1TR7A

Fimh adhesin receptor binding domain from uropathogenic e. coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FimH protein
publication title Receptor binding studies disclose a novel class of high-affinity inhibitors of the Escherichia coli FimH adhesin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1tr7A00
1QUNB 4XOEA 3MCYA 4CA4A 1KLFB 5IQNA 4LOVA 2UY7B 5F2FA 4AV4A 4J3OF 2VCOA 3SQBB 1PDKB 4AVKA 4AV5A 4XOBA 2JMRA 2WMPB 3ME0B 4ATTA 1N12A 2W07B 3BWUF 4CSSA 4X5QA 5JQIB 3ZPDA 5IQOA 5ABZA 1UWFA 4X5RA 3BFWA 5CGBA 1KIUB 4XOCA 3RFZA 3ZL2A 3BFQG 2UY6B 4XO8A 4AV0A 5LNGA 4AVHA 4AVIA 4X5PA 4AUYA 2JTYA 4CSTA 5FWRA 4XODA 4XOAA 4XO9A 1N0LB 2J2ZB 2XG5B 5FS5A 3JWNE 5AAPA 3JWNH 4BUQA 5FLUA 5F3FA 4J3OH 4AUUA 5IQMA 1TR7A 5LNEA 4X50A 5FX3A 2XG4B 4AVJA 4AUJA 3JWNG 3ZL1A 4J3OG 5AALA 1ZE3H 5AB1A
chains in the Genus database with same CATH superfamily
4UCFA 5L2KD 3MRPB 3NIGF 1KBVA 3FQ1A 4BWWA 2QSCL 3PYCA 4GRWB 4LOEA 1MCWW 2G60H 1QZ1A 1VEOA 1CGUA 1QVOA 1GIGL 2VUKA 4EVNB 4Q6IB 4Q56A 1AKJA 4LCYA 1BVKA 3BT2H 2FLBT 3LXCA 1UTDA 4M6ML 4UM9B 3WNLA 4BH8A 5D5MA 2NXYB 3QXAA 4TNWF 2DKMA 4KUCF 4JEGB 4FG4A 2EH8H 1OGAA 4ZW7A 3S34H 3F65A 4N8CH 5CR8A 2JKTM 4P4KB 1SY6A 1AHWA 3B7TA 5CCKL 4RX4D 3VWJB 1KIQA 5BS0E 1P4IL 3MTXA 2JQMA 2XTSA 1DVZA 3A5VA 3QDJD 4NQVA 4OZHF 4P06A 5F9WB 4ZQKA 1AQDA 2BY3A 1KELH 3LRLA 3QUXA 2CHZA 4XN1A 3NZUA 4KNTA 4YL4A 3U0TA 5J7CC 1KIUB 2D0HA 3BHBB 3X12A 2VSDA 1TQTA 3II2A 3OHXC 2GSMB 3T3MB 2FIKB 2J6WA 2CJ3A 4F8QA 4X7SH 3BPNB 3FONA 5EU5A 3NFNA 1YNLL 2YEZA 4M3KB 4FS0A 4PGCB 1KFAH 1KJMB 3QDMD 5BVJA 3DPDA 4HBCH 1T4WA 4O02B 2F18A 1S8DB 2DKSA 1KB5A 2AW2A 2ERJC 4OLUH 4DESA 5BUAA 2DQUL 3C9NA 1CICA 3LIZL 4IRZA 3IAPA 4K94C 2FVNA 4M6AA 3CHRA 5DWUH 3H9ZA 5F7YC 4ZW3A 3KL0A 3REWA 3Q3GB 3SCMB 2V0AA 3LH2H 3UX9B 3RNKB 3EGDA 2C4FU 3N43B 4WKZA 3UMTA 1Y6MR 1HCYA 3WS6C 1T3FA 3KWTA 4GG6A 1KYFA 4BRJA 1KYUA 3OAZK 1G0XA 3FS9A 1MHCA 4U1MB 1HEZB 1ZPUA 2JFCA 4WI4A 5I6OA 1PKQA 1RUPL 4ZUTB 4HKZB 2JNZA 4PRPE 4JVWA 2G3NA 1Y18A 4NI6A 3X13A 5HHVH 2CO7B 4Z7NB 2XYBA 2FL5B 4YHKL 2OL3A 4PV9B 5D7JC 4D9RD 3P4NA 1IGTA 3E3QE 3MRKB 3ZO9A 2JCWA 1PLGH 5I1GH 5L2KE 5CLTA 3WHXB 3QIUA 2X89D 5E08H 1SJXA 1GOGA 4RQQB 4HGKC 4G43A 1X9QA 2WCPA 3HHMA 3MUZ1 2MCPH 2OPCA 1JVKA 3FQYA 4FQ1H 5IVXB 2UVEA 1JF5A 2VISB 2VDMB 2ZCHH 5B4MD 4YWGL 5IQNA 3GXUB 1DVXA 1OANA 3MRHA 2PR4H 1LMIA 1RZGB 2D2CC 2OBGA 2TRYA 3APDA 3NCXA 4N1EA 4O2CA 5AD0B 4HJ0C 3UMNA 3WEAA 4BHUI 5JPNA 3BKJH 4CC0A 2HVJB 4JY5H 3GC3A 4DKTA 3QJHA 4XMLL 3N55A 3TJPA 1JYVA 2ADJA 1VGKB 1KN4H 3FL7A 2AQQA 4KJPC 2O93L 2Q0ZX 3REVA 2XWTA 5IB3B 4AYMC 3HVDA 3IPBA 5GZOD 3RDTA 3KGTA 3QDJE 3NZHH 3MBXL 4DP4X 5E6IC 1M7IB 3NAAL 3PRZA 2WWKT 3QZNA 1AE6L 4GNKB 3FN3A 2PCFB 3UC2A 2ADGA 3GMOB 3NA9H 1RURL 4V33A 2JKNA 2CAKA 5I1AB 3K80A 2FCBA 2JV6A 4WW2B 1XF3A 4NYLA 3QA3A 2PPEA 1GMEA 2OMVB 3FO9B 3QDME 4LNVA 4QRTA 4J28A 4ZO7A 4CVXB 3LZRA 1WJ3A 2PW2A 4FERA 5TQ0L 2X4OB 4KROD 1U8HA 4EDWL 5HVHC 2J25A 1TSRA 3C6SA 1AKJD 4XBGA 4QXUL 1JRHI 3MR9A 3VDAA 4GRMB 3AT8A 3RU8L 3GIZL 5IHUH 5FUZH 4C4UA 2RACA 4RZCB 4ENEC 3J8F7 1OGAD 2VZSA 3VXQA 4OI7A 5EN2B 4MRBA 4C58B 5IUCA 4Z5RA 1KMGA 2VWEC 3MRCB 4JL1A 3KH4A 1ECZA 4NIKB 3OAWA 2C1OB 3D39B 4DWHA 3QK0A 3QUXD 3PDOA 4L29A 4UQ2B 2J4WL 3AWFA 3CMGA 2OI9B 3D4YA 4RMTA 2IQAA 2QELA 3FU6A 1WA0X 1IL1B 3BCFA 3H9SB 3LQAH 3QORB 2O72A 3CFNA 3GXTA 2CUIA 5C0BA 4G82A 3A22A 5AVYB 2DN7A 4GUOA 1JPEA 4D9RE 3E9UA 4NNYA 3MQIA 5FV2A 4NDMA 3CZSA 3LMJH 4NIYE 1UXSB 1TJIL 3NGBC 2XIDA 5GS3A 1ACZA 2X87A 3JWNG 4B60A 2NNRA 2UWEB 5KVEH 3U9UA 4DK3A 2P43B 1IAOB 5IFAH 5KVDE 1MNNA 2R9HC 3BZFB 2IH1B 5CHNB 4AQAA 1ML0A 4QO1A 1CICD 1VEPA 5CJQL 3WTTA 3MCLL 4XR8C 5I1JL 3ULUE 4PHZA 3GKWL 1OLZA 3HZMB 3MODL 3T6WA 3HAEG 1S7UB 1HCZA 2A0LD 1CBVH 4Y5VA 5DFVC 2WVSA 4PJGE 3RBSA 3HOGA 2DMKA 4AL8L 1BLNB 4PP2B 2BVTA 3L3IA 3DXAB 1NFIB 4LNRB 2OULB 3KHQA 3C5SB 3E7JA 3V4VH 5CN1A 2Y07H 1MQKL 1OPGH 3U4EB 3LNFA 4GJTB 5IEKA 1XD0A 3GFUA 1X5XA 1GAFL 4A6YH 3LD8C 1HS6A 1U42A 3WIIL 1N3NB 4GQZA 3DRTB 2F53B 1KYAA 3GF8A 5AVTB 1ZHNA 2QEJA 3TBWB 3SQOH 1MHEA 4RAUB 1I9RH 2DQFB 4X5RA 4HF5H 1SHXA 1X7QB 1JL8A 3B34A 1AFVH 3L5WA 3QIUD 5IROC 3MOBH 1U21A 3SDDA 1CFNB 1PQZB 4H8VA 3TT3L 5IQ9A 1KY6A 2IOIA 1IB5A 3JT0A 3LHPH 3LNHA 4G1MA 4TUJA 3VH8B 3HTLX 1I7UA 1NEZB 5INCB 1BBDL 4G8FB 1NDGA 4MJ4A 5F70A 3TWCH 3MFFA 4AQ8C 5D5ME 1QNZH 3BD4A 4JUSA 5CFHA 2VDPB 1OGAE 3INOA 2EE2A 4HUKB 5IVZA 3U82B 2V3DA 2AJZA 4APQA 2PWFA 3V6OA 1MG2C 3A24A 1EBPA 1A5FH 5TK4A 2DD8L 3RDTD 2AJSL 3RX8A 3JTTA 5E56A 5TE7L 3RX5A 3VD4A 4UU9B 5HGBA 3DC0A 4XMPH 5IESL 1PG7H 3QB7C 1HOCA 1F42A 4G6AC 3DURB 3ZDZB 5A7EA 1CE1L 5FHBL 4LSSL 2BVQA 5T3ZL 4OV6F 1O6TA 2Z92B 3OZKA 4MDIA 3C6LA 3DK0A 3SIKA 2JJSC 3HZVA 4LVHC 1IBBA 2Y1VA 3G04A 2DTSA 1I1RA 1R47A 1L3WA 4JFEB 1LK3H 4ODTH 3MNZA 5BRZA 1MRCL 2RAMA 5L0QC 2FNWA 2FO8A 1EEYB 4E42A 1A3LL 3EH4B 1FN4A 3VUAA 3VD3A 2MIZA 4NJ9H 3TBBA 1DSYA 4B9GA 3UABA 3UAEA 3MRRB 4JVUA 5EBGA 2HJKB 3OC5A 2UV3A 4GAJL 4MJ5B 5FM5M 3CBJB 4TS6A 4NOBA 3G6JB 4KKQA 2ROYA 4N2BA 1CIUA 2Z3FA 2W1NA 4X5XB 1G9MC 5B38G 4GG6E 4LLDB 