5CGBA

Crystal structure of fimh in complex with heptyl alpha-d-septanoside
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Protein FimH
publication title Impact of ligand flexibility on FimH-antagonist binding a case study for substituted oxepanes
rcsb
source organism Escherichia coli k-12
total genus 37
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 5cgbA00
4XOAA 2JTYA 4XODA 4AVKA 1N0LB 3ZL2A 3BFWA 5AAPA 4XOCA 4XOBA 3JWNE 4XOEA 4BUQA 5FWRA 1UWFA 5AB1A 2JMRA 5F2FA 1ZE3H 5LNGA 2UY6B 5LNEA 4CA4A 1KLFB 2J2ZB 4X50A 1QUNB 1TR7A 2W07B 2XG4B 4AUJA 5FLUA 5CGBA 3SQBB 4X5RA 4XO8A 1PDKB 3BFQG 4AV5A 5IQMA 5FX3A 2UY7B 5ABZA 4AUYA 4AVIA 5IQOA 4X5PA 5JQIB 4X5QA 4J3OH 3RFZA 3ME0B 4AV4A 1N12A 4ATTA 3BWUF 5FS5A 3ZL1A 3JWNH 4J3OF 4LOVA 4CSTA 2VCOA 2XG5B 4AVHA 3JWNG 1KIUB 3MCYA 5AALA 4XO9A 5IQNA 5F3FA 4AV0A 4J3OG 4AUUA 4CSSA 3ZPDA 2WMPB 4AVJA
chains in the Genus database with same CATH superfamily
1H9DA 2D0HA 3AZUA 1I8KA 1OTSC 1CU4H 4K8RL 3RZCD 2VC2L 3G5YA 1TTGA 3ZRCC 1YEKL 4QRBA 4X7TB 1KJ3H 4W93A 3VH8A 5GRXG 3NTCH 1L3WA 3ARDA 1PIGA 1CLOL 1FH5H 3ML9A 4P07A 4U1GB 2PR9A 2PN5A 1HXYB 4B5ZA 3O8XA 1WK0A 4Y9BA 4DN3H 1MRCL 3ZUNC 1WICA 2ISDA 1F41A 3VQ1C 2BRQA 5B1BB 2NY2D 5I0YA 3LKSA 1S2EA 2DLEA 5LNEA 4FLHA 2H41A 3NIGB 4WFGD 2Y0SA 4PG2A 1WFTA 4UUJA 2WUBH 1CL7L 4ETQB 4Z5RB 3IBEA 3ULUL 1DBAH 1L0PA 5BOPA 3KGTA 3EFDL 4E9WA 4H26B 2ZIDA 4HFWA 1MVUA 1A3RH 1H15B 1OQXA 4KTDL 3HMWL 2DQCH 3Q1EA 5F7EH 3BGAA 1A6AB 3S35H 3S5LA 1JZFA 4H7VA 4JGMA 4QF1B 3MNDA 2BH0A 4WWOA 3BH9A 3S48A 1K5WA 1H3XA 3ARZA 3UDWC 3NDZE 5TQ0H 2KPWA 3L13A 1A9EA 1C08A 2MCPH 2ORBL 1KGUA 4N0YL 4KAQH 7FABL 4U6YA 3VWJA 4GAGH 1HKLL 2F9BT 5ICXA 2ZSVB 3QUZD 4IU3A 3OX8A 1E5BA 3BP7B 4QCIB 3I6SA 4RRPA 4AMXA 3CBRA 4GUPA 4U1LA 3EAKA 4HP5A 2R2EA 4A37A 4MD0A 3FQRA 4GW5A 2XIIA 2DQMA 4F80A 5C0AA 2FYYB 1Q9OB 2VUYA 2Q20A 3QNXB 3IJEA 3T2PA 1JGEA 5EOCJ 1R47A 4MMZA 4DERA 2EIEA 4JG1H 5L6YL 1J5OL 3IVKA 4X5WB 1R33A 3S36X 3HRZA 1CTNA 2OZNA 3D05A 2ICWI 3LZFL 3VG9B 1GTFA 2OI9C 3D1MC 2A0LC 3VXRE 5C0CA 5CEXA 3UACA 4Q9RH 3O6LH 4LSVH 1UOWA 3K0WA 3MUZ1 1QBBA 4RZKA 3QR2A 1IAKB 2V5MA 4K23H 5AOLA 1BFTA 2ZKHL 4KXZI 1WH0A 5DGQA 3R7QA 4IBUA 2P5WA 2WVVA 3GSUA 4GSQA 2BDNH 3FB7B 2EC9T 4FFVC 4XHQA 2VIRA 4FEIA 2C9RA 4KHXH 1N5AA 2CO3A 3DUUA 4P2AA 3PWPD 1QASA 5LBSA 1JOIA 4LLMA 2GSGA 1KJMB 4XBEH 5KBMA 3RWHB 4NKQB 3ZKXC 2AJSH 3D0LB 2K70A 4KDVA 1BZEA 3DX8B 1L9NA 1N0LB 3TV3H 1F1GA 1XFPA 4M02A 4F7TA 1TQTA 1T0MA 2WC7A 3PGDB 4XTRD 4OCYH 1D7DA 3CZFA 1CQKA 3TO4D 4X99A 4J8RA 1XF5B 2OSXA 3CFKB 2Z8VC 1JUFB 4PRPD 2R51A 2PYEA 5FO2A 3OGCB 1S7SB 3FHEA 4Z7NB 2UY6B 3UAJD 1IQDB 1ONQB 5HP5A 1CXIA 5AQ0A 3VSTA 1GGBL 3GI9H 1BVKB 1VKXA 4KKBD 1ZXKA 3MR9A 3O6FB 5DK0B 2DEXX 4NQED 5H94B 1X5KA 32C2A 6PCYA 4PJDA 1WBYB 3NJVA 3B9KB 3CLFL 3RVXC 3KLHD 4KX7A 2BZDA 2Z4QB 1MHPH 1X7TA 4U1SB 1K8DA 2CMRL 5HHXH 2W1NA 4BFJA 3ECQA 4H1LA 4KK8C 3IJSB 3UZQB 2HCZX 3QUXD 5D8JL 3S36H 4I87A 1M7IA 2GQHA 2HT2C 1FL5A 3C5ZA 2IAMD 5D7LA 4PIBA 2D7PA 3HUJF 4ZUUB 2HG5B 3H6AA 4Z7IA 1GVIA 3IDYC 4Y4KC 4PJ9A 4FHJA 4LNRB 5D70H 5D72H 5C0IB 3HKFA 2I9TB 4JFVA 1TZIA 5ECGA 2RGSA 2WQ8A 5DJYB 3TFKD 2WXJA 4K2UL 1T1XB 1CF8H 3MRDA 5DD3L 4P2OB 3RL1B 1GYAA 5IJBC 2GK0B 2NY5L 4NZTH 3HFML 4QRQA 3CWGA 1YN7B 4LGSB 1BJ8A 3ZBMA 3M8OH 1OB1A 4M7LH 3GDCA 5BO0D 5I1IL 1JI2A 2GITB 3ZSTA 2DEYX 3UGUA 1G4MA 1PAZA 1OPGL 5C08E 1VESA 4EN3B 1XIWD 1LP9A 2G4EA 2UXFA 5M7QA 5D1ZC 5J1SC 3O3BB 3LRSB 3RLSA 5GRVL 4OLVH 5C08D 2ZX6A 1NM9A 2BXYA 5DK2B 1MRDL 3Q8BA 1FLTX 5BVJB 5IMLA 4G80A 3LH2H 2H6UA 2ZYIA 2VERN 3T8XB 3QYMA 4RGMC 1F3DJ 1JPST 2OZ4A 2HLAB 4HDIB 5J06A 1DLHA 1I75A 3KE0A 1SYVA 4XPAL 5GSVA 4PJ5D 1MFBH 4PJBE 3PIQB 3KPNB 5EH1A 3VXPA 3P0VL 4F8NA 2AABL 1VA9A 3HZYB 4K71C 4J4PD 4JPVL 4YBHA 3WIHH 4FMFA 4WRLA 3HG1D 3Q9PA 5I19H 5FC9A 5D2NB 2K8QA 2PWFA 1FYTD 4TVSa 5MEPB 3W38A 4OIIH 2BOCB 2VM4A 2VXQA 3QIWA 4G1MB 1A6TA 5AD0A 1FC1A 1CU4L 1N26A 4FS0A 5DURB 4LEEA 3RIAK 3S2CA 4H0HB 3OKOA 4F8LA 3V7MA 5TTRA 1IC0A 1T5XA 5F2FA 1KJ3L 3C60D 4NN5B 3AXIA 1LMIA 2LOEA 3JV4B 4NYLB 4YHMH 3KR3H 4BA8A 4ZUSB 3FTWA 3MRPB 3VA2C 1NKOA 4I9WE 4N2KA 3NTCL 4PLJC 5DEGB 3ZE2F 1FH5L 4YSQA 1MUJA 4AKPA 1F6AB 3FQTA 4JZNA 3RX7A 4YMPA 2CZNA 3ESUF 3FULA 4XO5A 3FQWB 5A16A 4XBPA 4E5XG 2OXGA 2EVJA 3T1FA 5J4MA 4PJXA 4OZFA 1ND0A 1KBBA 1USQA 2BC4A 4L4TA 2QFRA 2XPZA 5E4AA 5HDWA 5T1KA 1L0XA 2OYLA 4B0MB 4ZSOA 3F7VB 3ISWA 3ES6B 3DLQR 2WUBL 1Q1PA 4Q6IB 3RNKB 1DBAL 1TETH 2JKXA 3TXAA 3DGGA 3WNNA 2ZSWA 3EXJA 5HGHA 1A3RL 5JQ6H 5F7EL 2DQCL 4LEOA 1XB6A 3S35L 5L0QC 2F61A 2Z6FA 4V2BA 1AKJD 1GJIA 2DF3A 1XGRB 1M9WA 3GK8H 2P49B 3G5XB 4L3AA 1DVUA 3RWIB 1RHHB 5TQ0L 2Y7MA 3GO1H 2VNCA 2IJ0C 2MCPL 4KAQL 2CKBB 1HU8A 5AENA 3D4YA 4GAGL 4G8EB 5DR5H 4CUCA 3LN4A 3FN9A 2UWEE 1M2VA 1O9VA 1ZLDA 4RISH 3PHAA 1ZLUK 4AY0A 3C8HA 3DTXA 5HVFB 5ACZA 5I2IB 1JJUA 2OPCA 3NH7H 4APQB 1G1CA 1HZKA 43C9B 4LHUG 3QH3A 1UHVA 3SCMC 4U7MA 1LEIA 3NG5A 4XO9A 1C7SA 4JG1L 4DESA 1A7NH 4GRWB 5DJXB 3RP1A 3S8WA 4LEXH 4LQ1A 1MCOH 1LNUA 4YBQD 2WLLA 2A6DA 5DMIH 1A4JB 5BRZB 2YRLA 5F7KC 3STZA 2OL3B 4N2AA 7PAZA 4X98A 4Q9RL 