5CGBA

Crystal structure of fimh in complex with heptyl alpha-d-septanoside
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein FimH
publication title Impact of ligand flexibility on FimH-antagonist binding a case study for substituted oxepanes
rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
total genus 37
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5cgbA00
1N12A 4J3OF 1TR7A 5CGBA 5IQMA 5AAPA 1KLFB 4XOBA 4AV0A 5AB1A 2WMPB 4XOCA 2JTYA 5FWRA 4AV4A 1N0LB 5JQIB 2XG4B 4AVHA 5LNEA 3BFQG 3MCYA 4AVIA 2W07B 1PDKB 2UY7B 2XG5B 5F3FA 5ABZA 4AV5A 4XOAA 4XO8A 4J3OH 4BUQA 4AUUA 5FLUA 4J3OG 4AUYA 4CSSA 4ATTA 3JWNE 3ZPDA 4XO9A 4AVJA 4X5RA 5IQNA 5AALA 1QUNB 2UY6B 3SQBB 2VCOA 1KIUB 4X5PA 3ZL2A 4CA4A 5IQOA 4X5QA 3JWNH 3BWUF 5F2FA 4CSTA 3RFZA 4XOEA 2J2ZB 4XODA 3JWNG 1UWFA 5FX3A 3ME0B 5FS5A 1ZE3H 4LOVA 5LNGA 2JMRA 4AVKA 4X50A 4AUJA 3BFWA 3ZL1A
chains in the Genus database with same CATH superfamily
1WF5A 5FIEA 4A66A 1O9VA 3K6NA 3LTVA 4O58H 5MEPB 1A6AB 2K6WA 5AOIA 4HEPG 3VD3A 4NQSA 1Q38A 4OZGB 2ID5A 2EDKA 1TKWA 1JE6A 2B08A 2EIZA 3KPLA 3P2TA 5LXGL 1EHKB 1KIQB 1UGKA 5IEHA 4JDZB 4I87A 2F53E 4PS3A 3OMAB 3D09A 3NIGF 5FECA 3IDXH 3ZKMC 8FABA 5ABDE 2M2DA 4H8HA 5DRXA 1ZXQA 2Y36L 5F0MB 1UA6H 4K23L 4QEGA 2VABB 1YYML 5I1CH 4LDEB 2EQDA 2WW8A 5K1NA 3WNPA 4XPTH 2RFXA 3NSFA 3QUXB 4KTDL 4YLBA 1KIPB 1ASOA 1FFNB 4KHXH 5KSBB 2A74A 2IANA 1PZDA 1TTGA 1N6VA 2KL6A 3MLRH 2WK2A 3SKJH 2QPEB 1T2XA 2Y4SA 1CDGA 1XGZA 5FKAA 1WAAF 3RIAK 2QV4A 1LP9E 2EEDA 4NCC2 3NFSH 2N3JA 3IDYB 1UZ6F 4Z0BH 4ZAKC 2UZXB 2VSMB 4PHZA 4Q2ZB 3KR3H 3TBSB 1XGTB 4Y16B 4XX1G 3EGSB 3JTSB 3GMOB 4DO6A 2CIKB 4JFEA 1AIZA 2PCFA 2V9RA 3B3IB 2IADA 1N8ZB 5KVFE 4ZDHA 2HT3C 5IY5B 4QRQA 1EERB 5KSAA 2EIMB 5JW3H 5FYKL 2JFCA 4G70B 2BCKA 2QQLL 3QDGE 2OXHA 3WDIA 5CJ8A 1MFNA 5D1XD 3FOLB 3TBWB 1K4DA 1MCSA 1AE6H 3FQUB 3O3DA 5DWPA 4X6BA 1BLNA 5D7SL 5JIKA 2PUQT 5KANG 2YXFA 2F61A 5I74B 4A6YH 4LE8A 1XR8B 1VACB 1RZ7H 2ZPKL 4IRSC 3RKPA 2MTAA 3K6DA 1OP3K 3VGHA 5C0AD 3GMMA 5MP6H 2Y3NA 4MNGA 5D2NE 4JFOA 4ENEC 3RFZB 3M7OA 4R2GC 3EOAB 2AQTA 1CTOA 4OB5H 5SWQB 3I9PA 3UCRA 1N64H 2EDQA 3LNGA 3VWJB 1CICC 3FUKA 2Y6TE 1NCDL 4Y88A 3QYNA 1BAFH 1FUNA 3RWEA 1DJZA 2B0SH 3QZPA 1U41A 2PPFA 2IWKA 1FFQA 2CLVB 4Y5YA 4GIOA 3QDMD 2H1PL 3C2SA 2DQHH 4ONHB 1YMME 3US9A 1B2YA 5DC0A 5I73C 1M6UA 3OV6A 5D70H 4EOWH 1AGDA 5FW6A 4LPCA 3U46A 2DQTH 4AENB 1M7DB 1R5VA 5CN2A 1QP1A 4U2ZA 1QFOA 4A2GA 4JPKH 3NAAH 4ETQA 2ZCLL 1UT2A 4X6CB 3ULVL 2UUDK 1EGJH 1RZKC 4KRMB 3GO1L 4W9EC 5C2UB 4XBEL 1KCWA 1MFBH 4XP5H 3KL0A 2IFFH 4GKZA 1ZOXA 3N55A 1SOQA 2PYFB 3TN0B 3VNYA 3QUYD 1KXVC 4HPHA 2XWXA 3L4ZA 1B4RA 4ELMF 4Z7AA 4HMDA 4F91B 1QR1A 3QQDA 4E9YA 5AYUH 2ICCA 3FQYA 4D3CH 5GGVY 1QFWM 1THAA 1HVXA 1JPSL 3O2WH 3WLWC 1INDH 4GSDH 4YSPA 4KRPC 4LB8A 3BAWA 3MUZ1 4DGIH 1EBAA 3BDYL 2NZIA 4ZMVA 1SMAA 3UIZA 3WO4B 5GRWA 1MREL 1L6PA 4N8VG 4J3OH 1G7IB 4V33A 5DQDH 2ITDB 3C5JA 2EYSA 3BVDB 1FNAA 2ED9A 5CO1A 3CH1B 4XVSH 2ZWKA 2NX5A 1AR1B 2OP4L 5FYKD 1VEOA 2A6JB 4G3YH 1CT8A 4N8CL 4YQXH 1GAFL 1GZQB 1NFDE 3EYUL 1X5XA 1U3YA 3SGKA 4P5MB 2CO7A 4N1EA 1L0YA 5D1ZA 2IH1A 3Q5OA 3TZVB 3CZGA 2W0LA 4ALAH 4LCCA 3KPMB 2J7LA 3QIWA 2IWGA 4AL8H 3T77B 1JYVA 4NEHB 1X7TA 4KKRA 1UJTA 4YPGB 3LKNA 3GSWB 4PPTA 2I25N 3B43A 4AQ8C 1LK2B 4MJIE 2Z8VC 4JM2B 5HYJA 1G6RA 1WFNA 3L1OL 5D1ZI 2CHXA 1CGTA 5I1LB 1EXHA 4FLHA 2A1WL 5KS9B 3MCLH 1TZHA 1SDDA 4O02B 1N0XH 3T4AB 5J13C 4XNMB 1L9NA 1QTYT 3NP3A 2FATH 4NWTL 1EVUA 5I6XC 4M1DH 4OUUA 2Q7AA 3O2DA 4G7VL 1BEYL 3QDJB 2CCLA 4BZ2H 2WO2B 1ZTXH 2UWEF 5CZVH 5K9QI 1IAKB 3UZEA 5T1DH 3GM0A 5AKSA 3S96A 3IFPA 3VG9B 4L4VE 4NO2B 4JL2A 3WHXA 4ZOEA 5EORH 3UJIL 1I3GL 3BUYA 3ULVD 1P84K 2B59B 2FD6H 5EO9A 5AAPA 4OCSL 2HMID 1AGBB 3OAZH 2OCCB 2BNRE 3KCPA 4NWUL 4JW3A 4W9GC 4L05A 4TPRH 1HESA 2NUPB 1FZKB 3DYMA 2B2XL 1N8OE 1X44A 4NYLA 4QMEA 2EUZA 1D3CA 3QFJD 1BPLB 3FUEA 1OM3H 1NUFA 1XF5B 2HFGL 3ML9A 3EO9L 3PHOA 5F1SA 5HHQA 3B2UD 3MO1A 1JAEA 2QHLA 3MJWA 4PJXF 3SDXB 3Q43A 4BGDA 3V6OC 1QBML 4UAOC 4TTDD 4JFHD 4MB3A 3T09A 4FLRA 1A47A 5KUMA 1R0AH 3C60C 3WSQH 5HI5C 3TNNA 2BHFA 4QT5B 3NJFA 2D0FA 3MV7B 3L5IA 4LASH 3BKYH 2WVTA 4U6HA 1V05A 3UTSE 2ZX7A 3DRTB 4KY2A 3IJHA 4Q58C 4R0LC 1UQSA 3SCMA 1QEWA 3O4OC 3PJSB 2VXQA 1DSFL 3QC5X 4FRWA 4I48B 4JANB 3LKQA 1G0YR 2Z91B 1ZGLM 3JWOL 4DPRA 4DSYA 1NAMA 2VC2L 4IRSA 3VTAA 1P6FA 3GI8L 4WW2F 1U2CA 3N1QC 1HEZA 4X5RA 2J6EH 4ADJA 2GJ6E 4YAQB 1WVZA 1RHFA 1XO8A 1T0NB 2GFBA 4PJ8A 1HCVA 4OFQA 4PS4H 4Y5XB 5AL8A 5CKGA 1T5WA 4I18A 4QXWA 3RTQC 3RWIB 1UD8A 1MIEH 4M8UA 1A25A 4CVZB 4HKBA 3ARBB 4MBRA 5CBAB 3LHPL 2UX6A 5SWSD 4E9LA 3G6DH 1JGUL 1G7PA 2E74C 4RMBA 1OW0C 4HJGB 5I18L 3LZPA 3T6ZA 4ZNCD 1KNOA 32C2A 1FVEB 4XPFH 2XN2A 2ARWA 1JV2B 1IBGL 4YHPB 3ZHLA 2FTAA 4F37K 5BRPA 4DF9A 3T0ED 4XRCA 3L1GA 2Y25A 3PXJA 3J07A 4GW4B 1U58A 3H9SE 4I7ZC 3CFMA 2NZ1A 5C08B 2E76C 3MOBL 3BH8B 4AYBA 5AAMC 1F4YH 1A7OL 4M8VA 3WKYA 3IXAA 4GIPD 1INQA 4XI5C 3DV4B 4R96B 5J6HB 4IMLB 1XF2A 4X80H 1INEL 4U05A 5IWLA 3PAVA 5CGBA 3QXDA 3ETTA 1LL1A 1S5IL 1XIWB 5FFGA 5C7XH 5CU5A 4BUGA 3CMGA 3J27A 2VZ1A 3V0WH 