5CGBA

Crystal structure of fimh in complex with heptyl alpha-d-septanoside
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title Impact of ligand flexibility on FimH-antagonist binding a case study for substituted oxepanes
rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
total genus 37
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5cgbA00
4X5QA 1TR7A 3JWNE 4X5PA 5AB1A 5FS5A 1KLFB 3ZPDA 4XODA 2J2ZB 5LNGA 2WMPB 4AUYA 3SQBB 5FX3A 5CGBA 2JMRA 4J3OF 5F2FA 2JTYA 5AAPA 1N12A 4AV4A 1PDKB 2UY7B 1ZE3H 3BFQG 3BWUF 5FWRA 1UWFA 4AUUA 4XOCA 4AV5A 4CA4A 5IQNA 5JQIB 4LOVA 3ME0B 2XG4B 4ATTA 4X5RA 4AVJA 5LNEA 3BFWA 5F3FA 3MCYA 5AALA 4AVHA 3ZL1A 4XO9A 2XG5B 3RFZA 2UY6B 4AVIA 4XOAA 4J3OG 4J3OH 5IQOA 4AV0A 2W07B 4XOBA 1KIUB 4BUQA 5IQMA 4AUJA 5FLUA 1QUNB 3JWNG 3ZL2A 3JWNH 4XOEA 4CSSA 5ABZA 4AVKA 4X50A 4CSTA 1N0LB 2VCOA 4XO8A
chains in the Genus database with same CATH superfamily
3ZUNC 2AV7A 3T0EA 3BEVB 4WTQA 3S4SB 2APSA 3HRZB 3N5AA 3QEGL 3RB5A 2ENYA 1L9TA 3QNXB 5HI3D 1OGTB 2WGNB 3H55A 4JFPB 5FYJU 1PZCA 5C7ZA 1Z9SA 5DD5H 3L7EA 4XI5C 1NFKA 3U2JA 1JWMB 3FO2B 2JKWA 4FJZA 2MFNA 3L5WA 3KPOA 4PJGB 2JH2A 4XCEB 1GRWA 1RJYA 4KMTL 3NQIA 5FA3A 4IMKA 4NHCL 5GGUB 5LGHL 3OAUL 4FQLH 1X5ZA 3TN0D 1S9WB 1SBSL 4Y5VB 3E38A 1VRSA 1E4XI 4PLKD 3NSFA 4QAWA 3FYEB 3RWDA 3TEXA 1UEYA 3L3IA 4JFED 2WKLA 1XF5A 1C12A 3AS0A 3CFQA 3HG1D 2V7NB 3KLSA 2OSXA 5AYUH 5KVEL 4R97B 3SE8H 4MYWB 3Q44A 4N2BA 3L08A 2PF6A 3DJTA 2X6BA 4FG2A 3UP6A 1H5BC 3FPYA 1KIPA 1DBKL 3GMLB 3X17A 1RVFH 1G7IA 2CU9A 2AZUA 1D5ZA 2NW3A 4EVNB 4OLEA 5CJXA 2XT1B 3D9AL 4DZ8B 4Y4KB 5T3ZH 4G80B 2G4GA 2AKRB 4U1JB 4PH8A 5T1DH 1G7PB 1OSZA 4ELME 5EOTB 1OY3B 1URIA 4GQZA 5T3XE 1J5OL 4A2HA 3FUIA 1RUAL 3LRSA 1N5AB 5CEZD 4MAYC 5I71C 3EGXB 3N43B 2GITB 4PR5B 4JO1L 3GMOB 1QG3A 1T1ZB 1TZGH 5KVFH 2PYFA 1WA1X 2CHWA 5ALCL 5DWUL 2EDFA 4KK6D 1PD1A 3C60D 3FUEA 4PGEB 4JO2H 1FVCA 3O4OB 3FSOA 3P0VL 3UL4A 4XTRD 1RJZB 4OZGF 5IWLC 5L8JB 3ZQWA 4DGWC 4AYGA 2H0JA 3O45A 2BCKA 1QBML 5KBPA 4HIHB 2V2XB 1P4UA 2YEZB 3FSWA 4WQOA 4HS3A 4XXCA 4K3GA 3RY6A 4YHZL 1ED3B 2OX5B 4QRSA 2V9RA 3CFKA 4UTAH 3NJXA 4MSWB 2Z8SA 1U4EA 4RMTA 5EZPA 1E27A 4LSRL 4XPHL 1JGEB 3QULA 3K71A 5HJDA 4LKCB 2CGYA 2ZUQB 3L6FB 3UEZA 4MMYA 4AZ8B 3T5WA 5I76A 1G0YR 5HHVL 4RBPH 3TA3A 4WUUA 4YEFA 3O3UN 4OFKA 2GFBB 1OP5K 3EGDB 5C0IA 4QRFA 4R7XA 3PDOB 2XXGA 5JOEA 1ONQB 5GIRA 5EU4A 2CLVA 4K23L 3UACA 1HVXA 3SGJC 4WK2B 5JORB 1KPRB 5FYKD 1ZLDA 2V2TB 3UYPA 4Z3JA 3NJKA 4BFKA 2Z4QB 5D4IA 3MLRH 4FOMA 4RGNB 2C9VA 4UAOB 4C8XA 3BX7C 1TCMA 3MROA 4G8EB 4OCRH 1BZ9B 1PLGH 5D1XA 1M05A 4CKQA 4KDTC 3EJPA 2XOTA 5FKAB 3ZQXA 5AW3B 5ALBL 2AHIA 4HZAA 4EO5A 2YA0A 3QDGB 5CCKL 2A6IB 1HT6A 1N6QH 5DYOB 2BNRE 1NLBL 2UY7B 2ZNWA 1CDJA 1N8OE 1I8IB 2Z8RA 1KYOJ 4LHUG 1KDJA 4ZT1A 4A6YL 4Q9CA 2Y7NA 4QJ4B 3WHXA 5F7DA 2XG4A 4XXWA 4W1TA 3H56A 5E2UH 1E9PA 4QRTB 4R8WL 5E00B 5AZEH 2W9DL 2C34A 3KNBA 3G5VB 3DX9A 4LSVH 3G04B 4PV8A 4ZO8A 4ZAKD 1RZ7H 4JQIA 5DYFA 5IV2A 2AW2A 4L3AA 1PQZB 3CXHK 4R3SB 4ONFL 2IG2H 2I9LB 2BHZA 4Z5RA 2UUDK 3TPUB 4EDXB 3BAWA 4MD0B 4JM4L 2CO7A 4X4ME 1P84J 5I8CA 3RTQB 2GT9B 1Y18A 3OHXC 5DZAA 3NT0A 1X5MA 4Q4IA 5KVGH 2O5XL 4WNQB 5GRVL 1QSFE 3FULA 3O3DA 4OF3A 4QRQA 3U1SH 1AFVL 4DP6X 1I9IH 5C08A 4NQDE 4V33A 4CW1B 2CBMA 3LNDA 3RA7H 2FEJA 4UZGA 4IGBD 3VCLB 3VU1A 4Q9QL 1R75A 3CK0L 3VFRB 2BP8B 1QFWI 3H0TA 4BZ2H 5AAWC 3CVHB 3RWCB 1QO3A 3U48A 3UJTL 4P57A 3KVPA 5C0CB 1JK8A 12E8L 1NEZB 1RCYA 3AY2A 4FKHA 3KJ4C 3IPFA 4L4TE 2XSKA 5CIPA 2YR3A 1JNLH 3LKOA 3JTTA 3KYNA 3QPXH 4XPFH 1AY1L 2Q10A 3B9KA 3EDJA 3LSOA 3VXUD 5J12C 2AGJL 1IKNA 1U2CA 2OTPA 2P8PA 1FORH 4IIQB 3VXTA 3KPRD 2Y3AA 1NUDA 4I18A 4N8PA 2EZ0D 3APNA 4P4KB 5DHMC 5E1QA 43C9A 4UM9B 4MJ2A 4OLWL 3S4SA 4XMLL 3VFTA 1ANUA 4DUWA 2J55A 4MNQD 3GI9H 5A2KH 1ZGLB 5D1QC 4DO4A 3PQYA 1TETH 3AFLA 1OAXH 1ZLWK 1CLZH 4PCSA 5IGXH 1Q0YL 1JWMA 4OGXH 3NZHH 4HK0B 3WV0A 4ZW3A 2QQNL 4UTBA 3V0VB 4LDCA 1TQCB 4XMWA 5FGBA 3DOHA 3S34L 4JFYA 1O9ZA 2A99A 3ZKMC 1P1VA 3GJFK 4KROD 4KKBD 4ABUA 4NWUL 3QJOA 1A7OH 5EEYA 1EO8H 5DJ8B 4XWGH 3KLKA 4PVLA 3QHTC 5DFTA 2NNFA 5DJDA 3MYJB 4NYLA 2F19L 3O2WH 4PGCB 1PX8A 2MQ0A 2E74C 3CBKB 2J3SA 1KDIA 2WK2A 2XZAH 5KSBB 2HJFA 3K72B 4K4KA 4R7LA 5HJGA 4PUBL 1U91B 2GSGB 2VDKH 2OK0H 5HGDB 1F4WH 4NOBA 2IQ9L 3IMVA 5F88B 4DZ8A 3EXJA 1E4XH 2DL2A 4Y4KA 1HZLA 3HN5A 4G80A 5BQ7B 1RL1A 2AKRA 3O11B 2ED9A 4U1JA 2XYCA 4G9FB 2NCEA 1MRCH 3VRIB 1CFTB 5IM7A 2JSFA 4F58H 4JPQA 3TH2T 1T03L 1M4KA 3UIYA 4AMKH 5EN2B 3BDBA 4K8RC 5IHHA 1U8PA 3EGXA 2GITA 3H9SB 1JF5A 1U0QA 1F11A 5TFSH 4NB7A 5CJOL 4IBSA 1TMCB 2Y25A 4KTEL 4DKFH 4GRLA 1AGFA 2V9QA 3QIUC 2IC2A 4IU2B 4RH4A 5EEWA 1A64A 1AHMA 2N4IA 3PV7A 3BP5A 2C9XA 3ARDB 3LXBA 3KPQB 4X6EB 5IW6B 1WVZA 2C1PB 4HIHA 2X1WL 4GG6F 3CLEH 1K85A 2YPVH 4WY7L 3LZLA 1IM9B 5CJQH 1M7IB 1ED3A 4Y1AB 1ZVNA 2CXKA 2VERN 2DQFA 4MSWA 2FJHA 3ESPA 3LQZB 2FL5B 4QDGA 4YQXH 4BSJA 1QRNE 2YD8A 3OR6A 3D18A 3TNMA 2BSDA 3WS6A 4QRRB 2A74B 1GJUA 4ZW6A 2GFBA 4KFZC 5FM5O 4RFNC 3QQ4B 3UAJD 1ONQA 2DQDH 3WG7B 1B2WL 3FFCA 2WKOA 2BP3A 3BKCH 3ZO0A 1KGXA 1VACA 1DZBA 4ODTL 