1TR7A

Fimh adhesin receptor binding domain from uropathogenic e. coli
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
158
structure length
158
Chain Sequence
FACKTANGTAIPIGGGSANVYVNLAPVVNVGQNLVVDLSTQIFCHNDYPETITDYVTLQRGSAYGGVLSNFSGTVKYSGSSYPFPTTSETPRVVYNSRTDKPWPVALYLTPVSSAGGVAIKAGSLIAVLILRQTNNYNSDDFQFVWNIYANNDVVVPT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FimH protein
publication title Receptor binding studies disclose a novel class of high-affinity inhibitors of the Escherichia coli FimH adhesin
pubmed doi rcsb
source organism Escherichia coli
total genus 35
structure length 158
sequence length 158
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09160 FimH_man-bind FimH, mannose binding
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1090 Mainly Beta Sandwich Immunoglobulin-like Fimbrial-type adhesion domain 1tr7A00
5IQMA 1KIUB 1QUNB 5FX3A 3SQBB 4AVHA 2UY6B 1N12A 2JTYA 4X5QA 2W07B 4XO9A 1UWFA 4AV5A 5IQOA 2JMRA 5F3FA 4XO8A 3ZPDA 5FLUA 4J3OF 4CA4A 2VCOA 4AVIA 3BFWA 4AUUA 4CSSA 4AV4A 4X5RA 5AALA 4XOBA 4AV0A 3JWNE 5AB1A 5FS5A 4X50A 4AUYA 3ZL2A 4J3OG 1PDKB 1N0LB 3ME0B 5JQIB 4XOCA 1TR7A 1KLFB 2XG4B 5LNEA 5FWRA 2J2ZB 5IQNA 3JWNG 4LOVA 4CSTA 1ZE3H 4XOEA 4XODA 2WMPB 4J3OH 4AUJA 2UY7B 4ATTA 3ZL1A 5LNGA 4AVKA 4XOAA 3BFQG 3JWNH 3MCYA 4AVJA 4BUQA 5ABZA 5F2FA 3BWUF 2XG5B 5CGBA 5AAPA 4X5PA 3RFZA
chains in the Genus database with same CATH superfamily
1J0YA 3L9RB 1A3ZA 3V7AG 1QD0A 1RV6X 1WCQA 3L5JA 1O0VA 3SDYL 4YGVB 4M62L 3OKDA 1IAMA 5BUGA 4A2FA 4N8VG 2JK5A 4IKKA 4DP7X 4W9HC 4NSKB 1NUDA 2KLRA 1ZJBA 3DV4A 1XGYL 4HUNB 4OKVA 5JA9A 3VD7A 1Q38A 3AREC 3D5OF 3MROB 4FJYA 5CP3H 1IRAY 1HU8A 1RMFL 2E9JA 2BP3A 5GS2D 4JG9A 1TEGA 1Y7VA 1I1CA 4P5MB 5E24E 3CXHJ 1XF1A 2CU9A 2BK8A 3APCA 5HDLA 3WY2A 4AYDC 1CT8A 3GSRB 3ZT5A 2VDPB 3G6DH 1YEIH 1YEJH 4G7VL 4N1CA 5F9JA 1F18A 2NQDA 4PP2B 4AMXA 5DJAA 3V6OE 2QDWA 1N6VA 3F7QA 5K69A 2KHAA 3FKUS 3S96A 3DLQR 1CE6A 2XACC 2NY3D 2DM4A 3AG1B 5CEYB 3GB7A 1WD8A 4PR5A 4EQ2A 2WY3B 2EEAA 2BOCA 4MMXC 4PG2C 5K9JL 5BMFL 4LFHG 4RMSA 2TAAA 3PLYA 5E2TL 3U46A 4AQZA 3N06B 2BIIA 5C97A 4XNQB 3UZVB 3ZMNA 3GRGA 1A7NL 1F1DA 5E7FA 2B08A 3F7LA 2ZSVA 3O45A 2OYLA 5DZAA 4OUUA 1T1ZA 4L8DA 1MIEH 3QFGA 4WF7A 5B1JA 1PBYA 5IBTH 1C8QA 4JHVA 4N8VA 5A2KH 3K2UH 5H37A 3C5ZA 5IGXH 4GUCA 3PWPB 4JFHD 3FFOA 3RWCA 1YN7A 5E6SB 2Y5TA 4MLIA 4N68A 4MJHA 5A2CA 5BV7B 2ARJQ 3ALXA 5E08H 3VMPA 4AEHH 3IXAB 1QMUA 3Q2VA 4Z77B 4JKPL 2GSGB 1TUPA 2B0SH 2YEQA 3ZE0E 1MREL 3DTXA 2NY0D 1WUZA 5LG6A 2WNXA 1PTZA 1SJEA 2R0WH 5IMOB 3IU3B 4X5XA 4HIHB 3V0EA 5A6IA 3D4ZA 3IDJB 1KIPA 4L3EB 5DRXB 1UWXK 2BLFA 2ZG3A 1QLFA 2C3WA 3SKOB 1LO2H 1NGYA 1MCSA 4QRBA 1F4AA 2F2HA 3P73B 4F80A 3ULUH 3T77B 2D2CC 2I60L 3B5GA 5DHVB 4ZXBC 2GJZA 3IJ9A 2J44A 1ORQB 3KH4A 4IJ3C 3ZDXE 4BSVA 2FHFA 4XBGB 1CTNA 1MCDA 3CN1A 4JFPA 3JV0A 5EEWA 1DJZA 3NJJA 5CLTA 2EACA 2ZCHH 3EO9H 5INCA 4KNQA 4F93B 3LNIA 5EA0L 5DEGB 1UH2A 1OAJA 3BH8B 1E4WL 3JV5A 2Y24A 5MI0C 4LU5L 4TUJB 4H20L 1FVEB 1Z9SB 2AEPH 2AEOA 4KKLC 5EB9A 4X6CA 5GGSY 1RUAH 3IDYC 1ZT1B 3DX2A 1LO3H 3MRGB 2HJKB 3LS5L 4YHLL 3OB8A 1LEIB 1WZMA 1OCWL 3VTMA 1DANU 3B1TA 4MCZB 3V5KA 1AD0B 4NUJA 4R4NC 4V2BA 4NM4L 1YUHB 1C8PA 3QXDA 2L7UA 2NY2C 4XGZA 4L4TD 3O11B 1R3HA 2VDNB 3HG1A 3QHZL 4QRQB 3SDYH 5CFAA 2J56A 4M62H 1E9OA 2E56A 3O6FD 4N24A 1B0RA 2HVJA 4PJGB 1PF3A 4F37F 5HSFA 1XGYH 2C9PA 2X41A 32C2B 1NUFA 5D2NC 5C3IA 3LZFL 1RMFH 1W6WA 3PFQA 3QAZB 4JVPA 1P7KB 4DWHA 5CM1A 2XT1B 2R0KL 5F9DC 1G7HB 5D4HA 1ZOXA 4NO3B 4R5VA 3DDGA 4DUVA 2MWCA 4P05A 3RVWC 3SO3C 1WBZB 3AWEA 3DUHA 1W6LA 3PWVB 2VLRB 4G7VH 3IVKA 5CZXD 4J3TA 3GMNB 3PFUA 1O6SB 5HGDB 1F42A 2OCCB 4EUPG 4TXVB 1MJ8L 3HC0A 1AG6A 3KPMA 4XP6L 2B1AL 4D9RE 1OPOA 2BS9A 4IMLA 1XH0A 3BMWA 3RGBA 5GS1A 1U3JA 3IE4A 4GG6B 3ESPA 2EIKB 2PN5A 2UY6A 2CJ3A 5BMFH 5K9JH 1R5IA 4KY1L 5E2TH 3RE0A 