5CGBA

Crystal structure of fimh in complex with heptyl alpha-d-septanoside
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Impact of ligand flexibility on FimH-antagonist binding a case study for substituted oxepanes
rcsb
source organism Escherichia coli k-12
molecule tags Sugar binding protein
molecule keywords Protein FimH
total genus 37
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5cgbA00
5LNEA 5IQOA 1N12A 5JQIB 4XOAA 1UWFA 3SQBB 3BWUF 4X5QA 4AUJA 2W07B 2J2ZB 2UY7B 1PDKB 4X5RA 4AV5A 5FWRA 5ABZA 1ZE3H 1QUNB 2WMPB 1KIUB 4LOVA 5AB1A 4XOEA 5CGBA 4ATTA 4XODA 4AVIA 4XOCA 2XG5B 3BFQG 2UY6B 4X5PA 4X50A 5FLUA 4CSTA 3JWNH 5FX3A 5FS5A 4AV0A 4AVKA 4AVHA 4BUQA 3BFWA 4XO9A 5AALA 5AAPA 3JWNG 4XOBA 4CA4A 3ZPDA 2JTYA 5LNGA 1KLFB 4AUUA 4J3OG 4AVJA 4AV4A 2VCOA 1TR7A 5IQNA 4XO8A 4J3OH 3ZL1A 2XG4B 5IQMA 3ME0B 4AUYA 5F2FA 2JMRA 1N0LB 4J3OF 3MCYA 3JWNE 4CSSA 5F3FA 3ZL2A 3RFZA
chains in the Genus database with same CATH superfamily
2YO3A 5INDA 4M6MH 3BJLA 3WEOA 5DEGA 1WCQA 4DVBA 1NCJA 3HOGA 2IWFA 4FL4B 4CDGC 2A83B 3GZQA 3QDJD 2EIKB 2XQ0A 3T0VA 4UQ2A 4U3SB 2HJLA 1ORSB 2CK0H 3SN6N 3OKMB 3P9MA 3H9ZA 1FJ1A 1EDHA 1FFRA 3FUHA 2EE6A 5B22A 1GR7A 1OTUC 1IKOP 1ZTXH 2W65B 4R96B 3RX8A 4O5LL 3FFCE 4A2DA 5AOIA 3P4NB 2XN9A 3JWNC 4UBDC 3WHE1 1QI3A 4Y5YB 4LLQA 3SDCC 4XMWA 4ZX4A 2EVHA 4NHUA 4HK3N 3IETB 3B83A 3QJFA 4QHUB 5FYJL 4G6AD 1ZRUA 4JFFB 5D7JB 4ZUTA 4LB8A 3D2TA 2QV2A 4HIHB 2WAHA 2W60A 4JQXC 4DZBB 4J3WA 1Y6MR 3TCLB 1IE5A 1GOFA 1HXMA 2EICA 3O4LB 5D1ZI 5C0NC 3ARGB 4L2YA 3F6LA 3C60C 2HX8A 3Q1SL 3QUKB 1S8DA 2RCSH 2GHWB 3QZWG 5D7JA 4YXHL 5JOFA 1DLFH 3VRJA 1X9LA 4YR6A 2NXZC 4MFHA 1XEDA 4QYAA 2XZAH 3EO1B 2Z1KA 4F7TB 2ARJA 3CHQA 1WGOA 3CBKB 1E50A 3IFLL 3WS3B 4P2OB 3QXAB 2EXYC 4EZLA 2OJZH 1SJXA 4F7EB 3VFWA 4JB9L 3GZOA 4N0RA 1V7NH 2KBGA 3OMNB 1YN7A 4YE4H 4LVHB 5FKAA 4CC0A 4S0TD 4OF6A 5IVXB 5CJQL 4IMKA 4Y2DD 1NKOA 2VAAB 3WFDH 2JJUA 5I8KL 1G4RA 1G9NC 2VDML 3DLQR 4U1LA 1BQHA 3CLFL 5I73C 1JWUB 2R2EB 5BV7B 3ULUC 4F9LA 5EA0L 3MNWB 4M6AA 5IB4A 5KS9F 3ZHFA 4H26B 2UXVA 1A6ZA 5KW9L 2WXJA 3ENEA 4KOBA 4G6FB 1NL0H 2EIBA 2EP6A 2ZOTA 5HHVH 2GJPA 3GSXB 4M8QA 4C47A 2Y23A 5C0IB 1KPRB 3RTQC 4E0RA 4ODVL 4AGOA 2UY7B 4WKZA 2YLKA 2GFBA 3GMQA 4HKBA 4ALAH 5LGHL 2KT6A 2FWOB 3GDCA 4M3JA 4R0LB 1UOVA 1BLNB 1BFVL 3Q3GB 3TWCH 2OMYB 2VN6A 4GSRA 4EZKA 2WTRB 4PRHD 5I18L 4KI1A 3RNQA 3MRNA 1BV8A 2F53B 2VLRD 3PHQB 4I18A 5CN2A 3W5MA 3CX5J 4MS6A 1OP9A 2IXQB 3ZDYE 3Q6GL 1LO0H 1A3LH 4WTZG 4Z7OE 2NX5D 2IQ9L 1X4YA 3MNMA 3ZW3A 5HPOA 5DHVA 4OD2A 2B3RA 2CKBA 4AQ8C 5INCA 4WW2A 3FQUB 4K15A 2CKBB 3H6AA 4MXVF 5GZOC 1P4IH 3OVUB 5TTRA 3VWJA 4PREA 1HJCA 4PS4L 4HAKA 3IGAB 4XN9A 2H3NB 4EI6A 4PWHA 3MLRL 4HGWA 3GB7A 3QIBC 5EU5B 2D0FA 2FNBA 5FYJE 1Y0LA 2ZSVB 1CBJA 1YQVL 3CLFH 3LIZA 3GBLA 1QPPA 4WWID 4F7CB 4NN7B 5JNYB 2GI0A 2RJMA 1QLFB 5LQBL 4XNMB 4P46C 3QIBA 3K6NA 5DJ0A 4ANKA 3DIDA 2XFXB 3QWQB 4G1EB 4JM0A 4NSKA 5HGDA 3JWDH 2JE8A 3RKPA 4PRIA 5JW4Q 4DKAA 2H4EA 4NNYB 1A3RH 2DTML 3RAJL 5CD5D 1QZNA 1IEAA 3EH3B 2KPWA 4RZCB 5IMLA 3BX7C 1TZOA 1QSED 2ED6A 2FEEL 4JO3H 5EHFA 4OZFB 3UIZA 4XOCA 4HIIA 1ZLWH 3PGFL 1MJJA 2FQEA 4M6NL 3X12A 5HY9B 2KPNA 1HFUA 1HHKA 1QLRA 1A6VL 4G3YH 5FGBA 4Q0XL 4FLQA 4M29A 1C5CL 3P9LA 1RUKL 2X4UB 3FB6B 3CVHL 3VACA 3LKQA 3CFNA 5AVUB 1NCNA 2FIKB 5IJVB 1JRHI 2WZPD 4D8PB 1DBKH 4PRDA 2F18A 1INDL 3L6FB 4AITA 2F8VA 1ETA1 1V55B 1PY9A 2FO1A 5CHNA 1AD0A 3CSFA 2WUCH 1TZAA 2NTFA 1S8DB 3EOAB 4OQTA 4A39A 4IEFB 2JB6B 3JUZA 3O3AA 5DS8A 4FA8A 3CHSA 3KL0A 4JY6A 2QPUA 2Z0BA 5HPMB 2FBJL 3RFZB 1KJ2H 3VFGL 5DJXB 3S2CA 5EEYA 1PFCA 5JPNB 4JN1L 3TJPA 1WH0A 3FB8B 1TFPA 2AEOA 4Q9QH 5DD1H 1YMHA 2QDVA 3BQUA 1YEIH 3H3KA 3EBHA 1NIEA 1SM3H 1UB5B 2EYTA 3NEOA 3C6EA 3TH3T 3FU5A 1RPKA 3GGWA 5DC4B 5BRZD 3BE1H 1ZXQA 3VDAA 1A65A 1FV1B 3SYCA 3KR3H 2DM4A 4HKJB 2WBJB 3B2PA 2F54D 1A3RL 1L6XA 3LD8B 5BRPA 5EDSA 1MSPA 1T3FB 2X1XR 4JCWA 4WWKB 3HCVB 1Z5YD 2NUPA 1P1VA 3K91A 4LDLB 2VH5L 4F92B 5KVGH 2HUEA 1NJ9A 4WI6A 1ZMYA 3HI6H 4F9PA 5HHXL 4ZW6A 2CGZA 3QJVB 2VMEA 3LIZH 4JFPB 3L7EA 3SDAB 4BFNA 3A67L 4KTDL 2NOYA 4JPSA 5C1MB 3VGHA 5F8RC 1M9SA 1NCWL 3BZFB 3ZDXE 1UOWA 4LEOB 2JI3A 3IDIA 2JIXB 2B2XH 3LKSB 5BW7A 2W92A 3WHXB 1ZV5A 2Q7AA 1MCRA 2ZAGA 4H5SA 3TH4T 4N2AA 3DMMB 2NSMA 4L23A 3FQNB 3EDDA 3IJYA 1ACCA 3QIBD 5GSRB 3ROOB 3RPKA 3V0WH 4ZFZB 1IBDA 5H94B 2DQFB 3GSWA 5SX4H 3RY4A 2CLRB 4RNRB 1TFHA 1VACA 4G6KH 2E7LA 4X6BB 3RWHB 3KNBB 1UWEH 1BVKA 5I66B 4HXAL 2G0LA 2X1QA 3QDMA 3DVFA 1F4XH 3L3GA 1SFDA 2BERA 4QTIH 3N41F 2IPTL 5JR1H 1U2HA 4Y1TA 2H0FA 2E46A 4B50A 3WO3B 1SM3L 3RP1A 3SPHA 2Q7YB 2VMFA 3WIAA 3SDXA 5IBUB 4LAJH 1FNGA 1XSJA 3RVTD 5C8JA 3MA9H 4MRCA 1VGEL 2OR9L 3UTPD 1UEMA 3NZ8B 4NDMA 4UNTA 2X6BA 1WC7B 3AY2A 3GPSA 1N5AB 3I3EA 4AVIA 1W6WA 2H9GB 2IOOA 1VHPA 2LAAA 3IDUA 2K45A 3CZUB 1VIWA 3NZHH 2AJZA 3K2KA 3PAZA 1NGPH 2IV8A 4ZYKB 1EHLH 4J27A 3CN1A 5DJDA 5E0FA 3VMPA 2OX5A 4RGNC 5EWIL 4DEPB 2YR3A 3TO4D 3SPJA 2YXFA 3ZLQC 5T1MA 4PJ8D 5FIEA 4RX4A 3B9KA 4JUTA 5KVEL 1MWOA 2CLZB 2VN4A 1GY1A 4Q56A 2DQUL 3BESR 1RMFH 1RP8A 4GQRA 4A6YA 3O0RL 3OM3B 1Z9LA 4MBRA 