1TR7A

Fimh adhesin receptor binding domain from uropathogenic e. coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
b'FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FimH protein
publication title Receptor binding studies disclose a novel class of high-affinity inhibitors of the Escherichia coli FimH adhesin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell adhesion
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1tr7A00
5CGBA 4AV0A 4AUJA 5FLUA 4CA4A 4X5PA 1N12A 5IQOA 4ATTA 4X5QA 4AVIA 5F2FA 4LOVA 4CSSA 3BFQG 5AALA 3ZL1A 4XODA 3MCYA 4XOEA 4AUYA 3ZPDA 2XG4B 5JQIB 4XOCA 4CSTA 4XOAA 2UY7B 5F3FA 4AV4A 3SQBB 4AUUA 2XG5B 4XO8A 1ZE3H 5AB1A 4AVHA 2J2ZB 5LNEA 1TR7A 4AVJA 2JMRA 5FX3A 5LNGA 2WMPB 5FWRA 3ZL2A 5IQNA 1KLFB 4XOBA 5FS5A 4X50A 2JTYA 4AV5A 1QUNB 4AVKA 4XO9A 3BWUF 4X5RA 3RFZA 4J3OG 5ABZA 3ME0B 1KIUB 4BUQA 4J3OH 5IQMA 3JWNG 3JWNE 4J3OF 1UWFA 1PDKB 5AAPA 3JWNH 2VCOA 2UY6B 1N0LB 2W07B 3BFWA
chains in the Genus database with same CATH superfamily
1DBJH 4X4YA 3C2AL 4UDUA 5K5YA 5TE7L 3NJIA 2ZUWA 2CO7B 1JMZA 5EWIH 2E47A 5TF1L 4RX4A 4I87A 1JPTL 4X5QA 3BGFB 3CN3A 2QSVA 1F90H 2FB4L 1ZTMA 1FI8C 1HI6A 4AM0A 1IFHH 3TLRA 4HK0B 4D0BA 2IADA 2WP3O 4V2BA 2B5IC 2JIXA 1SMOA 2VDMH 4Y89A 3PDOB 1G9NH 5MHSE 2UWEE 2Q2LA 4Q9QL 1KJ2H 5E1QA 1P5VB 2PW1B 3LKRB 3PGFL 1ZVYA 1MDTA 4QI3A 2Z1KA 4OZIA 4Z7UF 3LEYH 3P0YH 4LZKA 4UZGA 2Y22A 2CJ3A 3LXCA 2D4DA 5DJ8B 3UPRA 2X70B 4QRSA 2BO0A 1PIGA 5JPNA 2WQRA 3FO1A 4OM0H 5FO8A 4W1TA 3VXRA 3I75A 4JRYA 4WI3A 5DS8B 4K9JA 4HLEA 3S9DB 1MLCA 1J9QA 2X40A 2R56L 3PREA 3MGTA 4BCYA 4AIZA 2G60H 2N01B 5I6PA 2BJMH 2BSEA 2H2PC 3T0EE 1LK2B 4JJ5B 1FE8H 1KB9J 1Y6KR 1G7JB 3K72B 5E4IA 3WELA 3FAXA 3BIAX 1I3GH 2IO5A 4QIRA 4D9RD 1CFTB 1RURL 2P43B 2Q3AA 4WHDA 5F0JB 1U8CA 3EYQC 3ZYZA 2MCMA 3W37A 4UT6L 3CVHB 3FO9A 5ESAB 2H6OA 3WFZA 3O6LL 2EEFA 4C47A 1KEML 3PWVB 3KPRE 5T1KA 1G94A 4OCWH 1AXTH 4L3EA 1Y7VA 5I28A 2JKNA 4XO9A 5D6DA 1U0QA 5I0WA 1ASPA 4U3CA 5CGYD 4BJLA 5ECGA 4PEEA 5DD6B 5DJ6B 3WUZA 4DN4H 1NIDA 1MCDA 3E2HC 1T0PB 4M7ZC 3HPLB 2XQYA 1DVUA 1GGCH 4NUJA 4PJ8D 3VB8A 1TZOA 3NCXA 2ZCHL 1SY6A 3IDUA 1VGEH 5E6YA 1O7DE 4NZUH 5E4AA 5C0GB 1NGQL 3C6LB 2YC1B 5ETUA 1WV7T 2A0LD 4JFYB 2UZIH 5CP7A 1HH6B 4OJAA 4WI6A 3BP6B 4ZK8A 1ZVNA 5GZOA 4FZEL 1S7SA 4LVNC 1BWWA 5C92A 5KJRH 2YPVA 3NZSA 3SDAA 4UQ9A 5J6GA 3WS6C 4YLQT 4Y19D 3PIQA 2A6KB 5IMKA 1J5HA 3GLEA 5AW7B 1T1XA 3SE4C 2P7TB 3CXDL 3V9FA 4OQTH 1FPTL 3KPSD 5H2BB 3G6JA 4LASH 5HHNA 4F15B 2H1XA 3HR5B 4BK5A 4K5LA 5EU6E 3MA7A 5IW1A 4KRPD 5ENWB 1G6RA 1NGZB 5M94B 4JM2D 3QHZH 3WY4A 4H44C 3HC2A 4KVNH 3VU2A 4PJCE 1E3ZA 2JF1A 1S9YB 3QYNA 1P4BH 1P1VA 1D5RA 4ODWA 3ZQ9A 4DK6A 5DR5L 1WA1X 3OF6A 4Q6IA 2YPLE 3EBIA 4JANB 3F5WA 4GYBA 4J3OD 1ZLUK 1T2JA 3CN2A 4F27A 2D03L 3SGJC 4GW5B 4G43A 2J5LC 4BFKA 3Q5OA 5JORB 3MRPA 4M6NH 3AT0A 1B0GB 1IAKA 4JFEE 3DX7B 1V3LA 3M45A 3ZDXF 3GHEL 3PNRB 5EC1B 5D1ZI 1U3YA 2WQSA 4QF1A 1I3RB 2YLHA 4AG4L 3RGHA 2X05A 3K2KA 1KWKA 1IBYA 4WENB 2X2UA 3TV8A 1NSNH 5JW5A 5FX3A 3HE7D 4EI5A 5E23A 3ZHDA 3T4AC 3BQVA 4XPHL 3I6KB 4GMTL 1JGEA 2R23A 3DO3A 3OPUA 4RGOH 5GRVK 4XPGL 1MRDH 3WJMB 3HC0A 1DJHA 4MASA 5BRPA 4OJYA 1JHTA 2PPCA 3N1FC 3QDJA 3TOPA 4ES8A 3VFNA 2WB1A 2Y7OA 4RWYH 3BT2L 5CEZL 3V52L 3WI9A 4NZDA 3D85D 3LB6D 1NKGA 4NUGH 2C3WA 1JZ2A 1UHVA 4JQIH 3BOVA 3STZA 1RUKL 1CICC 5K39B 5IV2B 1ID5I 1NDMB 2NX5E 4BRVA 1P4LB 1WBXB 3CHXA 4UQIM 3DVIA 2ATKB 3UMTA 2Q7YA 1FV1B 3MRGA 4TM9A 1FF5A 1FFPA 3DC0A 4MJID 1NAMA 4OGQC 4P3CH 2XICA 3BPOB 3QUZD 1BOYA 3GYRA 3OB0H 3DBXA 4MB5A 4NC1C 3W9EB 2FO4A 4BXVA 4OQ1A 4PLOB 4F33B 3Q6FA 4XHQA 2V9RA 3MMEA 1BLNB 4WFED 4N2FA 4YDVA 2ZWZA 4HUMB 5ABDE 4H5SA 4DVRH 3C60A 2DM2A 4UINH 4JQVA 5F7DB 1BHGA 3K2MC 2EKSA 3MRKB 3VGAC 3QJFB 5T1DH 2X4RB 4WW2B 5CZVH 4PTUA 5TE6L 2CIIA 1I9JH 2DM4A 1IEBB 5DJAA 4DOHE 4P23A 2LR4A 1M6OA 1I9EA 4AYMC 5I66A 5C09E 2Y2WA 1OB0A 3LH2L 2CRIA 3SE8H 5KANI 5AZEH 2DD8H 3BFQG 3WKML 2ITCA 4ZMNA 1KT2A 5JOEA 3FOLB 4KX9A 4KXZH 3ARBD 2R9HD 2Y6SC 1BAFH 4PJIB 3MNMA 2GY5A 4RAVA 3OMIB 2JNZA 2GTZB 3BKML 2GIXA 5JW3L 1TPXC 1R3KA 4LF3B 5FGCE 1PS3A 4JFOB 4K2UL 5LN8A 4XBEH 4EI0A 2Y5TB 3MRMA 4PW3A 3EXJA 3B9KD 4H25B 1IE5A 2PCYA 5FM8A 4KC3B 3WFDL 4UIMA 1IGML 4HUWB 1QPPA 2GC4C 2QQKH 1YLBB 4P2RD 1U8HA 5JMOC 1NLBL 2ALWA 4DIXA 1B4LA 1DSFH 4BELD 2E86A 5IQ9A 3KJ6H 4I9WD 2DLFL 3C2SA 1MW0A 5IVZA 3NJFA 3U7WL 1YUHB 3DWTA 3LNHA 4LSQH 1F4WH 1HYSD 2BDNH 1BBDL 4U1IB 4HBCL 1X9LA 5SWQB 5KSAB 1HCZA 4EN2A 4O4YL 3N42F 4B9CA 5INDA 2EDFA 2WUBH 4LRNH 2NY0D 3KPSB 4KFZC 2DLTA 5FWQA 4EQ3A 4OCXH 4FFZA 4HOWA 3BLKA 3QI9C 4YC2C 4A2GA 4R84A 4Y0GA 4H0IA 2E4TA 5I17A 2H8PB 4LSUL 1W0WB 4DAGL 4JM2B 5AAWC 1EDYA 1MFUA 2X7LA 1QUNB 3F01A 3DX9B 5H4ZA 3WBDA 3L3KB 2JKTM 4QDGA 1A7RH 3ZKXB 3BN3B 4NSKA 2F8IA 2ZD0A 2YOCA 3QB7C 1ZD6A 4PMEA 4FNRA 4K94H 4F9PA 4Q9BA 3ATEA 4WFFE 1NANI 1ZJBA 1R5VB 4DN3L 2JCCF 4TQEL 3FU0A 1FJ1B 1TMQA 3PWJB 3OB0K 3RWDB 1V7ML 4NCC1 1S78C 4RISL 3B37A 1XGZA 5TE7H 2IGFH 3UBGA 4WWPA 5I6KA 2BY3A 1ET5A 5K9KB 1M71B 4FYRA 4YHYC 5FYJL 1TEFA 1JPTH 3H8NA 4ZFOB 3CTTA 5CLZA 2HKAA 5ID0B 1TQBB 1E28B 3F7RA 