4K94C 5JR1L 1JPFB 4QXTB 3G9VA 1ZTXL 4KJQC 4Z7OE 3DX9A 4U6VH 1CU4L 4N8VG 3DYOA 4H1LG 35C8L 3HG1B 3ZL4H 4J2XA 2PCPA 3ZSTA 3JTSB 1KENL 4JRYD 1WIOA 4G8GB 1M7XA 5CEXA 4JFFD 5DJAB 4XP4H 3SCMC 3WIIL 3WLWD 3L3OA 2D0HA 1U8QA 1A6VL 3BESR 3P0YL 1K3IA 1MY5A 4LMQE 2GTZB 4H1LB 1JPGB 1HDMA 5GJTH 3OR6A 5D7SL 3EYQC 3ECBA 3R8QA 4LVOC 3P9WB 4LSPH 1ZS8B 1ZT1A 2P8PA 3TBWA 4YIQB 5TDOB 4JHZA 1LO4H 4U7MA 4HLJA 5LG1A 4JPIA 2AEWA 2IADA 3GI8L 3CSPA 3HG1A 4PPTA 1U93A 4PGBB 5C07A 4CMMA 2QADC 2HJFA 4KK8D 4P2QA 5I1HH 2R4SL 4NN5B 5CILH 2LU3A 2G9HB 3G04A 4MAUH 4ZXBB 4FNLH 2OP4L 4X8JB 4MNQA 4XI5D 3GMNA 3DURB 3L5IA 3MRPA 2EDLA 1MCRA 3IJYB 4NM4H 3BI9X 4Q0XL 5JXAH 1MFBH 4NUGH 4PJDF 2GSIB 1N0XL 1TXKA 5KSUB 4Z7OF 4GG6E 4NPYB 4L4VE 4TSAL 5IBTL 2QSTA 4OCSL 1QR1B 1H5BB 2AXFB 5CD5C 2BSRA 3KDMA 4JFDA 3Q5OA 1U8KB 5DK2A 1YQ2A 4PRIE 2PNDA 3VFTB 4JKWA 4ODWA 4PLJC 3UTTB 2HT4D 5CJXC 3FL7A 4DKEH 4FMFA 4LKCB 4JO1H 3SO5A 2BVTA 1G0DA 5DQJA 1UB5A 4M4PA 3OF6A 1EFXA 4WHYG 5T1MA 2UVFA 3V6ZA 3O2WL 1AGCA 4HEPG 5HHOE 4PBXA 2BSED 4IIQA 1QSVA 1BVLA 1IAKB 5D1QA 3RVUC 1OM3H 1G7JA 3QHZH 5B38G 2MFNA 5C08D 1RHHB 1FIEA 4LHUD 4S1DD 4OV5B 4FG6C 2A83A 5H2BB 2Z35B 3F12B 3PNWB 4MX7B 2HVKB 4CVXA 1AQKL 4AEEA 1DFBH 1Z2KA 4S2SB 1L0QA 3A6CL 5DHXB 4R96A 3VD5A 5MEND 1C08B 1T6VN 2ZSVB 1IARB 4X5XA 4LF3B 5FKPB 1H5BC 3T8XB 1A9BA 4J4PA 2F8XC 1E27B 5IK3B 1JL8A 4KI1A 4PJHA 3ARYA 2YD6A 1KIUA 1MSPA 4XC1L 4F57H 3PXHA 3A6OA 1OSZB 1JNNH 4YDKH 4WENB 4NP4H 3MV8E 1VA9A 3Q6FA 5DFVD 2IPKA 1IMHC 5CCKL 3TIEA 2HWZL 3H9YA 1GGCL 1HI6A 4EOWL 5IIEB 1AXTH 3LRHA 5CUSL 1HHJB 1U6AL 4AT6B 3FB8B 2G9HA 3PJSA 4OLXH 4QWWD 4MNGB 5DYOB 4XBPA 2VB5A 3CMGA 4OT1H 2EC9U 4NO2B 4LGRB 1BD2A 5HY9B 2Y6SD 2ENYA 5IUSA 3MOQA 4LSQL 2VISA 1QQDA 1WEJL 2VDLL 4KMTL 3LZFL 2G75B 1KCSH 3HI5H 5ADPL 1ADQL 1A7RH 3CDFA 5CJQL 5L8JB 4CW1A 4KJQD 2BVQB 3RHWF 2D4FA 4DUXA 4JRXB 2IALA 3WE6B 2EYRA 4OI8A 3SDXA 5I1AA 4WU5A 1PEWA 4P59L 4NM8L 3TBYA 1JNHA 2EZ0C 3QIBA 4MA3B 3O8XA 3S96A 3VA2C 2PYFB 2IANB 4NZRL 4JDZA 2AV7B 4CU7A 4Y16D 1DJSA 1G7PB 3JBG7 3MJ6A 3BPLB 5HBBA 3WHXA 5E2VH 3JVGA 2YOCA 2W65A 3P4LA 2FH6A 3I02B 3QFDA 3EO0B 4P3DA 1T2QL 4ZSOA 3C9NA 4JFOA 5IHBA 4J3XA 3FB6B 4JG1H 3EDDA 4N0UA 2X4SB 4JLRB 2E27H 1KJ3L 2H8PB 3TCLA 3L3KA 5L7XL 1QFWH 3LKPB 3RPIB 1G9MH 2P43B 2NX5D 1PX4A 1UM4L 4NQXA 3KPSA 1I8KB 3ILPA 4OCYL 5C0BD 5T3XH 3DMMB 5JZ7D 1WCBB 2RFXA 3G6JA 3OKLB 1JI1A 2HTKC 3MRBA 1PKQB 4LLWA 2PXYA 1CXIA 5D7LD 2OMNA 3QUXC 4ELKA 1KCUL 3IDGA 1T1ZB 1IEBB 4WO4A 3ZHKA 1NCBL 4XCNA 4GMSH 1L6ZA 4JRYE 4D2NA 3GSWB 4KJYA 4XXDA 5A16B 4R96B 4OGYH 3KXFD 5F7DB 3O3AA 4YDLC 1MAMH 4P46A 2DLGA 3CX2A 3VFMA 1YN6A 4OF5A 2M2DA 2P5WB 2I07A 4RMUA 5C7XL 2JCCB 1VFUA 1K3ZA 1JRHL 4ORGA 3RWDA 3CDGA 2CMRH 3S8WA 1MNUL 1T7WA 1UQSB 3JUYA 3WHE0 4P9ML 4JZJA 3NPZB 4JRXE 1UB5B 4IIQC 3FJTA 4ELMA 3TP4A 1UKSA 4E41B 2J1KA 2ZJSH 2YN5A 1FL3A 1K2DB 1J5OL 3F7YA 3PHOB 1A6WH 2NY0C 4GS7C 3SOBH 1G7HB 4OF0A 1DL7L 1HZHH 3ZYIA 3LSOA 2XQYK 3MOAH 5L0QC 2V5YA 1E4XH 5FYJU 3ULSB 2FX8H 5TH2B 3O41B 4NRYB 5ALCL 5EU7C 3GMOA 4WGWB 3U7WH 1T89A 4S11A 1LO3H 1U8JB 4NDMB 4PY7A 1YUHB 1FLRH 5DGQA 3DUSA 3N1FC 5JOFB 2ZJSL 2F5BH 1QFPA 1JPSL 5C70A 3T1WA 2EDOA 2Z91A 1AP2B 5D1ZD 5L88L 3CDCA 3WSQH 3UBXI 4OLZL 3UJJL 1AC0A 1L7IH 3IDIA 4X6DB 5C6TL 4X98B 4GOSA 5HHQA 1TJHH 1C1EL 3D85D 5H2BA 1ZLVH 2YS4A 1KTDA 3D0LB 5EUOB 4G6ML 4HG4K 4IDJH 5INCA 5BMFH 3BWUC 2W0FA 1J11A 2YC1B 3N85H 1EJOL 4P5TB 4YGAB 4DGVH 4HT1H 4EN3B 5L9DH 4L3ED 2MCG1 4C83B 1U95B 1YY8B 1EBPA 2GUOA 5D8JL 2FB4H 4UT6H 3G5YB 1NBZB 2DTSA 4ZUSA 3MJ8B 3A67H 4OZ4A 5FIEA 1I8LC 1N5AB 2ZG3A 5T33L 4JB9L 4JHWL 4WWKD 3EAKA 1U91B 1G84A 3PQYE 1H3WM 3WFDL 1FE8L 3QCUL 3ROLB 3BXNA 3QDMD 1N6UA 