1TR7A

Fimh adhesin receptor binding domain from uropathogenic e. coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Receptor binding studies disclose a novel class of high-affinity inhibitors of the Escherichia coli FimH adhesin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
molecule keywords FimH protein
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1tr7A00
4ATTA 2XG4B 4X5RA 3BWUF 1N12A 4J3OG 4AUUA 3BFQG 3ME0B 4AVHA 1ZE3H 5FLUA 1UWFA 3JWNG 1QUNB 5FX3A 3MCYA 4AVIA 3ZL2A 4AVJA 4XODA 4CSTA 2UY7B 4XO9A 4XOAA 4XOEA 3ZPDA 1PDKB 5F2FA 4AVKA 4CSSA 5JQIB 2WMPB 3ZL1A 4AV0A 5ABZA 1TR7A 3BFWA 4XOBA 5F3FA 3SQBB 4BUQA 4X5QA 4XO8A 5FS5A 2J2ZB 4J3OH 1KLFB 2XG5B 2JTYA 4AUJA 4CA4A 4J3OF 5IQOA 2W07B 3JWNE 5AALA 1KIUB 4AV4A 5LNEA 5FWRA 4XOCA 4AUYA 4LOVA 5AB1A 3RFZA 5IQMA 2JMRA 2VCOA 4AV5A 5AAPA 1N0LB 5IQNA 5LNGA 2UY6B 4X50A 4X5PA 5CGBA 3JWNH
chains in the Genus database with same CATH superfamily
1QSED 4JFXB 1FP5A 3G08A 1RZ7H 3T4AB 3ROLA 3LS4L 1BZ7A 2A0LD 2N7AA 4KKQA 1J5OH 1V7MH 3VWKB 2NY3B 3BHBB 3M88A 2EIMB 3LIZA 3MZGB 1I8LC 4L3CB 1RUKH 3ABKB 5DEJA 3UJIL 5D4IA 4A6YL 2I60H 1TO4A 4OF6A 1LEGA 4HIJA 4AW7A 4KTDH 5AKRA 4UV7H 1A6AB 2GQHA 4HJSA 2QSVA 4NQDB 1YEDB 3ZO9A 3FB6A 2QQNH 1BVKB 1LK3L 5LLIC 4HLEA 3O6KH 4DEPC 4GBXD 3T6WA 2W60A 4UM8B 3WN5A 4XBPA 3J8F7 3VA6A 3BAYA 3HCVB 5ANME 3S3PA 1U3JA 2GBTA 1MRCL 2I27N 4F8PA 4L9LA 3HAEG 3C5ZB 4MCMA 1D5MA 3QORA 5BW7C 3BIKA 3F62A 3G5ZB 5KS9E 3MUGA 4X7SH 2FATH 4N22A 1BIIB 3HC0B 1JGUH 3RJQB 1QBBA 5F9DC 1OGAD 1OARL 3A21A 3L9RB 3VWKA 1P4BL 5KWYC 1F4WH 1KBPA 4KFMA 3VD5A 4YS4A 3BEVA 2ATAA 1HSBA 1NAMB 2XKNA 4LL1A 3CFJB 2VLME 1GPOL 2EXSA 3UTSA 4HAKA 4FFZA 3O0RH 1N10A 3L7FB 1JMZA 3AG1B 1MI5B 3LPOA 4TUKH 4WFHE 4X9GA 2I9TA 3DHJA 5EHFA 1AYOA 1I3VA 2X6AA 2XUWA 4FXGB 3HB3C 4CJ0A 3Q1SH 2NY3C 2A5UA 2AGJL 4BH8B 3LZFH 3OWRA 4MDJB 4C83B 3O3AA 1D7CA 2NCMA 5AZ2H 1DP0A 2JJWA 2R1WA 3CN0A 1AQKL 1QSFE 3BDXA 2DAVA 3P77B 4Y2DC 3T1WA 2ZUSA 2LE9A 2DLHA 2OSLB 3ECBB 2P43B 4Y9CA 5DO8A 2J4WH 3MRMA 4BKSC 2EDEA 2XRAH 5F89B 4BZ1L 3EOAA 4RMWA 1GHFH 1M9SA 5K5YA 2NDGA 4HWUA 4ODXB 3AS3A 2W81C 5DT1H 1TR7A 5HJGA 5J4MA 1HJCA 1L5GA 3D51A 1G7JA 4KDWA 1ASQA 4O02A 1ZLSL 3MJ8B 4FQXC 5CF3A 2AK4D 3QQ9D 4FXTA 2HTLD 3V6FA 3CBRA 2E8ZA 3HMWH 4Z77A 3ULVD 4JK0D 1BVZA 3S5LG 1CS6A 1U8CA 1JPTL 4B5ZA 1N59A 1Q72H 2CHXA 4KGLA 3JV6A 4K55A 2F53A 4I18B 1IJ9A 3V0JA 3VGBA 4AIEA 2BFVL 1F0LA 3GMQB 4ZK8A 1FHNA 3WCYA 4N5UA 4AGNA 4ZPTA 3BZDA 5FO8A 1BFVH 1I85A 3RWEB 3VA2C 2NXZD 5JORA 2QLYA 5FFOA 1F41A 3IXTB 1QBAA 5IHBA 2ZKXA 1L9OA 3NACL 4A2DA 3SPVB 1JPFB 4ZSOB 2X4TB 3RI5K 4A2LA 1MFAH 3EJJX 4AQEB 2VXQH 2ISDA 3DUUB 4XPBL 3D39B 4L4VE 3WMQA 4A68A 1TPXC 2X28A 3KVQA 3NJKA 2WLJA 4N87A 3FFCD 2X6UA 4LVOC 4NENA 1FFTB 2BINA 3AG3B 3MGTA 2J88L 2BC4B 3ES6A 3F85A 4IIZA 5HHXL 4PFEA 4YHNB 1MCHA 4ETYA 3IAQA 2WLLB 4LKXA 4UOZA 1N7ML 4MWFB 3DUSA 5J11B 5KVMC 4YDVB 2XN9E 4F7PA 5AB9A 1DUYA 2FEEI 1E42A 2MKWA 4EOWL 3JUZA 2L7EA 4CW1B 4YLBA 3LV3A 4XRCB 1CMOA 2WLYA 2FR4A 1NUDA 1KIPA 2XG5A 1FVEA 3NK3A 3SDXB 1DQTA 1U3HD 1JN6B 2K6WA 3BRDA 1S3KL 3QJFA 4QXUH 5GZOA 4YIQA 4R4FL 3UPCA 2X7LB 1NPNA 3VGDA 3CSFA 5AZUA 4HKZA 4P2OB 1FNGA 5F7AA 5KG9A 1DJIA 2Z4TA 1KLFA 1QFUH 1MHEA 1BXUA 3A4EA 3ISRA 4FTDA 4HWNA 3S5YA 1BAWA 4D9QD 5D2NA 1BJMA 3EZJB 3D69B 2ZX8A 1BZDA 2VXQA 4XOCA 2EXWD 3RGBA 2P44B 2NSQA 4HX1B 3EBGA 4PJEB 1JYVA 1P7QD 2IQAB 1YQ2A 3QIUA 4HD5A 4NRXA 2VQTA 2ESVD 4M62L 4AOFA 3NN8B 4HIPA 4LSPH 4B27A 3RWDA 1KGIA 5BZWA 1GAFL 1TETL 3D1MC 1Q94A 4YSEA 3B2VL 4ZG1A 3TIEB 2DQEH 1SEBA 3HUJA 4Q0XL 4FI8A 4TSBH 2HUEA 2RCSH 3FO1B 1T7WA 4HP5A 2D7NA 3ABMB 2GJJA 5E4EB 2H1PH 5LAXB 3H9ZA 1BF2A 4OBRA 1JFQH 4WW2C 5DD1H 5GS1A 3DLQR 5EFIB 1SHSA 3SCMD 4TQEH 4IDLA 1EAJA 3L7FA 3ULVH 3MBXH 4IRSA 5K59E 2QSQA 5L6YH 3D8MA 4X42A 2Y3NA 5CP3A 2FIRT 2DJ4A 1TTCA 2FNBA 1HSBB 1NAMA 2XKNB 5EULV 5ES4B 1I31A 4AEIH 4XCNA 2OMYA 3NSDA 4ELKA 4Y8DC 1OZTG 1XR9A 1TQUA 1YY8A 1CD8A 3F7KA 1NIDA 4QHMA 5I1LA 3L9BA 3QCVH 3X11A 2WLKA 3OAWA 4AQ1C 2IQ9L 1CFSB 2NY7L 4OFPA 1YPZB 3NIFF 3DIVA 3N41B 5IM7A 1GJUA 1FJ1B 2CKNA 3EADA 4E0RA 4I2XA 4QTIH 2G4GA 4K7PH 2XTJD 1DZ0A 4JRXA 3KVPA 4P2YA 2G5BB 2WBJB 3MLTA 3N1FC 4MMXC 4P2OC 1ACCA 2B0SH 3VMNA 4NERA 3VXRB 4DGWC 3QS3A 2IO5A 3BZFB 5CCKH 5JW5B 1WT5A 4NQEE 1AGCA 12E8H 1VACB 4OFIA 2YA0A 3MYJA 3T2OA 1UWGL 1C16B 3GB7B 4QXGL 4FYRA 1YYLL 3W57A 4LHUA 1W91A 2ARJA 1UURA 2VLRE 3OM3B 3ULUD 4U6XA 4IRSC 2XLLA 3FQ2A 1YDPA 2K7QA 5DHYB 3MRHB 4PPTA 4XXDB 4Y9EA 1U8HB 1Z5HA 5HHOB 2YFNA 4FFYL 1LWRA 5GIRA 4M7LT 4TLTA 2YKKA 4LVHC 3PCYA 4PRIA 2ATKB 1QFWI 1FNLA 2LT9A 4KOCA 5AW9B 5TE7H 4WK0B 5C0EA 3OL2A 1FYTA 4CN4A 4PRDB 4XN9A 3OC8A 1YY9D 4G3YH 2DQFB 3P30L 5DJDA 4HIIB 3FULA 3D06A 2JLLA 1K9TA 5A3ID 3NSXA 4NQDE 1S7XA 3QWQB 1R46A 3UTZA 1DEEA 2VE6B 2XA8L 3W2DL 3Q5YA 1M9WA 4ZMWA 1KBGL 4TVPE 5HYJE 2OCCB 4LSVH 3VACA 3KLSA 4XNQB 3LN4B 2CCLA 3KPOB 5IK3A 3DOSB 3EFDL 1H3PH 4QHLA 5DJ2A 1FFOB 4F3FA 3SZ6A 5IF0B 4ZW5A 1MNUL 5EBMB 2WWKO 2VDRB 2R51A 3VMOA 4XMTA 4Z7UF 1QR4A 5EZIL 2DM2A 3P11L 5HVHB 4I0PA 4J12A 3TXAA 5IHWA 4HCRA 2HFEA 5HJDA 2V2WB 