5FO7A 2H9GB 1CS6A 3ILPA 4M29A 4AQOA 1AZBA 3A21A 3BRDA 2AZAA 2XHNA 3TBTA 1AXTL 1MJ8L 3U6RA 5TK2A 4HT1L 2MTPA 1L6XA 1PKQE 4LPVA 1WPCA 2GT9B 3EBGA 1KLGA 5F9OL 2AEPH 1U8JA 4MQTB 4ODSH 3TVMC 1JFQH 3UYRH 4E9SA 3K6OA 3V5DB 5C0BD 3N42F 3EDEA 1RZJC 4N20A 1OF2A 3O0RH 5IW6A 3EYSL 5DZAA 3MUGB 5F21B 5C0GA 1YNKL 4WWNA 4JQXC 3GMMA 1HH6A 5GRZA 1R3JA 3GIVA 1YJDH 4PLNC 3F05A 4WHYH 2PWGA 1YVLA 3EF4A 4IMKA 4U6YA 5AKTA 3W82A 1F4YH 4K23L 3U2SB 1HZLA 4LVOC 5A6IA 1RD6A 2BC4B 4D7PA 4GEIA 4WI5A 2BNRB 2WXOA 4L8SB 4ODHH 3RL1B 3QPKA 1KV7A 2HAZA 2V5SA 4PJGF 1NGPL 3QGVA 3W9DA 3ZE2E 3NJKA 4ZTEA 2VXUH 3QFJB 4JG0L 4OQ1A 1HDMB 2Q10A 3NH7H 4KK6C 2EDRA 1ZEAH 3EOTL 1AJ7L 1B2WH 5C2BL 4O4YH 4PGBB 1LP9A 1RP9A 1SQMA 3NIFB 5DC2A 1MF2L 5DRZB 4XO9A 5B3NA 3I3DA 3HG4A 5DDHA 2GY5A 3T65A 1J0IA 4BFBD 3NCEB 4TQPA 4NAQA 5I6LA 2EINB 3EJCA 3MREA 3QCVH 4P23B 3IDMB 1H3XA 3UTSB 4ES8A 6PAZA 4HLJA 1SFDA 3ECBB 3LEYH 4XPAH 1GMIA 3S36L 2A73B 2P3YA 5F0PB 5CZXC 4F3FB 3T8MA 3NDZE 3SDDD 1SJEB 1XH0A 3ARUA 2FWOB 4LCIH 3CPLB 3DNKA 2JJWA 3UIZA 2N59A 2X12A 3ZTEA 2DMCA 5D5MF 3EKCA 4MHHG 1ZLVK 1NAMA 4DVBA 2OAAA 3FSAA 2VERA 4APQD 3K1KC 2GC4C 3LPOA 4WDIB 3CJJA 3QS2A 2X3BA 4N90D 3CFJB 5I1DA 1HQRB 5KSUA 3ZSTA 3OX8A 4Y5YC 4XX1G 5D93B 1CL7I 2B4CC 3CDGA 4ZMNA 3JV4B 1J05B 4KKAD 4R3SB 2XX0A 4YBLB 1E4JA 5B21A 5DQJA 5C0BE 3OG4B 1WFUA 2N0MA 3J07A 4I18A 1T1WB 4KJYA 4GBXB 3ZUNC 5I1EL 2CRYA 3NABL 3C6LD 4ZMYA 1O6SA 1LNUB 3ALWA 5IB1B 4F8LA 4CW1B 1D7FA 5TQ2H 2XZAL 1XGQB 5E8DL 4M1GL 3RWDB 2A9NL 1XF2A 2QPUA 5BRZD 1BZ7B 2GFBB 2OKMA 1JTPA 1WIUA 2VR9A 2YOAA 4HS6A 3QXVA 4QEGA 5CLXA 4AT6A 1OOAA 1XV8A 4HUMB 3JTSB 4YXHL 1EJ6A 2VLLB 1NZRA 2C3WA 1ZHKB 2H2SD 4JKWA 1C16A 3C09B 3F7VB 1N8ZB 3LKQA 4QRBA 4Y0GA 4DPRA 2DEXX 1LWRA 4LARL 1BA9A 5EV7A 2I9TB 4U1JB 3WLBB 1DL7H 2OJEA 4DZ8A 3WFBH 4GG6F 4M93C 5J6SA 2CWRA 5IG7B 5LBSH 1J7VR 1FO0L 4H26B 5KN5A 4KWUA 1YA5A 2BNQB 3RZCA 2NQDA 4HIPA 1TJHL 4IEFA 4KO7A 1XH3A 5CEYA 5CBAA 5GS0D 1E5AA 3OJMB 2BZ7A 1C1EH 4KXBA 2DL9A 2CIKA 1JPGB 4AUYA 4ZYKA 1A4CA 2X40A 4OF7A 2VDOB 1RMFL 3AXLB 2B1HH 3FO1B 3LQZB 3FQXB 2JI1A 2ZXGA 4UZUA 4FXGC 5I73C 2QPDB 3WKQA 1NKGA 3MJ6A 4V1DA 5IEHA 5BJTB 3LRSB 3RTQB 1NUNB 1OGSA 2RGSA 4OIIH 3GSUB 5B1AB 3M07A 4X6EA 1X9LA 1FGVH 2ZUWA 5E1AA 2ZSVA 3K6NA 1J1XL 3ZYOA 1NBQA 3DX4A 2BLFA 4GAFB 5DRXB 4ODUA 5LGKA 2O5XL 1QOKA 2R0LH 4M7JH 4PRHB 4IOFC 1WAPA 4U1NB 1F86A 1Z6JT 5HHNB 4ZFZB 1G9HA 4EO5A 2C4XA 3EUDA 2BS8A 2IDSA 3O6KL 3H6JA 4XNZB 3KLHD 1OCWL 5TGBA 3RB5A 1WFNA 2MNUA 3MLRH 5DZLA 3I75A 3ZE2F 2EVIA 5MEPA 3ZZLA 5EO1B 4L1TA 1B6DA 3UTZB 1RIHH 1CCZA 5EZOH 3O45A 3V6OE 4OGAD 3QFDA 3V4UH 4N90E 4F7MB 4KUZL 3RNQA 4K7FB 4GP4B 4U4IA 1E9PA 4ZUWB 4CBZA 3OKLB 1F4AA 3VXOA 2OZ4L 4OTXH 5TDOA 3ARYA 3PGDA 3AY2A 3UZQB 1CTNA 2MQCA 2A38A 2Y06H 2E6JA 1GGIH 4NUGL 4F27A 2V7HB 1YECL 2BSDA 4TUUA 2F8XC 1PEZA 4U33A 4NPKA 1BF2A 3JT2A 3EO0A 1KPUA 2ZTBA 2J8OA 3APNA 1CT8B 5BRZE 2FUTA 2WTRB 4FQ2L 3ZMNA 2UYLB 4XT1C 5ADOL 1I8KA 2RFXA 3QQDB 3FNKA 4NQDA 3WD5L 3SSGA 5I0ZA 4HS3A 2FEEI 2OK0L 5ETUA 2W95A 4HD5A 1KJ2H 2LVEA 4PRIA 4WV1B 3B2MA 5GXBB 5D8JH 2EZ0C 4R0LC 1DEEB 4WEMB 2CBOA 1D3CA 4F7CA 3TO4B 1UACL 2X53A 3NDYE 3ROOA 2E6QA 3RIAF 2VM3A 4DN3L 3ZIYA 3FUNA 1CFSA 1J0HA 5T8IA 4XTRD 3I9IA 2VZ1A 3HKZA 3OJDB 5F0LB 3GXDA 5I15L 4LFHD 1ROWA 2HH0H 5KJ4A 1X6LA 2OXHB 2DQJL 3JYCA 4TNEA 2WC7A 1CYXA 1YLBB 2DYSB 3FPYA 3QZWG 4AVIA 4BINA 1K85A 5ELIA 2ZE0A 4XCFH 1AD0A 1IC7L 2EE6A 3MRJA 3NZ8B 4OJEH 1IKFL 5C0AB 2Q7NA 5FO2A 4JO1L 2UZPA 4JO4L 1OAZH 1IGIL 4DKEL 2WUCH 2X6UA 3SBWA 1D5ZB 1FC2D 5DF0A 1YEKH 3FTWA 1OAQL 3KR3H 3P0VH 4CMHB 3FCTB 5C0CA 1QMUA 1HNFA 3FQUA 4KRPC 1GGCH 3UZVB 2XKNB 5I76A 1ZV2A 1YUKB 1T20A 5IQMA 3LKNA 5L4JA 3T0VA 3UGXA 5LNEA 4FQXA 4MYWB 4H0LC 3L4ZA 4X8CA 1BX2A 2BCKA 4N0CC 1J1PL 4URTB 1CB4A 2MSPA 4HHGA 4ZO8A 4OQTL 2FLRT 4YHYB 5CU9A 2BHZA 2EIEA 2FBRA 2V2WB 3V0WL 3ZDYE 1EAOA 4KKNA 3A6BL 3RZCD 5SV4A 3TT1H 2BVPA 3FSZA 1DVFB 4M1CD 3UL4A 4C47A 3GXPA 1A3RL 1X6NA 5E1QA 1ZA6A 1LP9E 4YGAB 1MLBB 4GMSH 4Y4KC 2EIZA 1KXHA 5HI3D 3VCLB 1N68A 3S36X 4NUPA 3JWOL 4YFLI 4WF7A 4OJAA 1ZK5A 2DI8A 3AQYA 3HNSH 1P7HL 4V1DD 1ACYH 3NTCL 1FIEA 1HHGB 3BQUA 4TL5A 5JHBA 4F8NA 4FQHB 1OW0C 1EANA 5CINL 3ULAB 1QASA 1T03L 4I48A 1UJ3B 2NT0A 2Y7QB 2Z65C 3K2IA 4PU2A 2RTTA 2WNXA 2YD5A 2BCMA 2DMBA 3MKKA 4N25A 3HC4L 3A0OA 1XEDA 4UINL 2G2NA 2F9BT 2F7IA 1HHJB 4R4FL 2X4TB 4WY7L 4LZKA 1MWAH 3K1DA 3MRMB 4MMZA 4LSTL 1A4JA 4S1QL 4ZUSB 3WIFA 1T2QH 3MNVB 3ZKNC 5AG9A 3QO0B 3QIBB 2X3AA 2XJKA 2ADFL 4RFOH 1AOHA 1LEKB 2C9AA 2VLRB 4G7VL 4N4YB 5L9DH 1UUNA 5DMGD 5HY9A 1CXEA 2MTAA 4DFHA 2PXYC 4XNYH 5J0BA 5AW2B 4IJ3C 3U1PA 1YO4A 5DJ8A 5JO5B 5I1IH 3MZTA 3HFFA 4AJYV 2R8SL 4KMTL 3QS3A 3RWGA 4C8XA 3JWDH 1X4ZA 2V7NA 3C08L 3T2LA 2GITA 2HVBA 4G80A 4UTAL 3HMWH 1GVIA 1QLEH 2SODB 4FP8L 4JFYA 3I6KA 5AAMC 3DPBA 3V0HA 4C56B 5KBNC 2Y25A 1TYJA 3F04A 3RVWD 4YSQA 2H26A 1PTZA 4QRRB 1MIEH 4ZSOA 3F6LA 3KCPB 4OGZA 2AEQH 3K6IA 3DMMC 2IXQB 3TPUB 4ZZKA 5KBPA 3ZJAA 1M2OA 3GBEA 4FNUA 1QBAA 3ABKB 2BDNH 3FSOA 2Y2YA 1FHNA 1FI8C 1FNGA 3BZEB 3KAAA 2V2TA 3LZFL 2Y7SA 5I1CL 1UKSA 5ECJE 1NAMH 1QP1A 