1EAPB 1PVHA 4XP4L 5GZOD 1CDHA 1MFEL 1QFWL 2KPNA 3O3BB 1XF5B 2WW8A 1JIBA 3QDJD 1JGDB 3OBAA 4WW2A 2Q86B 3SE8H 4H0HB 1KT2B 2R0KL 1N2RA 1CU4H 4HJ0C 5C0FB 4CVZB 1U58A 4NZJA 4X4XB 4UV4H 1KLUA 1NKOA 1HH6B 2H1PH 1BJMA 2YPVH 2BNRE 1LDSA 4YQXH 4HUVB 5TGBA 3NGBC 1M05B 4JRWA 5DRZB 4X7SH 3AB0B 3SJVB 4KTEL 1A64A 4F15B 2H9GA 4ZOBA 1VEOA 3MA9H 1IRAY 3EYVA 5C08A 2QHRL 3TFKD 3WJLA 3IFPA 4MHHG 1ZMYA 1YJDH 3DX8B 2R0KH 4LFHD 1H9VA 3LSOB 5DJ0A 4D0CB 1D5BB 1OCWH 4H1LA 1Q1JL 3EW3B 2EH7L 1GC1C 4CRPA 4PREB 3VWKD 3DGGB 2PXYC 4TRPL 1BAFH 1FJ1A 1S9XA 3VJ6A 3ZHLA 3PQYA 4G9FA 4BH8B 5DUMH 3RBGA 4NNPH 5LGJB 1T5WA 1TZIA 2PYEB 4FQXA 3CPLA 2E6QA 4ZFOL 4X98A 3BZ4A 1FDLL 1N8ZB 3OZ9L 4XWGH 5EZOH 5HHQB 4Z7QE 5DVNA 2BNUB 3CNKA 4X4ZA 5IJKC 2B4CH 3C60D 4YDIL 5ESVB 5D5ME 3SDDC 1SJHB 5HDQH 4IOIB 4QRPB 4X83A 5D7JD 2I25N 3WXWH 4MDIA 5IT2L 4YWGH 4YHYC 1IGCH 4DGVL 3ZLQC 2VUOA 3HR6A 1JTPA 1MCWM 1FJ1B 2MOVA 1S5HA 1HHIB 4ZUVA 1CXEA 3OKDA 5C07D 5DHYA 4NCC2 5IB3B 3BEWB 3GSRA 4J8RA 3MA7A 1BWWA 2FJFA 3D2UD 3MNZA 4GRMA 4GKSA 3K2UH 2HFEA 3KLAB 2EO9A 3RP1A 3D69B 1OW0A 3RWCA 1C5DA 1SBBA 4X6DF 5ESAB 2VR9A 4PJ8B 4CKVX 4OCLC 1D5ZA 4OI7A 5C8JA 3VA6A 3U83A 3QDGB 1HK6A 1R5WA 1S7TB 3G6AA 1NQBA 2FLRT 4WI5A 4YFDB 5ITFB 2UWEB 1A7PL 4D8PB 5HGAA 4ONFH 2FX9H 3QZWA 1DP0A 4AIXA 1M7DA 4L3CB 1F02I 1BQHB 3GKWH 4OQTH 5IMMB 1NCWL 2Q86A 5EBLB 3RX7A 1VGKA 5DC4B 2BVOA 3HNVL 2DKSA 4Y16A 2QR0A 1T5WB 1TZIB 2HTLC 1F58H 2W65B 4NKDA 4P49A 4QRUA 3GKWL 2NR6C 4U6HA 4M00A 5DQ9A 3IDXL 3D39D 1QLRB 3MTRA 1EAPA 1IGCL 4ELME 4H0IA 2VKXA 1HOCB 1QBAA 3UAJD 3QWOB 4JJ5B 5DWUL 3UDWC 1CFSA 2C4FU 3D1MC 3SE3A 1RZIB 4GW4A 3MJ9L 5IMLB 4XVTH 4U49A 1MWAB 4O4YH 4H26B 4RWYH 5J12C 1GC1L 2IH1B 4P2RD 5C7XH 1AGDA 4Z7QF 1OWWA 3DROA 4R26H 2H3NA 5JW3H 4FQCL 1HE7A 4K71C 3X13A 3IT8D 5JIIA 3DX6A 4UI2A 5MERB 3S97C 1W0VB 4L9LC 1G9NL 5C2UB 2DIBA 4L9LB 5TDNB 2VO5A 5KSAB 4CVUA 1UJTA 4CADB 3AS1A 2OTWA 4XCEB 1I7UB 4M6NL 3SQOL 3MLSH 4YHZH 2QHRH 3MQIA 1I7RA 2E9WA 2OBGA 3WIFB 4YPJA 3G04B 2J8UF 1R24A 4TPRL 2J4WH 1MCHA 3WDJA 3FQRA 5BXFB 3I75A 1KYOK 1F4XL 4J23A 4XMPL 3BN3B 1X5JA 1VESA 2EDKA 4EUPA 4ZFGL 3BP6A 2Z93A 1U3HB 5E03A 4FABH 3TT3L 4LASL 4TNVF 5C9KA 2UYLA 2Y23A 3O45A 3QP3A 1IGTB 3M1BB 1PSKH 2R8SL 3U0WL 2G75A 3BDYH 1YN7B 1G7LA 3ARZA 3TFKC 5KZCD 4NWUH 1YJDL 1CE6A 3ZDZE 8FABA 3O3UN 4PRNB 3UTSB 4I0PD 3CLFH 2W0FB 1V7ML 2YC1A 5ITFA 5E00A 3PWPB 3L7EB 4C57C 1ZKAA 1P7KA 3KNBA 1OT1A 5I8EB 1P6FA 3S35H 1RPQA 4XPBH 2ZCHL 3C6LA 3NABL 4J7RA 1UQSA 4GQPH 4DWHA 4AMKH 3A6BH 4O02L 4DZBA 3PGFH 3GB7A 4NRXA 3TNMA 1CLZH 2R0LL 2FB4L 1WIPA 4PJFB 5ID0B 1IAOA 2EIEA 1IGTA 5CEZE 5D2NC 5HTSA 3SKOB 1MH5A 4RGNC 3DO7B 4Z7UA 1BD2E 1DQTA 3G5ZA 3FONB 3BIKA 5DRNB 3LOWA 4XCNB 3VI3F 5GJSL 4H8WC 4PRBA 4NO0B 3C8HA 3WS6C 5J0BA 4JRXA 4MMZC 1Z6JT 3P9LB 1QO3B 1GGUA 1NCUA 5E8NA 3U6RB 1N59B 4MAYC 4JB9H 3GKZA 3SDDB 1TVHA 3O6KL 3WDHA 3I2CL 4KI5D 3BZ4B 5K93A 4GAFB 3SJVE 2UZIL 4JFXA 2VQUA 3KJ6L 5I19H 4HUKB 5H94B 4NC1C 3TO4C 3SDYL 1H3PL 3IDJA 3QDME 4ZO9A 4M8QB 2NW3A 1U93B 4PGBA 2VSDA 2BVEA 1NCDL 4G43A 3VXRD 4L4TB 5FA3A 3FN0L 5EC2B 4HQQL 2I9TA 4K94H 2G2RB 5GHWH 4YXLH 4LKCA 3U7YH 5C0BB 4YAQB 1LO5B 1S9YB 1Q9LA 2A6KA 4LAJH 5JLZA 4MJ5A 1VFMA 4ZS7L 4JG0L 3E3QE 5LQBL 2KZWA 3CSGA 4ZS7H 2NY1C 5E99L 3BP7B 1RUKH 4ZS6D 2NY1B 5ID1B 4F15C 4CW1B 4KROB 1FLRL 5I18H 3SE3C 3NGBB 1MFDH 3K81A 3SCMA 3UTSD 5IKCB 3IAPA 4LF3A 4ZFFB 5DUBA 4BQBA 3BPLC 4PRIA 1D5XB 1U2HA 2SEBB 3O2DA 1TVDA 1TZGH 2XIDA 4Y4KA 4MXWL 5JO5A 1QKZH 1KIQA 1T22A 4J12A 2XV6B 3BH8A 4IS6B 5CEYA 4O9HH 1N4XL 3CD4A 4I3SH 4QRQA 1NGZB 2PF6A 1JWSB 4R90H 4NJ9H 5IESL 4HIXL 3VFRB 3C5ZD 1ZT7A 3QULB 4LDLB 1HI6B 1UC6A 4IM8A 2XACC 4OD3H 2DOCA 4QGYA 4RWHA 