3X11A 2NY1B 1JZ8A 3LXAA 3II1A 3IN2A 4IIQB 1BBJB 2HJLB 4LNRA 5EOQL 1RZGA 1OQOA 3WD5H 5DR5L 5C0IA 2CK0H 5F7DB 5DHEA 2F74A 1H6TA 2CLRB 3AJ7A 3OZLA 3OX8B 4I89A 4P23B 5CR1A 4KI5F 1HYSD 5INCA 2YAHA 3QR1A 4W1TA 1T1XA 1E30A 4UB0H 1YY9C 1N5YH 1BWWA 2YO3A 1UB5B 4HZLB 4YDKH 3OAZK 1A6WH 1Z9LA 2HZHA 3SIKA 3BKCL 3RVWC 3V5DB 2MCMA 5PCYA 4ZUTA 4NKDA 1OPOA 1XGYH 3BPNC 5HYFA 1HEJC 2XHNA 3FTWA 4I4WA 3NEXA 3W81A 5FYJL 4YXLL 5DRNB 2XV3A 1T3FB 5IFAH 5KVEH 4YEFA 2E7BA 2C3VA 4WEEA 2WQ8A 3CVHB 3H6AA 4PJ5E 2ZAGA 3G6JB 4XB3A 1LEGA 7PCYA 2XXFA 2GY5A 1X6NA 5J1AA 1WITA 4IGBD 1FFRA 3POHA 4R4BB 4XP4H 1WC7A 4OF0A 1AG0A 3RP1A 5CJQL 3S37L 1YQVH 4KAQL 4NN5C 1E4KC 2C4FT 3RY4A 4H40A 3VO0A 1LEIB 4XP6L 5IEKB 3WXWL 3OSVA 4NRYB 2VZVA 5F96H 4HX1B 3CH8A 3P3UA 4JN2B 4PBDA 4W9FC 2X4RA 4YHZH 1ACCA 3F7VB 4LVHB 4WCYH 2J1WA 4TNGA 4BKTC 2B3RA 3NMEA 5LBSH 3ZGIA 2ZXQA 4MDIA 3K71B 4XX5A 1XH3B 2RALA 5DJ8B 5IG7B 1L5GA 3II3A 1JXJA 5G5DB 3BAEL 1IGYB 5JOFA 3BCDA 4B7LA 3DJSA 2O5YL 4L3AA 4NNPL 2G2RA 5E2WL 3RAJL 1BZOA 2H6PA 1EAJA 3SE8L 5JIDA 1XEDA 2DD8H 3FFOA 5L6YH 5JXED 3WTVA 5IVXF 2F8IA 1OLLA 2EH8L 3QAZB 5FS5A 3O9WB 4JFPA 3HHMA 2YD6A 5LNGA 3WLBB 3LRSB 2J25A 3FQNA 3T2NL 3HE6A 4X50A 1LXMA 4YDIL 4TVPL 2HA1A 1MOEA 4PJ9C 1CTMA 1CD1B 3RZCD 1OARL 4IJ3C 3IDMA 4NOBA 3F58L 4A6YB 4E2OA 5IMLA 1D5MA 3UPAA 3AC0A 1ZKAA 3VXUE 4K5MA 3B9AA 2X1OA 1M6OB 1EBPA 3K3QA 4PJDA 3LN4B 4M6NH 4ZO7A 1W0WB 5FUZH 2Z7WA 5JIMA 2HYMA 3BW9B 3KDPB 1E28B 4MJ5B 5IR1B 1AD9B 2ZXEB 3C5SA 3GIZH 3U0PA 1IC4H 4NSKA 4ODUB 1UD4A 3C60A 2PWFA 4IOFD 4MZ3A 2R2EA 5B3NA 1MRDL 3LS4L 1CFTA 3OHMB 4FLQA 4IBQA 5DD1L 5DHVB 4PFEA 3Q2NA 1TCRA 1AY1L 4N0FB 2BK8A 4UNUA 3ASNB 1C7SA 4XP1L 2WOBA 4EIUA 2IPTH 2Y1ZA 2JVUA 5SV3A 3LS5L 4UIMA 5AW1B 3HPLA 3NIFF 1JK8A 1FAIH 5J06A 1ZHBA 1UJ3C 4GH7B 2AGJH 2Z4QA 3MJGX 3TONA 1RLWA 1QNIA 2AJ3A 1J7VR 3FB8B 5F1NB 4G8EB 5A3IC 5TDOA 3VI3F 4E9TA 4UV4H 2CPCA 4LCIL 4XH2A 3U4EB 4Y5VC 1QLEL 3EXLA 2B1HL 4JPWH 3OB0K 3ARFB 1R5WA 4ZX5A 5HYIA 4FFVD 1N2RA 3TPUB 5EO0B 2F58H 3G7TA 1PYWA 2P24A 1HOCA 3GRGA 5FYJE 2I5YH 3WTSA 4G6ML 3QPXH 1NSNL 1M3IA 1OKEA 1MCWM 2CD0A 2P8PA 1SFHA 2CRZA 5AVRB 1Q9OA 1P2CA 1FH5H 4OD2A 3SKMA 2ITEA 1N68A 3O3UN 1XZWA 3FB7B 4F93B 1HH6A 4KITB 1C16A 3UP1A 5BMFL 2EC9T 2YA2A 5D1XB 2VDKH 2YA0A 2WOYA 3FAXA 4OBRA 1QAWA 4XXCC 1Q1PA 2F1EA 4Z3FA 4OZIE 3HZKA 3ARYA 4LNVA 4GMTH 3ZKND 4ZFZB 4BA8A 4HCFA 3ABMB 4GG6F 5G4OA 3VFRA 5DMIH 4DEPC 5J7CC 1S9WB 1EFXB 1TTCA 2HFTA 3EZJB 1Z32X 2FYVA 2CO6B 1BF8A 5ESAB 1VIWA 4ERSH 4NCC1 3LPFA 2MOQA 1DCEA 3EDKA 3PGDA 4P2CG 3TTSA 3ZRSA 1T20A 2CR6A 3WKPA 4EDXB 3LQAC 5BVJA 4JCWA 1FP5A 5FYJU 3ATEA 5FOBA 3VDCA 5ERWB 5JUEL 5DWUL 2Y7NA 4YOKA 3AG3B 3EZ8A 4JRLA 3QDMB 3FUNA 3V10A 4S1SL 3N40P 2G5BA 3P0YL 1SJMA 3PJLA 4TVPE 3K4DA 2YD8A 5BV7H 1SN2A 3FFCE 4HUXB 4PV9B 1CGUA 4HCGA 3BVNA 4JHWL 2R51A 3FOMA 2DS4A 3ROOB 1MFEL 3WOVA 4Z7WF 3HC4L 5DD6B 3GSXA 1M57B 4DWHA 5GHWH 5EU5A 5K59E 1NCNA 1YA5A 4OCLC 2APWA 3TEWA 2XY2A 4BKLA 2FEDC 5AOKA 4YHYC 1U8NB 3EO0B 3NCYS 3HEIB 4PJEF 4X9GA 5T8IA 1FZOA 2O6CA 3VCLA 4ZYKA 5EIIA 4PJCA 4YBLC 4AYID 4F2MB 3DWTA 3ZSSA 2EXYD 1HJCA 2YMTA 3DECA 1GC1H 1U30A 4JO8A 1DBBL 4ANUA 5DJ0A 1A14H 3RUGB 5FPIA 3KPPA 2EDWA 4OZHB 1E4XL 2BNUA 2XQ0A 4YZFE 2VWEC 1CWVA 4DGVH 4DVRL 4M3HA 2JLPA 4DUXA 5GGTA 3KXFD 4GKSB 3QCVL 4WDIA 5DEZA 3SY0A 4PVBA 2NY0D 3BUQA 4TNWF 1FZMB 4BBWA 2VAAB 4K15A 1BGXH 2W0FA 3U9WA 3VFVB 3RWCB 2VE6A 4JZJC 3MJ8B 1U91B 5DEJA 1XD1A 1MFDH 5JW4N 4FFZA 5IQNA 3O45B 1J10A 3SDDA 4MMZB 4XC3H 2WQRA 5TK2A 3MLVL 4A68A 1F13A 5C0RH 2WXRA 3VXSA 1NGZA 2GK0A 2ZUQB 3ARDA 4N86A 3Q6FB 3ZTCC 2KZKA 2VLRD 1A4JA 3KXFE 4PJ7B 4KI5D 4ZUWA 3JUZA 5KN5A 4UOW0 4I0KA 5GIRA 3D7PA 1H9DA 5A7EA 3SOBH 2JKNA 2R15A 2VLMD 3Q6GL 5DTFB 4PJ9A 1S4IA 3NUKA 3TWCH 3DSNB 1N3NB 2V3FA 2CRIA 2BOCA 2MQGA 4L3EE 4Z6AT 1EAPA 3UGEA 2QTEA 3AXLB 5BS0D 3PHSA 4U6YB 5LG6A 5DYOA 2Z7ZA 4NQTA 4RFOL 2ZOWA 2AJXL 3T8XB 5F6IC 4MXQC 2VLRE 4FXGA 3S5LG 2BIHA 1BFVH 3UYRL 5C0CA 2R1XA 1XHHA 1B2WH 1PW3A 4PP1C 4Y4FA 4PREB 5IMKB 4X42A 2NNAB 5E9DD 1LO5B 2X3BA 4X7SL 1NBVL 1H5BA 5FKPB 4DNLA 3LNEA 4F7EA 5I75B 2DQGL 4Q6YA 3BWSA 4HCRL 2J1ZA 5JHDE 3IF1B 2FLBT 3T1FB 3BRFA 1CK0H 2YBRB 4R90H 4BCXA 4DK6A 4A67A 2B8OT 3FSZA 3VI4A 1IFGA 1A3RL 4NJ9H 5IJVB 35C8L 1CLZL 2DDQL 2EICA 3O2VH 4TRPH 3UC0H 5HYQB 4AGOA 3VGBA 4AQAA 1QACA 3B2XA 1J1OH 1NPJA 5B39B 5KEZA 3DETC 1CIUA 4YWGL 3RVUC 4TUUA 5KAQF 1DO5A 5A2LH 3IRZA 3OKOA 4Z0XA 2WAHA 4H7VA 1L9SA 3FT2A 4PIBA 4E9RA 2BX5A 1T1ZB 4KGJA 4I0PA 1A1OA 4ORGA 3VDBA 2PTTB 5TFSH 4F9LC 3QFJB 2DQJL 3IPEA 4UOQA 4DTGL 5I1GH 5ABAA 3KM2A 3H3BC 1AGFA 5LQBL 4HEME 3HCVB 2ZOKB 4XNQA 2XN9A 2WZPA 4EI6B 4IKJA 1U36A 5EC1A 2AQ1A 3MV9E 2PCXA 3ABLB 5AD0B 3DMMB 2BIOA 4S0TD 2CKBA 3GDBA 3L7FA 1A1MB 2DY2A 1U3HA 2RIKA 5C6TH 4QXTA 1IC7H 4BFOA 2R23A 3VD1A 2DIBA 1SJEA 4GKNB 4YSSA 4M1CC 1A66A 1R3LB 3VFUB 3RJOA 4AYMC 1WE5A 3BWZA 3EYVA 1I8IA 2H1XA 4PJAF 5EBLB 5ELIA 5TPWL 1I82A 1ORQA 4IDJH 4JHBA 4FTVD 1FNGB 3U36A 5F3BB 4X9BA 4QTIH 3OVUB 1SY6A 2AK4E 1MCBA 4R97B 5IGXL 3OKMB 2RQ8A 1BJ1H 4L0PB 4PGEA 2O61A 1MWAB 4G6FD 4A7GA 4F7PA 2E46A 4OD1L 5KAQG 1G7MA 1F4XH 