4ODTL 2CBMA 5HDBF 3ULVC 4ZT1A 1FFOB 2XPZA 3HE7B 3NZUA 5C0CE 3VYPA 4JFQA 2OXGB 2EDNA 2KZWA 2ZUUA 4Q9QH 3ULVF 3RDTD 2RHEA 1JGVL 4LEXL 1UOVA 4O58H 4ZFFB 3N85H 1ZRUA 35C8L 5HHPA 5D96C 3FT2B 1YEKL 1FZJB 3T3PE 5KYUB 1FLTX 5F9WC 5E8DL 4XI5D 3GZPA 3HZVB 2VW7A 4X9HA 3ERXA 3TO4A 2XFXB 1E8WA 4PG9B 1RZQA 3T6XA 3ZTJG 3MRDB 3PU7A 4RMUA 1U2CA 1A6ZA 4XCCH 5E95B 2UXTA 2F5AH 2F18A 3Q6GH 5IVNA 4ELDA 1NBZA 4G7YL 1OK8A 4XE0A 4N8VG 4PJEA 2NPLX 1OM3L 5E6IA 3MBEC 1LEIB 4KNQA 2VL5A 1UM4H 4QWWC 3QUZB 3R1GL 1BZ9A 2WOYA 4LCWD 4M93B 5I1EH 3D07A 3IDXL 1RURH 2CR6A 3JUZA 4JJHA 4PJ7A 4U33A 1SOQA 5GGRA 1QSED 1ZIBA 4PCYA 5AENA 1NMAL 3K0YA 4GP8B 1BJ8A 2O6PA 4MA1B 3F6LA 1A1MA 3LSOB 4ZNCD 1J9TA 2JI3A 2Q8BL 3ILEA 3PNWA 1QLEH 2VDKL 2YUWA 3GSRA 3U0TA 1JF1A 2WZPD 2MH4A 4OJEH 3MRQB 3NIFE 4KKLC 1MXGA 3GRBA 1BEYL 1JWSA 2ZONA 1PY4A 1H15A 3KCPA 4RSYA 4RGMC 4HCFA 2V17L 4YXLL 1DJZA 5F96H 2O72A 2EEDA 3OAUH 2YLKA 1S7TA 1YEGH 2C9PA 3DSFL 2HRHA 1E27B 5ECJE 2H0PA 4KVPA 3PP3K 5HJBA 1WP6A 4UT6A 3SDYH 4PJDA 1U8IA 4PY7B 4ZMAT 4F2MB 4KO5A 3QQ3A 5EPMB 4H1LB 3ARBB 1MFEH 2AEPL 3AU1B 2QSCH 3N50A 1KZQA 2HFFB 3PWPB 1FH5H 1PFCA 3IDIB 4FZEH 4ZDHB 1U92A 1F0LA 2DKMA 4TPRH 4AGLA 4LEOA 2VUOA 2P5WD 4IIQC 1EWHA 3UTTE 3SDCD 3PPEA 5KW9H 2D7QA 4UB0L 4XMZA 2BSCA 2XN9A 3BKJL 3ZKMD 2D73A 3AY4A 3L95B 1NFIB 4MD0B 1Q0EA 3DA0A 2QPFA 2YWYA 1FPTH 4P2RB 4IOIB 5B8CB 3V95A 4XMWA 3BPNC 4AJ0A 4BE6A 4L9LC 1VRSA 5FGRA 1HCVA 3ALXA 4LARL 3ARDA 3M46A 1Y18B 1FL5A 4U1LB 1JVOA 4YHOH 1U3JA 1AC0A 4PW9A 1JS4A 4NAMA 2A73B 2CHXA 4BSWB 2X1QA 3D0VB 3ZTNH 1UURA 2O1AA 4PJXF 4L4JA 1KBGL 4JO2L 5H8DA 3GSWB 1A4CA 1N59A 3IXAA 3I74A 2F53B 5DEGA 3F58L 1KY6A 2OTWA 3GIVA 5D1QB 4NJAL 4Q7DA 1BVLA 4N68A 1HL5A 4OFPA 2CSPA 4JE0A 3QEUA 3X13B 5C0JB 2QJDA 1BJ1J 5EO1B 5AW0B 1OV8A 4YHIB 1Q1JL 3U0PB 1V05A 4LNRA 4YPJA 3O2DL 1I75A 5L4MA 1DVFC 1G9MC 1P7KA 3S3JA 4OJFL 4GMTH 2UZYA 4L1HA 5BV7C 1O9WA 3IF1A 1T1YA 5IF0A 5IJBC 4OIBA 4AT6B 5ICZB 3JWDH 2GBAA 1RUAH 1BEXA 4OJDH 2DMHA 4HEPG 2XKNA 2NQ3A 5EIIB 2ZX8A 5EO0B 3UP6A 2X89D 4PV8B 4BZ2H 5E7BA 4L8DA 1CXFA 1NEUA 5JMRA 1D2PA 3BT2H 3PABA 4F8TA 5A6IA 3V79C 1EVUA 2VISA 5IIEA 1H3UA 3QQDB 3ASWA 1OZTG 3N3EA 3RDTB 3GMOB 3RE0A 2VRQA 5AYUH 2WQAA 1DUZB 3EHBC 3PHAA 5TQ2L 4PS4H 4H8UA 2MQ0A 5C86A 1T4KB 1UUNA 5SX4H 3K6SA 5DVLA 3F12A 3IDMA 4D3CH 4F2EA 1FNHA 3WFHB 4F80A 1JD7A 1F18A 2PO6D 3BVNA 2ZKHH 2JQMA 3ES6B 4NPYB 2OSLA 3OAYH 4KFMA 4OLWL 2G3MA 3IT8D 5KEZA 5JDJA 4KTEL 3OKKB 3QDMD 2W0FA 2W1NA 3I9PA 4PW4A 5D70L 3L7FA 1KFGA 2OQJA 1AJ7L 2OS7A 3L3OB 3V4VH 3VD0A 4WDIA 1P69B 3MN8A 2XWBB 4LCWB 1XSOA 3NACL 4LFHG 3H0TB 4RGND 1ZT4A 3GGWB 1PLBA 4E41A 1O9VA 1SEBB 3BZ4A 1ED3A 3P02A 1QSEB 4PRPB 5FF6B 3GD1C 4L4VA 3IVKB 3KWTA 1JPGB 3M6DA 4F3FB 2KLSA 4XBPB 3LH2H 1EAOA 4NO0A 5E9AA 2WNGA 4YEEA 4QHKI 1HU8A 5HI5D 2BW5A 2DJ4A 4GQ9L 4KXCA 4FQCH 2Z8VC 3ROOA 3MRJA 4LLUB 2PP9A 1RIUL 2IOOA 4L2LA 4Y5VB 2PNDA 2YRPA 4J2QA 1U3HD 5AW2B 3BKMH 4RRPG 3S2AA 4AYSA 4YSUA 4U0RC 1UTDA 2JELL 4ABQA 2VR8A 3EO0A 4PRAB 2R2EA 2C3VA 2PUQT 2QVIA 4M5YL 1NC4D 3EO1B 4NKOB 5B4MC 4BQ9A 1RI8A 3KPNB 2YS4A 1FFNB 2IAMD 4M9PA 1A65A 4ZJ9A 2P5WB 4IRZL 3SDCB 3BQUC 3T4YB 3SB3A 1ORSA 2WWNA 3CPLB 3MKKA 1F6AA 4XPAH 4QKXB 3S7GA 3LD8C 3WHXB 5HYJD 2QDWA 1ZT1B 5DWUH 5A2IH 3REWB 4HJJL 5J11B 5I8OL 3W81A 4KWUA 5BRZA 1JF5A 3VAEA 2A99A 1DQDL 2ZSWA 1NPNA 2RTTA 2UV3A 3DVNB 4XMXA 5JYLA 1MIMH 2X6VA 2BSSA 1I8AA 1LNUB 1D5BB 4KO7A 2WYIA 2Z31D 3OGCB 1MCLA 3Q2VA 4ZX5A 3HG1E 2BY0A 1P53A 3WSQL 5LQBH 1P9MA 1NDGB 1GYAA 4HXAH 4XTRD 1U8KB 3GHBL 3ZT7A 1YY9D 4KHXL 5HGDA 3QYMA 3MRHA 5JR1L 3OAYK 4N87A 2H0FA 1RZIB 5LGHH 1YMMA 2FCBA 1U30A 2F08A 1LO4H 3GSUA 1OGAA 5GSRA 3CDZA 2XJKA 4ICXA 4GUPB 1HH9A 2OP4L 2ADGB 3M8OH 3Q2WA 1VKXA 3A21A 5D7LD 1XMWA 3P30L 3EBGA 5E70A 3W2DH 1N6QH 5IM7A 4W68A 2O61B 1YAZA 5FYLL 4W9DC 4CVXB 3SE3A 3EGSA 1YNLH 4LRIA 4TSAH 4X7DC 5EA0H 5TPWH 3V7AE 1K4DA 4AEIL 3TNNA 4MMZC 3LX9A 3OR7B 3FQWA 5BRQA 4LBEB 3DRQB 4LGSB 5EN2A 4LEXH 2WWMD 5EC2A 1OSZA 2ZYIA 4WO4B 2B77A 1E5BA 1P6FA 1YEKH 2VLLA 2XVKA 1HCFX 4HCIA 1U93A 5F93C 2VN4A 2KZBA 4GT7A 3P4MA 1EZLA 1BFVH 4LXFA 2FHCA 1DQQA 4Z0XA 4CRPA 1RUPH 4I0PD 3SPIA 4ENED 1QZNA 2F7OA 4PR5A 5IHZB 5DJDB 4EVNA 1NEZG 4F7CA 4ECNA 4M61B 1PY9A 4LLWB 1KCKA 4EUPB 5D7IB 5IESL 2Y2TA 4ZW7A 3CLFL 3KPTA 3VW3H 5AW5B 5I6LA 3FFDA 1XL6A 1I8UA 2FJFB 1GOFA 4G8FA 3MNZB 1JV5A 1WZKA 2NY1C 3O45B 2PLTA 2PO6B 5L2JB 4PJAB 3MO1A 4DGIH 2DWEA 3LYRA 3FHEA 2K9FB 3U30B 2V7NB 1JE6A 3AQYA 1NMAH 4XRCB 3K7UA 4YOKA 4AYEC 4UNVA 1MHPH 1SN2A 1EZVY 3DV6B 3WEBA 3TJPA 1J0YA 4FQXA 1X5AA 5BRZB 2CA3A 4PLNC 2ZNXA 3T0XA 1T0NB 4TUOA 2DTML 1KENL 1TETL 3QEHB 2VYRE 4P06A 4WNQB 5DO8A 2ZG1A 4RGNB 3OHXC 4LLVB 3ULAB 4JRXE 4OLEA 3QXTA 4WI0A 4U1HA 3OBAA 1IGCH 5CSZB 3HS0B 2CXKA 4YXLH 4P9HC 2DWYA 4Z3JA 3QZPA 4RFOH 1FNEB 3P11H 4E2OA 2EDWA 3P9WB 3ZMNA 2O26U 3VMPA 3KPLA 3QARA 1F4YH 1MCRA 2DRUA 1T66C 5FAAA 4RMSA 4X99A 2VO5A 3FCTA 1HOCB 2AEPH 2TSAA 2RQ8A 5L4IA 2R2BB 2V2WB 2PW2B 5HI4D 2GEEA 4U31A 1CCZA 1D6EB 3CSYA 5KVDH 3QJXA 4R4BA 3WUWA 5KVEL 4Y8DC 4D94A 1S3KL 4Q74A 3GO1H 3TCXA 5F3HA 3FF7A 1RJLB 3GTTA 4N0FB 1QSZA 1YEDB 1NC4B 