4ZFFA 2ILLA 4M1GH 1DQML 3RY5A 2Q20A 1XGTB 2VZ3A 4NZTL 5I1DA 4OQTA 3STZB 5IHLB 4N0UE 4H0GA 4LAQL 4K8RD 3QIWD 2EIZB 2R2HA 5TE7L 3VMPA 3ZKNC 3PG2A 1AR1D 4ENED 1Q0YL 3MZGB 4UQ2B 1MRCH 2JCCF 5FA4B 2ATPB 2I9LB 4MJ4A 2XG4A 1QQDB 2G5RA 5D72L 1B90A 1PZUB 1AKJD 1OTTC 1JYNA 4Y4FA 3QNZB 4GBXD 2UZYB 3MNWA 2Q76A 2HFFA 3VXPB 4QT5A 3WL9A 2A6DB 1BGXL 3HE7B 4XCFL 1EBAA 3JZ7A 5HHMB 4FP8L 4NQCA 1B6DA 1KB5A 2FD6L 2X5PA 4XBPB 1PY9A 3M17A 4F33B 3EGSA 2PO6B 1GGIH 3RAJH 4PJ7F 1DBAL 3BYTA 3C6LC 1AHWC 1ZA6B 3D39B 4XTRC 3D69A 2ID5A 4JY6A 4L4TE 5CD5D 3D18B 4Y5XB 1UCTA 2AJYL 2CK0L 1HXYA 1HSAB 2PETA 1MJUH 1V3MA 1BM3H 2VLRB 2QSCL 3QEQE 5L0QB 5F3BA 3ULVH 2ICCA 5I1LA 1B0GB 2J4WL 3SE4C 2OM5A 3CCHB 3QUKB 4HUWA 1URLA 4P59H 4RBPK 3IETA 2C4FT 3O0RL 4UDUB 3TBTB 3MRGA 3EYSL 4P4KC 1ZVSB 3DETC 4OLEA 5LGHH 3T3ME 2R1WA 3UXFA 5IG7B 2E8YA 3NCEB 4U4BA 2E7MA 5C0BA 1QUNA 1JF5A 1GSMA 3G5VA 3WO4C 3QEQB 4NP4L 1SJEB 4QRUB 1MCFA 1INQB 1OAKL 3QIUC 3L3IB 3C5SA 5IB5B 4KKLD 1NBQA 4POZC 3O3EA 4DZBB 4JM2C 5CP7B 3EKCA 5FO7A 5HHPB 3S34H 5HGAB 1S9XB 4YDLB 2V7NB 3WFBH 5FUZL 5JPMA 3U1SH 1AR1C 1ETZA 5HYEA 4HS6B 5EUKB 4NCC1 3QI9C 4G5ZH 4RWYL 5FYKD 1SEBB 1QLFA 2VLKE 2IAMA 2XZQL 1W72H 1RIUH 4FQIH 2HLFC 4HCRH 1XGYL 4R0LA 1DBJH 2W60B 4JG0H 3EUUA 3WNLA 3ZKMD 3HZVA 1GGCH 4EOWH 4XP1H 3T2OA 4ZXBC 2A0LD 4ZXBD 4HAFA 1Z3GL 2B5IC 3BQUD 4UILL 2V9TA 1IGML 1DBAH 2DM3A 5DMKB 2JJVA 4JQIL 4YE4L 2R2BB 1JPST 1JWSA 3TNNA 3KWWA 1YEHL 2PR4H 3VGBA 2ZPKL 5ANMA 3VRJA 3A0OA 5IB5A 3V5HA 4HJGB 4P57A 3RWEA 5EOQH 2DJSA 4HIHB 3K80A 1QRNE 5TPWH 3UTQA 5GRWA 4R6UA 4G6FB 3MRRB 3AXLA 4JFYA 1NEZB 3U9PH 1JHKH 4TOYL 3VG9C 4RAUB 1JF1A 1OF2A 3QDMA 4JR9H 3SJVD 3T0EC 5DO2D 2YZ8A 1IVLA 1J12A 1EGJL 2CIIB 2PYEE 3NZ8A 1QTYT 1ZS8A 4KTYA 5D1XD 1P7QA 5SWZA 3HZMB 4BFBD 2DQGH 4NKQB 2EICA 2MHAB 5DURB 5KVFH 1TDQA 3TBVA 1F4HA 4HPOL 1F00I 5C09A 1EXUA 5I2IB 3GBML 4TN9A 1FZKB 4HK3N 3ULVD 1AGBA 2JF1A 1KCVH 2A74B 3ILQC 5I8KL 3QAZB 1KIPA 4I5BB 4K7FA 3HNSH 4KKNA 3B9DA 3VFNA 4DTGH 3KYKH 3HG1E 3DV6A 4NRZB 4DW2H 2IBZX 2W9DL 2B0SH 3Q48A 4LSDA 1ONQA 2VIRB 5TE6H 4TTDC 4GAJH 3RZCD 4HUVA 4KJPC 2VLKB 4DN3L 2DMBA 4ZPTB 3BIBX 3S5LA 4OM0H 1RHFA 1XR9B 4R4BA 2GJZA 4NO5A 4HBCL 2P5WE 5CWSB 1T20B 4JGJA 1SYVA 4ORZC 1HXMB 4DAGL 2C3HA 3JTTB 1S7SB 2BDNL 1MIMH 1RMFH 3ZL4L 5DT1L 4K3EH 3WJJA 2GCYB 1S7VB 4LLWB 5CGYC 4JZJC 1J0ZA 3P0VH 4YHLH 1AGEA 1F42A 1S7RB 2YR3A 1UM6H 5JW5A 5IBUG 4UB0L 1OWRM 3SY0B 1M6OB 1E28B 1OB1A 1VADA 4XHJD 5ANME 3TO2B 2DWDA 3MLZH 1S5IH 2VAAB 2LU7A 4MXQC 3BGMA 4M48L 4ZFOA 2Q1EA 1J05A 4MB5A 3W0WB 3RDTB 1V3LA 3T0EA 1MRFL 2VLJE 2I27N 1F6LL 5EO9B 2BK8A 2EE2A 1GIGL 2QBWA 1BIIA 4UINH 4NHCH 1BWMA 1T03H 4O5LH 3LY6A 4IOIA 1YEGL 3ARFD 3G6DL 5I1CH 3B9VA 3MRKB 2GJ6B 1K9TA 2FBJL 2J6EH 3QEQD 5DUBB 2IEPA 5DJZA 1MVUA 4AY0A 1T7VA 2UWEA 3HZYB 3QCTL 1MI5E 3IF1B 1SHMA 5J1TC 1S9VA 2FEEL 3QWRD 2ORBH 5TQ2H 1AGEB 2R1YA 5H35A 4FZ8L 4LCUA 1S3KH 1XIWD 4TSCL 1ROWA 1XGRA 1NC4D 4F8QA 5DMGC 5CLWA 1O0VA 3ULUL 3WXVH 3C6LD 3VFGL 3DUHA 4U2YA 1NAKL 4UV7L 1QRND 3E6HB 3U0PA 4F7TA 3HUJA 4M5ZH 4LHUG 4PJXE 5JUEH 4OZHB 5DEFB 3QCVL 3T0WA 2YWZA 1OLLA 3W11C 3B2UD 2PO6A 2D03L 3QO0A 1EEZB 1ZHBA 2GTWB 4H20H 4PG2A 2PO6D 5DC9B 2XWTA 3ARQA 1XR8B 2IMMA 1NC4B 5DLML 4MNGA 1XIWB 3LN4B 3GGWB 1CDJA 3L9RB 3TZVB 3FOMB 3F58L 3VXMA 4DN4L 5JO5B 5JTWA 5FUOL 2BFVH 5DA0B 1DVFB 4KQ3H 2R39A 1E6JH 2YD8A 1N5YH 4OD1L 3V6BR 3OX8B 5SWSD 1N8ZA 1XCQB 5F1IA 3FTGA 3IU3A 3TGXA 1XF2A 3IVKB 4MNHB 4X99B 4V1DE 5IVXE 1OAXL 4JN1L 2D4DA 2R2HB 3ZDYF 2VZSA 3RVUD 5A16A 3BN9C 3HRZA 2MKWA 3ARRA 3AY4A 1CIUA 3B8YA 3W0WD 3EJYD 3RVVC 1RSFA 1IM9A 1EFQA 2MSPA 3QI9D 4CMHC 2NTFB 2VISB 3FQNA 2B1AL 5D2NE 4QNPF 3VMOA 4OI9A 3KR3L 4TPRH 