1L9TA 4DSYA 1JHTB 5E4OA 3MTXA 5B7MA 1A7NH 1S7UA 4MVBC 4HWZB 4XCNA 3HS9A 4ODVL 1EEYB 4ODWB 1J8HD 4R4BA 1D3CA 1OT1A 4WUUA 1ADQL 1ZLWK 2P8PA 4YHYB 2EDNA 5HHOD 3SPVB 1T1XA 2DYPD 3BVWA 1EWHA 2GVYA 4YO0B 5E5MA 1KT2A 3BRDA 3QWNA 4JKPH 4OZFG 4RMUA 3VRJA 1MREH 1HEHC 2CSPA 3GXUB 2V0AA 4D8PB 5CUSL 2VE6A 3AVEA 3BUBA 3T6ZA 3QFJE 2O5NA 1MRFL 4GIPD 3NIDE 5F6IC 3L2MA 4ENZA 1UZ6F 3ARDB 1NLBL 3CXDL 1LMIA 4Z6AT 4KUZL 4XI5D 3U4EA 3ZJAA 2QR0B 2E59A 4I18B 4PS3A 5EG6C 3DX3A 3ZQ9A 2YD3A 2I60H 4Z0BL 2P5WA 3B43A 3K72B 3O4LB 4ZW6A 1U4FA 2VJ0A 4PWEA 2DN7A 1E4XI 5KYWA 5LUMA 5IVNA 4UIMB 5AW9B 2EDLA 2EEXA 2E8YA 3GGWA 1OCZB 3S37X 1V3MA 1V8HA 2F74A 2HT4D 3DETC 5EA0H 2CCVA 1JZ6A 4B0MB 2N1KA 1E4WH 1G7IA 3CU1A 1HXMA 1OCOB 4LU5H 3EO1B 4PP1D 4H20H 1W0VB 4P2RB 1XGQB 3LIZA 2Y7OA 3NSYA 1YPZF 5JMOC 4F7CA 3BAWA 4LZKA 2XYCA 4G9FE 4YXHL 4ALAC 3U6XS 3DO7A 4ZX5A 3LS5H 4YHLH 1AG0A 3BP6A 4XHQA 1OCWH 3IKCA 1P6FA 1UJTA 5EU6B 1AZNA 3IGKA 3LMJH 3BZ4A 2LTQC 2PW1A 4O00A 3LN9A 3APNA 2AEQL 5FECA 1BMZA 4Q89A 3QHZH 4XXWC 5IQNA 2HKHL 4N25A 4HZ1A 1TMQA 1FJ1B 4NQDB 4MQSB 4OBSA 4PBDA 2COQA 4PV8B 3FQRB 3DVNA 5DGQA 4TSBL 3WTVA 1T7XA 3LZFH 1E30A 2W80C 5EOTB 1NCWL 1QSEA 2IGFL 4ZFZB 4ANKA 4ZZKA 4AG4L 3VACA 2BNRE 2GSIB 4XO3A 3X1NA 2WBXA 5D1ZA 4HPOL 1GA2A 1FNAA 4WRLA 2R0KH 5DC9B 3M1BB 1FNLA 1ID5I 3GJFH 1ND0A 3V0AC 3PCYA 2K6YA 1F3DH 2UXFA 1WT5A 1TCMA 1W72L 3DMMA 2D3VA 2UZIL 2VB5A 1K8IB 5J11B 4MYWB 5AB0A 1MJ8H 3V10A 1OXYA 4XP6H 5KSAD 2B1AH 3QXTA 2NXYB 4PWHA 4Z7AA 4IRSB 1M71B 2ZNWA 1VACB 3FRPA 4MAYD 4OBRA 4LHUG 4L4JA 4XN4A 2ZWYA 2EUZA 2PP7A 5HGBB 2CK0L 1ZGLB 2DQJL 3LEXB 1B3IA 4KY1H 2ENQA 3DX6A 5AOMA 2IWEA 3KWTA 2X09A 1CG9A 1R3KA 3IN0A 4HEMA 1IEBA 3QDHA 2VMDA 4ODVH 4L0ZA 1ADQH 3MNVA 3SOTA 3OPUA 4K7FB 4OF7A 1PFOA 1BZEA 2GUYA 5DRNA 5EBWA 3HS0B 4KZDL 4G6JL 1R24B 3GSXB 4EPSA 1HILA 5GGVL 5A16A 4HIQA 4NKDA 3KM1A 4A63A 1U2YA 2HXAA 2HH0L 2HFGH 4P2QE 5C3LD 4TMPA 4KJQD 3ZHKA 3QDAA 3SDCD 3U30C 2J1WA 2H1XA 4U6HA 2J25A 5CUSH 2NW3B 3VFRB 4BFKA 3I74A 1KIRB 3NIGE 5EU3A 1MRFH 3H7BA 5D96B 1E42A 1W91A 3C8KA 3CZSA 3KYMA 4J12A 4RESB 1P7QD 5FM4A 1NLBH 1SOKA 2EIEA 3CXDH 1U8MA 1VSCA 3LPGA 4KUZH 3WEXB 5L0QB 4QY8A 1Z0MA 5BS0E 4MD4A 2C8NA 4QF1B 1S46A 2QADD 3DHPA 3BPNC 2FIKA 1S5HB 4XPFL 3QIUC 1ET5A 3OAYH 4Z0BH 4ZMWA 3NRFA 3H4HA 1H9VA 5IVXA 3FCTA 2BNQA 5K1JA 4UOQA 1QNZL 4LMQI 1BPVA 1TQUA 3S5YA 3QR2A 3VXRA 4PJCF 1QO3A 3EGXA 3LIZL 3VXOB 4PRAA 3GT6A 2AAAA 2WQ8A 5E4AA 2Q3ZA 5ID1B 4EN3C 3QDME 4YL9A 5I23A 4XMLL 5I1GL 5DJ0A 2R4SH 5TDOB 4WI0A 4N0CC 1PKOA 4MX7A 1DVYA 3T3MB 1FO0B 4UM9D 4E0RA 5KS9A 4YXHH 3TBSA 3OLEA 5AOKA 1CBVL 3JV6B 3F00A 3BIKB 4KWUA 3N43F 2YWZA 1UWEL 4FA8A 3IPFA 2AEQH 2PPEA 1EBPA 4NNPL 4FA6A 4D9LH 5DVOA 2F53E 3R0MA 3NPSC 1WFMA 2HKHH 3FQNA 4HKZB 3MRPA 4XP1H 4JE4B 5HVGB 3U9PL 3X12B 2P5EE 1DQTA 1A65A 1J8RA 3FAWA 4I77L 1I1RA 1T20B 4ONFL 1F13A 4TSBH 5CGTA 1A3LL 2CBOA 4PJ9B 4UTBA 1B0IA 1OZUA 1RU9H 1NCWH 1V5JA 2IGFH 4OGAD 4PJ6A 5I6NA 2A77L 4AG4H 3LB6C 3S3PA 1QQDB 4HPOH 4U3XA 4A2MA 5DO2D 4MRCA 4N20A 5TK4A 5HY9A 5AVUB 2NOYA 1T3FA 2DLFL 4LVHC 1KGWA 4P46A 5FF6B 3NIDB 2LU7A 3V0IA 1AGDA 2HFEB 3WXWL 4KHXL 2H0FA 1P9MA 2PWFA 3HBGA 4G8GE 1W72H 2UZIH 3OGCA 2K8MA 5C0EA 1ETZA 1ZHNB 1KYDA 5C0RL 2Q7AA 5MERA 5D1ZI 1PAMA 3B3IA 1HOEA 5F3FA 3S4SB 4Y5VB 2J5LC 4BUHA 2CK0H 2QTEA 2VDML 2YQBA 2DQJH 1FFPB 3K6SA 2CO1A 4YE4L 1T1YA 4MQ7B 3WOVA 3AXLA 1LHZA 3WJMA 4M5YL 1U3YA 2EYRA 5JHBA 2RHEA 3F84A 1OE2A 1L9QA 1ZS8A 1G7LB 2F18A 2JXMB 1KNOB 4G9FB 4B95C 1WV7T 4KZDH 3UPCA 4G6JH 2FT7A 5D7LD 4EBQL 3RWFB 5GGVH 3MLVL 3MV8D 1RIUL 1MXDA 2HH0H 4BFNA 1S4IA 4YDNA 1JN6B 4N8PA 1RH8A 5E51A 4XBEH 3TU6A 3X1GA 1S7WA 3FQUB 3PABA 1USZA 2XN9A 4ESKA 3PU7A 4MXQD 3FOLA 2DLEA 5C0JB 4KXCA 1XB3A 4FL4B 2EH7L 3L08A 1RPKA 3N1PC 2Q3XA 3Q44A 2RCSL 2OTWA 4JFYB 4L3CB 2VLLA 4PSRA 4XPFH 3QYNA 1HXYA 5DVLA 2BNRB 5JHDD 3QJUB 1A4JB 2FX7L 4G43B 2OMBA 4Y1TA 4HIJB 