1UOLA 3KVQA 5DK0A 5TE4L 2DQHH 3BCDA 2QLYA 4E9XA 3W38A 2NY5C 4FLHA 4QJ4B 1CMOA 1BJ1J 5AOJA 1DSWA 2X10A 3D0LB 2Q8AL 4NQDD 1D2OA 4J39A 2H32B 4HEPG 4NN6B 3SE3C 1VHPA 1NMAH 4PRID 1OB0A 2X1WL 3RY6C 4A68A 3PL6A 3KYMA 3Q2VA 3T09A 1C5CL 1B4JH 3HRZA 1XR8B 5LAXB 5IF0A 1GH7A 1WICA 2IPUK 3UP6A 2J2ZA 3EYFB 1AGBB 4MB4A 2HVKB 2R4SL 4EZLA 2C26A 5L88L 1CI5A 5T1MA 2JKJA 2CKBH 5CILL 3WN5C 3DSFH 5DQDH 2D7QA 2QLVB 1K6QH 4FL4C 5AKSA 1ONQB 1EEUA 2QDVA 2OP4H 1T1YA 2JJTC 4MJIA 3LKOB 2ZUXA 4V1DE 1BGXL 1HCVA 1ACCA 1OTSD 2XTLA 3FFCA 4J3BA 5FYJL 2BOCA 2K7QA 4J8RA 3FB8A 2VW6A 3V79C 3N2JA 1KXQA 2X4SA 3FBQA 1DJXA 4G6FB 4J4PC 5KUKA 5ITBH 4PTUB 1UCBH 3CZEA 5D4QA 1GTFA 4Y8AA 5F97E 3WJJA 3SO5A 1A2YB 3BVXA 3AG4B 3N1QC 5ISZA 5C0CD 1DQQB 2E56A 1OCCB 1X5JA 2XV0A 4AMWA 5EEWA 1I9IH 2WCGA 4ADJA 4D2NA 4F1ZA 3TX4A 3IBOA 5T1LB 3NP4A 4FQXD 2QJDA 4W81A 3R0MA 4X5QA 4DEPB 2EIJB 5AVRB 4QHMB 3HLAA 1F00I 3NT0A 2BY1A 4WUUB 2X4UA 3VFPB 2C9XA 2ICEA 3ZDYF 2OS7A 3O41A 4JPSA 4LRNL 1JPFA 3QNFA 4NJAL 3BH9B 5CNHA 1RFDH 2NXZB 2Z93B 4M43H 4UT6A 2P8LB 4LKXB 2NQCA 3MLSL 1LP9F 3NIGB 1VERA 4OZFA 5DT1L 1PCXA 1BIHA 1M6UA 1NMBL 1WVZA 4L9LC 3MRGB 1P84J 4FEMA 4G5ZL 3TA4D 1FQ9C 3S5ZA 3HG5A 3WENA 4ANUA 4P5KB 2ZJSL 1J9RA 5I0XA 3QPXH 5E6UB 1G7MA 3ASNB 1ADQA 3PNWA 5EBLB 4UZSA 5EG6C 3UG4A 3IF1A 3JV6A 4U1LA 1SVCP 4YZWA 3BQUD 3QXTA 2BSTA 5KSVA 5I6MA 1FPTL 2VAAA 3X3FH 2OMWB 4TN9A 4AEFA 2DYPB 3K5RA 3PREA 4NQDE 5I19H 5HGAB 1K4DB 2EE9A 5FK9A 2IWGA 4PG2C 1RIUL 4NXKA 1H5BC 1TZHB 2X70B 3AWEA 3G5ZA 4OZHB 4PRIE 4PW4A 1CLOH 4YDJA 5E00B 5FXCH 4BV1A 2ZX5A 1HINL 2DLEA 2LGNA 1KJVB 3ISYA 1E67A 2CDFA 2PWDA 4PB9L 2H5UA 2V37A 4KAQH 1KWKA 2AAVA 2I9LA 2ZOTA 4OM0H 1KIPB 2KLRA 4X50A 3OQRA 1DCLA 4OCYH 2IAMC 2H1LM 2VABA 1SDDA 3H9HA 4FG6D 4NOFA 2P8MB 3WIHL 1KCSH 3KYNB 4YFDB 5GRJH 4QOKB 1A6ZB 2WLIB 5KBLA 5D1XB 1NJ9B 1U95B 2W60B 5EU4B 5IMOB 1FL6A 3TYFB 4PG9A 4RWYL 5I18H 3R1GH 4AG4L 3BMVA 3ILDA 2MWCA 4NHCH 2ZXAA 4UT7L 1PY4A 4XN2A 2IWKA 2CHXA 1NCAH 3EYOB 3LRMA 3BAJA 3NZSA 1NICA 1U36A 3RWCA 3WFDL 5HP5A 1FFRA 4DZBB 4Z0XA 4X5LA 5K39A 4K3GA 4N6QA 3I6LD 4H88L 1NFKA 4Y19B 5C0CE 2A4ZA 5T5FH 4KNQA 3E8UL 1E6JH 1KULA 4W6WB 1I82A 3SYCA 4GIOA 5JORB 2P45B 2P7TA 1QBLH 3DGGA 1JGLL 4E9RA 1ZLVH 3EFFB 4OJFH 4HLEA 3PL6D 1CQKA 5D1ZA 2VDNL 5FF6B 2AKRB 1N12A 3G3LA 2W07B 2FX7L 3TP4A 5FYLL 5ITFB 3LIUA 4QRQA 3GHPA 2A2QT 1VLXA 1K4CA 1CQYA 4CL7A 4S1RL 2JKWA 5BMFH 4MKTA 1J8HB 2JB6A 3BVDB 4G8GA 2ITDA 3GBDA 4U1IB 2FBOJ 2NY1C 1JGUL 1A1MB 5CIPB 5ALBH 5BUGA 2W92A 1AS7A 4YDIL 4L1LA 3QIWB 4GH7B 3MSPA 2H0PA 3I85A 1FL3B 2JKRM 1TQBC 2DJ4A 1DO6A 3ESMA 3L4XA 4MJID 1ORQB 2VXQH 4AW4A 1QFWI 1UYWL 2VSKB 3CH1B 1KYOJ 4RA3A 4N8PA 5DFAA 1ZTMA 3FFCD 5MEQB 5JXAH 1ZKAA 3U7WH 4LCWB 1E9QA 5KYYB 5E8NA 1XF4A 1BYNA 3MV8B 2FJFA 1NUFA 1W0VB 2B0SL 5DRNA 5AG8A 3TO4C 1KCWA 1BXXA 2PPCA 3BGMB 4Y4HC 1MPAH 4DVRL 1VPOH 3AREB 5K5YA 4AKOA 3VU1A 3E9TA 4I2XA 3FUEA 4DCQB 1ID2A 3EBHA 3KYOB 3T4YB 4Z7VA 5HYSA 5DS1A 2NYZA 5ISZD 1GYAA 4XPHH 4J3OC 1EFXA 1K5NB 4NZFA 2CKNA 4Y7OC 5ACMA 1J0YA 3MVSA 4BFOA 2LFGA 2P5EB 4KRMB 3RWEA 5DC4B 5FUCE 3AZUA 3LPGA 3VFTB 1EXUB 5I6XB 2ITEA 1EJFA 5CM1A 2O6DA 3V55A 4BZ2H 1NCHA 1BYPA 5KZCD 2HA1A 5FECA 3B3IB 2WXLA 3P30H 3I3BA 1T83A 1TTGA 1JD9A 3BWAB 4HD9A 2Z0BA 1DQLL 2F74A 2X0UA 4DP1X 5IGXH 1QSEA 3BYYA 1KLUB 4PJFA 4YX2L 4JRWA 4ZSOE 4ANKA 1E4XH 2X2IA 3FMGH 4F37K 3IJSA 2O5ZH 2BP0B 2LW3A 4WFGD 4LGRB 1DFBL 3GSRA 5HBBA 1A7PL 5GRXG 5J9PB 1DBBH 4OGXL 1CLVA 1BZOA 3QUZC 1AR1B 1AZZC 1JIBA 2DWEA 4PB0H 1AH1A 1G7LA 1UM4H 4AW7A 5EU3B 3GMPB 1CF1A 4FYQA 3L9YA 3SDCB 2HG0A 3I6LE 3WO4B 5BS0B 4NKOB 3P69A 4XI5D 2G0LA 2WNWA 5GGTA 1JZFA 2NY0B 2NZ9C 3CVBA 3HC0B 4W70A 3TBCA 3ETSA 3L9RA 4NHUA 2YPKA 1R34A 2GIMA 1HU8A 1BFTA 1E42A 1MCLA 4OIFA 4IQHA 1SNRA 2YLHA 4WJG3 1FFPB 2VZUA 3ARGC 1TKWA 4ALAC 4NCDA 3N41F 5J13C 1A6WL 2HLAB 3BP5B 4NN5B 3ZR5A 5JHLL 4G70B 4QMEA 4FNLH 2W0FA 3ILEA 1BXVA 2FX8H 4WO4C 1J8RA 2H45A 1S7WB 2QPFA 2OW7A 1F3JA 1JXDA 4MS8D 4R96A 4ATTA 4EAEA 1ANUA 5FGBC 1BJ1H 5I6PA 1P7KB 1TIUA 4M02A 5DD5H 3VD0A 1IM9A 2IV8A 1Z0NA 3FULA 2OQJA 4L9DA 2ICWB 4L23A 2X0VA 4MJIE 1GS6X 3O11A 4QCIB 5TPWL 1KNOB 3SKMA 2ZZUT 2B59A 3INUL 1QPPA 2JB5L 3FFCE 5MENA 4F58H 3ES6B 1YYCA 4GQ9L 1NCJA 4N1HB 1MFCH 4QKXB 2G5RA 4L3EA 4JKPH 5CO1A 1BZ9B 1ZLSL 2BSRA 4QRUA 3ZTNH 3RFZA 1NC2B 1KXQE 1Q9LB 1NAKL 1I9JL 2A99A 4GI8A 1R3HB 4XH2A 2VDML 4YLQT 4EI5B 3FN9A 2VQTA 1CXHA 2H1XA 3A67H 3RP1A 3ZHFA 3OKDA 2HXAA 5CJBA 3UDWA 1JNJA 1TMQA 2VERN 5C0FB 4GAGH 1ZAGA 1GL4B 3TYGH 5ISZE 5JHAA 4R97C 4NKDA 1A7OL 1LWHA 4PCTA 3KWUA 2FATL 1NGZA 3DJ9A 3SHSA 3IFLL 4LP5A 3ESPA 5D1ZD 5DJXB 5SWSA 1FF5A 2GCYA 2ATPA 1R33A 2E27L 4I13B 3GM0A 4JHBA 1B4LA 1OV8A 5E8OB 4OUUB 3L3HB 4Z77B 4JMXA 1JGEB 4JN2B 1R5WA 4BJLA 5L2KB 4G8GD 4YDLC 4HWBA 2WQAA 3VG0H 3QEQA 2GK2A 4MD4B 5AVQB 3BRGC 4OLWH 5F7LB 4JS7A 4AM0A 4PJEA 5ABAA 1BG9A 1Z5LB 2MOGA 3MGOB 1P5VA 3ASWA 1PVHA 1TLKA 4AXWB 4WFGE 4ACPA 1V55B 1N4XL 2F7QA 1DBKL 1NCCH 2XLLA 1MHHA 2AZUA 2Q8BL 4L8CB 3RWFB 1SJHA 2RIKA 3BPLC 1F8TL 4Y2DA 4I5BA 4JFTA 1JWMB 1WRFA 3FQTB 4HBQA 4IK6A 5IW1A 4AEEA 1BYOA 1WF5A 2WXQA 1BJMA 