3NIGB 1ORSA 4KO9A 1RK1A 2BWQA 1QKZH 4JKMA 4U1SB 1AS8A 2X9ZA 4X6DF 5DUJA 5KYWA 1SYVB 4KVNH 1K9TA 1XR9B 3EGXA 4PY8J 6FABL 5DMKA 1KJ2A 3P9MA 2KLTA 1VSCA 4XVTL 5GJTL 1F90L 1M71A 1VFUA 3IETA 3AT9A 4NT6A 3HFML 2ZSVA 1SBBA 1U8IA 2AJVL 2P1YA 3MRPB 3NEOA 4HJJH 5HYEA 3F7YA 1AQKH 4ZS6D 2HPTA 5F9JA 1CTNA 4Q56A 4ICWA 3CV5A 3U4BH 1AZBA 5SV4A 3DIFB 2R9HD 3C9NA 3P69A 1IQWH 4HZ1A 4AIZA 2WYHA 2ZXGA 3DTUB 3QHZH 3ZX1A 3FT1A 3Q06A 2FJHB 5IQMA 5SWZD 4OZFG 2AEPL 3DX7B 4Q14A 3DPBA 3WL9B 2BERA 5E8OA 2X0VA 5A16A 3QJZA 4OM0L 4L9DA 2ZOOA 1QRND 2UZYB 1OAJA 3F6IA 3IS0X 2E0PA 2ZUTA 3THML 5BRZD 3BWAA 3QHTC 4DPCX 3VD7A 4HMCA 4HIXH 4TSBH 5I0DA 4PV8B 4LBAA 5IHUL 4W9DC 1ET8A 1TJGH 5KBDA 4I3SL 3M46A 4LQFL 4HOZA 3RWGB 3SBRA 4IU2A 4GRMB 4L23A 1F58H 1GZPA 4KDTA 3WFEL 5EO1A 3E38A 4FMVA 4K3DH 2YPLA 3PQYE 2K8QA 3AS0A 3C09C 4TVSa 1SXBA 5CIPH 1YEIH 3BP6A 3VRJB 5ADPH 4AM0B 4G2AA 1GZHC 4PI0A 2Q6WA 3E1ZA 2ZUYA 5T5FL 4QHLB 1OHZA 5AKRA 4M5ZH 4BUHA 3D2UD 5FM5M 2HVKA 3UJTL 1URZA 3QPQC 3MUGB 3QIUA 4JMXA 3DDFA 2NXZD 1OTUC 1J5OL 1T4KB 3FAWA 1R33A 1BQSA 3CVIH 3ECUA 3UMTA 2R69L 3VGFA 3IU3B 2P5ED 3QJUB 3I6KB 3WUZA 3FDWA 4C4KO 2IGFL 1LK3L 1KPVB 2VN7A 4ISVA 3K6IA 4KU1A 2QLYA 1NFAA 2JB6B 5GS0C 2MPAH 1KLGB 4LPWA 4NDMB 2VC2B 1HHHB 2VL5B 3AB0C 3C5ZC 4IGBB 4MAZA 4P48A 4AE0A 4B0MB 2DI9A 2EDEA 3JV6A 4WU5B 4FHBD 4JRXB 3CXHK 4A2DA 4QXUH 3C08H 3OPZL 4J6RH 4QTHB 5J5EA 1WUNT 1OVZA 1KCLA 2YPVL 1MJUL 3FU6A 3DARA 2JCCB 3IXTB 2OJEA 4NQVA 4XMPH 3TLRA 3VX1A 4JRYA 5I0ZA 1NC4A 4LF3B 2V4LA 3MRHA 1GL4B 4MNQA 5CD5D 4X83A 1JZFA 3VXPB 5ESVA 5I8CB 1IKNC 4ELMB 3L3HB 1JXFA 4NM8H 4RRPA 2P42B 3O6FC 2IQAB 3EJZD 5AB9A 3MRBB 2IBBA 2NTFB 4A7UA 2D7TH 3D0LA 3MRCA 4PRHD 3TV3H 1NFDA 1OSEA 3BYYA 3OC5A 4NC2B 2PWEA 4ZPTA 4WWKC 4WHTB 2FX8L 4LIQE 4Z5RA 3BIKB 3F85A 4PH8A 5HI3C 2CK2A 5FK9B 5MEQB 2E9IA 5HYSB 1ZHNA 1S2EA 4PJBF 3BQUC 3RZCB 4KMLB 2Y6SD 4JFYA 3EFDL 4AQZA 4CN1A 2D9CA 4Z3IA 2XFGB 4M7JL 2VUKA 4Z3GA 1ZAGA 1WH0A 4FQPA 4U3SA 3GSNA 3HOGA 1IKOP 1UOKA 3G9AB 4AVIA 1NCBL 2XWJB 3BP4A 4P5TC 1KEGL 5HDBF 1MQ8A 2W65A 4R4FH 4XVUD 5D2LE 5GJSL 2KZBA 2A77L 3CBJB 3E80A 4FI6A 1P4UA 5DQJB 1UFUA 1WFOA 4ENZA 2XG5B 3KS0J 4WSJA 3DKHA 4RWYL 4P3WA 4YNYB 4MKTA 2Y5QA 3WFDL 1HXMA 5E0FA 3QI9D 4J12A 2Y72A 4PW3A 3WFZA 2EEFA 2F54B 5IREA 3GD1C 4UANA 4LCWA 3WN5C 3KPNA 5AUMA 3GBNL 5JR1H 3K4AA 4I1RA 2ICEB 4R84A 5GS1C 1FVDA 4HIJA 2BNRA 3MN8A 4U1GB 4BFFA 3F5WB 1NQBA 3QNZA 2WKOA 4RGMB 1N6QH 3D33A 2PYEA 2HKHL 5PAZA 4YVNA 5C0DB 4LLQA 1MI5E 5AW2B 4CU6A 3S3BB 3RWDA 5LAXB 2YLKA 2PW1A 3AQXA 3MPCA 1QTPA 2UWEB 4JPVL 4O58L 4NM4H 3DX2A 4PG2C 3DHMA 3HMWH 5IW1A 2ZP0T 2DYSB 2G0KA 5I66A 3LEXB 3DVNA 4ZS7H 3O3AB 1E5ZA 4I13B 3PDOB 2P80D 4AJWA 3K6SB 4EEEA 3FZUC 4OKVB 1QPXA 3W57A 1WBXB 3QO0B 2VXVH 4Z77B 3AROA 4M5YH 3GMLB 3KJ6H 2GCYB 3O4LE 5I26A 3HI5L 3TIDA 3U0TB 1PLBA 2HTLC 3SDXE 4LSUH 3OJDA 3V6ZB 1UA6L 3UTSA 4X4MA 2UYLB 1LLAA 3DJ9A 3K4ZA 3IMTA 4RNRA 1SYSB 1IVLA 5I16A 5MEND 5EHFA 5CD3A 4XMWA 2NY6D 1KN2L 2W88A 3RVTD 3SKJL 1G9ML 5K39A 4PJXB 2OMYA 1I9IH 3NSCA 1X5KA 2L0DA 2FL5A 3SGEH 3NFSL 4PRDA 3PWLB 1KTJA 2K4WA 2GJ6A 2Q76B 3KR3L 1OSPH 1RJZB 1JV5A 4HETA 1CE6A 4FQJH 4PJGA 5HHOE 2FJFB 3NABL 2YD9A 4LU5H 4LP8A 4TQPA 5AL0A 2P5WD 4WI7A 2X7LA 3M6DA 1XGRB 2B20A 1AXIB 2JTYA 1JWMA 2OK0L 3BPCA 3GINA 3CFDB 2UX7A 4N8PA 4AV4A 4CC4C 4IJTA 4PLJD 1OF2B 3OMNB 4LLMA 3CFCL 4DOHB 3QFDB 2BRQA 3DXAD 4ZODA 3T5WA 5IMMA 4ELKA 1J9TA 4AK2A 1E5YA 3MRKA 4J23A 1G9NH 4XR8C 4G6AD 3UEQA 3HNVH 1AE6L 3LH2L 3V0AC 1EZLA 2LOEA 3FRPA 4TKWA 4E41D 2R29A 2C4FU 2OQJA 3TO2B 4IHBA 4JREB 1PAMA 5T3XH 1AC0A 3RIFF 5K9QG 1OGAE 4K9EH 2V8MA 1IC1A 1RZ7L 3L7EA 1WICA 2WBJD 3GB7B 5E23A 4YHOL 5FGRA 2QSCH 2OULB 4NENA 4ABVA 5GGQL 4LSQH 4H1LB 3MOAH 4E36A 4OB5L 3P3RA 3D05A 1N64L 3FW6A 3NDYE 1J8RA 3BVUA 4NQDB 5HY9A 2O72A 3ISRA 5HGBA 5EEYA 4KJQC 2HN7A 4M1GL 2GK2A 1B0RB 3MMEB 4JK0D 4GUPA 1D5IL 1ZS8B 1UKQA 1E3ZA 3EJTA 1BAFL 4B5ZA 2V7NB 3DURA 1J8HA 1PLGH 3OKEB 1NMBH 3GMPB 1X4ZA 1QMUA 3C5ZA 4BH7A 1KGXA 4PUBL 2YZ8A 4Y4HA 5IMOB 2GI0A 5L2KD 5L88L 3ZQ9A 1A8ZA 3TFKC 1Y6NR 4LAJH 1M3JA 1JGDB 3OZKA 3U6XS 5AYTA 5K9OB 1OSZB 4JPKL 5D6DC 5EFIB 1CFVL 2QSVA 5F3HB 5I8OL 4GAGH 2NY0B 3N1MC 2ZWSA 3LQZB 2DWDB 4QOKD 4GQPH 1I75A 2DBLH 4N6QA 5J89A 1MFBL 1DL7L 5ICZB 2IFFL 4PLKD 4K5LA 1TMQA 4AQ1A 3TFBA 2P44B 3AWEA 5H8DA 4DQAA 1HNFA 3ENEA 3VSQA 5DD0L 4IEFB 2NY3C 5HXMA 2DQMA 3ZZ1A 1HXYA 3HRZB 4B9CA 3QPKA 2DKUA 5AYUL 1FFPA 2V9UA 4JDEA 5C0GA 1K8IB 1SOKA 4FNLH 4M7ZC 4OZFH 1RHHB 2ZG1A 2JKRM 5IIEB 3VTMA 3KBFA 4GSDL 4IRJB 2IMNA 1AYOA 4DGIL 5FO9B 4I77H 3WIIL 1YMHA 3QEQB 1MEXL 4XO3A 1HZHH 5D7KE 3G6JE 4QYOB 1BSIA 5A2AA 4MCMA 4LMQI 4MDJA 4X0KB 3SKUD 4G9FE 1CFQA 3AXIA 5E8PA 4I88A 6CGTA 5AVYB 1PEWA 4K3HA 4KNUA 3ISWA 3O3EB 4NQQA 2Z1PA 4FG2A 4TNWK 3VGGA 3UG5A 2EINB 2XWTA 4P07A 1FCGA 4G3YL 4N0CC 3H56A 5I28A 5E9DB 2DI8A 2BP0B 3GNML 4KOBA 3ROLA 2VQUA 4LEOA 2ADGA 1N59A 4JPSA 1HT6A 4LLYA 4FFYA 5E00B 2KLSA 3VE0A 4FMKA 1JF5A 3WN5A 4JAMA 3QG6A 5F72S 2VXTH 3ZSTA 5EN2B 3HS9A 3IKKA 3K8KA 4NQEA 2YZ1A 5G55A 3CPUA 4P4KC 2R8SH 3WENA 3N85H 2C1OA 3WEMA 1QLRB 3MACL 4U7MA 4HS3A 4E68A 4GFXA 