5C2BH 3O6LL 3FSAA 2KC0A 4LSVL 4AVKA 1V10A 4K23L 4UQ3A 4ANKA 4UCFA 1KB9K 3EGXA 3SGKA 3QJZA 2BDNL 3TN0C 2YPLA 5AUMA 4KHXL 5GQBA 5HGBA 6PAZA 3FUHA 4L1HA 4X5XA 3CSYB 3EJYC 3B2UC 1W80A 3K0YA 1SJHB 3GBMH 4XBEL 2OTWB 2VMEA 3QUYD 3LH8A 3EH5B 2AJSL 4FHKA 4OF6A 3HIZA 3EYQC 4MB4A 2BIHA 4MQ7B 4O00A 3TV3L 2W80C 4X6EA 1M57B 1X4YA 1LO5B 1OARH 5IVNA 3AXLB 4OCYL 4WFHE 5FYKH 1EJ8A 1MW3A 3JTTB 2B1AH 3BLPX 2GK2A 3RWFA 1NAMH 3ALPA 3NA4A 2L7QA 5CZKA 4IGBA 4JUSA 5ESQB 3TCLA 3WXWH 3I85A 5AZUA 4TMPA 5GISH 1RHFA 4JDTH 5FYLH 5DFVD 1RZIB 4QXTA 1CT8A 2H9GA 3DC0A 2WSDA 3DX6B 1BIIA 3HZ3A 4GBXB 1OCZB 2X4NB 1AGEB 1OO2A 2FVNA 4PJGB 4OKDA 3MV8A 3M17A 5HYJB 1U36A 3GI9L 4MA3A 2WINB 3RILA 1MFEH 3G08A 3E9UA 3PUUA 1KZQA 3Q7JA 3V5KA 1C9SA 3MXWH 1G7IA 4IRSC 1OF2A 1XGQB 3V79C 2C5DC 5I6NA 4JS7A 1RZKH 3SEPA 5C92A 1FUNA 2FJGA 1NBVH 1TTCA 1ZS8B 1PNCA 1MHPL 4QMEA 4Y9EA 2AQRA 1LK2A 5HHXL 4BCXA 1T3FA 3ZTNH 1P69B 2EYTA 1CDCA 3AGVA 1RJZA 1U93B 3AXHA 3BD4A 4U6HB 5DFWH 4WW2C 2CKNA 4JHWH 15C8H 1VDGA 3S36L 4PGDB 2Y69B 1V3KA 3VYNA 1TEGA 1XO8A 1OP3K 4MX7A 4QHUA 3ZW3A 2WJ5A 3GF8A 4J39A 2FIKA 4ERSH 4E68A 5IEHA 4FZEH 2F19H 3ARGC 5GRUH 1HINH 5E9AA 1BQ5A 1UD8A 5T1JA 5D70L 5D72L 4APXB 4A6YA 1JWSA 4P23C 3LZRA 1TJGH 3CFBB 4PJ9C 2KDGA 1QEXA 3BGFB 3MGTB 1CF8L 1TENA 2BCKA 4R4BA 4AZ8B 4F9LC 5EHFA 1K5NA 4NZTL 2YBGA 3UYPA 5AALA 2FNBA 1PZCA 4NC1C 3M8OL 4M7LL 3CSTA 2WZAA 5D6DA 5C8JB 2G2RA 3C75A 3UJJH 3H85A 4IKNA 2XWEA 1B4JH 5C09A 1WFOA 2Y5QA 3SZ6A 4HMDA 3UGXA 1DFBH 5EWIH 3FFCA 2DICA 4KNUA 4JFFA 4OLVL 1NPNA 3RUGB 4Y5VA 3FB5B 1AGDA 5AAPA 1J10A 2HFFA 3LNEA 3MRLB 1N7MH 5DLMH 1W72B 3LH2L 5FPIA 3RFZC 5I8CB 3PDOA 5I30H 3F2LA 5JZ7D 2NR6A 4Y1AA 5E6YA 1JDAA 4WHCA 1DQTA 5C07B 4IHBA 1MFBL 1AOZA 1CDUA 2CO2A 3BSHA 4XCCH 2CPUA 2P8PA 3O6FD 1BAWA 1BGXH 4P99A 2ZOKB 1KTRL 4PY7A 5H37G 3WIHL 4HD9A 2XBDA 4I0PC 4X8JB 5I19L 4QHPA 2WVSA 5B22A 4NAJA 4OIIL 3LKRA 5HGAA 4KXCA 3DDGA 3FYIB 4LOFA 3VW3H 3G6JA 5HHPA 4HVBA 4QO1B 5E8PB 1PDKB 2JV6A 2CDGB 4Y5XA 1JRHH 2D31B 1EEZB 5EOQH 4DPRA 3QIWC 3PHSA 4NUJB 5E03A 1YPZB 1XGUA 4YHML 1GRWA 3KR3L 3INUH 4PAZA 4X4XA 4Z3EA 3VNZA 4Z7AA 1H3GA 5I0VA 4OKVA 4M7ZB 3KBEA 5E2TH 2VDMB 5D7EA 3IDNB 1AD9A 2XFGB 4QRPE 3BX7C 5EBMB 3HBGA 1EAJA 1G1OA 3UTTE 4AYSA 4ZD3H 5HYSB 5I5IA 4N2IA 5CXPA 2VDQH 3P3UA 1H6TA 1JVKA 3RTLA 1E42A 3CVHH 2R29H 5E9DE 4KXAA 3V95A 4P2OD 1R24B 1HTYA 2WIMA 2W65A 1ZV5A 3JT0A 2YN3A 2JIXA 1DZBA 4N9GB 3CFIC 1NCWH 2YAQA 4JB9H 1TETL 1WSST 2EDRA 1Q90A 2PYFA 1UCTA 4GG6E 2WZ5A 4X5LA 5AVTB 3HG5A 4LVHC 5JQ6L 4P3DB 3JWDH 1T4WA 5DJ2A 1LGVA 4EN3D 4QRUA 2YXVA 2ID5A 4JO5A 1E0OB 2ZNXA 4J3OC 2O72A 3O2VH 4FG2A 3BGMB 3GK8L 4HHWA 4N90D 4CMHB 2JQAA 4I88A 1P84J 1MFNA 1RPQA 3U1QA 4HQQH 3U2SB 5KAQG 3CSPA 1SVBA 2K45A 3DRQB 4B3VA 3OMAB 4LSPH 3VCLA 1SYSA 1OAZH 3GM0A 5DR5L 1DJZA 4RISL 3FW6A 3CVBA 5EN2B 4LLUB 4PR5A 4DT2A 1IARB 4LDOB 5J13B 1T7YA 3SPGA 3NH7L 4CMMB 2HRGA 2OTPA 1KNOA 1S7VA 2RBLA 3FQ4A 1LO0H 3QS2A 5F0PB 4L3EE 1ACZA 1B4LA 1ZEAH 4LEXL 1MQKH 1MCOL 4GPVA 5IIEA 1FHNA 1PBYA 4NQVB 5F7NC 5DMIL 5HJBA 4EE2A 4BGDA 4UV4H 2JK5B 5TK4A 2R2HA 3CN3A 3SGDI 3UL4A 4TTDC 1HL4A 5C2BL 1QYGH 5IHHA 3QO0B 1E5AA 1BBDH 4CC0A 5EBLA 4WV1B 3QEQE 5K1VA 5BQDA 2VAAB 4ZNEE 3S8FB 2W0LA 4O9HH 1SOQA 3HBPA 4K3GA 3BHBB 2HAZA 1ZT7A 4U3HA 1G9NH 3SQBB 3GSXA 3GBML 5JPNB 5FUCC 2HMIC 1FDLH 3L3GB 1QSFE 1TJMA 4EI6A 4K7PX 3A24A 2GSMB 3RI5F 4L8CA 4UTAH 3ZDZB 1OARL 4JJOA 2IPTL 4I7ZC 5FYKL 2W91A 3VB8A 3QJFA 3TEUA 3MJWA 2XNAA 1P5UC 4CC4A 2BNQD 4DP8X 2B1AL 1NBYB 3H9SE 1GOHA 4UNVA 1NAML 4G83A 4PTTA 1ORQA 2PPFA 1G1KA 3KEDA 4L9LB 4X5PA 2DZEA 5GISL 4JDTL 5FYLL 5K1JA 2IQAA 1OAJA 3FRUB 1OTTD 4PRAA 3FQ1A 2DWEB 4QXVA 5FM4A 4QAWA 4IGBC 4M5ZH 1UH4A 3IRPX 5INDA 3BKJH 2H6PA 4HUXB 3D0VA 4K15A 1U33A 1MFEL 1HH9A 5DU7A 1VCAA 5FKPB 5FCSH 4N2MA 3DWTA 1ZA3B 3EW3B 3C09B 2Y72A 1H6EA 3MXWL 3W39A 2ATPA 4C8XA 5E0QA 5A6IA 2UZXA 5K39B 1RZKL 1F3JA 4Z7QB 4K8RC 3HZVB 1DDHB 1Q9KB 1S78C 1NBVL 5FUZH 3CPUA 3L5XH 3VFVA 4BH7B 3I74A 4F3FB 4FULA 4APQD 5K33A 1U3HA 2WO4A 3CSBA 3QORA 5TDNB 2VSKB 3ZTNL 2P47B 5EORH 2F8XC 3QCTH 1NWOA 4RA0C 1EXUB 2PO6C 4JHWL 15C8L 4HKXB 4ZT1A 1AQKH 2ZOOA 2GJZB 4JO4H 3VXRA 3UPRB 3E1F1 3MYJB 3NSYA 5EIQA 4OZGF 5BRZD 2O5XH 3H9HB 4ERSL 4FZEL 2F19L 3AGWA 2A74A 5GRUL 1HINL 3W11D 5IW3A 1DUZA 2WLHA 2QKIA 1X5IA 1A3QA 4GLRH 3O9WC 3IDGB 3HCVB 2AERT 1AQMA 2X0WA 1AO7E 1TJGL 1E6JH 4YS4A 1MEXH 3X1BA 2B5IB 4Y4HA 1DN2A 4U4BA 5KWYC 1C8QA 2PTVA 4PJAB 5IROD 3HFFA 1KCBA 4RQQA 3NJKA 5DHVB 3FUMA 4QJ5B 1AR2A 2F18A 3UYRL 2KZKA 2B8OT 4BSJA 4K7PH 5KYUA 4F7CA 2BNRB 5EDXA 3GLAA 2V9RA 3OZ9H 3UJJL 1CMOA 4ANWA 5J8OA 3VFOB 4JANA 2X10A 1B4JL 1RP9A 4ZK8A 3DV6A 4XN2A 4AE0A 4YSCA 1WCBA 2TSAA 3F12A 3LKPB 1DFBL 4ZUTB 2DQDH 3KYMB 4L8DB 5IBLD 4TTGA 4AC4A 1PGRB 2PNDA 2XWCA 1BZ9A 3L7EA 1FNLA 3AS0A 3K6NA 4HUMB 3WJLC 4BHUI 1KSRA 5HYJE 3CN0A 2IXQB 4P4RB 1N7ML 5DLML 3QZBA 2QR0A 4EI5B 5HYIA 3ULUF 2JJWA 3PREA 4WUUD 5C0NC 4HW6A 4Y5VC 5I30L 4J3SA 4YGVA 3RVWC 1UA7A 3FO9A 1HEJC 1QRND 3D3VD 5HYJD 2DWYA 2W07A 1F4WH 4XCCL 4F5CE 1BGXL 1ID5I 3SE6A 3NRFA 1DZ0A 2QVKA 4ILDA 1KG0A 2G2NA 1CICC 3W9DB 2UY7B 3RWGA 