4U6HB 1VPOH 1KELH 2Z92A 4PG9A 1INEL 1PDKA 5I17B 1AFVL 1I3UA 2L7JA 3C5ZB 1A1OB 5ANMB 3U2SA 3MACL 1NGZA 5FOJA 1SQ2N 4HJJL 1AXSB 1WBYB 5F93C 4O2FB 4ZYKA 2ZP0T 1R3LA 3Q0HA 1KXTB 2ZUWA 4ISVA 4WY7H 2F74B 3G6AB 4HGWA 4OFPA 3TH2T 5E70A 1R5VA 1MAML 3ARBA 2C3VB 5EU4B 3NACL 4KQ4H 3FCTA 3OKKB 1B4RA 5I16A 3SY0A 1N59A 3WMSA 5LWYH 4NBXB 5TF1L 3E2HC 4P3DB 5ESAA 4U0QB 3BRDA 2ZCKL 2VLKD 4X7EC 3O45B 1HHKA 4LHJB 2L0DA 5K9KA 2XOTA 1T6WA 4JO2L 1J1PH 1U3HA 3O2VH 2GT9B 1CDCA 4PJIA 1DBBL 4NPYA 3WKML 2IPUG 3QXAA 5CMAB 12E8L 4LEXL 3MA9L 4LLAA 2ZSVA 4LPVA 2C1OA 2B1AH 3EIFA 2C1PA 3KPQA 3TA3A 2CDEA 3GBNH 4DVBA 4X80H 5JW4M 4IOFC 2A6IA 3P4MB 1FH5H 4JFQB 2ITDA 5CJXA 3H3PL 3TEUA 3CFBA 1NMBL 2AEQH 5IG7A 3HA0A 1K2DA 4QHKI 2ARJA 3TV3L 1L6XA 3ILQD 4YHMH 4DEPB 3V6ZB 1GZQB 3QFJD 1GGIL 3RAJL 3BVNB 5AWNL 4UT9H 5F7EL 3IDIB 2EZ0D 4X6DA 2BZDA 3ARWA 1ED3A 2W9EH 4NZRH 5LVEA 5E7BA 1I9JL 3PWLA 2VDML 1ZLUK 1SBSH 3SDDD 4JKLA 2HAZA 1CTNA 1JUFB 3C08L 4OZHA 4Y4KD 4Z78A 2HMIC 1QVOA 1FFOB 2HMID 5GGUB 1EJ6A 4LSSL 3RZWA 1T80A 1AE6L 3EGSB 4U1GC 4KZDL 3GFUA 2XICA 4GW1B 2WWKT 3V6FA 1CR9L 2N1KA 3SJVA 5AUMB 5IVOA 1INDL 2CO6B 3O6LH 5F7UA 1NAKH 1L9MA 3R1GH 4PJFF 3DVNA 3HS0A 1KOAA 4LLQA 5JW4N 3EOBA 1I1YB 3L3DB 4G42A 3STLB 2C7UA 5IVZA 4JM2F 4OD3L 4Q74A 2ITCB 3WNKA 3DARA 2C3VA 4EUPH 3L3KB 4LFHG 2H6PB 1EHXA 2P24B 3OAZK 4LLVA 3RWHB 2AK4D 3V6OA 4TUKH 3I50L 4JM4H 1BZ7A 5EBMA 4LIQE 5B8CC 3P3YA 1FAIH 4FOMA 2NX5A 2VXQL 2W60A 3DROB 4I18C 1U91A 4Z8FL 4KZEL 5F7NC 5D1ZC 4IRJC 3ROOA 5DEGA 1FVCA 3TVMB 3ZE0F 5DVLA 4DZ8A 5KN5A 5EZJA 3R8BB 1IL1A 3NN8A 3GEWB 3QWOA 3WFEH 4RGMC 1UWEH 4JFDB 2NXZC 4PJ5E 2XTJC 5I9QC 3CC5B 3QR2A 3VWJC 1KJ2L 2DM2A 1T22B 4UB0H 4FFWD 4OZIF 3QIBC 4MQSB 5KSUA 4M3KB 5MEOB 2DQTH 3IXTB 2Z31A 1SYVB 4PBVC 3CLEL 4HV8A 1GGBH 4CADA 1CICA 1HN1A 5HHOB 3ESUF 4K3EL 3F65A 5C0GA 3WD5H 2FX7L 3ZKMC 4YXHH 3VRLF 1GPOH 3OGOE 3DRTB 4JZOB 5FUCE 4YGVA 3HMWH 1RZKC 1NCBH 1KN4L 4AL8L 3RL1B 4UIMA 2FBOJ 4EEEA 4YHPB 2JCCE 2MWCA 5JHDB 3IAGC 5GGRA 4LK4A 3LRSB 4U3HA 3TBVB 4NQCD 5HPMB 3V95A 3PWPE 3MZTA 4TVPL 4RFNB 4HT1L 3AS2A 4UIKH 2JELH 3HE7A 1MHPL 1CWVA 1TJIH 4HF5L 3B9KD 2OP4H 2BVOB 2FIKB 3T2PA 2YSSB 3MFFA 5A3ID 3TESA 1YNLL 4JFYB 2Y06H 1NC2D 5T1KA 2HT4C 4XP6L 3OGCB 2LAAA 1XT5A 4OZGF 3VFVB 3PGDB 2NYYD 3G6JE 3MYJB 5IVXB 4HIHA 1F8TH 1XGQB 1CI5A 2YPKA 4Z95H 3MR9B 4BH8A 4CUCA 1QEWA 3VJ6B 4YK4C 5D1QB 4JFHE 4E41E 4G8EA 3VW3H 4AEIL 3WFCL 2A9ML 1IAII 3PWJB 1OAZL 4U1IB 3VDBA 5HHNB 4UDTA 4HXAL 3NIFF 2A38A 2ESVB 4W6WB 2ZUTA 2QQQA 3QPQC 3WD5L 1WCBA 5CD3A 4KXZH 3JV4B 1CK0L 2JIXD 4YFEA 1BFSA 1YECL 4PJBB 3Q6GL 3O9WB 2AK4B 3RUGA 3RWHA 3DWTA 4C56D 3OKMB 1K4CB 1KLUB 2CGRH 4QKXB 4MDJA 5IVXA 5C0RL 2R2CA 4F80A 3SGKC 2ICWA 2Z31D 4HZAA 3DUUB 2X1WL 1JGEA 2LTQC 3ELAT 4R4NC 5CUSH 4L29A 3NPSC 1ZSDB 2QSVA 1N6VA 1TZHB 1TPXB 3SDAC 4M7JH 3VGAB 2MQ3A 4PJGB 4QOKE 3O8XB 4QLRA 4YPGA 3Q5TA 3NOIA 1RUQH 3DV6B 5DD0L 5GZND 3JSSA 1IAIL 3RWIA 4CBPA 4D94A 3NPSB 1EO8L 1IFHL 3MRCB 3QFJE 4GSDL 1ACYH 5IEKA 3WYRA 4WU7A 4H5SA 2XKSA 3HC0A 4K3JH 1FL5A 3ARBD 3LH2L 4P2OB 3KGRA 3RHWK 5I1JH 3UPRA 3U4BL 3OAUH 2K1MA 1HDMB 3HUJE 1G7HA 1HSAA 2FECL 2FO4B 1UVQB 5B3NA 4NKOB 3MODL 5D70H 3WJJC 4JDVA 4RISL 2WV3A 3FRPA 1LO2L 3QFJB 7CGTA 4AEHH 5FECB 3QNXA 5J13C 2CDGA 2A73A 3V0VB 3QQ9D 1X5GA 1NBYA 3QG6A 2VLMD 5DJ8B 1V7NL 1LDPL 3EOAB 1K8DB 4G3YL 1C12A 3KYOB 1BBJB 3BWAA 4M7ZC 1IZKA 4WFGD 2P47B 2UY6A 3NVQA 5IFAL 2BVPA 3GSNL 1FH5L 5SWSE 4DVBB 5BRZA 3GHEH 3PUCA 1NCWH 4X8JA 3QDJB 4LPCA 1Q9KB 3VD3A 4XP5H 5HYSA 4EI5C 1TMCB 2DJUA 3SGDI 4ZTPL 3BPOB 3BXNB 1BPVA 4NN6B 4RQQA 4U3CA 4XCFH 3S4SA 2VDRH 1G0YR 1DUZB 1BD2D 3HAEG 3LMJL 4YIQA 1AO7E 3RTQA 4PS4H 2EDNA 4TNWK 1FFQA 1UJ3C 