1SVCP 3E3QC 4QT5A 1NA8A 3ZYOA 1RZ8A 4TM9A 1M2VB 4Q2ZA 3NYKA 1QNZH 1IAKA 4CW1A 4JZOB 4RBPK 1RFDL 3CHRA 1Z5LB 3LIZH 2QPDB 3K7UA 1KTRL 3E2HC 1GGIL 2QHLA 1N0XL 3GFUA 4NUQA 2AAVA 4ZJ9A 4Q4IA 4HV8A 5IM7A 3B7YA 4XMLH 5I1GH 4M8UA 2BC4A 1E2WA 3CCHA 4GG8A 5CCJA 1PIFA 3RWHB 3OMZA 2VSCA 4L4VA 4LOEA 4R5XA 5JUEL 2R2HB 4HUWA 3QR1A 1CBVH 1BFVL 4MNQD 3ZHFA 3UJIL 4RA3A 5TQ0L 4Z7WA 1O7DE 3Q5TA 5DK0B 5F7UA 1I1FB 2E9WA 1CICD 7PAZA 1P4BL 2JJTC 1F4WL 1UWEH 3N42F 4YDJA 4NNPH 1FNFA 4WK2B 2OR9L 3BPLC 3ME0A 3U9PH 3L17A 2W0PA 3N1MC 3ZK0A 3MLTA 4I77H 2YPLD 4ONFH 5C07B 4DVBB 1A3LH 4I8DA 1KDIA 4GXVL 5GS3A 1BQ5A 4YSSA 5DMKB 4P2QB 4OF6A 1ERNA 2A77H 3R18A 3HUJE 1HCVA 5A1AA 1KTJA 1YDPA 4HIEA 2EYSA 2DLFH 4I5BA 3WFBL 4L1BA 5ICYA 3WXWH 4KHXH 2BSSB 4NZUL 3T3PE 1U3NA 2ZP0T 2MQGA 2J12B 3S5ZA 3NJIA 3VX1A 4A37A 1ZV5A 5IUSA 1JSYA 2E47A 4AL8C 1MIML 2EDDA 3QEQD 4JG0L 3RI5K 4BH8A 5BS0B 3GDCA 4G7RB 3FTGB 1DQQA 3W9DB 5HHXH 4YSDA 3IFNL 3NPZB 1HQ4B 2FBRA 3V5HB 3OJ2C 1D9KD 1TLMA 3A6BL 4KH9A 3B2UD 3PXJA 3O3EA 4H26B 4JFTA 2VDMH 1IBZA 2XG4B 1FYHB 2R29A 2XIBA 2XKUA 1TCRA 3UC0L 4YE4H 3FN9A 1NAMB 1PAZA 5I19L 1BEXA 4M5YH 2YEZA 1F6FB 2HMIC 1ZE3H 5BW7C 4JQVC 3QDMB 1ZMYA 3ARBC 3OLGA 4BSJA 4Y5YB 4UOJA 2AW2A 2NY1D 3R4RA 4JFEA 4X9FA 4WFHE 1EANA 3RUGB 3VMNA 4PIBA 2OSXA 4GRWF 5C09E 3L3HB 1UB6B 1BW8A 1CFMA 3HB3B 2G0LA 5FKAA 5DFAA 4GB9A 4EBQH 2G75A 2BIQA 2FQGA 3MLVH 1RIUH 3MLWL 3WBDA 3KPSE 5F6HI 2LABA 2PPCA 1KB5L 2WIIB 4PJ8C 3W11C 1KPUB 1XFPA 2WVUA 1U8LB 4J3UA 3CQFA 3P3RA 5KOMC 2FWOA 3TFKC 2X2IA 3BAJA 5EZJA 4FA7B 5FB8A 3CFMA 1K9TA 4K71B 3HRZC 5JOPD 3TZVB 3BSGA 3REWB 3SBWA 1KBGL 5D4JA 4JJ5A 2JLPA 2P5EB 1BJ1H 3CFBA 3ELQA 4X6FA 1PEWA 1MAJA 4HH9B 2EH7H 4HMCA 3TA3A 1LWJA 1IGJA 4U1SA 1F3JB 3O2VL 3PGFL 1Q9OA 4AYFB 1T0NB 2FX7H 1G7MA 2DOCA 4P3DA 4YLBA 3L95A 4JFDA 5C0AE 2XZZA 4N2IA 3VI4A 4GBXC 4D3CL 1U8IB 2H6OA 1JZDC 3DX9A 3BVXA 1RFDH 4FQHB 4G8GB 3TF7C 2LFEA 3CZJA 4QXTB 5ETUA 1GGIH 1N0XH 1JUFA 2GFBA 3ZDYB 4I1NB 4QHLB 1AC0A 4JPKL 2Y7SA 3NJMA 5LDSA 5I18L 4A7QA 2CO7B 4ZTEA 5F7KC 3GBEA 3SOBL 3K74B 5GS0D 3EOTL 1FIEA 1I1YA 3NZ8A 3PQYA 2R9HC 5DTFA 1HZLA 5JUEH 2JCCE 4WTWA 2R23A 1N4XL 1BFVH 1W0WB 3UJIH 3TTYA 5TQ0H 1FFQA 3RZWA 4BK8A 4FXGA 4ECNA 4QRPA 1P4BH 1F4WH 1EZLA 2PTTB 1D5MB 2OMTB 4MHHI 1BF8A 4NLAA 3VQ2C 1Q9LA 3VXNA 2OR9H 3CHXA 1R3LB 3KW8A 3IK2A 3M86A 1SXZA 5KBLA 4BINA 3WHE1 1J1XL 1AXIB 5KBMA 3VTTA 4NCC1 1SVZA 2AQSA 4URKA 4NIYE 5K9KB 4X4XA 3T6WA 2F15A 4N2BA 4XNXL 2D9CA 2XQYK 4PJ5E 3MKKA 1HWWA 4LLDA 4MNGA 4XVUD 2KH2B 1TJXA 4AQEB 2B59B 2YXVA 4PY7B 4JO8A 3KPPB 3QI9C 2DYRB 1GSKA 1NBZB 2ESVD 4FFVC 3DGGB 4LOVA 4MZ3A 4NWTH 3O2DA 4BH7B 1I9JL 4JHWL 5HI4C 4OIBA 3WFBH 4PJ7F 4POZC 3W3BA 4NZUH 2ETWA 3SCMD 3OKOB 4P9HC 3LXUX 3SO5A 1NCHA 3MU3A 1MIMH 4JG0H 4YGVA 3U0WL 3VG0L 1AACA 4AGLA 3NJLA 2FJUB 5SV3A 2ALWA 1ONQB 3ECBB 1XTLA 3FT3B 3IFNH 2BS8A 4NSKA 5EZLB 3AQYA 3O2WL 3A6BH 3MROA 3BFQG 3PL6D 3UEQA 3D2UB 2R2CA 4NRXB 3WO4B 1AZCA 1PY4A 1G1OA 3MJ6A 1BQHB 3C60B 1ZGLP 2UUDH 2XCMC 3UC0H 2APBA 3BMVA 2W60B 4M56A 4P5MA 4UQEA 5I19H 4QXVA 5FIEA 3JSSA 4B7IA 2E7CA 3GSRA 4OVVA 1EDYA 1MG3C 2WQRA 4R7VA 4Y8DC 3ZE1E 1E7UA 4OCYL 4PP2A 3BRGC 4WFGE 4UQ2B 2F54E 5LDUA 4KJPD 2Z0UA 3T09A 3SPCA 4WWKD 5CEYA 2PYED 3MLWH 4POYA 3DX1A 3IJ7A 1KB5H 3ROLB 3AS0A 2IANE 5IFHL 3QUYD 1SY6A 1AJ7L 4X5QA 1WFJA 1U8PB 4XNQA 3UZVA 2GIYA 4YNYB 1KBGH 3NK4A 4HG4K 1TKWB 4FQ2L 3UFIA 1J0JA 4E9XA 2ENJA 5C2UB 3MVSA 1X5FA 1USQA 1U21A 2DZEA 4UQIM 2PPFA 1W0YT 4G8AC 4NQCE 1TVDA 5KEZA 3IE9A 4QNPE 5GZOD 4KHTL 4MZ2A 1NFIB 3PWPA 2NUPB 3O2VH 3PGFH 2P43B 4GKSB 5T5FL 4HU8A 3ILPB 4CMHC 4LOUD 5KYXB 3IXAA 3DJ9A 4TUOA 1GS8A 3QNFA 1OW0C 1TYEB 4AM0Q 4D3CH 4Z77A 2GSGA 3RTLA 2APVA 2XZQH 4RFNB 1XQ4A 4KOBA 2ITDB 3VG9C 5L8JB 1E3ZA 2PCYA 5IMOA 1AGBB 4HIHA 3CG8A 1TDQA 3IDJA 3QIBC 4L3EA 4Y4FC 5DRXA 4DEPC 4W9EC 4FEMA 3N85L 1MI5E 1JPTL 4NFDA 4OLWL 1SXAA 4P2YA 4E41D 4JPKH 2A1WL 