3O3EB 3TIDB 1HQ4A 3OB0K 1GGYA 4WHDA 5FYJU 3L5HA 3GXPA 2AV1B 1XF3B 2YARA 3MRCA 4ODHH 3MV7E 2GJ6A 3OKDB 3FO9A 1SN5A 4HLZG 1KBKA 4KRPC 4ATWA 2PR4L 1OP4A 2WLLA 3SPVA 2JI2A 1AZUA 1MCLA 4M62L 3TBVA 2CO3A 1OZTG 4B9KC 1GVIA 4PV8B 3CVHA 3QIUA 5J12C 3ULVC 4UILH 1K5NB 3C8HA 2VSCA 3U9PH 3VH8B 4M7LL 4PG9A 1JTPA 2A9AA 2EXYD 4AYDC 4Y4KD 4JFDD 4F91B 3RVVD 5DD0H 4PVLA 1IBBA 4YAQB 3UZVA 3RWFA 4I18C 3MTRA 5DRZA 1WC7A 3EOBB 5GGTA 4MWFB 4XNQA 4XO9A 1Y1DA 1OSYA 2N0MA 2XBDA 1EJOH 5ICYA 4HIEB 3BKYH 2DI8A 4HH9B 4URTB 2AMUA 2CBPA 4WW1A 4Z7WF 3LB6C 5EBWB 5IMOA 2OV0A 4W1TA 1P69B 1H9VA 2Z7UA 1NPUA 4PRNB 5F7HA 3QDJE 1ACYL 4N0UA 3S36H 1QFWL 1INEL 1FLRH 4JFOA 2ERJC 4TLTA 5JQ6H 3D0VB 1CE6B 1EEZB 2UZPA 3FT3A 3L3IA 1NFDA 4U7SA 4A38A 4ZXBC 1TYJA 1N64L 1Y1UA 4TQHA 3H3PL 2G60L 3KH4A 2P44B 4XO4A 2W0PA 2F5BL 1F0LA 4JDVB 3RU8H 5C0RL 3KYNA 2F15A 3LZFH 3OKEA 4P8QA 3KLHC 1AGBA 5EA0H 4GP4B 1OB1A 1OCWL 5FHAH 4B5ZA 5HYFA 1EO8H 1S9WA 1XH1A 3RDTD 2SEBB 2PXYC 1XB8A 3QWRA 4GBXB 5L4MA 2NCEA 5MP6L 3ZVVA 4BCXA 3INUL 3IMTA 1I3RB 1AIFA 1WDAA 3KBFA 4ODHL 1NOLA 4UWQB 4X4MA 5FGRA 2I9TA 1F11B 3FB5A 3ZZLA 2P5WD 5KJRL 4N8VG 1P4BH 4FKKA 5TFSH 4HOMA 4JO4L 3VQ1C 2BNQE 1W9XA 4GQ9L 3UG3A 5DRXB 4V1DE 4R7XA 3RA7L 2JLPA 4NUJB 2CGRL 5LCVH 4U1MB 4AJYV 4DO4A 2B0SL 4HCGA 3I2CH 1L0QA 5SWZE 3BUBA 2NNFA 1BGXL 5H35A 1XIWD 3HZVB 3NVQA 2DMHA 3MACL 3B9KD 4G1MA 5H4ZA 1HH9B 1R9FA 1CD9B 2IQ9H 1VLXA 1H3PL 1RZFH 1DLHA 2BSTB 2ENSA 1Z0NA 2QZ5A 3NOIA 4OGYL 5EO9B 1LLAA 4R7NA 1TLMA 3DNKA 3DRQA 4CW1A 5EO1B 1RL1A 1FFOA 2BOBB 2P8MA 3PNRB 3HE7D 4XVTH 4AEIH 3CFEA 2XTJE 5KSAA 3HNTL 1QBAA 5E9DB 2CG9X 4NKDA 4ZFQA 2YUVA 3B2DC 4KJQD 1D6EB 4IIQC 4LEXL 1C5BH 1KT2A 4E5XB 4XPFL 4HMEA 4Z76A 1DQJB 4P4RA 2FVNA 2D4FA 4JVUA 1G9ML 4MZIA 4NRXB 5HGBA 4GW5B 2GY7B 5KZCB 5EZOH 2XI9A 2ITDA 3JWOL 4JEGB 3BP4B 1MRDL 4MJID 1S7TB 3NIFB 1KDJA 3VG9C 5ANHA 4WFEE 3L3OB 5D8JL 1OEZW 2Z0UA 2ZXDA 1FNGB 2A9MH 4YQXH 3V6FB 3WN5B 5CCJA 4IK6A 4NENB 3D4CA 4QXUH 3APNA 3C08H 3I02A 2DL9A 4FQXD 3DWTA 4TNWF 2DWSA 1QQDA 3MFFB 4JPVH 1JWMA 1YECH 3TBTB 1PGRB 1A4KB 3QDMB 3ZBMA 3N40F 3BN3B 2ZIDA 1BJ1J 3S35L 4FXTA 2P7TB 1SOSA 3V4VL 3WLWC 3O6FC 3B2XA 3NN8B 4B9GA 3IGKA 3HAEA 4AYFB 1HHHA 3VI3A 2VABA 4MJHA 4TVPE 4JNXA 1SJHB 2LV4A 4WK4B 4KPHL 4JAMA 4PJBA 1JZFA 4RMSA 4WI9A 3RIAK 5L2KE 2HYMA 2I9LB 4M5ZH 2CBOA 3WL9B 4ZMZA 4N0UE 4DPBX 1YUHA 2FJHB 2P26A 1CDCA 4Q9RH 5HYJD 4Q2ZB 1PMYA 4G42A 2EC9U 5ABZA 3MHZA 4PU2A 5E1GA 4L8DB 4NBYB 1F3DJ 3PL6D 4GAYA 3CSPA 3LPOA 1GKEA 1T1ZA 4PY8I 2X6AA 4MDIB 1TQBB 4CGUB 2DJUA 2BVOA 5JO5B 5F3HB 3UJTL 2FLRT 5ISZA 3PLYA 3P4OA 2KL6A 3EYUL 3DOSA 4HOWA 4CMHC 5HHPA 5I8KH 3HUJE 2MCMA 3T0WA 3IJHB 5AW9B 4NEHB 4WU5B 4EEEA 3NBNA 4F8PA 1WZ1L 2ZWLT 2ZPKL 2EEDA 4UAOC 4R4NC 2EXWC 2VMJA 2EH7H 1V27A 1ZHKB 3CXFA 1K4DB 3QZWA 4OGAC 1CI3M 3BZDA 5EOQH 3RZCB 1MH5A 1NL0L 1T83C 5ENWA 4X9IA 1G9NL 3TX4A 4GRLB 1CTOA 1GGCL 1Q72H 4HJEA 4H0IA 2YRBA 3QYNA 3RJOA 2OSWA 2FQFA 2CD0A 1ORQB 4MAYB 3KLSA 4Z18A 3VU1A 3TU6A 3DO7A 1HT6A 4RGMB 1H5BA 3V52L 3V5DB 4LESA 3N5AA 1FYTD 1JTOA 1WLHA 5AALA 3KW8A 1U8QA 2B15A 1T7ZA 4H8QA 4HIXH 1ADQH 1YEJL 3E8UH 3S5LA 4JJOA 2HZHA 1IC1A 3SY0B 4AL8C 1ZA6B 1P9MA 1WAAF 5HXMA 2VLME 3GM8A 4LASH 3EAKA 3MZGB 2EDMA 3M1BB 1OM3H 1UXSB 2W81C 5FA4B 2HRPL 4OLVL 3ZE1B 4ZT1A 4N86A 4H25B 4UOW0 4LKCA 4RWYL 4N24A 2WMPB 1U42A 2N7SA 5I74B 1WBXB 4Z1PA 5HDLA 3ZYZA 1AR1C 2CO2A 2AEPL 1KJ2B 4RETB 3A3YB 1NC2B 3BWAA 3IKKA 1TTUA 3LKQB 4I87A 1NM9A 2XPZA 2XTJC 5E00B 4PJ5B 4DZ8B 1LXMA 1MJ7H 1CJYA 2QADD 2K6WA 4FG2A 3SDXE 3LIUA 3UJTH 4H20L 3V0FA 1RH8A 1IAMA 3QNYB 1Q9LA 2Y5TB 4HHWA 1AGEB 4MAUL 4WKXA 4HXBH 2B3IA 3T3MF 3MLXH 1IEAB 4S0SD 4JY5H 3MRLA 1WEJH 1T66C 2H2SD 1ETZA 4KV5E 3WFEH 1S9KC 3D52A 1GGCH 1Q72L 4XBPA 1SVCP 3DXAE 1EXHA 4IHOB 3RVUC 5GSVB 1KIRB 4NRYB 2BP5M 3IN0A 3BZEB 2VLLA 2VR7A 1B3IA 4DP4X 2OR8A 5IVOA 3PWNA 2VYRE 4MXQC 1OW0C 3DXAD 3LZQA 1A8ZA 1X7SA 3REWB 4P57A 3BP4A 2K0RA 3SO3C 1CFQB 5B1BB 3QUZB 1PG7H 5IGXL 5ITFA 5IQNA 3PF2A 2EUVA 4YL4A 1MG2C 3TN0D 4BFOA 5JHMA 1PZ5B 3LDBB 4CBPA 1PCSA 4Z76B 2WLNA 1TEGA 3SO3B 4YS4A 2EKJA 4ZO7A 1TVDA 3RJDA 4P2QE 3MUJA 3RNKB 2C5DC 4FFVC 2GHZA 2CJUH 4XVSH 4DQOH 3P3TA 1J0JA 1YEDB 4X9BA 3WJMB 2OI9B 1A14L 1UC6A 4NWTH 5AKTA 4JFEE 1KCLA 2N7BA 3FO0L 4IRZA 2C3VA 1U91A 1Q94B 4TF4A 4PLJC 5KBMA 1M2VB 3MA7B 2DBLL 2P42B 4GY4A 4WO4A 3WLBA 3FFOA 3GIVA 4GKSB 3ESUF 3QXDB 2JQZA 4W6WB 5DZPA 3RDJA 3VWJD 3I6KA 3HE7C 2DIBA 3IS0X 2ZKXA 3QEQB 2BSTA 4QT5B 1JK9B 5ILTH 4MA8H 1D9KC 3BPLB 3MV8B 3QFDA 2C3WA 1MIMH 5EU3A 3P4OB 4M9OA 3VFGH 1IAOB 2QJDA 4JQVC 4WO0A 4LNRA 3JYCA 3PP4L 2JSFA 4QJ3B 1CLYL 5CZRA 1FL5B 2BVPA 3C09C 4D7BA 4HOZA 2OMBA 3IU3B 2YWZA 4Q6IC 4UT7L 5HI3D 3PUUA 4WWPA 4A7GA 1H3UA 3QEUB 5JW4M 2VLMD 3D25B 4E9QA 1VESA 4JREB 3C09B 1ZLUH 1XGTA 5D7IB 1IQWH 3PJNA 4L05A 1LJMA 3CVCA 3BFWA 2YFNA 4J3UA 4TOYL 3S3BB 1UCBH 2K6ZA 3FUDA 3P0GB 1RULL 4PJCB 4UQCA 5SWZA 1T5XA 4B5EA 2WBKA 3APMA 5JOEA 1VZIA 4KHXL 4ZRGA 1OSPH 5C6WH 3PQYD 4YBLB 1DQML 3S36L 1KIQB 1PD0A 4KU1A 4BA8A 4MJ6B 3IMBA 4JZNB 3IT8D 4PWIA 1AGBB 2D2OA 2MTAA 4MXWH 5LXGH 4KTDH 1JGVL 4J6RL 3S0PA 3LD8C 1CS6A 4GIAA 2YUWA 