5ACMA 1WFNA 3VW3L 1QVOB 3CN4A 3I2CH 3JZYA 1RUAH 3CHOA 5D6CA 1PZ5B 5CLXA 5C6TH 5FWQA 4KDTA 2NRDA 1KXQA 4BJLA 5AB9A 3OKEB 1JRHL 2F1EA 5EOQL 4CVWA 1J0KA 2WXLA 4NQSA 4AIXA 4ZO7A 3INUL 2PETA 5G5DA 1R75A 3LXCA 2EP6A 2ZOTA 1IGJA 1U8PA 4XMKH 5E2TL 3Q3GB 4ODBD 4EIZC 5KSAA 2EUZA 5I73B 1PZDA 2C1OA 2VDNH 4ZD3L 3AMKA 3AG4B 4K94H 4PSRA 2VMJA 3BWUF 2VDQL 1LE9A 3X2QB 3KM2A 2FWSA 4J27A 3CVHL 2R29L 4BFIB 4NWTH 5F1KC 2XRAH 4XGZB 2D7MA 4OD2A 3O11A 3WAJA 3P30H 4GIAA 4NEHB 3QJSB 5EZLB 1VENA 5ILTH 3I6LE 3SDDC 1M71A 1W0WA 4ZOCA 5IKCB 1SFDA 1RZGB 1JYNA 3WELA 3KPRB 1NCWL 4JB9L 3MRNB 3OXSA 4OCLC 2L7EA 1NFDB 4H13C 4XPFH 5I28A 5FYJD 3GSWB 2ICWJ 3JWDL 5B7FA 3S98A 1NPJA 4KKLC 2GI7A 1QEWB 5E08H 1YLBB 3FF7A 3OR7B 3HZMA 2E7LA 1XX9C 3O2VL 4YLQT 3HOGA 4EBQH 4YXHH 4NOBA 4HQQL 2ZE0A 3MROA 4OU3A 1UWGH 4JG0H 4PUBH 4XB3A 2XSKA 2BY0A 4LSPL 2W5PA 3P0YH 5D1QE 1OCWH 5FECA 1OAZL 3G3LA 3D0AA 3B7UX 4Q52A 1V3MA 3V9CA 3RIFK 2AJUH 4FQLH 2ADJA 2OFQA 5KTEH 2WYHA 5C07D 1G0YR 4AYFB 1IV8A 1HHHA 3ARVA 5BXFB 2ENSA 3QIUB 4JR9H 2YRPA 1ID2A 3V4PB 2CD0A 4GKNA 4K3DH 4W9IC 5CZXD 1LO0L 2GTWB 4YK4B 4XC3H 1GHFH 3ZE1B 2KL6A 5JHMA 4FQIH 4J23A 4M43H 4N6RA 2K4AA 3M45A 4HMCA 1ZEAL 2J8UB 2YS4A 4YVNA 2YRBA 1MQKL 2Q6WB 3HHSB 3ZO9A 4L8SA 5JORB 3WJJC 4UV4L 3PP3K 4M3KB 5CZRA 2XUWA 1C16B 2UXGA 3THMH 3TT3H 3LKQB 3X3GH 1BBDL 2H6OA 3O3AB 4HK0B 1XF2B 4YSTA 1KBVA 4G8AC 1ZVYA 1Z9MA 2VZ1A 2YAFA 4OCNC 4O9HL 1Q9WA 2AQ3A 5CBAB 3RX8A 1VGKB 5D55A 1G9NL 1SEBB 3GXMA 2E86A 4JFHE 4JKPH 4GT7A 3V6ZA 5EF1A 4YNYB 1FDLL 3PXHA 1ADQH 5DJ6A 1PYWA 1KJVA 2OMZB 1MCHA 4IEFA 3AM8A 1CLCA 4UTAL 4XWOC 4FNTA 4HUKB 3RPBA 5MENB 3AREB 4HBCL 4XNZC 1UXMA 3AG1B 4PCYA 3WTVA 4FMVA 2DM2A 2XN2A 3HE6A 3CDGA 4OI9A 4NFCA 3VXOA 4GXFA 5B3NA 2GUOB 4NZJA 1KTLA 1LLAA 1G7QA 1Q72H 4YDIH 5FFGA 3CVDA 3WIHA 3QDGA 1U8QB 2P24A 2K9FB 3N5AA 4WW1A 2OJEA 3CMGA 3E6FA 5ID0A 4R2GB 2UWEA 4M5ZL 3BKJL 3UZEC 1NDTA 5J6HB 1IKNA 2YFNA 3HE7A 4A2FA 4TQ8A 3LH9A 4ORGB 2ZX7A 4G6AD 3WMQA 3VFTB 1M3IA 5F1NB 4IOSD 5D93B 2VSCA 1CGXA 4OJAA 4OQ1A 2AXFA 5FUZL 2WN3A 3L5XL 1A4KA 3O41B 4DGUA 2AW2A 1EO8H 5LN4A 3TFBA 3JYBA 4WHDA 1QI4A 4ZS7H 2WLMA 2YPKB 5EORL 3QCTL 2R1WB 2NW2B 2CO6B 4UT6A 3BRGC 4MJ5A 3VXTB 2P3YA 1AQKL 3QORC 4JO4L 3CFCH 3SYQA 4E9RA 3K8MA 4Y0GA 1SRDA 2KMWA 5G4MA 2O5XL 5ENWA 2JKLA 4NNYA 1JPGA 4YE0A 4Z23A 1T1WA 4LKCA 3BRFA 3O3UN 2BP8B 1I3RA 1NBCA 1X9RA 3GPEA 1DP0A 3C5JA 3EGSA 3QA3B 4KO5A 4KJPC 4Z5RA 5IHLB 1E6JL 1SFHA 1CIUA 1MEXL 4Z6AT 2QKIC 4H8VA 3VFMA 1BJMA 1X4ZA 3ZYOA 5I1LB 1T66C 4LL9A 1WGOA 3IGAA 4FC3E 2D2OA 5D7JA 3DVFA 4GI6A 2XY1A 5T3ZH 3D69B 1CDBA 3K46A 3LEXA 2EE0A 3NDYE 2P45B 4K7PL 1UC6A 4B27A 4W4OC 3OZ9L 4HKJA 1KBGH 1Y0LA 4XO8A 3ZZLA 4WWKC 4D3CH 4PBVC 5KBPA 4U1HA 3OKMB 4KOBA 4GW4A 4NENB 4EUPA 3VI3E 5GZOC 5FX3A 1IEBA 5IBUB 5LJYH 2F7OA 2ZSVA 4X9YA 4GAYA 2K0RA 1JF1A 3LNFA 1R3KB 4HH9B 5B21A 3OKYA 1XR9B 3HB3B 1HSBA 4P2RE 4U1JB 5HVGB 1U8MB 2YLHA 5LQBH 2OA9A 4G6JH 2FTAA 5FLVA 4KH9A 2NXZB 5J1TC 4Z7QE 2FYYA 1F4WL 3TH2T 1NICA 4JY5H 3SGJA 3L3DA 1JTPA 3L3OA 2BOLA 2IBZY 1R3IH 3NQIA 1BW8A 1FZKB 5I6PA 4KDWA 4OZIE 1A4AA 4XE0A 3MA7B 3I2CL 5HXMA 2XWTB 1RUAL 1E4HA 3QAZB 5C6TL 5JIIA 3ZDXE 4KC3B 1IKFH 4O2FA 3EGDB 3N40P 3TNMB 4WU5A 4HMEA 4R84A 3OMZA 4KDTC 4NDMB 3SBPA 3BQUD 3QNYA 5FKAA 4XMKL 4X8GA 5F7DB 4AVHA 4GUOA 5KBDA 2O6PA 2GFBA 3HTLX 2FQFA 5FYJU 2VDNL 4ZFFB 1U3JA 2C8NA 4PJAE 4K94L 5T3ZE 2YEZB 3AWEA 1MAMH 3KPPA 2H1XA 5KSAC 3TYFA 2XRAL 3K74B 1JXFA 4TUJB 3P30L 4XNBA 4A7UA 1BQUA 3HBZA 1M4KA 3RDTB 2AKRA 3QDMA 4LVEA 4X7DC 3CC1A 3ZHLA 1R5VB 4PJFB 3DX7B 3SE3A 1A22B 3KXFB 1R46A 3SOBH 5JDJA 2YRZA 3OM3B 3S5ZA 1EHNA 2BNRD 2HB0A 2BM3A 4X0KA 1I1FA 4HT1H 3S3PA 3CFEB 3FT2B 2UY6A 3EJTA 3AS1A 3ILDA 5T33H 3VGEA 4Y4FD 5E08L 2A4ZA 3D2TA 3LSOB 4EBQL 5F3BB 4YXHL 4E9LA 1LEGB 3RWCB 3VGGA 1UWGL 4JG0L 4PREA 4PUBL 1MFUA 3RWEA 4PRDA 4M3HA 1IJNA 2XWDA 1JK9A 3P0YL 1OCWL 2WBJA 1IM3B 4DO6A 4EI5D 1IIKA 1X5MA 2EDNA 2ZZUT 3QZNA 2AJUL 4Y8AA 4FQLL 3EBHA 4R97B 1NC2B 1N8ZB 2JKRM 4ZMAT 2IPKA 2WXQA 1D5RA 5KTEL 3TA3A 3OBAA 1E8XA 2LLGA 3ATFA 5I6OA 1MLCA 5FOBA 3RJDA 4B3EA 3BP5A 4DO4A 1ZLWH 5A3ID 4B41A 3NJGA 4JR9L 4XO3A 3GFUA 3PWVB 5DHYA 4PRNA 3VFNB 4JZJC 3CHRA 4K3DL 1NCJA 3UABA 4JFOA 1F5WA 1INEH 4XC3L 1GHFL 2OMXA 5LLIC 4JHBA 4FQIL 5EU4A 4M43L 2BSTB 4TVUA 3ZN6A 1HHGB 2EYSB 1HSAB 1ZLEA 5C0IA 3WIFB 1IGCH 1TEYA 4CNIA 4Z7VB 3HI6H 3BT2H 4QRPA 4QTHB 4DZ8A 3THML 4NX0A 3TT3L 3UTTA 1FVDB 3X3GL 4XXDA 3HN3A 3QFDB 4KJWC 2YQ3A 3DBXA 2VLRE 4AQZA 4M4RB 5DTFB 1NEZB 4J8QA 4PJBF 3F83A 5E9DA 3WYRA 3EOAA 3HLAA 1MN4A 2ESVE 1E8WA 3FTGA 4MD4B 1AVAA 2Z31B 1MLBA 4JKPL 4HHAA 4I18A 3QRFM 4ACTA 2UZIH 1G7JA 1NFDE 3OC8A 4KTEH 3PUCA 5DMJB 4B0MM 1ADQL 1DVTA 2YPVH 4GG6A 3MBEB 3C9NA 4ZQKB 1GYWA 1KTCA 3TT1H 3KPRD 4OD3H 2EVFA 2B3RA 2A5UA 3DO3A 3P1VA 1OOAA 4N0FB 3QCUH 4HUVA 2NNCA 1J1XH 3CHXA 1A3ZA 2IQ9H 4UQDA 1QI3A 2NYYD 4O02B 4W9FC 1QLFA 1I1YB 4IM8A 4QUOA 5DRXB 4DVBA 4YDIL 9CGTA 4PG9A 3MREB 3VXSB 2I32A 1QLRB 2OMTB 4AUUA 3JV6A 1UACL 1N2RA 3OPZH 1UM5H 3IAPA 2AAAA 4IMLA 3KL5A 4HF5H 5JXEC 4P5TC 1NGYA 4L29B 3QULA 2Q86A 5HGDB 2ZOWA 1NBZB 1G7HB 4WSGA 5HBBA 3ETSA 