3SKOA 4W4OC 5DEFB 3ULVC 2P44B 3S6CA 5I18H 3MJ9L 5IHZB 4XNMB 2VLJE 3P73A 3SOBH 2YAFA 3T77A 2OI9B 3EOTH 5DHVA 5E4IA 5IJDC 3VRLF 3CZFB 3HE7C 1OSZB 4WCYL 1BP3B 3JWNC 1KENL 1N4XH 1ORQA 2ORBL 2VL4A 2YLHA 1HWHB 3NJHA 4ZAKD 1M7XA 3LNDA 4XBGA 2OSWA 3HNTL 4AYGA 1HEJC 2IALB 1KJVB 2EO9A 4OZHE 1J87A 3UTPD 5CSBA 5DEGA 5DMGC 4AUJA 1NIAA 3BH8A 2BW4A 1J1XH 5C09B 4E5XB 5C08D 2D03L 5FKPA 4TUJA 4OFIA 5DD0L 1FVEA 1Z9SA 3VWJB 4LPVA 3ARZA 1DVFC 2OYKA 3BYYA 5IQ7L 4ORZC 3QZOA 3ARVA 2BERA 1QACA 4OFKA 3QQ9C 4XNXH 4AYEC 1ZT1A 4C4BA 4UNVA 1LE5B 3N41B 4I0KA 3MRGA 1J18A 2HJKA 4PMEA 4QHNB 1ACYL 4TNWF 4U6YB 3WY4A 4B5ZA 1ECZA 4F2ME 5A2FA 1LEIA 5DU7A 2VRKA 4KKCD 2VN3A 4MDRA 4MCZA 1AD0A 2IV8A 1KGIA 1I9JH 4JHWH 1G6RB 1OSYA 4K7PY 1YUHA 4MA7L 4X4ZA 4XBPB 3RGVD 3VFGL 5HHQB 2X6BA 4JDEB 3CN0A 4WKZB 5B38B 4M5SA 5EIIB 3K1KC 3IJSB 1UXLA 3T8VA 3O11A 4QRQA 3VG0H 3U0WH 3WFZA 2CD0A 1FNGB 2GQHA 5ANME 5F7WC 4PJGA 5I0WA 5FFLA 1R0AL 3LX9A 2QZ5A 3O2WH 4HCIA 2NQ3A 5C0AB 1YC8A 32C2A 3ISWA 2EADA 4GLRH 5K93A 3O8XB 4AVHA 2FEJA 1IEAB 5CLWA 4JM4L 3C2AL 5I1EL 2E6QA 2FECL 3VXUD 5BPPA 1CFQB 2APTA 1P7KA 1JVLA 3RQ3A 2FEEI 5I74B 3ILQD 1G7HA 4M8QB 4NUPA 4A1RA 4NO3A 2MKLC 4I0PA 1FNSL 2UWEF 1WBZA 3BQVA 1AGCB 3PWVA 4PCKA 2VLRA 1PLAA 4JZJB 5IHHA 4XT1C 3L5XL 4OCYH 3GMNA 1O6SA 5HGDA 4OFVA 1CFVL 1BIHA 2UXVA 2DWEB 4KC3B 2JCCB 1JPEA 2O30A 1G9NL 5KZCB 4GG6A 1UM4L 1BZQK 4LPCA 5IFHH 1AJ7H 5DZPA 1JHTA 1N7ML 3B9KB 4X0KB 1XCXA 4HWZA 4FQ2H 4PSPA 3IS1X 5BV7L 2LVEA 1EEYA 4ODWA 2YD6A 5KVFE 3TEYA 3VFVB 3TBTA 2JE8A 2V5TA 1TQBC 4W93A 4JJOA 4B5EA 4LEEA 2GJ6D 4KHTH 4PJ5B 2YUWA 3SPVA 3T4AC 4LSQL 2YD2A 2CNZA 2ZOLB 5T5FH 1QG3A 3GLEA 2FYVA 2XBDA 1A5FL 3QIWB 4YO0A 1QBML 4Z23A 2Z8RA 4DPRA 3I75B 1I3UA 4PCSA 4CSTA 2GIMA 3VGEA 5DT1L 2NXZB 3HMXA 5LBSA 1E3XA 1BQUA 1RP8A 3GMPB 4D8PA 2OMWB 3RJQB 1QP1A 2R4RL 1SRDA 2NY0C 4KXZH 2Y2WA 4AKPA 3N85H 4OLWH 1JPTH 2ZAIA 3CVBA 4F57L 2A1WH 5FW6A 3TBYB 3UCRA 1J48A 3E6HB 4MMZB 4EIZC 5C9JB 3H3PL 4Z3GA 2QR0A 2BW5A 2ZYSA 3H6AA 3MJ9H 4I18A 5AVQB 1FZOB 4ZUUB 4TL5A 3TNMB 4XPBL 1UEYA 2DIJA 2ZNXA 2CGRL 4R26L 5EPMB 3SZ6A 3K72A 1E67A 3U82B 1W15A 2Y23A 1DJWA 4PLNC 4WCYH 1PW3A 4L4TE 1GTFA 1KENH 4N2HA 2ORBH 2N01B 2OSLB 3BRFA 1FHGA 2FX9L 3WKNA 3ESUF 4RIRB 3HNTH 4G2AA 4UOZA 4UIMA 2WZ6A 5DA4A 1F56A 1JPFB 1QEXA 3Q7JA 3GBML 2X5PA 1SVBA 2QQNL 1ZV9A 1OP9A 3OZLA 3ABGA 3ZE1B 4UAOB 4D9QE 4PM1A 1TIUA 3J2PA 3V6OA 4WW1B 2D03H 1V7NL 2FYYB 5M95B 3EO1A 1W0VA 3ARFB 5DD0H 4P2RA 4EE2A 4GP5B 1XGQA 5IQ7H 1FL6B 3K0YA 1PG7X 2B4CL 4DKAA 2X40A 3Q01A 1JMXA 3ML9A 3QUXB 5HHMD 1ZY9A 1ACYH 2IANB 4Q7DA 5AVVB 5IHLB 5EU6A 3TLRA 3NVQA 5FA3B 4XTRD 2ZXEB 3EJSA 4MA7H 3VFGH 5D7EA 1NIBA 1JCKA 1JD7A 4C8XA 2Y6TE 1NIDA 3NAAL 4FI8A 4AKQA 3K2IA 4KRMB 4WKXA 1CGSL 4OZ4B 3UH8A 1FJ1A 4NQDA 4N90D 3O6FC 4PV8A 2JB6B 1R0AH 3FQRA 2GC7C 3UDWA 3VU1A 1J5DA 4S1DD 5CN3A 1SQMA 4OTXL 3T1WA 5EOTA 5I1EH 4ZFZA 4JM4H 3C2AH 2XVLA 3HZ3A 2OFQA 2GSIA 1OP4A 4JB9L 1F6LL 1L9OA 3B7RL 5JPMC 3SSGA 1AXSB 1J8HE 5IQ9B 4IRJD 3M1BA 3II2A 4YDKL 2A74C 3M7OA 3JYBA 4X6CF 4Y5XB 5D4QA 1MW3A 3E8VA 4OVUA 1PDKB 2EECA 4P4KA 2R7EB 3L5XH 5J57B 2ZIDA 1CFVH 2VLJB 3IDMB 5CZXC 1JTOA 1FV1B 4IRSA 2H1PL 5CJXC 2H2SD 5J1TC 1VACA 2F5BL 1G9NH 2F8VA 4PWFA 1XAKA 3EZJB 5ENWB 4WTZA 1UM4H 5HGBA 1KYOK 1ZGLA 3NABL 3VGGA 3LEXA 3U36A 4OZHB 2F19L 3EO0B 4M7ZB 1N7MH 1UWGL 4GAYB 2H7WA 5C0CE 4ZUVB 5BV7H 1MCIA 4HUUB 1N5AB 2XA3A 1KJ3L 4LSVL 3ZVVA 3WDIA 4K7FA 4XNUL 5JOEA 3HMXL 3QXVA 5EBLB 4LSQH 3HS0A 4QRUB 3HZYB 1A14L 1X3DA 1R24A 4F2MB 5FOBB 1YMME 3GSXA 1A5FH 1QBMH 1AS8A 2ZXAA 4QCIA 3W38A 1REIA 4P5TD 3TJHD 4YHKL 3U2SB 2WXOA 4B41A 2YXFA 4DPBX 5KSVB 2R4RH 1GVIA 2NW3A 3VFRA 1KIRA 3WMPA 1SN0A 5EMYA 5TPWL 1RERA 4F57H 4P23D 1GZHA 3HI1B 4ETQA 3VD1A 3WEXA 1KGJA 2JWYA 4N9GB 1E8ZA 4F5CE 3H3PH 3LY6A 2WXNA 4FQPA 2EYTB 3IMSA 2HSIA 3GS7A 4QF1A 4E9TA 3C09C 4PGJA 1F41A 4XI5C 1S5HA 4XPBH 2CGRH 4R26H 4BCYA 