3ECVA 4HIJA 4KHXL 3WEXB 1H3PL 1E6OH 1MCEA 2D3NA 3L6FB 5C92A 1EWHA 1GIGH 1KLFA 4GQRA 2CE6A 5C2UB 3RB7A 5DMKB 4WHTB 5DA0B 3M1BB 1EFXD 4FD0A 2MCMA 1A6TB 1CDGA 4M6MH 3PP3K 1NGQL 1SBBA 4I3RL 4QWWD 2BIOA 3B2VH 3P9LB 5C09A 1NGXA 1XMWA 5LG1A 4BDVB 3VU2A 5IV2A 5CCKH 3TCXA 2EE3A 5GRYA 1P4IH 3VB8A 1FAKT 5DSCB 4FQQA 3GJFK 4TUOB 2Y6SD 2AAAA 3QDMB 3RIFF 4I3SL 1MRDL 2AK4B 1QSED 3CLWA 3HJEA 43C9B 1QLFA 1BFSA 4RETB 3U9PH 3KPMA 4FG2A 4FXLA 3L3GB 5E94B 2Y9RT 3MGTA 4GKNA 2XWEA 2OMUB 2YA1A 3HBPA 3TEYA 1QTSA 2Q3ZA 3NSYA 3DX2A 2FAUA 3MRBB 5BZWB 4PY8I 1MJJA 3V8OA 1YNLH 4EXKA 3L3OC 4XVUD 5A2FA 5JNYB 1A4KB 4JMNA 1QI4A 1RJZB 2PCYA 4ZFGL 4RMSA 3BKML 4B9JA 2C9SA 1JHTB 4FABH 5D96C 3BZ5A 3UOAB 3GM8A 3MYJB 1AY1L 1MCBA 1P53A 2HX9A 2XWZA 3DX0A 4Q4EA 3HAEA 4PSPA 2ORBL 5DI8B 5ICYB 3CSFA 5E2TL 3IYLW 4L18A 3N42B 2K6WA 1MFMA 4YBQC 3IMRA 1PPIA 5GSRB 1OHQA 4BGDA 3WFCL 4NO2A 1B4RA 3CNKA 4G8GE 1UZ6F 5DZPA 3CVHB 4Q6YA 3IEAA 1RUPH 2G9HA 1UOKA 4JCWA 1EVUA 2IH3A 1U8NB 3DIFA 1IM9D 1OCOB 3QJQB 3T9WA 5DEJA 2E47A 4N0YL 2HFEA 2AV7A 1MCNA 3I02B 3O81A 1SLXA 2WQ8A 1N0XL 2BSSB 2VM9A 4MMYA 2XTJD 4YHKH 5MEND 4WTXA 2Z31A 3ULSA 4OI9A 2A1WH 4K3JL 5ID1A 4L3ED 1TR7A 1RKRA 1ZCRA 4DP7X 4JJ5B 1TVHA 3F5WB 4YHML 1NM9A 5I16A 2VXTH 3QDAA 1PGRB 4I2XE 4NT6A 3PXJA 4N22A 3G7TA 4Z7VE 4PRDB 1J9CT 2HG5A 4M8QA 4YWGH 3MOQA 4H0HB 5D71H 1MEXL 1XX9C 4IS6A 4ZXBA 5C6WH 1C5DB 3N40P 3OMAB 1IM3A 2VDPL 3DETD 1ZE3H 3V52H 2Z1KA 3BW9B 3PJLA 5HPMA 2Q87A 4XMLH 4PJHA 4Z7QE 5SWSD 5A2CA 1HNYA 1I31A 2YGPA 2YAOA 1U41A 3QHFL 2CJUH 1S7SA 4D0DB 1PDKA 4LEXL 4L8BA 2UX6A 1KTRL 3ETBJ 3D07A 2Q2LA 5JTWA 3NAAH 3RI5F 3QEQD 4E41A 2UZXA 1JZ8A 1AE6H 4QHUA 4CBPA 4X42A 2N7AA 1QSEE 2VR6A 2JSFA 2V9TA 3F8UB 4PJFE 1JK8A 3M45A 4YSTA 2XXGA 2NW3A 1D5MB 4XPFL 1DLHA 1FDLL 1AKJB 2EDKA 1G84A 1RURH 2CUAA 1EK3A 2XRAL 4N28A 5EIIG 3BZ4A 2Y69B 4BH8B 5D5MB 4Y2DD 4H2AA 4Y9EA 4XNUL 1FNHA 2RH0A 5G4MA 1TEYA 1R24A 1OGAB 2HT2D 2NZIA 3ECWA 5TQ0H 2D3JA 4XVTL 4KTEH 2OXGA 2M2DA 1FORL 5D4HA 3D52A 1FIGL 4EDWH 3OG6B 3ARXA 4HPOH 3S35L 5KSBA 3BN9C 1AQDB 1CBJA 3QUXB 1VAHA 3L2NA 4QXUH 1OY3B 3U0TB 3V9CA 3RU8H 3GIZH 4MCNA 3C60A 5C09D 4WJ5A 5FHAL 3X12B 4HG4J 1W0WA 2WQVA 4HC1A 5IBTL 5DZOA 4NBXB 3QWOA 4W9CC 5B38A 1JMXA 3IRCA 3LVTA 5C0EA 4CUCA 1JXGA 3FONB 5EU5B 3RZWA 4PLKC 3NFNB 2IMMA 1PJWA 1OWWA 1WUZA 2YEZB 3V4LA 2FYYB 4L3AA 2VO8A 5DHXB 2J4WH 3DO3A 3HS8A 5DHMC 5BVJB 2H3NA 3NACL 2X05A 6FABL 1KB5B 4AYDC 1FJ1A 2HRPL 3TN0B 1L9RA 3C9NB 2XTJE 5EOCL 5MENE 3WGUB 5I1KL 2NY3B 4L3EE 1TJIH 4AGOA 3REWB 4LOFA 2PN5A 4UQ9A 1ETA1 3TZVC 4WKZB 4ECNA 2FEDD 5I6XC 3SODB 1T3FB 4HQQL 1FH2A 4N2GA 1JTOA 5DZJA 3OR6A 4UMGA 1MHCB 5AVUB 5E4EC 3V10A 1D7CA 3MCLH 5I1JH 3AS1A 2DTMH 5KEZA 1PKQB 2CXGA 2XXFA 4W4OA 4RRPM 2NY2B 2YZ8A 1UWXK 5SWSE 5ICZA 4HIHA 3VE0A 3VG9C 1RAMA 3KW8A 1Y18B 3X13B 4AL8H 2J43A 5DQ9B 3MRLA 4U3SB 3P4NB 1IGTB 2VL5A 4IKIA 4BSWB 1G1KA 2EDDA 1R3IL 4M3HA 5DLML 3QEQE 2VXVL 4V2CB 1CTOA 2BFVH 4G43B 4PJEE 5J1AA 2XWXA 3GDBA 3UO8B 4ZMQA 2E7MA 5C9JB 1GAFH 3GYRA 3IJYA 1ZGLA 2F58L 4JHAH 2N1KA 2J20A 3L17A 3WIIH 3MRHB 2GIYA 1WFOA 1YDPA 4O2CB 1KZQA 2Z31D 4BHUA 3IGUA 5EN3A 5JPNB 2NNFA 4HJEA 1A1OB 5FKAB 2GUOA 3KCWA 5AYTA 3UPRA 4NO5A 1QFWL 2ADJB 3ZE2B 4NN5C 5K1VA 1BREA 3EZJB 4K9EC 3ARFC 4PJ8C 4Z7VF 3TT3H 5JA9A 1USZA 1M53A 5ABZA 4U7KA 5HVGB 2WXJA 4R90L 1H8LA 2K8QA 3DHMA 5C0IB 2GEQA 4ZXBD 1G7JA 2G5BA 3FZUD 3NJHA 1IM3D 3MKGA 2GBUA 4PEEA 2W5PA 1P9MA 4Z76A 1T5KA 4Z7QF 5C09E 4ODXA 1TDQA 3AWGA 3IMBA 3JV0A 3E1F1 1C12A 4G83A 4WNQA 2WWKO 2O5YL 4NSKA 3UACA 1JXJA 2DD8H 5F7BA 2AJSH 4F9PA 1XF3B 5TE7H 3D25B 32C2B 4NYLB 3QA3B 4PUBL 4E41D 5IESH 3CZFA 1SHMA 1FA4A 2PW2B 4PJFF 4TQHA 3SEPA 1CE1H 2YPLA 4N2OA 5FA3A 2D03L 5FHBH 4LSSH 1U8HB 5T3ZH 1NCOA 2WTOA 1RPQA 4KQ4L 1B88A 1S9KC 3IAQA 4C83A 2D2OA 2VR5A 1AIFA 1P4BL 4YPGB 3JWNE 4UYQA 2UXTA 2QKIC 1HE7A 3VXQB 2ARJQ 1A3LH 1GCYA 5E9NA 3POHA 3OTTA 4N9OB 2GY7B 4UIMA 5KJ7E 1U8OA 1TTAA 3V0AC 2LR4A 3DHJA 3L5JA 4L29B 3PDOB 1E43A 4GAJH 5I82A 3TBYA 2ESVA 2Q7AA 4I0PA 3MV11 4CN4A 2IQAB 5DJ6A 2EYRA 3C60D 3G5YB 4U05A 4KITB 4TV3A 5C0BB 2XQBL 3EJZC 1RLWA 3NQKA 4L8DA 3L9EA 4L1BA 3SKUD 3B9VA 2FWLB 3L13A 1VFOA 2DPKA 4NDMB 3OHXA 2XU9A 1MJ8H 1FYHB 1N7ML 4XP9L 2B9AA 4YC2C 4HT1H 2AGJL 4TVPL 5A2LH 2VDOL 2BW4A 1KPRA 3F2LA 5GRWA 5F9OH 1CK0L 3ZGIA 1ZSDB 2PYEA 2HKHL 3N40F 3PABB 5AZEL 1K3IA 2K4AA 2VN5A 4UQAA 5G55A 4DKAA 4GEJA 3EO1A 4AQAB 2AJ3A 4B6ZA 2R83A 1E9OA 4HKXA 3FT2A 3B9KC 3EYSH 4MMXC 4F15B 3EJPA 4DP5X 1YNKH 5GS2H 1EIBA 4OLVL 1ZD6A 3MO1B 1KF9B 4JE4B 3JVGC 2XQYK 1JWSA 4XBMA 4K23H 3JZ7A 1GS7A 1MELA 4YDZA 2ODHA 5DUPH 5GRUL 3WS6A 4EIZC 5D70L 4LQFH 1T0NB 4H8WL 5CWSA 4LBAA 3DOSA 4F2FA 1EH9A 2I07A 1WS8A 1X5HA 1UWFA 5IEKB 2EIMB 2IOOA 5GGSY 1NGPH 4ODWB 3D85A 4PJHE 3QT2A 4JFOA 1KN2L 2F8IA 1DE4A 3SKNA 2ENQA 4JQIL 1X7SA 3NK3A 4X5WA 2B20A 1X9RA 4JG0H 1UA6L 2NUTA 4PREB 1GZHC 1MH5A 3BFQG 1M1SA 5D7JA 2YRPA 3QJFA 1BQHG 3EOTH 4E41E 3EHBC 1AJ7H 4O2FA 5C2BH 4PJEF 5I66A 4L37B 4YSCA 4H13C 3SDDB 4XP6H 1MF2H 2COVD 4ADIA 1A65A 5IQ9B 3KPOB 3FFDB 1UM5H 3UTQA 1MCIA 1HXKA 3FU7A 4G1MB 4TUJB 3LN5A 1I7UB 3LXUX 