5F0MB 2DLFH 4PJEA 1UXWA 1QZNA 4IOIA 3WFCH 1S5HA 2Y6SD 5CP7A 4DEWA 2ZAHA 4V1DD 1VHPA 3FO2A 3PHQB 4CMMB 4A04A 1BF5A 5SWSE 4MAUH 4J3UA 1IT9L 2B1AH 2Z31A 4HC1H 4U1MB 2QKIC 3MRFB 4X5PA 4UZSA 2DWTA 3LEXB 2PO6B 3OKDA 2J1WA 2QSCH 4R4NC 1YEJH 2VWEE 4FYSA 3AXHA 4P2OA 4MX7A 2IGFL 3S6CA 3T3PF 4PWHA 3MV7D 5H94B 3SODB 4Y1AD 4OB5L 2XWEA 3A67L 4ZYKB 4ZO6A 1LO3H 1E6JH 3IMTA 5TE4H 3D69A 4O2CB 1A6PA 2EABA 3OF6D 4P4KA 5EUKB 3TGXA 3UP6A 4OD3H 3KPRA 4JGNA 1AC6A 2WC7A 4H88H 5D7LA 2OMTA 1C08A 2EILB 5J7CC 4NIKB 2JJSC 4G5ZL 2OMYB 4ELKB 3WS6A 4L8SC 2ZWKA 4R7DB 1R6VA 2E6QA 4O9HL 4GKSB 4XBGB 1KCSL 4CU7A 4B9ZA 4OIIH 1FVDA 3FUKA 1VFOA 4PBDA 4XNZC 5FYJL 1PSKL 1QVOA 5DDHA 3PJSB 3GJFH 4ZMPA 1P5UB 3ZDZF 1JN6A 4I1PA 1J0JA 3K5RA 1OGSA 4GLRI 5EOQL 3VFMA 3WFBL 5J12B 5ETUB 2YD5A 4ZNEE 1RULH 3ARRA 4BZ2L 2DKSA 2OMZA 4I4WB 5SV3A 3W11C 2CUHA 2OMWA 1XF1A 5LBVA 3V0WL 3EYFA 2WVTA 3BIAX 1R3LA 4TF4A 4NFCA 3BSHA 3ESUF 3KL3A 2Q7YB 3WUZA 4KMTH 1BAFL 2ITFA 2NMSA 2NY2C 3FUEA 3X12B 2F1EA 2R0WL 4HX1A 4K3JH 3I9IA 1E3XA 4FGMA 3W5NA 4ZD3H 2QBWA 4PJFE 3C5SB 3BP4A 3GIZL 4PJCB 1XGTA 4GIOA 3QZOA 4Q58C 4BE5A 3MRBA 2PPEA 2OPCA 5GIRB 5H35B 3W56A 2ODHA 5EUOB 1OW0A 3O6KL 1S8DB 4KKRA 3GXIA 4PRHD 2R1YA 1YUHB 3S36L 1MUJA 5CJQH 3SKOA 3SE4A 3HIZA 4L1HA 4H20H 2XG4B 5FGSA 2KS0A 4YSDA 1RZJC 1D6EB 4DGIH 3GSNL 3DV6B 4ALAC 4MA1B 2W65A 4G7SB 1ZDQA 4YZFF 3NJJA 2FIKB 1E9OA 4K8RC 2ZCKH 4C83A 3QZNA 2B2XH 4EKJA 2WBJA 4PN6A 5K59F 4RMQA 1O6SA 1MFDL 4A39A 2MCG1 5F7DB 4MJHA 3OGOE 4HGWA 4ZPVB 5E9AA 3KYMB 1UD6A 2FWSA 2H3XC 3K74B 4FNSA 4LPWA 2GSGA 5CSZA 5EORL 3T71A 2ZSWB 2WXOA 4PJXA 1JV5A 1JHTB 3WFHB 4NENB 3VWJB 4JM2A 5AWNL 4HLZH 4PTTA 2HRPH 4IBYA 1RLWA 4GSDL 2BY3A 3H54A 3NSYA 3P0YH 1MI5D 4GKLA 5CUSH 3VI3B 4XNYH 3FU8A 1GY2A 1WGVA 3MX0A 5B8CA 3A47A 1L7TH 2OW6A 4B53A 1HYSD 5JHDD 4NAQA 2XIDA 2FWOB 4WHTA 2XN9B 1Q9OA 4AW4A 3VFUA 4MQXD 3MSPA 1ZVNA 3G04B 1CXFA 2GW5A 3DUHA 4Y4KA 2VMJA 1N67A 1TYJA 5FGRA 4XPAH 3F84A 3DV4A 2HLFD 5DMKA 4OJFL 3P3SA 1LL1A 1HESA 4OZ4A 1KXQA 4M56A 3IVKB 2DLGA 2HLAA 2TSBA 3NEXA 4FAAB 4FQXA 1BD2D 1EZVY 2NY5L 4BZ1A 2WXNA 1UXWB 4YBLC 1KV7A 3NCFB 1CICC 1RFDL 3GO1L 1W8OA 1EWHA 2QFPA 1ADQH 1K8DB 3BMVA 4PJFA 3P2DA 1N5AA 1QRNA 3ULUL 4XWOC 2AQ2A 5F6IB 1DBKL 3L4UA 4QTHB 2WQ8A 3CDFA 4M4PA 4TS6A 2BSED 4ANUA 1AFVL 2WTOA 4V2BA 4FFWD 1K5NA 3AB0C 1ZHNA 4LSRH 4Q89A 3WTUA 2CKBL 4ELMB 3L2LA 3BHBA 4ZOAA 2XWRA 2H26B 2LU4A 2YN3A 5CGMA 4WFGE 3CFEA 4JQIH 2AVFA 5LN4A 3T0AA 1I1YB 4NC0B 1BQSA 2OTUB 1IKNA 1J05A 3EO9H 4JFEE 4JY4B 3QPQD 3BAWA 5CEZL 5JR1H 5C7ZA 4AYID 1KIUA 3HS8A 5DK2A 4ONHA 1HILA 2CM6A 3PWVB 3FQXA 1FQ9C 4H8PA 3WJLA 3BEVB 4TLUA 4JAMA 5KVFH 2GJ6D 4XAWL 3QG6A 5IHUH 2ESVA 5IV2A 4AYMC 1IAIH 1GC1L 1YNKL 4LKXB 5BMFL 2VQ4A 4NSKA 2EYRB 2FB4H 1XB6A 3E8VA 4M7ZB 2C1OB 4N8PA 1E6JL 1FYHB 2WVSA 3MLRH 2FBJL 1QUNB 1ODUA 4KO5A 5DFVD 4H7VA 4GSQA 3WLBA 1G7QA 1IEBB 2JJTC 3V0IA 1TQWA 3ZT7A 2FL5B 1Z2KA 1WYJA 3NTCL 4PRAB 4NI6A 5CEZD 1HH6A 2C3XA 1YEKH 3BUQA 1Z9NA 2OKMA 5FCUH 2FZ3A 4L29B 3SKMB 2JMRA 1FZMB 4OZHF 3VTTA 5HD8C 1S7VB 4HS8L 4RX4A 1KYFA 1VFMA 3B5TA 4C4BA 2ZTBA 1L9NA 3MFGB 3GK8L 2FO4A 5FWQA 1EAOA 5DS8B 2XWZA 3UG3A 4RBPH 3BISA 1D2PA 1XSOA 3GXUB 3JVFC 2LAGB 3TVMC 2D0FA 4NO5A 2D03L 2XI9A 2YWYA 4HGWB 1EHLH 3QDMB 4KZEH 1BYOA 4X6FA 4CSSA 5TJWK 4L8BA 4D7BA 3L3GA 4LCVA 4PWFA 3X11B 3WY1A 4N0YL 1A8ZA 3I75B 2LU7A 4FYTA 2EE0A 3BKJH 4KI1A 4Z7UB 3EGSA 1ZTXL 3B9KB 5ETUA 1RJYB 2Z8RA 5ACLA 4O02B 3ZTJG 3CZUB 1PW3A 4HIEA 4DH2A 3MRJB 4HXBH 5T1MA 5I16B 3AACA 1D6EA 1DFXA 2G9KA 4POZD 4KMLB 4JFYB 3OLEA 2VKXA 1NGPL 1XF3B 1W9XA 3DJSA 3VXQB 3QCTH 4LDOB 2KC0A 3G5WA 2GI7A 4PY8I 1AMXA 1FNAA 2YD8A 3V7MA 2BH0A 2DI8A 2HT2D 1INEL 1WSST 3SDDA 5SX4H 3U36B 2N59A 4NNYA 3AREB 1EMTL 1CFVL 2FQDA 3N1PC 1MHPH 3NOIA 1UWXK 4H8WH 3HVNA 3V5HA 5A1AA 3IGFA 4QHUA 2R0ZH 3B2UD 4FFYH 1PY4A 2UXGA 3IEAA 3KXFE 4ILDA 4NZRH 4NXKA 2PCPA 5DZLA 2NXYD 3K6DA 5FGCB 1CD0A 4K9EH 3MRLB 1PFOA 2Z93B 4YDKH 2VWEC 3WI9A 1IAKA 2JQAA 1HHGA 1BPLB 5FYJD 1OIOA 1QTPA 3EO1A 1N3NB 1GXEA 4JPVH 5DSCB 3ARDC 1YQVL 3DIFA 3LEYH 4H5SA 2BCKB 4JHZA 1AQHA 3RBGA 4ODWB 2QQLH 4N2LA 4N2HA 3WXVL 1UOKA 1EDYA 2ORBH 4F37K 3LZNA 4AYGA 4HS6A 3LRKA 1S78C 3CX2A 4I9WE 3QUZA 4YFEA 3LH2H 2E9BA 3IKCA 2FJSA 3TEWA 4JJOA 3V6OE 2O5XH 3VE0A 1FLRL 2ZOOA 4WO0A 4LU5L 2D31A 4NQTA 3UTTB 5L0QC 3GXMA 3MTRA 1PVHA 1Q0YL 3U48A 2K1MA 5L2KB 1TJIH 2PTTB 1UQSA 3RDTC 4H8HA 2WXRA 3HMXA 1ET8A 4HEPA 5F3HA 2V2XB 1A1MA 2AW2A 4WUKL 1IEHA 1J1XH 3ESPA 1DQVA 2MOQA 5C08D 3QWRA 1AOZA 1M6OB 4BXVA 4F8TA 1QUNA 3JWOC 5DD6B 2IFFH 2YO3A 4HCIA 4FQJH 3UAFA 3O41A 5B1JC 2FWLB 1V5JA 3IMWA 3DTXB 3NFPA 3KM1A 1L9QA 2WOBA 2Z4QB 4GW4A 4F7CB 3H42L 1ORSA 4G7VL 4Z95H 4JFXA 2GCYB 3QZMA 3Q6FA 1JMXA 1HILB 4HJUA 2O61A 3RY6A 4DP1X 4X6BB 3ZHFA 4P57B 4PJ9B 4XB7A 4M6OL 1I1CA 2AXJA 4M6NL 2LV4A 2F74B 2VLLA 2F7PA 1GGIH 3ZKMD 4ZS7L 2YD2A 2H26A 5CBEB 5IGXH 3GXPA 2DTML 1JZDC 2PXYB 3PLYA 1OAXH 3LEVH 3QW9A 4OV5B 5D1XC 3SO3C 1B2YA 1MNNA 2VABA 3FUMA 4WI3A 4F1ZA 3QJHA 2VQ1B 4Y2NA 4K7PL 2QR0B 4H0HB 4RGMC 2VLJA 4J3VA 5AW1B 1IIKA 2FECI 4Z7OF 5KYWA 4RA0C 2YRBA 5D9SB 4U33A 2DQUL 4I0PC 2IQ9H 