2Z92B 1KXVA 4NQDD 1KXTB 5JQ6H 3UYPB 4KZDH 2YZ1A 4WTZA 5HPOA 3T1WA 5GISL 4L8BA 4X5XB 3LIZH 3NIGF 3ZRFC 5FK9A 2GT9A 1Z9LA 1J8RA 2ZYSA 5C2UB 4LARH 2FYYB 2NY6D 3B2XA 2AVFA 2D7NA 3B7SA 3WLWC 4OFYD 1FLRH 1OE3A 2JB5H 4M7LT 4ZW6A 3SDXA 1NKRA 2AAAA 3UERA 4K9EH 3ZE2F 2OR9L 3N91A 2ZWYA 1Q9WB 2J1XA 2Y1ZA 3JXAA 5KS9A 4S1DD 4WI2A 1E6OH 3QHFH 1V3JA 3SO3B 4X5WB 2GW5A 2OMVB 5E8NB 2WB7A 3BVXA 2W07B 1WS7A 4AENA 2NY7H 3F58H 3A4EA 5JPNC 3RAJL 4OZIF 4FNQA 4FLOA 3NABH 3MJGX 3FTVA 3VXQB 1F13A 3BRDA 1QZ1A 3ABMB 4WUUD 3IDYB 2X4QB 3VNZA 4PCKA 3ZDZF 1SN5A 2BSBA 2CR0A 5DRNB 1G7MB 2HRLA 4H2CA 2GSIB 3QE5A 4LLMB 1A4JA 3SY0A 4AGOA 3BO8B 4PLJC 1G9NC 1T22A 4IMLA 3FYEB 3M07A 3QRBA 4XNYL 1QR1B 4PWIA 3TTSA 1DQMH 4MDIA 3VQ2C 5I8EA 2E6JA 5HY9A 3GHPA 1NCBL 3L3DA 1RV6X 1OQXA 2Y69B 3ESVF 4J6IA 5D7LB 4WCYL 3MNWB 4FOMA 4DFIA 3WL9A 1ZT7A 2EXTA 4N8VB 3QK0A 3FONA 1QWHA 4UQCA 3WKPA 1A6PA 1IILE 2G9KA 3IAPA 6PAZA 3WIFB 3PHQA 5LVEA 1EJ6A 3LTVA 3SE6A 1MELA 3I3BA 2H32A 3BWAB 4LFHD 2AABH 5D6DC 2V8MA 3O2DA 5GS0D 1PY0A 4TVUA 2MJWA 1GCFA 4PWFA 5T5NG 4HPYH 5CKAA 5I0XA 1N68A 4LVHC 3DUSB 5FEBA 4IYKA 4NOBA 1M57B 1S46A 1H8LA 1UZ6F 5DJZA 1AS7A 1U42A 4I0PB 2C9UA 1T5KA 3VFTB 4EEEA 1SMDA 5DD0H 4P46C 3LN4A 3FSOA 1BAGA 5C0DA 2A9AA 3D34A 2HKFL 4MFHA 1EIBA 4YHPB 3MRFB 4GAAA 1KB5L 1NBYB 1RZ8A 3E8UH 1HSBB 2IDTA 1INQB 4DGWC 3TESA 4ZOEA 2WQ8A 4WY7H 4C83B 5I18L 2DDQL 3UCRA 2MCAA 3NACH 5D72H 4Y4HA 3BAJA 4KROC 2QKIA 1ET7A 4N85A 5AG8A 4N2MA 4JGMA 1B4JL 1L9RA 4K07A 1WSST 2Z91A 5T3ZD 4YS4A 1HINL 3KYNA 4NOFA 2OMUA 3P40A 2CLRB 3BW9B 4N5ED 5AW8B 4JPWL 4FG0A 3IB4A 3MLYH 4Y5YB 1FNGA 5IB1A 2G2RB 3FU7B 3PGCA 1DEEA 2CRYA 3AS1A 1RHHA 1YC8A 4ELMA 2ZUQB 3ZDYF 1QG3A 4G7RB 1SUJA 3OJDB 3V5KB 4IBVA 5MEPA 1Z5LB 1OGPA 3B9VA 2XZQL 3NYKA 5JPMA 3G6JF 4HLJA 4Z77B 1H6FA 5JNYB 5BVJA 5I6OA 1S7RA 2ZP0T 1CXKA 2DQIH 2G5RA 5DA4A 2EACA 3H7BB 3OG6B 4L8SA 4ZMLA 5FA3A 5J06A 4IRJD 5BQ7B 1YY8B 2X28A 5ICYB 4BV1A 3EGXA 2EECA 4NHUA 4HMEA 1UXSA 1E0OB 1RP8A 2DY2A 3C5ZC 4GW4B 3VFWB 3RNQA 5K9JL 1J8HD 4NKQB 2B1AL 4Z76A 2ZNWA 3IMBA 2XY2A 2WGNB 4ZXBD 1I7UB 4DGYH 1EAPB 2DJSA 2NLJB 3B2UC 3AQZA 1WC7A 4IGBD 1V7NH 4WQOA 2B3IA 1G4RA 2GJPA 3C08H 4R7LA 4XCFL 2MQGA 1KTBA 3SYCA 4OD3L 3FU3A 5CJ5A 5F7FA 3MLWL 3OZ9L 1GJWA 3RWCA 1RVFH 3PYCA 4GKZB 3DHMA 1BFOB 4NQDB 2FECL 5GSVB 3GEFA 1XF4A 2GUYA 3WTWA 4LSSL 2HN7A 2E59A 4P2YA 5DHYB 4RMBA 2XZCL 1ND0B 4LPYA 4W9EC 2A6DA 3UJJH 4KUCD 2XQBL 4ELKB 1L4IA 3LNFA 2NY6B 2IOIA 3N40P 5DRZA 3RP1A 4B9FA 4AV4A 3SY6A 3D69B 2PMZA 3F7LA 5GJSL 1RK1B 2AJ3B 4M02A 2NNCA 1C7TA 3AUVA 4OD1L 5CD3A 4G83A 2ZCLL 2YD6A 4IRZA 3WG7B 3UTOA 1HNFA 2WKOA 5DUJA 1IGJA 5INCA 3T65B 5ES4B 3GHBH 2XIBA 3UROR 2Z4TA 5DSCB 4M1CD 5I8KH 2LFEA 1J5OL 1G0DA 1MHCB 1KLUA 4M6OH 4KKPA 1J12A 1ZVSB 1EEZA 1MUJB 1N26A 3PWUB 3HEIB 4F92B 2OP4H 1ETB1 4XMKL 3WOVA 2B16A 4XMUA 2ZUSA 3HC4L 4QTHA 4TXVB 4WUUB 4Y2NA 4APXB 1ITCA 5BO0D 4YH6A 4K8RL 1PTZA 4OGAC 1IC4L 4XPFH 1Z5YD 4BUHA 3QZMA 4M3HA 1BJMA 3FSWA 4AEIH 1A0QH 2ICEB 2CIKA 3QWRA 4XMPL 1KYUA 5D2NA 1VZGA 2WK2A 1BXAA 4X7SL 3W39B 1IE4A 3QJZA 3KJ4C 2VE6B 3P1VA 1R46A 4O51B 1TMCB 2BOLA 1FRGH 3IMWA 3CZFB 2ED8A 3HE6A 3STLB 3EF4A 4P23C 4DTGH 3OMZA 2CMRH 4P5KB 4R8WH 1Q90A 3PHOB 2ZWNA 3L1OL 1JK8B 2YQBA 1B3JA 2W95A 1AZZC 2X6AA 5HXMA 3MROB 3DETC 4AMWA 5CJXA 3WXWL 4WTXA 3L6FB 1QBMH 4KVCH 4N90E 1CMOA 2YGQA 3NQKA 4CBZA 4DUXA 2X5PA 2BWIA 2MKWA 1JGIA 1CS6A 1QLFA 1YN7A 5D1XE 3P0VH 2AQTA 5FM5O 4I2XB 5IBLD 2QKSA 2QVFB 3NEOA 5I16B 1N0LB 1BXXA 3U2JA 5DK2A 5FYKL 2NXYC 3BFWA 1DSWA 4DP9X 2WC7A 5JXAL 3D25B 4ETQB 5C0NC 4F9LA 2P9RA 1DHKA 5DO2D 2PTVA 4HUVA 3V0JA 4JZJB 4UDTB 4J3UA 2XWJB 1CLZH 1JERA 1H5BB 15C8L 5DHMC 5ICUA 4IOFD 2YD9A 1EHAA 3IGUA 4Q0XL 4WEBL 1HL8A 5IKCB 4LHJB 2VM3A 4IS6B 1IM3A 2BS8A 3VFMB 2N56A 4GBXD 3MXVL 5J0BA 4UM8B 1L3NA 1F4XL 3D39D 5IOKA 3H9SA 2KC0A 1XF2B 1UQSA 5KVDE 3P54A 1O9ZA 5CIPA 4GG8B 1RCYA 5D1ZA 1RPKA 5E6UB 2PCXA 3RPKA 4DKEL 3NCBB 4UANA 2ZG2A 4XP5H 5B1BB 1JZDC 4X98A 1NCOA 3QI9B 4X6EA 1W72H 4PJHA 4NBZB 4JFFE 7PCYA 4GXFA 2APTA 4U1SB 3UTSD 4CGUB 4QTIL 3ZIYA 4F9PC 3MU3A 4J3VA 1RZKH 5E2UL 1KIRA 5B22A 5GZNA 5J1TC 4UILH 4AVJA 4YDKL 1K8IB 4IRJB 1HEJC 1WIPA 4C4UA 1VZHA 2VR5A 4J8RB 4TTGA 5HSFA 5I1KL 2VJ8A 1MW3A 5J1AB 4YWGL 3KS0J 1J8HB 2YXFA 3PAVA 4OZGA 4ZXBB 3BH9A 4KI5F 1D5ZB 4IGBB 4G59C 4PGDB 1XD0A 1AQMA 1GZHA 3Q5TA 1ZDQA 4OVUA 2D2OA 1AD0A 3ALWA 3NEEA 3II3A 3IXTB 3OKOB 1J1XL 3OVUB 5T3XD 3T8MA 1T80A 2X0UA 3L3JB 2HJKB 4MMYA 3VMOA 3RY4A 3LQAH 1BMZA 3D2UA 1PLAA 1Z9OA 3NJVA 5MHSD 1AKJA 3GSNL 5J6SA 2DB8A 5A3IC 4Y1SA 3RVWC 3T6ZA 1Y1UA 2EEBA 2ITEA 3SKNA 4B9GA 1BXVA 3FRUB 2F61A 1OARH 4XH2B 4BH8B 1MREL 4QXGL 1KG0A 5EU4B 3FTWA 4MKMA 5TF0A 2RH0A 1BMGA 3RAJH 3TO4C 4GI6A 3TPUB 5E2VL 3VSUA 4ACTA 3ZUCA 3JYCA 4L5FE 4TOYH 1RZ7L 1C1EL 3I6LE 5IOPB 4NERA 1G5AA 3E6FA 3FMGH 2CCVA 4PP1D 3G5VA 3MLTA 2UYLB 2AP2A 2CK2A 4EAEA 3CZEA 5DFAA 3AWGA 3U9PL 1PDKB 1YRKA 3O9WD 3TNMB 2DLHA 3ZT5A 5HGAB 1PPIA 4X4ME 3VXMA 4QHNB 4XNYH 5E6IC 3T0ED 1HESA 5AZ2L 1XF3B 4JKKA 2IXQA 5KBDA 3FZUC 1L9NA 4PJEF 4DW2L 1TTUA 3QJOA 4ENZA 1OEZW 4P4KA 4ATTA 4OJCA 2HJFA 4TSBL 2M83A 3BI9X 4ZUTA 