5LXGL 3WDJA 2MQ0A 4WO0A 1PD1A 5DWPA 3KZ8A 1A8JH 2FX9H 4WI7A 2YRLA 2IPKB 4GKZB 3GBMH 3VXOA 2QQNH 1PYWB 3QVAA 5I5RA 3Q1SL 5IBUG 3WN6A 2HT4C 5EU5B 5I6MA 5ID1A 2YPKB 1V7NH 2HX8A 5TDOA 3HPLA 4PP1C 4NBYB 4PHXA 5H8DA 4YAQA 2B4CH 5TGBB 4HMDA 1FO0A 4OGZA 4BK5C 3KS0J 3C2SA 2EDBA 5T1KD 3V8OA 3WTUA 3MA7B 3BIKA 3MSPA 2M1KA 3KVDD 1UFUA 3QUML 2C1OB 1GY2A 4FMVA 3UEZA 1DVUA 3NAAH 4K0OA 2UVFA 1KXVA 5CU5A 3LDBC 4HKZA 3X12A 1CGSH 2IVFC 2AJVL 2RJMA 5E6RB 3R7RA 1TZGL 3GMLB 1AQ8A 3RPBA 1SOSA 3D06A 5D2LE 3NESA 5E94B 1T20A 1ZAGA 3FW6A 4MDJB 5FDWB 4KV5E 4PJ9A 4OTXH 4E9VA 2IDTA 1YNLL 5GGUB 2IGLA 1QQDA 3MRLB 1JE6A 4JB9H 5D5ME 3QFJA 4YDKH 5FF6A 5IMLB 2HFEA 2J8OA 4I2XE 1HN1A 2VDQL 1NINA 1UOVA 4GKLA 1N19A 3VXSE 1PLCA 1UB5B 2BMKB 1K3IA 1UKSA 1N68A 3CVIL 3SD2A 1IM3B 1W9XA 1ZHNA 2WVSA 2H1PH 1SYVB 1MCKA 3FHEA 1QFWI 2F5BH 1CYXA 5KSAC 4DGIL 3S4SA 2CLZB 3N1QC 4Y5VA 4MAYC 5E1QA 4MLSA 2Z7WA 3NABH 1CR9L 5I0XA 3ZDWA 1S7VB 4I48B 1FFPA 5DO8A 5KAQG 2XWBB 1XV8A 4MQ7A 2PO6B 2F19H 2H4EA 4GT0A 1P5UB 5BCAA 3NSJA 1KFGA 1UWGH 4S1QH 2N7SA 3TOPA 2PWEA 3Q6FB 4FFZA 2V2XA 4AEIL 4M43L 4K94L 1G7LA 4LP5A 4WW2C 3HA0A 1KJ3H 2JXMA 2QKIC 1KNOA 5B3SB 2W59A 5KYNA 4EDXB 3AB0C 4XNUH 4G9FA 1JRHI 3VO0A 3HMXH 4KQ0A 3OAZK 1A14H 1THCA 1OD7A 3DIFB 3C5ZD 3L16A 3RWFA 4AQOA 1IEHA 4H2AA 1BQSA 2EIDA 4XO9A 2WBJB 1UCTA 2V3FA 3NA9L 4YHKH 1JK9B 4N1EA 1DVTA 2WTOA 1JN6A 3LXAA 3OMIB 4U0RC 4LRIC 1FNEB 4KJQC 4KTEH 4LPYA 3SDCC 3FQUA 1DUYB 3BSZA 4XO8A 5HDRA 1KBVA 4FTVE 1JZJA 5TPWH 5C0JA 9CGTA 3LS4L 1OB0A 3AITA 4IIQC 1AZBA 4IKJA 3OB0H 1R4XA 1ET7A 4JFYA 4L3CA 1BYNA 1OZTG 5BXFB 3DPDA 2BNRA 5IB4B 5LXGH 4CBZA 1A4JA 2QADC 3M1OA 2E8ZA 4G43A 1S7SB 2IH8A 2QGBA 2XVBA 4HIJA 2WB7A 1M2VA 4E68A 1J1OL 4NM8H 4MCMA 4JZOA 3VD3A 4MJ5A 1Z5LA 2L4OA 1AQDB 1QASA 5EU7E 4H8PA 2IDUA 3Q1SH 1I85A 1R47A 2D3LA 4XPTL 1OF0A 4WTQA 1UD6A 3LZRA 1G43A 4AQ8C 3H3BC 4GQ9L 4YOKA 3RWHA 3KGTA 1V05A 1GAFL 2X4PB 3BHBA 3OR6B 2Y06L 1NCCL 2CM5A 5HYQB 2R2HA 4EZLA 4HAGA 2XN1A 4HULB 1KGYE 3UTTE 5DK0A 3NMEA 5C0DB 3ZTCC 4J5VA 5C0CB 3NCEB 3QUMH 4NENB 2YMXL 3L3JB 2KQMA 3RX7A 1HFUA 2O6PA 2Y9RT 1RK1B 3MXWL 4TQEL 4NEHB 2AJVH 2VQTA 1TZGH 5IVXF 3HG1D 3II3A 4N3TA 1BVOA 1YMMB 5JHLL 2GIXA 1KPVB 1R3JB 5C07A 1IFHL 2VT0A 2HLAB 5DMKA 4P2QA 1YNLH 2YOCA 1SJXA 4Y2OB 4OZGE 3QW9A 4OGAC 4M6ML 1UASA 1TT6A 2WM0A 5DO2C 2AITA 5I71B 4OAWB 1KJ2L 3MMEB 2EDEA 2Y07L 2NT1A 2VDQH 4QLRA 3NCBB 2W5PA 5KVGE 3BGFC 5D7LE 5KS9F 2GYSA 5BS0A 3CVIH 3FTGA 4TNGA 4N2OA 5KSBE 2NDGA 3FHQA 3W9DA 4YSRA 3D8MA 2CDFB 3PHOB 4U0QB 5T1DH 3WG7B 5HP5A 4DGIH 4UT6L 3SE4A 1QBBA 4XO5A 1M2OA 1CLOL 1N2RB 4H26A 5D93C 4K9JA 2XG4A 3Q05A 2A4EA 1CR9H 3D05A 4H88L 2P26A 4HUXB 1R6VA 1NAMA 4KO9A 5A6MA 3H2PA 2YGVA 2CO4A 5C70A 2ZF8A 3QDMA 4MDIB 3CFCL 4R3SB 1Q72L 5I26A 3RU8L 2XPGB 2VJ8A 4AEIH 4M43H 2ZAHA 4K94H 5HHVL 1MOEA 2H2PD 3GRBA 4Y5YA 1GCFA 3ZMEA 2WTRB 3GSWB 5LGYA 4PRHB 3RUGA 2YUVA 1S9WB 3C9NB 3ECQA 4WUUD 1RZIB 1UB6A 5F0MB 1RLBA 2G2PA 4ENED 3EFFB 2WKOA 4NQSA 1X44A 2FWUA 3BSZL 2HFFB 3EH5B 3LZLA 3OKYA 2J21A 2A9BA 3G7TA 2ZWZA 2WIIA 3R0NA 1KPUA 1SGKA 1U8LA 1TQSA 3HHSB 3NA9H 5FYJE 4Z7OE 3OKEB 3PP3H 4PRIE 4H8WL 3B9DA 3WN5B 5J13C 1MVYA 3TZVA 3REWA 3KPRD 3LZQA 4YIQB 2CUMA 2P5EA 4QGYA 2F1BA 3G5XB 3LS4H 2DF3A 5D2LB 4HH9A 2KT6A 2C4FT 3MRRB 4MXQC 1AP2B 2CKBB 3N1GC 2IG2L 4DNLA 1F3JA 3QJFB 1WZLA 4AYFA 4ABUA 1MCWW 1T0NA 2H3KA 1UH3A 5D5MB 2XQBL 2J4WL 1R75A 5IOKA 1T7ZA 2P5WD 4PAZA 1J1OH 1U8IA 1UGNA 4I2XB 4FQHA 4G8GA 2EUWA 2WXKA 3VFSB 3VXSB 4DGYL 3AGWA 4FNUA 1GPOL 1QZNA 3FZUD 4HHAB 4XNDA 1Q0YL 2E46A 5J9PB 4XPTH 3FOMB 1FC1A 2YD1A 3NEXA 1WFIA 3A0OA 4GQ9H 4KOCA 3VFTB 1GAFH 3RB5A 1V55B 3MRQB 1NCCH 1MFNA 2H45A 3F85A 5BO1H 1XF2B 3SY6A 1W0WA 1BQHG 4BV1A 5AW2B 4L5FL 4BXSV 4JRXE 3LZPA 4XRCB 5BQ7B 3HNVL 2YMXH 2AGJL 1D5MA 2OMTA 3K6DA 1CICC 2ZUQC 2QJDA 4E9QA 4PU2A 1R3LA 3VI3B 4MXVF 5I6PA 3MXWH 1A6ZB 4IJ3B 4NXKA 1CF8L 4TQEH 1TENA 