4YSRA 5KUKA 3V4PA 5DJAA 2TRHA 4X99B 1ZJBA 3U6RA 3LKPA 1MW2A 4K73A 4OF3A 3CSYA 4OLWH 1FIGH 1R3JB 3EO1A 5T3XH 3CVIH 2N4IA 4CJ0A 2CDEB 1FYTA 4P59L 1RZ7H 3DPDA 3ULVH 2WB1A 1HDMB 4RFOH 1TTGA 4M56A 3K8LA 3KYOA 4PPTA 5E0QA 5LWYL 4K7PL 1UZ6E 5B8CC 1M1XB 1WFUA 5J1TC 1QYGH 4QIRA 2BXZA 1DVQA 1W0WA 3P4LA 3QUXC 2AJVH 4PG2A 4HWZB 4LCCC 3EJQA 5ID0A 2VLJE 2FECL 1R5VA 5L2KD 4G7SB 4YHLL 5B8CA 1NTDA 1RVFL 2MOQA 3ULUL 3IMUA 3KWWA 4JDTH 1UH2A 1TCRA 3ZTJG 1CWVA 5J4MA 2AK4D 1IGCL 2E56A 4A2FA 4XI5D 1EJ6A 2LLNA 5I15H 2J72A 1NFDE 2VDOL 3GM0A 3ZHKA 5D1ZB 4MNQD 3DTXA 1H3PH 4FXGA 4K8RL 4N4YB 3UIYA 1B4JL 3WTSA 1NAKH 2KDGA 1D7DA 4F9LC 1WBYB 1TVBB 2PCPB 5KSUB 4FG4A 3U0TB 1XSIA 5T33L 3UYPA 1XB6A 3UGXA 2VE6B 4AYBA 2I07B 3LNIA 4TULL 1WBYA 3PG2A 4I9XA 1I31A 5KSUA 3TYGL 1UD8A 3MRQA 2YA2A 1BSIA 3VXUA 3O3EA 1JBJA 1FAIH 1QBLH 4UU9A 1MUJB 4W9HC 1BVZA 3OZ9H 3BCDA 1OAUH 1XF5B 4OCWL 2WYHA 3B1UA 5DCCA 3QIWB 5DVMA 5FECB 4TSAL 2CR0A 5ID1A 5JUEH 3US1A 3GI8H 4NNPH 4AENA 2ESVA 2YAQA 1OK0A 4EQ3A 1X5XA 4NT6B 4X5LA 3O0RH 3ASNB 4APXB 3LS4H 2EEBA 3TBWA 3EADA 1SNRA 3NCFB 1N59B 1E67A 3HI1B 1O7DE 1JNLH 4J23A 4PBWD 4NBZB 1JP5A 4YHKH 1MFEH 1RZ7L 4Y1SA 4AQZA 1UOLA 5CKAA 5KWYC 4ODTL 5EUKA 1RZKC 1YPZE 2H8PA 2C3HA 4Y19B 5A2FA 1KACB 1E27A 3WE6A 4BXSV 4JX0A 3GMPA 4ZXBD 4L18A 3DO4A 5C9JB 1FBIL 1KTLA 3V0GA 5E95B 3H4HA 4PJAE 3VXMA 5AAWA 5CSBA 2P3YA 4FQ1L 3CBJB 5GISH 1M2OA 5DMGD 5G4OA 5CCKH 3PPEA 1MOEA 1BM3L 4ABUA 4NM4L 2LE9A 5DU7A 3EFFB 5SWZD 2FH6A 2ITEA 3ATDA 5IMOB 5J89A 3CG8A 3PFUA 5JHLH 2XJLA 3BISA 4AZ8B 2CLRA 4RNRA 1AZCA 4X4YA 2A7BA 1X7QA 4OI8A 3FSWA 4Z6AT 3HC0A 2IPUG 3DPBB 3ESMA 2Y25A 4G7VH 2NW3A 1GJIA 3TT1H 3LH2L 2OCFD 4N20A 3I75B 5B38A 1NBZB 1QFWI 3HJ0A 2RH0A 4E9TA 2HRHA 4I5BB 1T89A 2V5YA 1P6FA 2OTWB 3FUKA 1A6TA 5F6HI 4WHCA 5E1AA 4NN6C 2IMNA 2GJZB 2C7UA 4LEOA 1IM9D 4ZPVA 4WUUB 3VDBA 1SJEB 3SPVB 3MCLH 4GAJL 3S3DB 1EHNA 1KBGH 4GRWE 4BELD 1HSBB 5A16B 1MXDA 3SKNA 5EF3A 2XN9E 2WW8A 3BJ91 3DHJA 2WXNA 3KPQB 4U1IB 4M9PA 3DVNA 4NAMA 3RWEB 2XRAH 5MERA 3V0VA 1KPVA 5FGBC 4N22A 4O5LH 3O8XA 5AD0B 3VXOA 2GT9A 2HWZL 2P45B 3X2QB 4XPGH 3U30C 4AEEA 3WIIH 5FWQA 3MCKA 2H6PA 5GHWL 2A74A 4HA1A 5EN3A 2CO6B 1HIMH 2R0KL 4Y7OC 3NSCA 1NIFA 4JFEA 1WD9A 3VXSB 1A22B 1LEGB 4XC1H 5E8OB 3S5LG 4TVPD 3SE8H 4QLRA 3HG3A 2A9CA 4ZYKA 1E4XH 1YZZA 5D71H 2PP8A 4ZMOA 4LHQB 4K23H 2OW6A 4JFXB 1PZ5A 3T4YB 2NZ9C 3QJSB 1OAJA 4C56D 3NIGE 1FO0H 1UQSB 1IGMH 2F1BA 2IALA 4PWFA 4XBGA 3CZFA 4NKIL 1GZPB 5IQ7L 4WAFA 4ABVA 1L7IL 4MASA 2VDMB 5DQ9A 4P49A 3HHSB 3MV9B 3PGCA 2GIYA 3R4RA 3MLSH 5LAXB 2G4EA 4X8CA 3UPAA 5HJDA 5I9QB 3TYFB 5DMYA 1J8HA 4UAOB 3LZPA 2Q7YA 1Q38A 1J5HA 5C2BH 3RRQA 5E5LA 5JDSB 4Y9BA 2GEEA 5HYSA 2ADYA 3LN9A 1WJ3A 2EACA 2QHLA 1FG9C 3II1A 4NB7A 2ZUTA 5CAYB 5I23A 2GJRA 3ELQA 4PN6A 4Z7AA 3DXAA 1UGNA 3GSNL 5BZWA 4UV7L 4AMXA 5D4HA 5EO0A 4LHJB 3MLWH 5DUBB 4RAUA 3P77A 4NQCB 4L37B 4NN5C 4LLVB 4QRRE 1QABA 5GS2H 1DJYA 2ICWI 3BWZA 4WNJA 2XN9D 3T65A 5FR3A 1HC1A 4PRAB 4UZGA 2YRZA 3U4EB 5AWNH 4R2GB 1XZWA 2MH4A 2AQQA 4FTVA 4YEEA 3WNIA 2E74C 4LCUB 1I1YB 2QKSA 4XP5H 4AT6A 1AZNA 1ZHBA 5AG9A 3RKDD 3B34A 4PS3A 3RX7A 2Y22A 3NIDE 1LYQA 2KLTA 3T4AA 1FCGA 4ZAKC 1AC0A 2WJ5A 1XF4B 5LNEA 1I85C 3E7JA 1TF4A 1UXLA 2JI1A 5ANMA 3V55A 5IB1B 1L3WA 3LQMA 4S1SL 3H0TB 3U9WA 2XWBA 4J4PC 2ZWZA 2XKNA 4JFPA 1FNLA 4H8HA 4B27A 1IQDA 2DWTA 3FU0A 3O6LL 4ZTPH 5LB1A 5D1QB 3ILEA 5HHVL 3DTUB 2VUYA 3RVWD 1BPLB 4V1DD 1CVSC 3HEIB 2OTPA 2ZWYA 1IJNA 2IANE 1EDYA 3BP5B 3SIKA 3GMOA 4ODVH 1F4YL 2HUHA 1ZT7B 1IGJA 1N10A 4JRLA 4TQEH 1S7QA 5HVHC 2R4RH 5IV2A 3EXJA 4IKKA 2IAMD 1G43A 1I7UA 4BFIB 2P5WE 3KH3A 4J7RA 2QKIB 4KAQH 4B3EA 3ZTJH 4RQQA 3GRGA 3IDGB 4KRLB 1FV1A 4LOFA 4FABH 3QO1A 1SHMA 1T04B 3L9YA 3V4VA 1ZS2A 2R27A 2Y7MA 4MB3A 4MA3B 5DRWA 5JLZB 5T1KB 1TU2A 3UJJH 4OF0A 4UOW1 2X7LA 1E0OB 1Q9KA 3HRZB 1FGVL 2EEXA 4UTBL 1RJZA 2IDFA 2G75A 1YDPB 5EH1A 1A3QA 5DS2A 3QUMH 5H2BA 5GZOD 4XNBA 1D5XB 4MA8L 2MEJB 3NCYP 4I77L 1QO3A 1FZMB 2BIQA 4FE9A 4KXZH 1MLCA 4N2OA 4NJ9H 3L08A 3AC0A 3QUXA 3SDYH 4W6YB 3TO2A 5C0AE 3HHRB 1AS8A 3MLUH 3O6FA 1GGIH 1LHZA 1YQ2A 3MRNB 4I18B 3T2QA 3GRBA 3BKMH 1DVSA 3FU8A 5TQ2H 1A66A 3PWVA 1KENL 1OGAA 4LEEA 2UYLB 4PRDB 4ELDA 4KKCC 2WQUA 2BY2A 1MZYA 2QPFA 4Y1AE 5FO9A 5CGYC 4ZOBA 5D6CB 4ENED 2AV7B 2ZWNA 4R0LA 4L1BA 4TLSA 5EIIB 1GH7A 1PFOA 3C6LA 1PDKA 4YO0A 4XNAA 3ZE0F 4FXGC 4OFVA 3ZX1A 4U1KB 5I24A 2JKLA 4LSVL 1A6UH 4A63A 3B7UX 2ZOUA 5D2LB 3VFVA 5HY9A 5JYMA 1VERA 5AOZA 4KQ3L 3HC2A 4JO1H 1KB5B 3B9EA 3JT0A 3K4AA 1GZQB 3MRLB 4J4PD 4OZFA 2NY6C 4R8WL 4YDNA 5CD5C 5ITBL 3G08A 3CXDL 3DYPA 4Y1AB 2G2RA 3FN0H 2EADA 4I0PB 4ENZA 4U7MA 5KYXB 4KQ4L 3GYRA 4GAGH 4KC3B 3G08B 5HHME 3MRBA 4LLDB 2YSTA 4OJDH 2ZXBA 4A6YH 1VADB 4KAQL 5C0AB 3P11L 1NBVH 4JY4B 1I3VA 5C0JA 3L4WA 2VGLM 2XA8H 3CPUA 4H8UA 1E5BA 2VLJA 4YWGL 4JCLA 1PLBA 4G1EA 3KMDA 1T83A 3O6MH 2YD7A 3ATAA 4OUUB 5ICXB 3N40P 2WVVB 1E7VA 2MWCA 2VDQH 1XGPA 1JJUA 3BC9A 4PJ9D 4B6ZA 1DJGA 4X8XA 5AB0A 2UYLA 1C5CH 3DGDA 1CFSA 4JKMA 3UMNA 5IHWA 3DRTA 2B4CL 5I71B 2D3LA 5KANG 1C16B 1BVLA 1IGIL 1CUOA 4Z7VB 5BZDA 4Y9CA 2VM4A 3I6LD 2HKHL 1ZT4A 3HB3B 