4AQZA 4MD4B 3ULUL 1JI2A 1SN0A 5LCVH 4K7PX 4KDWA 2HPTA 5GQBA 1MFVA 4PJ7F 2AJXL 3EH1A 4XCEB 1EANA 3RIKA 1V55B 3TV3L 2VDPB 3KPRD 3CUPB 1UKSA 1BGXL 3N43B 3GB7A 3KH4A 4JDVA 5CZXC 1DO5A 3V5HB 3U1QA 1IL1A 3AAZA 2WTRB 4Z7WA 4NQTA 5CU5A 5KVFH 5M95B 1NGXA 5F8RC 3CFJB 1JBJA 3SBQA 5LXGH 5J8OA 3MLXH 1BF8A 4JM4L 1WHPA 4PJGB 1G43A 3QISA 3WENA 1N7MH 2HRPH 1YPZA 2HKFH 1L9MA 5F1OB 5IFHH 1OAYL 5FO7A 5D7HA 2XYBA 4BKLA 1KN4L 5GGQH 3L4TA 4J27A 4APQD 4ZYKA 2VR9A 4PJDF 5I18H 4PJFA 3VE0A 3DSNB 1JD9A 3U4AA 2ZT9C 1Q94B 2Z7WA 2IVFC 4X7TB 3HG3A 4XCNB 3G04B 4NO3B 2GUOB 5I1DA 1XBRA 4IIQB 2EICA 2NW3A 3AY4C 1HINH 1A4KB 3Q06A 3MRLB 3NCYS 1FORL 2B1HH 5B1JC 2XWTB 2Y07L 1MPAH 2ZX9A 1RJZA 5K69A 1FZOB 4MVBC 2X87A 5EU6D 1SYVA 1KB5A 3N5AA 2XZQH 4FABH 4GBXB 3TU6A 1EEYB 3RKDD 4S1QL 2H26B 4WSJA 4J28A 5IQLA 3LN5B 3AG1B 3D39B 4P3DA 3FUJA 1F42A 5JHBA 1R33A 4BH7A 2ENYA 1V54B 4HETA 1FYTE 1HXMB 5ELIA 5FDWA 4ADJA 1K72A 5DD5L 4TMPA 3UO1H 4IU3A 2AXFB 3FCGA 2YN3A 5K9JH 3H2WA 2B1AH 2WQUA 1NMCC 5I1AA 4R7DB 1BPVA 3UTSB 5IMLA 2OJEB 3CVHL 5CU9A 1BCIA 4AEHL 1WA2X 4HHWA 4BSVB 2WZ0A 4UQ3A 4JFED 4O2EA 2N1KA 4UNTA 5J9PB 3KW7A 4K7FB 5TQ0H 2K8MA 2VLRE 2UZPA 1NICA 5CLWA 5DZAA 5HHVL 3VA2C 4EZJA 2COVD 3ZHNA 3WEOA 5JQHC 1XGQB 1RPQA 4YDLC 4UUJA 3CFTA 4WHTA 5KG9B 1HWWA 4D9QE 4RZCB 4XAWH 1ZHNA 4PN6A 2DQFA 2NT0A 3ECVA 4YPGB 3RTQD 5HDRA 2YRBA 5IT2H 3G5XA 5L2KE 3BSZL 1RY7B 4PWGA 4QEGA 4E68A 4UOZA 5I6NA 3K74B 2DWXA 2J88L 3B5HA 3I6GB 3OXRA 4XVSL 3ZL1A 3D18A 4PI0A 5EFIA 2VDQH 3VNYA 5B39B 2DQCL 1K8DA 4F57L 2E0PA 1QHQA 2WAHA 4ODSL 4KTGA 5DJXA 1HTYA 2V2TA 5DMYA 3P4OA 3NAAH 4J7RA 4MCMA 1TZHB 4XN9A 1ETJA 2NX5D 3TIDA 4AL8H 4BZ1L 5KSBA 5EBMB 2VZOA 5ALCH 1D5IL 1MF2L 2Y4SA 2SEBA 3GXMA 2Z7UA 2A74C 3GBDA 3EJZC 4KY1H 3GJFH 3FN9A 3G3LA 3BN9D 3BT0A 3QQXA 1DBBH 4H88H 4AVHA 2J55A 3RILA 4K8RH 4QRRA 4HKZB 4EE2A 2ZAHA 3D3VE 4FX5A 1EUTA 4B3VA 4FFVC 4PRHA 1SHSA 4LHUA 1M1SA 4X8JA 1OB1A 4FKHA 1I9RL 2VLKA 5KYWA 3T0EB 4DQOL 3VI4A 1E9QB 4X7SH 3N0AA 4X7EC 3JTBA 1X9RA 2YR3A 1P7HL 1CI3M 4YDJB 4QUOA 3RBGA 1RUMH 1ICTA 1N18A 1AGFA 2P1YA 5E9NA 1PAMA 4B3EA 1EZUA 2X2JA 3KHQA 3VFRA 5IGXL 5C09D 3AG3B 4I3SH 3WXWH 3KWXA 3ZVVA 3CSTA 3KPRB 4MA7H 1NCIA 5E4EB 2DM3A 2Y23A 3N1QC 5AOJA 3UJIL 5ITFA 4V1DA 2XUWA 2O5YH 3O4LE 3IKCA 2OZ4L 3PUUA 3RFZA 2WKGA 4HFUL 4P9ML 4P59L 5K59F 3DO4A 1UWXK 5DK3A 1WBZB 3EDDA 4FTDA 3WTTA 4AXWA 2XPYA 1JFQL 2ZWKA 4U0RB 3F7VA 1SBBA 3MRCB 3O81A 1IKNA 5D8JL 3QYCA 4MNQD 2FO8A 1SOSA 2JI1A 1NCNA 2P42B 3BXNA 4M7KL 4APQB 5I1CH 5E9DA 4MNGE 4JPIB 3B83A 1MG2C 1UATA 5CUSL 1RSFA 4YHZL 3FRPA 3MXVH 1DDTA 3KDMA 1IAIL 3QJSB 1AQDA 2HWZH 3MFFB 1RHFA 3DHJA 2YEZB 4HIEB 1R4XA 1BVKA 5CINL 4B9IA 3LD8B 4WI4A 3RVTC 4OGYL 4DKEH 3AS2A 3TBTB 5D9SA 3CLEH 2X44D 3BP5B 4M43H 4Q4EA 1FN4B 1GAFL 3K5SA 5IBTL 3SQOH 1ZHKA 2DI8A 3S4SA 5IVOA 1J5IA 4X6DA 5EZJB 4NP4L 1OHQA 1KPUB 5IWLA 3O2WH 4HIHB 4PJCB 1DQKA 4LCYA 5BO1L 5JQIB 1P9MC 2F15A 3OB8A 5IG7B 4DGVL 1J10A 1QFOA 1AXSA 1TTFA 2AITA 3GJFK 1GMEA 2HG5A 2JB6B 4WFFD 5FYJU 3GLZA 2RQEA 5A16A 2BVQA 4OCRH 1GGBH 3VCLA 1CBJA 1CLVA 2MMXA 4ZX4A 1IC0A 3LOWA 4HWEL 4Y2OB 5H37A 2NYYC 3BAXA 4JFEB 4YZFF 1WUZA 1EHKB 2J2ZB 2J8HA 3K46A 4NQEA 4ADGA 4N25A 3VXSA 4AJVA 4JY4B 2NY5L 5SWZE 1J1XH 2VDOH 3NK3A 5GXBB 5K9QI 3W1ZA 4LRIC 4XNAA 1L0PA 1XXFC 3AG4B 3M17A 5C0CD 2ICWB 2VM9A 4LDEB 4YN3A 1NEPA 4CAGA 1E9PB 4DZ8B 4M62L 3QULB 1JXGA 3EJPA 3HG4A 2V7HA 2X6BA 3RTQB 2GBUA 1F97A 1TQCC 2EDKA 3INUH 4HKXB 4OT1L 5D7JD 4OLXL 4YX2H 4ZSOE 5EOCJ 1DL7L 5E2VH 4S11A 3OPZH 1P7BA 2PP8A 2FQFA 2IAAC 4HQQL 3F00A 1BQLL 1W8OA 3BGMA 3MBWB 1ZXQA 3VYOA 4Z78B 3A0OA 2AJUL 4UZUA 2GI7A 3HRPA 1ZHLA 2F19H 2LABA 3U9PH 4X6FA 3QPXH 5FKPA 3MUZ1 2NX5B 5KJ4A 3U9UA 1PG7X 5FW6A 3VWJD 5FO2A 1MJUL 2BSTB 4K3EL 3V7AG 4ODHH 3GSNA 1QTYT 1JRHL 4UOJA 4LT7A 3U4EB 1MWAL 2FIKB 2DICA 5DQJA 1NC2B 1QABA 1WA0X 2R1WB 1NM4A 1I7TB 4JAMB 2OXHA 4G1EB 1QRKA 1YEFL 3MTXA 1CZ8L 4LVOB 4F58L 4M8QA 4R9HA 4S0HA 4UNUA 2BIQA 2FBOJ 3ZIMA 4FQXC 2Y6TE 1P84J 1WT5A 2AJZB 1KJMB 4W9KC 2W0LA 1HAUA 4S1SH 1AI1L 3TT3H 1KEGH 4PGJA 4KKAD 4Y7OC 4RNRB 4OFQA 5GRYA 3O0RH 1IFGA 3POCA 5TJWK 3SKJL 3E6HB 2YPKB 3AREC 2ADIA 1M53A 1AS8A 5E99H 43C9B 5JHDE 3GMLB 1RK0A 5C0BA 2EXYC 2PP7A 1NFKA 4JM4H 4OZIE 3A6BL 2DIEA 3EBHA 3GTVA 4G8AC 3COOA 1OAZL 5JOFB 1GJUA 1Z0MA 4XOEA 5EZLA 1WISA 5C0AA 3P9LB 2Y3AA 3S88H 4JRYE 2AEIT 5BXFA 2Z6FA 1CDUA 3MOBH 4HCRL 2VWEE 1F3DH 5FGCB 5DMKB 3L4UA 3RWFA 1TZGL 1I7RA 4MNQB 1NOLA 1R5WB 1DBAL 5C1MB 4WGVB 2IPTH 2VXVH 1FC2D 3OXSB 1U8MB 2Y07H 2OTUB 1QVOB 3U48A 4Y2LA 4JRWA 5GIRB 3VH8B 5D7KE 5GHWH 1WIUA 5I24A 4LU5L 5IMOB 4ACPA 2JJTA 3KNBB 4HK0A 3S5YA 1FC1A 1KPVA 3R06B 4YR6B 2WVUA 3TS8A 3CZJA 4L1SA 3PDOA 4A63A 2XIIA 1PKQA 1E4HA 3EH2A 1UXWB 1P5VA 3QUXD 5GS3A 2PW1A 3LKRA 1N64H 3SDXF 3C5SB 3FUMA 1KUMA 2HVBA 3LIUA 5F7KC 5E4OA 5CS7A 1UZ6E 3K71B 3DVGB 5GGTL 2BIHA 5DJ8A 5DQDH 2X70A 4U1MB 5KS9F 4N9OB 4M7JL 5IUCA 2GJJA 4X8CA 3CVHH 2D31B 5I5RA 4WK4B 4XVJH 4AEHH 5JXED 2G4GA 3S37L 3NZ8B 5DS8A 2P3YA 3QS2A 5IP4A 2H5UA 1I3UA 2R0WL 3ILPB 1C16B 4FJYA 1P4UA 4XP9H 4NM4H 1OPGH 4YXKH 3BP7B 1JXFA 2CO1A 1MCWM 4U7KA 5AWNL 1I1FB 4YHMH 