4YO0A 3ZVVA 3OB0K 2WSKA 2CK2A 1Z9PA 4P0DA 3HZKB 3UBGA 3OL2A 4MJIA 4OGQC 2OMZB 3K5SA 5TGBA 4F9PC 3EYOA 4M1CC 4LT7A 5E8NB 4QNPF 5FKAA 1QR4A 4K3JH 4NC0B 3FUMA 2Z0BA 1OT1A 3WIHL 3QDGA 5C6TH 4JL2A 1MCOL 1OGAA 4GAYA 2BOLA 4JM2A 1OWWA 4WWNA 4XAWH 2UY7A 3TZVA 3GSQB 2OV0A 2FX8H 4ANXA 1I8IA 3L7FB 5IFJA 2DI8A 3NN8B 1ND0A 1DVYA 5C92A 1UB6B 3TYFA 1AGDB 4OD3H 1YEIH 2FVNA 4HPOH 3R06B 3LMJH 1H3XA 2FJFA 4HWEH 4IRSB 2VNCA 3ZDWA 1F3DJ 2UZIL 3U4BL 1LO4L 3FO0L 3TV3L 1F4AA 1KTJA 3Q6FB 5J6HA 5D72L 3RB7A 1PQZA 3P9LB 4R3SA 5CEZH 2I9LA 1NANI 3TWCH 3B3BA 3VQ2C 4JG0L 1OTSC 2VXTL 4QHKJ 2ED6A 4XBMA 3KL5A 3RTQA 3HPLB 3MGAA 1T4KA 3ILPA 4XNMB 2CUHA 3PWUB 2RB8A 1LDSA 5H37A 3S3PA 4BSVB 5BO1L 4ZG1A 1UT2A 2BMKB 2CRMA 4PD4K 2F7IA 5IHWA 5DLLA 4FQCH 4GRWE 4LLDB 3VD7A 1J5IA 5F3FA 1NM9A 1NGPH 2VLJA 3RX8A 3JWDC 1MSPA 2UXVA 4EN3A 3MRJB 2N59A 4ADGA 3QUZB 2DBLL 4PP1D 1PLAA 1KBKA 2V8MA 4XCNB 2Q2EB 4D0CB 1Z9NA 4HPYH 3VFRA 4IEFA 3CV5A 4X7DC 4J3OG 4PJ7B 5C0CA 3JV5A 4Q9RL 1MI5A 1JNHB 4B9CA 4YX2L 4ODVL 1AZRA 4ZJ9A 4N90E 3RYMA 1WCQA 1YEHH 1QBLL 4ZFOL 2GSMB 4UI2A 4GSQA 4YWGL 1JZJA 2ICWI 3HMWH 1D9KD 4NM4L 2ZF8A 1XGUA 4IIQA 1NL0H 5ITFB 3U9UA 2F54B 3MV8A 4WSJA 4Q52A 1QFWH 3VGAC 5FYKH 1U8OB 5ECJE 4XP5H 3CX2A 1OM3L 5LGYA 1E7UA 5PAZA 3NDYE 3RX9A 1KWKA 3B7TA 4KO5A 3II3A 4LCCA 2QSVA 4R5TA 4WKZA 3ULAB 4IJ3C 2XWJB 4HK0A 4YBLC 4CUCA 3NCFB 3NSXA 3FQUB 4FX5A 1E4WH 3BIAX 3PV6A 3DSNB 5JQHC 4G6ML 1T4WA 5E5MB 1JYXA 3B7RL 3MCLH 2NY1D 5CNHA 5AD0A 1IGYA 4PJIB 1VCBC 2EDTA 1FC2D 1ZIAA 3BKJH 3HG3A 3IDGB 3LN4A 3TT3L 5TF1L 1N0XL 5GGVL 3MYJA 3W57A 4RLDA 2Z31A 1YJDH 1R3IH 3BDYH 4WI2A 5IF0B 5HPOA 4Y4HD 4ILDA 4AV4A 1SMOA 4W4OA 1HOCB 2AQ3A 3GXTA 4P2OB 2I5YH 5HGDA 4N2DA 4TUKH 5F88A 1CQYA 3MX0A 4JFHD 3WD5L 4RDQF 1I1CA 1NOLA 5BQ7A 2IQAA 4WHYG 3O11A 2XY1A 2O61A 1IARB 2O26U 5FGCE 2PTTB 3FU3A 4M9OA 3KYKH 4UT7L 1C5CH 3II1A 4OFYA 2AJUL 1T80A 4HWNA 4Q58C 2HTLD 2C1OB 4GI9A 3ZKSD 3WJMA 3FU6A 4J8QA 5EN2A 3WJJA 3NTCH 1LEGA 3H9SA 4ANUA 3VAEA 25C8H 4A6YA 3DHPA 4AYFA 5EZIL 2EUWA 5HHOE 4LARL 1U95B 4IU2A 2EIJB 1HAUA 3DYOA 1Q90A 2F2HA 1ZY9A 5KUMA 1X5GA 1JNNL 2Y7SA 1S9KC 3L48A 2R4SL 2DOCA 4G3YL 3MJ9H 4R4NC 4EBQL 3X1FA 1BZ7B 2J1YA 1R34A 3KPQA 4NQEB 4PJCF 5I18H 2C1PA 4FFWD 4OU3A 3SBWC 3LD8C 2Y5TA 3FAXA 4PRNB 4U3HA 3ZHDA 2FJSA 4F8LA 3HHSA 1IM9A 3HHRB 3O8XC 3O3AB 4E9XA 1M7IA 5DDHA 1GW6A 5HP5A 5IOPA 3T0XA 3OJDB 1TPXC 1BGXH 3HW7A 4L9DA 4PJXF 2FL5A 2VDPB 5IMMA 3UTZB 5ABZA 3T1WA 4ZO7A 3D69B 4QRRA 3QW9A 1YY8B 2A74A 2DIBA 5FW8A 4DPCX 3S5LB 3LH9A 2WZAA 1ID2A 4F93B 1RZJH 3RU8L 4LL4A 2PXYB 4IRZL 1WFJA 2KLSA 2H8PB 4LU5L 1BVNP 4B7LA 2NT1A 3IBOA 1AKJB 1G6RB 2VE6A 1QSEE 5CZXC 5D7SH 5AKTA 3LQMA 2AVGA 2WQRA 3BGAA 4KKLD 3OGCB 1BLNA 1TTGA 4CNIA 3OAZK 4LSUL 4U0RB 1HAWA 1C16A 2MCPH 3FJTA 3GHEL 1URZA 3V5KA 2VW4A 2NTSP 2OMZA 4HG4J 2QGDA 4I0PA 4M61B 5F97E 1NCDL 2PO6D 4CGUB 4TVPL 3QDAA 4IBLT 3UABA 2VDRB 2VKWA 2CBQA 3MLPA 4APQB 3MUZ1 1KJ3H 3GMQB 2AANA 3OPZL 4S0TD 2WCSA 4IKKA 3QXAB 3VFGH 3RGBA 3BAEH 5CGYD 5KYUA 1AC0A 3NVQA 5IB5B 5B3JE 1NGZA 1W2KT 1EZVY 1RUQH 3HC4L 2AERT 5JOFA 4XVUD 5I74B 3VMOA 2Y07H 4NKQB 4NUQA 2FUQA 2VDNL 2O5ZH 3BP4B 4B9JA 1QQDB 1PZ5A 3Q6FA 4MJHA 4N0YL 2A6KB 3P9LA 1HXKA 4OB5L 2ZOTA 5TQ2H 3VXRD 1OANA 4AW4A 4HT1L 4M5SA 4MA8H 1RZFH 1MCPL 1FCCA 2X2IA 1S7UB 3FN3A 3ZKXC 5ADPH 3HPLA 4XNMA 5AW0B 1D6EB 5TF0A 5GRVK 2NDGA 3IDXL 3ZYZA 3GGWA 3VI3E 3PWLB 1LGVA 1NCUA 4NNYB 4P4RA 2Z0UA 1U30A 3SPGA 5IQ9B 3ZE1E 4F1SA 4JFZH 4DSYA 1IGIH 3KYMB 1S3KL 5CP3H 5F9WB 2P45B 5D2NC 4LRIA 4O4YL 4IBVA 4OI9A 3MREB 1NAKL 2WAQA 1CG9B 1NANH 1BFVH 5K9OB 2EABA 2WYIA 1A7PH 1IFHL 2DMBA 4P5TB 4X80H 2VLKB 5JXAL 4AM0Q 4S1DC 5G4MA 4CMHC 5A2JH 2O30A 1CTOA 4GMSL 3CH8A 3V7MA 5HYQA 2HH0H 3ELQA 4RSYA 1QTPA 1W72H 5E51A 4J1UB 4DW2H 1LP9E 3A3YB 3DMMB 3FL7A 5DTFB 5ISZB 3MJGX 2VL5A 3IJEB 1F02I 1KMGA 2ENPA 2J1XA 2DMKA 5D7HA 2XWTB 4WU5A 5TDNB 3NJFA 5I8EA 2JB5L 1MFDL 1FH5H 2ZSWB 4PS8A 1B4JL 5EOCH 4Y2DB 3HI5L 5E8EA 3A47A 3WUWB 3IDYB 4J4PD 1FPTL 4FEMA 4TS6A 3ABKB 3Q6GH 3LH2L 3FQ1A 4XX1E 1XHHA 2N1KA 3DX6B 5K1NA 3NA9L 1DQML 4LEOB 2HWZL 4UQEA 5E5MA 4PBVC 4YZFF 1C8QA 1R6VA 3S4SG 1ZEAL 5KW9L 2G5BB 1KELH 2PUQT 2EUXA 4PJIA 4UUJB 2H9GA 4JFDA 4WFEE 2R83A 5FYJD 1AQKH 3IDGA 2G2RA 3RQ3A 3ULVL 4XNQB 1FVEB 3GS4A 1R3HB 3OSVA 4XMKL 1TJHH 1HKLH 1X4YA 4YHYC 4NN6C 4ZRGA 3N9GL 5FHBH 3TCTA 1JDDA 4Y2OB 4C56B 4GAGH 4U49A 1VKXB 3AQYA 4U6VH 3UG4A 1Q0XH 2R2BB 4G7QB 4M03A 3C87A 2E9BA 4OZ4A 1OTUC 4X4XB 3P30H 4JRXE 4XMXA 5E8DL 1AGEB 2V17L 5IHZA 2PTTA 4N9GB 4FQ1H 1J8KA 1Q72H 5F0JB 4LCUB 1AACA 3BPCA 1J8HD 1OQOA 4AV5A 3EUUA 2B59A 3WIHA 3LQAH 2NUPA 3MRKA 2R2CA 5JA9A 2WQAA 2P8MA 2Y23A 1M71A 4L0YA 5BQDA 4FYSA 5HY9A 4OT1L 3VDCA 3EGSB 4D9LH 4FXKB 1U95A 1KENL 2ZWKA 5E94A 1KCBA 4H0GA 3RPIB 2OXGB 3DVGB 1NICA 4WRLA 3QEGH 4FXTA 4R2GD 3KR3H 5TDPB 2GIYA 2IMMA 4UNIA 4OJFH 5KBDA 2AK4E 3TVMC 3IN2A 5GXBB 4P48A 1FP5A 4HH9A 5TE7L 3IAQA 3FC8A 1TVDA 3FN0L 4RMRA 3ISRA 5SWSE 4DP7X 5CCGE 3GXIA 4FTVA 3OJDA 4HZLB 2DMHA 2I24N 1F1DA 5I82A 4KMTH 4LVOB 3QUXA 1EAJA 3LPWA 4NP4H 3UTZA 2ZXQA 1R5WB 3X1NA 5LDUA 1MCDA 4CADB 5LGHH 1USZA 4FQHA 2LGNA 