2LTQC 4IDJH 3LDBC 1T89A 3ILPA 4FJYA 4X4XA 5I5RA 5F93C 2NSXA 2IPTH 4TV3A 2VDPH 5B21A 3QC5X 1LE5A 3AADB 5B7MA 4BA8A 4QXGH 1ACXA 4MDJA 2C9QA 5BZXA 3KVDD 2AITA 4CUCA 3FQNA 3O9WA 4CNIA 1K3ZA 1ETZB 3DVIA 3SD2A 5IFAH 4MZIA 2MJWA 1EFQA 1KLUA 3PXHA 1IRAY 2A74B 2Y72A 4I9XA 4XNXL 4X4YB 5MERA 1MEXL 2I9TB 1T4KB 5IOPB 5IM7B 1PZ5A 3TPKA 1D9KD 1SPDA 4J3OD 3RL1B 3WS6C 3EJZC 4K0OA 4QTIL 4LVEA 2EE9A 4N9OB 3K6OA 1BQUA 1V3JA 2A9CA 3OGCA 3BZ5A 2WV3A 4PJDE 1GRWA 3NZ8B 4E9VA 3U6RA 1EO7A 4EXPX 4YSCA 5IJDC 5JZ7D 5IFJA 3H42H 3K6SB 3HMXH 3J7HA 5F7HA 2ZCHH 4Q9RH 1GOHA 4HV8A 1ONQB 4W81A 1HE7A 4AEIL 4D8OA 4FQJL 4TVUA 1S7QA 2IFFL 2X6MA 4MMZC 2E46A 5K1JA 1EANA 3TLRA 2AK4B 4R4BB 1MJ8L 2QV4A 1AHKA 2AEOA 2E9IA 1KACB 1YN6B 4ZFFB 4BUQA 3IMBA 5T33H 4N2GA 4JPKH 2HB0A 4Q52A 4XMVA 2UXVA 1HNYA 2FIKA 3MRIA 1GS7A 1S6NA 5GRWA 3HG4A 1TJIL 1MW3A 3ZKSD 1JGLL 2I25N 3VSVA 1T2JA 1GR7A 2DD8L 5CNHA 1AIFB 5D71L 2A77L 3UAAA 2AHIA 1PZDA 4Q4IA 4KOBA 4F93B 5C3LD 3LIUA 5FUCE 4AM0A 1C12B 3I2CL 3PF2A 3K0WA 1ZRUA 2L3BA 4OCSL 1RY7B 4PRHB 2ENSA 3NJNA 5JHDA 3IN0A 2OV0A 3Q9PA 2A4ZA 3QDJE 1B9ZA 4HK0A 2OXGA 3SCMA 1P1VA 3DX0A 2HVKB 5DGQA 4UWQB 1BXXA 1U2YA 4NO0B 4RFEB 1U8MA 1TENA 1QBMH 1MHHA 4W6XB 1WZLA 1OPOA 4RMRA 4L3EA 4UZUA 1M6OA 4CN1A 1U3HC 4XH2B 4RMSA 3QZBA 2PW2A 4DK3A 3BWZA 4ZOEA 1CIUA 1TJGL 4PVNA 4R4FH 2YKLH 3WFDH 3RVUC 1HOCA 2X4SA 3MZTA 1MXGA 2Y6SC 1EZLA 4ZXBC 2YD9A 1KJVA 2YGNA 4ONGH 4PB0H 4KY2A 4PVMA 1QTSA 2J1ZA 1BZEA 4FS0A 1BG9A 4PGBA 1IL1B 1HC1A 2XBDA 5IW6A 1PLGH 2VDQH 4JPWL 4ZSOA 3ZE2B 1Y07A 4X9BA 4DUVA 3VWJD 4OUUA 4KKCC 4XCEA 2WGNB 4JZOB 3RNKA 1BV8A 3U30B 5HSFA 1CDBA 3PWJA 4LCCA 3RVUD 1R3HB 3IJYA 4WFED 1BQLL 1HT6A 1LO2H 1NANH 4Y1TA 4CC4A 5I30L 5IEHB 1UWFA 1HINL 1S9VB 2CRMA 3QJFB 4JEGB 1JV2B 3MRRB 5JHDB 1PDKB 4X6DE 4PP1C 1OPGH 3OKOB 4IHBA 1OE1A 4IRJA 5DUBA 4KKBD 3L3DA 4MXVF 1TJHH 4KQ4H 1M1SA 4X7TB 4MMZA 3FJTA 3MLYL 3D85B 4I18C 3GSNB 3WKQA 1LO0H 5I76B 1UM4H 2GITA 2NTFB 4GQ9H 3ZT6A 4LFHD 2XVKA 3VRJB 4GUPB 5EBLA 1CR9L 1KLUB 5I9QB 1RZFH 5CJOH 3LCYA 1GC1H 4M5TA 5HYSA 3T8XA 4ZFOL 2QQLL 3BFQG 4FP8L 4L4TB 4XVJH 1NIAA 4QTFA 4W68A 4RSYA 1XV8A 4JHAL 3KNBB 2BVOA 2G0LA 2NY1D 4LHUG 4O51A 4RFNB 4L0ZA 2J5LB 3RWHB 2YOCA 4HQQL 3HBQA 4K5OA 5IVZA 1CBJA 3OAYK 2Y6TE 2IJ0C 5TQ2H 4F58L 5KSAB 1D7BA 3JBG7 1FL5A 4XPTH 4EN3A 4HV8B 1HEZB 1LO4L 1GCFA 1UZ8B 2ZICA 4PTUA 4LCIL 3OV6A 1AI1L 1QYGH 3X17A 4PBWD 3R8QA 1M05A 3NZ8A 5FEBA 1IVLA 4EKXA 5I26A 3IDUA 5EO9B 4ICXA 3LKOB 3TA3C 2BRRL 3IFLH 2FT7A 1K4CB 3D5OF 3OG6B 5DZAA 4WF7A 4X7SL 4N2NA 2Y1YA 2ED9A 1M53A 1ZA6B 1AGEA 2V7NB 3GO1H 2WBJD 3KPRD 4FNRA 4LASH 1B4JH 5DEZA 4LLQA 2COQA 4ZFOB 4IHOA 3MRGB 5D55A 4ZUVB 1SOKA 5DK0B 3K4ZA 4BFNA 3CX5K 5T3ZL 5KYWB 3VDAA 3R06B 4AQ1B 2GC4C 3F7VB 5IMMA 1AD9A 1F45A 3ARVA 1ONQA 1UT2A 3CPLA 3G5XB 1BVNT 1IFHH 2R4RL 4F2EA 4XX5A 4MGXA 1Q1PA 3CBKB 1XF5A 2X6CA 1NCJA 5J13C 4LGRB 4NHCH 4PU2A 3BE1L 1WBYA 5AZEH 1SEQL 4WAFA 4KDTA 1T22A 2WKOF 5HDQH 2Q86B 1XH3B 4UM9A 1PD6A 1AG0A 1QEWB 3BC9A 3PY9A 2BZDA 1SXBA 3FCTA 2AABL 3NEOA 2R29H 3P3RA 1QLRB 1C16A 3QH3A 4M8UA 5ITFB 1M71A 2ITCB 4XC1H 3IS1X 1VACA 5AWNH 1SJVA 1XGQA 5GGRB 4E9WA 3S35L 2ZUUA 5LNDA 4MCNA 5FPIA 3Q1EA 2CCVA 3ZW3A 1OWWA 1OAZL 2G30A 4WTWA 3RA7L 2PWDA 2J8HA 2DBJA 4WY7L 1A4KB 1WVZA 1HL9A 2GC7C 4DOHE 4GQQA 4YDZA 1BD2E 4M6MH 5K9QI 2IGTA 3KYOA 2ZCKL 3QZWG 2F7IA 3AITA 3SJVA 5D7JC 2IVFC 2ZWZA 4CVWA 1IKNC 2V2XA 4L4VD 2AJUL 1JTPA 4PJXF 2J2ZA 3L4WA 3IDMA 2G3NA 1TEFA 1QR1B 3FTUA 1GOGA 3FQUA 1CQKA 1ZDSA 1PLAA 3DHUA 1E5AA 3HBGA 4WJG3 3WGVB 1HKLH 5I0XA 3QWOA 3U2SA 4D8PB 2P7TB 1NZRA 3OJVC 2EO1A 3KH3A 1J5DA 4KUZH 3NCJH 2CBTA 1HH9A 3TF4A 5I74C 4HIHB 4HJGB 4PG9B 4RAVB 3U4EB 5DEFB 3DPDA 3X3FL 2BS8A 3FW6A 1T5XB 3ISWA 4IKLA 1P9MA 3AFLA 3OQRA 1OCOB 5AG8A 3ULVE 5C07D 4BD4A 3GZPA 2B2XL 4ANVA 4OF5A 3C5ZD 1YNTB 2AXFA 2C26A 2A6DA 2X9ZA 2ZUQB 3CVDA 4Y0GA 4C59B 1UEYA 2R29L 5DGRA 4APQD 3QJXA 3KLQA 3L1FA 2A3TA 4DGIL 4FL4B 4MQXC 3ARDD 4MMYB 4JN1L 4QLWA 1HXYA 5AOLA 1XB8A 5FUOL 4NM8H 5C0AB 4X8XA 4U3SA 4J8QA 2EYTB 2AJVH 2VSKB 4JVWA 4QF1B 5FA3A 3VG0H 1D5XA 3IFNH 4K5MA 5DQJB 2EYSB 3MXVL 1NUGA 1DDTA 2E47A 4QXVA 1YECH 3TO2B 5I24A 1LEIB 3QFJA 3SDCD 4BFIB 4RLDA 3SY0A 1NCBL 4ZUUA 1NH6A 3D7PA 3B2PA 3ARFD 3SYAA 1S9YB 2MQCA 3DX6A 4DZBA 4EQ2A 3VFWA 3MVSA 5BVPL 4FEMA 1YN7B 3C6LA 2GIYA 1OTSC 3FTWA 1TO5A 3IDGB 1N64H 3HLAB 2XIIA 5JZ7C 4BV1A 1DQJB 3KBEA 1CGSL 5I73B 1DLFL 2SEBA 3W1ZA 3EH5B 2DYSB 2WN2A 5HGDA 3PGCA 4L8SB 4OCWL 1GZPB 2CHWA 1XT5A 4B9JA 2EDMA 3SDCC 3T4AC 1OGAE 2HRPL 2OYMA 3UTQB 4OFQA 2NDFA 1T83A 1DUYB 4KZ0A 2CA3A 2VZUA 2K7PA 5I8EB 4LOUC 1NIBA 2FEJA 5A40E 3PDOB 3LZOA 4QMEA 2A9ML 4MJIE 1GH7A 3MBWA 4M9OA 3SKOB 3EHBB 2D8KA 5D1ZI 4EI6A 1Q4NX 4PHXA 3D3VA 2EDBA 2E4TA 4PLKC 1BBJA 4JFFA 5F2FA 4DW2L 1FYTE 1HFUA 32C2B 4G83A 2B59A 4O02H 5C6WH 1X7SA 5CIPB 3IRZA 4IQHA 2DQCH 4JQVC 3BDBA 3ZQXA 1U8IB 3B9VA 3IGAB 1U41A 1KBKA 2CO7A 3BI9X 4JANA 5D1ZA 1V27A 1JPEA 2E56A 5E8DL 4N86A 1PNDA 5E94B 4MDIB 2APWA 3GRGA 5I6OA 1G6RB 1UWEH 3N0PB 4BEIA 3HE7B 5ESQA 3KYKH 4DQOL 2KQMA 5IR1B 2A9NH 4NJAH 3U4BL 3GDBA 4HKJB 4G6JH 1T66D 5K93A 1W6WA 4MVBC 