5HHVH 1LK2A 1ZANL 4JJ5A 1G7QB 1BF5A 4BDVB 2VDMB 5IFAH 3K72A 2X6MA 2OYKA 3C5JA 2NY3C 4XMLH 3BVVA 4KMTH 2NSXA 2EYSB 1CFTA 2IBZX 2HT4C 3IMRA 4H13C 2PYEB 4YIQB 4CMHB 3IGAB 4E9SA 4RDQG 3C87A 5DUPH 3A4DA 3CVHA 3P2TA 3PAYA 3ZDYE 4K23L 5ESAA 5L0QB 3E0GA 5BOJA 3Q1SH 3PWVA 4TNVK 4ZQTA 5C0CB 1CLYH 3JWOL 4M3JA 4F57H 3CZLA 3VMNA 4MWFB 3WD5L 4PSPA 4PYHA 4TVPE 4MAUH 2VXQA 5DD6A 2XXMB 5DJ6A 4QYAA 1RUQL 3QT2A 1S5IL 5F0LB 5I19L 3T3PB 1E5UI 3HPLA 4KY2A 2HLFD 1SDDB 2PXYD 4OLZL 2G30A 4ZZKA 3ARWA 2FQEA 1CL7I 5C0GA 5IJKC 4B9JA 4JHAH 1T03H 3BSZA 3FN0L 3C6LA 4R3SA 2YC1A 2COQA 3S5LG 2PWDA 4JFYA 3DDFA 1HH6A 4JM0A 4OZFH 3BP6A 4QJ3B 1I9RH 3SYPA 3FCSB 4G6AC 1JFHA 1EK3A 2H3NB 5B38G 1FL6B 1XGTB 2QKIC 4BZ1A 1ZWIB 5HHOD 1U3ZA 3FUEA 2A6KA 3MRIA 4YDZA 2P7TA 1O7SA 4EF3A 3TBCA 1TR7A 3U36B 5BOPA 5I30H 5EEUA 5H2BA 2AJYL 5KVGE 1LO2H 4I1RA 1TKWB 5IGXH 3HR5A 4GJTB 4PYGA 5HYIA 1JAEA 2GBVA 5T1MB 5ENWA 2EYTB 5FUCE 3QDJE 4ONFL 4JFDB 3ILDA 5JPMC 1CB4A 3CFKB 1FVCA 4MXQD 5CILL 5KBPA 4W4OA 1S9YA 3MV8E 4ELMF 2ZXEB 1CFQA 4MAZA 4JANA 2J6EH 4YSQA 3WTSA 1GZQB 2X9ZA 4FI8A 2IGTA 2A1WH 1XH2A 5IB3B 3EJCA 1V3KA 4GW5A 4HPHA 3PGDB 3BWSA 4E36A 1G5GA 4R5TA 1TTGA 5JORA 3PJNA 4W9IC 2K45A 1B0GA 2CLVB 1B6UA 3DX7A 3TJEH 4F37K 5EC1A 4QRBA 5A43C 1R24B 1I3RA 4HS3B 5C71A 4XC1H 3O6ML 2OZ4A 3H3KA 4ZX6A 3FQXB 1F5WA 3TL5A 5AB9A 3I6KA 4G5ZL 1Q72L 5CINH 2F7RA 3FO2B 2OULB 2YZ8A 4MJHA 1SHMA 2DTSA 3GK8L 1ANUA 2IPUG 2QTEA 2LHAA 2V5YA 3FFCA 3LS4H 2O6FA 3VX1A 1ZK9A 3A22A 4MS8C 3F8UB 3OZKA 1E4JA 2R27A 3HG1D 2V4LA 5BO1H 2JXMB 5B1CA 3QUXB 5E5MB 1DFBL 4U05A 5K39A 1RIHH 4DGVH 5IV2A 2QELA 1NDMA 1P4LA 3DI3B 3IJHB 2ATKA 1ZGLM 4KUZL 4R4ND 3K8KA 4NCDA 5I1IH 4DZBB 3JTSB 3QC6X 2GTQA 3C6SA 4HWEH 2LLLA 1OOWA 3W9EA 2W9EL 3AM8C 2R0KL 1PZ2A 4GMSL 3ZRCC 4F33A 2H2SD 5DEZA 1BLNA 2NY5H 2B8OT 1HQ4B 4PGEB 3VXTB 1QLRB 2H6PB 1WICA 1D3CA 2FBRA 2VC2H 5F7DA 3ROLA 4AUUA 2DZEA 3UC0L 3QJFA 1SJHB 4HLZG 4IMKC 5D2NC 1E90A 4WW2A 1F58L 3OKEB 1IEBA 3CHSA 3SZKC 1HWHB 5LNEA 3H2QA 3QPKA 4OT1H 4OLXH 3HG5A 3VFGH 4N2GA 3BPCB 1XGYH 3CK0H 3D06A 4YXHH 4WK2B 2OSWA 4AH2B 2C3GA 5DVKA 3PY9A 4OGXH 3FOLA 2C9RA 1AZBA 4P07A 2DQUH 2XXGA 4PJIA 3GDCA 4Y1TA 2V3DA 3EYUH 3I9AA 4AMKL 1O6VA 2GTZA 1OF0A 5HHME 3QRGH 1JRHH 4LF3A 3N0PB 4JFOA 3NOIA 2F8OA 2WUCH 2Y5TA 4KI5E 1WITA 5F7EL 4FULA 4F9LC 3L4VA 4H25A 2VITB 4U1NB 4GKLA 1UWEL 1YEFH 3B7UX 1CZ8H 4HUWA 2HFGL 5DHVH 4XNMB 4X9GA 1Z9MA 1XCQB 1IBGH 5E94B 3W38A 3HAEH 1I31A 1YUHA 3OSVA 1F56A 1NDTA 4J3OH 3MOQA 5HHOB 1N0XL 3I50H 4G8GB 1ADQH 4YSTA 3IETA 5SWQA 2EVJA 5KSAA 2Q6WB 4JRXD 1W8NA 1EV2E 4HMCA 1CT8A 1R1CA 4YBLC 1IM9D 1MWAA 5CZKA 1XTMA 3KPSA 2KDGA 1OTTC 4LK4A 4G11A 4N0YL 3TVMD 1D7FA 3JUYA 5I9QC 4MCYA 2H8PA 3VFUB 3UFIA 2CO2A 4V11A 5MENB 1W0WA 3IJSB 2W38A 1QUNA 3RY6A 3DX9A 1FIGH 3L3KA 2BXZA 3P73B 3MLSL 3VGBA 6PCYA 2HVKB 3D9AH 4Y4FD 5C7XH 3X3GL 3A3YB 2JQZA 1TUPA 2GCYB 1TLMA 5IHUL 1R5VA 4AQ8C 1KYFA 4LOVA 1CVSC 3L13A 3PWJA 3TJHC 3RWDA 1TZGH 3LEXB 3GSOB 1DBAH 4PJEE 5CZRA 3QIWD 1DEDA 4KHTH 4E5XG 5LGJB 4L8CB 2KDYA 5K9KA 4G9FA 1M71A 4OIIL 3Q8AA 4ODBD 1ZLWH 2H9GB 1J1PH 5DYOB 2DBLH 4PJ7E 2PR9A 1GZHC 4GQRA 3MHZA 2FD6L 5ID0A 4OZGF 3K2UH 1E28A 1ZV9A 1IBFA 4NHCL 4RESB 2OW7A 1FFOA 1YECL 3HE7A 4XNDA 3EADA 3M1OA 2OXGA 5BNXD 3TFKC 4HCRA 4PI2A 2X2HA 2JJVA 3DX1A 5AOMA 4ZFFA 5GGRY 2AQ3A 3FT2A 1J05B 3BIKB 3ZO9A 1FZJA 5KYUA 1LM8V 4PJBE 2VERA 1FVDB 3PDGA 4M7JH 2XFXA 1HQRB 4PG9A 3RZCA 4BWWA 3MRDA 2PPEA 3HG1B 2Z34A 2R0WH 1NCWH 2QBWA 4LSVH 3S96B 4NDMB 4PJDE 1IGYB 4BCZA 1KTRL 2WCPA 1F1GA 2AK4D 5JYMA 1GJIA 4MZRA 3UIYA 4JGNA 3TBYB 3LQAC 4Q4IA 1IGFH 1LEIA 1X5IA 2DQMA 3QUZA 3D09A 4RCAA 2C4FU 4JREB 4AKQA 1QQDB 1F02I 1QYGH 5GGTA 1G84A 3W56A 2XN9E 3BDXA 1EXUB 4L1LA 2X4TB 3CWGA 4WI7A 3VSTA 3CXHK 4K23H 3LSOA 3R4RA 4XXDB 4YZWA 2WLKA 4YSOA 1PFOA 3GSXA 4TQ8A 1Q4NX 5AKVA 3GXTA 4XBGB 4A04A 4Y8AA 1T2QL 1E9OB 2VRAA 4OD2A 4TNFA 3WJJA 2DBJA 4NFDA 2P5EE 1FVEB 3MRNB 4NQXB 3NUKA 4WEUD 3SBWA 4OM1H 3QZWA 1D2OA 1S5IH 3OKLB 1UYWL 3IDNB 3MREB 1GGYA 2GB2A 2FEDC 3O3UN 4LDCA 4BA8A 3VTMA 5IR1B 1E27A 2XWXA 1R34A 3HN8A 3WEXB 1T3FB 3WKYA 3RA7H 4Q97A 4IOSA 1LL1A 2OKMA 4PY7A 5DJYB 4F2MA 4GRMB 4AE1A 5EPMA 3D05A 4H1LA 4GXVL 1G7LB 3ARBA 1LO3L 3AU1A 3KYKH 3PWPA 2HFFA 3IDIA 3UEZA 4ZDHA 2J1ZA 3VG9B 2BK8A 1UXMA 1QLEB 3O41B 5FOJA 1QRNE 3WNIA 2H4EA 3NP3A 5LBSL 4CN1A 4EOWL 2F1AA 2C4FT 3L95A 1ZLWK 1YEHH 4PJFF 1NFIA 4EN3D 2MOQA 4HXBL 4MD0A 3IGFA 3II1A 3QUGA 1PBYA 1PD1A 2FRGP 2G3NA 3MKGA 3ARPA 4IOIA 4P2RA 4J3SA 4GAFB 4MDRA 3EOAB 1E6JL 2PABA 4XOAA 2EVGA 5AOKA 2YD2A 3JBG7 2WVTA 3BVTA 4LP8A 1Y18A 1KELL 3IAGC 4UAHA 4P57B 5AB1A 4R4FL 3UIZA 4HF5L 4Q56A 3EAKA 4N20A 4JRXB 3W11C 2A73A 3QCTL 4BSWA 2JJUA 3D0VA 4O9HL 3WHE1 4QAWA 3BKYL 2CUHA 4HUNB 3SCMC 2Z8SA 3BDYH 4K55A 3D87B 3G08B 1D5MB 3GSWA 3RGBA 4Q2ZA 4TQPA 2F53A 1WAEA 1W15A 3MXWL 3W5MA 1A4AA 4R97C 1AGDB 3APNA 5D1QA 1CG9B 5EOCL 5IQNA 4EQ2A 2XIDA 3BH8B 5C0JA 2O5XH 3X13A 2OMTB 5EO1A 4YHIA 3QCVL 4Z9KB 1JNNL 4HISA 3ZTEA 4NI3A 5CEZE 5JIMA 1WAAE 5KTEH 2WLYA 3R7QA 3UCQA 4WFGE 5LKNA 3EYSH 3QIWB 4G5ZH 1L6PA 2NYKA 3T0WA 1IKFL 25C8H 2V8LA 3VRJB 3SD2A 4FQQB 4AT6A 