5ALBH 2ADIA 1UT1A 2A6KA 4IOSD 5IFHL 3QE5A 3MCLL 3T0VA 3UBXA 4QXVA 3BO8B 1XF3B 5CLTA 5EU3B 4M1DL 2H9GB 1MDAA 1T2JA 4WI8A 4TSCH 2JIXB 2NY4D 4HBCL 3ZIMA 5TH2A 2IAMC 5I6KA 3BZFA 4BZ2L 1T1YB 4ZUSA 3AWGA 3S34H 5CZVL 1UACL 1PZCA 5T1DL 2FBJH 2IALA 2UY6A 4GFTB 3AFLA 4I3RH 1I9JH 7CGTA 2VCOA 3UBXI 3E6HB 3JWNC 1RPUA 1CLOH 5B7FA 1XH1A 1A1NB 3SDAD 2NY2C 3U6RB 2FD6L 3BXNB 1DSYA 4MAYA 5GSVB 1H9VA 4EN3C 5CLXA 4BK5A 1KBPA 1UKSA 2FO4B 3PWNA 1H6FA 4KVCL 3RJQB 2GTZB 2GITA 4GP4B 3VFMB 5EOTA 2NNFA 4TPRL 3G5WA 4ZUVB 1R3KA 3NJGA 4CU8A 3ME0A 2EUVA 1FQ9C 4RETB 3SZ6A 4WUKH 5JNYA 1Y6MR 1J8SA 25C8H 5LO7A 3X1EA 4AW4A 5HGHB 4QLRA 2NLJA 3VGAC 5I6OA 3WJMA 2YAQA 4X9YA 3T2OA 4FQ2H 4GS7B 4QKTA 3V52H 4WI0B 3UO1L 4MA7L 5FGCB 4U4BA 1FV1A 3GSOB 3MNZB 4UINL 5E24E 4WNQA 5I1DB 4P04A 4GEJA 2ICWB 1R0AL 4DKFH 5HHXH 1KEMH 4OQTA 4UT9L 2MTPA 3SJVA 1H3GA 3BKYL 3QB7C 5CZXC 3IJEA 2ZCHL 4JBSA 3NIFB 2OV0A 2XPGA 4NJAH 1KGIA 3MYJB 3HZVB 4PJDF 4HJSA 4KPHH 3TESA 3E3QC 3B2PA 3EYQC 2WKLA 3BIBX 3K1KC 3NZ8A 2J43A 4AVHA 4KNTA 3RX5A 1TSHA 2GT9A 4R4NC 5C92A 2DIJA 2RBLA 3ZW3A 1EV2E 4N2FA 2ZWNA 2W81C 1ZLDA 2J6EL 1VJSA 4GW5A 5KJ4A 5SWZB 1X7QA 1DANT 1IL1A 3L3IB 3W11D 3KH3A 1LTXA 2CO2A 2PCPB 1WLHA 1QRNB 3RNKB 2BMKA 4WW1B 5E51A 3ZTNL 1WCBB 1MIEL 2BVQB 2DM2A 4FYRA 5BRZB 3NCYP 2GPZA 3IDJA 1ZHLA 1H0DB 3G6DL 1SMOA 1EO8H 1H3UA 2QZ5A 1NCCH 2ZKWA 2XVLA 2X3AA 3AGWA 3FJTA 4HF5H 3UTQA 1EAQA 5ECJE 3ISYA 5CJXC 5E4AA 4FABH 4ABWA 2EVFA 2XWCA 1PG7X 4ZQKA 1L6ZA 3CFTA 3VM7A 4LHUA 3ZKMD 2D31B 1CU4H 4K7FB 4AMXA 1KB3A 4F15B 4HG4K 2MHAA 5D6DA 1DQIA 4PWKA 3O0RL 3MBED 3ZDZF 2Q3AA 5IROC 2ESVA 3FFCA 2DYPA 3MGOA 4F1SA 3H0TA 1BFTA 1NBYB 4X80L 3HE7A 4CNIA 5LDUA 3SQOH 2HWZH 2J8UB 4WLCA 1GGCH 3U82B 2P7TA 4L0YA 1UOVA 5C0EB 5JDJA 4LRNH 4KROD 4D2NA 2I07B 1L6XA 4XN8A 4W4OC 2R1WA 3JT0A 3V0WL 4FEMA 5I74C 5J6GA 4G8GE 3SPVB 1I8LC 2JI2A 3B5TA 1EX0A 2BP5M 4OVUA 3T0XA 2P5EB 2VLKA 1S3KL 3FO2B 2X2HA 3FTGB 2LLLA 1YPZB 1ZTXE 2APXA 3LKOA 5KVGL 3MJ7A 3ZE0B 4NRZA 4G8FB 5HBBA 2CK0L 2HT4D 3UBHA 1AOHA 2Z65C 3M88A 4OBSA 1U8HB 2QSQA 4UYPA 1NINA 4YO0A 3KJ4B 1IAIM 2A9CA 1I7UB 3KLAB 1XGQA 1KIUA 1P7QD 2ADJB 5AEAA 3T6XA 4LCVA 1XT5A 5IHZB 3CFNA 1AD0A 1ML0A 1OTTD 3RGVD 2F5AL 1F00I 2W9DL 1HH9B 1OPGH 1DJIA 2R0ZH 3RUGE 4B6ZA 4Z7QE 1IMHC 2R2CA 3FT4B 4OZHE 5DEFB 2AVGA 1RIHH 1W72A 3OKLB 4XPHL 3PL6A 1XGYL 4PJEB 4M4RB 3RBSA 2MOVA 5J56B 3EH5B 3ELAT 5L7XH 3L13A 4JO5A 1BG9A 4NUPA 3GSRB 5CM1A 2WMPA 4QRRB 5CMAB 1U93B 4WTWA 4JFVA 1O6SA 4MQSB 3VB9A 1IGFL 1HI6B 4OGXL 4NRXB 1BQHB 1G6RH 4ENED 1FH2A 2VXSH 2EE3A 4I0CC 3X14B 2BSDA 5DDHB 2E47A 3D3VD 4LRIC 3QQ9C 3BJLA 4X6EB 1JSYA 2VN5A 1YQVL 2IPUG 4YE4H 1KCVH 4XCNB 3V4UH 1QW8A 5LBGA 1RERA 4ONOA 4N9GB 2DQUL 5TDNB 3OAWA 1PCSA 1DEEA 1QSFB 1XCQA 3O2DH 4KQ4H 3P54A 5IB4B 3MLWL 1IM3B 4MWFA 2CBOA 2JTDA 5CN3A 3FYIB 5J57B 4WCYL 2I7OA 2A9BA 2LTQB 3S36X 4L8DA 2HJKB 2ZXCA 2NW2B 2Y0SA 1WGVA 3IE4A 3IFOA 1E65A 5BZXA 5C9KA 1FLTX 4FXLA 5I19H 2HLEB 1E3XA 2YPKA 1OAZH 3C6LB 3FRUA 4PJCF 1RURH 2QVFB 1YC8A 4GRLA 4JFFA 4YL9A 3IMWA 2DD8L 3PAZA 1VFBB 3EGDA 2DJMA 5I6MA 2X9WA 3MFFA 3DK0A 4AW7A 4D0DB 5C09A 3BP7A 3TCTA 3V4VB 1G1OA 4WFGD 4PJ6A 1DP0A 1S7QB 2IBGA 4Y2DA 3I9GH 3ZVVA 1XGPA 2H2PC 3DUUB 4KXCA 4HBQA 3QI9B 4DUWA 2EO9A 5I1JH 4W6YB 3NJNA 3QEUB 1TJIL 4W70A 1AG6A 1NUNB 2I60H 1JCKA 4G42A 4S10A 1GY2A 3FQTA 1XF4B 3WLWD 3TZVC 2QPDB 4PJHE 4K7PX 4UQCA 4XOEA 1P4LB 1QA9B 3NIDE 1R24B 5FUZL 3RILA 3KYOA 4N2BA 2CO1A 1UM6L 4P3CL 4BE6A 1WG3A 4MA8L 4K94H 5EBGA 4PRPD 1IC4L 2R7EA 4HT1H 4XCFL 4KRNA 2ZX8A 5JPNC 3IJYB 4CMMA 2VXQH 4NO0D 3V9CA 1YJDC 5EIIG 3MV9A 5F7NC 3VG0H 4RZKA 2EH7H 4J1UB 1JVOA 3VXQB 2JI1A 2IQ9H 1NAMH 5MEPA 4EI5C 1A6AA 5F0JB 5AZUA 2F2HA 3TCXA 4D0CB 3IDNB 4PTUB 1XSIA 1ID2A 4LAQH 4MXWH 2CGZA 4OZGA 3RU8L 5K1VA 1KIQA 3C8HA 4JDZA 4NLHA 1S78C 1UATA 3NOIA 4ZPVB 1FAIL 2KUTA 3INUH 4U49A 4XNXH 4UCFA 4ZZKA 5FYLH 5T1KA 1I4FB 2NY6B 3F65A 2VDQH 4W81A 1TNNA 4NZUH 4DUVA 3F62A 5D7LD 4XX1E 4R5TA 4UV4L 2CJ3A 3KYMB 4XCYB 3WUWB 4PRIE 3M86A 5D93C 3IAPA 5D9SB 2LE9A 3QUXA 1KIPA 3DTXB 2YWZA 1FFNA 5KSBA 1FYTD 1MIMH 4GUOA 4L0ZA 2P5WB 4FOMA 1IT9H 4F7KA 5KVEE 4DERA 3D4GA 5DEGB 1AMXA 2UZXA 2VKWA 4Q2ZA 4PYGA 3DXAB 1XGTA 3TBSA 4Y16A 1RPQA 2O93L 3JTSA 3CX2A 2KMWA 3GMOA 2CIKA 2VRQA 1BQLH 2CXGA 2PWHA 2VDKL 4Y1SA 4HK3J 4JG9A 4ACTA 4F7CB 1N8ZA 3C8KB 1MJ7L 2JJSA 4YIQB 3PWPD 1TZ8A 4GMTL 2QADB 4ZW6A 1JHKL 2D0GA 3QA3B 4F2EA 9PCYA 1OIOA 2WBJB 4PGJA 1FI8C 2WUBL 3FOLA 1A2YB 3FQUA 1WAAE 1EEUA 4UILH 4WFFE 4WFHE 3IB4A 2WVUA 4DP1X 1UZ6E 1F56A 1H8NA 3AQYA 1D5ZB 1X5AA 5I8KL 4LP4A 4F5CE 1XR8A 4I9XA 5DUBB 5J3HC 3QO1B 4GINA 1P5UB 2XZCL 1QQDB 3NPSC 3Q13A 4X5PA 4NQCD 1A3LL 5IQOA 3W82A 1KCSL 1FL3B 1NMCB 4CGTA 2X42A 1DZBA 4APXB 2DL2A 3RFZA 4P46C 3OHXC 5HI5D 2HRHA 3EOAA 4RGNC 5SWQA 5K9JL 3LMJH 5TE6L 2EIZB 1BQKA 3DX3A 4L4TD 1KN4H 2ZXBA 3CN4A 2K70A 2A9DA 3DX9A 4A7GF 4CAGA 2KBGA 3VWJA 4JQIA 5L2KB 3ARBC 1M2OA 1D2OA 2D4DA 3JVFC 1F3DJ 4HA1A 4L2YA 3WNLA 1VFMA 2DOCA 3EJUA 3IGUA 2CLVA 2QHRL 1S8DA 5GHWL 3TM6A 4TUKH 4HGWB 2X6UA 1TO5A 3LNIA 4O2CA 4ONHA 3RIFK 1PZUB 5FUCC 1A7QH 1FDLL 2X4OA 4AENA 1M7DA 1QWHA 1CB4A 