2BERA 1D5MB 1UZ8A 4FQLH 1CICC 3LN5A 4JFPB 2DI9A 1BFOB 3KPOA 5E6IB 3Q1SL 5HHME 2CKBB 3BVNA 1ZHKB 2DQIH 1A3LH 4GMTL 1DLFL 5KTEL 4XXCA 3L7EA 4RNRB 4OZFB 1LMKA 5EU3A 4JKPH 3MRHB 4GG6A 3UBXG 3FMGH 5HHPA 5C0DA 1MF2H 2BOBB 3I6LE 3QA3B 3BPNB 4N9GB 4R97C 4BSJA 4WGVB 3LKRB 1JFQH 4EUPG 1T2XA 1GXEA 3ZDXE 3X17A 3LQAC 1DSFH 1UYWL 2HWZH 1AQDA 3QO1B 3LCYA 2F5AL 4HAGA 1YA5A 2ZCKH 5F44A 3S37X 3ARGB 5SWQA 4EKXA 1YZZA 3TBYB 1TNNA 4W6YB 4BZ2L 2WWMC 4XC1H 1QEWB 3VFSB 1NLDL 4AIOA 4QXWA 5K33A 2JB6B 3ULUE 4MXVF 3GSQB 5I0ZA 2OTUA 2OR9H 1OAQH 5F9DC 4LIQH 4LSRL 4NQDD 4AZ8A 4CL7A 4H25B 3T2NH 4KQ3L 3LKQB 4PLKC 5TDNA 5KSAA 4OJFL 3WN5C 1KBGL 4WI7A 1RZKH 1QSFE 3W9EA 3MRLB 4UOW1 5FA3B 2MTPA 1MUJA 1MCJA 5EN2A 3CVHH 4CN4A 5HDBF 2MJWA 5T1LB 1JZ7A 4K2UL 4Z6AT 2DI7A 2V2XA 4WO4D 2YWYA 1WIUA 3NH7L 1J88A 4X6CA 3LQAH 5I71C 2P44B 2QEJA 1DQLL 2P5WD 4Z7UF 4QHMB 1FVDB 4S0TD 1WVZA 3GK8L 3IGAA 1BOGA 5HJ3A 5FYJH 3K8MA 4D9LH 5EO0B 4WWKC 4L3EE 3PDDA 2IG2L 2Y1VA 1PG7W 3QUYA 3ULUC 1HKLH 2XKNB 3BEVB 2VXUH 3S3SA 2ZSWA 3E8UH 2R69H 1BIHA 3VRIB 1YDPA 1I1AD 3FQXB 5ILTL 5FCUH 3BZEB 1CD1B 4QHLB 3RVWC 3DMMA 1G7QA 2X42A 5CJ8A 4XNZB 5ILTH 4ZG1A 1K4DB 3FRPG 4XCYB 1U3YA 3UYOD 3P4NA 4P9HC 4C4KT 4ZUUA 2CKBH 2Q7YA 5FGBA 3QH3B 4Q9BA 3I85A 5AD0B 1JK8A 1KULA 4ODBD 3L3HB 4XX1G 3ZT6A 2EKSB 3CVIH 3T0EB 1KLGB 4IDJL 4Y1AE 3E1F1 2I5YL 1J05B 3O9WD 3W0WA 1EZVY 3U2SB 3PQYD 1MHHA 1A6TA 5GRYA 3VXTB 3VH8B 3LQAL 1JGVH 1ACZA 5D7JB 5CSGA 1RULL 4Z0XB 3PGFL 1D5XA 3KLDA 2FJGA 1DANT 2XI9A 2AEIT 4LSPL 3PF2A 4EZMA 1GOGA 4PJBE 2H2SD 2X44D 5DXWA 2WAHA 3X3GH 4DVRH 4RFOH 1EEUA 4XWOD 4PJGE 1D3CA 5L2KE 1R3IH 1LNUA 2GEEA 4B50A 3L5XL 3QUXD 4ODUB 1S7WA 3HCVB 1ORSB 1YEGH 3G6DH 5FEBA 3B2VL 1FN4A 3PGDA 2WIIB 1NLDH 1UACL 2HJLA 1UJ3A 1MLBA 3IDNB 4LSVL 1R24B 5E9DB 3BDBA 2EDBA 5KBNC 2VLKA 1CGSL 4L4TA 5KVDH 4DQOH 2NW3B 2OTWB 1A4JA 5D2LF 5DK3A 4WI8A 1XR8A 2F54A 2W9DH 2Y36L 4PLOB 2GTWA 6FABL 4M61A 1X4YA 5BV7B 5FHAL 5AZ2H 3JV0A 4PRPE 5ISZA 1T0PB 2HA1A 3K4DA 4PJFE 1MHEA 3NCMA 5J9PB 4OM1L 1WV7T 4QHUA 1J9CT 4NQDB 5DURD 5AYQA 2OZ4H 4LCWE 4NQED 1WFOA 4DAGH 1TVBA 4YEFA 4GXVH 4RDQG 5B4MD 5E8DL 1RAMA 1KJ2A 4PJAE 3L95B 3V0AC 1CFSB 3QDMB 3K4AA 1A6UH 3NZHL 2X10A 2X4UB 4ZOEA 1OP3H 3MRQB 1FZOB 2DQHH 5C0FA 1FG2A 1BMGA 4P9HL 1MJ7L 4C58B 3LMJH 4L9DA 3E3QC 2KKQA 3L3GA 1FNGA 5MENB 5ALBL 3FT2A 5E1AB 1T7YA 4OV5A 5C0EB 3BZFA 3ARFC 3MLUL 3VRJB 2YD5A 1NCTA 3JWDC 5IMOA 4GG6B 4ENEC 4WTXA 1G0XA 43CAB 1DLFH 1UCBH 4ZFZA 5I8EA 4GT7A 3O6FD 3QJFA 4Y2DB 1I1CA 4LVHB 1FZKA 3HE7C 1A2YA 4NWTH 1TENA 1K6QH 5I1DB 4IDLA 5IEHB 3QXDB 5IQ7L 2RFXB 5D1ZB 4BZ1H 4FQLL 1F11B 4RMSA 4KPHH 5MHSE 1QNZH 2YRLA 3HAEH 5B8CB 1JRHI 3FO2A 1QR1A 1CF8L 5FYLE 2DDQL 4KK6D 1UZ6F 5EUKA 1TJGL 2VDRL 1C5BL 3P30L 4TQEL 5FUZH 2CLRB 5CP3A 3AM8A 5ECJE 3FT3A 5CIPA 2GYSA 1I1AC 3UJIL 1H8OA 1ZLVK 4AH2A 3MO1B 2AV1A 3LZFH 3V5HB 3OKOA 3QZWG 1A0QH 4XB7A 1QRKA 2CRZA 5KVEH 7FABL 5DJ8A 4Y5VA 3T65B 2R2BA 4AEHL 1HYSC 2EC9T 5JHLH 4RFEB 3GMOB 5CKGA 4QO1A 1CFNB 4NCDA 5TDOA 3GDBA 1D9KD 2VL4A 3HC3H 4ZNEA 3QUYB 3G6JF 1FDLH 3BMWA 5F3BB 3HE6C 4I0KA 4OCRL 4W4OA 3VGGA 3ZE1F 4EDWH 2OR7A 5E2UH 4FQ2H 2FBJH 2J6EL 4HW6A 4PJEA 3E6FB 4TRPH 2EXWC 4KXZI 1ZA6A 4OGAD 3BKCL 3RWGA 3QUMB 2NMSA 5DO2C 2VMFA 1RUQL 1UFUA 8CGTA 1GIGH 2H9GB 4UINL 1G9MC 1NDMB 2HT3D 3GHBL 4OGZA 5FO7B 1BQHG 1S9WB 5J1AB 4XMLH 4AEIH 5MEQA 5F6HI 3W81A 5F7LB 4OFKA 5A2IH 3N50A 4RGOH 1OGAE 4H25A 2HJLB 3HR5B 4IJ3B 1G7MB 1UT9A 2DN7A 3MRGB 4M62H 4JFZL 3LDBC 1P53A 1RZKL 1CXKA 2CDFA 3KHQA 1VGEH 3RWJB 4UV4L 3QHZL 5D7LE 2OXHA 2Q6WB 3VFSA 1KN2L 4C56B 5K9KB 2W92A 3PABB 4MA7H 1WBZA 4PY8J 1YNLH 4PJCF 4HH9B 3MJ7A 4X5LA 1A7QH 1U42A 4MAYD 3KPRE 3E2HB 1W2KT 2DLTA 3R0MA 