4LAJH 4XOEA 4E9TA 2BOBB 4ODSL 5FO7B 3BZ4B 4N0UE 1UUNA 2ADJB 3DHUA 5HDBB 3PWPA 3AB0C 1IIIA 3FXIC 4OUOA 2YGPA 1GS7A 2XZZA 3EZ8A 3A24A 2H8PA 3BSZA 5C0AB 3PXLA 3OGCA 4CN4A 3MUUA 4BUHA 3GSWB 1MIEL 4A2DA 3EOYG 5KSUA 1FWXA 2NY0D 2J73A 1FG2B 1SN0A 5TE4H 3CGTA 2ESVA 1RV6X 4M61A 3CSYB 3KPSD 2Z65C 2VC2H 1NKRA 2HKFH 4KWUA 2BSTB 4X83A 3MTXA 3PWVB 4APQA 4FP8L 3GMPB 3FCTB 5BJTB 4D9RD 1MWOA 1KGWA 4POZD 5I1LA 3EYSH 4IOSA 1IT9L 2Y6TE 4FHKA 1UG9A 1DE4B 3D51A 4UNVA 1ZVSB 4NHUB 4DTGL 5JXED 3L81A 4LSSH 5E95B 4IKLA 5D7JC 4W9IC 1GCYA 2BRQA 2C9PA 4X8JA 5I1KL 3BP4A 4ZX4A 2ADIA 1QQDA 1CYWA 1DVXA 1Y0LB 4LCWA 4YLBA 5DWUH 1OIOA 4YHPB 2GPZA 3TNNB 1J9CT 1H3GA 2OTUB 1M9SA 3C8DA 1TJMA 3DTXA 3F2LA 4TSCL 5B4MD 3TO4B 5GPRA 1L9RA 2J5LB 3V7AG 1QBMH 1RIHL 5KG9A 4NNYA 4YHIB 3QJFA 1UA6L 5IQ9A 3MRBA 3V79C 1UZ6E 3K2MC 2WD0A 1A22B 3QFJE 2AJ3A 2IADB 2WYHA 4LSRH 4YSRA 4P23C 4I9WE 3VTAA 3FBQA 4MNGE 4X9GA 5FOJA 1AHWC 1CG9A 3FPXA 3IETA 4O02L 4Q2ZB 5HHVH 4ZX6A 5K9OA 3NJIA 5TDOB 4XHQA 4Q56A 1UH3A 3VD0A 3L3JB 1UD8A 3VI4E 1A65A 2VLKA 3ECBA 1JXDA 2JIXA 3G9AB 2VDKB 3KCPB 5H37G 3UC0L 1IE4A 3RWHB 1ZHNA 1T1XA 4K23H 1ZLVH 1NGXA 3HZVA 1NGYB 3DMMA 4J6RL 4XB3A 1MF2L 5ISZA 2OMNA 4XN9A 3WEBA 4H25B 2CJ3A 5AOMA 3TT1L 1X6NA 3D39D 3FT1A 4FMFA 3VFNB 1EHNA 5EUKA 3TASA 3VX1A 4XNZB 1VFUA 4JDVB 3EFOB 3T3PF 2BSRA 1XGRB 2ZSWA 3VWKB 2ZICA 5ID1B 4GSUA 1DANU 4QTHB 2FECL 3O41B 1PEWA 4OLVL 2WANA 4F8QA 2W0FA 3QXDA 3DYPA 4XCCL 1I3RA 1NLBH 2QVMA 3CFMA 1BVKA 4PBWD 5FUCE 4OFVA 1SOXA 4KFMA 4LSQH 4YUEH 3DX6A 4MXWL 2VL4A 4NKIH 2P5ED 2R4RL 4AKOA 2DQJH 4UT6L 4KRLB 3FCBA 4HXAH 2XWCA 3DGCR 2F9BT 4J2XA 2X4SB 3HUJB 1GZPA 1W9XA 2W9DH 3MRQB 1PW3A 4TPRL 5G2NA 3LCYA 4HHAB 2G5BA 4EF3A 4F57L 1HE8A 3IPEA 4UUJA 2W0KA 4CN6A 5BV7L 2GUOB 5AZ2L 5EF3A 2P5WE 5FCUH 4NC1E 3ZKQD 2IGLA 1R3HA 1NIFA 1SGKA 4OI7A 5F96H 1KCLA 1T2JA 4RGMC 3NZSA 4F3FA 1YQVH 3ZDYB 3FF8A 4EI5D 5JOPE 1I7UA 5DO2D 4MXVF 1AFVH 3MUY1 1CFQA 3ORJA 4Z0BL 3ZYOA 2FHFA 4N24A 4ANKA 3AY4A 1UJ3C 1CYGA 3B2MA 3NBNA 1CCZA 3HE7D 2CIIA 3SJVB 2A6DA 5L4JA 4Q9QH 2FNBA 3CK0H 1YPZE 4N5UA 2LW3A 2FRGP 4JFEB 3NPSB 1JDCA 1RIUH 3MOAL 4Z0XA 3UJTH 4LCUA 2VISA 3HG1B 1SZNA 2G30A 4Z7AA 5HD8C 2VR6A 5E2VH 3CSBA 1WDAA 2DDQL 3G3LA 4Z6AT 1MELA 1OSPL 3PPSA 3ZE0B 3SY0B 1QBAA 2YBRB 2FYVA 3ARGC 1SHSA 1PKQE 3EGSA 2WUCL 3FN9A 4FXKA 2YSTA 2OQJA 2E75C 3BGMA 3DSFL 2CO1A 4FQXA 1CLYL 4R90H 2OXGA 1ZHBB 5E6ID 5JPMC 4MMXA 4PJDA 3BEWB 1JV5B 2MHAA 4FCAA 5A43C 1JSYA 2IGFL 4HJJH 2R8SH 3B9VA 3UYOD 1AAJA 4I85A 1I1AC 3F00A 1XF1A 3STBA 2HFGH 4A63A 1Q0YH 2M26A 2FD6H 2RGSA 2R0KL 4NRXB 4W9HC 2E6QA 4MAUH 3QIWB 1FNEB 2HMID 5BZWB 2VDOL 4YDJB 4CADA 4K2UL 3BP6B 1TNMA 3S34H 2HRPL 4OI8A 4XC1H 3ZBMA 2ADJA 1YNTF 5B8CB 3J07A 4ODBD 4NWUH 3JWNG 3SPIA 2ZX8A 5BOZG 1L3NA 4KHTL 4JL1A 5I1EL 4L4VE 3NIFB 5AB9A 3ZYIA 4AYMC 2VMDA 5FUZH 2VW6A 1MUJA 5L8KB 4N2FA 3BSHA 4X6CF 1MEXL 5FYJH 2OCJA 5EUOF 4K8RL 1WAAA 1FG2A 2MOVA 2KHAA 1XCQB 4PUBH 1NIAA 1TIUA 4S1RL 3AU0A 3D0VA 4QHUB 2NSQA 1WFIA 3IMSA 1R1CA 2ZUUA 2BY1A 2YOCA 5TE6L 2BY2A 5CGTA 2LVCA 2BSTA 3OZ9L 2E0PA 2ZX6A 1HU8A 3PWVA 4L29A 2VR4A 3OXSB 1RZKL 3ROOB 3N44B 2ZUXA 3W2DL 5D5MF 4YBHA 1T03H 1OE3A 5BUPA 2UXTA 4TSBH 1TYEB 32C2B 5IBUG 2R2HB 2NY5H 3KG5A 2XRAH 3SDDD 2XQ0A 5KSAC 1JXFA 1MVFA 5H4YA 3ZO9A 2EEFA 5KJ7E 2BFGA 4H1LG 5CSZA 3BQUC 5CJOH 1Y0LA 2F74B 5CFHA 4KTEH 4F7TB 5D6CB 5MERA 3IKCA 3L1FA 3TNNA 5IR1A 2Q8BH 3SB3A 2OTUA 2WWNA 3POCA 1VPOH 3WEXB 5B7MA 3TJEH 4EXPX 2MQCA 3ASNB 4PEEA 1QNZH 3FFOA 1XEUA 5F3HB 3QDJB 2ZOKA 2F7PA 1TENA 2Q20A 3LPGA 2GYSA 5AW7B 4I77H 4CU7A 4YXHL 3EOTL 1WJ3A 2IADA 5IEKB 1RPQA 1F8TL 1T1WA 3WTYA 3QORC 2DYPA 1FG9C 2NX5A 5DD1L 1G7MA 1NCBL 2KBGA 2YXMA 4J3WA 3RL1B 4F7CB 2CDEB 1L9NA 2DQUL 3OGOE 3LZRA 3CTTA 4E41B 3QDHA 3BFWA 3QI9B 3V0AC 5GGTA 1OPOA 2Y1YA 5DZ9A 4B3EA 2FBOJ 3EH4B 1E67A 1YEGL 4GJTB 3EG9B 3X14B 3IFLL 4KOBA 3OKOB 5HHPB 5F7KC 3MGTA 1T6VN 1JWUB 3U7AA 1DN2A 5MP6L 3VFNA 2V5MA 1E5BA 1RQ5A 2CIKB 2X6UA 3NSJA 5IMLB 3NIGF 4QRPD 3MV7E 3V6FB 5JW5A 2C9RA 4NAMA 3VXNB 1IAOB 2DWSA 3U7WH 2X9XA 3QCUL 4KY1L 5LXVA 4F37F 2R69H 3IGKA 1NCCL 1I1FA 1EHLL 5ID1A 2GTZA 3LS5H 3RDTD 5IJBC 3O41A 5GS1B 2WBJC 3V4VB 2ISDA 4H2AA 4JVPA 4XN5A 1GKOA 2RALA 3AT9A 2ICCA 4JPKL 3ILDA 5GRUL 3VXUB 4ADIA 1E40A 1ZSDA 1SEQH 2VLRE 3LZFH 4WEMB 1E6OL 1E5UI 1AYOA 2ZKHH 3KPRB 3CXFA 3PABA 4BQCA 3LKQB 1WH0A 3EHBC 3HUJA 5AKVA 1T7XA 1K72A 5G5DB 3MRQA 1DL7L 1MAML 3VU2A 4HHAA 2UZIH 3SCMC 3FO0H 3WXWL 1UXSB 2R9HC 2F5AL 2ZIDA 5D2LE 3DROA 4H7VA 3QAQA 5D72H 4AMWA 3JBG7 1P0SE 2UWEA 3O0LA 5BRPA 3G6DL 1JHTA 2VXTH 3ZDXB 1LO0L 2WLLA 3P11L 5F9JB 5TTRA 3ZMNA 3T0EE 1SVBA 3QDMD 4M6OH 5BO1H 2NR6A 4DGIH 6FABH 5I1CL 2ITDB 1O9WA 4M5YL 1A7RH 1PCSA 4Z7VA 1QWNA 3AREB 4IU3B 4JM0A 4F8PA 1E5ZA 2DYSB 3KHOA 2P46B 4NPYB 2DBLH 2AQSA 1V7ML 4KROB 5G55A 1B2YA 4V1DD 3SJVA 4UOZA 4PV1C 5B21A 2B1HL 3HR5A 4JKLA 1JZIA 1BIHA 3BZFB 1REIA 5AVRB 4LPUA 4Q9RH 4WEEA 4JDEA 4PRIA 1DVFC 3LN5A 4X7EC 4Y16A 2G5RA 2WKGA 4YX2H 2JCCF 1DVSA 1RZ8B 4N9OB 3IT8D 4DOHE 2ZAGA 4M6NL 4ICWA 2QQKL 3TJPA 4AX3A 1CBJA 5CF3A 5AWNH 1JYWA 2VXSL 2YC1A 8FABB 2ATAA 3VFWB 3MLSH 1T1YA 