4OCRH 3ATEA 5G4MA 3IAGC 3PHOB 1XL6A 3SE3A 2VAAA 3GHPA 1A7NL 1PJ9A 3VX0A 4BA0A 1ZCRA 5E08H 3QUZD 1IGIL 1KUMA 4I2XE 1UFGA 3QIBC 1NMCB 1BLIA 2XQYA 2PCFB 4OI8A 1OD7A 3GNML 1CGXA 1YEHH 2YD0A 4GKOA 4Q2ZB 3ZDZB 1T3FA 2VSDA 3TO4C 5J6GB 3K1DA 1YEGH 3KYKL 3VFRA 3TH4T 2BJML 1ZLVH 3S8GB 2PWHA 1EHXA 4FTVD 3NDYE 1RZGB 1MPAH 4R97C 5FDWB 3HRZC 2DQHH 5DMIH 3IJHA 3SE4C 3C12A 3N04A 3NPZB 1R3KB 4TNVK 5D5MA 4LF3B 3MR9A 3MX0B 4GKZB 5LCVH 1RSYA 5B8CB 2BW4A 5HDBE 4FNLL 5JA8B 4QAWA 4XBMA 4G6KH 4Y5VB 3DDFA 4F5CE 4G3YL 4ALAH 1CDIA 3FN0H 4C54A 1RUQH 3UL4A 3LRSA 4Q9BA 4WV1C 1AR1D 1H3XA 3HKZA 4O02L 4ZFQA 3T6QC 2DQTH 1U3YA 2C7UB 2FJFB 2IAND 3Q8FA 4K8RH 3BLPX 2EDLA 1F3DH 3A4DA 4WSKA 3CHRA 1UJ3B 3E2HB 3PHOA 4I3SL 4NC1E 1J1OH 5I8OL 2MSPA 3REVB 3FT2A 2P28B 3VXUA 4OCMC 1XQ4A 2VDML 1E4XI 1KIUB 4ZRGA 1PZUB 5B4MC 2VMFA 4TQPA 1JZ7A 5DVOA 2NR6A 3UPAA 4K9JA 4F9LA 1ZA3A 3VVVA 3DWTA 1UUNA 4GRLC 4V1DA 1KB5H 1MJUH 4AZUA 4RAHA 4K94L 4UOW1 3LQAC 4GAGH 4WRLA 1UH3A 1MSPA 3AREC 3RX7A 5TH2B 3VFOB 1CLVA 4NO0D 1LO5B 2ZCHL 1J88A 4Q0XH 4PRPB 1ZGLP 4WVRA 3ULSB 1R1CA 5F8RC 4GMTL 1M7IA 3QDJD 3S5ZA 2ZSVB 4U31A 3RWCA 3ZKNC 4UMSA 4CSPA 3CH1A 3AY2A 2R9HD 4LSPL 1JGDB 3A5VA 4R97B 1KSRA 2WCSA 1JZ3A 3BH4A 3FFCA 5E99H 3W9DA 4AE1A 3G04A 5GHWL 5AAWA 2Z3FA 1KTLB 5AAMA 2W92A 3OAUH 5DJCA 1A6WH 3HI5H 3PIQA 4OLXH 5T5FL 4JO2H 4TSAL 5EMYA 3T0VA 2WP3O 1K6QH 5ENWA 1HHIB 3LKQB 1TVHA 5IMOB 1RUPL 1IEAA 1KTBA 4JX0A 2H32A 1CXLA 4TSBL 2D0GA 3C8KB 1TTUA 3V6OA 3T0DA 1J1PH 3M1BA 2DQUH 2VIRA 4MQSB 2WPGA 2X89D 1BBJB 3DXAD 3N9GL 4KQ3H 3EHBC 4LCWE 4M93C 3QDMD 2JH2A 2NQDA 5E5MA 4DP0X 4E0RB 3QNXB 5JPNC 4FC3E 2XYBA 5FYKL 3B1UA 3DKHA 3EO0A 3KLHD 2UWEF 4ZMTA 1SBSH 2MPAH 3WKNA 4M61A 2YWZA 1FNEB 3UH8A 3THMH 3MROB 1F3RB 3NA4A 4BFRA 2NUPA 1RZJH 4LLVA 1T0MB 5JUEH 1SLXA 1U8LB 1UZGA 4N1EA 2CJSA 1MREL 1HI6B 4U0RB 5EOTB 1UJ3C 2B0SL 1ZGLM 2VMCA 1C1EH 1DBMH 1AKJB 4IEFA 4HWEL 4RGNE 1A9BB 3INUL 4IU2A 4DGVL 4OZIE 3UGXA 3O3BB 1CWVA 4JZJB 3LPFA 1RMFL 5ID1B 2VDLL 2NY1B 1RK1A 4Q9CA 3QJSB 4MKTA 4NEHB 2YMXL 3FF7A 3PGFH 3S3JA 3AGWA 4FFTA 5F3FA 3ZZLA 3VFVB 3ATAA 1MIEH 3GRWH 2OR7A 4UT6H 3VFMB 3V7AG 1W72H 1XO8A 1PEZA 3TIEA 3QFJE 2IWEA 3BPCA 2KLTA 4QHKJ 1PYWA 3MAWA 4G59C 2I9LB 3CZJA 4L2LA 5SWZB 2AEQL 3NAAL 3O6MH 3RWIB 5A2IH 4UQCA 4XPGH 5L4IA 3VXNA 1GYCA 1H9DA 1G7HA 1W0VB 4TQEL 3T77B 4F33B 4WW1B 3EKCA 3FU6A 1KJMA 1ILUA 1E8XA 4S10A 5KZCB 2J88H 1PKOA 4NNXB 1UATA 1ZVSA 4UQEA 4XT1C 4ZMVA 5LG6A 3BH9B 3CK0L 4JFSA 1KDIA 2A6IB 3AU0A 2D7TH 3MV7B 3B6SB 4WKXA 5D1XA 4Z6AT 1KIQB 2BVEA 3KWXA 4Q56A 4XMWA 5B4MD 1KFAH 2GJ6E 2I85A 4XPBH 3WTXA 4I88A 4K2UH 4YZFE 1U6AH 3MOAL 2O5XL 5JXEC 4G72B 1RD6A 5D4QA 5D1QD 3F7YA 2YJQA 2WNKA 3A6BL 3NACH 5IVXF 1WWAX 1MFCH 1TQTA 4GW5B 1AQDB 4E9YA 4U1MA 5AYUL 4WW2B 3CWGA 2BFVH 1FWXA 3GSRA 3QULB 3ZU8A 2ATKA 2X4PA 4DVBB 1U91B 2XT1B 3CU1A 3C2SA 4LO9A 4ZQKA 1J9SA 4PRBB 2F9BT 1YQVH 5GPRA 2FX7H 3T1FA 1HHKA 3D4CA 1U2HA 4PLNC 4DETA 3SDXF 5JA9A 5CJ8A 5DFWH 3WO4C 1TVBA 4LGPB 4LSDA 1EJ8A 3TU6A 1MLBA 4PJGA 1ESOA 3D4ZA 1UB6A 1W15A 3AM8A 3P4OB 2FJHA 4RESB 3NPSB 3KPOA 3KJ6H 1IM9B 1IQWL 4OQ1A 4BZYA 5JW4M 1BX2B 1IBZA 4CSZA 3T3PE 1CZ8L 3MA7A 1N0LA 1XDTT 4HUNB 1R0AH 1B6DA 1YJDL 4OM0H 5LXVA 3O6FA 4F27A 5DEGA 5DC0A 3O6LL 4OZFB 1IEAB 2IMMA 5MEPB 1TDQA 5IMOA 4GH7B 3JV0A 1NPJA 5AYUH 1ZOXA 2Q3AA 4GKNA 4WK4B 5H4ZA 1O9WA 4MA1C 1AD0B 3RJOA 3TH3T 4CBPA 5AVUB 4BCXA 5D6DA 1M2OA 2AKRB 3MLYH 5JYMA 2BOLA 5ANMA 5ICXB 2PMZA 1DE4B 2CDEB 1QA9B 1ZV2A 3L4TA 3Q8BA 3GUTB 3KH4A 5FX3A 2O6EA 3JT0A 5D72H 4H0LC 5JW4N 1AO7E 3PIQB 5C07B 5ALCL 5DJ8A 6CGTA 3QFGA 1A1NA 3Q43A 5JW3L 2VLMD 4GUQA 3RVWC 1WHOA 4ODUA 1OCWH 1UOLA 4RRPM 3V4VB 2WLIA 5ALCH 1DBAH 1JGDA 1IC7L 1ZLVK 4FXKC 4KI5D 3GFUA 3QHFL 2OYPA 1CFSA 5IQLA 1BVOA 4PJFF 4LNVA 1KB5B 5E00A 4XZUB 2EXYD 2XWBA 1SJHB 1RIVH 2YMXH 1JUFA 5KYUB 1XTLA 2P5EB 4P2OD 3ZMNA 3G6JF 1D5IH 2DL9A 4DGVH 3GZOA 4YHZL 4B60A 3EFOB 4UOW0 4PJAB 5SX4I 4G43A 5KSAC 5EEXA 2OSXA 5AZ2L 2XFGB 1J9QA 1J8HA 5F70A 1XF2B 2WOYA 4XCNB 4LSQH 5LAXA 4UTAA 2CO6B 3ECUA 1OF0A 5INCA 5IQ7L 3KR3H 4PRID 5IVOA 4IOSD 2JE8A 1AHWA 2CUAA 4P2QD 3ZDZE 1RUAL 4AQOA 1PIFA 1JXKA 2WAQA 4N5EC 3O3BA 3U0WL 3IGKA 4NUPA 3PWLB 4NZJA 2JWYA 4HUMB 2B08A 3MRDB 3F7YB 3GXNA 5C6TL 4U1GB 3OPZH 4FKEA 3H56A 2CU9A 4C47A 5TDOA 3NT0A 5LG1A 1OCRB 1HHHA 3AAZB 3B6SA 5D1XB 3SO3B 1YPZA 1DVQA 4PWIA 1T04B 1JNHA 3LKSA 1J11A 4LCUA 4S1RH 5CS7A 4BDVA 2H6PB 1AR2A 1TJXA 2JB5H 2EE3A 3LKRA 4ELDA 2ZYHA 4KWUA 4B9PA 3U9WA 3DO7A 2OP4L 3S4SA 1W0VA 3ZKXC 1F4HA 2OZNA 1CFQB 5D5MF 3W82A 4ZMNA 2J57A 3D2UB 4ZMOA 2V17H 2X7LA 3JWOH 5E6ZA 2YOAA 4PJEE 1VZHA 2J8UB 3AS2A 1WBXA 2L7UA 5D2LF 2VDRL 4OJFH 1HEJC 1DVZA 2WWOA 1TQBC 1DJZA 3E3QE 4L9LC 2CBQA 1VEPA 4ES9A 1T3FB 1NGXB 1ASPA 1T0NA 2ZXDA 3O8XC 5A7EA 3VO0A 5FW7A 4JDVB 4UZGA 2OL3H 4MJ2A 1CN4A 1IE4A 2WN3A 3LN5B 5GQBA 3MNVB 3TNNA 2ZKYA 3VXRD 4P9HH 4BYHA 4DP6X 4OLWL 4Y7MA 4DSYA 3DXAE 3DHPA 3LOWA 5AVZB 5DA0B 5I74B 2D73A 3P0YL 2YRLA 3RIAK 5HGAA 3WE6B 3TVMA 4MAZA 5T3XE 1TU2B 1CFNB 2ZIDA 1NBQA 3VX1A 1LO5A 2TSAA 4F2MB 1QKZH 3M17A 4JFZL 4LLMA 3CFMA 5LUMA 1AQ8A 3KG5A 3NPSC 1WCBA 4JN2B 5ERWB 