1VADB 2VDOH 3T3PF 2CUHA 1QI4A 2MEJB 3GPEA 4X6CA 2LU4A 3AUVA 4ZTPL 3RVXC 3RTQD 1ZGLB 1ADWA 3V0VB 2MPVA 3MLTB 3TN0A 3F64A 3VXMD 1G6VK 3WYRA 3U9PL 2QGEA 5DJ2B 1W6LA 4KKAC 4J3BA 3O0LA 4EI0A 2P28B 2FGWH 2PCFB 5IB5B 3CDZB 4KK5C 4LSTL 3CZFA 2Q3ZA 1BGXL 1P7KB 1LDPH 4U7KA 2KDYA 1T2QH 2EIDA 4IIQC 1QYGL 5DHDA 5KSAB 1NDGB 1MFDL 3D4YA 4FKKA 4TQ8A 4KKNA 1WQVT 4YJZL 1U95B 1NMAL 1PDKB 2PR4H 1HHIB 4JRXE 4XC3L 4PG9B 5ALCH 5CEYB 2GEQA 4QIRA 2H45A 1ZEAH 1Q9KA 1Z9NA 4U4IA 1MCRA 4JO1H 3GJEB 3FB5A 1RZJC 4XI5D 4OLVL 5DLMH 1G7IA 1A6ZB 2XTJD 1NEZG 3VXOB 3NBNA 3RURA 4ELME 3PP4H 3A5VA 2FQGA 4NCDA 1AGCB 2ZUWA 1A9BB 2IC2A 4N9OB 1OAYH 4EJ1C 2A6JA 4NZTH 1XL4A 2CCWA 3BYTA 3D39D 3P30L 4TLKA 1GZQA 2CRMA 5E2UL 2C9XA 5KBMA 1PEZA 2C9VA 5CR8A 3KVDD 4ATTA 4LLDA 2OKMA 3MKKA 5B1CA 3T65B 3B4NA 1LO4L 3TZVA 1CZ8H 3NVQA 3KPMA 2IOMA 2WLZA 3RWEB 4ZG1A 2H8PB 3T77A 1B2WL 4MMXB 4OVVA 1UYWH 3UTTE 4Y5YB 4YPGA 3B37A 3GSWA 1WAPA 1YY9D 2ZXDA 1UENA 1LK2A 1MCJA 1LWJA 2I85A 4JM2A 3SYQA 3M7FB 4R5XA 3U46B 3LH9A 5I1LA 3AVEA 4JVPA 3OAUL 2J8OA 4B9KC 4PWJA 2GC7C 2MNUA 3WO3B 5KS9A 3RB7A 1CK0L 1Q0XL 3MRNB 3V6FB 4O02A 1A6TB 3MNVB 3T4AA 5LN8A 2VLJE 2X6CA 4PJBB 4XNMA 4WQOA 4EI5A 1J5CA 3UC0L 1I3UA 3O2VL 1L4IA 3UABA 1W16A 1J1OL 4YS4A 2MMXA 2ROYA 3CLEL 3QDJA 2LAAA 1T0OA 3I9IA 1OWRM 2NYKA 1PGRB 4W4NA 2WC7A 2FBRA 2BS8A 2Z35B 4FX5A 4Y4KC 5EF2A 2C3WA 1IAKA 1NIAA 2WWOA 4BV1A 4Z18A 2WCSA 3ULUL 4NO3B 4OF8A 4YDMA 4FQIH 4NO2A 5HDBB 3T8VA 2F54E 3FULA 4PW4A 4JY5H 4JHAH 1YCSA 1OTSC 3W0WD 1UXWB 1YHPA 4X0NA 2B59A 5TE7H 3HR6A 5TFSL 4Q9RL 5G4MA 5DSCB 1AGBA 3I2CL 2OMBA 5E2TH 4ESKA 5HSFA 4EZMA 3B2VH 3B1UA 4RAVB 3ZYOA 5HHME 2F9BT 3I6LE 4D9LH 5IHHA 2NUPA 4W6WB 1FZKA 1K4CB 2OMZB 2YIHA 3MLUH 5FWRA 5HPMB 3H3PL 1Z9SB 4ABQA 1TXKA 3MCG1 3BSZL 3ZDXB 1QI3A 1XF5A 1HC1A 4TN9A 4WWPA 1ZLUH 4AGLA 2NX5B 5DJDA 3SDXA 3B83A 5E4EB 5CGMA 4XNDA 2BVOB 4CN4A 3DBXB 1BD2D 2CO7B 3FPXA 4C54A 1REIA 4DP9X 2IH1B 4QT5A 3L2MA 4IDJL 1UEMA 3MV7A 1U3JA 2DMHA 3TF4A 2G3MA 3WTUA 4DK3A 3DRTA 2BSSB 1B9KA 3GRWA 3JYBA 4K71C 1F4XL 4RRPG 5FCUL 2EADA 3NH7H 3PJSA 5D1QD 4U3HA 3B56A 3GUFA 4KMTH 4I48A 4MCNA 4JANA 2AF2A 1JWSB 4UQ9A 2Y22A 2Z91A 5JYLA 4KZEL 4PJXE 1QSEE 5HD8D 3FCGA 3UFIA 2NYYC 4M6OH 4YPJA 5FW7A 4Y19E 2CJTA 4YAQA 1AQKL 4HFUL 4Y5XA 5T1MB 3PWJB 5LGHH 1R3JA 2WPGA 3DROB 1UFGA 1TQTA 2OXGB 9CGTA 3RWIA 2B1OA 2Z8WC 4JKNA 4XNUL 4AOFA 3G5YB 5F7EL 4GJTB 5AOLA 1KB5A 1P5VB 3BPLC 2VR7A 3ARBA 2WLMA 1HN1A 4HSAC 4CVZA 4DOHE 5CBAA 1W8EA 5JHMA 3CDGB 4HJGA 1T6BX 3LIZA 3QRGL 1FVEA 2J5LB 5FV2A 1JV2A 4AIXA 4N87A 4XVJL 4YHPA 5EO9B 2C8NA 4Z7VA 1CLYH 1KV3A 5D2NC 4GW4A 3WIFB 2IDQA 3M07A 4WRLA 3RZWA 4TSBL 2UXGA 1A64A 5C08A 3ECVA 5D1XC 1CS6A 1UXLA 4L8BB 4X4XB 4JVWA 4KROB 3GMNB 5GGTH 5J12C 3S6CA 4XXWA 2VTFA 5LG1A 3ULUD 4GEIA 3DV4A 4R96A 5J6HA 4IMLA 1NAKH 4ZAKB 1AIFB 1JHLH 1YEIL 3Q8BA 4J3UA 3BZEB 4NQDE 4FFZH 5CF3A 5GRVL 1A3QA 2C3GA 2HCZX 1XIWA 3D9AH 4GRWF 1QSVA 1DEDA 4Z95H 2B4CC 3BDXA 1QSZA 5ESQB 4MJ4A 5LXVA 4BFRA 3E9UA 5GZNA 1P7QB 4IIQA 4PJGF 1BBJA 2HJLA 1GPOL 4UWQB 2PABA 3K0WA 4GQ9H 3CN0A 3P1VA 1FG2A 2ERJC 3MRMB 1KCKA 2N01B 3KZ8A 2Y7QB 3IJHB 3QCUL 4OD3H 4GW1B 5F7DA 5C6PB 1QUPA 3OX8A 1TDQA 1O7DE 4KV5F 5JZ7D 2WANA 1JFQL 1PFCA 1X9UA 3CVIL 4OT1H 3PGFL 1RL1A 3D69B 3ZMNA 3ZO0A 1NCTA 4IRSB 1UB5A 1QWNA 4HZLA 2DH2A 3V5DA 2UY7B 4MCYB 5TE4H 4JDTL 1KT2B 2AERT 5H37H 2IPUK 2O26U 4R2GB 4OIIH 3BKJH 1RMFH 5CZKA 4M9OA 3D3VB 3FQRB 2WY3B 2WZ0A 5DRNA 3DVGB 5K69A 2QVTA 1AZNA 1S9VB 1T3FA 1WHPA 4EBQL 5EUKB 1MAMH 5H2BB 1CICB 3QUYC 4HKJB 2MJWA 4HKBB 3CVHA 3D85D 3G6JA 1ZLUK 6PAZA 3HTLX 3TBTB 1AGEB 2XOTA 5EF3A 4R4BA 2VXUH 1DVQA 1NCIA 1ES0A 2WXFA 3QEQE 2VDLH 5EF0A 4K3JL 2AK1H 5I73B 5HVFB 1LEIA 2X70A 1MFMA 4XRCB 5IEKA 3IWUA 2ZKXA 2JKSA 3T4YB 4NRYA 1NBZB 1G7HB 5EIVA 2X1QA 2OYPA 3LDBB 4M7LH 4HX1A 4DP0X 4JN2A 2N59A 3SY6A 4IS6B 5C2BH 12E8H 3F7VA 4F3FB 2K4AA 1DQJB 5DJYB 4KKBC 5F7UA 4J7RA 3K71A 1XH3A 3EH1A 5DJ8A 1ZANH 1JNNH 3MXVL 5IG7A 1IGYA 2CPUA 3TURA 1XCTB 1U6AH 3QXDB 2WB7A 4KK8C 4MVBC 1TVHB 3TVMC 4PGDA 3FRPG 3O9WA 1DVTA 2BSED 2WINB 4EVNB 3WLBA 2GBTA 2PPEA 3QUML 1NGQL 2UZIL 4CDHA 4KRPB 3VXRA 1CD1A 2VMFA 4KKPA 3PYCA 2CKBH 2N1TE 3K2KA 4HHAB 4JMNA 4QWWD 7FABH 2Z0BA 1EHLH 1NBCA 4OM1L 1JRHH 2FX7H 4OCNC 2G60L 4AEIH 3NZSA 3BUDA 1M6OA 3MV8E 1X9RA 2WAQA 3QIBC 5IVXE 3LN4A 3QS2A 4NO0B 5AAWA 3U7YL 3UAFA 5LLIC 1E90A 1T0MB 3BW9A 4JVUA 5T3ZL 2IDSA 1SY6H 1YNKL 1E28A 2YAOA 4MJ5A 1AD9A 1VHPA 4N0YL 5F9WC 5IR1A 5JR1L 1GJIA 4ODUA 1WTLA 3ZE2F 4WUUD 3AAZB 1I1RA 4AKQA 1N6QL 1FBIL 3WS3B 5DHVA 1JZ2A 3A6OA 1KJ2H 3N42F 4N0FA 1WC7B 5AOZA 4NM4L 2M8XA 2ZUVA 3LQAH 1NGXB 1WDAA 5D7LB 4JZOA 1EHAA 1E9PA 3KE0A 5LDSA 3ECBB 5IHBA 2HMIC 1TZIA 2ZE0A 1VGKB 2Y7OA 3A6CL 4PP1D 5IESH 3BPOC 5E8EB 1SEBB 2XG4A 2E75C 5F1NA 5J13B 3EYFB 3KYKL 4G8EA 4QGYA 1FYTB 5FLVA 1MRCL 1DQML 5I6XB 2Y2YA 4D94A 3U4EA 4ZD3H 5F88B 5FGCE 3FN9A 5A2BA 5DZOA 3ARFA 2AEWA 1LWHA 4NNYB 4HJ1A 1D6EB 4R7DB 3TPUA 5LGJB 5EO0A 2Q8BH 1BP3B 4TOYH 2Z34A 5HVWA 3BJ91 3NIFE 3OMZA 4LO9A 1QUNB 3R8BB 1AKJD 1I9IL 2OL3L 2MFNA 3OJ2C 3LRGA 3VNZA 3FB7A 3PWPB 3KW8A 1CGYA 3REWB 3L3OC 3EH3B 3VI3E 