2ZCKL 1QMUA 2PWHA 3VYPA 2BS8A 1G9ML 5CN1A 3PL6C 1XGQA 1ZHBA 2PMZA 2XKNB 3W3BA 1NDTA 3BEWA 4XN1A 1WFNA 3H3BC 1OF0A 4AJVA 2ADGB 2GI0A 3WYRA 4E2OA 5C1MB 5JNYA 1SXNA 3KEHA 2J8UB 5JYMA 1W8OA 1IGCL 1OK0A 2DIJA 1L9SA 2FT6A 2VSKB 2HG5B 1YMHB 4PJBA 2GJ6D 4ZS6C 3QIWA 1QYGL 1FNEA 4HUVA 5FA4A 5BZWA 4M5TA 3T3MB 1WGVA 3IJSA 3KYOA 1KT2A 4YSAA 1ZANH 2YUZA 4BH8A 2DY2A 3IU4L 4R96B 4QXTA 2J4WH 3RDJA 5HTSA 2BS71 1TJIL 1ACCA 4F8NA 3MRFA 4YSPA 5B8CA 3C2SA 4O02A 1CD1B 2WINB 4FAAB 4R26L 5I0YA 3MBWB 3TT3H 3UG5A 4Q6IA 5TF1H 5GGVH 4RAVB 1JCKA 3HC3L 4MAYD 2KQNA 4XE5B 3DIFA 1VENA 3AACA 3HVDA 3LY6A 3IXTB 4P2QD 5A6MA 4KH9A 2E27H 4UT9H 4A67A 1IJNA 4PRID 1X6LA 4QHUA 4E9YA 2R15A 4XBEH 2APBA 3CFCH 4U6YA 1JVOA 2WB7A 4RZKA 2PP9A 3NH7L 5I66A 1W72B 1T0MB 3OXSA 3IGLA 3OZKA 2C8NA 5DJZB 3RTLA 1BVLA 1J05A 1WHPA 4HGWB 3ROOA 4UT7H 4N2EA 1LO3L 5HHXH 1G7QB 4R0LB 5AG8A 5KBMA 2KPNA 3HZYA 3QIBB 3LKRA 2VAAB 4FFVC 4ODHL 2IDSA 2WN3A 2X2HA 3K91A 3V6ZB 2Y7OA 4K94C 1V10A 4PJ9C 2R2HA 2VLMD 4QJ3B 3SBRA 3WKMH 5L4MA 4Y4FC 2H1XA 1QWUA 2IPTL 2YK1H 4OJDH 2F74A 3DX2A 5AW8B 5DD3L 3WO4C 4F7TA 2XN9E 3GS7A 2Y1VA 3KJ6L 4XMZA 1RPKA 1JNNH 1TJXA 1BBDL 3I74A 1OF2B 2QTEA 4IS6B 3IDMA 1FJ1A 1SFHA 3BIKB 4LB8A 5I28A 2JMRA 1KGJA 4EBQH 2X4QB 4GMTH 2AJSH 3T2NH 3I6KA 4FZ8L 2NQCA 3MZTA 3QDJA 1H3UA 4EUPH 5FUOL 3AQZA 1YCSA 1X4XA 2F53E 2ZOLB 4PRPE 3UJJL 5JW4N 3AVEA 3G6JE 5A2AA 2HT4C 4WFGD 4F91B 4E0RA 2DIEA 4UQAA 3U46A 3SE4A 3RL1A 2CUIA 4F7CA 3HPJB 2R29L 5TK2A 5CMAB 4NZJA 4BH7B 2I60H 2J8OA 4IRZH 1SDDB 4QD2E 4E41A 4LU5H 2LLNA 3QI9A 4X6DB 1B9ZA 1P5UB 2Q87A 2K70A 3D4GA 1WC7A 5CINH 4BWTA 3Q06A 3KXFB 3FRUB 1RKRA 2W60B 5HHPA 4OVVA 3PG2A 3QYNA 4LSUH 3F7QA 1HS6A 2BH0A 3B8YA 1BWWA 3GHEH 1W6LA 2IH8A 4XVJH 2CIKA 5IREA 5IMLA 3V5DB 4OLZH 3V6FA 4CSZA 4OZIF 4AJ0A 4IKIA 4G6FD 1IAOA 2P49B 2OMTB 4AGMA 4ZMAT 1MCNA 2XPGB 3WIAA 5ANHA 3AJ7A 1XF2A 3L8QA 3OPZH 5GS1A 3V4VA 3RVTC 4F9LA 2F8IA 1FZOA 3A6CL 4JO3L 4P2RD 3APDA 3F84A 3HC4H 3F85A 1D9KB 1HINL 4JFSA 5ESVA 4NQVB 4RMVA 3LKQA 4DVRL 3ALXA 2L4OA 2XBZA 1U58B 3FH5A 4QRAA 5AENA 2LAAA 1CGVA 2AJXL 4N0YH 4HAGA 2YN3A 5IJKA 2OMXB 3APFA 1IC7H 3VGDA 2DS4A 1SLWA 2MTAA 1MW0A 4CC4A 4JB9L 5M7QA 3TEYA 4UOJA 5HYSB 1W0YT 2H2SC 4Y9FA 3IDXH 4N1CA 4I2XA 4YHOL 4BK5A 4EUPG 1NIDA 5F8RC 3DPDA 3R18A 4YHLL 2ITDA 1TU2B 5ICXA 2VERA 2ZONA 1NCAH 1KBPA 2AS5M 1ES0B 2XNAA 3AREA 4XMVA 4YNYB 2B3IA 1THAA 1NOAA 5G4OA 2NY1B 5D1QD 4O4YH 5LNGA 2BX5A 4YPGA 1NAKH 3QJSB 3D85A 3I02B 4Y8DC 4PJGE 4RFEA 3UAEA 2WWKT 5J06A 3D3VD 5T1KD 4F8OA 2P80A 1LK2B 3F6JA 5E4AA 4J3OF 4M1GH 3IPBA 1NJ9A 4MMZB 1RZ8A 1XGYL 4Y4HB 2G9HB 4YDNA 2VC2B 1IC4H 3K2KA 3RUGB 3QUGA 8FABA 1LILA 4ZMOA 3KLAB 5HGAB 3VFWA 3ZKMD 5IB2B 5DJ0A 2PLTA 4QOKA 3TGXA 5EZJB 3LOWA 3IFOB 2J44A 4KXZI 1NFDA 5DS1A 2XKNA 2YQBA 3OJVC 4HD9A 4NQSB 5F7NC 1XH1A 5KZCB 2ADGA 3DX7A 1SQMA 4GKNB 3HI5H 1X7SA 4JRFA 3TH3T 1D5BA 2ZWNA 4ZOBA 1FPTH 2Z7ZA 4QHLB 4ZTPL 2IPKB 5FHAL 4AVJA 3G5ZB 2HG5A 3CQPA 4KI5F 4Z7UA 3WDHA 3IM1A 2A6JB 4ACTA 4G8FA 3W9EB 3O2DA 3QXTA 3SDYL 1KZQA 4R96A 3HB3C 1ZEAH 1ZVHA 3ZIMA 4UDTB 3W0WE 4DEPC 1U8MA 4NO3A 1YMMA 1DBMH 4A7SA 1Q1PA 2QEJA 1CBVL 3UTTD 4K8RD 4RAVA 2N7BA 3GJEA 1A6ZA 2R0LL 4KU1A 1Z2KA 4OLXH 4WTXA 5FDWA 1J1OL 1UKSA 4HPHA 3RNQA 1KGIA 1BEYH 2HLFC 1BD2D 3N9GH 3TV8A 3WIFA 3VG0L 4YC2B 1TVHB 3B43A 1IBGL 3DGGB 3QIUD 5A2LH 2XXCB 2FJUB 3CFBB 4YXKL 3U36A 3LHPL 1ORSA 1VFMA 2OS7A 3HZ3A 4LPVA 2DJMA 3LX9A 1RI8A 4UANA 4HZ1A 2YD3A 5DT1L 2YOAA 1T0MA 2JFCA 2W9LA 3OMNB 5E8DH 4OH2A 2KS0A 5CILL 4MZRA 4BM7A 1ZT1B 1JI1A 3QC6X 4HGWA 3SKJH 2BNQE 1MQKL 1G7QA 1EAPB 3GK8H 1E6JL 4HUCA 3L13A 3QIBA 4P5MA 4Z7WA 3NFNB 1CVRA 4ZO6A 2B3RA 1AP2B 2V9UA 3WMSA 2G2NA 2ADFH 1HCYA 1ICTA 2C4FU 5AUMA 3JWOC 1MNUH 3E0GA 2Q7YA 3N42B 1RURL 1WITA 3QQ3A 5DK2B 5EBLB 5JPNC 3MV9A 4OT1H 2PO6B 3MRIA 1KENH 4BZ1L 4FZEL 4Z7QF 1SY6H 5B1BB 1H6UA 5DU7A 1Z5YD 3OR7B 1N68A 2X4OB 2NY6C 3RNKA 3G08B 1OTTC 5E1IA 2X3AA 2QQLL 3GRBA 4JRLA 2P24A 5TE7H 1BYOA 5DXWA 3WTSA 3FN0H 2VB5A 3PGFL 2VR7A 5K9JL 4FCHA 4G6KH 3VMPA 1JPSL 1BHGA 3QDGE 4M1CD 3EO9L 3JXAA 1F18A 4QUOA 2BWIA 1QVOA 3K8LA 4HKXA 4UTCA 5DVKA 3GXDA 5C09D 3WKPA 4Z8FH 1U92B 2W88A 1RFDH 3HPJA 4TNVK 2APFA 3VXRB 4PJ8B 4I88A 2XN0A 5AOJA 5DQ9B 3REWA 4X5XB 2MNWA 3K4DA 3T08A 1BAFH 1UXLA 2ZKMX 1HL5A 1SDDA 1RSYA 1WS8A 3FUKA 5LDSA 2I7SA 4B9PA 4X6DA 3Q43A 5E2TL 5FFOA 1P5UA 3L4XA 4G71B 5BXFB 3CHSA 6CGTA 5K59E 3IVKA 2IVFC 3KXFA 4LLMA 2QR0B 3FRUA 2MCG1 1CE6A 2W60A 1GKEA 1B0IA 3ABZA 3QR1A 4AMXA 3O9WC 5BS0D 1N0LA 2AJYL 3V5DA 4H26B 4I3SL 5E5LA 3NGBB 1OTSD 5DCCA 4N68A 1SHWA 2OMTA 3BDXA 3FTZA 4XOAA 1MFNA 5D7IB 2DQGH 5E24E 3MRMB 3PWJB 1QEWA 3QQDA 4FQJH 1UOWA 1WP6A 1GC1C 4PI2A 3ARUA 3T6WA 2ZWZA 4KUCF 5DQJA 4PGDB 4DTGH 1NKGA 4KK5C 3DI2B 2UXFA 3MA9H 2BIMA 1FL3B 1DN0A 3LKPA 4IK6A 2HVJA 5I1KH 1E9QB 4G59C 4WUKH 3IB4A 3QUMH 4RFOH 3I6GA 1MCEA 1C7SA 1ETZB 5DSCB 2OMXA 1EAQA 1IE5A 4HWBL 4X8XA 4JE4B 4PG9B 2Q6WB 1XFPA 4GINA 2R2EB 3UZEA 5E9DE 3CZFB 5EWIH 4DQOH 3DUSB 4PBDA 2R56H 3S88H 4E42B 1UENA 1TU2A 1UA6H 3SO3C 4ETYA 5JW4M 1ES0A 1BMWA 3EDDA 5T3XL 4PP2B 1MJJA 3ARSA 1RHHA 5DEJA 3MXWL 2BVQB 2C3XA 2ZUWA 