1JF5A 5D71H 1HL5A 1WE5A 3QIUD 3DARA 4L3EA 2HYMA 3LRKA 5EZOH 4MMXB 4ZS7L 2IH1A 3J2PA 4AIZB 3QFJE 2JKNA 3B8SA 5E5MA 4HC1H 4M62L 1L5GA 1ACCA 5EU5B 3RAJH 3TBWA 3ZHKA 2QMJA 3CVHA 2R29A 1PG7W 3CFCL 4X2UA 1BECA 3AFLA 2B15A 3V6BR 1TR7A 5I17B 4HWEH 1XEUA 4P2QE 2LTQC 3QEQA 5DK3A 3ZHFA 4GP4B 1E9OA 4U3CA 2X28A 3BAKA 1WRFA 5AL8A 1B2WH 3VXQB 2UWEF 4L3CB 5FM5O 3L6FA 5I76A 1NUNB 5KVDH 3BDYH 5JYMA 3IFNH 1KLFA 1MFDH 3VTMA 2XTJB 2AC0A 2VMCA 4J3WA 1QSFA 2RB8A 3UTSB 1CFMA 5JIMA 1PLGH 3F6IA 4J3UA 5T3ZL 1D5MB 1EZVY 1XGTA 3IFPB 1I7UB 1S7XA 1S5IH 2H8PB 1DQJB 1KBGL 3CSGA 3H9SA 5MEND 3GSOA 3ARED 1BXAA 4F2FA 1JYXA 3GSRB 1D7FA 1ZDSA 4X9FA 2CIIB 3ZK0A 4ZFOL 5ACLA 3WMPA 1P4BH 1WT5C 1AS7A 4C57C 2KKQA 1WIUA 4ZZKA 4ZTEA 1WISA 5HI5C 4GO6B 1WS8A 4Y5YC 5GJSH 1Z32X 5LQBL 4G6JL 4PGBB 4R2GD 5C3IA 3A0OA 3SO5A 3T4YB 3IXAA 3FCUB 4HKZB 2GABA 2DDQH 3EG9B 1T22B 1DSFH 4ZQTA 1CFSA 3FB6A 5IP4A 4JY5L 3OWEA 3ULVD 3WS6A 2X1PA 4ZW8A 4Z0XB 3HAEB 4PJ8A 1R3IL 2CHNA 5AW0B 4D8OA 3ZX1A 5ETUB 1WYJA 2ADYA 1VFBA 3OF6D 2PXYC 2PW1A 2GJPA 2J57A 3SGJC 2PTTA 2VERA 3NVQA 3B9DA 4KHTH 4M93C 3B37A 3VGDA 1HE8A 3BDBA 2F7QA 5ITFA 4QYAA 4RNRB 2VOTA 1IKFL 3NABH 2HFTA 3WENA 2GYSA 3VYPA 3SDAA 1PLAA 2CBQA 4OI7A 1DBJH 1OGAB 1GYUA 5CIPB 1P2CB 1BREA 2PCFA 2KZ1B 2V5TA 1KGXA 2CCLA 3DGDA 3LQZB 4RFNB 1WQVT 4UTAA 1AO7A 1M7DA 4PCTA 2W9EH 4YPJA 1MAML 4OCRH 3P0GB 3AU1B 3IXTB 5LWYH 3QI9D 3VFRB 4JFEB 4F33B 4EPSA 5LGJA 1DUYB 5E1HB 3SOBL 1NCHA 3P4LA 2WKOA 4HT1L 4UIMA 4ZODA 3VMOA 4KX9A 3FFDB 3KBPA 1WBZA 5T33L 3AC0A 2E9GA 1X5FA 2I69A 3QZWG 5I8OH 3GLDA 4JL1A 1T5KA 3WD5H 3WLBB 4HJUA 1MCIA 4HIEB 5CLWA 3ZQWA 3X3FH 3MRMA 3RGBA 3IU3A 2CNZA 5EC1A 5IQMA 2A6JA 3E6HB 3HB3D 3LPOA 3MTRA 3D34A 1UASA 4F5CA 3FJTA 2WLZA 3FK3A 2VZSA 5JTWA 1KXTB 2NXZD 5CEYB 2J3SA 1YYMH 3FN3A 2MOQA 2XWBA 2E4FA 1N6QH 5TGBA 3AY4A 4FFYL 4JM2A 4LLVB 3HS0B 4U6HA 4YHPB 4GFTB 3HI1B 2BZ7A 2N4IA 1MJJA 2CLRB 2ITDA 3TA3C 4FADA 3ABLB 1OE1A 4N68A 4X5QA 3S3JA 1INEL 3KLSA 4LGRB 4UQBA 1YJDH 4ORZC 3VXNB 1QPPA 3OKDA 3KGSA 3T65B 3UAFA 3MLXH 1F6LL 1T5WA 1IGCL 3PRZA 3T2QA 2DYPB 1UWXK 2VRKA 3BT2L 3HI6L 2CXGA 2ZKYA 4A7TA 1BP3B 3NFSH 2YQ2A 2YN5A 3EYVB 3WN5B 2UUDH 3S8GB 2ZONA 5FS5A 1ZHKA 2WTOA 4WSJA 1JZ3A 1QI5A 4DK6A 3HR5A 4HA1A 4D9LH 3CHPA 4YPGB 4LOVA 5HD8C 1EK3A 1MHEB 2D2CC 3T6XA 5IM7B 1NA8A 1JHTB 1BJ1H 4NAQA 1BFSA 4ZI8A 3KXFE 1KFGA 2CNYA 4W70A 3TV8A 1C5CH 2UZIL 3EZJB 4KTEL 3RDTD 4GRLB 1RZ7H 2YPVL 4LKXA 5I66B 3TT1L 5C0FA 4XCFH 3VGFA 5E5RB 5JO5A 5DT1H 3KXFD 3MKKA 4I18C 4OD3L 2HWZL 4BFKA 2B0SH 5HHQB 2EDYA 4NPKA 5F7AA 1FSKC 3QCUL 3N41B 5DQJA 1J1XL 3EBAA 2IQ9L 3CH1B 2XXGA 3RKDC 4QYOB 4PJHB 3FQNB 4Y2DA 3Q5YA 1YEGH 4MVBD 2RJMA 4JZOB 4UDTB 1RY7B 1ZT1B 3N9GH 5D1QA 1TTRA 3AQYA 1XF4B 2A9MH 1QA9A 2EUWA 1NCDH 3VXUE 5IUSA 2C3HA 5CNHA 3OPZL 1UM5L 4B5EA 4U05A 1KF9B 2H2SC 1IM3D 2YHGA 4HF5L 3QQNA 4WTQA 5D5ME 4F7MA 3PCYA 1G43A 3ILQD 3VNYA 2XN9A 2BSCA 4JLRB 3NFNA 4GAJH 1THAA 1U95B 1RD6A 3BZEA 5D71L 1Z7JA 4GG6F 4UNTA 1T83C 4YDJA 5FO7A 1U2YA 2CUHA 5EZOL 2ALAA 3RVUC 4P9MH 4X5RA 4Z7VE 5MI0C 3PU7A 4WI0A 4HC1L 3RAJL 43CAB 3L81A 4GT0A 1CXFA 3R1GH 5HYSA 1JPTH 4KKZA 5I74C 2X40A 3FRPA 4U1NB 4WGVB 4HWEL 4JL2A 2FQEA 4KFZC 2PPDA 5SWZB 3EDDA 4AX3A 4AYID 4XBGA 1AGBB 1B2WL 1EDHA 1YYCA 3LKOB 4ENED 1FO0H 4LPCA 4WDIA 5KVDL 2CJUL 3BDYL 4KTYA 3IFNL 2CHZA 1KPRB 1OCRB 3US9A 2NZ9C 1MFDL 4S1DD 5KYXB 4HWZB 5DC4B 3NPSB 2Z31D 3T04D 2AQSA 4PP2A 2C4FU 4HU2A 5DC2A 1PLGL 1JTOA 3JWDC 1U58B 4HZLB 1NH6A 4M8UA 5AW3B 4XMZA 1TQBC 3DXAB 3MBED 2QQLL 4PLKC 1UWYA 4KFMA 4FI7A 4DCQB 2JCWA 1RXLA 1M42A 5IT2H 4E36A 3UZVA 5FO9B 3L4WA 4IIQB 4U1KA 5DJCB 3VXSE 4WTZG 2R9HD 2HJLA 1P4BL 2VDPB 3UAAA 4W4NA 5CZVH 4BELD 1AANA 3BI9X 4MNQA 3VWKB 1JGUH 1G6RH 4ZAKB 3VXSD 1FNEB 5F72S 3BZFB 3KBHE 5GJSL 3TZVC 3N3EA 2ICES 1Q94B 2XKUA 2BWIA 5E94A 3V4VH 3SD2A 4AK2A 1OW0C 5HJDA 3NCMA 3GIVA 2X4PB 3L9EA 2JB6A 1DSFL 2VRQA 4BZYA 2H5UA 1S7UB 3H53A 1ZPUA 2EEFA 2IBGA 1J88A 3OHXC 1UA6H 3J8F7 5FF6B 1SJEB 4ESKA 3QYCA 2FQGA 4ZMXA 3WS6C 4KHTL 4X4ME 1NGZA 3ZQ9A 4PJ8C 5IFJB 4YE4H 4HJ0C 4Z7WB 3FCBA 3WNKA 1Y7VA 2BVOB 3NABL 3QUHA 4ANUA 4RAHA 1S9VA 5C0RH 1DBJL 3U36A 1JK8A 4UAOC 1ADQA 4F7PA 4KK6D 4H8HA 1G9NC 2X9ZA 4MHHI 4OCWH 2F1AA 4PU2A 2XTJE 3NCJL 2A83A 4H25A 5B1JA 2W9EL 1JAEA 5LGYA 3KS0H 4OCRL 1XWVA 3OD3A 4AM0Q 2IGLA 4W9DC 2V9QA 4AQ1B 3GKWH 2OW6A 5LWYL 4PYHA 4JFYB 1II4E 1HVXA 3VGAC 5TE6H 1EZSA 2X4UB 3P9LA 2XTJD 5C97A 1IGYB 4IU2A 1I1RA 2Q8AH 3UTSD 3K4AA 5FUOL 1DJXA 4FQHB 3WTXA 3TEYA 5HDLA 1DQMH 3E2HC 4MYWB 2D73A 2QL1A 2WKGA 4K07A 3RE0A 1S3RA 3VI3A 3UBFA 4YLCA 4DP5X 5FGCB 1QFPA 4X6CE 5HJGA 5I8OL 4L8BB 2WCGA 2WO3B 1DQQB 1NJ9A 1YEIH 1OZUA 4P2RA 3X3FL 5IB2A 2DWDB 2JJTA 2JKIS 4K0OA 1RUQH 4FFWD 1Z2KA 4LPTA 4OVUA 4Y16A 3T9WA 4XWGH 1B6UA 5KN5A 1JN6B 4XP1L 5E6SB 4DGIH 3RURA 2Q3AA 4YHOL 2E5EA 3M7FB 4F37K 1BZ8A 1YYML 2FK9A 3DA0A 3OAZH 2XBZA 5EU7E 3TJHD 4EDXA 1N6QL 2GJ6B 4KNSA 3RPIB 4OZIA 3ARBC 3V7AG 1S8DB 3EH3B 1JZ6A 3QHTC 5CD3A 3X1EA 2Z9TA 5TF1H 3AY4C 1BBJA 4WKXA 1NMCB 2WKOF 2TRYA 3VFUB 4TNVK 4C56A 4JAMB 1W6WA 4ZMLA 5AVZB 1YJDL 1J05B 3QNZB 2FX8H 4KI5D 4XVUC 2HKAA 4QHKJ 4IOIB 