3RX5A 3CFDA 5GGVH 4L4VB 4PP2B 1TNMA 1OTUC 4RCAA 2EC8A 3M17B 4S1QH 4F33A 1T1XA 1NFDB 1MCDA 5J57B 3L3JB 1BZ7B 1U8HB 4OCSH 3RDTA 5B4MC 1B0WA 1JHLH 5EU5A 4UT6L 4Q9QH 1RIVL 1F5WA 1XGQA 3C5ZC 1JP5A 1QOKA 2VC2H 5HYJA 3CH8A 1A4KB 5KSBA 1X6LA 1QA9A 4PRIB 3BRFA 2VKWA 3MLTB 5LAXB 4XHJC 2UUDK 4YBQD 5E56A 2Y06L 3WUWB 3UTTE 4YUEL 1NC2B 4I0PA 1R3KA 4CMHB 1P5VA 4G8IB 4LCYA 4URTB 4RBPH 3MV11 4JFEE 4L8DA 2GW5A 3SEPA 5JOFA 1IC5H 2QKIB 2RCSH 5DSCB 1I85C 2BVQA 4TVPH 4U0RB 3AAZA 2X40A 4PRAA 4WIQA 2VXVH 3GRWA 4I77L 1IQWL 1YMHA 5GGSA 1T0NB 1JHLL 2RB8A 2J2ZA 2PKDA 5SV4A 2YHGA 4M7LT 5IVXF 1IGFL 4YHPA 3ALWA 4HC1L 1LE9B 3QQ3A 5HY9A 5KVDL 3WIHL 4N9OB 1MLCB 3U7WL 5F7WC 3EJZC 4N1EA 5E4IA 1RUPH 1XIWC 1H3PH 3HRPA 4D9QD 3RTQC 3VG0L 3O2DL 3QUMA 2FX7H 4ZDHB 5B38B 2X70B 5J8OA 3L5HA 3WKNA 5MERA 5C0GB 1W0WB 5L2KA 2XXMB 2F8VA 5E94A 1B6UA 2HVJB 4ODSH 1JI2A 3U0PB 5SX5H 4F7MA 5BJTB 1F45A 4OLVH 3FAXA 4LKXA 4PRPD 3X11A 5K9JL 4BH7B 3CU7A 2J88L 3AAZB 3UYRL 1HYRC 5KSAC 1MWAA 1ZAGA 4DGIH 3H9HA 3IKCA 4WWID 1Z5LB 5EBWA 1EUUA 4JFFE 5D93B 5GGTA 5BZWA 2CRYA 5CEXB 3UC0L 1CLOH 3WFEL 4JFDD 5CS7A 5JHLL 3IDMA 3T09A 3F6IA 1HYSD 3KLSA 4GAGH 2DQUL 5KVMC 3VXRA 5IB2B 3FRUB 4JFED 1ACYL 1R5IA 3TJHD 5FYKL 4XAWH 2Q8AH 3ZT5A 3LV3B 4LBEA 4WHDA 4X5WB 4OIIL 3CFIC 1FIGH 5EU5B 2ZUUA 3WNOA 4POZD 5C71A 5D7IE 1FNFA 4YHIB 5BS0B 3QEUB 1LEGA 1EO7A 4JN2A 4AK1A 1VKXB 3VFPA 1ZWIA 5KJRH 4G8FA 4M7LH 3MBXL 1TJGH 3TPKA 2F19L 2B4CC 4HFWA 5FCUL 1T66C 4HUNB 3ZSSA 5DJXA 1NKRA 4QHKJ 5HGBA 4L3EA 4BK4A 1RZ8B 4HS3A 4NWUL 5F9OH 3QJHB 5J06A 1OAYL 5I17A 2B1HH 3B5TA 4GLRH 2NXZB 2PO6C 5ERWB 4R2GC 4PLKD 4AJ0A 3OXRA 2R9HD 1CK0H 3VD4A 1PQZB 3BUTA 4MCZB 1HHHA 4HX1A 1LO0H 1VDGA 1FZMA 1HHIA 3TVMC 2VABA 3I6KA 4YHOL 4LCCA 3IJYA 4M1DH 4Y5YA 1NCAL 3DHJA 1KJMA 4F37K 4K8RH 4BM7A 1WSST 1M1SA 1KACB 4FQJH 2JJTC 3GRWL 1QNZL 4LRIA 3OJDA 5AEAA 2H2SC 3T1FA 2IADB 1A7RL 4JFFB 3BQUA 4WV1C 4K9EH 4XPTL 5FECA 1I8IA 5FV2A 3NMEA 2E3VA 1S7XB 5EU6D 2VN7A 5INDA 3AS0A 1EEYB 3U9UB 3NFPA 1H15B 3RWDB 3GMPA 2DF3A 4JFQA 4AT6A 2AJSH 2DLHA 2DM4A 3QIUD 4ODHL 3QQ3B 3MV7A 3S4SG 2UYLB 1FBIH 2WQ8A 3FO1B 3GIVB 3NTCH 3SDXF 1FZMB 4U0RC 4M61B 5HGDB 4UNVA 1LEKA 4YFLF 3BGAA 1GVIA 3OL2A 1N4XH 4I3SL 4O9HL 3ARBC 1MJ7H 3EHBC 1RVFH 3ARED 1D9KA 3UCRA 1X5IA 2AJZB 4X6CF 3BHBA 4CVWA 3HZYA 2ICWB 1J8KA 3NAAH 1KT2A 1F2XK 2IBGA 3KLHD 5HYJB 3C8DA 4V2BA 3PHQB 3ARSA 3OKMA 4APQA 2H45A 1LEGB 4QF1A 1OLZA 4G6KH 4A6YA 1L7TH 1I7TA 3MJ9H 2FL5A 3TBSA 2GK0B 1BP3B 1KB9K 5FYLD 1IL1B 3NN8B 3U36A 1CYGA 3MGOA 3MREA 2EE6A 2WBJD 1A7OL 1UADC 3PXJA 2WBJC 1N3NA 5DUPL 5FM8A 4AENB 1WAAF 4PB9H 4J4PC 3CSYA 4W81A 3O2WH 4LGPB 3VFTA 1CGSH 3QI9B 2Y7QB 4IEFB 2JIXA 2VWEE 2P45B 4R3SB 4C83A 3MRNA 5I71B 4M6AA 1S5HB 4J3UA 2Q87A 4FQ1H 3MLRL 4NNYB 5FGCE 3ORJA 2AKRA 3BIAX 2GI7A 3B2VH 5SX5K 3QDJA 3D3VA 4JM2B 5IFHH 5IHUH 4HULB 2G60H 4IRJD 1YEKH 2M26A 5FKAB 3WO4B 2W91A 5D70L 4W70A 1M7IB 1OY3B 2YSSA 3MFFB 3EOBB 4PV9B 2P48B 2R1XA 2X70A 4WHTA 1DQDH 4XC3L 4HUWB 5KJRL 3QFJA 1KSRA 3C2AL 4XVSH 5TQ0H 3QDGA 3H9SA 2BHUA 1BZ9A 2VXUL 5F8QC 5EIVA 3D0VA 2XFXA 1NGYB 4O51B 3LPGA 3RZCC 3VXSD 1Q8MA 1LD9B 2AGJL 4I3GA 5IFHL 3OHXA 5J56B 2X89A 5DJ0B 4D0CA 1D5BA 1B88A 3E0GA 1WK0A 2W38A 5JUEL 1F4WL 4YBHA 1T1YA 4QEGA 3VXOA 4YAQA 1HEZB 2ATKB 2F58L 1CFTA 1N7ML 4F9LA 2AQ2A 5KSVB 3QUYC 3VXSB 5F7KC 1ZXQA 4M9OA 4DGIL 3GM8A 2ZCHH 3C2AH 3S36H 3T4AA 3BYYA 3V0WL 4DK6A 3IB4A 2A6DA 4XVJH 5CAYB 4PJAF 3IF1A 4P4KD 2YA0A 1SBSL 1KLFA 5EU7E 4ZUWA 4JPKH 1HH9A 3QUZB 2FSEB 3PDOB 2DICA 4DKFL 1FNEB 3DI3B 1JYVA 3HE6D 1F4AA 3I3BA 2NY3B 3DIFB 3TT1L 4JM2D 1P9MA 3TV3H 1CG9A 3GUTB 4B41A 2XY1A 1UH3A 4D0BB 5CZKA 1XGTA 1KEGH 4BZ2H 5JIHA 2AI0H 3F62A 4ZQKB 4LGSB 