1WS7A 2DQIL 5IROC 1R5VB 3RIAK 1X7QA 3ENEA 2CBOA 5CKGA 3VDAA 1RZIA 3UC0H 3WNPA 4XPBL 4FD0A 1KY7A 3N41B 2G9HA 4Z77A 1V3JA 1H6EA 4NQCA 1X3DA 3B5GA 1O6SB 2XVKA 2E7BA 1VF5C 4J6RH 1MF2H 1FYHB 1EBPA 2Y2YA 2PTVA 4S1SL 4YSCA 5IB2A 4L8SC 4YFDB 2OW6A 3INOA 1MHEB 2IV9A 1RUPL 1R19A 5D55A 5AOLA 4OZHA 4RIRB 4JZJC 5KSBE 5E8OB 1LEKB 4JAMA 2WLIA 3LH8A 2LABA 4GKNA 2ZAHA 5B3NA 5D7KE 1J8HB 1KFGA 5KYXB 4BSWB 1QLRB 1N67A 3CDFA 2IPKA 1Z6JT 3G5ZA 2ERJC 3DC0A 3F7YA 3WNNA 2WM0A 2ZXEB 4OGYH 4R4BB 3SGKC 3V0DA 4G9FE 3ES6B 4DEWA 4F2MB 5GGRB 1NMCB 1PY9A 2BP0A 2DM2A 4UT6H 2FATL 4ZSOB 4ZXBB 1RJLA 2WTRB 3UBXI 2IDCA 1MFMA 2O4EA 5D1ZC 5B1CA 1T83C 1PLBA 4UNTA 1ERNA 3OQRA 1LEIB 4UDTA 3JVGC 2IAND 3AADB 3PREA 4R2GB 4WK4B 5E7BA 4DP9X 2XY2A 2WLYA 3STLA 3BZEB 3H9SE 4W81A 3K2IA 2R29A 1WV7T 1JK9A 3KS0J 4OUUA 4PY8I 5EZLA 1X9RA 5FAAA 4IBZA 3L2NA 1ASPA 2VR8A 2YAQA 2YQ3A 2CR3A 4K7PX 1QA9A 2UV3A 2PYEA 1WA2X 4E9WA 1R0AL 1TVHA 5GS0C 3CFBA 2E8ZA 2BWQA 2R23B 4L5FE 1DSFL 4R4ND 1KB5H 4U1GB 2LU3A 3AGVA 4GS7C 2EYSB 1D2OA 2FAUA 4Z7NB 4Y1AE 3T0BA 5EU6A 1UD2A 1GZQB 4OLUH 3OKDA 1BMZA 4E68A 1EQWA 1BG9A 1S4IA 2HUEA 1E28B 1SDYA 1TFHA 1EAPA 2O5YH 2YD4A 3DA0A 3MOAH 3MRDB 3O8XD 3FHQA 3NFNA 5A40E 5L2KD 3D30A 3EAKA 2DDQH 5ITBH 5KVDE 3DXAA 5B38A 1T7WA 2VZ1A 5FK9A 4PRHD 4X5QA 1L0YA 3PY9A 5EBLA 5DVOA 3S3SA 1MWAB 3KPSB 2VQ4A 1OSYA 2FWOB 2IAAC 2NZ9C 3ARQA 3DSFH 3ECUA 4JFOA 2CR0A 1CLYH 2N3JA 4ZFQA 5F7EL 1I9RL 2JJVA 4O2FA 2NRDA 4LPWA 2A9CA 2YMTA 5CZXD 1YA5A 3K7UA 4WI6A 4XP4H 1EO5A 1BM3H 1GS8A 2YD1A 3UTSD 2X28A 5B22A 3HG5A 4ZD3L 2V2WB 4MTMA 4PCKA 2DWYA 5AKRA 3QCTL 5KYWB 5DHEA 5HHMD 3SZKC 5CD5C 1OCCB 3ARFA 1BQLH 4FNRA 3JYCA 1QATA 1AJ7L 2R51A 4K2UH 1G94A 2GEEA 1U9KA 4DGYL 2LTQB 4ZFFB 4PJ8A 5DQ9A 1K5NB 5CLWA 2B9AA 1W8EA 2RFXB 4AIOA 1MCIA 1AS7A 4FNSA 2VQTA 2FBJL 5BXFA 5JQ6L 3V8CA 2JJUA 1D5XB 5MEND 3TFBA 1CT8A 3C6EA 5HYJE 2QR0A 2X4UA 3NEOA 4HUUA 4ZK8A 4ABQA 3WGUB 4KV5F 4K8RH 4G1MB 4K07A 4MXQC 5KWYC 3HBQA 3HS0B 5HBBA 1G9HA 3ZHLA 1UCBL 4UINH 3FQWB 1PAZA 2J88L 4RA0C 5TE6H 3M1OA 1T3FB 1XO8A 4JZNA 3SKNB 2WYTA 4L23A 2Y9RT 4OLYH 3L3OA 3S8FB 3US0A 3T4AA 3FT0A 4XO9A 5IFAH 1I3VA 1KB9J 3RPKA 1P4LA 4M1DL 3AG2B 2WKOF 3ALWA 4LVHB 3AU1A 4RRPM 3PDGA 4PGDA 4PJ7E 5IW3A 3D39B 3BPOB 3AGWA 2N0KA 1FL3A 4JMNA 4KAQL 3G5XB 2VZUA 1PPIA 1IEAA 2BHFA 1E9QA 2EVIA 4UQ9A 4W9EC 4KHXH 3CZLA 1KYOK 3GSRB 4YSOA 4YIQB 2WO3B 2APVA 1FSKC 1V7NL 1Z0MA 4MD5B 4S1DD 5BZZA 5DSCA 2IBZX 5TJWK 1LVEA 2UYLB 4AQEB 1T7ZA 1XMEB 4LBAA 4WTZA 3GLZA 4QHNB 1JERA 4HX1B 5GISH 2BIHA 4BK4A 2F54E 4OD1L 3O6MH 4WIQA 5I15L 2QVTA 2R2EA 1FFPA 1B88A 1E3FA 4JM2F 4WZ9A 3DUSA 4GG8B 3C5JA 3UGEA 3M1BB 3SE9L 1AD0B 2P5EB 3CX5J 1ZA3A 4NENB 3GXFA 1P84K 4IHOA 2VMFA 5EDSA 4U1LB 2D7MA 3RWGB 2A4CA 1JGVL 5EC1B 3FT4A 4ISVB 2BVQA 2EDQA 2BNRB 5IEHB 1ZHLB 4B9KC 4M4RB 1R5VA 4OKDA 2JTDA 2DQUH 3R8QA 3QZMA 2KKQA 2X10A 3ROLA 1K4DB 5LAPA 2FT7A 3ZPDA 1ID5I 4GIOA 3BHBB 4A55A 3WFBH 3NEEA 4EI5B 1O6SA 5INDA 4AKPA 1YEGH 3IFLH 3MTRA 5HHQB 3J27A 1VIWA 3D25B 4XMPH 5MP6H 4GUPA 3CH1B 2FTAA 4XRCB 1MHEA 3V0WL 4CVXB 3HE7B 3LJ3A 3WDJA 5EC2A 1LEKA 4G43A 2F7OA 2HLAB 4JE0A 2MNUA 2DQTH 2OSLB 1EHLH 1NCCH 3RZWA 3RP1A 4JN1H 5KYXA 1UXMA 4IKJA 4NQDB 5J11B 4M93B 2QPUA 2FJGB 4N0CC 2XWBB 2YZ1A 3T0AA 4OD2A 3BRFA 1OTUD 4RNRA 1SVCP 4XNYL 4H20L 4UV7H 1LQBC 1O7SA 4AT6A 4X4KA 4ZXBA 5E08L 2WTRA 5ETUA 2QJDA 2Y24A 4F8TA 5E6YA 2PPAA 1AVAA 1DL7H 4L4TB 4N8CL 3JWDH 2X05A 1SBBA 1LEIA 3VFMA 1D5IL 2F5AH 2DI9A 2M1KA 3SBQA 4GBXC 5GQBA 4KVCL 2UX6A 4RQQA 4P2CG 3G6DH 4QO1A 2X0UA 2YPLA 1BQHB 2XV2A 1LO0H 3HBGA 2LFGA 4N8VB 5BRZB 2D0HA 1J88A 1INQA 4G8IB 2BSSB 3EFDH 2CBTA 5LWYL 1LHZA 1GMIA 5HGGS 2W91A 4YSEA 4FJYA 4NQEE 4NT6B 4G8GE 1KJVA 2LFEA 4RWYL 1J0YA 4FXLA 2G3ZA 3EO0A 1S7WB 4LASL 1V7MH 3HVNA 3MRRB 4J3OC 3TVMD 2B1HH 2AQNA 2XQYA 3IDJB 1W0WB 3TS8A 1JGLH 3P3UA 2IFGA 1E28A 1WWWX 3GLAA 5KANG 4A38A 3NACH 4NZRL 1FNGB 2P44B 4Z3IA 1JFHA 4M56A 1A6WH 2QKIB 3BLKA 5IBLC 3HNSH 4M6NH 1DFBL 2QQKH 5DC4B 3TBWA 4L8DB 2AQPA 2VXSH 3CPLA 3MACH 3JUYA 4LLQA 4G5ZL 1SN5A 1MWAA 1YN7A 5F7LB 2D8KA 5AZUA 4HCIA 4NRZB 2AJZB 4KK9C 4GKOA 1D7BA 3AXHA 4JKPL 1P7QD 1AGCB 5D7LD 2Z7UA 3HCVA 4HDIB 4KI5C 1KLUB 1YYLH 4V2BA 4L9LB 4XWOC 4U1NA 1E5CA 1A1MB 4HWBA 3C2AL 1IGCH 2MWCA 3SDDB 4HUWA 5DJ2B 1KXQE 5F7MC 2L0DA 3ZT6A 1KEML 1QYGH 2QHLA 3QWRA 1AANA 3T0EC 5FV2A 2K8MA 4KXAA 1KV7A 2O72A 3WTTA 3NJJA 3U30C 4ELMA 3K3QA 2YO3A 4G42B 4NCC2 3GB7B 5J1SC 2VRQA 3PXJA 2YGOA 1FF5A 1HL9A 1K8IB 4O5LL 2QV2A 3D4ZA 2W59A 4Z3EA 2X89D 4YGVA 4TUJB 4NP9A 4ZUSA 2V8LA 4IMKC 1DVQA 5D7JD 5C0BD 5I6XC 3SGEI 1QHOA 1A7QH 1KXTB 3QUYA 4ZPTB 2XQYK 3V6BR 3SPHA 1QUNA 4X6FB 2Z1KA 2WAHA 5F72S 1FBIL 1GSMA 2YD0A 5T1LD 3MZGB 1E3ZA 4WFFE 3SKNA 4HALA 1Y6NR 1A7NL 1GOHA 3QFGA 2XZCH 1J0ZA 1K5WA 3JV0A 1LO3H 1TTRA 2AZAA 1QRNB 1ETB1 2ZKXA 1B0GA 2OPCA 4N0FB 5JHDD 1IGFH 1UCTA 4ODHH 3VRLE 4YVNA 1PNCA 4P23D 4Z7OF 2R1XB 5CJXC 1NPJA 3O0RH 4JHUA 2DWEB 5EO1A 3G5XA 2V7HB 4WI7A 4AL8C 1S7RB 3GSNL 2GABA 4GY4A 2FX9L 1C5BH 3GSRA 4YIQA 5T3ZE 1KTKE 2WNKA 5IG7A 2VN6A 1QBBA 3U4EB 1E5AA 4GLRI 3KJ6H 4RZCB 3RDTB 1BBDH 2UYLA 4AQEA 5C0EA 1T5XB 