5ICZA 1DLFH 1Q1PA 5EOQL 4MKTA 1GGIH 3P3YA 4YDLB 5EIIA 4U4BA 3CSFA 1JG9A 3DHPA 4PV8A 3FQUB 4E41E 2CRMA 4OLUL 1J8SA 1UJTA 4XVOA 5H94B 1FYHB 3DK2A 5DVMA 1A3RL 4RRPM 4C4BA 5JHMA 3RWJB 2D3JA 3QQDA 4MLIA 2ICWJ 3BDBA 3RDTA 3CDGB 3GMOA 4QHMB 1DUZA 4FHBD 5DZVA 5T8IA 5K59E 4XWGH 1KIPB 1T21B 3VXUB 3WTXA 2A9ML 2BP8B 5K1JA 1WBYB 4AY0A 4N2CA 3EF7A 1OE2A 4JUSA 3DURB 3GKWH 4L48A 4YUEL 3FH7A 3WFHA 3I02B 2QVMA 4IDJL 2CJSA 2FR4B 2ICWI 5FLUA 2HTLC 1BIIB 3ES6A 4NPYA 2A74B 4GMSH 3NRQA 5KSBF 4JKNA 4X5PA 1RH8A 4CC0A 2A9DA 3OKKA 5ILTH 5T5FL 2WLJA 2AK4B 3QUYD 3OLGA 2XZAL 1FNLA 2CO3A 3JV4B 1AE6L 1D7BA 2A5UA 5IK3B 1ZOXA 3L3OA 3UC0H 3ZYOA 2EH8L 2XWBA 1MKFA 3KLAB 3SD5A 3H0TA 4M5TA 3GGWA 2K4WA 3WKQA 2C9XA 1TENA 1UFGA 2AJSL 1X5YA 1SEBA 4N6RB 1FNAA 5KYXB 3QORD 3BZEB 1FBIL 1QATA 1QSEA 4PRPA 3S5LB 2EIKB 3VI4F 1A14H 5FF6A 3IVKA 2LLNA 5AOLA 1JPGA 2FT7A 4ZOCA 3HN5A 2EE3A 1A3ZA 1Q0XL 4MXWL 4XBPA 2WHVA 4F3FA 4QYOB 2BWQA 1OWWA 4K8RC 5C08A 3F3HA 5DHXB 2WLZA 3V0FA 2DH2A 4F7PB 2I7SA 1CQYA 1PVHA 5BZWB 1I1AD 4J23A 4N90D 1PD6A 2MQ3A 5FYKU 4LLUA 3RFZC 4Y5VA 1EHLH 3QR0A 5TDPB 4JMNA 5L9DL 3UAJD 3V4VB 4Y16A 2Y2YA 1ML0A 2J8UE 5D1XD 4M56A 1L9PA 5BQDA 3MLPA 2XKUA 2VOTA 4PB9L 4PRAA 4NQSB 1UWGH 4LCUB 2ADFH 4P4RB 1KY7A 1XGRB 2GHZA 1YMME 2ZUXA 3KPNA 2FDBP 1ONQA 5C3IA 1MHHB 3F7YB 4N0UB 1R0AH 5CEXB 2P5WA 3F7KA 4DWHA 1EUUA 3T4YA 3L3GB 5IHLB 4LSTL 4DUWA 1N0XH 3CPLA 4WWKD 2GFBA 4WJKB 4KZEH 3EH4B 4HHAB 4G6JH 3WHXA 1ETA1 1ZT1A 3REWA 2IALB 5EORL 3CLWA 4N0YH 5F1NB 4P99A 3EGDA 3IFLL 1CU4L 1EQWA 2ALAA 2WLLB 4NZTH 3DVNA 1J88A 3EW3B 1WZLA 1IV8A 2GSGB 3ZKNC 1LNUA 1D5BA 1SHWA 4KJWD 3EFFB 3BD4A 3OGCA 5FYJE 3ZDWA 1XH1A 3KGRA 3HHRB 3F2LA 4JFFD 5IWLC 4YHLH 3EJQA 2Z35B 3BKCH 1FO0H 1AOZA 2J5WA 2K8QA 5DT1H 5G4NA 3RHWK 1NDGA 3AADB 4X6DF 1M42A 4HULB 1CL7L 1QFWL 1U8KA 4TLTA 1AACA 1UA3A 3AXLB 4CILA 2PCPA 3BAEL 3QH3B 2KBGA 3CVDA 2V6HA 3CVBA 4NQCB 2Y1AA 1BF2A 1LO0H 4HJGB 4ZO8A 1XAKA 2R7EB 4GUPA 4PRBB 3UBHA 2ADGA 3N41F 4OF5A 4XWOD 2QFPA 1E7UA 5GGUB 1OALA 4I4WB 9CGTA 5C2BL 2WO2B 2ZYRA 5JIQA 3HS9A 4CVXA 2BS71 3CX2A 4NHCH 4XT1C 1YECH 3RI5K 5GS0L 2NTFB 3QNZB 1PLCA 3ZZQA 1DBMH 3I2CH 4JQXA 1G9HA 1MY7A 5IBUB 4A2MA 1O5PA 2F58L 3DRQA 1QFUH 4KNTA 1FGVH 1KJVB 4WO4A 4GRWF 3U1SL 1F3JB 1ROWA 3DRTB 4BIKA 2B1OA 1K3IA 1OSEA 1ACYL 4YHKH 4NN5B 4MZ3A 3QCUL 2Y25A 1NCTA 4HUKB 1G1OA 2I9LB 5JUEL 4D0CB 5DJDA 4OSUL 4Z0BH 2FGWL 1HXYA 2ZCKL 3I6LD 1YEJL 4LLWA 2YKKA 4HH9A 5L6YH 4EUPA 2VW6A 4AK1A 4NN7C 3B34A 2NQCA 2H3XC 4PRID 1ASOA 5CR8A 4Z7NF 4P2OD 1XEDA 2FJFA 5T3ZL 4EDWH 2EZ0C 2I5YL 4U6YA 3MNZA 3O45A 2PO6A 5L2JA 4PJAA 1TFHA 1R3LB 1HYRC 1A6WL 1HHHA 2V9TA 2V7NA 4BINA 2ED9A 4XRCA 1TYJA 4Z7VE 2X41A 2JSFA 2OFQA 1KGUA 1SOXA 2VZ3A 3QUYB 3TM6A 5PAZA 3DV6A 3CDFA 2HPOA 4F20A 1I85A 3LHPH 3NSJA 1TLKA 1T0NA 4H40A 3QEHA 2O6CA 5EBLB 2ODIA 4WNQA 1I9IL 1E4KA 4LLVA 5E2WL 1AKPA 3QORB 2IBGA 2R39A 3S36X 2QADC 5CSZA 3HS0A 1WFUA 5ALBL 5TFSH 1L0XA 4F8NA 1M1XB 1FNEA 1G0XA 3AREB 4S0TD 2VXUH 1H3GA 2FEEL 3JWNE 1I1AB 4ZPTB 3ULUC 3O8XD 1D7DA 1LO3H 4FL4C 1HOCA 3UMNA 2VR7A 2QFRA 1AFVL 3ZYJA 3T9WA 4W9HC 3DGCR 4M9OA 1D6EA 1VDGA 5D1XB 3ULUF 1VZIA 2YSSB 1UB6B 3PFQA 2FWOB 3TASA 3ARUA 4MQ7B 3A4AA 4ISVB 5I2IB 4UBDD 5IROD 2CPUA 2DEYX 2Q9OA 4JE4B 3ETBJ 4N0FA 4IBUA 1S7VB 5EU5B 1YEDA 2Z92A 2HKHH 3RIFF 3ZE1B 4FMVA 1KXTA 3S8GB 2FBJL 4KQ4L 5HD8C 4G80B 3CMGA 2G3XA 3D51A 4X5XA 1YNKH 1PX3A 3P3SA 3BGFC 1C7SA 4DEPC 3IU4H 2K70A 2AXGB 5CFAA 3FQYA 2FYYA 1MFDL 4QRUB 3BVDB 2JJTC 1AYOA 4WWKB 4Y2DD 1E4WL 1S7QB 2XU9A 1QFWM 4MCZA 4E5XB 1OP5K 1ROCA 5KUKA 1E30A 1Q9WA 3BKYH 5IJDC 4NNYB 5DJ2B 4FTVE 5LBSA 1FYTD 1U8NB 5EZIH 4JFSA 2HH0L 5F3FA 4X5WA 2YMXH 3TEYA 5E8NA 1MI5E 3VU1A 3H55A 2W07A 3NG5A 1J0JA 4BQ8A 3MJWA 1DQVA 2W91A 2X4QA 3O6FB 1SQMA 2WXRA 3L1FA 2VDPL 5JIIA 4X80H 1M56B 1G7MA 3DK0A 2GSIA 4IEFB 4LLMA 4TF4A 2MNJB 2VLRD 2VQ1B 4LIQL 3BO8A 3S3CB 3S5ZA 1LEGB 1XGPB 3FQ4A 4FQIH 1JHKL 1QR1A 3ARGD 1P4IH 1OWRM 3DOHA 4F7EB 5EOQH 3RY5A 1ETZB 5D7LA 1FL3B 2EVIA 4FEIA 3MNWA 4JO3L 1U6AH 2IH9A 3RIAF 4D9QD 4XNZB 1T89C 4ONHB 2EIBA 2BVTA 1LP9B 3KWWB 3K6NA 4N8VA 4KH9A 2Q2EB 5HYSB 5L2KD 4HJ0D 3JYBA 1EZVX 4POUB 2RA1A 1P2CB 4R6UA 3WIFA 1QPKA 4JHWL 2XQYG 4WKXA 3QJHB 3HFMH 3BWAA 1G1KA 2QEJA 1EGJH 4ZTOL 3B2VH 3Q8CA 3MOAH 4QXUL 2R83A 1SOKA 1JPSH 3DUSA 1KIUB 2NY2D 3RPIB 3A6CH 1WWBX 4F37F 1I8LA 1MNUL 4I0PA 4P2QB 3VFTA 5C6TL 1KFAH 4OF8A 3JV6B 4JDTL 2ADJB 3LKPA 2BP0A 1IGIL 3CH1B 4YHPA 1K6QL 1WWWX 3MRFA 4JKPL 4PRIB 1NBYA 5HDQH 2XZAH 1HSBA 5IHBA 3L17A 1AE6H 4K3JH 4P2OB 4G9DB 5HPMB 4ZW8A 2PN5A 1B88A 1BV8A 2DMCA 3FQRB 2EC9T 4C83A 4EKXA 4JFZL 2UUDH 4GUCA 1RP9A 2DWSA 4X5LA 4NRXB 3MCKB 2EXWC 3K8MA 3T04D 3UBXG 3D52A 3BFOA 4PGCB 4FLHA 1FBIH 4AIOA 2R0LL 4DO5A 3T2NH 2CLRA 3BW9A 4WJG3 4XPTH 1KYAA 3SE4A 4Y5YA 1Q9LB 4TSCH 1Q0XH 2G2RA 5IJVB 4QKTA 1JI1A 4F15C 2ZKYA 2FX7H 1AG0A 4XMTA 3TZVD 5SV4A 3FN3A 2WP3T 3OJDA 3V5KA 5GRUH 2WSKA 1Z5LA 4XR8C 5T5FA 3CSPA 4Z77A 3ABZA 3MBXL 4A37A 5JNYA 3IFNH 4W4OC 3O4LD 3L16A 3HHMA 2AQ1A 6FABL 5L9DH 3H7BA 4NI6A 3QO1B 1R3JB 1CFVL 4TUJB 5BQ7A 1YY8A 3H4FA 1LJMA 3KYMB 1UM5H 2BFGA 5J13B 4Y5XB 3ZN6A 2C7FA 1QEWB 