2VC2L 1TR7A 3V7AE 1GJUA 1KT2B 3C60D 3H9YA 3KVDD 2XV6B 3QARA 3S5YA 3I74A 1HESA 4PJBF 1RKRA 4OD2B 4Y5YA 1ED3B 3NFNA 2NW2A 5DJZA 3TV8A 3K1KC 3L5XL 5I8CB 3NCJH 2JQMA 4JY4A 4NO2A 3KPRD 4GRLA 1WTGT 1NDGB 2H1PL 2Z34A 5AVRB 1I3GH 1UACL 4MAYC 4HK0B 4PTTA 3RZCA 1LEKB 3WXWH 4C54A 1ZTMA 3EXLA 1AD9A 2ZQKA 4EXKA 5C0EA 4TTGA 2KYIA 4MB5A 3WTVA 5FM8A 3OJDB 1NDTA 4QCIB 3DI3B 3F12B 1L4IA 4ZUVA 4ZUSA 1DANU 1U3JA 3OB0H 4R26H 2X6MA 4KOCA 2H1LM 2YZ8A 3UACA 2ZXWB 1NGQL 1PS3A 4OZGA 2XKNB 3MBXH 4KJYB 2FIRT 3H0TA 4QRRB 3NCBB 3JV0A 3PHAA 3KPOA 3DJ9A 4O58L 1MJ8L 5D6DA 5FKPA 3UTZB 1GS6X 3N2JA 5M7QA 3ULUD 4MCNA 1ZEAL 2FJFB 1J9QA 2APSA 2W0LA 4KJYA 3QJOA 3MNWA 1ULVA 1CXEA 3NJXA 4IHBA 4JHBA 2BWDA 1N0XH 1WFMA 1W8OA 2Z31A 2ZWKA 4Q2ZA 5D1XB 5F1OB 4DUVA 3LN5A 4EI5D 3N3EA 3NJMA 2OK0H 1JZIA 1LNUB 2X4SB 3LRMA 3OX8B 1QD0A 3LRSB 5I75B 2XY2A 3PP4H 5K39B 1RIUH 4ONFH 5CUSH 1HJBC 4IRZL 2IDCA 3VRIA 1RHHA 3MXVH 3V8CA 1SJHA 2MMXA 2A6KA 3CCHA 2EVGA 2VLRE 3DX6B 4H8WH 2QSTA 2BW4A 2CDFB 1JHLH 1RJZB 4GEIA 5I8CA 1U21A 5IB3B 1NC4D 1V3KA 3D0VA 2ID5A 2X4PB 1BZ9A 5BZXA 2CXGA 2P4AB 5E99L 5DZVA 2EDNA 3UG4A 3QUXD 1OGTB 1A1OB 4TNVF 1L7TH 2EECA 3M07A 3DARA 1NEZG 2ZXAA 3TYFA 1XH3B 3HVDA 3NEEA 2FAUA 3HZMA 3JV4B 1JPGB 4U3XA 1S3KH 5J7CC 5T1LB 4YH6A 4PD4J 2JKJA 4A67A 4M43L 3QJQB 3MJ9A 3GTNA 1HAWA 4PJFF 4UBDD 1S6NA 1ZE3C 4ZW5A 3GMOB 4L0YA 2EQDA 2I5YL 4X5XB 2YD0A 4WHTB 4L0ZA 4F20A 1A4BA 1J9CT 3QDJA 1D6VL 1KLFB 2ZG3A 4WY7L 4YUEH 3K46A 2K7PA 3IM1A 4HUMB 3VXSA 5IROD 4GRWB 3CDGA 1WD8A 4CNIA 3AY4C 1N6QH 2F7PA 2VLKB 4R97C 5C0BD 1MCJA 1AHWC 2HN7B 2ZP8A 1IKNC 3OKDA 5EWIH 3CFKB 2H32A 4RFOL 3CFQA 4XPGL 4NKOB 4U1IA 2UZXA 1VJSA 3CX5K 1CYWA 4BFGA 2G30A 4N2HA 2QR0B 5CN1A 5D7IF 3OR6B 3Q7JA 1RMFL 1KJMB 1U8LB 3VCLA 2V8MA 3SDDB 3WXVH 3BSZL 2Y2WA 3G5XA 2QHRL 1B9KA 3EHBB 4CMMB 3CZJA 1AE6H 4P46B 4TQ8A 3RWGB 5IFHH 3VFOA 3IDJB 4MGXA 2ADIB 4HQQH 3BRGC 3OAUH 3DKHA 4FTVD 3OGCA 3ZE2B 4XRCB 4NKIH 32C2A 4XVUC 4LSDA 4M7KH 1PDKB 2FJSA 4Z7WE 2R2HB 4YO0B 1KNOB 3I9GL 5BRZA 3MRGA 5AL8A 2HMIC 4JGMA 2LVCA 1AACA 4LVEA 1BYPA 1UHVA 3CDYA 1DBBL 1WWAX 2DJ4A 4P9HH 2F58H 3BVWA 4UT9H 2PR9A 5A6LA 5JA9A 4CC1A 2KMWA 5I76A 4AMKL 4PJIA 4AL8L 1E2ZA 5ILTL 3L17A 4HEPG 1CLOL 3P3UA 3UP6A 3CMOH 1QO3B 3APCA 3EDJA 1KZYA 3GI8L 3LEYH 1KBBA 4RMWA 3R0MA 3WFHB 2XYBA 1KN4L 3ZZ1A 3QG7H 4L4TB 3VFTA 4PG2C 4BH7A 2JCCE 5KJ7E 2IFFH 4BH8B 4BK5C 3G5WA 1GTNA 2CHWA 5FF6B 5FV2A 1KB5L 2Q7NA 2A6JA 4U4BA 5DUPL 4D9RE 2AJ3A 4OCRH 5AW4B 2J88L 3UCQA 3V0IA 2I27N 3HG1A 5F7BA 2W9DH 1TVHA 4ZO9A 4ZPTA 5IZ7A 3BXNA 1HK6A 2NX5E 3TVMD 4P4KB 5DZAA 4ZFFB 3OQRA 4X4XB 5KBNC 2F8XC 2Q86A 1MAKA 2DQDH 4O02L 3ME0A 3NFSL 4MNHA 5B1JA 1LE5B 3VYPA 3RWFB 4XZ4A 3D33A 4U0RC 5HGAA 3JTTB 3LTVA 4GB9A 3T3PF 1YMMA 4K9JA 1J5CA 4TUOA 2MNJB 2VXQH 3MLZL 4HJTA 2BP0B 1ZOXA 4HSCX 4NCC1 4CADB 3T3MB 4POYA 5BVPH 4EI5A 2HB0A 4OZHF 3CIQA 4QHLA 2PO6A 1EZVX 4WHYG 3WTYA 3D85B 4ORZC 3ZUCA 4K9EC 4NC1E 5J12B 3DX8B 5JIDA 2ZKWA 3ET9F 2YPLB 4YSCA 4DVRH 5DD5H 1J8RA 2IANA 4PJ7A 4NJAH 5JXAH 2YC1A 1XV8A 3NMEA 4PSRA 4AQEB 3H54A 4QTHA 1H6UA 1SYSB 2V17H 1URLA 3HIZA 1UH4A 2IDTA 3FUEA 5T3ZE 3LKOB 1HZHH 3HTLX 3VWJC 4A7TA 2AI0H 1AR1D 2O93L 4CU8A 1VSCA 4S1DC 5DJXA 1CLVA 3RFZA 3KHQA 1RUML 3NFPB 4PIRF 1TKWA 3BKCH 3BOVA 4MJ4A 1NLDH 2DF3A 3HG4A 1OV8A 1VZHA 1T5WB 3G5YA 1JWSB 1EAPB 2H0PA 4BFKA 2J4WL 3U2SA 3UYRL 1XR8B 2A4CA 1W8NA 1HL9A 1FL3B 5C9KA 1T5WA 3G5YB 3GK8H 2YEZA 3QJHA 4IYKA 2FATL 2E6PA 3JYBA 3KDMB 1P4LB 2VM3A 4P5MB 1SY6A 5E2WH 4ONOA 2LU5A 1FHNA 3EH5B 4O02H 1IGYB 4XC1L 1OO2A 2L3BA 3BVVA 1Z9OA 2MPAH 2H1XA 1NMAH 2EDRA 2CDGB 1LDPH 5T5NG 1VDGA 3GQFA 3VGAC 1T7XA 3H9SA 3HZYA 4YBQD 5KVDE 1ZKAA 3GPEA 2V2TA 1BVKB 5I66A 5AVWB 4FXKA 3TTYA 3TESA 3KM1A 4QTHB 1U8IA 5ICZB 1IGFL 1H3XA 1QA9A 3QQ9C 2CIIB 2LFGA 4R5XA 4XMLL 3CH8A 3KPPB 4XNXH 3MLSL 2R69H 1EV2E 2GBAA 3AUWB 1T66D 4JKKA 1PZUB 2IG2H 2BS71 2R8SH 4W9LC 5JORA 4K0OA 4O4YH 1WAAA 4FXGB 4OM0L 3WHXA 1VCBC 3CU7A 2V2XA 4F8TA 4UQ3A 4I2XE 5JHLA 4B96A 1QTYT 3TVMA 4CAGA 2BK8A 4EN3C 3DDGA 4F57H 4CRPA 4G5ZL 4EN3D 5I17A 4I4WA 3L1FA 3I9PA 4UM8A 4DKFH 2I60H 3MROB 35C8L 1S3RA 5EF1A 4W4OC 2HAZA 1MCWW 3OF6A 4FMKA 4B9YA 1YYLL 3F8UB 5ID0B 1FZJA 3UTTD 1BAFH 5J6HA 3FRPA 3WIFB 1P4IL 2AKRA 1HCVA 4Z7QB 1I7TA 2WSKA 1S7XA 2RGSA 1KYUA 5HYSG 2IFGA 4P99A 1CF8H 3GB7B 5AOLA 1F1GA 1ETB1 1FFTB 2X4TA 5AEAA 3X1NA 2KZWA 1LEIB 3D8MA 2VDPL 3BAJA 4KY2A 2RFXA 4ZD3H 5KOVC 1Q1JH 2OP4L 1BQ5A 1U8IB 2WYIA 1IARB 4JCMA 2APWA 4BSJA 4DKTA 2YAOA 4BH7B 4G11A 5D5ME 5INCB 2CAKA 3CGTA 2X0WA 4CILA 4EBQH 3P73A 3VG9B 3S37L 3UBXI 4P2CG 5KG9A 3VGDA 3N55A 3UAJC 3D06A 4MHHI 3ABLB 1F90L 2GBTA 1QR4A 1F1AA 4ZBJA 1TENA 4JJHA 4TM9A 3QNXA 5C71A 2D2CC 1FWXA 4JY6B 4XMKH 1ZSHA 1J1OH 3DYMA 3VGEA 3PABB 1AXTH 1NGQH 2AEPH 2DB8A 2CNYA 3RL2A 4XXWC 5GGUB 3L3HB 3IAGC 1XHHA 4JS7A 3QI9D 4QXTB 2G5UA 4GQPH 4WTQA 2WINB 3AFLA 1MJ7L 1Q4NX 1IV8A 1CDUA 1RZGA 2MHAB 3DBXB 4HUWA 5DQJB 4ZAKB 4UM9B 2GUYA 3QUML 3D69A 3TNNB 3DSFL 4A2HA 2MIZA 3MRFA 1TTAA 4MMZA 3QFJE 5CO1A 1FAKT 1YVLA 3LNDA 4RX4D 2ATAA 1U30A 3BEWB 1MJJB 3BKML 1DVFD 2ALWA 1PQZB 3HNSH 4QRPD 2NR6D 5D1XC 1BIIB 2NY5C 5L0QB 