4HX1A 2EIMB 1F41A 2CDFA 1VCAA 5CLZA 1Q0EA 4BZYA 5MI0B 2A9AA 3L3HB 4L0ZA 1MHHB 3NSDA 4FZ8H 4J8RA 5T3XD 3RZCB 1DJHA 5C7XL 3P0GB 4YHML 1KJMA 3V55A 5C86A 5LGKA 1VB9A 4KRMB 5FUOH 1HHHB 4QRUA 2EKSB 4NENA 1V27A 3GZKA 1X5KA 1XB3A 1XSOA 1K8DB 4K5MA 3UJJH 4KZDH 5J89A 4LXFA 3RWGA 5EC1A 1CB4A 5KVFE 1BIIA 3QG6A 3WO3B 2PW2A 5L9DL 2BNRA 2YKKA 4FFTA 1ZHKB 5I1AB 4PV9B 3A6BH 2YUVA 3BPNB 1XGZA 3VVVA 4ONGL 1H0DA 1K4DA 1JS4A 2ZT9C 1JYNA 4UZSA 2YMOA 4JREC 4XXCC 3RY6C 1XAUA 1TQTA 4M6ML 4ABWA 4AQAB 2P3YA 3GIVA 3I9IA 3QDMB 4WNSA 3ZDZB 2DM4A 5HI5C 2IOIA 1KNOB 4D8PB 1KPUA 3MYZA 1ZK5A 2H32A 4LKXB 2GTQA 3TA3C 1G7LB 4DFIA 3BKML 3OZLA 2RCSH 4TVSa 4X4MA 5T33H 2NW2B 4V1DB 3GPEA 4L3EE 1AHKA 1MVYA 2HLAA 4C56E 2A4EA 1Y7VA 4YDIH 3BVVA 3R8BB 4NQDA 1S7TA 3FCSA 5CS7A 2DQEL 1CXEA 4OFIA 1PU0A 3FQNB 5IJVB 3A6CH 4JO3H 4L4JA 1PZUB 4W9ZA 2XWBA 4NOFA 1EFXD 4P5SA 3V4UL 4LCIL 2YSSB 2VM3A 1I8MB 1JXJA 3V52H 5D1XC 3JT2A 5CHNB 5F7FA 3BMWA 3U7YH 1BQSA 3GTNA 4L4TA 1AS8A 1NPUA 3FDWA 5FCSH 4DVRH 2PWEA 2I27N 3OKKB 2A9NL 3DV6B 3GBML 1L6PA 2RIKA 4NCDA 5DEZA 5HD8D 3F3HA 4X98B 2Q8AL 4I0CC 3FTXA 2ZE0A 2XTJB 1SJXA 3ETBF 1UVQB 3RWEB 4JB9H 1H5BB 1EEZB 5LBGA 1S3RA 2PWDA 5BRZA 3QJUB 3ARGD 4XXWC 2BSSA 3FS9A 5JO5B 2FQGA 1YEJL 4PSPA 1U3HB 3WXVL 3T4YB 4BQBA 4M7LH 3AQDA 2J71A 4X9IA 3RFZB 4DP8X 3MV01 2YUWA 1S7WA 5B39G 2OYMA 3FQRA 1OAUH 3MRRA 4HCRL 3VYOA 1I1AD 4H8UA 1OE2A 4PJIF 2R27A 1TTFA 4PMFA 2V6HA 4MDJB 2VN5A 4MAYB 1FNGA 5I71B 4PG2A 4HAKA 5DC0A 1XIWA 3HMXA 4PN6A 5KVGE 3Q2WA 2WZPA 8CGTA 2Z4TA 3BISA 4PHXA 3TXAA 5HDBE 1QSFD 4L8DA 5C6PB 1HK6A 2FSDA 3A5VA 5L6YH 1ETA1 4M8UA 1SNRA 2UVEA 2AJZA 5C0AE 2IXQA 2DLTA 4I4WA 3F12B 1P53A 2AXWA 1WFMA 3C08H 4NDMB 3D0LA 4HDIA 4QCIB 4XC3L 2Z9TA 4LLYB 1U8HA 1Y1UA 3BN3B 1KTDB 2DWDA 3B9KC 3E3QC 4L9LA 4HBCL 4Y2LA 5LCVH 2HJLB 2DEWX 1IKNC 2IF7A 3N04A 1BP3B 3CSTA 3QUMB 5DJ2A 5FHAH 5B38G 2EE6A 1RLBA 5FECA 2IFFL 2CXGA 4I18C 1L5GA 2F68X 1RXLA 3SDYH 1BZOA 3DOSA 3QA3A 5LG6A 1H3TA 1AYRA 3MLTB 2EDRA 2WWOA 1FV1B 2Q3AA 3SPJA 1J1XH 5D93B 3VWJA 1DUZB 2XV3A 1WZAA 1JMXA 2ZPKH 2J6EH 3ULUF 2BZ7A 5JHBA 3U83A 3L45A 4PWFA 1PYWA 4GKZB 4ZQKB 1HL8A 4QXWA 5KSAD 1J1OH 4TUJA 5FFLA 3UTQB 4HS6A 1VAHA 5FGBC 5FWRA 2XCMC 3BQUD 4X0KA 3VG0H 4EZMA 4ZPTA 4OIIL 1XTLA 2YLHA 4YXKH 4X6FA 5J13B 3JWOL 5DHVA 3LHPH 2EXWC 4U3SB 5E23A 2AABL 2YGQA 4HMDA 4I1PA 4S0HA 5JHLA 5CILH 1A7BA 3CU7A 1KYFA 5JDJA 4LP5A 4F20A 1OV8A 1QRNA 1E6JH 4HWZB 3T6VA 2RTTA 1P7BA 2ZP0T 4J6IA 3SGEH 2WQUA 1IGJB 4FEIA 4N86A 3PP4L 1JUFB 1SJEB 2DMCA 4FFZH 3QORD 2DWEA 4Y4KC 5EU5B 1LK3L 1HSBB 2WLNA 5F7UA 1UWYA 2HTKC 1RURH 4HW6A 4ZBJA 1OZTG 4X7TB 4JFVA 3RVXC 4AK1A 1PFCA 4HFWB 3C09B 4JY6B 3U4EA 1KG0B 4Y9EA 4C54A 3VFUA 4JGUA 3UCQA 5E6RB 4OCMC 1A4CA 1T5XA 2Z8VC 1I8AA 1YEDA 4FS0A 4XP6L 1S5IH 1MLBA 3QQNA 2C7FA 1MHHA 2F61A 2V37A 3RZCA 3DJ9A 2H0FA 3QZNA 4ZMZA 5ILTH 3MXVL 5LQBH 1ZS8A 1J9TA 3REVA 2QSQA 2EKSA 2IEPA 3FTUA 3PGFH 4GRLC 1NC2D 2ALWA 3F04A 3PP3H 2B8OT 1JPSH 2MOQA 3EO9H 1SYVB 2KZBA 3RI5K 4GLRH 2HG0A 3B6SB 2HN7A 4JQXA 1DTUA 4N25A 1ZHKA 5I1AA 4OJEH 2CNZA 3KJ4B 5K5YA 4WTZG 4JPVL 1KIQB 5D7EA 2WBJD 1FFOA 3LXAA 3FOLA 1MFVA 4F5CE 1JWSA 2CAKA 3KDMB 4PJHB 3TM6A 3HUJE 4JKMA 5EORL 4ENZA 2XN2A 4FYRA 4F1ZA 4JFWA 1KB5B 2MRYA 4HETA 3EHBD 2CJSA 2IPUK 1CTNA 5DS8A 3MNMA 3WS6C 3ZHKA 3ML9A 4LKXA 4HC1L 5BO0D 3SCMD 2R9HD 1N8ZA 2ZSVB 1A4BA 2NW2A 5D1QB 5DGQA 2AJYH 2WLHA 5F1IA 5T5FH 3QXWA 5J1AB 2B15A 3ZDYE 1MY7A 2BW5A 1YUKB 1CL7L 3MJ7B 4EDWH 2D7TH 3AWGA 3D3VB 2B14A 2Z35B 5T1KB 5JZ7C 1BOGA 4AENA 5I6KA 1NSNL 4XCYA 4ZW7A 3IJHA 2ZXAA 4BBWA 4GXVL 2KC0A 1U36A 1XF3B 4RGNC 3SJVE 4UAOC 1KTLA 1G9EA 2AP2A 3LIUA 3MRHB 4F7EA 2YSSA 2HX7A 4JFEE 5F3BA 1I8MA 5HJBA 1IKFL 1M1XA 3HG1E 3TO2A 2IH1B 3QP3A 4HJ0C 1AKPA 2YJLA 5KS9E 1MCWW 2W38A 5B3SB 3IN0A 1S46A 2BDNL 2JKTM 5C3TA 3QT2A 2H3KA 3AS2A 2WLZA 2FEDC 4JM2C 4A7VA 1DVFD 3GSVA 3TZVC 1XR9B 4X98A 3ILQC 1UXWA 1LP9B 3QZWB 4NBZB 5D4JA 5SX4I 4XMUA 3PJLA 3QZOA 4LOFA 3A22A 3LHAA 3ZK0A 3WLWD 1F3DH 3NCJL 4PWJA 4F24A 3DLQR 2PP7A 1U3HA 2VDMB 4S1QH 4B0MB 4PBXA 3PL6D 2BSBA 5AFAA 3ZW3A 3RFZA 5I6OA 1CC3A 3MXWH 3G6AB 3NZ8A 1ZDSA 3PS6A 4FLRA 1T04B 3PJSB 4KJYB 1KJ2B 5CEZE 3BE1L 3RTQC 2AEPL 3CDGA 4FF9A 3UTTB 2AMGA 2ARWA 4JPIB 1KGUA 2ATKA 3C6LB 3W5NA 1DBJL 1IGML 4ZS6D 2D03L 5FGSA 5J6GB 4H88L 1YNKH 3NIDB 2A9DA 4F27A 1BD2B 2MSPA 2X42A 4EN3C 2YKLH 1GMEA 4WW2A 1Z1WA 3B5HA 2E9IA 2QGEA 4OY9A 3THML 4U7SA 3U2SB 3DTUB 4XXDB 4YHKH 3NIFE 5E1AB 3LTVA 1MW1A 1L6ZA 1MDAA 1ZJBA 2XQYG 2HFTA 3MRGB 1UURA 1WBZA 3SYQA 4FNPA 4K71C 4NDMA 1HN1A 1E4HA 3L9RB 4LLYA 1QAWA 2DLFL 3LKSB 1T2XA 2MJWA 4HJTA 2C3HA 2HJLA 5CSBA 4TL5A 5KEZA 1JPTL 3HTLX 4IIQC 4QIRA 1R3LB 3UBHA 5ACZB 2XETA 1HHKB 2EXSA 4AYDC 5FS5A 3J8F7 4MJ6A 4BK8A 1BX2A 1AR1C 5GS0L 1XXFC 4DIXA 3ZTNH 4ZW5A 3DK2A 5FYKE 4LCCC 3MLTA 3S97C 1FV1A 3NCXA 1JOIA 1SM3H 4RGOL 3RJQB 1UB5B 5I0VA 1G9NL 4JKKA 4J3VA 4PJDF 2AJVL 4FFVD 3I9AA 3IU3A 3NCYP 1U42A 2CQVA 5CGBA 1OB1A 4KKQA 4PJ9D 5I5IA 1YYML 5MHSD 3M7FB 1TQCC 4YLCA 4KNQA 4Y4FD 3IDNB 3PHQA 5ESQB 4OCSL 3FZUC 2KZWA 4HKBB 1YEEL 2UY6A 3K6SB 1R0AH 2ZWLT 2NOYA 5AG9A 4Y5XB 5C09B 2ZJSL 3MGOB 