3ARWA 3T2OA 4BKTC 5LNDA 3TIDB 2Y3NA 4M4RB 4IYKA 5JHLH 5K9KA 1WAPA 4RZCB 3TNNB 4WWID 1IFHH 4X99B 1DN2A 3DYOA 5KJRL 5DZOA 4AQEA 3QT2A 2B59A 4PY7A 2PXYB 5T3ZD 1CIUA 3KPPA 3MR9A 1NBZA 4M6MH 1QSED 3DGGA 4BH7A 4FG2A 3PDOB 4LPTA 4MB4A 5D1ZD 1KJ2H 4FTVB 4TVPE 5FR3A 2Y07H 1UA3A 3OKOA 3FO1B 3T4YB 4P2OB 3ZIYA 5IVZB 1AS7A 1LILA 3W39B 2EVGA 1R3IL 1XGUA 1OHQA 2H9GB 3KWUA 4GQQA 1U8NB 1ONQA 3ECBA 3FT3A 3DMMD 5EZLA 2AMGA 4Z7WF 4BM7A 4ZFGL 5KN5B 4OF0A 1DSFL 4PBVC 2CHDA 3OHXB 3PHAA 4JDZB 4UT6H 3TV3L 3OXRB 2NSXA 5JOPE 3D2UA 2E7DA 4M3HA 1CLOH 4NRXA 1D9KC 3PAZA 1BQRA 1BQHA 3C60A 4H88H 2OLDA 3FUHA 3B2UC 4HDIB 1JXKA 2X6CA 4AGNA 2W60A 1P5VB 1TTBA 3HKZA 4IKLA 4U49A 5GRJL 1DQKA 2XN0A 5SX4I 1U6AL 3CFCH 3RU8H 1Q72H 1YLBB 5HHVH 2CNYA 1UM5L 2X9YA 2K4AA 3GXTA 4EKXA 1KC5L 4TV3A 1ZV2A 4UQ2A 3TV8A 2DQTL 2NY1C 4TQHA 1UG9A 3UP1A 3PXLA 4XNYL 4YHOL 3G6JB 1BOYA 2L8AA 3NIFF 4R97B 4K3GA 2VKXA 3BSZH 4XB3A 3INOA 3VNZA 3UTTB 5EULV 4YGAB 3EF7A 3ROLA 4H2CA 3TEZA 2ZZUT 3CZUB 4IU2B 1K4DB 2GT9B 1FSKB 5CEZL 5FO7B 2B3RA 4CN1A 1U8PA 4H8WH 4PWJA 4CMMB 3I6LD 4YNYA 2DBLL 2Y1AA 2X7LB 5DHYB 1TKWA 3R06B 3TH2T 1GOGA 1ZLDA 5B8CB 1E43A 1IBYA 3CX5K 4HOZA 4ABVA 5JQ6L 2JI2A 1Z5HA 1P69B 1NFIA 2IG2H 2NCEA 3Q2NA 4UMSA 1JDAA 2NUPA 3HUJA 3BUDA 4GKSA 1DE4B 4OZGB 3MBXL 4FNPA 2XQBH 2J4WH 3GK8L 3TO4B 2F58L 5ECGA 1TMCB 3W81A 1UUSA 1LP9F 2ITDA 3S37L 4DGYH 2BNQD 3TVMB 4NN7C 1GPOH 1AGBA 1Q0YH 1OANA 1R19A 3ARGB 1K6QH 2PPAA 1KEML 3TYFA 2AZUA 3VXRD 5KSBB 2Q7YB 2AQQA 1RZQA 3LPPA 5DEFA 4PBWD 5LJYH 1Z9NA 5IHZA 4XNMA 3LPOA 2ESVE 3X3GL 4X7EC 3BPOB 3KYKL 2ITCB 1SYSB 3EBAA 2VMJA 4R9HA 5E9DB 1OSZA 1PZCA 4NZTL 5HHPB 4D0CB 3O4LA 5GS0C 2AVGA 1H6TA 4A7VA 2X9XA 4I13B 1RXLA 3NTCL 1BG1A 4L5FH 2IALA 4HISA 3BWZA 1KJVA 4M7LH 3HNVH 3T6VA 2AGJH 4KO5A 4XAKE 1I7RB 2WB1A 4EAEA 5IOPB 4XWGL 2VR4A 2VDOB 1IAII 1CF8H 2HVBA 4ZO7A 1IT9L 5C09A 4E5XA 3VI4F 4JO2L 1JIBA 1EPFA 1RUKL 3VWJA 1BZ7B 3ZZSA 4F15C 5TF1L 2OTPA 5JIPA 3ZE2F 3B5HA 1LE5A 5KJRH 2B9AA 3S7GA 4MKTA 4U6YA 5D1QB 3ZKXB 1CDGA 3VGHA 4ZPVB 4XVUC 4AMKL 4Z7OB 4HJGB 4JG1L 1JNHB 4PRIB 4ZOCA 4NP9A 2JJVA 5FUZL 3CLEL 5DVPA 1G6RA 1M9SA 3WENA 3SD5A 3NGBC 4XBPA 5HHQA 2C3HA 4JDEA 4WKZA 2IXQB 2AEWA 4L9LC 4NUMA 3P4MB 3HMWL 4U1GB 3IJSA 3V0JA 3VVWA 5B38A 5EIIA 1ESOA 2DJ4A 1UM6L 4P46D 1X6NA 3CVHL 4PJBE 3SCMC 1R3IH 2O5XL 2PYEE 1J5OL 1FNGA 1U92B 5D72H 2BH0A 3MRBB 3UG4A 1FVDB 1MQ8A 1JBJA 4L1LA 3REVB 4ZFGH 3G08B 4LPXA 1EHLL 2WO3B 5C0AA 1DSFH 2PR4L 4TYUA 4XHJD 3MI6A 1KLUB 3O8XA 4XMZA 1IEAA 1EFXB 3PL6C 4ZD3L 1CFQA 2IDCA 1U3HB 2X6VA 5TJWK 2R83A 5GRJH 4C58B 3D09A 3N6YA 4XR8C 1HC1A 5DUBB 1U6AH 3MO1B 5B1KA 1CLYL 5LXVA 1AGCA 3BP7B 3BJ91 1XMWA 1CI3M 1IC7L 4JZJA 4DKFL 1UM5H 4E9RA 4R7XA 1KC5H 3QG6B 1HKLL 2DQTH 3ARUA 4H7VA 2DWEA 1T89C 4GJTB 3D85B 5C0IB 1CN4A 4XNYH 4YHOH 2O61B 2JCCA 4KJPC 3UIZA 2QKSA 5GGRB 1DBBL 1TO5A 4P3WA 4YR6B 4AGOA 1F90L 3BH9B 1HINL 3KS0H 4WWKC 4JRXB 1WA1X 3BYTA 5IQLA 2NZ1A 1QUNB 1UXWB 1S78D 1JOIA 2DH2A 5CEZH 3AWFA 3GZOA 3IU4L 5J12B 3CBRA 2MOGA 3QUYC 3JVFC 4EUPH 3B9KA 4X0KA 4PLKD 2DBLH 2NYYC 2YHGA 1RPQA 4HZLB 4XMKL 3B37A 1U4EA 3HCVB 2XN9D 5CWSB 2OTUB 5KVDL 5JQ6H 4PJ5A 2G5RA 4QWWD 5GZOC 1A0QL 3U9UB 1TTRA 1D6VL 2ZOLA 3V79C 5DWUL 3QIWA 2NY6B 3MBXH 1WG3A 4YX2L 2ICWB 2VERN 3FH5A 3I75A 3MBWB 3WTWA 3HAEB 4OD1L 3ZQWA 1MLBB 2IO5A 4LOUC 3GK8H 3WY1A 1AR2A 2F58H 4FE9A 3EYUL 3FO0L 3S3CB 1MVFA 4M6AA 3S37H 3UG3A 2W92A 2OMWA 2I9TB 3CFUA 3H9ZA 1KEMH 3KLQA 5GRXG 1GS7A 1DQDL 3FQ4A 3S8WA 3TBYA 4HC1L 3FCUB 3E6HA 3BVNB 4MMZA 5C9JA 2OJZL 1ZCRA 4LL1A 4KFMA 2X1WL 4KROD 1BDYA 1FZOA 1LYQA 4ZUUA 3X3GH 1H5BB 3TNMA 1LVEA 3KYKH 5EPMA 2BVYA 3HC4L 6CGTA 3BN3B 3CHSA 5FYLD 2PTVA 1CIDA 3GZPA 3OTTA 1QTSA 4NZTH 3GIZL 2OSLA 4L4VD 3GWJA 4G6FD 2BXZA 2WLYA 3CE1A 4RIRA 3NTCH 1ZJAA 3AY4C 1VIWA 5DYFA 3UIYA 2B77A 4ZAKC 1TNMA 1FLTX 1JPFA 3UG5A 1OY3B 4B0MM 3P3TA 1QVOB 2VR3A 4XWGH 4JO3L 1LLAA 4R83A 4WW1A 5H4YA 