15C8H 1PCXA 5ANME 1CXEA 4LU5L 5D1XA 5E9NA 3MUUA 4ODVH 2QPSA 1OAXH 1XSJA 3TEXA 1MFAH 1DUYB 3GS4A 2Y23A 4ZFZA 1ET5A 1GSKA 2CUAA 2DQEH 1HKLH 4HFWB 2BC4B 2OMVB 1P84J 4NQCB 4OLUH 4XO4A 1G7QB 1EFXA 1E43A 4UAOB 2VR5A 1JUFB 4Z7UF 3QUHA 4NSKB 3C60B 2CO6A 1V55B 5ESAA 1RIVL 1WK0A 3HUJF 2RAMA 5T3XL 4JN1H 4HHWA 4L4TB 4PLOB 4DK5A 2Q0ZX 2Z8SA 4TSAL 1AZZC 1QABA 3UBXG 4R0LB 3SZKC 3V7MA 4EDXA 2VDPH 4QXGL 3WXVL 1CD9B 1CGWA 2E7HA 5ERWA 3O4OB 4XN2A 4EE2A 4V1DD 5GS0L 3QDMA 1MRFH 4GG6E 5T3ZD 1BECA 4AYEC 1F02I 4OF6A 4HUXA 4PV9A 1PG7L 3BH9B 3T0EC 1FHNA 1JI2A 3NK4A 3ROOA 1TJHL 1KBWA 3MA7A 5DD6A 5KYXA 2ZWLT 3WJJA 1A4KB 1WT5A 1T83C 3O81A 1IAIL 3RTQB 1CXFA 2TSAA 2Y9RT 3ZDZB 1MG3C 1U8NA 2W07B 3EO0A 3BVWA 4PGBB 2YRLA 4GAYB 1D7BA 3ES6B 3Q2LA 4RDBA 5B1JA 4XGZB 2CKNA 5D7IE 4F2MA 1P4BH 2G4GA 1IGMH 4J28A 3E1F1 2Y1AA 3RUGA 4TM9A 4F57H 2GIYA 4LHJB 4OZHA 1O6TA 4NGHH 2XDHA 4Z7WE 4HXBH 2XLLA 4P5KB 1AXTH 3BLBA 4MX7B 1ZK9A 4GKSA 1HTYA 2HX7A 2GUOB 2E8YA 1UOLA 2QDVA 5LBVA 4WTZA 1FZMA 2NSMA 1HYSC 2XUWA 1N19A 2BNQB 3Q2VA 3RWCA 3EW3B 3C6SB 3VFVA 3MJ8A 1U91A 3MFGB 4FNLL 3IK2A 1H6UA 3O45A 4G1MB 5IT2H 1A0QH 4HW6A 4KZDL 4N25A 3T2QA 4MMZA 4KY1L 1IJ9A 4K5NA 2X0WA 1XXDC 1KFAL 4QRRE 4I77L 4JFDE 2F7QA 3GSNH 1XGUB 5C0BD 1HZHL 4R83A 3Q6FA 3LN9A 4PJ7A 3D39B 4UIKL 4CVUA 1RUKL 5ACZB 1T20B 4NBYB 1HCZA 4QRUB 5DTFA 3O8XC 5BVJB 2CHDA 1AMYA 1N3NA 5BZDB 1BYNA 1HAUA 3JWOC 3AXLA 4FFWD 4U6YA 1KTDB 1QSFE 3QPQD 2DMGA 3GBLA 1V7MH 3ARGC 5D72H 3Q9QA 4DW2L 1A7PH 3POCA 3T8XA 2OMUB 4L9LC 1JG9A 4ZSOB 1BHGA 3HZMB 1OE1A 1YEHH 3DPDA 2XC8A 4HAFA 5JQ6L 3QJHB 3BPNB 2X4NB 1CDUA 4BFKA 2GSMB 1CYXA 1PG7W 5IMKA 5AVSB 4AXWB 1LO5A 1XMWA 2VXTL 5SX5K 5FKPA 4Y7MA 4HOWA 2NY5L 2KC0A 4LHUG 1EEYB 5JPMC 4XWOD 5LB1A 5GS0D 3RPIB 3A67H 5DA0B 3VCLB 5EDSA 3IF1A 1CGSH 5FC9A 4TULH 3H42H 4UDUB 4PJCB 5JXEC 1CFSB 4PJIF 5IJVA 1HHJB 3QUZD 2A9MH 5T3XE 4NN5B 5HYQA 2AJUH 2O6PA 3F6LA 1ZSHA 2FLMA 1MCKA 3W0WB 4OLWH 5B39A 4M6AA 4C56B 3UTPE 4DZBB 3MCYA 3CZJA 3MX0A 4M02A 4M3JA 3R8QA 3CNKA 4OFPA 4ZOBA 1CQYA 1CLCA 1BIHA 1OB1B 1ZT1A 2FBJL 2W0FB 3O6FD 4JKKA 4B50A 1T1ZA 2VE6B 1CLOL 5ABZA 1RXLA 2PTTA 1AAJA 1KIRB 4D9QE 3QFJA 1SF3A 3FUJA 4D9RE 2CSPA 1X5LA 2WCGA 5TQ2H 1HFUA 4K7PL 1KPRB 5CLYA 3MC0A 1YRKA 1NZRA 2AI0H 2GHWB 4GRWH 3HCVA 2ZOKA 4EI6A 1B6UA 1G87A 2JWYA 2M26A 1C1EH 3RL1A 5AD0A 2XBDA 5KN5B 3K46A 1N70A 1CYWA 1BD2B 2CM6A 1A1MA 1N7MH 4X6FB 1FRGH 1N18A 3US1A 1KXQA 5GPRA 2R0LL 4IJ3B 4GKNA 4FULA 1ZVYA 4N2GA 1R3LA 3CFKB 5F7AA 3VFUA 1YEJH 1DBKH 3V52L 3SDYL 4UQ2B 2E7DA 4XAWL 4ORZC 5GS2D 4DKFL 1FNGA 2MNWA 1KB9K 2WIIB 4HPOH 4P5TD 4X5QA 5ITBL 5E0QA 1V8HA 4JFSA 2PWDA 2E9JA 2R1XB 3OKMA 4P2RD 5DU7A 4L1LA 1BM7A 1FAKT 1MWAA 1XZ0B 4M8RA 2X2YA 1IZKA 1IB5A 4KPHL 4U1SA 5GQBA 1SYVA 3T71A 1XR9A 1JOIA 4JHUA 4XBGB 1FN4B 2K1MA 1JTOA 1ROWA 1VCAA 3TT1L 1OGPA 3LZNA 4PJAE 3VMPA 2R1YA 2EVHA 1DHKA 3MRPA 1HS6A 1RUQH 5SWSA 1J1PH 2YAFA 1VERA 4ZOCA 3L4WA 3QJSB 1SXCA 3DIFA 5IQ9A 4CC0A 4YX2L 1UJ3B 1WAAA 4DKTA 3T0EA 3N0AA 2FJHA 2HSIA 4X6DE 3DX7A 4LFHG 3ATBA 4OZGF 1EO8L 2CH8A 1C5DB 2X88A 5GRUL 3HN3A 4ORGB 2UZYA 3CC5B 4Y5VB 1FO0L 4FHKA 4FABL 4JE4B 3ESOA 3U1PA 2RCSL 4OLYH 3ZRCC 3ZOAA 3ZKNC 3LNFA 3FZUD 3MNWB 3QR0A 4HUCA 3CLFH 1CU4L 4PV8A 4XNQB 4P8QA 2GW5A 3LPPA 4QF1B 5E70A 3BFQG 5A1AA 3CK0L 3QR2A 1TQUA 4NUGL 3V6BR 4GRMA 2OCJA 3RX9A 4G80B 2CKBB 1Q4NX 3ZT5A 1M1SA 4JG0L 2WNWA 4QAMB 3VRJA 2BLFA 4GOSA 5CCKH 4XMLL 4AM0A 3BHBB 1UXSB 3GWJA 4ZW7A 2HWZL 2YXMA 3ERXA 1SN0A 4FQHB 2X09A 4QHLA 4AEHH 3SPHA 1L7IL 3I02B 1OB0A 3BUBA 2CMRH 4BGLA 3MUGA 1A4AA 1CI5A 2DB8A 4NNXB 1KY6A 4DP5X 4U1KB 2F7OA 3B2MA 4DEPB 4JFED 1MCNA 1T4KA 2CALA 4WK0B 1S7XA 2AQNA 2OTUB 3ATFA 2QR0B 3KPRD 2DEYX 2IANE 1MCEA 5FXCH 3IU3A 3I6KA 3P9MB 2L4OA 4Z9KB 4AC2A 4M48L 2MCPH 1M71B 3HG5A 1CDBA 1KPVA 2JB6A 1TO4A 1LO3H 3D85B 4NDMA 4B9YA 2BVPB 3P4NB 2GJRA 1HHHA 2VL5A 4IGBA 3NJLA 4FFYH 1YEEL 2EXYC 5L7XL 2WGXA 5IW3A 4UBDD 4JRXA 2OM5A 3HG1D 3TH2T 1AO7D 4OUOA 2VZTA 2X2JA 4K5PA 1O0VA 4QTHA 4JJ5B 2JCCA 3IXTA 3I9AA 4NZRL 3N3EA 2J1XA 4H20H 4BKSC 4LF3A 1G6RL 5E8OB 1OCCB 1AHMA 3AQDA 3JT2A 4ZMQA 4HAGA 1BOGB 3VXPA 5I8CA 3OF6D 3L3HA 1EZVX 4EZJA 1W0YT 1Z0MA 5DC2A 2IQAA 4KJQD 4ES8A 4LLVA 1HQ4B 1G4MA 4YHYB 2CNYA 2NTFA 2YFOA 1FJ1B 5F1OB 3APDA 2ZF9A 4BWUA 4AE1A 3O2DL 4KQ4L 1I8MA 3D07A 1CO1A 3E8UL 4JQXC 4KKQA 4YBLB 5LCVA 1GZPB 4WHTA 1B9ZA 1EQWA 5AG8A 5EO1B 4MNGE 4OTXL 4RLDA 4ZJ9A 3TFKD 3BIKA 3R7QA 5A7BA 5DUPL 5FK9A 5MEQA 5HYSA 1RURL 3NCJH 3G6AB 5BNXD 1C5BL 1M9SA 4PN6A 2CM5A 5FO7B 4H88L 5J6SA 3RZCA 1YZZA 4RFEB 2Y2TA 4W68A 5J0BA 3B9VA 4CBZA 3FFDB 3B7YA 4MNHB 1ID5I 4JZJB 4MAUH 3JBG7 2Y1YA 4U1MB 1ZLVK 2FZ3B 2FWLB 5TF1L 4BK8A 2XWJA 3QXUA 3VFPB 1A6UH 4FQLH 5FDWB 4HJEA 1UCBL 5I1JL 5DQJA 1MCPH 4UQBA 2XG5A 2I60L 2YBGA 4HS6B 4XE5B 5D96C 2L8AA 3V79C 1HL5A 4YNYA 4PJBE 3NFNB 3WMSA 3NCBB 2QMKA 4WUUB 1LQSR 2XFXB 2JQMA 3T2LA 2BXYA 4Z3TA 3C12A 2F54A 2WNKA 4IOIB 4TNEA 5ENWB 1IBFA 4OQTH 1MVFA 2A38A 3D0VB 2EUWA 3X1FA 2XRAH 2DLFL 2ICEA 3OR7B 1D6VH 4LSSL 4HT1L 3F5WA 3HA0A 5F6IB 1R19A 2A4EA 4ZMTA 2TAAA 2VXQL 3CWGA 4MD4B 5C0DA 4UM8B 3L17A 1NC4B 2JQAA 3HBZA 4UQIM 4QY8B 