3UBHA 4OFDA 4MNHA 1NDGB 4WWOA 2DM7A 3MFFB 1XGTA 3S5YA 3S35X 3DX8A 1A0QL 2D4DA 3S36H 1GC1L 3DVIA 3PP4H 4P05A 1QHQA 3MNMA 4N0UB 4GSRA 5J1TC 3K71A 1N0LB 5ENWA 1RUQL 5IVZB 4DT2A 1JUFA 2BIMA 4IRJC 4UTBA 3EYQD 3I9AA 5KG9A 1ERNA 3JTTB 5KSBE 5AB9A 4L1SA 3TNMA 2K70A 1XB3A 3PHQA 4NC0B 4JREC 4Z23A 1ZGLP 5E6IA 1INEL 1HOCB 3PDGA 3BIKB 2YZ1A 4EUPG 3NUKA 1PFOA 2IBBA 2BVQB 3ABMB 5B4MC 1G9NL 2ICWI 3P2TA 3T1WA 1JCKA 2KUTA 4MDIB 4S11A 5M94B 2R56H 3ULUC 4HSAC 1W0YT 5I8EA 1J9QA 4MCMA 3WMQA 2WXFA 3VGDA 5BRZB 4A7TA 1KENL 3OZLA 5CJOL 4K3EL 1NC4A 4QF1B 5DHVH 1SBSL 3L4TA 4XOEA 2YPLD 3ZHNA 2BX5A 3QZWA 4WHCA 3VA2C 5I1EH 4ZMAT 3C5XA 4TVSa 4BZ1L 1T4KA 1TCRA 2XZAH 5E8DH 4M1GH 4KJWD 4BSVA 4K55A 3UIYA 1LK2B 1PS3A 2BVEA 2DKUA 4HJ1A 4EE2A 3CZKA 2EUVA 4UAOC 4RA0C 5FO7B 3ILPB 5A2AA 5HYQB 3HBGA 1U3ZA 4YXHH 3WY3A 1MKFA 3UERA 4OVVA 3TBTB 5L4FA 2IC2A 3AG2B 1PBYA 4UANA 4QAMB 2BK8A 3U6RB 2D7TH 5AB2A 2CCVA 5GIRA 4LARH 3EOBA 1KLGB 1ZLWH 3MV7B 2ESVD 1FGNL 4I0PD 3VYNA 4KROC 1ROCA 3TA3C 5BXFA 1XT5A 1WK0A 3MLTA 4U1GB 4PD4K 4HETA 1FO0H 1OF2B 3QUYA 4D8PA 1CI3M 4EUPH 5IW6B 1TJHH 4X7EC 5C0GB 4PWJA 5T5NG 3D34A 1Z1WA 3GMMB 3EJYD 1HH6B 3POCA 4GAYB 3GSNL 1R3JB 3ATAA 1XSIA 2X7LA 4TNVF 3ZE1B 3X11A 4M5SA 3EJRA 3BP7A 2PYED 1AHWC 2E7LA 3ET9F 5IKCB 2CDEB 1WS7A 4DF9A 1PKOA 1HL8A 1WO2A 5HPOA 5EULV 1YQVL 4IRSC 4MXWL 3RJDA 2P24A 3ARWA 3BC9A 1V3MA 3DSNA 4WFED 5FOBA 3DTXA 3X1GA 2VJ0A 3MLXL 4QTIL 3W9DB 5JXEA 3A6OA 3UP1A 5FWRA 1II4E 3ZDYB 1R5VA 1BD2A 1ZVHA 1EDQA 2O5XH 3L3DA 2E7CA 4HCRH 5IB4B 4LESA 2XVBA 1ITCA 2V9RA 1LP9B 3O6KH 4DQOL 2IO5A 1OTTC 5I74C 3VMOA 1DO5A 5TF0A 4PJHF 3RPKA 5I28A 3D85D 4WK0B 5DDHB 4N24A 1CICC 4J3WA 3SGJA 5EWIH 3B7UX 3TV3L 3WY2A 1D7BA 3MREB 4FNQA 1YAIA 1A25A 3D87B 4HWUA 4OY9A 5G5DA 4EQ2A 4KUZH 2MEJB 3VXPA 5D7JD 3QJSB 5IJBC 3ULVD 1TEGA 1DUZA 1UM6L 3QRFM 4XX1E 2OZ4H 1RY7B 4RDBA 3TEZA 1QLEB 5IROA 3UTOA 2YPLE 4KO5A 3O3BA 1J87A 4UNUA 3JXAA 2F68X 4NUGH 3FT0A 5D9SA 5F89A 1NH6A 1YECH 3SPCA 2YFOA 5F7EL 3GPEA 1ADWA 4YE0A 5DJ2A 3IS0X 1ILUA 1AR2A 4CVUA 4HA1A 4GW4A 3MDJA 5EF3A 3DX3A 5ACZB 4AK2A 4HJ0D 5C9KA 4AQ8A 4FQ2H 4GG8A 1NAMB 4DVBB 1D5IL 3ARBA 2PUQT 3VRJA 3TGXA 4F57L 4KJPD 2IANA 3ZXAC 3WD5H 5KSBF 5I23A 2WGNB 2JTDA 3TS8A 1IGFL 4HEPA 5F8QC 1SEQL 5I1DB 1DQVA 1S78C 2FO4B 3OX8B 3QIUC 4NNPL 5KSUB 2OK0H 4IIZA 3CDGB 4ZOEA 3NP3A 4NQUA 2ESVE 5DURB 4RBPK 5E6ID 3CBKB 5AZUA 4ZAKA 1FNEB 4V11A 5CGMA 2O5NA 5DQJB 1FYTA 1AANA 2ITCB 3NCJL 4DN3H 1VZGA 3S3BB 1CXIA 1TSHA 1JRHH 3KM2A 4KJYB 4XBPA 1VADA 3I9PA 3V0DA 2Z4QA 2Q3XA 1O6SB 4FCAA 1E28A 2LHAA 1AGFA 3E1ZA 3ZRCC 2HRLA 3PGCA 3EOAA 2JJSA 2GSGB 3ZE0B 2XIIA 2CKBB 2XJLA 3LNIA 5I5IA 4MZ2A 2PYEE 1Q1PA 4PJBA 4AT6B 1NC4D 2DQJH 3SZ6A 4YGVA 4L5FH 1XGYL 3RDTC 1YEHL 2WPGA 3ZYJA 2HJLA 1WZLA 3L2LA 5HHMD 1B6UA 1C16B 3LKQB 1A9VA 3ZDXE 4HKJB 4WFEE 1E0OB 1IKFH 3N3EA 4JO1H 5BNXD 2VITA 4JG9A 4JO4H 1ACXA 1JNLH 3NJGA 3VFNB 3ULUD 4LEEA 1Z5YD 1ZT4A 2CA4A 1IGIH 4DKEH 2TSAA 1PZ5B 4XB8A 5EFIA 2UZYA 3RIKA 5KN5B 5MI0C 1UA7A 5L4MA 1OGTA 3VRLE 1QG3A 1S4IA 4IEFB 2B8OT 1XH3B 2R15A 5CEYB 4AIXA 3MJ9A 5GGSB 1M7DA 1RCYA 3H0TA 5L8LB 2W9DL 4ZYKB 5GJTH 4KRLB 4WRLA 1J1PH 2PNDA 1VZIA 25C8L 4PFEA 3TVMA 4WTWA 1Y6NR 3V0WH 3IFOA 4V1DB 5IEHB 1IFHL 3QUYD 3A6BH 5C3TA 4XPGL 1CFMA 4K94H 5KVGL 4G8AC 1A3RH 4J3TA 3ULVE 3O2DA 2H6UA 4JPVL 4ZO6A 5E1AB 1G4MA 1E8ZA 5IREA 3RWIA 1AMYA 3OM3B 1HL5A 2ZSVB 3VXTB 1P1VA 5EOTA 3JWOH 1HX0A 1X5IA 4JCMA 2OFQA 4WI2A 4XN4A 4UQEA 3EOYG 2QVTA 5DGRA 4PQXA 4UQDA 3DO7B 1V3KA 4PD4J 3NTCH 5DU7A 5TGBB 5CINH 4JPQA 3T6VA 3I75B 5FW8A 5FW6A 4GXFA 2BJML 5MEPB 2L4OA 1F58L 3HC4H 5JMRA 4JM2A 5DFVD 5JXED 1IEAA 4UINH 2J55A 3O45B 2H0JA 1BD2D 4R4FH 2YUZA 2J72A 2R1XB 3RNQB 4WY7H 4HIQA 4S1QH 2R51A 4LSTH 1T89C 5CP3H 1BWWA 3VXOB 3F12B 4AV4A 5TDOB 4AQ1A 2WP3T 4G7VH 1WA1X 2E46A 5HVFB 4RIRB 2XACC 4OT1H 3ARVA 2R8SH 1UADC 4KMTH 4FG0A 5LUMA 1ESOA 5DZ9A 4B41A 1H15A 3C08H 4Q7DA 5EBMA 5CCGE 3Q2LA 4FZ8H 4Y5VC 3VFUA 4XN8A 5F7KC 3LCYA 4UTAH 4FP8H 4HP5A 4A7GA 4CU6A 4YK4C 5IROD 4WSKA 2Q5BA 2RFXB 1I7TA 4PWGA 4NQDB 5JDSA 4MB5A 5HHME 4IBTA 4ZMWA 4XOCA 5DS8B 5KOMC 1WZMA 2YLKA 3FHAA 4F2MA 5ETUB 4NKIL 3CFCL 2GPZA 2IPTH 5I1CH 4RRPA 5BRQA 4F7CB 1NMCC 2X41A 3FB5B 3ROOB 4PJIA 1EZLA 1L6PA 5TFSH 4UV7L 3ARBD 4G3YL 1TTRA 3N41B 1FVCA 4BFIB 5AW0B 1CFSB 2M1KA 1JZHA 1G7QB 1Q4NX 2IAND 3DUUA 2Q8AH 3WXWL 4E9WA 1OAKL 2ZWNA 3OLIA 2VWEE 3KWXA 3L7FA 1WZAA 2BY2A 1WBYB 1FNFA 3W0WA 2EDTA 5F7UA 1MVUA 2CK2A 4Y5YA 5ICUA 4ZAKD 1M7XA 2ZWSA 3OWEA 4ZG1A 1C5CH 1FYTD 1KTJA 4G6AD 3Q6FA 3ZYIA 5F0MB 2KZWA 5C97A 3VTMA 4B9IA 3GKZA 3MRJB 4NRZA 2X0WA 4LDOB 4WKXA 5EO0A 1WEJL 3FB7A 3GLEA 2R4SH 1QRKA 2BPBA 4HIEA 2QMKA 5CILH 4P46B 3EBAA 3I84A 2QMJA 4APQC 1YN6B 2CRIA 4U7MA 3R06A 3WMPA 3N91A 2PWEA 1IGJA 3CN4A 3KPRB 3FQUB 3K74B 4LIQE 5C0CB 5I76B 1UXWA 3ZDXF 1T20B 1HK6A 3LKNB 3BFOA 3GD1C 1XXFC 3SPVA 5FO8A 3O4OB 4D9QD 1YN7A 1BVNT 1BX2B 2BCKB 3N50A 4JUTA 3QUMA 4FX5A 4L48A 4M9PA 4U6XA 4U2ZA 3WUWG 3VQ2C 1RP8A 1RJCA 1RZIA 2VRQA 2UY7A 1C8PA 1BD2E 1FL5A 3C6LC 4RMRA 4EZMA 3W11C 4YXLL 1E3FA 1X5LA 2PTUA 3EJQA 5I2IA 1ZA6B 1JZ6A 4KI5C 2DQMA 5BZXA 3A6CL 