5B22A 1MDAA 4P5SA 1ZS8A 5B39G 1ZLWH 3VQLA 1QSZA 2DWXA 7FABL 3SHSA 1V7NL 2DICA 2A99A 4U0QB 4PM1A 3RVXC 2IC2A 3SBWA 2J56A 3BAEH 4NJ9H 4QRTB 1JK8A 3TWCH 4OGYL 3TJEH 2XCMC 3QRGL 1XAUA 5GSVA 4ZT1A 3ARGB 2NW3B 5HDLA 4QXWA 4XTRC 1AZZC 1O9VA 4Y9FA 4UIMA 5TE6H 1ZLDA 2J43A 4KK5C 3PL6A 3ME0A 4HBCL 5E6ID 5F1NA 2O6DA 1JIBA 1U4EA 4QIRA 4M5YL 3NSJA 4PJ7B 5GZOD 3WY3A 2CRYA 2IANB 4MHHI 4XN5A 5KBMA 5GGUA 1T1ZA 3D50A 2X1QA 2XXGA 1CE6B 4HT1L 4IK7A 4QYOA 1QI3A 2XZQH 3GD1C 4PW4A 3T2NL 2YXVA 2GSIB 3QG6B 2QQKL 2Y4SA 4E41B 3EH3B 1OGPA 4P5TD 3BWAB 3EYSH 4LKCA 1QFWL 3BIKB 4IJ3B 5D7IA 1K6QL 5ACZB 3C5ZA 2ADFL 1QG3A 1R3JB 3U1QA 3UROR 1KTKE 3I02A 3QIUD 2GPZA 4MTMA 2IWFA 3UX9B 4MRCA 1EAQA 4BFBD 2HKHH 4PCTA 4OFYA 4JQXA 3GZKA 4FXKB 4V1DB 4MA3B 1EO5A 5JHLL 2JLPA 3KW8A 3Q8EA 3CFJA 4HUKB 2E59A 4PRNB 2UYLB 5FLUA 4JFDB 2BXZA 3EJSA 1EXUB 3QG7L 4MS8D 3MCYA 4X7EC 2WM0A 5J6HA 3GT6A 2XNAA 2V5TA 1Q0YH 4XVTL 1HNGA 4AV0A 1G9MC 3BUTA 4U1HB 5L7XH 5SX5H 4J3OH 4M03A 3UTSB 1BQHB 5E6SB 3NRFA 1B0GB 4IRSD 4LLDB 4K8RL 4FQHA 5IQNA 4GEJA 5EUOF 1ZTXE 4OGAD 5GGSB 4JLRB 3MRPA 4N8VG 1VAHA 1R5WA 1F97A 5JLZB 4ALAL 2XQBL 5FKAA 2R1WB 2ZF8A 4PJCF 2BOCB 2B9AA 4X98A 5ABDE 5FGCE 1I3GL 2BHFA 5TQ0H 3G5ZA 1HOEA 4Y5XA 3L6FA 5KJRH 2ILLA 3GHEH 1Z0MA 3AB0B 5BJTB 4YDKL 3AUVA 3JQOB 2IV8A 3OLGA 2WWNA 2Q8AL 3TT3H 5BOZG 2WLHA 4BQ8A 5T1LA 1UQSB 2DRUA 4HDIA 2ATPB 3IU4H 1IT9H 1DN0B 3MACH 1URLA 4KROC 5DR5L 3X13B 2ICEB 2FUTA 3NIGB 5E4OA 2J5LC 4BGLA 2FD6L 2OMVA 2H3NB 2DQGL 1XH1A 4R5VA 4DKFH 3N5AA 2Q10A 2ITCA 5DZPA 1DVFD 3O41B 5CM1A 3V9FA 2YEZA 1N70A 3ARBD 3E80A 3H9YA 2VDNB 3HOGA 2VAAB 5K9QG 5IQ9B 1XCWA 4UM9B 1ED3B 3A22A 1R24A 3MLUH 2AV7B 4HXBL 5JIPA 4QGYA 3S98A 1IQDB 4A7QA 1TQBB 4NQCD 5F3HB 3ZYOA 4Z7WA 3CXDH 4QEGA 5IW1B 3LXUX 1XGQB 3FL7A 2R29A 4WNQA 3KPNB 4N0YH 3G5XA 4FG4A 3LNEA 1QLRA 4Z7IA 4MJ5A 1U36A 3E0GA 3RGVD 4GSUA 1ZWIA 1A66A 3GXDA 3BYTA 5HGGS 2ODIA 4HBCH 3MV9D 5I1DB 4GAYB 4R8WL 1BFSA 2J55A 1NA8A 2DQCL 2VR4A 5IBUG 2C8NA 3MLPA 1O9ZA 4RGOH 4E9XA 4NO2B 3LRHA 3PWPB 1G1CA 1FGVH 2V9QA 3VXTB 4DW2H 1KXVA 4G6JL 2WYIA 1AANA 4ODWA 3SBRA 3D34A 4N20A 2EIZA 1F58H 3KPTA 5C0AD 4U3SB 5M7QA 3RBSA 2F54A 3MNWA 3FHAA 4KJQD 4WWNA 1BF8A 4IM8A 4YHIA 5CKAA 3APMA 3CMOH 5ADPH 4KUZL 3RWFB 3G5VB 4PJBE 2ZX6A 3EOTL 3OSVA 4MMYA 5JXED 3HBZA 4FTVA 2OL3A 3SE3C 2WXHA 1JNJA 3U7YH 1JRHL 2VZ1A 3HNVH 5I71B 4GG6F 3ARGA 1YEEH 2X09A 3F7RA 1JI2A 3UDWC 4AYFA 5IIEB 4N25A 2W59A 2QSTA 5KYXA 1AIZA 2MNUA 4IJTA 3DX7B 3EYQD 4Y8AA 4W70A 5CBAA 1M7DA 4B7IA 4J6IA 1DANT 3FB8B 2R2CA 3SGDH 1DQDH 2D7QA 2DEYX 5AKTA 2AEIT 4G71B 3ZSTA 4MNQD 4OLVL 3VFWB 3FYEB 4HF5L 4JDZB 4WU7A 2EEXA 3HZKA 4WK2B 4JQIL 4XVTH 3T2PA 2CUMA 3OBAA 1D5BB 5GZND 4MD4A 1MJJA 1VKXB 3GHBL 1MHCA 3ZK0A 1F11A 1MFMA 1NAML 3FU9A 2QV2A 4P23C 4PJGE 1IGFH 2K45A 3VFTA 1R33A 3L4CA 1MHEB 4NM8L 2XWTB 3WMPA 1WA2X 5I1GH 5IHHA 1E28A 1FNGB 5KG9B 3MODH 3SKNA 4FHBD 5FB8A 3UMTA 2WXKA 3ME0B 4YHML 3U46B 1KGCD 1V3KA 3VXUE 2X9XA 5C70A 3QZLA 2WO2B 1FO0L 5KUMA 3I6GA 4PJHB 5KYYB 2PPFA 5CJXA 1L9SA 1W80A 1JYXA 1I8KB 1NKOA 3KPMA 4AX3A 1PDKA 4NQQA 4UQAA 1B4LA 3D3VE 3TFKD 4JPIA 2VR7A 2XIBA 1OOWA 4P46D 4E41E 2V7HB 5EDSA 4MJIA 4A63A 4YX2H 4O58H 1S7SB 5BRZD 2VGLM 3WKPA 1G7QB 5TGBA 4Q97A 3P0GB 3RTLA 3QVAA 4HUCA 3LDBB 4GP8B 2ICEA 3QFDA 5CHNB 5ICYB 1MHHB 2B1HH 5MEOA 3OMAB 3NFSH 4LSSL 3WKYA 2RHEA 3X14B 3LS5H 5HYFA 5I18H 2GEQA 2C3VB 3O0LA 5FF6A 2VUYA 1MAML 1HS6A 2BVQA 1V05A 5CLYA 2JKJA 4FQ2L 4XCFL 4POUB 4QXUL 5CD3A 3POHA 1KY6A 4MNQA 4U1NB 3APFA 1UG9A 2KZBA 2X2IA 1FC1A 3BVNA 2DQFA 4G8GB 1LD9A 1JD7A 4BFEA 4C56E 2X4QA 3FPYA 3NFNB 5E1AB 3NJFA 5I6XC 1RUML 2EIDA 2QHRL 1HIML 1IC7H 1A47A 1MCIA 2YPLE 4RBPK 1G87A 1OP3K 4FULA 2M8XA 4Z7QB 4LQFL 4WHTB 1DUZB 2LOEA 3MRHA 2JI1A 3T3ME 4GIAA 1EV2E 5H2BA 2NX5E 1XR8B 4L5FE 4PGCB 2Y23A 1A4AA 1LDPL 5CJOL 5FECB 3KEDA 3BQUD 4U6XB 1JGEB 3QQ3B 3S4SB 5IQMA 4O4YL 3QXAA 4P2QB 4XGZA 4HJJH 4NKOB 3GB7A 4GQ9L 1JCVA 3B9KD 3CUPB 1P7HL 3LKNA 1IBYA 1JP5A 1CBVH 4MMXA 4Z78A 5IEKA 1TT6A 2YGPA 1OPGL 4GRWE 4TVSa 4XNUL 2M1KA 2GUOB 4UIKL 4YC2C 1G1KA 3T8XB 3WTVA 2GTWA 4LCWA 3VG9B 3WJJC 2O72A 1AHMA 1FGNH 2Y25A 4ELMF 4E9LA 3MGOB 1GL4B 2G3ZA 5D7SL 1SVZA 4Q4EA 1XB3A 5ISZD 4JNXA 2NW3A 4LEOA 1KB9K 4F7KA 3RX5A 4ZQTA 3ILDA 4DK6A 2BIOA 2OM5A 5I6LA 1NDGB 2A38A 1FAKT 2BVPB 1JV2A 1I3RA 3FHEA 2NNRA 1NCAL 3VFGH 5E0QA 4OGXL 4OF8A 2I7SA 3ZYZA 1IO4C 1XIWD 2YPKB 3SJVD 3NP3A 1RKRA 5EOQH 5IVNA 1P7QA 3VXSB 2XRAL 4LCCB 4Y2DD 3JV4A 5DVKA 4NLHA 2JCCB 1UCTA 4G9FE 4HEPG 1YEFH 5KBLA 4UQ9A 3X1BA 1QBML 1T21A 2IDTA 3I9AA 1G6VK 4OSUH 3BUDA 3L3HB 3PHAA 3T4YB 1OM3L 2F7QA 5DVNA 4H88L 1FZKA 4MZ3A 4YDLC 3HPJB 4P9ML 4AIXA 3FTYA 4KKPA 4LDCA 4KXAA 1MW1A 4AC4A 5B38A 1JWSB 2HXAA 4XNDA 4PBXA 1XZ0A 2G9HA 5D4HA 4QRRD 2VLKB 2WSDA 3I2CH 5C0BB 2WYTA 3UGUA 2VITA 5C0DB 5GS0L 1UC6A 1A1NB 1NCTA 3MOAH 3MUHL 3FB7B 1CFNA 3ARZA 3OKEB 1YC8A 5GRUL 2XVLA 4U6VH 1NCAH 3OKYA 4M43H 2DD8H 1NGYA 4F58H 4NOBA 4MA7L 1COBA 1QRNE 1NWPA 4R9HA 3IB4A 3L3DB 2WJ5A 3AWFA 3FU7B 4P3CL 3Q5TA 4H2CA 3QHFH 1BOGB 2B1AL 2C9AA 4JFHD 4MAUL 4WKZB 4X6CF 3WOVA 1A6UL 1JNLL 1G6RL 2BS71 2EE6A 4F2FA 3S5LB 