1GGYA 2AK4B 3STZB 1DSFH 5I5MA 1FL6B 4LMQI 5IJDC 1AXTH 2CA4A 2Z31C 3P4NB 4NN7C 1KIUA 2GK2A 3KLHC 1QLEH 1L9OA 2EIDA 2ALAA 4EXKA 4ZOCA 4W4OC 4D3CH 1S5HA 3OF6D 4JY4A 4HWZA 2D31B 3VE0B 2W5PA 1JCVA 3FT2A 5ESAB 1JUFA 2HT4D 3ZGIA 3PPEA 3VXSD 5EU5A 2HUHA 5BS0B 1A9EA 5KJRH 3UPRB 1WAAF 1U3NA 3HE6A 3ULSB 4E41E 5JIPA 1A6TB 1VFAA 3FO1A 4QLWA 1HTYA 1RK1B 1UYWL 4JY6A 3BXNB 3K8KA 3O4LD 1PZBA 5AAMA 1XMWA 4UCFA 1FNSH 3QEUB 3BPLC 4APXB 1CICA 1EIBA 3VFSB 3PWNB 3R0NA 3E8UH 3WJJC 3T09A 1AQHA 5IHUH 5IQOA 3QEQD 2AEWA 3NCWA 1DEEB 4WI0B 4W6YB 4LQ1A 1HKFA 5EA0L 1FVDA 3D09A 1LNUA 4OVUA 3QCTH 3RVVC 3ARZA 5C0RL 1SYVA 2AAVA 4TNWK 5DVNA 1P6FA 4DN4L 1V3KA 3MNDA 5BW7A 5HHOD 1B6DA 1QPXA 3GKWL 5AB0A 3DO4A 3VXUE 3JWNC 4CSTA 4DGYH 4FN0A 3OQ3B 1ZT7B 3WAKA 4XPGL 2H1LM 4LPCA 1ZLSL 3RVTD 3UBXB 3KPRE 4HCRA 5ERWB 3WN6A 5FO8B 2GEQA 2VJ0A 3KDMA 1HHJA 5EF0A 3O6KH 1FA4A 2FBJH 3ARBA 4AYID 2LVEA 5LAXA 1BPVA 3B3IB 5KOMC 4MNQE 3N1PC 3ULVF 3TBSB 1G4RA 2A74C 2BJML 4PTUA 2V0AA 1VGEL 3M17B 3ZDXE 5FPIA 2Z7YA 35C8L 1QNIA 3OLGA 4PS3A 5GSVB 1UCBH 1S7SA 1PG7X 4AEIH 1C9SA 3GRWH 1N3NA 3TF7C 2Z1PA 2J57A 3OM3B 2CM5A 4ZS7L 1A9BA 3SQBB 2OULB 2H2SD 3MNWB 4IJ3B 1FZMB 4YBLB 2JQMA 3I75A 4P46A 3QO0A 3GZQA 2A77L 1EBAA 1WZ1L 3FU7B 3N1QC 5MEPB 1QSED 3U9PL 1A1NB 4FNQA 4MNGB 5IVZB 2GG1A 3MRHA 5A7BA 1QKZH 1CICD 3IJYA 4I0PC 4Y2NA 2J43A 3MBXH 3ZN6A 5DMKB 4KAQH 3HLAA 4B60A 4BFRA 4O58L 1HL4A 4M7ZC 2LT9A 3LXUX 2EO1A 3GSXA 5FKPB 5EO0A 1U21A 5GSRB 4NUMA 4AIZB 1XR9A 1LP9A 2H2PC 4ZI8A 1PS3A 2HRGA 3MNVB 1EHXA 1BBJA 3MHZA 3N1MC 4KX9A 2DI7A 3SE9H 1FAIH 1QPPA 3VXMD 1H8OA 1I4FB 1OCOB 4LIQH 1EZLA 2J8UE 1JGVH 4D7PA 1NFIB 1T04A 3PJSA 1KJ2A 4TQHA 3WL9A 4AWJC 4GXUM 4NGHL 4ZMNA 1OP3H 1T66C 4P5KB 2X09A 5SX4H 1EX0A 1NH6A 2CHNA 3FB6B 2UWEF 3T3ME 2EXYC 4NAJA 4A39A 1PX3A 2V5TA 3RRQA 4JPIA 3C6LA 3ZE2E 2F5BH 5IVOA 4PLNC 2MIZA 1JRHL 1OAKH 4JQVA 1GW0A 2OMVA 5EIIB 3BSGA 4HU2A 3D2UB 5AL0A 1MZZA 4HCGA 4LRIC 4G9DB 5AW4B 1FNLA 2AXFB 2BP5M 3HB3D 3U2SA 4KVNH 4XVSL 2GIMA 4Z7VF 3BN9C 3GMNA 3IF1A 2JI1A 2VOTA 5E1AA 5JYLA 4MHHG 4WW1A 5DZOA 4JR9L 5CO1A 5IP4A 4NNXB 1OCRB 2DPKA 2AQTA 3LD8B 4CU8A 3IFPA 3L9RA 1CI3M 1JF1A 1QTYT 3QE5A 1IL1B 2HLFD 3JSSA 2VO5A 5L2KB 4IM8A 3X1EA 5HDQL 1R3LA 1CGSH 3B56A 3TCLA 4YBQC 4JRXA 1NCTA 2GUYA 5E0QA 3ZE0F 3MBEB 5LXGL 1VGKA 1BF5A 4TQIA 1DDHA 4TULH 1AD9A 4MCYB 4PRDA 3V4PL 1DLFH 4KKRA 1D5IH 1WBXA 2Y7QB 2DKMA 2EAEA 3P9WB 1ET8A 7FABL 3UTSB 1F56A 3KLLA 3ATAA 3UZVB 4HFUL 1EZSA 1PEZA 3NP3A 3OTTA 4HKJB 5CN2A 1KIRB 3AITA 3IDNA 2CKBH 4K15A 1NBQA 3NRPA 4PJBF 1BXXA 2I25N 3OC5A 3T6XA 4Y5XA 2NYZA 2AK4A 3STZA 2NY6D 2PKDA 3WEOA 4ETQB 1LE9B 2CK0L 3L1EA 4Z76B 4MNHB 4F7PA 5FOBB 4PREA 1OTTD 3DPBB 3V0GA 4JW3A 4TUOB 3R1GH 4ZUWA 1INDL 4BFFA 5MENB 3ZSSA 2D31A 5JR1H 5DD0L 4WDIA 5LBSL 3NJNA 5ESAA 1KEGH 1KFAH 4N0UA 1CDGA 4OZGB 3V5HA 1HH6A 4LK4A 1KYAA 1EFQA 2J72A 3CHPA 5MEOB 4QXVA 2P7TB 1A6TA 1LO2L 1RK1A 1TXKA 4GAFB 4K7PL 4L4VB 1OCZB 3ZKXB 5I8KL 2ZG1A 2NY0C 4V2CB 4PS4L 3KXFE 4O2CB 5TQ0H 4JKPH 3LPPA 1ROWA 1UM5H 1ZIBA 4R7DB 2NTFB 3H3PL 1P1ZB 1AO7B 4W68A 4WI0A 1IVLA 3SODB 3H4HA 3C2AH 5D2NB 1LWHA 3O9WD 1P69B 4J2QA 1KEMH 5IQMA 4CBZA 4I5BB 3NPZB 6PAZA 3ULUC 4CMHB 1VADB 3K74B 1IQDA 1ZT7A 2ICEB 3UBXA 4F33A 2AAAA 4QTIH 4L1HA 1RAMA 2IWKA 1IM3A 1UACH 5DFVC 1TCRA 2OTWB 5DEFB 1K6QH 1MAJA 2OR9H 5GRJL 1B3IA 5EIVA 3OLDA 3B3IA 2WLKA 1MFEL 3A23A 4KK5D 5F1NB 2Z8WC 4BFIB 3QUXC 4UU9B 1BLIA 3TBSA 1LMIA 5SWSD 4HUMB 2FIKB 3RX7A 4EIBA 2ARJA 1A2YA 4K94H 1XV8A 1B9KA 2OXHA 3IGAB 4W4NA 5GGSY 5AB1A 4AL8L 1FBIH 2IH3A 1I8KB 1Q9KA 3CHRA 1P2CB 3DETC 3HG4A 2GBAA 2F08A 3HNTH 4Y19D 3GHBH 1DJYA 3APMA 4XAKD 1NDGB 4M43L 3MNWA 4WGWB 3KBFA 4LCYA 3C8KA 3VH8B 3QFJA 4L8BB 5JIHA 5E4EC 3CXDH 4MNGA 1AZCA 5D6DA 3F5WB 4JMXA 2HSIA 3LPOA 1CXFA 3OKLA 4WU7A 1R3KA 2B7DT 1EDYA 2EDDA 3GBLA 3MRCA 4PJAE 3VI4A 3QCVL 3SEPA 1IVTA 1NDMA 3GSNH 4IRJB 4APQC 5IROD 2FX9H 1JV2A 3GM0A 4RVBA 3U0TA 2QVFB 5FKPA 4UQ2B 3RUGE 5GSRA 1DQLL 1ZV2A 5B1AB 4YHYB 3MI6A 4DP1X 1LD9B 2BERA 4JFHE 4OSUH 4YDMA 3BO8B 2F8VA 4JN2A 1L0QA 2X70A 1A3RL 1V8HA 4YHMH 4M7JH 1G84A 4QTFA 1XGTA 5IOKA 1CE1H 2DJUA 1TVBB 4NIYE 3DBXA 4PYGA 1L0PA 4DKDC 1I4FA 4LBEA 3U0WH 3EXLA 3WNLA 4X0NA 1NFIA 3CZGA 4TMPA 2EJ1A 4NO0D 2A1WL 5I1JL 1B0RA 4KNUA 2VLRB 3FB6A 5FYLD 4LHUD 4J27A 4AI7A 2FEEI 4PS7A 1CFVL 4OZFA 2FR4B 3WUZA 1KN4L 1F13A 2YA2A 3D2UA 4PJ5D 4NZUL 2WVTA 5F9WC 3VD5A 4DKEL 5IKCA 1RU9L 5D1ZD 2AI0H 2X2UA 2W9EH 1HEZB 1Q94B 3GLDA 3U6RA 2P5WA 4QGYA 3U6XS 3WBDA 2VQ1A 1UM6H 1DQKA 2ZCHL 3S37X 2WNXA 4CC0A 3W9DB 1R3JB 3CBJB 4G1EA 3DMMC 5BMFL 2DQEH 5GS0D 2DM7A 3IRPX 4YHNB 1MIML 1PY4A 2EH8H 4JANA 3SE3A 3S35X 4XZUA 1YPZA 3V4UH 4LCIH 3MBEA 3VXQA 1XZ0A 5FDYA 4JG9A 5FM4A 1T7YA 2DWXA 1IIKA 5L88L 3ZTDC 3PAVA 4MCYA 2WOBA 4HA1A 3MLXL 4ENEC 1WFTA 3IDYC 3MUJA 3AS1A 2A73B 1NFDF 1RIVH 2I07B 1YZZA 2Y7QA 1FNAA 4TUUA 1GGCL 4UIKH 3CCHB 1M3IA 4WO4B 1PKQA 2ZKYA 5KOVC 1K2DB 4HKJA 4N6QA 3LS4L 1YEKH 2E86A 3V8OA 2VITB 2E9WA 4HD5A 5GGRY 5ADOH 4A66A 1YEJH 4Z7UF 5BOJA 2NZ9D 1FO0L 4MQ7A 3RPBA 5EEVA 5F7WC 3BD5A 4U7MA 4ERSL 3LZPA 5CZKA 1LE9A 3AC0A 4Z76A 1AH1A 1TQVA 4I1RA 