5A43C 1KG0A 2FBRA 3L5WB 4FDWA 1ZJAA 1SEQL 4HWBA 3QXDA 3SGEI 3EJTA 4XCFH 1MW0A 4UQBA 4BDVA 2HRGA 2JCCB 5DHVH 2VDMH 3FYEB 3QQ4B 1KLUA 1B90A 3CDGB 4AQOA 1OGAD 2ICES 3HPLB 4I0PC 4N25A 4HH8A 3MLXL 3FSVA 3QXAA 4JRYE 3D6GA 3F3HA 1D5IH 2IQAB 1NLBH 3ARBA 4OZGE 5FLUA 3VX0A 1OWWA 1S3KL 2MOGA 1MHPL 4PP2B 1BHGA 3LJ3A 3TV3L 1FA4A 5JXEA 2AJUH 4B0MB 4N1CA 1EZLA 1FQ9C 4XVJL 5E1IA 4Z95H 1CG9A 2V3FA 3O6KL 2B1AL 4F7CA 3C5XA 3Q8EA 1WZKA 1PAMA 3S8FB 1UXWB 1ZPUA 4Z3TA 1MIEL 5LKNA 3WTXA 1MI5D 4KDVA 4XVSL 1AXTL 3PGDA 4FCAA 5AAWC 3D0AA 2IBZX 3PWNB 3PV6B 4F2MA 4QHUA 2EC8A 2YPVA 1A1OA 3VH8G 2WXKA 5GRXG 4KJPD 3WG7B 4A66A 5I18H 2XQYK 1KY6A 1KTCA 1T1XA 1KCBA 3CSYB 4WW2B 3PREA 3LB6D 2MTPA 1YN6B 4NZTH 2A6KB 2ICCA 4LSQL 4NPYB 4PJHE 1SXSA 1MIML 1A21A 4H13C 3NIDF 1BG9A 2Z64C 1MFBL 1RUQH 4X7SL 2M2DA 1OARL 3FQRA 5A40E 1J0HA 3AXLB 2J8OA 4W9IC 1CTNA 1JZEA 3NA9L 1MCIA 3ERXA 3NJLA 5HVFB 2RHEA 4BZ2H 3OAZK 2DBLH 2IDSA 5D7LD 2FJUB 1CXIA 2CR6A 2YMXL 2OMYA 5GS0L 3MXWL 2XIIA 4HQQL 2PPCA 1IQWL 5CLXA 3W0WE 1UYWH 3E8VA 2IGFL 2KZKA 3CIAA 1E6JH 3M88A 4TOYH 4K07A 1AY1L 3WY1A 3QEHB 2WVUA 3VFOB 1ZK5A 5E5UB 5EC2B 4OZGB 1D5IL 4JRYB 3QEHA 4KI5C 4GYBA 3MLTB 4ZMTA 2Q9OA 2WOYA 3FK3A 1YUHB 3IU3A 4JO5A 4YSAA 2HLEB 4NO5A 1OP5H 3VM5A 2HJKA 2DAVA 4DH2A 1DVXA 1T4WA 3Q8BA 4O2FB 4F58H 3E80A 1ACZA 4L4VD 3SCMD 3NRFA 1JK9A 3SGEH 1L9TA 2QPDB 2DLIA 4P2RB 3TBBA 3HZKA 1NCAL 1XR9B 3NP3A 3QQ3A 3MOBH 2LQRA 2BOCA 1X5MA 3EW3B 4L1SA 3EJRA 3VWKB 3SE4A 3ARFA 4Q58C 2E6JA 2FH8A 2YD5A 3P30H 4EXPX 4C55A 4LDCA 4OZHB 3U0WH 5AW0B 3HR5B 5T1DL 3RDTA 3VXRA 2YSSA 2IDQA 4NZFA 3L3OA 1JGVH 4MQ7B 2XBTA 1E7UA 4HULB 3O3UN 4LSQH 4G8AC 1VF5C 3QZWB 2AXFB 2DQCL 5HDRA 4XPBH 5KSBA 3RVTC 2ZNXA 4BFBD 1BEYL 4HAGA 4AOFA 3FTXA 4LRIA 3QUKA 4HC1H 2BY0A 1I7TB 5D1XE 4HJGB 3MV7A 4JK0D 1GGUA 2PTTA 1M56B 3MXWH 3NQIA 4FXKC 1KN2H 2YKLL 1DBAH 4I85A 1BD2A 3QUMA 4WV1A 2X4PA 1NAKL 4M1CD 1SXNA 3NACH 1L0YA 3H4FA 4DESA 1DVFA 2WGXA 2PCYA 4PWGA 3G9AB 4OAWB 2WKGA 4FYTA 2L04A 5C08E 1QHOA 1JZJA 5KN5B 2ODHA 2ZZUT 4G1MB 4WUKL 1QHQA 5FCUH 1XMWA 2GSMB 4I0KA 1KG0B 5H35B 4NKMB 2O30A 4HBQA 4HWBL 3V0JA 3DURA 5IWLA 4PV9A 3VFVB 1A9EB 2B77A 3IAQA 4FL4C 3FBKA 3GHBH 3P40A 5DRXA 3VXUE 2JELH 1G0DA 2AQ2A 1C9SA 4CBZA 2Z93A 1FLRL 3TNNA 4UIKL 4YHKL 5K1VA 1KJ2A 1O7VA 4FFZL 3RILA 1U3NA 1YSOA 1A4JA 2AMGA 2OI9C 4ODTH 4P2RE 4GG8A 3BVNA 1G6RL 3C87A 3CN4A 3DO3A 3MBWB 4X7DC 3U7YL 1CFNA 4UI2A 5B1CA 4LCWE 1NGXA 1Q9WB 2Y7OA 5CF3A 5CMAA 1OZUA 4JO2H 4PB0L 4CKQA 1XR8A 2G4GA 4AJVA 2BNRB 3IJ9A 3KGRA 4QYOA 2XG4B 4HK0A 4PTTB 5F9WC 1ZLVH 3QJZA 4YZFF 1G7MB 3SY0A 3X3GL 5ALCL 3SYAA 3RWDB 1MAMH 4ZX5A 5CJXC 3CNKA 3D2UD 4XPTL 4N9OB 1NM4A 3FS9A 3KS0H 1U8OB 4JG1L 4K3JH 4ZNEE 3B37A 4B0MM 3T0AA 1F6AB 4OJFL 1DSWA 4AG4L 1E5UI 3IE9A 4LL4A 5AQ0A 3VI3E 2X44D 4DGWC 4FQ1H 1KYOJ 3P0YL 1SDDB 4HX1B 3G5VB 3OKOA 1KELL 1RERA 3ULSB 5A7BA 2J73A 1K4DA 4AMKH 1F3JA 2YPLA 3EJUA 3W2DH 5AUMA 4XO3A 2FL5A 3U83A 3EIFA 4WGKA 1ITBB 5F7EL 1UG9A 3ZT6A 1GIGL 1ITCA 2E9WA 4M4RA 2PO6B 2VQ1A 4ZOCA 4OJYA 2PPEA 4FEMA 5DVOA 3IFLH 3VE0A 2CPCA 3HLAB 2WVVA 4PAZA 1CT8A 5E1HB 4GAYB 25C8L 5D72L 3D4ZA 4AKOA 2Q5BA 3L4VA 3S9DB 2PKDA 1LK3L 2XVBA 1LTXA 4FQLH 3FUJA 2WNXA 3AG3B 4KMTL 4P3CH 4N2FA 1HE7A 2V2XB 2NY1B 1EFXB 2XWDA 4GBXA 1TVHB 4GAJH 3G3LA 4MD0B 5DJ6B 1NFDF 3PE9A 1QTPA 1YO4A 4OIIL 5C3TA 3SOTA 5CM1A 4YSDA 3ZE1F 3U1SL 1RZKH 4EIUA 4NHCL 3BEVB 5E6UB 2E7MA 2HVBA 4JDVA 1BJ1H 2O26U 1PY0A 4JANA 1JHKL 3S96B 3TCXA 3BUDA 5BOPA 1ZHLB 3QUYC 2VXQL 2FO8A 3RL1B 4AW7A 1HCFX 3ZL4H 1XBDA 1A4AA 4QO1A 1HH6A 4X5WA 3FB7B 3OJ2C 1JWMB 3T3ME 2ZOOA 5CGYD 4BE5A 4NX0A 4YN3A 2AJZB 4FF9A 1FL6B 3QJXA 2PCXA 1P5VB 4X98A 4AKQA 5EEZA 4HISA 3DUUB 4DN3L 1E4XL 5IB2B 3F85A 3VFUA 1OHQA 1Y18B 4BXVA 2AXHA 2DS4A 3DUUA 3QGVA 4FQ2L 1BIHA 4M7JH 3VD9A 4HSAC 5CZXD 1C8PA 1EXUB 1F5WA 1I7RB 1KBVA 4NP4H 4RDQF 4HJIA 1W72H 2XVKA 3GMRB 4O2CA 2Q0ZX 2I32A 5CFHA 1I9RL 5B39B 2G75B 2HMID 2BZCA 1HILB 3L2NA 3L7FA 4TPRH 4K8RC 3L4UA 3IE4A 1MHEB 1YEKH 5D2NE 3BEVA 2EYRA 3MBED 4MA3A 2ARJQ 1P7QB 1U95B 4QRUA 1N64H 1E9OB 5LBSL 1U8MA 5JIHA 4KZ0A 2D7NA 3IU4L 3UZQA 4AJWA 3HN8A 2WZ6A 3UGEA 2CJSA 1AKJA 1AGDB 1LP9B 4I13B 4YSSA 4YSEA 4TRPL 4ELKB 3II2A 3DX8A 3WDIA 5K5YA 1IUZA 2VOTA 3BPOC 4XAKE 4PGEA 2EE2A 4NUMA 1IQDB 3QDGE 2MSPA 1QVOB 1QSEA 3AG2B 5FUCE 4DN4L 2DEWX 3O6KH 4WJG3 1CBVL 3EJJX 4PGEB 4LPVA 5IROC 5TFSL 5IJKA 3T4AB 4XNXL 1DDHA 3SE4C 5D93C 3AVEA 4HDIA 3TA3B 1NCCL 4FABL 4KO5A 5DMJB 4N6RB 3E8UL 4R4BB 1RI8A 8FABB 4S10A 4D9LH 1X5HA 1I1YA 4OFPA 3K74B 2HG0A 4QRTA 3TL5A 3I2CL 1OCOB 4E41A 4PRPE 3AU1B 1XGZA 3OKNA 4N8VB 3HBZA 4FLHA 3UC0L 1BPVA 1ESOA 4GMSH 1DLFL 4KK9D 4HGKC 4ABQA 4FS0A 4AQAB 4Z3EA 4QKXB 1S9YB 5C0FA 4X9YA 3SGKC 3VXSE 1I1RA 1BZ7A 1CICC 3MJGX 3N1QC 2CO7A 1BCIA 4N2GA 5CIPA 3HG1D 3RWHA 1QW8A 2GW5A 4ES9A 1NIBA 2NDGA 4NYLA 5E2UH 3EKCA 4YC2B 3QWOA 1Z0MA 1FG2A 5EORL 1O6SB 2ATKA 5K39A 2D9CA 3GBDA 5DHXB 4GOSA 4RDBA 5EOCH 1OPOA 4XAWL 2OCJA 1CF1A 4I3SL 1NGXB 2EDEA 1IT9L 2FBJH 4UTAA 4MWFA 4XNQB 5FWRA 2FR4B 3LKSA 4JRWA 3MAWA 2FJGA 1A3ZA 3JTSB 3RJQB 1DDHB 1UM6L 3SJVA 1GGIL 1S7WB 3ELAT 2DZEA 3I3BA 2Z93B 32C2B 