5I30H 1BQLH 1LO2L 2IOIA 1EAPB 3EUDA 4OZGF 3BPNC 5C08B 1B0RB 2CIIB 3FT3A 2DLFL 1UA6L 3L2MA 3O11B 4OT1L 4KUCD 1MJ8H 2DEXX 1H19A 1ZK5A 4G42B 4XPFH 2AJXH 1MFCL 2D4FA 4GRWH 1HL8A 5D72L 2OMTB 3P4MB 2I32A 3UZEA 1JNHB 5A2LH 1ZHKB 4YLCA 4U1IA 4Y19B 1F6LL 2VR5A 4K2UL 3RIAF 5J1TC 4BRJA 1G5GA 3DX4A 1OAUH 3VQMA 4MAYB 2DDQL 4JDTH 3PHSA 1J86A 4MX7B 1IJNA 2VXUH 4G2AA 1DSFL 2DWDA 1J9CT 1G7HB 3IE9A 4ZX6A 4OGZA 2FQGA 3NIGE 2OA9A 4Z7AA 4XNXH 1IILE 3M6DA 1CVRA 4URKA 3BPCB 2WMPB 3N43F 2Q1EA 2Z1PA 2RALA 5I2IA 1R0AL 4YHYB 4W9KC 3ZE2F 1BZ9A 3DX8B 2JI3A 4Y5YA 3DETD 1ZLEA 1OP5H 2R56H 2ZG1A 3BSZH 7CGTA 3CVHB 3DMMA 3UYPB 2OJEB 3DA0A 4EIUA 4TUJB 3V0VB 2P42B 2XN1A 4DPAX 1HHGB 3WFDL 2A77H 2YKLL 1DHKA 3MV8D 4JZJA 1ZSDB 2COVD 2VDLH 3MXWH 1CGTA 3HS0B 5T1DH 1MLCB 4EN3D 1BFOA 1U8CB 4P2RB 1P5VA 2EH8H 4AXWA 5KN5B 1UACL 2C7FA 2P5WD 4DPCX 1F00I 4Y1SA 4P3WA 3MROA 3MRIB 3D12B 1JHLH 4JHWH 1I82A 4XWOD 1G4MA 3IETA 2Q9OA 3A4FA 3PGDA 4FQLL 1Y6KR 5CIPH 2TRHA 4MXVE 4RAUB 3V52L 3C08H 4BE6A 4G1EA 1R9FA 3U83A 1ERNA 4R3SB 2GVYA 5KOMC 4OLZL 3VU1A 1XMWA 3HUJF 4R0LC 3OR7A 2CHDA 3H53A 5DJAB 3SDCB 3FQYA 2Y7LA 3V4UL 5GGQL 4ZUWB 2R27A 3HI1A 1IAIM 1S46A 4YVUA 4FZ8H 1FCCA 4JFFE 4MCYB 3QCVL 1OGTB 1X44A 4BQ6A 1BEXA 1KZYA 1W6LA 2RBLA 4BFIA 4MNGA 4FYQA 1C7TA 2AV1B 5IG7B 2H6OA 3QORD 1J10A 1YDPB 1U92A 4X6EB 4AQ8A 1BGXL 2EEDA 4JZJC 1MEXH 2AP2A 4I48A 1KPUA 5D5ME 5JYLA 4RISL 2YZ8A 5CCGE 2OR9L 2Q3XA 4G5AA 3QEQB 3VWKD 4XNMA 4L0YA 3ARBB 4HKXB 1OF2A 1FZKB 2GBUA 4FMFA 2KERA 3E9TA 2FX8H 1MFVA 5KANG 1BMZA 4ZFZB 1RPUA 1WBZB 1H5BB 4NT6A 2F58H 4KDVA 2FZ3B 3QI9B 1HXMA 4PY7A 3VJ6A 4BK8A 3KL0A 5FIEA 3TBSB 2PTUA 4YXLH 1M57B 4GI9A 4OZFA 4BGDA 1TZGH 1ZSHA 4GY4A 1SXCA 2O93L 3JWDC 3RURA 4XP6L 2E76C 5HGHA 3KCWA 4PRBA 4WI0B 1JDCA 5T1KA 2E86A 1I9JH 3B9AA 2XPZA 4E42A 1FIGL 4RETB 1N68A 4M3JA 5AB2A 5EIQA 1VRSA 4PRAA 3QUYB 3FB6B 3P4LA 5J1AB 3NCEB 3FQXB 1EJOL 3NQKA 4RWYL 4XMPL 3HE7D 3ZTCC 4M00A 4BSWB 1J18A 4NYLA 1TTFA 5H37G 1Y18B 3CQFA 1HHKB 4OZGB 4XN4A 5B1AB 4A38A 3QR1A 3O2DH 4MVBD 3CFEB 2LLNA 3LPWA 4NQUA 2CM5A 1IKOP 5J57B 3Q3GB 1HQRB 1T6VN 3DGGA 4F8LA 1N12A 2ZXBA 3G6DH 4MZRA 1DSYA 3M07A 3SIKA 5AEAA 5GRZA 3CE1A 4DKEL 5JOPE 3AY4C 1M3IA 4GAFB 1KB9J 3CZGA 4H25A 1EUUA 4PGDB 4DGYH 2R2EA 3TH2T 2JB6A 4OCRL 1JAEA 2ZWLT 3IFPA 3U6XA 1EZUA 1N18A 1RK0B 1IC0A 1X4XA 3A23A 3L3IB 4ZUSA 4K23L 2HP4A 3KBFA 3BAXA 1A7OH 1IB5A 1AKPA 2ZUQC 3MLVH 4OJYA 4MNGE 3CXDL 4UT6A 4PMEA 5LBGA 3W39A 3BEWA 5FKAB 4NP4H 5L4JA 3FBKA 2Z0UA 1S5IH 3EXLA 1EHLL 4DESA 4YHOL 4IBQA 4XNAA 1MY5A 2P8MA 4X5XB 2C9VA 2QPUA 5A2BA 4JZNB 2NY2B 5FO7B 5E9NA 1HI6A 1RJYA 5BVJA 2YA2A 3BW9B 3VXPA 1S7RA 2VISB 5SWSB 5MEOB 3EO1B 5KOVC 2VLKE 1UH4A 1UOWA 1XBDA 2VQUA 1TQVA 4MDIA 1VESA 4U6VL 1SYSA 2HFTA 4JRXD 2ZXWB 3WIHL 4EEEA 3K6FA 2P48B 4HZLA 4WHYG 4NQEA 1OSPL 1F8TL 2VIRB 3FCUB 3IJHB 1PU0A 2C9SA 4KXZH 3OHXB 4PHZA 5BOJA 1SHXA 3U7AA 3UBFA 4P46B 1JNNH 5F9JA 2PWGA 4IIQC 3VFRB 4QY8B 1YAZA 1E3FA 1P5UC 3GRBA 3ERXA 2BPBA 3VH8B 1JPSL 1D9KC 3N91A 2YAQA 4L8DB 3WYRA 4DZ8A 4QRFA 4KNQA 5FO8B 1XF3A 3VXQA 2VW7A 3ATFA 3WD5L 4AENA 5AG9A 2ZCZA 4GO6B 1L4IA 4ZDHB 1SOXA 1UHVA 4YQXL 1UJTA 4JVUA 2XG4A 4M8QA 1AZNA 4WIQA 3MCKB 2R9HC 1B90A 2ZG2A 3QQ4A 2WBWB 2NW2B 3HHRB 4DTGH 4PI0A 4NUGL 1AJ7H 4MD5B 3I75A 4CKVX 3AMKA 2OJZL 3RZCA 1RHHB 4H8WL 5F44A 3ZX1A 2ADGB 2EEBA 3GSVA 3MRBB 1FL6A 3KHOA 3CHPA 4K5PA 4AQEA 4D9RE 2BSSA 3ZRSA 5EU5A 4OLYH 4TTDC 4ADJA 2BP8B 1RZQA 1DLFH 2V37A 5MENA 2CLVB 2A74C 4TRPL 3O3AB 3GMQA 1A4BA 3SQRA 3W5MA 5BVPH 1MRCH 5I5JA 3VH8G 3HE7C 4W9HC 2NY4C 2B8OT 3ZE0B 4DQOH 3SY0B 3EJPA 5JOFB 2I69A 2E4FA 1ZTXH 3LNGA 2ICEC 5FO2A 1BVLA 4UU9A 5H8DA 4E5XA 4ERSH 4E68A 1YECL 3KLAA 1OKEA 4H4NA 2NY1C 2WKLA 3T3MB 4N0UE 4KZEL 4EIGB 3P2BA 3LX9A 3O4OB 1FV1A 5T3ZD 5HPOA 4FL4C 4KJWD 1BYNA 3OXRA 3WNIA 4E41D 5A7BA 5C0NC 4UQIM 4X6DA 4JN1H 1YPZE 4YL4A 4FDWA 3SOBH 2CDGA 5E8OA 2IDSA 3II3A 1PG7W 1URIA 3NDZE 4GG6A 1WPCA 2QHLA 3TBYB 5I5IA 4LSTL 5D7LB 4PJ5E 5D7HA 5D8JL 4AE0A 1NCUA 3PGCB 3BP7A 4L8SA 1SLUA 3UAJD 1E9PB 5CEZH 5E1IA 3S34L 1ZHBA 1J0KA 2XPGB 5KVDH 3X3FH 3KGTA 4FFVC 1RK0A 4KPHH 1NIFA 1Y7VA 1KGXA 2NX5A 4DFIA 2CLRB 3AQXA 2ADJB 2YZ1A 3MRKA 5FYKU 2VOTA 5TF1H 1UXSB 2BO0A 2J6EA 2WQSA 4OFKA 4ZS6D 4BFFA 2EC8A 3ZTEA 3ARDB 1IAOB 3EJTA 4TNWK 3CC5B 2HJFA 2BIHA 3IFPB 5IROA 2JKIS 3U9UB 1MWAA 4PGDA 3P3TA 5L0QB 1Q9WA 3NZHH 4UUJA 1U95A 2ZPKH 5AVYB 3ZTJH 1UA7A 3IT8D 3DBXA 5JHDE 1FAIL 2IH3B 1MCFA 3BP5A 4EXKA 3GTVA 4ZS6C 2BZ7A 1JF1B 5C0BD 3WFEL 3SGDI 2EC9U 1I9IL 2BNQA 4OAWA 1TITA 3MU3A 5F8QC 1LD9B 3ARGC 2Q7NA 3EGDA 4PGZA 2ZOUA 2VT0A 4XO9A 2DS4A 4HCRH 4EAEA 3MLXL 1Z3GH 4LQ1A 1U8IA 1YUHA 2Z34A 1N9PA 1PZ3A 5GISH 5KVGL 3ALPA 6FABL 1BBDH 4K7PY 5AOJA 1ZPLA 1I8IA 2Z35B 3H4HA 5CIPA 3PV6A 4DAGL 2Z65C 3FCBA 4AZ8A 5CHNA 5ICYA 3ZYJA 4Y5XC 2E0PA 2VDPB 3NBNA 4K3DL 2DYPA 5GGSA 4ZW3A 1M1XB 3FKUS 3REWB 4AEHH 3RUGB 4GT7A 1CU4L 4XMZA 4BM7A 2WQVA 2X2HA 4NN5C 5DFAA 1J5CA 2BK8A 4KJPD 4PV1C 5FCSH 5HHOA 3BQUC 4GMSH 1B0GA 1RPQA 1ANUA 4A7UA 1WITA 4ONFH 1Y0LA 1A7QL 3IE4A 5EF3A 4GBXC 3FQTA 3GMRA 5G4OA 5K39B 2JXMB 2HLFC 2Y36L 3CG8A 2UY6B 2P4AB 1ZY9A 