4IBWA 1B4RA 2OSYA 3I50H 2BNUB 3V0JA 4GO8A 1C5DB 3AM8A 3LVTA 4TUOA 4PGJA 1CURA 1CU4H 5AVTB 5JIMA 3O6FA 1IC5L 4TOYH 3QZPA 2NSXA 1E4JA 3AZUA 5CD5D 2Y4SA 1TKWB 4XCFL 4DK3A 2OMYB 5D7JB 3VXRE 4TNVF 4Y5YB 1NWPA 3ETTA 1TZHA 1FAKT 3WN5A 1NUNB 3AY4C 4X5WB 3CPUA 2OJEB 1J10A 1SYSB 4JPWL 2P7TA 4GG6B 1A4JB 4L4VA 1DQQB 5E99L 4ZFGH 3DJRA 3CHOA 3VXPB 3KHQA 4R7DA 2NLJA 4XC3H 1AO7A 1GYCA 4HBCH 2M8XA 4HWUA 4HULB 1FLRL 4Z7WF 1T22A 5A1AA 1QPKA 1A6UL 1QRKA 3MCKB 1FGNL 3D05A 4MXQD 4PWEA 4G83A 3BI9X 4FXKC 4CGTA 4FQXC 5D7IE 1HILB 4C47A 1BQUA 2BHYA 2OL3H 4MMXC 4I5BA 4OCXH 1ZA6B 4GUCA 4PB0L 4AJWA 3B1TA 2C3VB 3BLPX 3ZTJH 1JE6A 1WPCA 1AG0A 1CDIA 2ICEA 2XIIA 4D0DB 2P8LB 4AEEA 2Y06H 1PKOA 1YEFH 5C07D 5L7XL 3G7TA 1OLZA 3T71A 5EFIB 5TH2B 1XB8A 4HJ1A 2OTWA 2LU7A 5DEFA 1B4TA 4LNRB 3EJSA 1JGDB 3BYYA 5JLZB 4BFIA 2ZD0A 3L95B 5C0FB 5LGJA 1OD7A 4ZO9A 2FIKA 1I82A 4JDTL 4KTDL 3EJTA 4LP4A 1IILE 3I2CL 1OZUA 3BD4A 3JWOH 1PSKH 1DLHB 4BXVA 2NNXA 3WTVA 3HFFA 2DEXX 3B2VL 1I8KA 4NRYB 4TTDC 3SDXF 5EOCJ 3QNFA 5CZRA 3TFKC 3ZT7A 5SWQB 1HNYA 1F2XK 5F1OB 2VDLH 5ABAA 3EYUL 3HAEA 3EO1B 1MHCB 2XKSA 3S36L 4GXFA 3FB7A 2OAAA 4ZUVB 4L8BA 2P1YA 2CHZA 4OQTH 1FRGL 4X6DF 3KPPA 1YNLL 1FHNA 3DVNB 2OP4L 3MO1B 5FYJE 4OTXH 3RIAF 3PP4H 3VMNA 5IB1B 3QQXA 2J5WA 1EHAA 4ZUTB 4KQ4L 3T2PA 3BH9A 3EIFA 5HGBB 4IRJA 3UO1L 4LRNL 3MLVH 3OXRB 1XX9C 4S11A 4PMEA 2X1XR 3S9DB 4UQ2A 1MCKA 1HNGA 4IKNA 1W0VB 2VYRE 3V4PA 4UILH 1E2ZA 1E30A 1S9VB 2ATPA 4P49A 4PCYA 3D4YA 3TBVB 1JZDC 2CLRB 1IFGA 1IBZA 4RRPG 4MCZB 1XSIA 5L4IA 3MXVH 1EFXB 1FH2A 3MV7A 2Q7NA 4ANWA 5AW5B 3GSUA 1TZAA 4CA4A 3LIZH 1J8HE 4M7KL 5HHNB 1SMDA 4JFFD 2J5LC 1FYTB 3VFOB 2ED7A 2QV4A 1A6VL 5JUEL 2G2PA 4JPVH 2X1OA 2VLRA 4PW9A 2FYYB 4F2ME 3DIVA 5DEGB 5E1HB 4ZSOE 3ULVC 1O6VA 4N0CD 2YWYA 5LNEA 2W81C 2EYTA 4M48H 4NXKA 5F89B 4X4YB 5J57B 2FR4A 5C8JA 2CCWA 3TBYA 1MCSA 3TC9A 4AEHL 2NY3C 2PETA 1GC1H 4ODXB 4JRYB 5D2LA 4MX7B 5LBSA 1N2RA 1QLEB 1L7IL 2GIXA 4HC1H 2XQBL 4P07A 5GGVY 3X3GL 5JPMB 1Q94A 5CZVL 1EANA 2K45A 3CDZA 4GBXD 4PVNA 4LHQB 4BFOA 1FFNB 2F8XC 1I1AB 2PPFA 4XX1G 1R5IB 4NJAL 2YUXA 1PCXA 4EQ3A 4ZTOL 2WVVB 3RJOA 1GIGL 1WAPA 4G6AC 4B27A 1NSNH 1R3JA 2PCFB 4JHZA 5F21B 5IVXE 2SODB 2JKNA 4YH6A 1L3WA 1KB3A 3V0FA 2GAZB 4OV5A 1XBRA 1P9MA 2XX0A 2KERA 4G7YH 3GEFA 4Z7NE 1DZ0A 3OKEA 1R9FA 3QHFL 3QJHB 5CLXA 4PB9H 4J3OD 5C9KA 4R83A 5SWZD 3BUTA 1M2VA 3MNZA 2C4XA 2VZOA 4XNXL 1OSEA 3LNIA 4OZHF 2OMWA 1AGBB 1CFNB 2P48B 3KBHE 1GS6X 4PJEE 1PLCA 4BCZA 3SDAA 5IBLD 4YDVA 1OO2A 1MJ7L 1WWCA 3DKHA 3KPSE 3QH3A 4RISL 4WO4A 3TA4D 4JFUA 3PDDA 2BVOB 3S3DB 1ZLUH 2VITA 3NCJH 4LOEA 1OOWA 2VAJA 2ZG3A 3JTSB 3L4YA 1UT9A 3F7PC 2V5YA 3PRZA 4LQFL 5DJAA 1UZ8B 4KK9D 5DD6B 1G4MA 4FJ6A 3IDIA 1SLXA 4TLSA 5J9PA 2QMJA 1BREA 2CDGB 1IAKA 1UWGL 4KI5D 3FQXA 2BNUA 3CVHL 4X9BA 1SUJA 4XWOD 2L7JA 1C5DA 3NFPB 5CEXB 1SPDA 2BIQA 3B2UC 2NR6C 1M6OB 3OV6A 4AC2A 2HX9A 5KSAB 1P4BL 3NCMA 1CD9B 4XNUL 2OR8A 4DGVL 4KRPC 2E59A 2OMYA 3T0ED 4Y5YA 4BFNA 1T21B 5FYLH 2N56A 3W0WB 3P9MA 4PJCB 4X5WA 1E8WA 1Z5HA 3H7BA 2OJEA 3OAYK 4ES8A 3GIZH 1OQXA 4U0QB 4GG6A 4WEBL 2X4TA 4B53A 3OKMB 2YGVA 3BUYB 2QHRL 3KM1A 1DCEA 1V3LA 4PJXB 3VXPA 4GW4B 4Y16C 4YAQB 4N3TA 2R0WL 4X5RA 2DLFH 4HIPA 2EEAA 3GDCA 2WXHA 2A83A 5ACMA 3MCKA 3AABA 3QORB 3GZPA 4KPHH 4FFYL 4EOWL 1DFXA 4PIBA 5CGMA 5DJ6B 2H5UA 2ODHA 3WNKA 1K4CB 1SJHA 4H8WH 4NZ8A 1O7DE 1F6AB 1XSJA 1FIGL 2BNQB 3PP3K 4XP1L 5GS0H 1ZA6A 5SV4A 2H6PA 5KVMC 3DUUA 3S2AA 3BH8B 3BVNA 2P8LA 3RHWK 4DN3H 3D39E 1EJOL 3MDJA 3ARPA 1ADWA 5EFIA 2AJVH 4WWKA 3FRPB 5TH2A 5ES4B 3WKNA 4LNRA 3W37A 3QIWC 1N5YL 1CXHA 1I7ZB 4NEHB 2XN9A 1UQSA 2C9SA 1BDYA 4GFTB 1NC2B 3EJYC 1U8IB 3DHMA 5D8JH 1YEEH 3H1ZA 2KZ1B 4DESA 3VDBA 4IYKA 1E90A 2H45A 5B8CC 1QFOA 1Z3RA 2P28B 4U2YA 1DLHA 3EF4A 2EDLA 3T77A 5C0DB 4YS4A 5SWQA 1LE5B 3EKCA 2ZUSA 4M62L 2P5EE 4Q6IC 3EO1A 2CMRL 2BK8A 3VUAA 1CLOH 2W0PA 1MHCA 2F53A 5BZXA 5DUBB 4PRPA 2Z34A 3G6JA 2PCYA 4ZUVA 3Q5YA 2IBBA 4IBUA 5E8PB 3ATFA 5CBEB 3MJ8A 3EHBB 2AQ2A 1D5MA 1MHPL 1SUHA 3SDCA 1EEUA 2LU4A 4ZUTA 3SCMB 3SKOA 4CAGA 4NWTL 2XPYA 3U1PA 3T0VA 4BJLA 1OWRM 2WUBL 5I17B 3WLBA 4RETB 4YE4H 4M8VA 1UYWH 3NAAL 4I3RL 5EU7E 4RAUB 1HI6A 3K2UH 4CKVX 1S9VA 4TQEL 5HI5D 3ZUCA 4BHUA 4KVPA 2BC4A 1NAMH 3FQTA 1NBZA 5AVUB 1TQSA 3P4MA 2BZCA 3GJFA 4WUUD 3TA3D 1F86A 4AXWB 1DUYB 4NERA 4U1MA 3X11B 1L4IA 1P5VA 4NUGL 1V3MA 3RWIB 2DTSA 2QVKA 5CP7B 1F4YL 2ODIA 3T8MA 1X5JA 1FO0A 5DRNB 2YWZA 1FYTA 4AQOA 3VFOA 3BT2L 3GKWH 3EOAA 3UOAB 3FCGA 4KUCD 5KVDL 5BV7C 1DVFB 5L0QC 2CKBB 1CVSC 4E5XB 2E9JA 2FYYA 4XPGH 2UZXB 3O2VH 3TBTA 3LXCA 4NJ9H 1KCSL 3F62A 4X4YA 1F3JA 3LRLA 3D5OF 2I85A 1A1OA 1G43A 5D1XD 1MFAH 3FQYA 3FTVA 4Y1SA 3PL6B 5CXPA 2Z91A 2FHBA 2PTUA 1E8YA 3SE4C 1KTCA 2EILB 1MG3C 3ZTEA 4DWHA 3FB8B 5DUPH 4WHDA 5DFAA 5DJCB 1CDHA 5F7BA 5BRZE 4KKZA 1DYZA 1KUMA 3JZYA 4FRWA 5E9DB 1R5IA 3BEVA 3PNWB 3HRZA 3QI9C 2WVVA 4N5EC 3QNXA 4AV0A 1MXGA 4OZFG 1OGTA 4MLSA 4JFPA 1Z32X 3F7KA 2GAZA 4YDLB 3OD3A 2VM4A 5INCB 1I9JH 1GYAA 2A77H 2ORBH 3VW3L 1PBYA 1N4XL 5DI8B 3FO2A 1FGVL 2YFOA 4XCEA 3QJHA 4PJGA 4DO6A 2QGBA 3RWJB 1FCGA 4W9GC 1MY5A 1RULL 1W16A 4UF7C