2R4SH 2RR3A 4N0CD 2D7NA 5EWIH 3TX4A 4FYSA 3S4SA 5BQ7B 1SVBA 2UWEA 1KY7A 1O6VA 4R9HA 4B41A 2YAPA 4S1QH 3UTOA 1PY4A 3LEXA 4LAQL 5D55A 4MXWL 4BE5A 5C07D 4DH2A 2B77A 1JK9B 1UA3A 3QIWD 3BKMH 4RQQA 3O3AA 5CS7A 3MRCB 4AJ0A 2ATAA 3B1TA 3K6SA 1KLUB 4OKVA 3INUL 1WBXA 2V5YA 1UUNA 3QO0A 2BCMA 4Z77A 2Y7SA 3GMLA 2NX5E 2GCYA 2XWEA 1F6LL 2VDQL 3D25B 4P4KD 3U0TA 5C0NC 4Z5RB 3V6ZA 3ILPB 4K8RH 1NGYB 4L8SC 3QG7H 1AKJB 2VR9A 2PTUA 3AGVA 3S5ZA 1DQTA 1ZHNB 3AADB 3ZMRA 5AFAA 1SYSA 2ZJSH 3QWRA 4JPQA 1FNSL 1UD2A 1MLBB 3ORJA 3UMNA 4P2OC 4L1HA 3NACL 3ZL1A 5LGYA 4PJXA 1R3HB 3Q8AA 3SEPA 4JG5A 4U3SB 2IAMD 3GKZA 3GSNB 5H35B 4CKVX 4PCTA 5DT1L 5HYJE 3PWLA 1BZEA 2Q76A 4HUVB 2XY1A 1KJ3H 4ZX6A 1NWOA 5FHAL 1BF5A 2MQ3A 3KVQA 3F2LA 2XQBH 3FO9B 2FJFA 2AXGA 3QUMB 2N4IA 4RGOL 4L5FH 4P99A 3L5HA 1XGRA 3ETBF 4X99B 5EBWB 3T8MA 5HVGB 3CFDA 1TZAA 3QEGL 2XA8L 2JV6A 1OF2A 2K8MA 4LEXL 3QFDA 4EN3D 4APQD 4Q0XL 3N0PB 4N2CA 4AKOA 1K5NB 4F24A 5MHSE 3NP4A 2E4TA 3Q5YA 4QO1A 4UILL 2WYTA 3Q1EA 2VH5H 4HZAA 3EFOB 3TO2A 4FERA 4DGWC 3L8QA 3ABGA 3UGXA 3TJEL 4ZFQA 3GB7A 3GK8H 4H8UA 1I1AC 4QHPA 2AV1B 1NFIB 3EG9B 2XBTA 1T6VN 4UUJB 4LLAA 4H1LA 1CG9B 1HE7A 1BVNP 1PKOA 2MQCA 2NUTB 3DVNB 1W72H 1GGUA 3LMJL 2X9XA 3GFUA 4NQDA 2OSWA 1KN4L 4PSRA 3AMLA 2WQWA 3I74A 5CZXD 1F2XK 1B0RA 3MMEA 1L9RA 3CCHB 1ZS8A 2IDCA 3GC3A 1J5OH 1KYOK 3B2DC 1LE5B 5CP7A 2V7NA 2VDML 4U2YA 3OKEA 3QYMA 1BBDH 1JGLL 3GMPA 2WUCH 3TT3H 3OJDB 4KJPC 5KVDL 2V3DA 4HWEH 1F8TH 5IMOA 4HLEA 3L9BA 4QDGA 4R4ND 1A7QL 2YKKA 2HP4A 4RNRB 1JGDA 3SQBB 4I9WE 4LHQB 4O51B 2VDOL 3EJCA 3NCCB 4F15C 4XBPB 1YEFH 2V5MA 5EFIA 4KKZA 2A6DB 5TK4A 5F3HA 4NIYE 4NHCL 3LQZA 2DWDA 1TQCB 1ETZB 2OX5B 4R5VA 3IJ9A 4AEHL 5ICZA 4JO2L 4WZ9A 5FFOA 4UT7H 4PRDB 3X2QB 4P2QD 2EE2A 2NXZC 3DHJA 3IMRA 2OS7A 3L95B 4IEFA 4W93A 3MLZH 4DGYH 3DGCR 3HRZA 4JQXA 4Z7VF 1EEZB 2R4RH 5C0BB 2J72A 1OP9A 1LDPL 4Z76B 1T2QL 1K8IA 1YY8B 1BVKB 3NCEB 4KUCD 1ZDSA 2WN3A 3BFWA 3C09B 2HFFA 4AYFB 1RHHA 4PHXA 3PXLA 4XMKL 5IIEA 4XCCL 4XZUB 4IRJA 3TC9A 2AMUA 5AOJA 5FO9A 3NZHH 1P9MC 3QEQA 5FYLE 2NYZA 3ZHKA 4H8WH 1I7TB 5IROD 4QYOA 5BS0A 4X0KA 5DLML 3UOAB 2JXMB 2YOCA 4G59C 2K7PA 1JPGB 4EF3A 1KACB 1FNLA 4HGKC 1PQZB 1V3JA 1DBJH 1NCUA 3AG4B 1PJWA 3O3EA 4FG6C 1OAYL 4H0LC 5F70A 2R0WL 4BZ1L 1ECZA 2BP8B 3F7QA 5CD5C 4ILDA 2X12A 1J5DA 4HWBL 5E9DA 2JELH 4QRPD 2BP0A 2B14A 2OMWB 2HN7B 4FA8A 1CZ8L 4M43H 3RNQB 5DZNA 1A4CA 5L4FA 5LUMA 2J71A 1IARB 2PNDA 5E00A 5T1LB 4QI3A 1BAGA 3HNSH 2VM4A 2HH0H 3AB0B 2APTA 4X7TB 3C5ZB 3QP3A 5EN2A 3FB6B 3QUZB 2HG0A 3NESA 4IBYA 1QLRA 4Y2LA 1KYFA 4F7MB 3BRGC 4XN1A 4MB1A 4V2BA 1E42A 4XO5A 4R3SB 2IV8A 3WY2A 1HK6A 3SYAA 3G9VA 3BO8A 1XF3A 5EU3A 3O6FB 2LU3A 2H9GA 3A22A 4PBWD 3HLAB 2JIXA 2D03H 4OCWH 3SPCA 1T1YA 3CXHJ 1GS8A 4XVUC 1HXYB 3DYOA 3QQ9D 3MODL 2OW6A 4WWKB 3S37X 4FQIL 5EIQA 3E6HA 4PJFB 1DYZA 4KRLB 5AW8B 4JHAL 2OJZL 4KBPA 1A1NA 4OW6A 4TLUA 1GSMA 3JVGC 1SZNA 4L8SA 2CAKA 3FU3A 4M7KH 3BSHA 3BXNA 5TE7L 3U6RA 3BE1H 5GSVA 4YUEL 2E3VA 2FO4A 3BQUB 4JFXB 2GTZA 3VFMA 4D9LL 4ZUVA 2VL4A 2DI7A 4LGRB 2BPBA 3JSSA 5ILTL 1E4XI 3MLUL 1BJ1J 1A9EB 2YAMA 5E8PB 1U8CB 1RVFL 4LDLB 4IRZL 5HVHC 5JHLA 5DQ9B 3CU7A 1B4JH 3ZE2B 4P5TB 5E2JA 5HGHA 5IBUB 1JPEA 2JMRA 1GOGA 3B6SB 5KTEH 3TYGL 4YSQA 2FWOB 4P2RB 1X5YA 4WI0A 7TAAA 4GAJH 3D12B 2D73A 3GSOA 3MNZA 1JPST 5F89B 3VDAA 3LAFA 5IQLA 4WFED 5ISZD 2ICWA 3ROLB 3EHBD 5JHAA 1ZLSH 4BQ9A 2XV6B 2E7MA 1N59B 3DIDA 1PD0A 4BFEA 4ZBJA 3QQNA 2GSIB 1YAZA 2ZOTA 2ZXAA 4AC4A 4G7YL 2VR6A 3U1SL 2JNZA 3N1PC 4J6IA 2A83B 1T7ZA 4W9HC 4YVUA 3MYJA 3CHXA 3HZVA 1JZJA 3L4TA 3NH7L 5GS1B 3B3BA 3MLYL 4KMTL 4CSZA 5AWNL 1WD9A 1K3IA 2ICWI 4WEBL 3O6MH 2I69A 3KPOB 2VJXA 5B38B 2A6KB 3SHSA 4NN6C 3WY1A 4NPJA 3C5XA 4F9PA 5SWZA 5F93C 2ZCKL 4JEGB 4JQIH 2G3XA 5AVWB 2A4CA 3OAYH 5JXAL 2PCPA 4PM1A 1QRNA 3GS7A 4WW1A 3FCTB 4PWIA 1WCBA 1QZNA 2BVQA 3K2UH 4QAWA 3QNXA 5BRZA 5I17B 2ADFL 4LSPL 4PJDE 4EAEA 1J87A 3JZ7A 3T6QC 5F7KC 4CKQA 1H0DA 3EJQA 4TQEH 4ZXBC 3CFEB 1SLUA 1GS6X 3WY4A 4J8RB 3VA2C 5JIPA 3GKWH 4NQUA 2XKNA 4ODSH 2EKSB 5IHLB 3H7BB 1CLYL 4PLJC 4UOW1 5JYMA 2ARJB 3PWNB 2D31A 1FGVH 4P9HH 4C83B 4K7FA 4RISH 3AM8A 3VYNA 2F5BH 4KO5A 4FP8H 5EOTB 4FJ6A 4G6AC 2YEVB 2DJSA 1Z9PA 2GVYA 3D2UA 4NOFA 4WWOA 4B27A 3IT8D 3EOTL 1AS7A 4Z7UB 5L4IA 4HSCX 2AQ2A 1NBYA 1JHLL 2ENQA 3HUJB 3PV7A 3TIEB 2WBJC 2J8UA 1AQ8A 3DO7B 3OR6A 1DZ0A 4FFZL 5C0EA 3UG4A 5I1KH 3NSYA 4PLNC 2I07A 1EXGA 3D9AL 1NLBH 2EIEA 1JZIA 2OBGA 3B9KC 1JZHA 4JDVA 1A7NL 4LGPB 1TPXB 2HRGA 3KPRB 3SPVA 5ADOH 3GUTA 2P5EA 2JB5H 2WYZA 3FO2A 3FTGA 1YPZA 1QPKA 4E9SA 4N3UA 5KJ7E 3IJEB 4FLOA 1DFXA 3VVWA 5CEXB 3ZDZE 4A2HA 4L8CB 3TTYA 3KBHE 4UZUA 1U8HA 1BQUA 3TNMB 1YVLA 3JZYA 3RA7L 4KHTH 4WO0A 4GMSH 1TZGH 2FUTA 3KLAA 5BW7A 4HHGA 2ADJA 4NHUB 5IHZA 2IWEA 3P0VH 3BGFC 1IGTB 3FSAA 1TYJA 1HH9A 3HG1B 2GT9B 5I24A 1YYLH 1AO7B 2YGOA 1AZUA 3MUHL 5DJCB 5E4IA 4XMUA 5EEZA 5DEFA 5DGQA 3GSUB 3OKLA 3V0GA 2JKWA 4C47A 3TF7C 2IG2H 1X7QB 1WEJH 4PJEA 1NC2D 4M4RA 5CSZB 4LOEA 3KLDA 1RMFL 1W80A 4HP5A 5ID0B 3LKSB 1FCCA 1IILE 4QRRA 1FF5A 4HU2A 4PLKC 5CMAA 1U93A 4WHDA 2LLGA 3CX5K 2BNQE 5A6IA 3NA9H 3KPSD 1HI6A 