4P4KA 3HW7A 1BQKA 2K4WA 3MLXL 3KLAA 5E9NA 5I1EH 4GMTH 1LD9B 1OGAD 3NFSL 3Q6GH 4XAKD 2YSSA 2NLJA 2H4EA 4JFPB 4ZMZA 1JGLH 1S7WA 1IL1B 2DM4A 4D9LL 1D5IH 1KT2A 5TH2B 2DQJH 2EEDA 1SMDA 4KUZH 1J1PH 4HV8B 4OV5A 4N2DA 1W0VA 4NRXA 2DKUA 2Y1YA 3DIVA 4W9KC 3BUDA 3T3PB 4G11A 4JM2F 6CGTA 1OB0A 1C5CL 3LNGA 4JFED 1GCYA 1RCYA 2GAZA 1HL9A 1RZ7L 1TMQA 4HJJH 1DBKH 5IG7B 4XCFL 4IOFD 1N18A 2HXAA 3BZ4B 5DT1L 4IRJB 5HYEA 2E59A 4XOEA 2WB1A 2B0SL 2KI6A 1SHMA 3JWOH 1E9PA 1PZBA 4E0RA 2LHAA 2VXUH 5MP6H 5FDWB 3RL2A 3O4OB 2YAPA 3MFFB 4N0CD 5LGHH 4MZRA 2VABA 1TZHB 3L5WB 3BMVA 2NY0C 3BISA 2OS7A 1NCAH 3CIAA 3L9YA 3WUWB 5HYFA 5L2JB 1YEGL 1J0HA 2Z8RA 3N9GL 3P77A 3Q48A 1BM3H 1SF5A 3QUMH 4Y2DC 2A9ML 1NCDL 3QSKB 2CK0H 2WVTA 4MD5A 3CLWA 1FVCA 2FO4B 4BDVA 4GRMA 4OUOA 3C6LC 4J6RH 2F5AH 1M6OA 2NY1C 2Z35B 3U6RB 2IWFA 2JXMB 3VRLE 1HHJA 4GAJL 2X4SB 3TF4A 1PKQE 5T1LB 4CADA 3QDJE 4B9FA 3MLWH 4PJ6A 4P9ML 3QWOB 2H26B 1MCRA 3AUVA 4LPUA 1TTUA 4HUUB 1E9QB 3R1GL 5AOJA 3QHZH 1JPTL 1J9CT 1QQDA 2BY3A 3D2UA 2DYPD 1TPXB 2GTZB 2N1TE 2VLRA 3PDDA 4K94C 4XZ4A 3V6OE 5J11B 1OP4A 2K6ZA 3T3MB 3S3DB 2CBOA 1FO0L 2ESVA 2CLVA 4N24A 1R1CA 1TO5A 3O3DA 3ZT7A 1KTKE 4PJIE 5I0ZA 2HUHA 3HNVH 2DLTA 4JO8A 4L5FH 4R7VA 2PWDA 4D0BB 2EDOA 3FDWA 1MHCB 3GMPA 4BRJA 2VCOA 3TBSB 4HOMA 4GRLD 3UCQA 2D7TH 4M7LT 1LE5B 2Z7UA 4KX8A 1U41A 1IE5A 2O26U 2R7EB 5IT2L 4Z7UB 1WEJH 4KOCA 1RK7A 3SKOB 3TU6A 3X11B 1YN6A 2CA3A 4DGVH 5CZVL 1B3JA 3QEHB 1JGUL 1G6RL 1KB5B 4ZPTA 2E27H 3BRDA 2WKLA 3SO3B 2N7AA 2E6PA 5DRWB 3QXWA 4OUUA 3GMOA 1I1AA 2LAAA 5GGRA 5C0GA 1PX4A 1XGPB 4M3JA 4ZW6A 4YSUA 5B38G 1LO2H 2OMNA 4HX1B 1HYSC 1J5CA 4E9XA 3QFJA 3VD2A 4NKMA 1NIAA 3TM6A 1T4KA 4YE4L 5EPMA 4K4KA 4LPVA 3VDCA 5DJ0A 5TDOA 1MY5A 4JHZA 3SYOA 4FF9A 2F08A 1TQCB 5KJ4A 1T0PB 4P2QA 1VERA 2DS4A 5C0RL 4WO4B 1H5BC 4MJHA 3ARQA 3WKQA 1ZE3C 1K4DA 2YPVA 1W91A 5SWZD 3BESR 4OCWL 4DF9A 3KW8A 4L9DA 1XH0A 3T6VA 3SDCC 2WN2A 2BX5A 5T5FA 2FEEL 2ITEA 4EQ2A 3VFSA 2M2DA 3GKWL 5MERA 4N2HA 4YC2C 3D18A 3VACA 3MMEA 5TE6L 5JQHC 5DJDA 1FA4A 4F1ZA 3MYZA 4JDVB 5HVHB 4DIXA 3L08A 5JQIB 3EYFB 3ZE0B 2K6YA 2WYIA 3CX2A 3DXAD 4FN0A 3FU9A 1A3LH 4D7BA 2HVKB 3PABB 5H8DA 4AGQA 1UD2A 3VTTA 3T77A 4BXSV 2FBRA 4YIQB 5I1DA 2PW2A 2DMCA 5CCHE 3I02A 3SSGA 4GRWH 4BKLB 5EU3B 1F11B 1YEIL 5IB3A 2YD4A 3RU8H 3PJNA 2MQGA 4M1GH 4PGZA 3FMGH 4ATWA 5IREA 4QRTB 3VWKD 5JUEH 4ZAKD 3FCTB 4ZYKA 1IGFH 1RUQL 1CDHA 2VR3A 4JKKA 4QWWD 4XWGL 2X6CA 3BH8A 3K80A 3WV0A 4DGIL 4JFTA 3DK2A 3PAUA 2JJTC 1MZYA 2FL5A 4HC1A 3ECBA 3GS0A 4Z8FH 2FSEB 1BSIA 1INQA 1S7TB 1R5IB 3GJFH 3WO4B 2IWEA 3MLTA 2VDKH 2X05A 1UXSB 5TF1L 2C3WA 1IVTA 4R7NB 5IB4A 5EEWA 4G9FB 1DVFB 3MNVB 3OAYH 3VI3F 2AZUA 2FX8L 4N26A 3GI8H 2VITA 3NCFB 3POHA 5I1EL 2IAAC 2WXRA 2FR4B 2O61A 5BJTA 4JY6A 5BV7B 2PKDA 3GMLA 5BQ7A 3IAGC 3Q6GL 1YMME 4CSZA 1EAOA 2CRZA 2EH7H 3CG8A 4HZ1A 4P4KC 1FL6A 1JGLL 4S0TD 4XP4H 3DO7B 2GBUA 4Z7QF 4H0IA 1AC0A 1D5IL 3W0WB 3QG7H 2DQJL 2HN7A 4KUZL 1CYXA 1J1PL 2HLFD 4HLEA 4IDLA 3C6SB 5IJCC 1EWHA 3IDIA 2B1HH 2OSLB 3MUGA 1OSPH 2C3GA 2UZYA 4HUWA 3G5VA 2EIKB 4NQDD 3KPOB 4OZIF 3DVNA 3QIBC 4P46B 3LIUA 4N0UB 4HJJL 2OM5A 5HI4D 5IW6A 1AHWC 1DBKL 4CKQA 2VLLB 2FLRT 5GSRA 3UBGA 3ZDXF 5HDRA 1KCVH 5C9JA 3JWOL 2FYVA 1GYCA 3ZMEA 2VXUL 5E6IB 1N3NB 4H8PA 5MP6L 1MNUH 2ITCB 2YQBA 3I6GA 4RCAA 2QT6A 1IO4C 1G7LA 3JQOB 5LGHL 3KWWB 4R83A 1WGVA 1D9KC 1OGPA 1IVLA 3VMPA 1NCAL 2EXYC 1IJ9A 1UGKA 4GEIA 4HUCA 3KPSD 4XCEA 2QMKA 3GSNH 1LMKA 1BG1A 3LXUX 4PJAF 1BM3L 3QUML 1FZMB 3KGUA 2CK0L 3PDGA 5DRNA 1U8NA 1PZUB 1G4RA 1OANA 3B3IA 2R1XB 4NRZA 2GJ6E 5CJBA 1T1YA 1KGJA 4J6RL 4WVRA 2B9AA 3B4NA 4Q97A 1QR4A 4O2EA 1XCQA 2FECL 3MBWB 4CDHA 2X2UA 3ISYA 4X6FA 2Y6SC 3MNWA 3K5RA 1MXDA 4ONHB 1K72A 3Q6FA 4XX1E 1IKOP 3A4DA 3BAYA 2MRYA 3U6XS 4FG6D 3LPWA 1KIQA 2VXTH 3MLWL 5HY9B 1OAXH 5F3HB 1AD0B 2Z91B 4OH2A 1ZVSA 4MCYA 5FYJH 1K3IA 1KYUA 3QXUA 3RY6C 3QHZL 1REIA 5AAWA 3KPMB 5F6IC 2OBGA 5MHSE 5T3XD 1WWAX 2I24N 4OJYA 1F97A 3ZR5A 2DW5A 5K69A 1FZJB 1W72H 1UOLA 1J5HA 3HNVL 4L5FL 2X4OA 1O6SB 2X4RB 4Z78B 7CGTA 4R3SB 1R19A 3S9DB 1T80A 1ED3B 4NN6B 3QUXA 3S34H 1IB5A 1N4XH 4MDJB 3Q0HA 2BSED 5FGRA 4IBVA 4ZJ9A 2D7TL 3ABMB 3TCXA 2RAMA 3SB3A 1NGWB 5DI8B 3UTQA 4Z77A 1UURA 2NNRA 4CAGA 4GKSA 3L2NA 3L3IA 4DEUA 1CGSH 3MZTA 3X12B 5DD6A 1BVLB 3WKYA 2WMPA 4I5BB 3TEXA 1HWGB 1WEJL 4ZPVB 1UT9A 3PHOA 1WC7A 1NGXA 4DGVL 4QNPE 4Z7OE 3X14B 4OZ4B 3S4SA 4MFHA 1TYJA 3VXUA 1ZHLA 4ONGH 3ILPA 3G9AB 1UG9A 2V37A 2EDWA 4OAWB 3TGXA 2E27L 2FGZA 5K93A 5D5MA 3PL6B 2LR4A 2EC9U 4AUJA 2VE6A 3VFNA 4FNLH 3R4RA 1AIZA 5KEZA 1NFDF 4Q2ZA 2X6BA 5IVZB 3KCWA 1ICTA 2O4EA 2IADA 4XMTA 1NPUA 5DUMH 2LU7A 3ZU8A 3VU1A 1I1AC 2LABA 1LO2L 1E2WA 5T1LD 1OGTB 2YMXH 1F4XH 2QV2A 3FOMB 4AWJC 3QQ3A 1GZPB 3MUY1 1BOGA 2FATH 2HRPH 3BWAB 2X3BA 3ISRA 2VO5A 2ZG2A 3ALWA 3L54A 3FO1A 3QQDB 4X6DB 3JT2A 2BMKA 2AV7B 3ZY7A 3GRWH 4JG5A 5E8DH 4KTGA 3VD3A 3WAKA 4IMKA 1GS7A 4WHTA 1VEMA 4OGAD 1S7RA 3TTYA 3BEVB 2ZUYA 3E8VA 2DJSA 2XWJA 1I7RB 3JV0A 1RU9H 2R1YA 4DHLA 5J9PB 4NC0B 1FJ1A 1NCIA 5EUKB 2WBKA 5AVRB 4AYMC 4BFNA 3NCYS 3QZOA 2GIYA 1WUNT 1P7QB 1MWAH 1QFHA 3OR6A 4Z7UE 3RZCC 