3VWJA 4BFIA 4DN3H 3ARUA 2I60H 1C5DB 1P2CB 5E5UB 1RVFL 3IRPX 3CSYB 3VXMD 3OXRB 1KPVA 2AK1L 4OCWH 3UDWA 4DZ8B 1C7SA 2GT9A 5KN5B 4WFHE 4F37F 5L2KD 4LLMA 4TNWF 1BVKA 5TF0A 1DSFL 3DPBA 4ODWB 1RUAL 4OZIA 1NBZA 5IW3A 5IM7A 1EAJA 5I8OH 1OP3K 3LHPL 3JV6A 4R7DA 3TJEL 1NLBL 9CGTA 4KUZL 3FB7A 4LVHC 3I3DA 5EBMB 2UZXB 4NN7C 4JZNB 5BMFL 4ODXB 1RZ7H 1QG3A 4Y1AD 5CZVL 2O26U 4NSKA 4O2FA 4W4OC 1FNEA 1AHWA 1JTOA 3BKJL 4D9RD 4P3CH 5DJDA 5IMOB 1D9KC 4OZIE 2KQNA 4ODVH 5EWIH 1YN7A 3DMMC 4KK9D 1KNOA 4JFPA 4BZYA 2V9RA 2LU4A 4KROD 3RZCB 2IANA 3BT2H 1B4JL 2PTTB 2ICEA 5DWUH 1UZ6E 3FQRB 5F7YC 4AEFA 5BXFA 2P49B 4Q9CA 1YNKL 2HJKB 5C0ND 4QXGH 4NQEB 4PJHF 1WICA 4FZEL 4I3RH 4WFFE 2JTDA 5KVGH 3OSKA 3UTZB 2J8UB 4LQ1A 1G6RH 2BVUA 3VXNA 4NQDA 1J1OL 2VLLB 5BJTA 4H88H 2ED8A 5J9PA 4KKLC 4F58H 3F6LA 3U30B 3MRDB 5C0CD 4CGTA 1PEZA 4JN1H 4KKAD 1S7XA 1IM3B 2O93L 3BKMH 4WTWA 3EFFB 4QOKB 3CAFA 5F9WB 5FGSA 5JDJA 4AG4L 3C87A 3U9PL 5DS8A 4P23B 4U6XB 1OHQA 4TTDD 4KVCL 5LGKA 4G5ZL 2BFVL 2H3NB 1CDIA 1SMOA 3O9WC 4MJIB 3GSQA 1HSBA 3KXFB 1JNLH 4S1SH 4X4YA 2Q76B 5HVHC 2FYYB 1OTTD 1UKTA 3GSWA 4KJYB 4XXDB 5IV2B 3D9AH 4KWUA 5HI4D 2QLVB 4GRWF 3H9SE 4Z77A 3KPTA 3F7RA 3CFKA 2QKIA 5ERWA 1J5OH 4TUKL 5T1DH 2BY1A 3VXUD 1X5FA 1MIEH 3QG7L 3G5YA 5GXBB 2QR0B 1FG9C 2ED9A 3KPRD 4LKXB 3QXDA 5KANG 4N8VB 3QJHA 3NFNA 5DD3H 3OR7A 3MV8A 4GXUM 3CGTA 2XG5A 4LLUA 4YDIH 4OFYA 3MODH 5DD3L 2WQRA 4HWEL 4X6FB 3FB6A 5DUML 3R06A 4AQOA 1IM9D 3CH1B 4HMDA 5IVNA 43C9A 3TO4A 3ZYJA 1KTRL 1WWWX 4WEBH 2WANA 2GHWB 4P2RE 2HFTA 1JTTA 1MJJB 4EQ2A 3NA9L 4PLJD 3DXAE 5E5MB 1C16A 4HXBH 1LP9E 2ZKHL 5JMRA 1JNHB 1BFVH 4MA3A 2DQDH 3QBTB 2BHYA 5B39G 1J0YA 5IB2A 5GS2H 3OWEA 5DR5L 4OKDA 3WHE1 2FWOA 1PYWB 1Z5LA 1WISA 3GUTA 5DRWA 3VFWB 3LEXA 4OQ1A 3ARXA 4GRLB 2R15A 4LPTA 3DYMA 1XCQA 1I7ZA 3KPMB 3WJLC 1DCLA 2AJYH 1A3QA 4GW5A 5GS0D 3H9ZA 3QHFH 2V5TA 5DS8B 3LKPA 2WZPD 4QCIA 2Q8BL 4LPYA 3RPIA 2FIKA 4JCMA 2H41A 1G6RL 2FNBA 5DMJB 2D31B 3ZE2E 2I9TB 4JFDE 1AJ7H 4G43B 1NGWA 1UEMA 1REIA 3X12A 4G9FB 4UT7H 1NC4A 4UIKL 1RFDL 4JY5H 3B5HA 5EUOF 5T1LA 2FR4B 4K71B 4OM0L 1AGDB 1CBVL 4WUKH 2P5WA 5ALBH 3ULUF 2XQBL 5A43C 3MNWB 1MLBB 5IMLA 4TULL 4JY4B 3BMVA 3SHSA 3V52L 4YX2L 1T3FA 5D7IB 1VFBB 2HG5B 2GQHA 1BLNB 4XPGL 4MLSA 4RAVA 4NYLB 3RNQB 4M1CD 2HRPH 1UA6H 1KFAL 1ADQA 1BZ9B 2XZAH 3SGJA 4PJHB 5DJAA 5F3HB 3FKUS 3O6MH 4EDXA 3W5MA 1V05A 4JQVA 1C5CL 5I18L 5FKPA 3MRIB 5IQ9A 1AI1L 4NQVB 3MACH 2Z35A 3F12A 4IMKC 5LQBH 4NFCA 1T21A 1FNSL 1U8IA 3DBXB 1PG7L 5HHVL 3MRJB 4Y7MA 3BSZL 4QY8A 1AD0B 1UWEL 1T1XB 5BV7C 1IC1A 4X6FA 2GIYA 3VI4F 1IEHA 2A6JB 2GKIA 4HQQH 1UXSA 5D4QA 4U1MB 2AI0L 1N64L 4EVNB 2BXZA 4AENA 4PJEB 2WK2A 1OOAA 4IHOA 1D6VH 3MJ8A 3OR7B 5J4MA 3MA7B 3MNZB 4E42A 3U36B 2VAJA 3FFCB 4Y89A 4OV6F 4PYGA 3W11D 5JXEA 4FFYH 3U0TA 3KDMB 4IRSB 1MI5B 3DI2B 3S3PA 1A22B 4CNIB 1CFNA 3BP7A 5E8OB 5FDYA 1PG7H 2GCYA 1VGEL 1RU9L 4TSAH 4QRPA 4ZFZB 5D7IA 1WTGT 4A2LA 4QXUH 3VI3E 4Z77B 4QRPD 1KJ2H 1V5JA 4K7PH 1IAIM 3UZEA 3PDOA 1T20A 2M1KA 1AI1H 3P77A 5E24E 1H8NA 4XPHH 3PL6C 5F88A 2D03H 3GMNB 4XRCA 4HLZH 2WINB 3K74B 3WIFA 1CXLA 3TF7C 3RFZC 2X4PA 1I1FA 2PXYD 2F58H 4JO1L 3P4OB 4HUUB 1BBJA 2YMXH 5E8PA 5BW7A 3S34L 5E2TL 4CJ0A 4R7NB 4HKBA 3MGTB 2AAVA 3REVA 2GAZA 3LB6C 5A40E 1WZ1L 4LQFH 4L8SC 3IU4H 1FQ9C 4JREB 3OAZH 2YA2A 1CGYA 2CLVA 2J8HA 2P8PB 2VUYA 4MD0A 3TBWB 4JM4L 5I30L 1U8MB 1QHOA 5I1LB 1WF5A 2YRZA 4KGJA 1ZGLA 4MJID 5BOZG 2NY6D 4FQHA 1MCBA 2EDEA 2IAMC 1NGQH 1UM5H 3C5JB 1N0XH 1CFQA 3GMPB 5ICZB 1CF8H 1U8PA 1WFUA 2EDFA 3IS0X 2F8OA 1CS6A 1U2CA 3ZYOA 1H3UA 2OK0H 4KRLB 3H9SB 2AQ1A 4G8GD 2VWEC 3H42L 3D39A 3AB0C 4NC2B 5HGGS 2VLJA 3MRCA 3HAEA 1T03L 1U58B 1BX2A 1M7IA 2GSGA 3VFUB 