1RZFL 1MFAH 2UZIL 1UUSA 5HJDA 2EECA 1MLCA 3TVMD 2H2SC 3MJGX 3OAYK 3EO9L 3OGCA 1RV6X 1MFDL 1EERB 2EJ1A 4FXGA 4NJAH 1FFOA 2E7DA 3ULVF 2WBJC 3CG8A 4I48B 2FRGP 2DWTA 4X98B 1TTFA 5DT1H 4S0SD 1O7SA 1NMBH 2Z34A 4G5ZH 2LU5A 3CQQA 5EIQA 4ZMTA 3ZQWA 1XIWC 2ZJSH 4X80L 4BH7B 4MMZB 3NSDA 4JFSA 1LMKA 1TCMA 3WIFB 5GS0C 1IILE 5AZ2L 3N44B 3P9MA 4JR9L 4MTMA 1Q72L 5ADPL 3NJFA 1VACA 3QEHA 1KACB 5HY9B 1INQB 4K4KA 2AJXH 4U49A 5ID0A 1MCDA 3CXHK 2KMWA 3MJ7B 5DJ8B 4JM2D 4F20A 1S3KH 4IBLT 3GRBA 2IANE 1HSAA 1U58A 3RWGB 3P2BA 1E8XA 3QUKB 3U7YL 4G6MH 5CSGA 4W6YB 1RIUH 1JZDC 4G80B 1NOAA 5IWLA 4NUJA 5K69A 3CSYA 3I6KB 2WQSA 3UFIA 4NKMA 4K9EL 2H26B 4TVUA 3D51A 1FYTE 1HINH 1KT2A 4ZSOB 5TJWK 1FZOA 3CHQA 4XNDA 1EHLL 3KG5A 3RFRA 4PB9H 4IKNA 4XRCA 5F6HI 3PXHA 4HU8A 1FNGB 2JCCA 2V2TB 2OX5B 3W81A 3U30B 5DJDA 4F7PA 1MCKA 1BEYL 2ITFA 4GRLC 4PJBE 2X6AA 3THML 2XWBA 2P49B 4OGAC 1JPSH 5HHVL 3WIHH 4X6DA 2C3VA 3KPPA 1IBYA 3OKKA 3IDNA 3GRGA 5HJBA 5D72L 5D2NC 1T6VN 4RWYH 2PKDA 2Y1ZA 4QRPA 4AG4H 3LEVL 4XO3A 4A55A 3O8XC 5EIVA 4D9QE 1MHPH 4UT7H 5J3HC 1X3DA 5F3BA 3S3PA 1JZ4A 4KX8A 1OARL 3VWKB 4R0LA 5GGUA 5IF0B 4FQ1L 4QTFA 3SGKC 5LXGL 3MA7A 2NT1A 2CRZA 1S9XA 1CG9A 4H88H 1AHKA 2ENYA 3E8UH 5DJYB 5T1MB 2BRQA 1HH9A 3U4AA 3DIDA 4J6RL 2EVHA 4XZUA 3W0WD 4KKRA 2VZ3A 2XPYA 1JGLH 4OV5A 4JRYB 1BECA 1T1YB 1KN4L 2VDNH 4MJIB 2RALA 3QWRA 1QRNA 2FX7H 5FYLH 4NUQA 4OLZL 4M7LT 4HHAA 3KHOA 3NZHL 4J8RB 3HPJB 2VQUA 1U3YA 3HG1A 2ZWKA 3FB8B 2RA1A 4J1UA 1VFUA 4LLWA 1Q9WA 4YZFE 1JGUH 5DD0H 4AV5A 2EUXA 2X4SB 4YDIH 1U3JA 2Y4SA 3QC5X 4K5LA 4O51A 3FOMA 2EILB 2ZCLH 2Y3NA 4OLEA 3IJ8A 1YZZA 2WSPA 5FB8A 4O5LL 3KBPA 2JXMB 4XTRC 3WAJA 5ISZB 4N2NA 2JKSA 1UYWH 4Q58C 4IGBA 1DLFL 4U6HB 1SYVA 2AITA 2PTTA 3GWJA 4GRWH 4KKLC 1HC1A 4NFCA 1E3ZA 2B0SH 2OMZA 4NEHB 2OR7A 2VE6B 1I4FA 4YHZH 2WXMA 2FEJA 3HLAB 2FHBA 3OGOE 4GKSA 4I18C 2IV9A 5C3IA 1MCSA 3O41B 1RZJH 3BAYA 1ZLUK 1JPFB 1UASA 4ACTA 5KZCB 4LASH 2OMTA 5MP6L 3LEXA 2QADC 1BIIA 2APBA 3OV6A 5H4YA 3AGVA 4BEIA 1CDBA 1IEHA 1XTLA 1XZWA 4HV8B 1HFUA 3HJ0A 4Y4KA 4X99B 1G7MB 3PNWB 4QD2E 4FLOA 4HAFA 4U3XA 2QT6A 4JFDA 3IF1B 4U1LB 3CUPA 4TRPL 4WEUD 3D18A 1JCVA 1NFAA 1JERA 4X4MA 2VAAB 2K0RA 1M6OB 3B1TA 4LLAA 5JLZA 1M9SA 1DQLH 2TAAA 4ZPTA 5E6RB 2A7BA 4A37A 4YX2H 2G2RB 4UNTA 3RZCC 4O9HL 1NDTA 3GXNA 5I71B 3NCYP 2QVIA 4DAGL 4F2ME 4PJAA 1OAYL 1MCRA 1ZRUA 3G5ZB 1A7PH 1LD9A 3GSXA 4W9FC 2JJUA 4OGXH 2DWDB 1KJ3L 1OSPL 2X28A 4DTGL 2J5LB 5ALCL 4PJIE 3LY6A 5IY5B 3IN0A 3VXNB 2PXYA 2CDFB 4LLMA 2EKSB 3CFBA 4OLXL 4EN2A 4AVJA 2I9LB 3RDJA 5LCVA 3CX5K 3BUYA 2ZX8A 1N6UA 3W0WE 3K6SA 1IC4L 3BX7C 4N5ED 5AAMA 5DYFA 5DHEA 3RL2A 4P48A 4XC3L 5JHLH 1A6WH 4MA7L 5I75C 3D48R 1H19A 2EXSA 3CXHJ 3K8KA 4GP8B 1NBYA 1KCVH 1FL6B 2Z8WC 1JZEA 3CVHL 4B9YA 1MN4A 4JZJB 5B8CB 5DMGC 2EYTA 3F84A 3OMZA 5CGYC 5I6NA 5JW3L 1ET7A 3KYAA 5IW3A 3TESA 4M7ZB 5KVDL 1E4KC 4PJBF 1LO5B 3X1EA 3BPOB 3IETA 3FU9A 3RWCB 3VW3L 4ZFFA 4Z0XB 5H35A 3HEIB 3D08A 4UUJB 1UHVA 3HI5L 3Q5YA 2HTLC 4E0RB 5E5RB 3Q1EA 4XNMA 3INUH 1KXVC 2JB5H 1I9RL 2P7TB 3DGGB 3HG3A 4GQ9H 4QRPD 5D7IA 3SE3A 1NA8A 4UQ3A 1ZLSH 1JNHB 3UBXG 1A14L 3EW3B 1AFVL 5D1ZB 3MOBL 4I8DA 1NAKH 2EZ0D 2VUOA 1I9JH 2YD7A 3RY6A 1RULL 3BP6B 2VDMH 4R83A 1K4CB 3RGVB 3ML9A 4HOWA 2JB6B 4G8GB 5DZVA 3RWJA 1YY8A 2ZSWA 1A7OH 2VDRB 4RBPH 3WAKA 2FATH 1C5BL 3P0GB 5EUKA 5LGJB 3WN5A 4RCAA 5HGDA 2VO5A 1ZHLA 3TIEB 4R2GC 2BY0A 3QWRD 4N8UA 1QRND 1XGRA 3KLQA 4DGYL 2E59A 1SJVA 2VSMB 4LSQL 1PFCA 1C7SA 3NJVA 2R7EB 4UAHA 1GGBH 1E9QB 5E8NB 1XF4B 4QIRA 4YZFF 2FJFB 4X8JA 5E2VH 4KTGA 3HG1D 2B3RA 2RCSL 1PG7L 5DRNB 4Z6AT 1RERA 2GAZB 4P2OB 4RGND 2I69A 4Z3JA 1FZKB 2Z7UA 2VJXA 4J4PA 1LDSA 5HYSB 4Z7VB 3U6XS 4GI9A 4YPJA 2UY6A 3O9WA 4AYBA 1EFXB 1DBKH 4IGBD 2YEQA 5EIIA 4YE4L 5G4NA 2Q8BH 1OSZA 1F8TH 4ODTL 3KJ6L 1SY6L 4JM2F 4Z7QB 4BCZA 3RWEB 2G4EA 4KDVA 4KHXH 4N0CD 1IO4C 1MJUH 3MBWA 3N1PC 2ZIDA 4TLSA 1AD9B 3QG6A 4G6JL 2FECL 4MLIA 1X5MA 4MXVE 3QI9A 4JQVC 2CLVA 3FTXA 3KL5A 5CBEA 1DQDL 2YD9A 2F74B 3SBWC 1NGQH 2BOBB 1WFTA 2C1PB 2P5WA 2ZUTA 4PJFB 4I3RH 2EDXA 4Y4KD 5DD6A 4S2SB 5J5EA 2AVFA 3WKML 3CU1A 3SY0A 4JFDD 3BUPA 3GSRB 1OP4A 2JCCE 2ED9A 2GW5A 4FQXC 4DUXA 5KVMC 2DWEB 4A7GF 1KB5L 4GXVL 4PYGA 3FTYA 2X2YA 1MRDH 3PHOA 4I3SH 2YMXH 4NBZB 4X6DE 4IRZL 4JL2A 2KZKA 2CMRL 5CJXA 3O0RL 1BW8A 2RD0A 4NHUB 2YPKB 1HHKA 3KJ4B 3QPQC 4QRPE 2O6CA 4PG2A 1H5BA 1P1ZA 1NEZG 2BMKB 3F62A 4XCYB 3UBFA 1LO4L 4PJIF 4FE9A 1V3LA 4PJCA 3ESUF 1AYRA 2PXYD 4ZFGH 5EUOA 3BKMH 5JQIB 1G9EA 3TJEL 2W0FB 3T04D 2VDQB 3NG5A 4XCEA 3BQUC 2G3ZA 2QZ5A 1R6VA 5AW1B 3ZPDA 4QUOA 1QW8A 3PWNB 1F3JB 4K9JA 4XB3A 4R96B 4B96A 4KKBD 1AY1H 5AVWB 2X9XA 2IAMA 1IM9B 2ORBH 4XAKD 2OQJB 3WY1A 3PIQA 2P28B 3O11B 2OL3L 1U92B 4B3EA 3SKMB 1QRNE 2VXUL 1IC1A 5HI5D 3VFGL 2XTJB 4ZI8A 4W93A 4PBVC 3WFCH 3T0XA 4L3EB 3O3UN 3RFZB 3PFQA 2BSRB 3HG1E 4QRUB 4O4YL 4DP9X 4K8RC 4P5SA 4RGNE 4XH2B 3HNTL 3E2HB 3VDCA 2H8PA 3OKDB 1MXDA 4N0YH 4QHKI 2FZ3A 2JELL 1XB6A 1N0XH 3GSQA 2WCSA 3LEYL 4XPAL 3HFML 2Z91B 3SDAC 43CAB 1NGZB 4K3JH 1WCBA 1ULVA 4FG6C 2DIBA 4YHMH 5SWSB 4ZX5A 2GCYB 2ATPB 4B7IA 5F9JA 1JV2A 3ESNA 4LCIL 