3ORJA 3LDBC 4K9JA 5IB1A 7PCYA 3DO4A 3IFOB 2FZ3B 4YOKA 5K59E 2CLZA 3MRCA 1TVBB 2VLKB 1A3LL 4LE8A 3DUSB 2Y2WA 1ZLWK 2H0FA 3P3RA 3FTXA 4LCWB 4HGWA 4ZOEA 5CHNB 5I16A 1SVZA 4PBDA 4UZGA 5J3HD 3UBHA 2E3VA 3RU8L 1I4FA 3D39E 3FMGL 2P46B 4J28A 4M1GL 4ZMYA 4XI5D 1BYPA 1PTZA 2X0VA 5JUEL 1KLUB 1N59A 5JDSA 3HVNA 1IGFL 2NY2C 5KG9A 1DCEA 5GJTH 3NK3A 1N19A 4NO5A 4UF7C 3RTQA 4Z8FL 5DS8A 3QGVA 3U46B 5IHBA 5IV2B 5AB0A 4X4MA 2JWYA 2VDKL 1KGCE 4CSPA 2ZUVA 3L3HA 2FT8A 3M1BB 4PV8B 4Y19B 4YSEA 1M53A 2Y1ZA 4WNQA 3QWNA 5DYOB 3H2PA 5B8CA 1FO0A 3FTYA 4KKRA 1R5WA 4ODUB 4PRIB 1GSMA 3F05A 3GI8L 3SZKC 4RDQF 4BQ6A 3NZ8B 5ESVA 1OAKH 5CJQH 1RK0A 2HSIA 3E7JA 1D5XA 1VIWA 1KXVC 3KPTA 4RMRA 3SDXB 3H4FA 2EH7L 2F5BH 4FTVB 4MAYB 4WO4D 2CXKA 4XP4L 2BNUA 4I9XA 1S9WB 3QJVB 4U0RC 3QUZC 4V1DB 1QX1A 2A9NH 4Q8BA 5AKVA 5ANMA 5AW6B 4MWFB 4N6QA 4XVSH 1OF0A 3Q01A 3QPKA 2W60A 3LRMA 2B1HL 4YR6A 2CA4A 4PTUA 1OSPL 4Q9BA 3UTOA 3MUHL 2E56A 3MRRB 3DX4A 4AM0B 2IEPA 1DR9A 2K7QA 1BIHA 1CFNA 4Z9KB 4DK3A 4KH2A 2JSFA 2F7IA 2Z7YA 1G6RA 2R23A 3BD3A 5ABZA 4KVPA 1KCVL 1DEEB 1JWUA 4X6CA 2NX5A 1MNUL 1XHHA 5DZ9A 3V4VA 4PRHE 1VSCA 2CO7B 4NLAA 4FERA 4KMQA 3D08A 3ZE2B 3N1FC 3GSNL 1EFXB 2QJDA 3QJRB 3QUYA 4JDZB 4U2YA 1NLDH 5GGSB 5I75B 5IMOB 1G94A 1UD3A 2XQYG 2JB5H 3F5WA 3N42B 4K71B 1WFJA 2JQZA 2CQVA 1ANUA 3RVVD 1QHPA 3ZKMD 3WTUA 2IO5A 1E30A 4ODWB 2FO1A 4D0DA 3WJMA 1QSEE 3ZL1A 1MCKA 5BVPH 1B2YA 2WQSA 5FIEA 3KYNB 4G9FE 4S10A 1K6QH 1DJYA 5E7BA 4LLYB 4U0QB 1HHIB 1M1XB 2VXTL 1PG7X 5DHVH 1I8KB 3TO4C 1OAXL 3G5YB 3L2MA 4QOKE 1DVFD 3QZWA 5FYJL 3VH8B 4N8VA 4BQCA 3MV01 2F74A 5GRJH 1FFPA 3ARDB 4L1BA 2YC1A 4MQXD 1TXKA 2G75A 2EDKA 3O8XB 1TZGH 2UYLA 4KKBC 1NFKA 5LAXA 3BAXA 2WY3B 1OK0A 3J07A 3W0WD 3EF4A 1W72L 3V5HA 3LKSB 1LJMA 3K72A 4N0UE 5FK9A 5EN3A 5EFIA 1L9RA 2WOYA 1YNLH 2N01B 3S34L 1N4XL 4UUJB 1AXSA 3BD5A 3UXFA 4P46D 2V2XA 4OJCA 4WFFD 4HFWB 4CRPA 4JRYA 1MREH 3FU6A 5EZIH 3FONA 1MVUB 1AZZC 3QUXC 4GXUM 4BK8A 5E4OA 2P8MA 3KVDD 1CGSL 3QZPA 1BQLH 5HI3D 5IBUG 5GS1C 2J5WA 3S5LB 2IAMC 4I3GA 4NPYA 1COBA 4OCSH 5E6ID 3ROLA 3FQUA 1BAFH 3BH9B 2CGRH 2H2PD 3OAWA 3U4BL 2RCSH 3EJCA 1Q9LB 5CJ5A 1UJ3A 2ODHA 3N1PC 4KNQA 1A9EB 1VZIA 1BV8A 4EXKA 4ONGL 4QRRD 1C08B 4P48A 5CF3A 3NIDE 3TFKC 4U6YB 1A65A 2H1LM 1VEOA 4NZDA 5INCA 1CXEA 1H8SA 1MCBA 2J5LC 3QB7C 5DUJA 3VWJB 3WLWD 5ICXB 3PAYA 1P1ZA 2GI0A 4PJCE 4IU3B 3GZKA 3OX8B 4FNLL 6FABH 2X89A 2XICA 1T04A 3VFWA 1PKQA 1NCBH 1RSYA 3SY6A 2GEQA 4GUPB 4U1LB 3EJZD 4UT9H 3L2LA 5E23A 2R2EB 5DUML 4MD0B 3FQRB 3QDJA 4GW5B 4OFYD 5C0AB 1YJDC 2YMXL 1XIWC 1YEDA 1F4XL 4PN6A 2XFXA 5T1MA 4FQXA 4KV5E 1EEYA 3G6AA 3IJEB 4OFPA 1JGEB 5F9WB 3CV5A 2FATL 2HRPL 4MMZB 7TAAA 3S97C 3IVKB 1EHXA 3DMMA 1G1YA 2VR4A 2ZUSA 3S6CA 3HRZB 1NDMA 2H1PH 5DEZA 4KPHH 4DEPB 3GRWL 4UM8A 1EVTC 5E8DL 5CEXB 5C0CB 4IJ3B 3OKLA 3U0TA 2P5WB 2WVVB 3I84A 3GSUB 4PJIA 4Y7MA 1VZGA 5D5MF 2WNGA 1GGTA 2VIRB 4IMKC 1KELH 1N5AB 3DUUB 2BERA 4J4PC 2UZPA 1A5FH 1RU9L 2WLIA 4LLMB 2GSGB 1P4LB 4HGMA 1A1OA 2R2BA 4RFEA 5FM5M 4LRIC 3SE4A 4PGEA 5EUOE 2AJXH 2LE9A 4WEEA 1MWAL 3U2JA 4F8TA 4Z7VF 4YH6A 4F7TB 1T0MB 3C60C 5C71A 3QUMA 5KSVA 2Y23A 1HHIA 3ASNB 1RI8A 3CZFB 3HPJA 4PBWD 4X99B 4J8RB 3IE9A 3LN5A 1HJBC 3L8QA 1Z5LB 3ILEA 2PYEB 3QK0A 5KSBE 3B2XA 4KKCD 1F02I 1G7MA 1QAWA 4G7QB 2JI3A 4PEEA 2ENJA 2P48B 2R0ZH 4R0LA 5DRZA 4XNAA 2YEQA 5GJTL 3GJEA 1J18A 3P2DA 1VKXB 2J44A 4HIJA 3PL6D 3U9WA 5IF0A 2WZ6A 3MR9B 2UUDK 3VG0H 1CTOA 2DWSA 1BA9A 32C2B 1UQSA 3VM5A 1PD6A 3NQKA 4AKOA 2I60H 4PJDB 2DIBA 2ZICA 3L17A 3BPLB 4P06A 4NAMA 3NN8A 2WQAA 4RIRA 3MFGB 1O7SA 1H3PH 1GMEA 3EOYG 4IRZH 1K8DB 3IGKA 3INOA 2Q9OA 1BPLB 4X6DE 4H1LB 1BQHA 4RAUA 5TDPA 2ZOUA 2NTFA 4BFBD 4MHHG 5I8EA 1M7IB 2DL9A 3Q8EA 1OAKL 1FL5B 4QHMA 3GXPA 5CJQL 2PP9A 3WUZA 5D7LB 1L0YA 1JWMA 4HAGA 4GW1A 1UWEH 5DA0B 1V3JA 1U2HA 3IRCA 2MIZA 3FH8A 2F5BL 4PJ9B 1H9VA 2EXTA 2F53E 2A9NL 1TZIB 3FQYA 5D7KD 4XVSL 4D9QE 4H8UA 1TU2A 1IM9A 3MRDB 2Z92A 4XHJD 5B4MC 1NUGA 3KWXA 4U2ZA 4QRQB 4WFEE 5DS2A 1U91A 1G7PB 3ULVH 3VQLA 1OB1B 3MVSA 1P7QD 3BFOA 4OBSA 5IWLC 1KENH 3LD8B 4OCMC 1HWWA 4YBQC 1LP9B 5AYTA 2VLKD 5GRWA 1HCVA 2HUEA 3O4LE 1ACYL 3LZOA 4LMQE 4LCWD 2EDBA 4NFBA 1XR8A 4JGNA 4U1GC 3MUJA 1AI1H 1SJMA 2Y6TE 3E38A 4CSTA 5IMLB 4G80B 2AXGA 3ZKND 3H55A 1NLDL 5GS0D 1SJXA 1A0QH 2JB5L 2VDLB 1JD9A 1DLHB 1SYVB 1NDGA 1X3DA 3QUYC 5GSVB 2YD6A 3LAFA 4HYTB 3VXPB 3VSVA 2Q5BA 4M7JH 3G9VA 5BVPL 4HEPA 3ZDWA 2BNQA 3KVQA 3U9UA 3FUNA 2N1KA 4TN9A 5I23A 4KK8D 1K6QL 1AZNA 2E76C 3QIWB 1A6TB 3F01A 4BHUA 5AD0B 4Y19D 4X6CF 3OKOB 5D7IA 1T5XB 1SQ2N 2UX6A 2BP5M 3BEWA 3SDXE 4PRID 4TULH 1Y1DA 4U6XA 1YMMA 5E4EC 5IR1A 5DFVC 5GRJL 3TVMA 4BUQA 2OCCB 3GXTA 4HSAC 1MUJB 4NM8H 3CXHJ 3FQTB 4FEMA 4JZNB 1TZGL 1CQYA 4FTVD 4MAYD 2BJMH 4XMXA 1YAIA 2CGZA 2YMOA 3QJUB 5A16B 2P5EE 3T4AC 4XBPB 2OXGB 1ZKAA 4V1DD 3T1FB 4PJXB 4OZFB 2BY1A 1ND0B 1XMEB 1M7UA 4AMKH 2BC4B 4L4TB 3LEYH 5D9SA 4XP9H 3DPDA 2NSMA 4AENA 5T1KB 1YNLL 3CUPA 4ZSOB 5EG6C 1VF5C 5K9KA 3UIYA 4UTCA 3QC6X 4O51A 5EIVA 3ZTDC 3DGGB 2ZSWB 4W68A 1MREL 2XWRA 5EZIL 3ZOAA 5HGHB 2AQPA 2EADA 2H3NA 2CRIA 2FE0A 2LAGB 1BQLL 4LEOB 2P5PA 4EIUA 