4B97A 2XXMB 3FTGA 1F4XL 3BDYH 3CXFA 4ORGB 3SGJC 2J44A 1YEEL 3V0FA 1R47A 1CICD 3CSYA 1QYGL 3QEQE 3UYRH 5EF1A 2R2HB 4A7SA 2CKBB 5TFSH 5KVDL 4X6CE 4L1SA 2AC0A 5BXFB 2IADB 4JG1H 3O4LE 4S1SL 1FZJB 4KUCF 3QI9A 2DPKA 3BO8A 3CSPA 3H2WA 1OTTD 1E7UA 3L3OB 4A1RA 4GRWF 5IY5B 1K2DA 4C56D 4NN6C 5ID0B 1GYAA 1TSHA 3CHSA 2Q2LA 3QDJA 4P46A 4Z0BH 3D30A 5FKPB 1WAAE 1ML0A 1AGBA 1OCWL 3LH9A 4YPJA 3SPHA 3RDTB 5JMRA 5JPMB 2V5SA 3BGMB 4FP8H 4GUOA 1IAII 3I6SA 1E30A 2OX5A 1DLHB 1A64A 1CO1A 1T5WA 4RWHA 4HHWA 4I48B 1EO8L 2YXMA 1BPVA 5C0CA 1TVBB 2H2PD 2Y3AA 4R2GD 4HK3J 3FRPA 3E9UA 4LIQE 5F0LB 1ZVSB 4PJ7E 2C9RA 4FTVB 4OCXL 2LR4A 3DPBA 3HI6H 4IOIB 4P3DB 4ODTL 1NCWH 1TMQA 2QLVB 2BZCA 4HH8A 1QHPA 4U1GC 1G7IB 1JL8A 4LOUD 3A3YB 4HKBB 5I6XB 3TEYA 2DI7A 4XO4A 5EC1B 4WFGD 3RNKB 1WC7A 1YMHB 3RAJL 3WLWD 4AVIA 5B3JF 4WNSA 2R59A 3CAFA 1MCSA 1S7TB 5KEZA 3BQVA 1NDTA 3KPSB 3KCPB 1GGUA 1ZEAH 4PB9L 4P4RA 4MAYA 2X3AA 3FSOA 3ASWA 2PXYC 1MIML 2B3IA 2DWEA 2AXGB 2WQWA 3B34A 3KJ6L 4V1DE 1T0OA 5BUPA 5EBWA 1WEJL 4MB5A 1U8NB 2AJ3A 2VC2B 4FLOA 5C92A 4OZIA 4R0LB 2QPFA 2RQEA 1FF5A 2APSA 3FQRA 2YA1A 4ACPA 4NKIL 2FUQA 1OL0A 3KWTA 2H9GB 2PO6A 2IH1B 4K3GA 1JGLH 5G5DB 6PCYA 3UBXA 1WS7A 1XGRB 3MRFA 3QI9D 3GSNA 4PJ8D 1U58A 3Q3GA 1G4RA 4QXTA 5I6PA 1JBJA 2XSKA 4QYAA 1I9JL 5BO1H 3HN8A 3IDIA 3D2UD 5CCKL 4BFJA 4JJHA 1VADB 4BFOA 2HFEB 1OB1A 1I4FA 3T3MF 3SY6A 1TJMA 3A6BH 4JKNA 1THCA 3NJGA 4APXA 2J12B 4KKLD 4D3CL 3WNNA 3BKCH 4L3ED 1A25A 3EYQC 1L6ZA 1RZPA 3RL2A 5DA4A 3FMGL 2D2OA 3ZDYB 4LEBA 4RZCB 4Q8BA 4KRNA 5HVHC 4EZKA 4CW1A 3L2NA 3CVHH 1HHHB 2Q86A 2W94A 2VN5A 4ELME 4G8GD 4JPKL 4N2AA 2XN2A 2E3VA 2VDLB 3M8OH 4PJIF 4DN4H 4W4OA 1NIEA 2OYKA 4PW3A 3TL5A 3V6ZB 1U3NA 1ZA6A 2V7NA 5HHOE 1ACZA 2J3SA 1PLGL 3RU8L 3ULUE 1Z66A 2PCYA 3B9EA 5D7LE 4HUXB 1O6TA 3L16A 2A7BA 3CV5A 3O2DL 3BZEB 4P23B 1W0WA 3HMXL 4PB0L 1MVUA 4X8JB 2QQKH 5BQ7B 3BVUA 2EXWC 1ZIBA 2EVJA 4ZI8A 4QO1B 4GG6E 5BS0D 4QRSB 4WEUD 1XSJA 5JORB 4YLQT 2Z91A 2VDOH 3OMIB 5D1QE 1FIGH 1UD2A 3U2IA 3VRLE 4X9FA 2NOYA 3TURA 5CZRA 1FHGA 1E27A 2J73A 2AJZA 3VCLB 1RZJL 4FTVE 4XZ4A 3GUFA 3HUJB 5IFAL 4XCCH 2BFGA 1K8IA 3G6DL 3BGFB 5DQ9A 4PS3A 5FUZL 3LIZL 3QDGD 5FYKH 3VTAA 1R75A 4JFOB 5J12C 4JS7A 4CADB 3VXUB 3L5WA 2IPTL 4YXLL 3UG5A 4YJZL 3DX9B 3VYPA 2P52A 4X0KB 3AJ7A 3S4SG 1WA0X 4FI7A 4QGTA 4KO6A 2ZOLB 3OKLA 4JREC 2O6PA 1ZVHA 4LKCB 5E2WL 3F5WA 3LQMA 1LHZA 1QKZL 4JFZH 4JL1A 3WEMA 3APNA 3BOVA 4UINL 2YPKA 2HVJB 2YAPA 3A0OA 4X8JA 1EERB 4XGZB 2IANA 2NY6D 4DP8X 3MOQA 3O8XB 4FG0A 3ZDYF 1MFBL 2IIJA 1H5BC 4FF9A 4X0NA 5DRNA 4YIQB 1XR8A 4PGCA 3DIDA 2E75C 4RDQG 4LBEB 4N0FB 3OB8A 3BSGA 4JZOA 5KZCD 3OQ3B 4X2UA 2YS4A 3T04D 4YHYC 3U0PA 2QZ5A 1A22B 3ARWA 3BUYB 4Q9RL 3QR2A 2OK0H 2ZNWA 5IJVB 5JW4Q 1G94A 4W9EC 1IMHC 3HN3A 4PGBB 3UTSD 5C09B 5LGJB 1GW6A 3DURB 4FZ8L 5TTRA 3SQOL 3UC0H 1GSKA 3ORJA 4PRIE 4J1UB 5G5DA 1UT9A 5C0IA 5I1AA 1E5UI 3LH2L 4XN7A 3VI3F 4H1LB 4NRXB 4LLWA 3MUGB 3P9MB 2F18A 3JWOL 4G6AC 3WUWA 4XPFL 4LL4A 1E2VA 5IW6B 2CE6A 2DWEB 3OAZH 5GRJH 4BK5A 1U8JB 5E8NA 5EC2A 3KM2A 4OKVA 3FT4A 3FN9A 4U1IB 3G5YA 4Y19A 4P5MB 5IBUB 4GO8A 4O2FA 4OV5A 1A7BA 4KI5E 2DQEL 1GSMA 2Y9RT 1P4UA 2CNYA 1ZXQA 35C8H 4O5LL 5JXAH 3TESA 2YSTA 4WTZG 5HJ3B 4PMFA 1XGRA 3RFRA 5C6TH 4JFQA 1HZHH 5T5FA 3BSZL 5C08A 3SYQA 4R7XA 1BLNB 2KUTA 3LIZH 4YNYA 2R15A 2XWTA 3H4FA 4FQLH 4S0TD 3UABA 3K6NA 1SDDA 4LSQL 4BWTA 1WWCA 3D09A 3B2UC 3EOAB 1XGZA 1I1AA 3TM6A 3DXAA 2VO5A 5DMIL 1DL7H 1AXTL 2C9XA 3I3BA 3HI6L 1HSAB 3IKKA 2Y7QB 3PFQA 1TNNA 4TTGA 3WTSA 4G8FA 3CVIH 1SN5A 2K9UA 3CHQA 2R56L 1AS8A 1NCIA 4U6YA 1MY7A 3FSWA 2AQTA 2QVIA 1YEHL 4MDRA 2X4RB 3ELQA 3T3PB 3ZE0F 5BUGA 1T4WA 5AW0B 4KK6D 4LOVA 5DF0A 4J27A 1QUPA 32C2A 5CU5A 5DRZA 1EJ6A 3MQIA 4ZW8A 3VFSA 5IB1A 5BQDA 1Z1WA 2LAAA 4NUQA 3RL1A 1BM3H 4RH4A 3J07A 1ZGLA 4DN4L 4GP4B 1A7NH 1EGJH 3HZMB 3JZYA 4YPGA 1WAAF 5KSBB 4KVNL 3B3IB 1P1ZB 3TBTA 2VERA 1P84K 2YSSA 2VLRB 2X87A 2PETA 1GMEA 2CO6A 5T3XD 2R2BB 4XVOA 4AJWA 3H9HB 3WIFA 3CDZB 4BCZA 5IFJB 4LOEA 2GBVA 2B5IB 2CR0A 1MCWM 3NJLA 4WW2F 3BW9A 4LVHB 2VR3A 3BFOA 1JWUA 4X5QA 4HOMA 4KKNA 3RIFK 1BIIA 2AMGA 3AG2B 3HC0A 4X6FB 4N8VA 1G7JB 5TK2A 5EA0L 5B1KA 1KCRH 3EJRA 4B0MM 3PWPA 5J6SA 3D07A 3V55A 1Q0XL 3TX4A 5I5MA 3ZZSA 1QW8A 4WFHD 4XZUA 1XIWC 2GT9B 1SNRA 3RDTA 1JERA 5E2TH 1FE8H 4MKMA 4PJBB 4B9KC 2DWYA 4YBHA 1R3IL 5IB4A 1V7ML 2B77A 4NDMA 3HVDA 4WZ9A 5DYOA 1UCBL 5JO5A 4FXGA 3QUXD 5FCUL 1A7PH 2FYYA 3T0WA 3E6FB 3MJ9H 3ZJAA 2LLGA 2D0HA 4NBYB 3QO0A 3CMGA 3WN6A 4NZRL 2O5ZL 2FEDD 1E8ZA 3OAYH 4YHIB 2OXHB 4TSCH 1FDLH 5I8KL 3SKJL 4ODSL 3VM5A 1YNKH 3QFJD 4G9DB 2E6JA 2HFFA 4FQQB 2NXYC 4TN9A 4W9IC 1FRGL 3QJQB 2N1KA 3NFSL 3LZFL 4PRPA 3SE9H 3S36X 2CD0A 4GKNB 1ADQL 4UNIA 4XO8A 3WIHA 1DCLA 1YVLA 1JXDA 1A9VA 3FK3A 5JW4R 5DRXB 3RE0A 4OFVA 4UAOB 3QXTA 5HJ3A 4CDHA 2ENPA 5F6IC 5J13B 4GW4B 4B50A 3HCVA 4B9CA 1I8MA 4XPAL 1SVCP 3ET9F 4O2FB 4K8RD 3IFNL 3C5JA 4KKZA 3GINA 4C4KO 5KSVA 1TTGA 2RB8A 4F9LC 2D03H 4P2RE 5I6MA 3QIBB 5FAAA 2P9RA 3BPOC 3L4ZA 1U8KA 3VI4B 2MOGA 3MRCA 4KTDL 5LBSA 3TBSA 3WUWB 2E7BA 3A24A 4XNZB 2QPEB 1K4DA 1LEKB 3GK8H 1YMMB 2OZ4H 3TO4B 3IMVA 