2Z8RA 3V8CA 1R5WB 2EXYD 4GFTB 1MEXH 1KG0B 1QQDA 3Q9PA 3QEQB 4O00A 2CG9X 4C4KT 3G5WA 1EJOL 4PJEB 1TO5A 1P5VB 2V9QA 4BE6A 2FWUA 3QHFH 4JFDE 2NR6A 3ZTDC 4LEXH 4G8IA 3T4AC 1N70A 1SJHB 4ZFOA 4X4ME 4PRBA 4MA1C 1BVLA 3CHPA 3PL6C 5IW1B 4H1LA 2GG1A 3HRZC 4TSBH 4FFZH 4HIJB 1LJMA 4HPHA 4Y5XC 1U8PA 1M1XA 4J4PD 1KLFB 4EMZA 3P9WB 3VXSA 3KBHE 4XPFH 3OJ2C 3O9WD 1FDLH 4PJAE 3NEEA 4PV8A 2XRAH 5TQ2L 2QR0A 4GIPD 1E5BA 4FQJL 2CZNA 3PHAA 4IBUA 4XNUH 5IIEA 1NGXB 2JKLA 3IPFA 2ZXCA 1HI6A 3P0YL 2MQ0A 1UZ8A 1XGUA 5IV2B 2XPGB 4XVTH 1JV5A 1FORH 4MXVF 2XUWA 3S35H 1GPOH 4E5XG 4FA6A 3QI9D 4IKLA 4WW1A 3VYOA 1H8OA 3P02A 1EEQA 1DL7L 1JOIA 4XAKE 5FKPB 3V0EA 2P5WD 3H2QA 3WJJC 4FULA 3KPLA 1QLFB 5FHAH 3KPMB 5IBTH 3P3YA 3MGTB 4GKNB 4UYPA 3CCHB 3GMQA 2JCCF 3T8XB 3QO1B 5BUPA 2HYMA 1QLRA 4UNVA 4PR5A 4YHNA 2VW4A 5H37G 1ZDSA 1MJJB 1VF5C 4XGZA 4PY8J 4QJ5B 4TULH 3G5XB 5JW4R 3QUZA 2YA0A 3NACH 3P2DA 2ICEC 3R8QA 4ELDA 4X6DF 2NZ1A 2WSKA 2HRPH 2DQCL 1UFGA 3GMNA 3OB8A 4TTDD 5I1KH 4OIIL 5D7IE 1WLHA 1GRWA 3G08A 2VC2B 3KWWA 2CU9A 1KV3A 3UAJA 4CVZA 2W8CA 1WCQA 3MCKA 3CPUA 2R0LL 3QH3B 1KXTA 4HQQH 4M7JL 4Q97A 2RR3A 5I5RA 4NO2B 1F1AA 2NRDA 1NGWA 4X6BA 1F6FB 1OKEA 5JYMA 1ZK9A 2FQGA 2VR7A 2G9HB 3O3EA 4PM1A 1P69B 1U9KA 4MD0A 2IH3B 2IAMD 5KSAB 1YAZA 5FGBA 1PG7X 4ZMVA 1A6VL 4HULB 2AV7B 3EDJA 2X1OA 1RIHL 1MSPA 5EZOL 3V4UL 4DETA 2L3BA 4MMYB 4HU2A 4KTYA 3ULSB 1ES0A 5KYWB 4KO9A 2F5BH 4TTGA 5JA8B 4K07A 1R3IH 4XMUA 5DLMH 1TVHB 1BQHA 2PO6C 3HE7A 5F1NA 1I8LA 2WLYA 4EBQL 5GGRY 2FQEA 4EDXA 4NT6B 2WYHA 3CFQA 4OKDA 1ZY9A 3SO3C 3DBXA 1P6FA 1GSKA 2F58H 1MAML 4MS8C 4OCSL 4U2YA 1I8MA 1P4LA 4BKSC 2HG5B 4M8QB 4MVBD 3ESOA 3Q44A 4I4WA 2R1WA 2ZYIA 4L1DA 1D5BA 4ZMPA 1IM3B 2VKXA 4FQLL 3MBEB 4HDIB 2EXWC 3DHPA 1Q0YL 3Q2CA 3QAZB 4N6RB 5HPMB 1V7NL 3PQYA 1I53A 1M05A 4PJHB 1QFWH 1LWJA 5DFTA 2ILLA 1K9TA 2FT6A 5LHDA 4MJ6B 3OL2A 1S7SB 1PDKB 3TONA 4FYTA 1PYWA 1QUNA 3C75A 4L8BB 4EI6B 4LXFA 3EG9A 4R90H 3EGXA 3OWRA 1F4WL 2HN7A 2UZXB 5D8JL 2IQ9L 8FABA 1ZVYA 2NY1D 2P5WE 4FMFA 2WZ6A 1JK8B 3NPSB 1V54B 4NRXA 2IBZX 1GOHA 2NW3B 3GJFA 1DLHB 4CVWA 2NR6D 4MCYB 2O5YH 4ZT1A 4QT5A 5B22A 4FFVC 5LLIC 4JHZA 5D1ZC 3WTSA 2YD3A 4PUBH 5ERWA 1H6FA 1O5DT 1UCTA 3TEXA 1R24B 3DGDA 3FUFA 5GS1B 1JHKH 2BWDA 1E30A 5ECGA 3D09A 4IBQA 2OXGB 3VXSD 3CZJA 2D03H 4RGMC 4PJAF 4U4BA 5B3SB 1Z66A 5KSBB 3OXRA 4B5ZA 4AY0A 4JK0D 4KVCL 2D7PA 3TEWA 4DUWA 4JDZA 4KQ4H 1VESA 2YGVA 2X4NA 3BP4A 1BWMA 1P4BH 5FCUL 2EDBA 4FNSA 1T7YA 3C60B 4KJQC 5AOLA 4JVPA 4WJ5B 4WI7A 3ISRA 4HMDA 1W0WB 4OCXH 2G75B 2UUDH 1ZANL 2ALWA 2W94A 3DJZA 3KR3L 3QXDB 4Z7WB 3ELQA 5ESVA 5C0EB 2APVA 1N67A 3D69A 4YQXL 3HC3L 2X6CA 3BGFB 1HOEA 2QKSA 3Q01A 3ZN6A 5DVOA 4N8VG 1GYVA 3MRQA 2PLTA 2E4TA 1EA9C 1AZNA 3FJTA 2AJVL 3WSQL 1EEZA 2XQBH 3F00A 1IAIL 4UBDD 2XN9B 1H8SA 3NCBB 2K4WA 1FO0B 1N7MH 1XSOA 2EKJA 4FHKA 3RURA 3UO1H 4P5MB 1U8CA 1G7HA 2AGJH 3ZK0A 4XNQA 2VUYA 3QUZD 3C6EA 3L3OA 1CK0H 3ALPA 5AZEH 2HKHH 3KPQB 3OR6B 1D5RA 4XNXH 1A7NL 3HNSL 3OKMA 3H7BB 3T71A 3C8KA 3VD9A 4YSEA 3ARDC 1LE5B 2AMGA 5D7IF 5EPMB 3PG2A 2MMXA 4UB0L 2XPZA 4W9EC 1LO3L 3UAJD 4JZNA 5ICZB 1CVSC 3BMWA 4N2MA 3FRUB 4P07A 3CHSA 3FUIA 1XL4A 2D31A 1S7XA 5GRUH 5J8OA 4OCLC 5D70H 2VL5B 2M8XA 4H8WH 3LHAA 4XP4L 1U4EA 4XVUC 5L9DL 1NGYB 3ILQD 4UF7C 4ZX3A 3CE1A 1X4YA 4XNYL 2AABL 3FUHA 5DTFB 4X4ZA 1N2RA 2IGTA 3IJYB 1DN2A 5I1IL 1KN2H 4RFNC 3MNWA 1EXGA 1XR9B 4JQIH 3HE6A 4NB7A 1PNCA 3S37L 1WH0A 1YDPB 2EQDA 3VGAC 1UA6H 2UXGA 4ZD3L 4G5AA 4M00A 2GUOB 3HMWL 1QLEL 4JFWA 4KK8D 1CJYA 1YYLL 1F90L 4NO5B 2RBLA 3HE7D 4PWKA 3UPRB 2DDQL 4I7ZC 3WTYA 4H8HA 3VGFA 2NPLX 1VEMA 3IGLA 2AEQL 3VXSE 2VLKA 1Z2KA 2HLEB 1TJMA 2PPFA 4P2RB 5I0YA 1QTYT 4Z0BH 4ELMA 3GLZA 3T0DA 2I26N 2G5BB 2VMCA 2R23B 1NAML 2HB0A 1BAGA 1A0QH 3HZYA 1T7VA 4FZEL 1GC1H 2ZKHL 3PQYD 2ZXWB 3AXHA 4IU3A 3KGRA 1NL0L 4BYHA 1KTLA 3B2PA 1RUQH 5G2NA 4M6NL 4P2CG 4WNQB 1T22A 5IBUG 4NSKB 1T80A 4XMXA 2AP2A 1XAUA 3KLAA 3H9YA 1NMAL 4JZOA 4H1LH 3U36B 1E65A 4HEMA 3AFLA 3CZFB 4KH2A 4GIAA 2AQNA 2BO0A 4BA0A 1B4JL 2YPLB 3UDWC 5FA3B 4HSQA 5FS5A 3ZVVA 1G9NH 2HMID 1NUGA 3OVUB 1LVEA 1TMCB 1EHKB 4J3OH 3DETC 1W8OA 4C83B 1AIFB 2DJSA 4K5MA 3CLEL 4I9XA 1KENH 1MAJA 5D1ZI 5CJOH 4K3EH 4GS7B 3ABGA 2ETWA 5E4AA 5GQBA 1SBSH 1Y6KR 4UIMB 4NQCA 1QPKA 3LQAC 4WWPA 3IGAA 1OSEA 4MJJA 4BZ1H 5AALA 2FLMA 3QR0A 4FXKC 4OM1H 4OBRA 5DJ6B 3PU7A 3CVCA 4MA8L 4YSOA 5EUOF 3WIAA 3MCYA 1ZIAA 1DHKA 4L8DB 2W88A 1CGYA 2Z7YA 1GZPA 2NSMA 2A9CA 3VTTA 3OHXB 3EFOA 2Y3AA 1R75A 4Y2DC 3BSZA 1VFAB 1KPRB 3F7PC 3EJTA 1FGNH 4WU5A 4ZNEA 5JIHA 3W39A 3HUJA 5I8OL 4KDWA 1CDHA 3EO1B 5BO0D 3T8VA 5D6CA 4AKPA 1E9OB 4HKXB 2ERJB 2M83A 2MQGA 3FT2B 3SGDH 1RFDL 4AENA 1D9KA 5DEGA 3ZDXB 1TZIA 2AERT 1HWGB 3Q8FA 2ED7A 2E74C 3CZLA 3E6FA 4M4RA 1SXBA 2OTWB 15C8L 1R19A 3GSNH 3LNEA 2X4QB 3LS4L 3RRQA 1JWSB 2CGRH 1MFBL 5IB2A 2GBAA 3ZO0A 2VRAA 5DJZA 2IVFC 3T2NL 4A67A 1JI1A 4A38A 3N0AA 1YQVH 1XCQA 5CWSB 3DOSB 3R4RA 4MXWH 1XF5B 2A83B 2I07B 4ZNCD 4UM8A 3H4HA 1GYUA 3PQYE 3B5TA 4W68A 1QUPA 3D85B 4KFZC 3BH8A 3MLXH 3O3DB 4QTIH 4JFOB 4WGWB 5SX5K 1AG6A 3SKNB 5E7FA 4BQ6A 1OXYA 4PGEA 3ISWA 2Z0UA 