4WI3A 3VH8A 2D03H 3LXAA 4HKXB 5MI0B 4A7QA 1LEGA 1MFUA 4D0CB 1T5KA 4X4ZA 4JFEB 5EN2B 3HI5L 1JRHH 2RR3A 3WMSA 3X1BA 3JV5A 3U4BL 3VU2A 1ZHLA 4HJ1A 2DIAA 2JF1A 1GW0A 4PRPB 4JFHE 1UKSA 3GBNH 4EVNA 3U48A 1YECL 1NBVL 2MCPH 4KKBD 5BXFB 1RIVH 4X8JB 1AXSB 3S35H 3ECUA 4KTYA 3RIKA 1TJHL 3C6LD 3CZGA 1A7NL 1INQB 1WA0X 3N9GH 1MRCL 2B5IC 1UVQB 3DETD 2H32H 4HKJA 4M3KB 4NO2B 3D1MC 1TQCC 3FZUD 2EIJB 3GD1C 1U8PB 3MJWA 1NCWH 3QUMB 2DPKA 4WV1B 3T6ZA 4UUJB 1I8AA 3TTSA 5CEZL 5IR1B 1TYEB 4Z77A 1E9PB 3WS6A 5E1AB 2OMWB 1A14H 3GIZH 1BFOB 4RIRA 3SBQA 5JNYA 1IKFL 2AK1H 3NYKA 4AV5A 1YPZB 5BV7H 3QZBA 1B0GA 1J87A 4XX5A 3UERA 5E8EA 4DCQA 1BYNA 1N3NB 4NBXB 1YHPA 1EXUA 4FMFA 4M3HA 5I74C 4WFGE 1G84A 3VFMB 1U36A 4MJ2A 4UTCA 3VXMD 3DRTB 2O5YH 3MLVL 2X38A 5IIEB 1K9TA 4RMQA 1CICD 3I9AA 2GJJA 4I1PA 5JMOC 2ZAHA 4E41D 1DCEA 5E4OA 1JNHB 1MCHA 4PJ9C 4TSCH 2H1PH 1WQVT 1YJDL 2DLGA 4IBQA 2W9LA 2X5PA 5DJYB 3D39B 2L4OA 5DZJA 2P24B 5ESQA 1ET5A 2RAMA 3KNBA 3QZMA 3KEDA 4HJJH 2AGJH 1I9IL 3QHFL 4L5FL 3KDPB 1F4HA 3MKKA 3RNQB 3TBYA 3QEGL 2VZ3A 3AB0B 3F62A 1OTUD 3JWNG 4H1LG 5LBSA 2IH8A 4JKNA 1RULH 1KXHA 4OJEH 5DYOB 3Q48A 4OLYL 1VKXA 2BPBA 3G5ZB 5DHYB 3WKYA 3K5SA 4IDJL 4O00A 4XP6L 4KKBC 4GUPA 2HTLD 2JKRM 2Z31B 1EIBA 2FNWA 4BKTC 2NY6D 4ILDA 5D7IA 1TZIB 4IRJD 1JD7A 2UY7A 1OM3L 3ZT7A 1KPRA 1HOCB 1U3HB 2DQHL 3L4ZA 4J6RH 3U7YH 4ZUUA 5KVEH 3IDNA 4WEMB 3JTBA 5FYKU 4ODUB 1FL5A 1LMIA 4OQ1A 4XNMA 4JREC 2L7QA 4LCIH 1MVYA 5A2AA 5GS0D 3LN4A 3T3PE 5BS0B 4MNGA 1RJCA 3LQAC 3SGJA 4Z3FA 5DHDA 1X5LA 3MBEC 3I9IA 4LCVA 2W38A 2JJWA 2QQLL 3ROLA 1PYWA 3EJZC 1BLIA 2YOCA 3NSYA 5HHMB 5I2IB 2R1XA 5E08L 2H3NA 2WXMA 2XVLA 4UB0H 4XPTH 4DFIA 4ZUWA 3N1GC 4PIBA 4EQ2A 2HT2C 2AQSA 2KZBA 2AQ3A 1G7LB 4PJXE 2C9VA 4PBDA 5HVWA 4XHJD 1JV5B 4Q9QL 1G7IA 3AQZA 5BOZG 1T1XB 4OCLC 1U8OA 4DETA 1QUPA 4ZTEA 3DROB 4W4NA 1YC8A 3LQAL 4F33A 3KJ6L 3ZTCC 4GXVH 1W91A 4FNUA 2K1MA 2GBVA 4FA6A 1W0YT 5FA3A 3AQXA 2XX0A 1WIUA 4L5FH 4RQQB 4EO5A 4ZMNA 4P57B 4X5QA 3OHXA 5HHNB 1HXYA 2JB6A 6FABH 3E3QE 1YYCA 1T89C 5AZUA 1E5CA 2APVA 5KSBB 4WEEA 1BLNA 3H53A 3QC6X 4TULH 1DVTA 3BZEA 1IFHH 2ZX6A 3L6FA 1P1ZB 8CGTA 3QUYD 1H0DB 1X9QA 3U36B 5LHDA 2NY2D 4O2EA 4DK6A 2XQYG 3L3KA 4YPGA 1JMXA 4TTDD 2V7NA 4J3TA 4I3RH 4RMVA 5GRVK 4PRHA 1XTLA 3QQ4A 1BVNP 3MV11 3VG0H 3F58H 6TAAA 2R1YA 4DUWA 2NRDA 1DJIA 1A7RL 1FFQA 3ULVE 3ORJA 1EGJH 2AQTA 1BZEA 5IF0B 1EO8L 4QHKJ 1RZKL 2AJSL 2QQKL 4MJ6A 1USZA 1G1OA 5DEGB 1KMGA 2CK0L 4GNKB 3QNYA 4M1DL 1JHKH 3NT0A 3GBEA 5SV4A 2NNRA 3FTUA 4I9WD 2YJLA 1G4MA 1CVRA 3FCTA 1LDSA 3IXTA 4OZGF 4D3CL 4JG5A 3R19A 3ZDZB 1YNLH 1GOHA 4Z8FH 5E7FA 3RWIB 4AE0A 5KN5A 4J1UB 3GXTA 1BJMA 1BQRA 2A77L 5CBAB 3THML 2VJXA 1LE9B 2QLVB 2F8IA 3RUGE 1N70A 1KGWA 1NC2A 1XGTB 3TCTA 2F08A 1I1AD 1R5IB 2PNDA 3GSNA 2OYPA 1RIHH 1TOXA 4IQHA 2CGRH 2CA4A 2C4XA 3CV5A 5LCVL 4JRXB 3M7OA 4UT7H 5EZPA 1CXHA 1MNUH 1FNSH 4LLWA 2QGBA 4OCMC 2UZYA 2BVPB 4G7YL 1DDTA 1WFNA 1AE6L 4I1NB 1D9KD 2W91A 4XPAH 3W37A 1V3LA 5FW6A 5J57B 4UYPA 4DWHA 1ZGLM 1UM4L 3IXAA 4NNXA 3ARGA 4QT5A 1RZFL 2VXVL 1NANH 5FDWA 4DZBA 4CDHA 4XBGB 1A6AB 2GY5A 2V4LA 3WTWA 2X28A 5JHDD 4NHUB 1OSPL 1FZMA 3PWPD 4WDIB 4LRIC 1UWFA 4PGBB 3FNKA 1MVUA 3EJYC 4B7IA 1MFVA 3LZLA 4P05A 1DJWA 3KYKH 3KLLA 5CZVH 1K8IA 2CKNA 4G43A 4I8DA 3EH1A 3BT2H 1L9NA 3V9CA 4OI7A 3ZOAA 3Q5TA 3MNDA 5C0GB 1WPCA 4P9MH 1TQCB 1XR9A 1GA2A 2KDYA 1UWGL 2DWYA 3DIVA 1Z5HA 1S9XB 1JZ5A 1JOIA 1SLUA 3ZK0A 2V9UA 2VDPB 1PVHA 2V9TA 5F7WC 2FYYB 2QSQA 1JAEA 5E4EB 1HYSD 1MPAH 4IJ3C 2DQEH 3WNNA 2R7EB 2E8ZA 2V7HB 4FFZA 3WIFA 2YPKA 1D5ZA 1HSBA 5F1KC 2UZYB 2R56L 3DI2B 1JDAA 1Z9SB 4WSKA 3V0EA 3WKPA 4Y5XA 1N7ML 1JN6B 3BLBA 3NRQA 4FHKA 1IBGL 4MMZC 4UAHA 4NRYA 5LGHH 3MGTA 5C3LD 4AG4H 2R0KH 1HIML 5AYQA 2IMMA 1GS8A 2H26B 5EEWA 4HBCH 1HHIA 3HC3H 3GSXA 4WNQB 3EZJB 1D9KA 2NY0C 4P07A 2G9HB 2X1PA 4ZMLA 3FSOA 5I19L 3L5JA 1IZJA 4ZFGL 3ZO0A 3LNFA 4PVBA 2VW6A 5J11B 5C7XH 2VSDA 3HC0B 3SOBL 3A0OA 2AC0A 1Q9LB 5GZND 1U4EA 2Y7QB 2LU7A 3GEWB 4MRBA 4NZ8A 3BEWA 3O45B 3UEZA 2QADC 5IF0A 3PXLA 4R9HA 4H8WC 2JCWA 3KCPA 3DGGA 3CPLB 3JZ7A 3KJ4C 2FWSA 2PYEB 2EH8H 1CFTA 5I30L 2CDGA 4IGBA 1ZGLP 2C4FT 3NABH 4Z0BH 3C5ZD 4F7EA 5E6IB 4NZUH 4NQEB 4WI7A 1UENA 3ZL2A 4P5MA 2J8UB 5F0JB 3PFQA 4UIMA 1TNNA 1NBCA 3LZFL 4UQ9A 1EEYB 5CINH 4N0YH 4GXFA 4FNLH 2EH7L 3HUJB 3PABA 5TDPB 3ZHLA 5TE6L 2UWEF 5GS2D 2KC0A 3RGBA 4PJHB 4OGXH 3LV3B 3TCLA 1N5YL 1T7YA 2OMXA 4KZDH 5DD3L 3ECBB 4X4ME 1MFEL 2NY3D 4JHAL 2RQ8A 3FN9A 3C8KB 4OLZL 4JMXA 2B5IB 4DGUA 4HWEL 4PP2A 3U25A 5FECA 3NSJA 4YFDB 5B1AB 1W80A 2X4RA 4ZSOE 4ESKA 4EN2A 2WIMA 5C0CA 3BT0A 2K9FB 3MUGB 2B08A 4PGDB 3CMGA 2B0SH 2EXWD 1S4IA 4KKAD 5DZLA 3HPJA 4UQ2B 2GT9B 3BPOB 2A1WH 1FNEA 5I2IA 3ROLB 4LP5A 2VLJD 4RWYH 2UX6A 2VDRH 2F5AL 3OQ3B 1JPFA 4JFYA 3N42B 2MKWA 2R69L 1YAZA 4KX9A 1NIDA 5A6MA 1DL7H 1KJVB 1I8KB 2LVEA 3T2LA 2CMRL 5TE4L 3TT1L 3TM6A 3T6VA 4KNSA 4FERA 1CF8L 4MBOA 4RGOL 4ZFOA 3DV4A 1R5VB 3PAUA 1BQKA 3S8GB 2WZAA 5EUOF 2OTWA 4ZG1A 3PAYA 2MHAA 5DQJA 1UKQA 4G5ZH 2Z4TA 3MKGA 3ZHDA 1RLWA 2I60L 2O6PA 2AJXL 4YHOH 3VFRA 2PLTA 1W0VB 1HNFA 4TRPH 5J3HD 5GGUA 5AW6B 3O9WA 3CE1A 5ESAA 2D7TH 