5AYQA 1IT9H 2CA3A 2FYYA 4MKMA 4JO2H 1HX0A 3SGDI 3ARFA 1RUKH 1DO5A 1Z2KA 3FUIA 4J3OH 3KXFB 5TF1H 2Z0BA 1FL6A 1HL5A 3QUXA 1NDGB 2JKJA 2CHZA 1SDYA 1F3RB 1DVQA 4K07A 2IANA 1DBML 4JG1H 4XB8A 4KI5E 4F37K 5FA3A 1ES0A 5FUZH 3CLEH 3V0GA 2J7LA 4KKCC 3IF1A 3M46A 1INQB 3MQIA 3RGVC 1MCLA 3HMWH 4PJXE 4BK4A 4NQCA 1UM6H 5H2BB 1RZ7L 3CVHH 1J5OH 2O5XH 3K2KA 4PI2A 2YQGA 4OZ4A 5J8OA 3BWUF 3FH7A 5I1JH 5I9QC 2JB6A 1CDYA 1EHLH 2B16A 4IHOB 2B7DT 3NJGA 2PR4H 2EXWD 2ZKMX 1EEUA 1GGTA 1H3UA 4YJZL 35C8L 1MFUA 3KPOB 4FQCL 4N5UA 4WSKA 3WLBB 4ZD3H 3N44F 2ZAGA 3H9YA 1AXSA 4JJHA 3NCMA 5IQ9A 3IMVA 1WBYB 1SFDA 1FE8L 4FKHA 3H3KA 3ILQC 5ITFB 2GHZA 3ARPA 4Y5XA 1CLYH 2ZXQA 1IC7H 4DKFH 4CSZA 2R7EA 4M5ZL 4KX7A 3TJPA 3EJZD 5DJ6B 2X1QA 4M00A 1HKLH 2VLJA 3IDMA 4JEGB 4ACPA 2X6UA 1FV1A 3FC8A 1AMYA 2ZUVA 1DBBH 4ETYA 4CGTA 3U9WA 2YBGA 1F90H 2JNZA 1HINH 3SN6N 3VXPB 3QULB 4B9JA 1GMIA 3DTUB 4R84A 4TSAL 2W9LA 5EO9B 1ICTA 4OZHA 3EO0A 3IU4H 4PJGF 3RURA 2FVNA 4CL7A 2AQNA 2JKXA 5JXAL 4GAYA 1JWMB 4ZUVA 4XMKH 2C9QA 1N5AA 4HUUA 4PJ7E 1BG9A 3MZTA 3OM3B 1SHXA 2YD7A 1U9KA 5KVDH 3PG2A 5CSZB 1DDTA 4EQ3A 1YEKL 3U4BH 5EBLA 1G6VK 4QRUA 1A0QH 3HZYA 4JM2F 1D6VH 4F2MA 5FOBA 5DWUH 1NUNB 3TA3D 5B39B 2WO4A 1MWOA 4A7SA 4YX2H 1C7SA 3LQAL 1ETA1 2OS7A 4BZYA 5KWYC 4OD1H 3ULUE 5AB2A 4U1LB 2IBBA 3EYUH 4JFDD 3U2SA 4O51B 4A04A 5KSVA 3QDJE 4RAUB 4H1LB 3WNLA 3K6FA 4ZMPA 2H5UA 3HZMB 3KJ6L 3TCLB 4AK2A 5ANMA 5BOPA 1DQDH 1FYTE 1CC3A 3HI1A 4JFUA 4HC1H 4N9GA 2KDGA 2OJZH 2EYTA 3P30L 2MNJB 1DTUA 3NCWA 3HC4H 4CUCA 1JDDA 4N26A 4PJAE 3KBPA 1DQML 1BAFL 3GIZH 3G5YB 2BM3A 3PQYD 5B3JF 2IPKA 4GKZA 5E7BA 3BPCB 1Q9WB 3DO4A 2EE3A 1PYWA 1WISA 4QRPD 3B9EA 5I8EB 4JO3H 5EU5A 2YPKA 1JHKL 1VF5C 5DI8B 3QJHB 2DIBA 1FPTH 3ZZLA 3VFPA 1HIML 2EVHA 1MPAL 2GEQA 3K3QA 2O6FA 4KMTL 5TGBA 1Z9LA 4PH8A 5FYJU 4OV5B 1XSIA 3OWRA 2MHAB 4IK7A 4D94A 1DBMH 1UOWA 2FO4A 1UD3A 4HVBA 3MA7A 4ZI8A 1NANH 2A0LD 2XTJB 3EUDA 4PTTB 4XTRC 4AJVA 2C1OA 4DP1X 3MFFB 2SEBB 2XFGB 3IRZA 5INDB 2D7TL 1RZ7H 2YEVB 3QNXB 4LO9A 2OBGA 1OK0A 3K91A 3GMLA 3WCYA 1G1CA 2YSTA 5E94A 4G6KL 4MDJA 5FDWA 4AI7A 1BX2B 2VZ3A 35C8H 5DMJB 3BPLB 3KPLB 3MRCB 4BSWB 5GGUA 4FQCH 2DLTA 3MRLA 3TO2B 2V2WB 4U31A 1HHIB 5ILTL 4TTDD 3BUIA 1YEFL 2WSPA 4U33A 5IMLA 1FE8H 4IRJC 3FSWA 4UUJB 4H40A 2DEYX 3MRMB 3Q5OA 2C9UA 4M5ZH 1UB5A 4NB7A 3COOA 2LU4A 1WIOA 2BMKA 1DQIA 3DI3B 4J8QA 2XHNA 1IM3A 5T1MB 1X9LA 3F7YB 1SYVA 3L1EA 4PGEB 5E8EA 3FTUA 3WNMA 2EXTA 4AQ1B 4NQEB 2CLZA 2H2SC 3JV4B 4TSAH 1S7VA 4I48A 1U0QA 1H6UA 2XWBA 2FBJL 2PO6A 3KD4A 4AGMA 1MJ7H 1P5UA 3AQXA 2H1LM 4PQXA 4YSTA 4HXBL 3EBHA 3QPQD 4HEPA 4LCCC 3Q6FA 8FABB 4UCFA 4DP4X 2VXTL 5I8CB 5LG1A 3TONA 1KSRA 1U36A 1AE6L 3JBG7 4EDXA 1YEKH 3RI5F 2IAAC 1TETL 3BQUB 4HW6A 2JI3A 1UWXH 2AZAA 2NY7L 1MDTA 4PW4A 3K8LA 3DIFA 3DBSA 3WD5L 3PWPD 2D7QA 3AU0A 3LQAH 2CLRB 5JTWA 2WBJA 1HE7A 5FUCC 1E5ZA 1BIIB 1ASPA 3SKJL 1PG7W 1FH2A 4R0LC 1I9EA 1X7SA 1JK9A 1QA9B 1M9WA 2JKNA 3JT2A 4TNEA 4DVRL 3MC0A 1FNEA 4U1MB 4WWOA 3TJHC 5I8OH 2K78A 3UPRB 1DUYA 3WU1A 5DK2B 3KJ6H 4ZQTA 4UTAA 4HBCL 3WE1A 4BELD 3KAAA 1E7VA 3ZDXF 3STZB 5CKAA 3GMOB 4ILDA 1BM3L 3F6IA 3Q43A 5G4OA 4HJ0D 4JRYE 1NPJA 4L3ED 1WWAX 4P23C 1DL7L 4PLOB 4PEEA 1A9EB 3P30H 1WICA 3FQWA 3G3LA 5IB4A 5BXFA 5DDHB 4OKDA 1DQMH 1S7SA 1BAFH 1WWCA 2G3NA 3P3YA 5EO0B 2EAEA 2QQLL 3KGUA 5A40E 3AG3B 4NC2B 3EF4A 4BFJA 2HG5B 1AQDA 3EOAB 4H8QA 4PGBA 4PJFE 4UNUA 4UU9B 4F24A 1I9IL 4QXUL 2NNFA 3PWNA 4GBXB 1JHKH 5C7ZA 4Q9QH 4XP4L 2QPUA 2J8UB 3QQ4B 3RDTC 4UMGA 5CLZA 2CR3A 1HIMH 2H3NB 1MPAH 5D9SB 1NMCB 2X4PA 4KMTH 3OR6A 4RGNE 3RG1C 5HYQA 5E03A 4RCAA 5CJ5A 4K8RD 4EI6B 3QEGL 1TQCB 2Z8SA 5C0DA 3U0TB 1JF1B 1ADWA 1NFDE 5C0CA 4NENA 3BD5A 1S7RB 3L3JA 2R51A 3X2QB 1CL7I 3RJDA 2CDGB 2L0DA 2D7TH 4BRJA 1RK1A 2ZUYA 1IL1B 3BKYL 4LVOC 1WFOA 2V9UA 3GPEA 3OQRA 5DZNA 3WUZA 3SQOL 2WQXA 4ZX6A 5KYUB 1YMMA 4G6KH 5HYEA 1KPVA 1R3JA 1ZVYA 2J43A 1XTMA 