1YY9D 1EJ6A 3NCWA 4GXUN 4OCSL 5EA0H 1IC5H 4X4YA 1BAFL 3UBXA 4KZCA 2CGRL 3VG9C 1RLBA 2RCSL 3BYYA 2M83A 5HPMA 2ZP0T 5AVUB 3GJFA 5IROA 3EKCA 5IQOA 3DOHA 1EFXD 5E2WH 2GJ6A 4IIZA 5EBGA 4W9ZA 3LN4B 1UB6A 1M2VB 3CD4A 3HAEG 1KN4H 4FQ2H 3FBQA 2FLMA 2IOIA 1UM4H 4X6BA 6FABL 4OGZA 1EIBA 1BM7A 4OGXH 5KYWA 1FYHB 1MRFH 2AMGA 1NCBL 3SKNA 3RY4A 3DTXB 4UT9L 5ACZB 4LCYA 4J2QA 3QS3A 2IH9A 1YVLA 4UILH 2EABA 4LL1A 3SYAA 2VTFA 3CPLA 3QH3B 2IANE 1LEIB 3B43A 5CCGE 4XNMA 4FGMA 1SXAA 4X7SH 3HC3H 3BWSA 4U3SA 4WUUA 4PLJD 3VAEA 1LNUB 2WLLB 4EOWH 2NW3A 2A6DB 1Q0EA 1E5CA 2H1PL 1QRNA 3D3VA 4KPHL 3STZB 1AY1H 3IGUA 5C0JA 2CGYA 4X98B 5JZ7C 3ARDD 3UC2A 4DQOH 3F85A 4UQ3B 4ODXA 3O8XD 3EFFA 3EGXB 5CN1A 4CSSA 1XTLA 1RFDH 2IDSA 4AVJA 3O6FC 5AUMB 1KELL 5HGBB 5CGTA 3VRLF 4X5XB 1A5FL 1E65A 1FE8H 4UQ2A 2IPUG 2CUIA 3FT0A 1KJ2H 4RAVA 5BMFH 5I0XA 2AJXL 3NESA 5B7MA 1WTGT 4X6EB 4WJ5A 3GSNA 3HS9A 5DMKA 1TQUA 2WQRA 3OAZK 1YECH 3SE4C 3EF7A 4F93B 2ENQA 4UOQA 3RWFB 1EUUA 3QP3A 1JFHA 3SBWA 4L4VD 4IGBB 3TCLB 5KVMC 3OSVA 2W59A 4KZEH 4FFZH 4G1EA 4S2SA 5KANI 5C0BE 2AEOA 2IDCA 3ATAA 5ADOH 4QXTB 1CT8B 2H9GB 3GB7A 2Q7AA 4KK5D 1BIIB 3T0XA 1IC7H 2O6EA 4PJIF 3MV8B 2GBVA 3M17B 4CGUB 4MA3B 2F54E 3VWJD 2WIIA 3G08B 3KJ4C 4ZFQA 2VC2B 4P2OC 2NOYA 4XE5B 3SQRA 3V5KB 3VG0L 3SN6N 4PGJA 3QWQB 1G7IB 1Q0YH 4R0LC 4ZTOH 3S3CB 4ZX4A 1ILSA 2RMNA 1NTDA 1OF2B 2NY6B 1AGFA 2I60L 1XVSA 1BXVA 2EIZA 2EDXA 1MW2A 2HZHA 3PYCA 4HIPA 3N41F 3U48A 2FJGB 4OFQA 1H3PL 2E7HA 4IRZL 5C0AD 4FDWA 4HULB 1LK2B 2NUTA 1T3FB 1Z1WA 4GAFB 1G5GA 3CE1A 1YNKH 2VAJA 5IMKA 3MLVH 1EFQA 2DLHA 3ZTJG 4MX7B 2DBJA 4QHUB 4F57H 3LYRA 1RUMH 2FAUA 2FIKB 1UWEL 1SHSA 3NYKA 3P69A 4LF3A 4DZBA 1YHPA 3TO2A 5IEHB 5C0CD 1RJLA 2R0LH 4A6YB 5K9OA 1JWSB 1V55B 1KMGA 2P5WD 5C70A 1P53A 4RGNB 4HIQA 2BCKB 4R4BB 1BLNA 4DPCX 3EYQD 1K5NB 1E2ZA 3BVNA 5D2NC 3ZLQC 1JTTA 3WOVA 5B38A 5CJOH 5F9DC 3ULVL 4DOHE 2QQKH 1QW8A 3IKCA 2ICCA 3BKYH 1HHKA 2G2RB 3IDJA 1N0XH 1NIBA 4M5SA 1KENL 2YKKA 1BXUA 2V0AA 4F91B 4NN5C 3SDYH 1WBXA 5C09B 2W8CA 4KRPB 3EFOA 1EVUA 3OWRA 1JV2A 5IQNA 1P5VA 3FFCB 4JFFB 3D39A 3WY2A 4Y5VB 5LBGA 1AGDB 2YLKA 1IX2A 2HFFB 4I0CC 3ATEA 4B7LA 2PYED 2Z34A 3CJJA 2X4QA 3BKCH 1A21A 3PDOB 4PS4H 1A0QL 1TSHA 3IMWA 3VD4A 3RGVA 4Y1AB 4KK9D 2BWQA 4PJDE 4NKDA 1LK3H 5CLTA 4ZXBA 2P8PB 4M7JL 2WV3A 3L4XA 4PY7B 1R4XA 4YAQA 4RMTA 2QZ5A 4N1HB 4P05A 3LKRB 5HGAB 2C1PA 5CP7A 3EIFA 5LNGA 4ZOAA 3G6JB 3PXLA 5HHPB 2WWNA 1WFIA 2E9JA 3ECWA 4F15B 1S3KH 4NERA 4Y5XB 1J5DA 1FF5A 5GGSY 4TULL 1XGUB 4X4XB 4NXKA 4Z3IA 1IEAA 3C5ZD 1OTTC 5D7LD 4CILA 1L9QA 3CC5A 3DJTA 4JCWA 4NM8L 4OKVB 1AD9B 1MWAA 2BJML 4NC1E 3BSGA 2WP3T 4XMUA 4AMKL 1TT6A 4MXQC 4ODTH 2YEVB 5CFHA 3LEYL 4FRWA 1FGVH 1MDTA 4XP9L 2YR3A 3AWGA 4HXBH 2W65B 4PI2A 4APQC 2WYZA 2JIXB 1LP9E 2XVBA 1QSZA 1QHQA 4NIYE 4NZUH 2PYFB 3HAEH 1DVYA 1EXGA 2F15A 4PRHA 1X9UA 5DJ2B 4QRUB 4J3OH 1TITA 3U1SH 35C8H 5EA0L 1IC5L 1V8HA 1CIDA 2KDYA 4ZS6D 4ELMB 1FPTH 4KKQA 1HI6A 1FZOA 3W11C 4JM4H 4Q58C 3COOA 5JHLA 1UOVA 4BK5C 1EO5A 4U1MA 2XI9A 3L4VA 3WGUB 1DJGA 3VCLB 5E2WL 1SYSB 1EAPA 2ICEA 1QSEA 4A7QA 4FQ2L 1KN4L 4QTIH 5IROC 3WGVB 1H6FA 5GGVH 1UM4L 4AE1A 4Y2OA 2BVTA 5L8LB 4PR5B 4OGXL 1MRFL 1TQVA 3NRPA 4K7FA 4OGQC 3JWNG 1YCSA 4G9FA 4G6FB 3QR1A 1O0VA 2IWGA 4WI6A 1VLXA 4UILL 1XD1A 4R9HA 1KNOB 1S7VB 3QRGH 3QQ9D 3VMNA 1PEWA 4JHUA 4QOKA 4Q7DA 4RBPH 4A2DA 1PQZA 5KVEH 1ZTXH 3HC3L 4X7SL 1GOGA 2P8LA 3AT9A 3IGFA 4NGHH 5IIEB 4EOWL 4XRCA 5BZDA 2P43B 4J3XA 3PE9A 4CL7A 2XXCB 3CFJA 2R2HB 1AY1L 4IJTA 4F8QA 4RDBA 1HCFX 1Z6JT 4G8GD 4DQOL 3OJMB 3IJHA 4PJXE 3CLEH 4YDVA 5EBLB 4WKZA 4TQHA 2WPGA 2DLFH 4HEME 4RSYA 1RFDL 1ET7A 2X88A 5DEFA 1I82A 3I9IA 4ZSOE 4UTBH 1ZT7B 1FE8L 3GT6A 3GSXB 1XCWA 4L4TD 2DQHH 1GZHA 3DSNA 4J3TA 4DN4H 2G3NA 4M61A 5T1KD 4XN5A 3ZMNA 5BMFL 4G43A 4QPEA 1HCYA 4EI6B 3BKMH 1WA2X 4JPKH 4M8RA 4L8CB 3BQUA 4ODVH 1YECL 2JLLA 4G5ZH 3QJFB 2XNAB 4ZFZA 3IM1A 1FQ9C 4HK3J 4EF3A 4HG4J 5GZND 3B83A 1ORQB 4PTTB 3VJ6A 4KZEL 3OAYK 4FFZL 4D94A 1BZ7A 1XCTA 2IQAB 2QGDA 3WNMA 5ADOL 2NDFA 4PRAB 4GSRA 4YFDB 1D6EA 1IC7L 1LILA 4PJCA 2WO2B 3RWDA 4DGYH 5INDB 2H6PB 2CIKA 3D0VB 3ABGA 1HH9B 3BGFC 3LB6D 4XVJL 5I18H 1PU0A 2FJUB 4DH2A 4FX5A 2AVFA 1NANI 5JLZA 4KBPA 3W39B 1F4YL 1Q0YL 2ATPB 1ZTXE 2UZXB 1DFXA 4QXUL 1F3JB 4UM9A 4Y4FA 3VFVB 5KSUA 1QKZH 1IAIM 1U3HB 4LCVA 3QORB 3T0BA 3ZSSA 2ADIA 4U7SA 1JZ8A 2GJJA 4WI3A 3TP4A 4YSOA 3QFGA 1YNKL 1A8JH 3MX0A 4QNPF 4Z7OF 4HSQA 4F27A 5JOPE 3MLVL 3PWNA 1F86A 3VXRB 1AIFA 2ZXAA 1M7XA 2YUVA 4F57L 4TL4A 1RUML 3GHPA 3TIEA 1E8ZA 2R59A 1GJUA 5FUCE 3JTSA 2A74B 4MNGA 1ZGLM 5DVLA 1EHKB 1KBWA 1OLLA 1DUZB 1RUKH 2HJFB 2XQ0A 2QKIB 2R0LL 4PJ7A 5F71A 4NCC1 1KGYE 4YL9A 3CFUA 3UJIH 1MHHA 2VDOH 5FXCH 3P3TA 2DL2A 4B97A 2YPLD 3NGBB 1C1EH 4LVOB 4Y4HB 2QGBA 1A1MA 3BUYA 5EUOA 4RQQB 2VL5A 2QGCA 2Y25A 5CJOL 5CZXC 1A2YA 1E4XI 4F7CB 5KVGH 2QQKL 2VLJD 5KYUB 4A39A 3BKYL 5DSCA 1N0XL 1F2QA 1D2OA 4Z76A 2RFXA 2VJ0A 3Q43A 4JANB 3SDYL 2FIRT 1A14H 3DV6B 3OMNB 1WCBB 3F12B 4IK6A 5KSBA 4N0YH 4FLQA 3ZYIA 1U2CA 1BZ9B 3L7EB 3JTBA 3MV8E 4IGBD 3VSUA 3CZEA 4W9GC 2H7WA 1DQDH 2QR0B 3BKCL 1MDAA 3ETBJ 1QFWI 3UP1A 