2WTPA 5IUSA 4P06A 4XWOD 1KTBA 2C1OB 3KYMB 4X4YB 4MS8D 3D12B 4GG6E 4LO9A 1DUZA 2ICWA 1FVEA 1MI5A 3O9WC 3QI9A 1NFDB 2CKBL 1O9VA 5F1SA 5DVLA 1HINH 2YXMA 1TQTA 4RRPM 4OU3A 1UCTA 1ADWA 1GHFL 1A6UL 2BP8A 1QRND 3GZPA 4FG0A 2EKSB 4IDJH 2VMCA 5FYKL 3ZIMA 3GNMH 2WCGA 4K23L 1XGYL 2HT3C 5CP3H 1PG7L 2VZVA 3CXDH 4PV1C 2WWKO 2X1OA 4POUB 3UC0H 3ILQC 2QDWA 4RBPK 5C0DB 3ARVA 1AQMA 4NQCE 1NFIB 4Q9RL 3EG9B 3RUGA 1K5NA 2R0ZL 4WFED 3ZKNC 1A7BA 1TG8A 2CR3A 5D5MB 4G7RB 4ZX3A 2BSRB 1OGSA 1BAWA 1DQVA 4ERSL 3DRQB 5ELIA 1J5DA 4GRMA 4RMBA 4P5KA 3GUTB 3ARSA 1NAMH 4UU9B 5IT2L 3SKOA 2NXYB 4PJ6A 1BX2A 3B9KC 1RUAH 2DWDA 2H5UA 4G8FB 1IILE 4YK4C 2FSEB 4FFWC 3V5KA 1MREH 5DEFA 4JBSA 4YHOL 1KXVA 3VRLF 3B9DA 1UT1A 1UWEL 2DQTL 3QR1A 5DS1A 4BQ6A 3SQOH 2EYRB 5D7KD 3QXUA 5CGMA 2BZ7A 2HX9A 3T71A 5K9QG 1LILA 1NAMA 2CH8A 2DWEA 1JRHL 5FOJA 4HPYL 5D7IE 3QSKB 4TUOB 4N85A 4Y7MA 4ZNEA 2EJ1A 2BC4A 5B39G 3QDJB 2R51A 4BCYA 4XPHH 5DLMH 3WSQL 2DM2A 1M1SA 1LO2L 2YGQA 2ZXEB 1RIVL 2GYSA 4ZMXA 2JVUA 2EUZA 5MEQB 4M5TA 5A7EA 3PS6A 5FUZL 2HLAB 1CFQA 4F1ZA 1A7NH 1TTBA 3NUKA 3FFDB 3UGUA 3O4OC 1H6TA 1NEPA 3N50A 1EHLL 1HDMA 4AE1A 3UAJD 3CQPA 1FG2B 3OKEB 2XWJA 4JFFD 1X7TA 5FW8A 2PW1B 4X6FA 1A25A 1MIEH 1ZHNA 3O9WD 5JPMA 1AI1L 5GSVA 2FEDD 1A0QL 2UWEB 4KY1H 5JQIB 4IGBB 3DX6A 4JFOB 1OF2B 3CVIL 1MY5A 4OCXL 4OB5L 3JWNH 4H1LH 4MX7A 2E0PA 4TSBH 2C34A 5I76B 1DQLL 1DQDH 4FI7A 4HJSA 3V5HA 1VPOL 3DMMA 5HGHA 2HPOA 1DN0B 3RWJA 4LQ1A 1A7OH 2VZSA 4GI9A 1JPTL 1RUPH 5K1NA 4FP8H 2WVTA 5DK0A 1RU9H 2QQNH 4KO7A 3C6SA 5BRQA 1UEYA 1D5BA 1ZTXE 1L9QA 1QSZA 1XX9C 2F6AA 2OJ1A 5E00A 4LT7A 1YY9D 1CT8B 5D1ZC 1OAXH 1E28A 3GKWL 2ZX5A 3VE0B 3LPPA 1JPFB 3VXQA 5IB5A 3WELA 2WLLB 4ZO8A 4H25A 3BVXA 5F7MC 5IQMA 5ECJE 1JGLH 2BNUA 4PJDA 4PRBA 1X9UA 2H6OA 3MOBL 3ARXA 1FNEB 2Q2EB 4FN0A 4XTRD 5ABDE 1J5OL 4BGLA 3QCVL 3HPJB 1I85A 3VX1A 2RA1A 4U3HA 2FUQA 1ZA6A 4EI0A 2AEQH 5D2NB 2WXIA 1N4XH 5D7LE 4DKEL 1FDLL 3WLBB 4XGZA 1UB5A 7TAAA 2HVJB 4PJEB 1G5AA 4TSAH 5JW4R 2DI9A 4HMCA 3Q6FA 3FDWA 1TCMA 3H1ZA 2R39A 4LL1A 4NQDD 1Z5LB 5DYFA 4GH7B 4NQSA 1A0QH 3FTZA 5F0PB 5E4IA 1YEEL 1BQHG 5H37A 3LV3A 5IHZA 3O6ML 2JK5B 3X11A 3STZA 5JIPA 4WDIA 4L8SB 1BXAA 4JHZA 2DQEL 3O0LA 1QACA 3GXFA 2NTFB 2C26A 1XEUA 4HLJA 2VC2B 4ODWA 5G2NA 2OSLA 3QO0B 5TH2A 1HNYA 3AXHA 1CFMA 5AW2B 3V0HA 3DOSB 1IO4C 1QSFD 1M7XA 3HZMB 3N42F 3QIWC 1AFVH 3BVNB 5EFIB 4DFHA 4XPBL 1RV6X 4FKHA 4JLRB 1KLGB 1MLBA 1AJ7L 4QXGL 3WXVL 5GRUL 3DHUA 2VIRB 2IPTH 1CFTB 1IC4L 1YEWA 3GSVA 4QHMA 4X0KA 4XBMA 5I1LA 1TJIL 5FO8B 4HFUL 1QAWA 3VRLE 3TLRA 4N2IA 3TIEA 4G42B 4NAJA 2O5NA 4AYEC 4U7KA 4N5EC 1GKOA 1E4WH 4YVNA 3ROOA 6FABL 3BGAA 4JW3A 2ZX7A 3KCWA 1U8LA 4Y16B 3VCLB 3VSVA 4YDLB 5DC0A 3HFML 1VFAB 3WJJC 4CU6A 4FLRA 3TF4A 3FT2A 3D18A 4M7ZB 4KZCA 2Y7NA 3CFBB 1CCZA 4EAEA 1IE4A 4Z7WB 1OP3H 5H8DA 3V6OA 5E2VL 4P5SA 3AS2A 3BGMA 2VZTA 2MNUA 4A68A 5AG8A 2HXAA 5JMRA 1PKQB 3DJZA 4WUKH 5FCUL 4J8RA 3QRBA 4L8CB 3QDGA 4OZIB 1Q9OA 1BD2B 1JK8B 3MCLL 2F74B 5AYUL 4NCDA 4F37F 4ONGH 3QFJD 2YD3A 4TQPA 1WK0A 1BF5A 3V95A 5MEOB 4P3WA 1MVFA 3AB0C 5I0XA 2BIPA 2GSGB 2QBWA 1UD4A 1QTSA 3A6BH 2P5EB 3G04B 4FQJL 4YHYC 5KBLA 4NCC2 4P59H 4JM2F 3EGXA 3UG5A 3MU3A 1CZ8H 1RK0B 3HG1E 4JZJB 4XCCL 2XVGA 4FTDA 4DKDC 5DO2D 4PREB 2A77H 4JO8A 1XGUA 1NDGA 5L2JA 4QHPA 2K7QA 2DI7A 4OJFH 3BPCA 1KV3A 4RGMC 3X13A 5L88L 2BIHA 1MF2H 5KVFL 1JI2A 4I7ZC 5F7LB 5FOBA 1UT2A 2RIKA 2EYTB 1B88A 1KCSL 2LTQB 5C07D 5DHVB 5GRUH 1AQKL 2HKAA 1H8NA 3QDME 1KIUB 1H5BB 3V5DA 3HB3C 4KI5F 2NXZB 4LHUB 4K94L 4MKMA 2BSCA 3JV6A 3OKKB 4XPAL 2QGDA 3W2DL 4BZ2A 3CZEA 4OW6A 2VDOH 2ZUUA 1UM4H 2J1XA 4XN1A 5F7EH 5C92A 5I71C 3CFCL 3MV8E 3VFNA 3O41A 2HLFC 4XHJC 1N6QL 2ZOWA 3IXAB 4NNXB 5B3JE 3ZKMC 2CE6A 3NPZB 4YPJA 3NESA 4Y4FB 3ASWA 3MPCA 5IBLC 1FZKB 1F4AA 4BEIA 2WNGA 4Y5YC 1A5FL 3KPMA 1SMOA 4EN3A 2FWOA 5AKRA 1I1AC 1CGTA 4U6VL 4BGDA 4WJKB 2GJ6E 4NJAL 5JXAL 3ZYJA 3MBWA 1XIWC 4GSUA 5JQ6L 1PU0A 3HJEA 2F54B 4LCYB 3FFCA 1AKJD 3VMOA 1O6VA 4LPTA 4NFDA 4CN6A 1UA7A 4UV7H 2M1KA 3OR7A 3LRGA 3BHBA 3UTZA 1X5GA 4WFGD 3PDGA 3IAPA 5IW1A 1OTSD 4QUOA 2VRKA 3UTTE 5IFAH 3PHOA 3NSFA 4PGZA 5TDOB 1KXVC 3ZL1A 3OLDA 2YXWA 4LSUL 2X2HA 4BWUA 3NQKA 5T5NF 2R2EA 4OKVA 3S5ZA 3LOWA 1A6PA 4G8IB 1MRFL 3BPNC 4XWGH 3DX4A 3VB9A 3IDMB 4D9QE 1T21A 3FQRB 1YNTB 4X9GA 1AD9B 4BE6A 5MI0C 4HF5L 2JIXD 4LP4A 5JZ7C 2R29H 2APBA 1OAYL 1KGIA 4LBEB 4PJCF 5J1AB 1M6OA 5GQBA 3DX7A 4TLUA 3TBTA 5ESQB 4Q97A 5HDWA 1HHJB 1SDAB 2MPAL 3BSZH 4XNUH 1A7QH 3PJSB 2XWJB 5D6CA 1TJGL 5CU5A 4MMYA 1T80A 4N8PA 4C56E 5ACMA 3HHSA 3MV9A 3TEZA 1HXYB 3JSSA 2GK2A 5D4JA 4POZD 1VB9A 3Q5OA 4OGYH 3ISYA 2OJZL 1NDMB 2BZDA 2IG2L 3H6JA 4P9HL 4AEIL 1OCZB 3M86A 4FQHB 3UZVB 4YAQA 1ZGLA 1I4FB 3DV6B 4BM7A 5IHZB 1CR9H 4LIQL 3EYFA 4PG9B 5TK2A 2GC4C 3VXRB 3FQUA 4AL8H 2BJML 2HT2D 1J05A 4NZUL 3MRDB 4YXHH 3FF8A 3GMLA 3ARFB 2A4ZA 3UL4A 2OMZA 3HBQA 1PZBA 4PJEA 2J71A 4LPUA 4F7KA 4XPFH 2NQ3A 5JLZA 2MCG1 4HPHA 1DJHA 1NMBL 4MD5A 3TXAA 3FO2B 2AAAA 5GS1B 4LGRB 2BFGA 4W9CC 1WE5A 5GXBB 2AVGA 2PW2B 4P5RA 3UTOA 4PCTA 3TO4B 4OGXL 5IVXE 1ODAA 4ZS6C 5T3ZD 4IS6B 4PJ8B 5FYKD 1T0MA 5A16A 1ZT7A 2NSQA 3U1QA 