5I19L 3DA0A 5FM5O 1RI8A 4YBQD 1MH5B 1FZMA 5D7JB 3QJFB 1INDL 2QSVA 2Q7YA 3L4CA 4KZEL 3JWNC 2AXGA 4O2FB 2Y7MA 2OMYA 5I66B 4NZDA 2ED8A 3UTQB 1A7QL 2CRMA 3FU7B 4JKLA 1G94A 3LN5B 3HE6D 3LNDA 3LSOB 5AKVA 4MNHB 1L9PA 2CPUA 3HMXA 2DQGH 4LRIC 1XGTB 5IFJB 3GHEL 4F37F 3HS9A 4AYFA 5CEZH 1UM6H 4X4KA 1VKXB 3H3KA 5ENWB 5C8JA 3ARZA 1JUFB 1RZ7L 1ND0B 2C7UA 3TNNB 2VLKD 4BFRA 4PJ8A 3O2VH 3U9WA 3KPNA 2XI9A 5F7EH 4UTCA 4UT9H 3R1GL 1FVDA 3TNMB 3BRFA 3FFOA 3FTGA 4NHCL 5JYLA 4G7YL 5E6IB 1OAXH 1BM3H 2NY6C 5F7NC 2GTZA 2OYKA 1J5CA 5K9OA 2H32H 3LV3A 3GMRB 2ICWJ 3NCCB 3VD5A 1QR1A 4F57H 1ZJAA 3SKOA 2Z31C 3SY6A 4KVNL 5I8EB 4FFWD 4U6TA 4BUHA 5EEUA 2YUVA 5AUMB 1TU2A 5J12C 2FDBP 4KZCA 4O2EA 4OJFL 2DOCA 1NC4B 1IRAY 3QJVB 4JDTL 5BQDA 3DV4A 3S98A 1RZKL 2H0FA 4HMEA 4PJ9A 5F2FA 3SYQA 2CLRA 2DS4A 2YARA 2YKLL 4ZXBC 4B5EA 2J8UA 5BMFL 3FZUC 5HVHB 1WD8A 1T4KB 1U8LA 1B3IA 3U4BH 4OZIA 2FR4A 5HJGA 4BSVB 2J88L 1N5YL 3FUKA 1CVRA 3WS3A 1NPNA 2J6EA 4DKDC 3WU1A 2VXQL 3PCYA 1XGYH 3TV8A 5HHPA 3I50L 1EZUA 4NQCD 5IQ7L 2K6YA 1IFGA 2J21A 3SD5A 5GIRB 1OQXA 1QNIA 5E5LA 4LL4A 2QTVA 4NM4L 5KAQG 5E0QA 3BN9D 4G7RB 1UURA 2G3MA 4XN5A 3STLB 4URKA 2LABA 1Z9NA 1ZLEA 1VIWA 5AENA 3WUWA 3MRFA 1SLUA 1YJDC 4UOW0 4NAJA 1U4FA 1UT9A 4KY2A 4XPHL 4JFZH 1MAKA 1E27A 1MJ7L 3H2WA 2A6KA 4RAVA 4XMWA 3S37X 2X2HA 1RIVL 3ZQ9A 2P8PB 3NGBB 2X7LB 4PLKD 2CM5A 1OM3L 3X11B 2XC8A 5DRWA 1ZT1A 3BLPX 25C8H 5H2BA 1FFNA 1KTDA 1V3JA 2H6PA 4N2LA 4RX4A 5T33L 3NJJA 1OGPA 2W9EL 1D9KD 4XPGH 3DSNB 5KVGH 1TQWA 5FOBB 3ZUCA 3P30L 3B9KA 4MMXA 1UENA 3DTXB 4JPVH 1NOLA 3US1A 1J0JA 3AUWB 2XFGB 1NEUA 2NY4C 3FMGL 4XE5B 3V9EA 3TH4T 5KS9A 1R5VB 2VLKE 1BD2B 3JVGA 2GEEA 3L3DB 3S96A 2XNAB 3SGEI 1J5DA 5EU6A 1YPZB 3VA6A 4ELME 2CR0A 1NIDA 1DBBL 1CFTA 3OF6A 1UB5B 2N1TE 1XSKA 1YEJH 1UM4L 4H20L 5BV7C 5IJVB 3RYMA 4FADA 5D7HA 5BOZG 5LKNA 2AC0A 2WJ7A 4QXTA 1EQWA 4XO4A 1N5AA 2W65A 3LD8B 2LLGA 2FD6L 5G5DB 3T0EC 3IJ7A 3VXPB 4LLQA 4P9HC 4WWID 1DUZB 4HEME 5EBWA 1LEIA 2KLTA 5DK2B 5CZVL 4Y88A 4FNLL 4A04A 3GPSA 2HUEA 5DJ2B 2CR3A 3SYAA 3HR6A 1N10A 3PE9A 4GW4B 3UPAA 3ME0A 3J2PA 4PGDA 4GUQA 3V7MA 3IMVA 3WTUA 2VMFA 5DD5L 4GG8B 1Z3GL 1NCUA 3L81A 3DECA 4P49A 2YQBA 3VRJB 3MRPA 3OKEA 4MWFA 1R3LA 4PLJC 3FAXA 2IANB 5FYJD 2WOYA 2B5IC 4PJ8D 4NQCE 2WXKA 2JI2A 4AM0Q 4IRJA 5E7BA 2EICA 3MACL 4NKIH 3CFCH 1J88A 4CSZA 4EVNA 4YOKA 5FOJA 4Q6IA 1DDHB 3C5ZC 1FVEB 4FQPA 4X0KB 1FYTB 4LF3B 2P4AB 4HOXA 5ACLA 4XBPB 3WXWH 1TTBA 1OAKH 2EO9A 1AGFB 2WUBL 4M3JA 4P4KA 2R39A 3EH1A 1OPOA 5GISL 3PGCB 1IKOP 2KHAA 3O6ML 4LVHB 4Q14A 2KH2B 2F5AH 4AQEA 3S2AA 4ZNEE 3GINA 4AITA 3MNDA 5C3LD 3HUJE 5FYKD 5L0QB 1DFXA 5C7ZA 2ROXA 5AAWA 2ZPKL 4PJ9D 1A6UL 2HJLB 4NQTA 2C7FA 5T5NF 4NO0B 1YMMA 4UIKH 3L3JA 2EDWA 2VITB 4OLWL 2EP6A 4NO3B 3DYMA 5CP7A 1BVOA 1ZT4B 1M3IA 5EFIB 2UZYB 4HIXL 4NI3A 3IXTB 1OGTB 1NBCA 5SWQA 1KJMA 1I85C 4O02A 1JFHA 4M5TA 1PZCA 3F7QA 5AVZB 3RVXC 3FCSA 3GBMH 4UILL 4KQ3L 2Z9TA 1QEWA 3AC0A 3H0TB 3TPKA 3D30A 5E2WL 3RIAK 1E6OL 3BAKA 3TVMB 1B0RB 4GSDL 3RPBA 1A66A 3TA3A 4UT6L 1E40A 4DP2X 3K6DA 3EJZD 3FN0L 2IGLA 2K6ZA 1AP2B 3WJMA 4YXLH 3FXIC 4XMVA 5C0JA 2X4RA 4KJWC 3VFMA 1KCUH 3QQXA 3RWIB 5AW9B 3A6CH 1RZFH 4U1MA 5EOTB 3B2VL 4GS7C 2UZIH 4FNTA 1ADQL 3W1ZA 5DVNA 4HGWA 1ZIBA 2QV2A 2CBQA 1TUPA 4ZUTA 3H42L 2GYSA 4NQSA 5E51A 3DOHA 3EO9H 1MFDH 3K46A 4LVOB 1EUUA 3LRGA 4P8QA 4IRSA 4B95C 4I0PC 3D3VA 2EEDA 2H3XC 1FRGL 3B9KD 1JMZA 3KNBA 3QYNA 3PUUA 1ZLDA 5CMAA 4JLRA 3MRKA 4M56A 3V0GA 4G42A 2A6DA 3MC0A 5FYJE 3U9PL 4X80H 4UQIM 4AX3A 4ELMF 5HXMA 1HAUA 5EU6D 5AZ2H 3EJYC 4PJDA 4JR9H 3SPGA 4AIOA 1ZA3A 1Q72H 5ADPH 2O30A 2DBLL 3OF6D 3K0YA 4NQXA 3SE4C 3Q13A 3WE6B 4FABL 4L4TB 1S3RA 3MU3A 2ZNXA 4XXDA 2WP3O 3GSOA 3OKNB 3CDFA 1H15B 3IU3A 4HFUH 4HUWB 5EBMB 4MGXA 3U7YH 3OMIB 1R3KA 5F1IB 5CGBA 3VFUB 2WLLA 2YGNA 1F2XK 1M57B 3M8OL 3RAJL 3EHBD 4IHBA 2IADB 4K9EH 1M7IA 1OL0A 5FYKE 2DF3A 1I7TB 3IS1X 4BM7A 5JDSB 1Y07A 2R2BB 1EHLH 2PCFA 2CGZA 2J8UE 5I8KL 1JGDB 1QYGH 4EZJA 2EXTA 2ZD0A 3GMOA 1Z9PA 3QQ3A 4OZIE 4WI8A 4AV0A 2AQPA 3ATFA 1BEYH 4PJIB 4WW2A 5J57B 1FVCB 2E7BA 4ZX4A 2GSIA 4GB9A 3THMH 3FU3A 2OMVA 1NBZA 3DUUB 4CVXA 3RHWF 1EHXA 4FKEA 4IRJD 2O6PA 4ABUA 4IIQC 2X4OA 1Z5HA 3UROR 3ULVC 5D72H 2A1WL 3V95A 3GEFA 4PVMA 2BM3A 3LEVH 1MVUB 2F1EA 3UBXA 1NIEA 4Y5YB 1CR9L 3UEQA 2VXTL 5A3IC 2XA3A 5JIPA 1OARH 3Q6FB 4LBEA 3VVVA 4NRZB 5EO0B 3BQVA 5LXGH 5DK3A 4DFIA 3FB7B 2VDRL 3V6ZA 5FPIA 2E5EA 4WI0A 4BKTC 4P4KD 1FG2A 4HIEB 2C3HA 1F56A 4KV5E 2SEBA 3KDPB 3MRCA 4J6RH 5JW4Q 4RNRB 3HUJF 3D39A 2E0PA 3R06B 3TFKD 1BOGA 1J5OL 2CJUL 2BWIA 2K45A 5C86A 2ZYSA 1UXWB 4OLZH 2EDHA 1A21A 3ERXA 1HHHB 1UWGL 5FO8B 1YMMD 3IWVA 5LDSA 2PW1A 3QUMB 4U6XB 3S4SA 1UXSA 4MHHI 5KS9E 1RZIB 5J6GA 2NUPA 2UY7B 4O5LH 1FL5B 4M93B 2V5YA 3Q9QA 5DJAA 1FH5H 4F92B 5EU6E 4P2AA 4Y1TA 2WQWA 3PV7A 5I2IB 1DLFH 1AXIB 2IH1A 4LHJB 1KZYA 2JF1A 3BVNA 1HIML 1KTKE 1SHSA 1KDJA 5GJSL 1WAEA 5F7HA 1DJZA 1MLCB 3SE6A 4KTEL 5AW3B 3TA3D 3OGCB 4CSSA 4FXGB 4HPOL 5INDA 2JLPA 3H8NA 1FFOB 5I73B 1N8OE 2WM0A 2D3VA 2GB2A 2F54B 3DXAA 4YHPA 3RE0A 1Y1UA 5MP6H 2WY3B 3T0BA 2R4RL 4JY6A 5BZZA 2PPAA 4E68A 4JAMA