3RDTD 5FK9A 3TPUA 3PG2A 3CPLB 1WISA 3QJRB 2NY5H 3P02A 1G1YA 2Y7OA 1HZLA 3VD1A 3PPEA 1QLEB 2EH7L 3GRWL 1WFMA 4GXVH 4K71B 4BSVA 4BXSV 3IN2A 1E8WA 4MCZB 5D7JB 3IKCB 4RIRA 5GRXG 3ZL2A 2UZXB 2UY7B 2XQ0A 3JTTB 4JG0H 1ZV5A 2J25A 4OLVH 1E2ZA 4Y89A 2XN9A 1TSRA 4Y4FD 3LPPA 2F54D 2Z7ZA 5LJYH 2FB4L 5D93B 4LDEB 3D33A 2W9DL 4PAZA 4PBVC 1W16A 1JK8B 2Y1VA 4X4ME 1CGVA 5KVFL 3ARGD 3SOBL 4QHPA 5I15L 1DQQB 4FXLA 1N8ZA 4EI0A 1LK2B 1FFNA 3RVVC 1WUZA 4HOWA 3IYLW 5TF1L 3N44B 1R5WB 4M9PA 1AD9B 4H0GA 2FVNA 3ZKMC 3S8FB 4ZAKD 4FNTA 5IVXA 3AU1A 3EOTH 4KHTH 5GGUB 4I5BA 1EEYB 1WLHA 4WFEE 5EORH 1KEML 2FQFA 3O4OC 4EZLA 4LAQH 4RQQA 4YGVB 2CO3A 4U7KA 3P0VH 4GXUN 2RACA 4M3HA 1F3JB 3IRCA 2GABA 5F0PB 4E9TA 1IUZA 1BP3B 2CPUA 1UYWL 1DO6A 4GNKB 4WEMB 5ISZB 1TZIB 2E7HA 4RMTA 4KK8D 1GKEA 5E9DB 3MNZA 1U4FA 3ZDXB 4JO3L 3HZMA 2A1WH 4FXKA 2WZAA 3RPIA 1HWHB 1VENA 1P4IH 2FO4B 2ZONA 3TFKC 3FXIC 4HCRL 5GS0D 3VH8A 1Z9MA 5EUOA 1TFPA 3ZUCA 2AQSA 1J9TA 4D0CB 1SOQA 3LN9A 4BFKA 4TQ8A 4Y2DB 3WFEH 5F1OB 1XCQA 4PJEF 5C2BH 4G8FB 4HUXA 2BERA 4HZLB 2YXFA 2NNCA 4HXAH 8PAZA 3KWVA 2Y5TB 3CLFL 3GLZA 2XZAL 4A2FA 2NNFA 1IGMH 4OF7A 1J5HA 4NBXB 1ND0B 2ROYA 4MJ5B 5HI4D 2H7WA 1QLEL 4TPRH 4LESA 3F7LA 4HSCX 3GSVB 5AUMB 1H8NA 2QGEA 4U4BA 2DMCA 4UT9L 3L5XL 3QEGH 5LQBH 2X1XR 4OJCA 3V0DA 4HH9A 5DK2B 1E4WL 4XH2A 4C57C 2GFBB 4QRUB 1LO4H 1H3UA 5IQ9A 4ZODA 2AZAA 2D2CC 4XP5L 5J56B 1AZUA 3HBPA 1G7MA 3ALXA 4M48L 3UEZA 4ZNCD 4RFEA 1J1OL 5IV2B 2P47B 3GHEL 4JJ5B 3V4PA 5HGBB 4XHJD 1E90A 4EDWH 1C08B 3OKMB 1XCQB 2GSMB 3TV3H 4H26A 3DK2A 2WQRA 2Y07L 4LP8A 5K9JL 1C5CH 4NZUL 4B3VA 5AD0A 3CDGA 4HDIB 1A14H 4N0UA 1C12A 3B9KC 1IM3D 3OHXA 2MQ0A 2FO8A 4ZMAT 4AEEA 2P24A 4RCAA 1PIGA 2R4SH 1NEZA 4UT7H 3MN8A 1UM4L 2DQHL 3ZZ1A 4YHKL 4CADA 5EBWB 2VMDA 2ZKMX 2DL2A 4L3FA 1Q9LB 4N4YB 1BEYH 1HX0A 2V0AA 4GBXB 1CIDA 4ACTA 1FL3A 2HJKA 1KT2A 1MQ8A 4NPYB 4NRYB 5KSAD 4P4RB 3B9DA 3G9VA 4XVUD 3ARQA 3GNMH 3TZVA 4YHPB 2V5MA 2X4OB 3T9WA 5BRQA 2HT4C 3X2QB 1NFDB 3FFDB 1MZZA 1A4CA 3P30H 2N1TE 4PJ6A 4IBZA 1NLBL 7PCYA 4GS7B 3Q8AA 2JKSA 1DE4A 2CDEA 3ZRCC 5HYIA 3GUTA 5IF0A 3NA9H 5HTSA 3HZVA 5KAQF 2QZQA 3TBWA 3PAZA 2Q3ZA 1OGAB 2JFCA 3U4BH 2XXFA 4Y5VA 5FA4A 4AQAB 2HG5A 1JFHA 3U1SH 3KPRB 5GJTH 2ICWB 3MRKB 3P2TA 4HIQA 1UWXH 2UWEE 3V4VL 1VPOL 4A7GF 4DO4A 2MTPA 4LLAA 2W9EH 4S1DC 4CDGC 4J7RA 4GQPH 4OIIL 3OJDA 3PABB 4U2YA 1WQVT 3DDGA 3BUPA 4I77L 4PREA 5D2LB 4E9QA 3VXMA 5EF0A 3OKDB 3X1GA 4MB4A 4BK4A 3NCYS 4C4KT 3SE6A 1KDJA 1J0YA 1OSEA 1DVYA 5K9KB 3QCUL 3QDHA 5ITBH 5CEYA 3V4VA 2GB2A 3HE6A 5TE7L 1A21A 4IBLT 5C71A 4OF0A 3GSXA 1S5HB 4F7MB 1KY7A 1BG1A 1TNMA 1V7NH 2ZE0A 4Q6YA 1T80A 2VLJE 3ZY7A 1YEJL 2VQ1A 1GMIA 2R0LL 3S37H 1ZT1B 2DYRB 3HZ3A 4P05A 5LNEA 3OG4B 3MO1B 3BX7C 3JTSB 3EH2A 4OTXH 1K8IB 1KGUA 3QUXC 1DDHA 1YHPA 1IV8A 1DBBL 2FBOJ 2LVCA 2MQGA 4I3RL 3VGGA 4GFXA 1F90L 1NGQH 4UT9H 5PAZA 2UY6A 2IAMD 3NZUA 4DKAA 2EUZA 1Z9LA 5D96C 4NWTL 5IMLB 5EF2A 2GJZB 2PPAA 5GZNC 1BIHA 2GEEA 5ECJE 4HUWA 4XC3H 2BVYA 3T0EC 1J8KA 4LLQB 1KG0A 4JGJA 2F5AL 3Q6GL 5EU4A 2XZAH 4CA4A 1LYQA 5IFHL 4A2MA 3MV01 1F1AA 2Q8BL 2E27L 1LJMA 3MMEB 1IKFL 1JZHA 1TFHA 3DOIA 2G2PA 4KO7A 1JZ2A 4NNXA 4AL8C 2BHZA 2EINB 4JFPA 3F01A 1NOFA 3D39D 3IDYC 5FYLE 5EO1A 3BPNB 3PV6B 4WCYL 4TNEA 1NCOA 3IDNB 3PDDA 5C97A 2YQ3A 1HU8A 3DETC 4L1DA 4PV8A 3UJJL 3S0PA 4XTRD 4KTYA 1F56A 3WNLA 4JPIB 3QXDB 3QRGH 4K15A 2C3GA 1NGXA 3PNRB 5B3NA 3UPRB 4GJTB 2WLZA 2O61B 2E7LA 4YVNA 1M4KA 3FRUA 1U8PA 4PJ5B 3HNTL 3VM7A 3WU1A 4GB9A 2MFNA 5E8PB 4BK5C 1G84A 2RCSL 4I0CC 1BHGA 1P84J 5FW8A 5T1DL 1TTRA 3NG5A 2ZXAA 4IDJL 3QQDA 4EO5A 3P0VL 4UOJA 1MZYA 3BGFC 1S3KH 4U1KB 1U3HB 4FCHA 8FABB 2X0WA 3TA3B 3GXTA 3NCMA 1AY1H 4OW6A 3UBXG 5E0FA 4PJGB 2TAAA 4N0UB 5FKPA 3C08L 3V52H 1CD1B 3GJEA 3ARFB 1LNUB 3VSUA 3KR3L 4R5XA 2NT1A 2UUDK 1V8HA 1N0XH 4JFEB 4RGNC 2XWDA 2YQBA 2ROXA 1NKGA 4JJ5A 1WC7B 1YMHA 2NYYC 3GS7A 4L1LA 3T8MA 1VEMA 3BQUB 5A6LA 1U8NA 2AJ3B 4OZIB 3N42B 2X88A 5HVGB 1EFXA 2WKOA 1AQDA 2ZUVA 1MFEL 2WW8A 2DW5A 1MAJA 3QORC 2XTLA 1KPVB 4LCCC 4OY9A 1KTDA 4WKZA 1HAWA 4ORGA 3DPBB 2FR4B 2GTZB 4O2EA 3MRQA 4GI6A 5AVWB 4PJ8C 3BKML 1A7RH 1H3GA 1N6QL 4Z7WF 5DJCB 4KVPA 3MV7A 3O2VH 3PAUA 4DO5A 5A6MA 2GK0A 5SWZE 2AK1L 2FX9L 3EHBD 4GSRA 1KCLA 4FKKA 5ILTL 2G9HB 1XZ0B 3HG2A 3T6VA 5B38G 4H13C 4YHNA 5EU6A 1TOXA 4H25B 4HJ1A 5CILL 4LCYA 2Y69B 1A9EB 3MCG1 2P24B 3CN2A 1JD9A 2F8IA 4JL2A 4AMKL 2EZ0C 4ZZKA 4JO8A 4X8CA 4ZTPH 2B4CH 3WDIA 1BMWA 2EUWA 4Z7VB 1RI8A 2NR6D 5HDBF 4G7QB 2WWMC 4JKMA 3VFPA 3V4UH 4MQ7A 1SRDA 4J3BA 1CDUA 1ROCA 1PZBA 2P8LB 5HHPA 5DJXB 5I0WA 1DFBL 2ETWA 2GJZA 5EV7A 3QPXH 5IMLA 3NMEA 3QUMH 4ZMQA 1FORL 5ID1A 2VXTL 5H37A 1FN4B 2VTFA 1UA6H 3MA9H 4OT1H 4JHWL 3ARFC 3DVNA 4GRMB 4NFBA 2X4UA 2ZAIA 4IGBA 4TUOA 1U8HA 1DZBA 5KVGE 3FU7A 3V5KB 4JR9L 3D0LA 1IQDA 3TCLA 1ZT1A 1RVFH 2MIZA 4MYWB 1FDLL 5I8KH 1SJXA 5JQHC 2F8XC 3WIIL 4NKIH 1KTRL 3WLBB 1OTUD 5ABAA 2AK4A 4I2XB 1FG9C 4KV5E 2OLDA 3CCHB 3RTQC 5BZDA 3QS2A 1RJCA 3HE6B 1JF6A 4NI3A 4P23D 4HUVA 4MSWA 2OMVB 4H40A 1UCBH 3CGTA 3FSAA 5CD5C 1CCZA 3ULUF 1FI8C 2AK4E 4Y4FB 4EUPB 5BPPA 1I1FB 3CFBA 3IM1A 2CRZA 4XN1A 3C2AL