2WO2B 1IC5L 2HJKB 4M5SA 5J56B 2YXVA 3GRWH 5K9JH 2BDNL 2WM0A 4DP2X 3FQ4A 4ZQTA 4JR9H 1HOCA 3T0BA 5BMFH 2VQ4A 3LNEA 1JGEB 1OAQH 1QEXA 4TKWA 3BYTA 1NFIA 1KB3A 5B38B 3VGAB 2DICA 4KPHH 1NOAA 2CA3A 3BN9D 3LPFA 2JXMA 2I9TB 2Y5EA 4Y16C 4GMSL 2R0LH 4V33A 4MYPA 5CWSB 2H2PD 1WHPA 3UTSB 5I1IH 3KXFB 1BFVH 4Y4KB 4ODXA 4MX7B 2CMRH 5TE4H 1TZGH 2F7OA 4NYLB 3P77B 2C1PA 5E2UL 3ZR5A 2AERT 4Z9KB 1JNHA 3EYOB 3REVA 3FQTB 2DBJA 4F7MA 4D9RD 2BRRL 3X1EA 2IWKA 1FVEB 1NFKA 4JM2A 5ISZE 1JZDC 3BVDB 2VMDA 5AVQB 5IIEA 3GMPB 4N0UB 12E8L 1ICTA 3BSZA 3NRPA 5FW7A 3LQZB 1F45A 5F2FA 43CAA 5JXED 3X1GA 4WSGA 5C0ND 2E5EA 2HKHH 1WICA 3PGCB 5DXWA 2FQGA 2RBLA 3T09A 4ETQB 1BMWA 4QRTB 3HI1A 3Q13A 3SDCD 3JWDC 1F02I 1CC3A 1OAXL 4GLRH 3ESVF 3VXUD 4HJ0D 4HK3J 1PIGA 4L3AA 4PJEF 4UUJA 5LVEA 5ID1B 2K6YA 3BZFA 3GBNL 4BINA 3DETC 4MZ3A 4AYSA 2ORBL 2F7QA 4J2QA 5DEJA 5J5EA 4RMTA 4UQ3B 5DVPA 1H9DA 3S3CB 4OM1L 4HHGA 2ZXQA 3RBSA 1GSMA 5C09A 1LDPL 3G6JF 5B7EA 2FK9A 1C1EH 4HZAA 3SZKC 1MW1A 2P5WB 2Z8VC 4L1TA 3UBHA 1KGUA 5SX5H 2WQAA 4XVJH 3EJSA 5LGYA 3UADA 3VD0A 5SX4I 5B38G 1KXTA 1AHWB 4PJGB 4MLIA 3R4DA 1WUNT 4R26L 1T2XA 1SBSH 3SKOB 1CO1A 2RD0A 1WAEA 4PRAA 3UFIA 4YDLC 3NSXA 2DM3A 3NIGF 2PO6C 2VDOB 2A9BA 4LLVA 3L3OC 3B9KB 5CEZE 1UD3A 4XNZB 4OM0H 1Z3RA 1XXDC 3TBSA 1KB9K 2CRIA 2GITA 1IC7H 3F84A 4X80H 2ZCLL 3GXNA 4G8GA 4L3CB 4AIEA 1NCOA 5IM7B 3KLQA 3D08A 2PWFA 1V8HA 3DUSB 2RMNA 3HE7B 3HUJA 4N5UA 1C5DA 4TNVK 4PY8J 4NDMB 3MLUL 3T1FA 5E9DD 1E8YA 3HZ3A 1GYUA 3A6OA 2IH3A 1Z3GL 1UASA 4BWTA 1AG0A 3EO0B 4WW2C 4IRSD 1A9BB 1JV2A 1DQIA 1TZ8A 3OAWA 2EVIA 1SUHA 4OZIE 4PP1C 4XPHL 4C57C 3FB6A 2O5YL 3MLVH 3MUZ1 5I8EA 3FB7A 1LP9F 3JBG7 4A55A 1RAMA 1KJ2L 5T33H 2LW3A 4X6DA 4X6BA 4OLYH 2CRMA 5FUZH 5I75C 5EU6B 3H42L 1AR2A 5FX3A 5IK3A 3MRKA 1K6QL 2Y7QA 1LWRA 3P1VA 4P3DB 5GGQL 4RRPA 3O8XB 4FQXB 5AD0A 5BO1H 3IJYB 4N6RA 4R4BA 8FABA 3FQNA 3W56A 4GRLC 1OT1A 4QHNB 3QDMD 3B56A 4WFFD 3OAZH 1MELA 4F93B 3QEGH 2G9HA 5IKCB 4A6YL 4OT1L 2O6EA 1XF2B 5HD8D 1MCOL 1FVDA 2W8CA 3FO0H 5CP7B 4GKLA 4AENB 2IBZY 3EYQC 5EZIH 3H2PA 1GYAA 2F19H 3A6BL 1PCXA 1KGXA 1Z7JA 1Z1WA 4Y5XB 1N2RA 3GMMA 1KWKA 3AGVA 3BP6A 3O2VH 2B14A 3ZHNA 2VXUH 4LCWD 4X80L 3A67H 4UT9A 1AGDA 1LP9A 4Y8AA 4LAQL 2ZSVA 1MCPL 4IBZA 1DBMH 5IHUH 1N0LB 2CJTA 4P0DA 4YLBA 2PW2A 1QWHA 4OZIF 1E9OA 2NW3B 5L88H 3WFBL 3B3BA 1IJ9A 2WNKA 4NP9A 3UEQA 2CRYA 2X2IA 5F88A 1OW0A 2A6JB 1J8HD 4OTXH 1BM3H 1GPOL 3VNYA 5D7JD 3NP4A 3LQAH 1M7IA 2EILB 4S2SA 1EANA 4X6DB 3O4LD 4QNPE 3FQTA 3QPXH 2WO4A 1AH1A 5CLTA 1L5GA 4N2KA 5BO0D 3MA9L 2WLKA 3RZCD 3FB8A 4ODXB 5I1DB 2IXQA 4F2FA 4L9LC 5IHHA 4A2EA 3H42H 4U6HA 3QCVH 4KNTA 4YDVB 1YNKL 3VVWA 1G7MA 2D3JA 5DC2A 1ZWIB 3PNWA 3H55A 1K6QH 5K69A 5TDPA 3V10A 4AEHH 5TE7L 2OW7A 3N43F 3ZGHA 5DO2C 2UXFA 4Z95L 1RK7A 1ZLSH 1JZHA 1Q9WA 3JQOB 4N1HB 3UAJA 4G8GB 4L3CA 3OGOE 1KBPA 4NRZA 1TETH 3VVVA 4FQIL 4AW4A 2WTOA 3MLYL 2VR6A 4L4VA 4PJFE 2IAMA 4Z7UB 3NZHL 1KB5H 3RTQD 4XWGL 4C4KT 5JTWA 3EGSA 2BS9A 3RWIA 2IC2A 4XXWA 3ATFA 3SPGA 3BH8B 3HNVH 3TBCA 3GS7A 1LO3L 3D0LA 2A73B 2YZ1A 3GHEL 3KHOA 3BMWA 4D0DB 3BO8B 1AHWA 3VQMA 1XSKA 5DFTA 5DWUL 1NGWB 3CHXA 2P8LA 1T5XB 4KX8A 3PHOB 3FQ2A 3GJFA 4MAZA 4NZDA 5DT1H 3T08A 1OE3A 2J2ZA 1PX3A 4JDTL 4XCEB 3IJ7A 4X6DE 3DX0A 3MRDA 4AM0A 3L3KB 2GIMA 4YPGB 1MCEA 4C4KO 5DK2B 1IC0A 3K4ZA 1RZJL 4NUPA 4EKJA 3B7YA 1IRAY 4K3JL 1GGBH 3FQYA 4IOSD 4HW6A 2NX5B 4FLOA 4HKZA 3HKFA 1F6LL 1F3JB 1JDDA 3QRFM 2QEJA 3K8KA 3KZ8A 3F7PC 3WTTA 4RFEA 2EIZA 2YD9A 3EYVB 3N06B 1FGNL 3PPSA 5FPIA 4DPCX 2YN3A 4K3HA 2PXYB 3W0WD 4ELME 1AZRA 1E4JA 1D6VH 1WIPA 5BQ7B 4WRLA 1R75A 2EDXA 1QLEL 3KWUA 5CJOH 4DP9X 4X6CB 4MJJA 4TUJB 1JGUH 1J88A 3BPCB 3X13B 5F9OL 3CCHB 5L2JB 2X1WL 3EO9L 2E7BA 1N8ZA 5C0CE 3MI6A 4BSWB 1CZ8L 2OTUA 2C7FA 4QF1B 4K5LA 4B97A 3MJ9H 3HBGA 4PW3A 4W9GC 5DJ8A 5K9JL 5DSCA 4MNGB 5CR1A 3ZGIA 1HNGA 4KTGA 4XBEH 5DDHB 4HPOL 3GMNB 2YGOA 3WKMH 5DWUH 4XZUB 3I50H 3T2PA 3RWCB 3GF8A 5TDOA 1BEYH 2NY4D 4LLWB 3V9FA 4NHCH 1BJ8A 1V54B 5FKPB 4L8DA 3QEQD 4K94H 4ZFGH 2VN5A 1JGEA 3OC8A 3FFCB 1BWMA 1ZPLA 1ROWA 4YK4B 4FI6A 1UADC 2YPVL 4JQIA 1NUDA 4FJYA 3QJTB 4MQTB 3U82B 3G5ZA 3WHE0 5C0BA 1K3IA 1V3MA 3LY6A 4LNRB 5CIPH 3IDXL 3R0NA 2Y5TA 1JPSL 3DIFB 1WWWX 5DLLA 3WY3A 4DN3H 3T8XA 4ZZFA 4UTAL 3Q1SH 4OAWA 15C8L 1AC6A 1FGVH 4M7JL 3T1WA 4RMUA 3L81A 4XN8A 3CFKA 1KWGA 4AQ8A 3FO2A 1LM8V 4A2MA 1LD9A 2CGYA 4EDWL 3VXNB 2Z1PA 1NGYA 3OSVA 4LVOC 4P23C 4QWWC 1KOAA 5FM4A 2ZUYA 4XMTA 4WK0B 2AEIT 4JZOB 4RCAA 2V5SA 1ONQB 4GG6B 2P46B 3P3SA 1F42A 4H2AA 1H0DA 4Z3IA 4L9DA 1WA2X 3S36X 3EO9H 1G6RB 2DW5A 5CJ8A 3R7RA 5DD6A 4XB8A 2YRPA 4IBLT 3EGDB 5AVVB 4ZMPA 3QISA 5I6XB 2CK2A 4DGVL 3OAYH 4OFYD 5FA4A 4N90E 1P84J 1I7ZA 1PSKH 5TF0A 1SOKA 3EGDA 5I1AA 2VDQB 1XTMA 4KXAA 2B16A 4F27A 5FB8B 4Y5VB 5HHQB 1L6ZA 4OCSL 3MUHL 1JZ4A 4XE5B 1XH3A 4U1NA 4BKLA 3CVBA 5ICUA 2E9BA 4B9JA 1X6NA 2WLIA 1SVBA 3S37X 5I1CH 4JO1L 2QGEA 1TNMA 3KD4A 1HHJA 3EDEA 1G7IB 1F90H 1F4WL 4NIKB 4BHUI 4E42B 4HGMA 4CL7A 1JV5A 3HBPA 1MCNA 3L9BA 5EIIG 3FL7A 3OLEA 1KLUB 4HAFA 2WN3A 2YFOA 5BQDA 3OKMA 3P9MB 4XCYA 4ZMWA 3CDZA 3SDAD 4JPVL 1WRFA 3BPNB 4ZMQA 3ECQA <