2FWUA 3SGJA 4GW4A 3VFWA 3O8XB 2XV6B 4KXZI 2X4SB 1LE5B 3QO0B 1RPUA 1BD2D 1I7UA 4CMMA 5T3XL 2NLJA 1UOKA 4JZNB 2R2HB 4WU7B 2P44B 5AQ0A 1CFBA 1PJ9A 2ESVE 3WJLC 3BMVA 4PJ5D 4UV7H 1VB9A 3CFCL 2ID5A 3VO0A 4PBVC 2AEWA 3RUGB 1M9WA 4O2CB 4GKZA 4PTTB 4Q58C 4NQDA 1Z3RA 5GSVA 1YEIL 3IYLW 3WFCL 2NUPB 5DHYA 3MR9B 1ND0A 1RZFL 1TCMA 1L6XA 2FQGA 4N2BA 2X1WL 4ELKA 2E7BA 2I26N 4ABVA 4W93A 3P4LA 2YAEA 3D69A 3L4CA 2OPCA 4OFYA 1RK1A 2AJ3A 3DXAE 4HJSA 3NRPA 4XP4L 2ROYA 4UZSA 5FUZL 5AKSA 1N19A 3VD5A 4Z3GA 1I3VA 3MJ9H 5FYLE 3T65A 1FYTB 1QFWH 3MNDA 5DSCA 1TJXA 1CGVA 1DVZA 2V3EA 4YBQD 1E4XI 3QNFA 1MHCA 3AS0A 3LZRA 1ZVSA 2ZAIA 1MUJA 2BHUA 3BPOC 3PWUA 1RFDH 1CE6B 4DHLA 4WF7A 2YQ2A 3A24A 2Z93A 3OJVC 1DN2A 4LB8A 4WUUA 4APXA 2VO8A 3QEQD 5C2BH 2ZP8A 1NCAL 2DQHL 2UUDK 5GS0H 5FECB 2QPDB 5SWZD 4IM8A 2VLRB 4Y88A 4JGJA 2ICCA 4LPVA 5CN3A 1ES0B 1NCCL 2FATL 3Q2CA 4FQLL 2F58H 3ARGB 4HZLB 1YJDL 4MXVE 4WW2C 3W39A 4BFEA 1A8ZA 2VE6A 4PWHA 4N1EA 4O51A 1QO3B 4CU6A 2WBJD 3A23A 3CZFA 2E76C 3LPFA 3MYZA 3STLA 4DSYA 3L7EB 4P5KA 5DMJB 3PHOA 2AKRB 2QV4A 4WW2F 1AR2A 4NO2B 3H9SE 5ID1B 4Y1AB 4PLKD 2WM0A 4AYDC 2NNAB 1NJ9B 4KK6D 3L6FA 1GYUA 2VKXA 1YEJH 2NY5C 3TN0D 1ID2A 3WY1A 3GF8A 3L2LA 3LH8A 5CGYC 2ZG3A 4XOCA 4PJHE 4YSPA 1KMGA 4M8VA 5AYQA 2ZXWB 5T3ZH 2GSMB 4I2XA 4F5CA 4PRDB 1NINA 1JGDB 1ZV5A 5I16A 1N0LA 1NCHA 4JKWA 4PJ8C 1PG7H 1M3IA 3UX9B 3D25A 3T1FB 4ETQA 4PJIF 4X9YA 4EO5A 2K4AA 2BRRH 4A7VA 2K7PA 1N2RB 1QUPA 2FWLB 3HMXH 2YRLA 4HWBH 4JZJA 2A0LC 1A6VH 1LDPH 1L0YA 3KPPB 4UDTA 2NZ9D 1FFQA 1LLAA 2XWJA 4HOXA 4K7PY 1H5BA 2BNUB 3Q05A 4IS6A 3VWKD 5FWRA 3VFMA 2EYRA 4I48B 4UM8A 1XF2A 2JV6A 3ATFA 1Z3GL 1X6LA 4WIQA 4YSRA 4GG8A 1RIVH 2LU5A 2ETWA 2PETA 4LO9A 2N7AA 3DX2A 5JHDD 4KRPC 4MZ2A 3DX6B 3QI9A 1T2XA 3RZWA 4JM2C 5I9QB 4CUCA 5L88L 2WXNA 2VZVA 3TO2B 1AOHA 1X44A 4YSEA 2CDGB 5AAWA 5ADOL 4YE4L 3ZKXC 3T0BA 2B20A 1WYJA 4JM2F 4TNEA 5CFHA 4JRYD 4RFEB 1VSCA 1WAPA 1K8IA 1X5GA 1CYXA 2EADA 4IRJA 4J3OC 3ZZLA 4J8RA 3ESOA 4OUOA 4J5VA 4PY8I 5J1AA 1IEAB 1J8HA 4DT2A 2LU3A 2FBJH 4J3OF 5FIEA 1WTGT 4ZXBA 1BD2B 1D5ZA 3OJMB 3IJ7A 1AMYA 4IGBA 4NZFA 4WUKL 3IK2A 1ACXA 4H0LC 4H0HB 4PGDA 3TWCL 3U4BH 3B56A 4BFFA 1S5HB 4PJ5B 1CF8H 5D7KD 3SOBL 2AQSA 1TQBC 3OKOA 3OJ2C 1BFTA 3HE7C 1W72B 4AYFB 2VSMB 3FH8A 1DBKH 1AAJA 2R29L 2FJUB 4KXBA 4QHPA 2CGRL 2HJKA 3QEGL 3K4ZA 3W0WB 3CH8A 3HUJB 3FQ2A 4HX1A 4WTQA 3UGUA 4OB5H 5T1KD 2HH0H 3ZHKA 3L4WA 2WVVB 3FRUA 4XH2A 4BH8A 4XAKE 5EU4A 1LMIA 4R96B 4Z7WE 2VAJA 2Q8AH 3S35L 3TPUA 3IU3B 3GS7A 4LSDA 3LB6C 1ET8A 1NGWB 5IOPA 5EF3A 1BXUA 2VRKA 2UYLA 1KJ3H 4IBZA 4WGWB 1YPZE 3JQOB 3TNMA 3GI8L 2K1MA 4OF3A 5HGAA 1F8TH 3GZKA 4QHNA 4FQ2H 3GMQB 5I15L 4GUQA 2K6WA 3RWIB 4OAWB 3QUZC 1XF3A 1U95B 4GKSB 5GZOD 1NL0L 4XZUB 1MOEA 2AI0L 2VLMD 3NA9L 4M93C 4EIGB 3EH3B 2R15A 3LJ3A 5JW4N 3QEQB 4HKJB 3SDAD 3PG2A 3U25A 1YVLA 2BSRB 3NN8B 4D7BA 1IEHA 5F7MC 2AV7B 4MD4A 1MFBH 1SLXA 2NXZD 4YAQB 5SWZB 2AMUA 4XCEA 3PQYE 2IQAB 3QSKB 5T33H 3CUPA 2NT1A 4ZTOH 2APWA 4ERSL 4WWID 1A2YB 2GI0A 3V5DB 3U83A 3V5HA 3KLHC 2QQLH 2H7WA 2WTRA 3GUFA 3IE9A 4TVPD 3SBWC 5L8LB 4KNSA 3W9DB 4ZMVA 1TJIL 3EOBB 1IO4C 2DQJH 1RULL 4O5LL 3M86A 2K9UA 1QSFA 4Z3EA 1S9WB 3OF6D 4PJGA 2DKUA 2EC8A 3K6DA 2EH7L 4RQQB 2YD0A 4K3HA 4NZJA 5F0PB 3FUDA 3GXUB 4MDJB 4I77L 5AOZA 1KN2L 4Z7OE 3ARBC 2R9HC 1DANT 1PL3A 3JWOC 3X1GA 5G55A 1EO5A 1HS6A 4M48L 1WIOA 4JFZH 5AW4B 3DSNA 4IKKA 4B41A 2OL3B 1Q94A 1A7OL 4X7TA 1VA9A 4XCNA 3SJVA 2WD0A 3G04A 2LT9A 3X12B 4A1RA 4IIQA 5MERB 5FDYA 3OTTA 4EI5D 2WXGA 1DBJL 5B8CC 4JEGB 43CAB 5AAPA 5EWIL 5FFOA 5E8PB 1OAXH 3QAQA 4JFWA 1NBCA 4ZOAA 3OL2A 5F6HI 3VWKB 4L9LA 1F90L 4A66A 3MBXH 4GBXA 5FA4B 1HYSC 1EEYA 5LAPA 2H26A 3QDJD 3LN5A 3D39A 4AM0B 4AW7A 4KPHL 3RX9A 4PJXA 1OSYA 2HT3D 1HXMA 3MV8D 2NY0C 4C54A 2VDML 2N7BA 4ORZC 1TTAA 5EUOB 2VN6A 3QAZC 3QFJD 4Y9FA 1HZLA 1KJ2L 2WO3B 1JZHA 3ZE0B 5JHDB 2YXWA 2AXFA 3SCMB 5CBAB 2BNQB 3LEYL 3P0YL 4JZOB 5KSBE 1E3FA 4DP0X 4MQTB 3RTLA 4R7DA 1NBVL 3S6CA 5I23A 3UTSA 2BERA 2OJEA 4KJPC 4NXSA 3BEWB 4BSVA 3BUBA 1QR4A 2UX7A 4OM0L 5FO8B 3ZR5A 2YBRB 4JRYB 2ZOUA 5J9PA 1KTJA 1JZEA 4QRRE 4K7FA 4FJ6A 2IFFH 1J0KA 1UD5A 2R1YB 4JDZB 4LKCA 4HPOL 4U6TA 3MRBB 5I1JH 2WSDA 1B0IA 4J4PD 3VRLF 4B5ZA 3C60D 2NY4D 1XGQA 2G60L 3TCTA 2BJML 2HX7A 2HTKD 2GKIA 1FE8L 2FLMA 2CHNA 5KG9A 4B9ZA 3OSKA 2YGVA 4RZCA 4KK8D 1G1YA 2AV1B 1MJ8H 4XB3A 3FT3B 5AVZB 5G4MA 2KPNA 3EDEA 2EIEA 4ZNEA 4YGAB 1KCVL 3I6GA 4J3XA 4LSPH 1GY2A 4YEFA 5GRVL 3FO9B 5DXWA 5B39A 1OHZA 5TGBB 4KX8A 1UD2A 3N9GH 3RDTC 1U8LB 1AXTL 1TTBA 1IBZA 3WFBH 4EIZC 3TIEB 4HW6A 1EPFA 1TZHA 2PWFA 2FO1A 5EBMA 3Q7JA 4XI5C 2XV2A 4X7FC 4CU7A 3V0WH 3CBKB 1LE9B 4N6QA 2DH3A 1B2WH 1GGCL 1JXDA 5E00B 1IQDB 4HKZA 1NCAH 1TTRA 2MCPL 2AFNA 3BD3A 2Y7SA 4NZUL 4A6YH 3EJUA 2L7EA 3WO3B 3QXAB 2WNWA 2BVEA 3L3OC 2UZIL 2BZDA 2FATH 4UOQA 5E9DE 1NGYB 3OQRA 4N8CH 2VDQB 1E9QA 2AQ2A 1YYMH 5I8CB 5IHWA 3QVAA 1S7SB 5KJRL 4YDJA 1AG6A 3NPZB 1XMEB 3FNKA 4OI7A 1YSOA 1A1NB 2FJHA 4ZTPL 2YQGA 3BYTA 2YHGA 5FYKE 4OI8A 4IK7A 5B3JE 3FU6A 1BZ7B 1IFRA 3RHWF 3GJFB 4OQTL 4MS6A 3KPRA 2IGLA 4LASL 3DMMD 3GRWH 4AV0A 3FB8B 4EI6B 2PCFB 3C09B 3UBXB 