5BO1H 4XPGH 4XC1L 4NRXA 1BQHA 4P46D 3X14A 1JGVL 4KQ0A 2QGDA 5DDHA 4YN3A 1X4XA 2R56H 4RGND 3T0BA 3BGMB 2G30A 5ICYA 2VXUL 3WE6B 4X6EA 5AZEL 5F7WC 1JZ6A 2QKIC 4L2LA 2VDLL 4UQ3B 2AK1L 2BW5A 4ZI8A 5F7FA 4O02H 4XCNA 2YN3A 3IU4L 4N9GA 4ZQTA 4BFIA 5T5NG 4EIGB 5TDNA 2IXQB 4OLXL 3N04A 1QSFA 4Q7DA 4YDLC 2JJUA 3CHRA 4LZKA 1HSAB 4NO5B 5IB4A 2QQNH 1UM5H 1IM3A 5C2BL 1RZIB 12E8L 5BCAA 1FLRH 5E5UB 2HJKA 2NW2A 4G83A 1ILSA 2UVFA 3Q2CA 1J9RA 1ZANL 1NDMB 4CNIB 4U1JA 2HLAB 2HFEB 3C6LA 3D52A 3FCBA 1DVXA 2NY3B 3QFGA 4IMKC 3RVXD 1VFBA 2H3KA 2AQPA 4WJ5B 2WXMA 1KGCE 2RTTA 2AKRB 4D0DA 2XNAB 4G8IB 2AXHA 4QHKI 4M7ZB 5T5FA 2Q8AL 3V4VA 1S7QA 3HG0A 2EILB 3DUUA 5A2JH 2ZYRA 2FHFA 3QI9A 3W2DL 2FB4L 4JG1H 3COOA 2J1YA 3QEUA 4FD0A 1KIUB 1JRHL 4AM0Q 4TVUA 4PJCE 3UTZB 2QJDA 4AEIL 1XBRA 3F8UB 3SDDD 4FQCL 5M95B 4R26H 3EBGA 3VRLF 3DI2B 5HHVL 4CSTA 1A7RH 1IC5L 1QA9A 4X7DC 1R24A 2R69A 4LLWB 1SM3H 4C56E 4U0QB 2W0PA 5I1EH 1FSKB 2D7OA 2TRHA 1CGVA 4MLSA 3SD2A 4F33A 2CDEA 5GISL 4KTYA 3W38A 1BDYA 4PJIB 3GRWH 4K7PY 1PSKH 5EU6D 2QVMA 1RSFA 5C07B 1SLVA 2NY4C 3IJYA 5F0LB 5IOPB 1Q0YL 1PJ9A 1J9QA 4LEEA 1CBVH 2AJYH 2IDUA 4J1UA 1KJ2L 3VXQA 1OCZB 4BXSV 4IKNA 1AHKA 2FECI 2OR7A 2YPVA 1C7TA 4MFHA 3VXSE 2XKUA 1ZLEA 1QFWI 2NTSP 4D0CA 3IDNA 4P4KB 4PTUA 5LN4A 1N5AB 5ACMA 4DP8X 5KVFL 1SJXA 3SDAC 1PVHA 2Y07H 3WNIA 4YHLL 4ZPVA 3GXIA 4ZFOL 1DVFD 3L5XH 1KC5L 2KZ1B 2EEXA 4ODBD 4WTZG 4EN2A 4WGVB 5MENA 1PNCA 3BH4A 3MLXL 1I4FA 1KB5H 2VQTA 4L8DB 3APCA 4ZD3L 2V8LA 1VAHA 2FAUA 1ZDQA 3KYMA 5FGBC 3WUWA 2IAMB 3HG3A 3ZE1F 3LIZH 4LOUD 1KTCA 3DTXA 3EGDB 1CDHA 3MFFB 4R7NB 2AJSL 4RSVA 4TOYL 5C0CE 3ULVF 4QGTA 2ISDA 1IE4A 3VXTB 4MHHI 2P5WA 1G0XA 1RPKA 4H5SB 5J9PA 5DEGA 2ETWA 4PBXA 1E67A 4J27A 2MH4A 4Y4KD 5CEZH 4PSPA 4EN3B 4J3OC 4YK4C 3DXAA 5CLZA 5MI0C 5E99L 1IKFH 2WQXA 3S8GB 1K6QL 1Z9OA 2FJGB 15C8L 3S88L 2ZZUT 1WISA 4AZ8B 5EUOB 4ODVL 4EDWH 2FT6A 4F7CA 1XB8A 1GYCA 3C8KA 3SPIA 2YGQA 1DJHA 1HU8A 5E08H 1MFAL 3G08B 4E41A 3H2WA 3CDCA 3QA3A 2QVIA 2DQEL 4NBXB 3OLGA 5MERB 3VGAB 2WBJA 4C55A 3KYOB 2CBQA 3LEVH 3L3DB 3ALPA 3FUIA 3HFFA 5E2VL 3DX1A 1A2YA 4ALAC 4DEWA 2KDGA 5I15H 2F53D 4Y8AA 4WV1C 3W11C 2R7EB 3MOQA 1D5ZA 2HRPH 3IDIA 3IKCB 1U8PB 1GGBH 4ANWA 4XB7A 3GXUB 3QZMA 5DUBA 3W56A 1P5UA 1D9KD 1QQDA 2GBUA 1RZJH 2EDTA 3MRRB 4PB9L 5DO8A 1NUGA 1FL3A 2FR4B 2PR9A 4APXA 1H8SA 4NKIL 4E42B 2JH2A 1VZHA 3KAAA 2XN9E 1SEQH 4ZMLA 4YBHA 3LH8A 5B39G 2OSYA 2YC1A 3MR9B 2A3TA 5L2KA 3K74B 2APSA 2C9RA 3GGWB 4POYA 2YUZA 2BFVH 3IYLW 2WTPA 4DKDC 5T1KB 1JYXA 3UZQB 2AABL 3CVHH 4HGWA 4GXVH 2V2TB 2J5LC 3MBEC 4PRNB 4QOKA 3BN3B 3EJJX 4WO4D 4XP9L 1CLVA 5HGDB 2NYYD 1VADA 4P2QB 1X5FA 4PYHA 4AQEB 1RCYA 2HKAA 3HG4A 2FNBA 3SE4A 1BA9A 4XMVA 1MQKL 5ID1A 2VDNL 2X28A 4KROC 1UM4L 1MHPH 4BFBD 1ZGLA 3V0VA 3LSOB 2CRYA 3QDGD 3WG7B 3MLTA 4N8UA 4RA3A 4CDGC 3UBGA 4FZEH 5C0FB 1JPTH 4NGHL 2C9AA 4Y9BA 4D0BB 1J5IA 5L0QB 3NPZB 4Y1AB 3SPGA 2IBZX 1AXTL 3MCKB 5DJ2A 2ZYHA 1YEKL 2HT4C 1U21A 3EYSL 3PGCB 5IB5A 1BF2A 3DV6B 4X8CA 3CDZA 3KHOA 1P7KA 1GGYA 4RIRB 2VMJA 2H2SC 1NDGA 5DC4B 2MWCA 3T3PE 4OY9A 1OTTC 3OGOE 4UV7H 2IH3B 3MRGA 3RGVC 1U95A 4ZMNA 2AEOA 5KOVC 2QL1A 1PDKA 3QCTL 1HHIA 3MBXH 5CEYA 4PG9A 5F9OH 2Z6FA 1CL7H 1KFGA 1WFIA 3GJEA 4MJHA 2LU7A 2M1KA 4HG4J 4EXKA 5ITFB 2Q2LA 1A6ZA 4QRPB 3VXOA 3RY6A 1JF1B 4MYWB 1AGCA 2DWEB 1AHWC 3MI6A 2DMKA 2DWSA 2O5XH 4BQ8A 1A9BA 1UG9A 4XCEB 1OHQA 4HV8B 1YMMD 2YMXH 2CJUH 2VDRB 3F7RA 3V7AG 5AQ0A 4XNBA 1JXGA 1V7ML 4EZKA 3CZEA 3H8NA 1I9RH 4ANXA 3FHEA 1JJUA 1FHGA 5IJKC 3DX9B 2CBPA 4K5OA 3T65A 3DSFH 1HHKB 3L08A 3CZNA 1YEHL 2YPLE 3PWVB 4BXVA 3ILQD 1TETH 2H8PA 4ZFGH 4MMXA 2VWEE 4IOSA 1CGXA 1S8DB 1WFJA 4JB9L 5DHVH 3ZL2A 4O2CB 4PI2A 1RJLB 2BIMA 1RFDL 4OGYL 1XCWA 3T2PA 5I1IH 2X4OB 4CGUB 1F4WH 3D08A 2HKFH 3LDBC 3U7WH 2B3IA 3MRNA 3H42L 4TULL 2OYLA 3V6FA 1EAOA 4CSPA 5BVPH 1A6TA 3MNVA 4PJBA 2DZEA 2QSTA 1RK0B 2G4EA 2JCCF 2EDNA 1R3IH 3EO1A 4P59L 3MV01 2BJMH 5FOJA 4AI7A 5B1KA 1SBSH 3MREB 3ZTJG 4ZTOL 2Z35A 4MKMA 4ONFL 3TS8A 5C0JA 5CP3A 3K5RA 5I2IB 4NO3A 3CZFB 3U1QA 1E6OH 3MDJA 1AOZA 4BWWA 5CJOH 3ZK0A 2Y5TB 1WZKA 1UXWA 5E8NB 4PRAA 1QHPA 1YDPB 3TBBA 1JZ4A 1S9XB 2APVA 5DSCA 5DF0A 4IBZA 5TQ2L 2V6HA 4RAVA 1Q9KB 3SBWA 3TBYB 4D8PB 4ODTL 4KNQA 1HZLA 4KKBD 3FB5B 4JRYE 4P3DA 1K4CA 4QPEA 2OMZA 5HPMA 1MW3A 4MNQE 2VW7A 3CPLB 3IPBA 1FC1A 1Z9SA 5JQIB 3K6OA 5ISZB 4UMGA 1RI8A 1BWMA 2R2HB 5K5YA 4KK8D 2HX9A 3FH5A 4MVBD 3TVMD 1SXAA 4MJID 4OCYH 5EPMB 2FT7A 1DBKL 3DLQR 2KERA 3SE3C 2BVOA 2WXLA 3DBXA 2XWBB 1U2HA 4Q8BA 4G5ZH 1JGEB 4LLDB 1P4IH 1ZPUA 3HC3H 1OEZW 3EJPA 1RJCA 2BP3A 2B4CH 3DO3A 3NJKA 2F68X 3VD9A 2R29L 3A0OA 1CF1A 2FEEI 1N9PA 5JA9A 2BSSA 2WB1A 1KZYA 2NZ9C 1LD9B 2ZKHH 3NQKA 2DTSA 2B9AA 5F7MC 2GUYA 2GBAA 5GRJL 5BJTB 3QIBD 1AQDB 3GZKA 4HC1L 3TO4C 1JWSA 2E9WA 5JPNB 3LVEA 4L4VD 4OQ1A 1ZY9A 5HDLA 1NL0H 2ZUXA 3C87A 3TT1H 1QFHA 3QXAB 4RA0C 3G3LA 1EJ8A 1G43A 2KQNA 4EI5B 1ZD6A 1W91A 2QV2A 3PWJA 5T1MA 3Q05A 2BNRD 3DROA 5H4YA 2OXGA 4OLZH 3TP4A 2WYIA 5LXGH 5I30L 5HYSG 1UH4A 3CG8A 3G5YA 2EEAA 1P5VA 3S35X 3P11H 2Y69B 3AQZA 1J9CT 4XMZA 2B39A 3CDGA 2WXNA 3ARED 3QJRB 4KFMA 1LJMA 3FU7A