4YC2B 5CILL 2FIRT 3MLRH 5K59E 4RGND 3IFNH 4NKIL 2WUBH 1CL7I 2V17L 3QIUA 2QQNL 3KPLB 1DQLH 1WC7B 4X9FA 2LTQB 4RA0C 1U41A 4HJGA 4P57B 2EH8L 4LSSH 3RWEB 1NCCL 4PB9L 3TO4B 4WI9A 4Q9RH 4U6YA 4FP8H 5FK9B 2IBZY 3MRNB 3OXSB 4TQEH 3ZKSD 4AYFA 2RGSA 3S35L 2EE3A 1EDQA 4LEXH 1RJLA 4ODXA 3I6GA 4OGXH 3V8CA 2X41A 1EPFA 4P9HH 1EA9C 2DTML 5C86A 3MCLH 3FFCD 3C60A 1I75A 3BDYL 1CICD 2VQTA 5KZCB 3BH9A 4R4FH 4FTVE 1J1XL 1NMAL 2W9LA 1MHEB 2FZ3A 4HBCH 3U82B 5I1EL 5CJOL 4Y2DD 3MNVA 4R26L 5HI3C 3SBWC 5D7JA 4OUOA 1UCBL 1UXWA 5D1QD 4OLWH 4M1CC 3SE9H 4NKMA 2ITCA 3VD9A 3TZVC 4HCRA 2Y07H 2BRRH 4OBRA 2EDDA 1EMTH 5MP6H 1A4JB 5SX4H 5HYSB 5M95B 3VWJD 5CBEB 4JPVH 3AUVA 2CR6A 5EZLA 4JQVC 3MV7D 4NUJA 3P73B 1T0MB 3NCYS 2FLBT 3QXTA 1VPOL 2E6PA 3H6JA 3L3GB 2PN5A 4OAWA 1HINL 1QLEL 4TUOA 5HGHA 2V7HB 4XVUC 4XVUD 3RY4A 1UEYA 2Z8SA 4POUB 1A6UL 1JZ3A 2PYEA 1YMMD 3IETB 4FQXB 5HI5C 3LS5H 4G7VH 4HZLB 4F57L 2HKHL 4P4KA 3H9HB 3WO3B 3D3VD 25C8L 3NACH 1U8PB 1J0HA 3RI5K 2VLLA 1OGAA 5TFSL 2VXTL 5KS9A 3RI5F 1J0IA 4OM1H 3NFPB 4OD1H 1X6NA 1DVFD 3D18A 4DFHA 1I8MA 1S9YA 5HHXL 4H5SB 1WTLA 1YYMH 1SYSA 4K07A 1AIFB 4G8GA 1QFUH 1HQ4A 1X7QA 5EIIB 5AYUH 4ZPVB 3LS4H 2B8OT 1CCZA 1QSED 4HWZB 2DS4A 1BHGA 4P4RB 1ORQB 4YHOH 1YEHH 5IJVB 5DQ9B 3DBXA 4K94L 5GHWL 1U3JA 3IYLW 5IBLC 1HHJA 3S36X 1FV1A 1RJCA 2R1XB 3O4LA 3GSNH 2ZOLA 3DXAA 3TA3C 1T7XA 1YEFH 4ZNEE 1KEMH 4KMLB 3GBLA 3WXWL 3S88H 1CZ8H 4K23L 4Y2DC 4GRLD 3ARPA 3JWNC 1BBDL 4M7ZB 4Q2ZA 4U6TA 1YMME 3REWA 2WWMD 2EDXA 3QUXB 5FXCH 3O4OB 1I3GL 3BQUC 4WV1A 4ZAKD 1NANI 2Y4SA 1GRWA 2OZ4A 4S1DC 4DN4H 2VXTH 3T0XA 3MLWH 1W72A 1KPUA 1NGXB 3CZFB 3QDAA 5EWIL 3T0BA 1BOGB 5HHNA 5CP3H 1MY7A 1A3RH 1YQVH 3QEHB 2A83B 3LKSA 3D2UB 4EI6B 2GUOB 2YA1A 2VH5L 2Z8VC 5IJVA 1T4KB 1B3JA 3CVIL 1R3HB 4D3CH 2AXHA 5DZLA 5HI4C 3RRQA 1KIQB 2DQUH 3DIFA 2FO1A 3HC4L 2YPLA 3WNMA 3FT4B 3I84A 4BSWA 4MZ3A 4O02H 4FTVA 1EO5A 3QEQA 1FRGL 4M6OL 4XCYA 2B4CL 3KPRB 2CIKB 1BREA 2NCMA 4A6YH 4OGAC 3I6LD 3K0WA 2QTEA 5J6GB 1KJ2B 4OJFH 2XWBB 5GSVB 2OL3A 5FDWB 4PJCA 5IMKA 2MPAH 5IGXL 2F54E 1A21A 3RIFF 1JYXA 4DKDC 1CGVA 1G9EA 2CH8A 4PREA 5D9SB 3HNTH 3RKPA 1R6VA 4X0KB 3L5WB 3MCLL 1LO5A 1YYLL 1Q9LB 4MYWB 5LKNA 4NO5B 5HGHB 4XMKH 3SO3B 1P4IL 1C16B 1T1YB 2DD8H 5J3HD 4U1JB 1P5UA 5JR1H 4OUUB 3AREB 3UJTH 2WUCH 5EO1A 2R56L 2V6HA 3QA3A 2EE9A 5J1AA 43C9B 1CVRA 3RIAK 4GRWH 3UTPD 3HPJA 4APQC 3PV6A 4XAKE 4HWBA 1MAJA 2ZOKA 4CMMB 4GRWE 5GRXG 3AU1A 1WWCA 1OTSC 3KYKL 4JFXB 3W9EB 3AM8C 2FJHA 4L8BA 4U3XA 4DCQB 1QBLL 5E9DE 4OCXH 2ZNWA 3IDNA 4X9HA 1UG9A 3SDDA 2VDQH 2W0PA 3KPOB 5GPRA 3GBMH 4NKOA 3NFNB 3VXQA 1ZLUH 3ZTJH 1MWAL 4UQ2A 1HWGB 1OT2A 1C1EH 1ORSA 2JB6A 2Z0BA 1QZ1A 5D7JC 3LEXB 4XCCH 1FL5B 2JELL 4CNIA 2ADGB 1UA6L 2HRPL 2A1WL 4Y5YB 1A1NA 2OJEB 3FQUB 5F9JA 4N0CD 1OPGL 2F54D 2X4TA 3S4SB 3L1OH 3J8F7 4GAJL 2HN7B 2AQ3A 1MJJA 2G60L 4MX7A 3MRBB 1XF1A 1XZ0B 4MJ6B 4R0LC 1GOFA 3GMLA 4LPWA 1E4KC 4PJXF 3QZWB 1C12B 2B2XH 4L3EB 4FQ1L 3CK0H 4HC1A 1KYOJ 4X9BA 1A02N 1OD7A 4ZFOB 1A3LL 2VXSH 4YE4H 2P24A 3HAEB 1MFDL 3QH3A 3SGKA 2VLJD 5HYQB 1D6EB 4KJWD 4HWUA 1V7NH 1E28A 2DQEL 1EUTA 2JK5A 3WUWG 3OG6B 1EGJH 2EEDA 5DUPH 5IQ9B 5IVZB 5HSFA 4M02A 4K7PL 1Y18B 3C5JA 1DBJL 3JUZA 4Z5RA 2W1NA 2DQJH 2ZCLL 4U7KA 5F3HA 3RWCB 1MFCL 1YPZF 4P2OA 1ZLWK 3VRIA 4Y5XC 1RZGA 1S7QA 4WI4A 5EUOE 1X5HA 2BMKB 4JGUA 1LWRA 1WBXA 1CN4A 4C56E 4RA3A 2XTJB 4PRHE 2GK2A 4JPWH 3P11H 1Y6NR 1VEMA 4OZFH 4D0DB 5EC1A 5BZWB 4PTTB 1ULVA 2D7MA 5BVPH 3O3EB 5I73C 3WS3B 2F53E 3ZO0A 5JZ7C 3HI1B 3RGHA 1XGUA 5MEPA 3BWAB 3CU1A 1NGPL 3KYOA 3JWDH 3F7YB 1HH9B 3BSZH 4EI5D 4QTIH 5EU6E 2BSSB 1ZOXA 2H32B 4I18B 4ONHA 4YDJB 1ZK9A 1Y0LA 4N8CL 3GMMA 4E41D 2FEEI 3MBEA 4F7CA 4WEMB 1X3DA