4AMXA 3O0LA 4X6DE 5A7BA 1MCQA 2OBGA 3G9VA 4A2FA 4Y5VC 4KVNL 2J6WA 1WBZA 2O6DA 3H1ZA 2AQRA 5CCKH 1P4BL 1GZPB 1SFHA 4GXUM 5HHMD 4NB7A 2R2CA 2KQMA 3MRCA 4UM9D 3RI5F 5DMGD 3W57A 4DFHA 4KI5D 2AANA 3GM0A 2MCPH 4J12A 4IHBA 3R8QA 3NCMA 4B97A 1X5FA 3V0IA 4APQA 4M6NL 2YEVB 3WDJA 1HJBC 4GKNB 4JPIA 1XSIA 2IMMA 1JHLL 4B9KC 2EO9A 4ZODA 3HB3D 1MQ8A 3FFOA 5CMAA 2XG5B 3SDCC 3SEPA 3VM7A 3EO9H 3ZKMC 1EBPA 3PL6B 1NSNL 3MFFA 4UIKH 2UXGA 2YEZA 4HIEA 4NKIH 5E5LA 1URZA 4GRWE 4EI5B 2I60L 5J11C 3P4NB 4F8QA 1TVHB 3TBTA 3V6OC 2EDJA 3BP5A 1KLGB 2HX9A 3FOMB 3QA3A 4RGOL 3GMRB 1FN4A 1MRDL 1NMBH 3OC5A 2JFCA 3O6KH 2VXSH 1G87A 4ZMPA 3FB6B 5EZJA 4S1RH 3RBSA 2YSTA 2CH8A 3QDJB 5ADOH 3ARSA 1M7XA 5FCUH 4RWYL 5HBBA 4HIHA 1TJMA 2OYMA 3MV8B 4QHUB 3X1NA 2MSPA 4IRSD 4Z7NE 5IG7A 1NUNB 2A83B 5EU7C 3QFJB 2BY1A 4JQIL 1SVBA 4KQ0A 2JB6A 3B9AA 4KQ3H 3INOA 1OL0A 1JUFA 3ZL4H 1TSRA 4JVPA 1PGRB 3KYOB 4Y2OA 2BCKB 3NEXA 5E6ID 2NNFA 3VSQA 1YA5A 3TWCH 5IB5A 4JFEA 4FQJH 4P3CL 3TH4T 5JOPE 2J2ZA 3FTSA 3DX4A 5A40E 2P24B 3FCUB 4JY4A 2BP3A 3MZTA 2EINB 3NCCB 3QIBD 2ARJQ 5IQMA 2XBDA 4DVRL 4JQXC 3C60B 5D93B 2ICWA 2NY4B 3PWLB 4UINL 4DKDC 1E9PA 4DZ8A 3EOTH 2B2XH 2EKSB 3LQZB 4U4IA 3QULA 1EO8H 4DPCX 3BJLA 1CBVH 1SXBA 4PTUB 5G4OA 5CZVL 4XE5B 3RTQA 1I9JL 4A2HA 4JPKL 1TTCA 2GYSA 4HKXA 3QWQB 3ZLQC 5I6MA 2FT6A 3MZGB 3GPSA 3N06B 5BS0B 5C0BE 3MBWA 4Z78A 3QQNA 4OV5B 3DJZA 4LCIH 3SE8L 5AZEL 4TNWK 2DD8L 2CM6A 5BMFH 2CHDA 3RKPA 2R29A 2VDOB 2NX5A 4R7XA 4NN7B 5C0AE 1BP3B 2FL5B 5JIPA 2BSTA 5I15H 1BAFL 5D7IF 4HD5A 2VAAB 3UGXA 3CHRA 3MCYA 2A9BA 2FIKA 2PO6C 3U4EA 2AI0H 4AUYA 1NC2A 2QHRL 3TBVB 2R1WA 4UQ2B 2Q3XA 4BQCA 2VERN 1BVOA 1MRCH 3U30C 4XBEL 3HKFA 3CU1A 2H1PH 4G1EA 5DVOA 1JMXA 4PJAF 5F88B 2G75B 3VXOB 4KMQA 4ZW3A 1FZKB 2AJZA 2B14A 4UIMB 1KJMA 4ZO7A 1OW0A 2YAFA 2QQKL 3ZSSA 1H3XA 4HD9A 5HVWA 2WXLA 3FT9A 3K3QA 3VD2A 2D9CA 3Q1EA 1F86A 2X53A 4RGNC 4RNRA 5CN2A 3KJ6L 1EFQA 5IVZB 4YVUA 5EEYA 3QP3A 2DQEL 3ARDD 4LSQL 2P5ED 3HBQA 3WFEL 3AC0A 4QR7A 2BDNL 3MV01 3C9NB 2YPKA 3E6HA 4MMXB 1PKQE 4O5LH 3BUYB 1F2QA 1LHZA 3C8KA 1OT1A 1IVTA 3GMLA 3KE0A 1N3NB 2WUBL 1CD1B 4L0PB 3DMMB 3SKMB 3WUWG 3EDJA 4OCXL 4WJ5B 5HI5C 4N1HB 5JOFA 1R9FA 2D7OA 1ZJAA 2C34A 3HKZA 3GJEB 5HDWA 3QDAA 1XTLA 3P9LA 3ARRA 5F6IB 2EDOA 4FL4B 1UASA 4WTZG 1U3HC 1LD9B 32C2B 1A7RL 3LPPA 4R83A 4U3XA 2BVPB 1N4XH 4HJUA 4K94L 5HHMB 1A7OH 2APVA 3NFNB 3Q9QA 4N9GB 1A1OB 1ZTXH 1GTFA 4UM9B 4GAGH 1QRND 2NW2B 4HZAA 4AWJC 4MNQA 1R5WA 4WFHE 1B4RA 1BQUA 1CFNB 2RBLA 2DQGH 3BAKA 2DMBA 3DROB 5LBVA 3OXSA 2OMNA 1RKRA 2OTUA 2FYVA 2IGFL 2JKJA 3VH8A 2EE2A 2O5ZH 4LEBA 5GIRA 5I1LB 3II2A 5JHLH 2IAMC 4QRFA 1I7ZB 5I74B 4ALAH 3HB3B 5IMOA 3KNBA 4DEPB 2YEQA 3JWNG 5IB2B 1GYCA 2Q76B 1L9OA 3R06A 1Q0YH 1ZCRA 4YR6A 5A2AA 4KPHH 4L37B 2J1YA 2XJLA 4M5ZH 1UXWA 1KIQB 2AXJA 1OP3H 1AGBB 5ACMA 2J3SA 3C5SA 4X8XA 3P3TA 1R3IH 4U6VL 4CDHA 3SO3C 3DVGA 5KJ7E 4O58L 1TO4A 3N85L 4QOKD 5C6PB 4U1MA 1NBVH 2Z31C 4J3BA 1KXHA 3HBGA 4CA4A 3CZSA 3NZ8A 2EDTA 2WQXA 3ILPA 1C16A 3IDYC 4IRSB 4BBWA 2BIIA 2WJ7A 4XCCL 3BP7A 2Z0BA 4XTRC 1YY9C 2F5AL 5C8JB 3Q6GL 4MA3B 4HPOH 5BCAA 1G7QA 2F54E 4XP1L 1X5HA 4BDVA 5IJCC 4A7QA 1KJ2A 3SYOA 2VL5B 2EYSA 2YBGA 1UM4L 2QDVA 2IAND 2PYEA 1VFAB 1CXEA 4YIQA 3IGAA 2GTWB 4MNHB 4R2GD 5I1EL 3KM2A 2QVKA 1QHPA 1FSKB 4E41D 1ECYA 5FFLA 4LQFH 2WXOA 3T3MB 1KCVH 4KKNA 3QIBB 2Y7QB 3LXBA 4WTWA 5C0CA 1LQSR 5DJ0B 2Y3NA 5CCJA 1UGNA 1A1MB 1F1AA 3JV5A 3DX8B 2K7QA 4YQXH 3KG5A 4JG1H 5DZLA 3BHBB 2B7DT 3UP1A 4CADB 2W9DL 4MWFA 1QLEL 5TH2B 1PZSA 5JIDA 5F9OH 5HJ3B 1FCGA 1CGSH 4IQHA 3U4KA 5ADPH 1F4AA 2WMPB 4PD4K 3K4DA 4PJBB 5AB2A 3QPQD 1SDDA 3IMSA 3LQMA 1I8LC 2L7UA 4I0PC 5GJTH 3NFSH 4ENEC 4GW1B 2Z8WC 4KXDA 2ICES 5F96L 3OAUL 1YEGL 2ZKWA 3APDA 1M9SA 4IKNA 4XOBA 5A1AA 4P46A 5JLZB 3X1EA 3SDYL 3WIHH 2FX9H 5AEAA 1CDGA 1MFEL 1AGCB 2QSCL 1FH5L 2XLLA 2YKLH 2W80C 5A2LH 5E5RB 1GC1L 4U1KA 1Z7JA 1XGTA 3WTUA 1U92B 4TPRL 1ZWIA 5KUMA 3PV6B 4G6KL 4C56B 5KW9L 1IMHC 1IT9L 2OV0A 4U6XB 4ZTPH 3DJRA 5I5MA 3U36A 3U7YH 4Y5YC 2QHLA 4XN4A 3PRZA 1TKWA 4M8RA 3BZDA 4X4XA 1BZDA 5HGBB 2ZUQC 5T1MA 3B5GA 2EYTA 4PRNB 1HHJB 1MLBB 2B4CH 3FFCE 4JFDA 1OP3K 2L8AA 2PWHA 3QUKB 1OAJA 4WHCA 1CFMA 1X4XA 2P5EB 1MFCH 4YHOL 4OZFB 3BSHA 4FQ1L 3POHA 1UG9A 4M4PA 3FPXA 1GZQA 1YNTB 1GY1A 2PR4H 2QGCA 2WXIA 3CZKA 3T08A 4M1GL 3ZTNL 4OCYL 2AJVH 3ZK0A 5IB3A 2VZ1A 1SXAA 5LO7A 3PGDA 4HZ1A 1SM3H 1B4TA 2EDMA 1OPOA 4G5AA 1JNLH 3IPEA 3C5ZA 2CLVA 3KL3A 4OQTA 1YMMD 1WGOA 5HI4C 3HZYB 3UZEA 4CNIA 1R24A 1JHLH 4GFXA 4HS3A 1HL4A 1HNGA 5IQ7L 5D5MB 5D71H 1DVYA 3GXPA 3FQXA 4XNQB 1QRNB 3NSXA 1T20B 4FYSA 5ISZD 2EUVA 5DRXB 5HDOA 1GSKA 2J56A 4QRTB 3FO2A 2I60H 2XA3A 1QEXA 4GINA 3IRZA 3NK4A 3AQXA 1I8KB 3IF1B 4I88A 1AQKH 1N5YL 5EG6C 3JWDL 1RUAL 2FUTA 4PREB 1KCSL 2NY6C 5JA8B 2X09A 4BZ2L 3RVXD 4UQDA 1COBA 2YO3A 2Z7ZA 5FYJD 4XVUD 5DLLA 2JXMA 5IIEB 5E5MA 2C1PB 4S1DC 3GIZH 5FV1L 4HIIB 4M03A 5AYUL 2P5PA 2PYFB 4PJIE 4QOKB 3O3AA 1HAWA 4PS4L 4DZBA 1W6LA 3JTSA 2YA1A 1URIA 4X9IA 3WEAA 3B4NA 3I84A 3QXVA 4OU3A 4D3CL 3RU8H 4HA1A 1OAUH 1MRFL 2BMKB 3HC3H 4FYQA 2ZKHL 1RZPA 2ZPKH 2OSLB 3V0AC 2JTYA 3HLKA 2XX1A 4PGEA