4YGVB 2NMSA 3MV8D 3FO9B 1LK3L 2ZWNA 4JPQA 4BQBA 2W07B 4R7LA 1JZ5A 1ZD6A 3PNWA 3H54A 4Z7UF 1UD4A 1KG0B 1ZIBA 2NY6D 4A2MA 1RK1A 4PWFA 5K59F 3RWGB 5DQ9A 3KWUA 2APWA 2GUYA 4DP2X 3BJ91 2PCPA 4PVMA 1NKGA 1FV1A 4MDIA 4WI4A 2AQ2A 5D6CB 1A6VH 3BCDA 1S3KL 2MCAA 1Z3RA 1P6AB 5BRPA 4CMHC 4YHNA 4NQSB 4AJYV 4X8CA 3FT3A 5G5DB 3NEOA 4MCNA 4WWNA 1IGJB 5FR3A 1U8PB 2XVLA 1AE6H 1FNAA 3L4CA 2F53A 5F1IA 5KSAB 2HH0H 2C1OB 5F9JA 3SQOH 1H8OA 3NJNA 3ZYJA 2YXMA 1XMWA 3GPSA 4U4IA 3ULUD 5I9QC 3K6IA 1EEUA 1LE9B 2OK0H 2XKSA 4UINH 4YGAB 1ZLSH 4ODTL 4G82A 2ZOLA 4OD2B 3O11B 4RGND 1FGVL 5J13C 4HXBL 1DJHA 5SWSE 1M71B 1W0WB 3DECA 2XIDA 5AVSB 2EDQA 4JX0A 3OXSB 4NZUL 5JW4R 3D85A 2AQTA 5E0FA 2Y4SA 1U8KA 1YUKB 4JJ5A 2DLIA 3O4LA 3JWNH 1CD1A 1TQWA 1Q38A 2Q1EA 3U1SL 5C09D 35C8L 5FB8A 3WTYA 3K6OA 4KRPD 4LU5H 2Z8SA 4FAAB 3HZMB 1FPTL 3ETBF 3FFCD 4JFFD 3U1PA 2HJKA 4AITA 3MROB 4JM4L 1P7BA 4MAZA 4N9OB 5L8JB 4WV1C 1NIDA 1U8LA 5FECB 3TNNA 3MKGA 3QUKA 2V8MA 4DO5A 3ZPDA 1JSYA 4OLWH 1KV3A 2NR6D 4Y1AD 2ADJB 4QTIL 4Q9CA 5GGVL 2WM0A 1ZIAA 2Y2YA 1GL4B 1HHHB 1YDPA 2DQ6A 2R69H 3C2SA 3GEFA 3A23A 5DC0A 1I3GH 3G6JE 4MNHA 4ZRGA 1D5ZA 2B16A 2FB4H 2PP8A 4Y4KA 2NTSP 3QRGL 4GKNB 3FB8A 1FG2A 4TVPD 2WXFA 4NFDA 2B77A 2XV6B 2WXPA 5KVEL 1ZTXL 4N6RB 2FX9H 3HJ0A 4NGHL 1LL1A 2HLEB 5BPPA 3UG4A 1ILUA 2XPYA 4L8SB 4L9LC 4DFIA 1XTMA 2G9KA 5GIRA 5F8RC 2DTSA 4QHLA 1VRSA 3CLEL 2P5EA 3DIFA 1Q8MA 2DLFL 1CL7I 2BIMA 3EUDA 3HI5H 3P11H 2BW4A 5D1ZA 4TUOA 1Q9WB 4UTBL 3FUIA 5DHDA 1OPGH 1LHZA 2DQHL 3KW7A 5FA4A 3V0VA 3V6ZB 4DN4L 5L2KE 2VZOA 4IYKA 3LPFA 5DJ6B 1PYWB 1KJVB 3BKML 4IEFB 4JPKL 4LIQH 3CFDA 2JIXD 2KS0A 1T7WA 1JCKA 1OZTG 4ODVL 2NT0A 3L3JA 4G5ZL 1SXZA 1S5HA 4ELME 25C8H 4YHIA 4JKMA 1MW1A 3HE6B 3CDGB 3VXOB 2QELA 3BQUC 4FCHA 1J0ZA 2W38A 1KTLB 1G7QB 2WQWA 3QDGB 4NUQA 1AR1C 2AJ3A 2P24B 3C8KA 4MSWA 4WW1B 1JI1A 2OJEB 2GKIA 3IDMA 5ID0B 4FXTA 5EDSA 2UWEB 5EO9A 4RMQA 4DGYL 1WP6A 1J5IA 4KKPA 5EO0A 2PLTA 1SDAB 2B5IC 3HE7B 2C9UA 5I18L 2BPBA 2BP3A 3FO0H 5GGUA 1LVEA 5C3TA 4A2HA 3G5WA 4ODSH 3CZSA 4BE6A 4FKHA 4G6FD 3TBVA 2AXFB 1CLZH 2IANA 1A4KB 4AYDC 3QJHA 3NFPA 4P57A 1QKZL 5IHZA 1MCFA 2Y3AA 2J56A 4Y4FC 1HCZA 3RDJA 2X70A 1Z5HA 4EDWH 2DI8A 3PHQA 4MJ5B 5AAMC 2XVKA 4POYA 2QKSA 2D7OA 5LG1A 3K8LA 4XXWA 4OFIA 4PRBA 5DYFA 5ENWB 3NIDF 1R3LA 4NNYB 4EI5C 1JPGB 1SM3H 6TAAA 1T1WB 4LKCB 3SKUD 1RUKL 1I3RB 3EYSH 4PJCF 1HJCA 1AQ8A 1P9MC 1AYRA 3C5JB 3EGSB 1TDQA 2VDOL 1DTUA 4LIQE 3UJIL 3TESA 1WHPA 3C87A 1C1EL 3L48A 3TBCA 2R8SH 5A3IC 2VW4A 5KOVC 3VDBA 3VFMB 1AS6A 1S9KC 3C5SA 4HKBA 4B6ZA 3IGAB 5D7JB 4KV5F 3NP4A 5KVGL 3BAJA 3LEXB 1PJ9A 1PEZA 4LEBA 4DGWC 2A3TA 1G84A 4NHUA 5FEBA 1Q9LA 2CRYA 4BFFA 4HKJB 4M29A 1QLEH 1RIUH 1Y0LB 2HTKD 4N0RA 1A14L 3N1QC 3UADA 4U1HB 2GC7C 4GW4B 4EUPB 4Q9QH 3QE5A 5G4OA 1IEBB 1FNHA 3FH5A 4RESB 5C0BA 3ARTA 3DX1A 3IMRA 4ES8A 1R3JA 3AUWB 1UB5A 4GAYB 4DK5A 1JF1B 1JDCA 4K9EH 4AEIH 4BZ1H 1DO6A 1DSYA 1DQDL 1HSBB 2F54A 3WN6A 4EQ3A 3SCMA 4TSCH 2PWHA 4ICWA 3E8UH 1TMCB 1NOAA 2EAEA 1JL8A 1CVSC 2HA1A 2KT6A 4JCLA 1WAPA 4NSKA 2PXYB 4MBRA 3B7TA 5EUOF 4AYBA 5K1NA 3L3DB 2R83A 3L3OB 3PPSA 3DJ9A 4OLUL 2DTMH 1R6VA 3U6XA 3GC3A 1U3HD 1A6VL 4X4ZA 3TN0A 4AW4A 1SMAA 2NYYC 5KSBF 1UCBH 4KQ4H 4O2FB 4UOW0 3NOIA 4WU5B 3MCKA 3VXRD 1ROCA 2E46A 3QNYB 5FKAB 1AE6L 2WXHA 8FABA 1KJ2A 4BGLA 1P4LA 4HSCX 2GFBB 2HH0L 3ULAB 3SQOL 4R5XA 4J3BA 2WLNA 5CWSA 4FKKA 1IMHC 3SYPA 1J8HE 5D1XA 3U7WH 3TURA 5CSGA 1XL4A 1KB5H 2OK0L 3KPPB 4G70B 4UINL 4NJAH 1ZLSL 1OK8A 1JXDA 1UZGA 2L0DA 3TYFB 2J6WA 4Y4HD 1F13A 3QIUC 5HDQH 2AKRB 3MRQA 3QDMB 4G59C 3SPJA 2AJYH 1MY7A 2X2YA 3PJLA 4KGLA 4PW4A 3KLQA 3K2UH 1BD2E 4YHLH 4TSAH 4X6DF 4YK4C 3ZXAC 1Z5LA 4X0KB 3QQXA 3VD9A 1I1FB 2XV3A 4BK4A 2MKLC 2N7BA 4G2AA 1KIUA 1HIMH 4LU5L 4NLHA 4TV3A 4IRSA 1U21A 2DQTH 4YDLB 1EDQA 3W2DH 5JPMA 4GS7B 2E7BA 4PREB 2WSKA 1SMOA 5GXBB 1JZHA 1W8EA 4IBZA 1W8OA 3RWEB 4PRDB 2CDEA 1FN4A 2B59A 4OFDA 3WG7B 1JK9B 1JIBA 2WBJB 1DYZA 4GQQA 1EGJH 2NY3B 4OLWL 4WW2A 3DURA 1V3LA 2IPKB 5J5EA 3TA3B 2X9YA 1FL3A 2R69L 1MLCB 1JD7A 5FOBB 3BP5B 1I3GL 1XAKA 4OD1H 1T0NA 2ZG3A 4BFOA 5A2BA 4WIQA 1O75A 2FB4L 3ARGA 1NUDA 1WAAA 2ZUQC 4NQCE 4Y9GA 5DHYB 1KXQE 4PRNB 3R7RA 4AK1A 5IUCA 3AREC 4JFOB 1ETZA 2DOCA 3REVA 1B0RA 4P23A 3VI4E 1HYRC 1LWJA 2OMXB 4NB7A 5IK3A 1WFMA 1JHKH 5EU4B 2FX9L 5IVXE 4N2FA 5HTSA 2EINB 2VXSH 4F9LA 8CGTA 1UXWA 3IWUA 1EA9C 4XZUA 4CNIB 2O1AA 1HXMA 2I07A 3KCPA 4QRPB 4DZ8B 4H88H 4MZ3A 3UTTB 4XXDB 4R2GC 1UZ8A 3DBXB 1VEPA 1N6VA 3B7RL 3IPBA 4I2XE 3EDKA 1G7PA 3HI5L 4G6MH 1BHGA 5E9DB 3P11L 2WWKT 3EOAB 3HLAB 5AKTA 3M07A 3ULVC 1JGIA 2AK4E 3FTGB 1C7TA 3EO1A 1YY8A 3LPGA 5AVQB 1MLBB 3N91A 5D93C 3V0FA 4HHAB 4I18B 1G7JB 1ZHNA 1Z0NA 1ITCA 4OM0H 4GG6B 4ISVA 4LIQL 3C9NB 3RFZA 4MZIA 3GMQA 3QWRA 3UTPE 5D2LE 3RIAF 1I9IH 3SDXF 3BZ5A 25C8L 4HUVB 3WFEH 3C6EA 1FGNH 1QLFB 1V27A 2IBBA 4I0PA 4PWIA 4DVBB 5CEZH 4PG9B 2WXNA 3L9RA 4FG4A 3BT0A 4WHYG 4PPTA 3IWVA 5L4IA 1QFWM 3JV6B 4UB0H 4ZUWA 1L7TH 4AQ8A 1N2RB 1LXMA 2ZXDA 3QI9C 4IMLB 5EMYA 1NGYB 1KB9J 3KGRA 3QULB 5D96B 5T1DL 2Q86B 1U4FA 3TASA 3FO0L 4JKLA 5C0DA 3S3BB 1Q1JH 5A2IH 4EKXA 4ODSL 3L5HA 3N04A