2C3VB 2HLAA 1H15B 4KPHL 4FULA 2F8XC 2BWIA 5BZWB 1E9QB 4Y2OA 5TDNB 3E1F1 4LLYB 2Y6SD 3QDJB 2PW2A 4JRLA 1YEFH 3FT4B 3GXNA 1EZVY 4OAWA 4TL4A 2OXGA 3MMEA 4JKMA 4ANUA 2N4IA 1FYTB 3UYOD 4I0PD 5TE7L 4F5CA 3LYRA 1G1KA 4UINL 3RPKA 4LDCA 3QHFL 4E9SA 4N2KA 1G9EA 1AY1L 2VLRD 3L2NA 2ADJB 2YA0A 1KTDB 3UBXB 4HYTB 1QPXA 2CDFA 5MHSD 3PHOA 3BEVB 1T80A 5HYSB 5AKSA 1YYCA 4WNQB 1N2RA 1ZLWH 4KKRA 5D7IB 4GQPH 2Y7LA 1I1AA 2CBPA 2VUKA 4R2GB 2EE6A 4HUXA 1GMEA 4TLKA 2FBJH 2YAMA 3US9A 3V4LA 2WNWA 2VW4A 2QDVA 1CZ8L 1EXHA 4HXBH 1MW2A 4U6TA 4R3SA 4MDIA 1U8KB 2XPGA 1FORL 2R1XB 4JNXA 2VXTH 2ZT9C 3CC5B 1AE6H 2WTRA 3SE9L 1S9WA 1TETH 3C9NA 1YAIA 4LDOB 2GCYB 5AW4B 4DP8X 2Y1YA 3LPFA 3EFFA 3NIDF 3WD5H 4NLHA 2VISB 3CHOA 2BSTB 2GABA 2HFFA 4HWBL 5B1JC 1T7VA 2V37A 3C5ZC 5FCUL 5DFWH 4KU1A 3SKJH 3HHSA 1NLDL 1GZPB 4DVRH 1KB9K 1VB9A 2X4NA 3MLUL 3OKEA 1CD9B 1SN2A 1SBSL 3WN5A 3TH3T 4HOXA 4JW3A 1L9MA 4OCWL 4YIQA 4HBCH 3FUNA 3G5XA 5D55A 3GHPA 5FEBA 1BM3H 3P11L 3MRRA 5D2LA 2W65B 1AP2A 1DL7H 2CKBA 1D7CA 3RWIB 4B3VA 3ES6B 3QJFA 1JYNA 2VO5A 3F7PC 3H1ZA 4TPRL 1WITA 3EFDH 4R7DB 5D5MA 1AZVA 2X87A 2ZX6A 3OG6B 1BHGA 2QQLH 4WU7B 1TQTA 4B6ZA 4C54A 1DZ0A 4I2XA 1ZHBA 2EKSB 3VFSA 3HG1E 2L04A 1I82A 4M7LT 3VXSA 4UQBA 3BO8B 4HHAA 1I9IH 3STLB 2CR6A 4QXUH 4HJIA 3VD2A 5J9PA 2XXGA 3FOMA 4FX5A 3ZL2A 4XP4H 4A7UA 4AIXA 4B50A 1UXMA 3F01A 4L3AA 3VFTA 4HG4J 2CH8A 3MRQA 3FB5B 1ZSDB 2ED6A 2EXYD 2N0MA 4C59B 4ZRGA 4DEPB 1KULA 4YHZL 4ERSL 1XF2A 2PWGA 2OMZB 5C6TL 3QEGH 3HR5B 2NTFB 4XRCA 5BQ7A 2NZ9D 5EU6D 4NO2B 5CD5D 4WUKL 5AVTB 3VI3A 3BKYH 3HE7B 1URLA 6FABL 1A6ZA 1WBXB 1BCIA 4H4NA 2DJUA 4N0UE 4XX1E 5D1XE 3V55A 1IKFL 3SQOH 2KZWA 2G30A 4OLYL 4NGHL 4M4RA 3TIDA 3WSQH 5KAQF 5E0FA 3RZCB 3D39E 3L9EA 4RZCA 2R2BB 3TNNA 4X99A 2XRAL 4NQDD 1WCBB 4Z3EA 5KYYB 7PCYA 4O2EB 4MWFB 2PXYA 4M93C 1NGXB 3DJTA 2YD0A 4MQTB 3VVVA 3CNKA 4BQBA 1IC4L 3PDOA 3L4UA 4FTVA 3P4OB 2BJMH 1X5IA 1YO4A 3FO1A 4P2OA 3T4YA 2F7RA 5IVZA 4TQ8A 4GW5A 1BWMA 5TE7H 2VIRB 4YE0A 3W39A 3MV7E 4UINH 2LLGA 4W9DC 3QHFH 3LVEA 2H9GA 1AY1H 1U8NA 3SPHA 4WFEE 1S2EA 1U42A 4F3FB 3MCG1 1ZVHA 3F6JA 4P4KD 2K70A 4WSJA 5F72S 4HK3J 5KN5A 4ODTL 4LVNC 3OHXA 4IOSA 4JDZA 1VDGA 1AKPA 3OXRA 1WVZA 3NDYE 4GS7C 4IRSD 4NI6A 2ZUSA 2PF6A 4HDIA 2VH5L 2XV3A 4XMPL 1ZT7B 4LMQE 1P5VA 2ISDA 5I1KL 1CZ8H 2WLJA 1F45A 3NJKA 5GS1C 2VQUA 2Y36L 4Q52A 4YLCA 1FORH 4LEXL 1WC7B 1OAQL 2AJZB 2DQDL 4UQAA 5F21B 4GSUA 5I0ZA 5CNHA 2DB8A 2H2PC 3SE9H 4RGNB 1EO5A 4F7KA 2LR4A 4BCXA 3MUHL 3W0WE 4DO6A 3MNDA 3L3OB 3G6JA 3NIGF 1IX2A 4Z7IA 2COVD 3B5TA 3DUSB 4HWBH 3UTTA 1VEMA 3ATAA 4ENEC 4BZ2A 5F9AC 3U7YL 4DJMA 5FCUH 3IGUA 1NFDB 3V52L 4H25B 4NOFA 4PD4K 4IU2A 1K4DA 1NLDH 1PNCA 2GT9A 3FT2B 4JUSA 3MLUH 4JREC 2F9BT 2WV3A 5JXEA 5DR5L 1SBSH 4CMMA 3GJFB 4MBOA 5DHYA 2X7LA 4G70B 5B8CA 3R06A 4OCWH 1U8QB 3FU8A 1OAUL 2NY3B 3P11H 5HGGS 2W9EL 3TURA 3CLWA 5A2AA 3W82A 2QMJA 5I75C 5FFGA 1M1XB 2CMRL 1DE4A 2B5IB 4OZGA 4TPRH 3C5JB 1PS3A 4LBEB 2Q7NA 3WDHA 5HPMB 3TO4A 5DJ2B 5EIQA 1JVKA 4FDWA 1G5GA 1I3VA 3TVMA 3VA2C 4BBWA 1IGML 3ARGA 3FZUC 5KSBA 3BKJL 3DHUA 1BAGA 3S48A 4WK4B 2Q7YA 2ZKWA 4HZAA 1ID2A 4RMRA 4ODHL 3UJTL 4QHUB 1KCUL 3FFCB 1M6OB 4K9EL 1B3JA 3OGOE 3K8KA 4M48L 3CQQA 2YUZA 1TITA 5A43C 2ITCA 1SYSA 1TTGA 5SWSE 5F0JB 2GITB 3MRFB 4M1GL 4YHZH 4D0CA 5HHPA 4YK4B 5C6TH 3OLIA 2DWTA 5JW4N 4JFVA 5MENE 4LKXB 2UZYB 4N2FA 1I7RA 2FNBA 1H3XA 3ZR6A 5IOPA 3LEVL 3CN4A 1P4LB 5BUPA 6FABH 3X1EA 3KJ4B 4V1DE 1AMXA 1IKFH 2WNGA 2D4DA 4OLYH 4NGHH 5KVEL 3ARQA 1PCSA 3MHZA 3GJEB 3BLBA 1BZ7A 3E6FB 3RIKA 1RSYA 2XRAH 4GXUN 4FNLH 3T65B 2EO1A 1NCBL 5D1QA 4B9YA 4ZPVA 2N3JA 4HJGA 4PJ9D 3RYMA 3ZDYF 1JNHA 4PRIA 2HX7A 4P57B 1IC4H 5HVHC 1OOAA 2IXQA 2XLLA 2FJSA 3P4MA 3KLLA 5D1ZC 3OSKA 3QFJD 4F9LA 3HZKB 4NNYB 3B8SA 1T6WA 1HKFA 1U92A 1E28A 4WHYG 3MRBA 1FVDA 2RA1A 2EDJA 1EX0A 2VLKB 3G08A 3REVA 5JW4R 2I26N 5GJTL 1WT5C 4ODTH 1QBLL 1KLUA 3DMMC 1KUMA 3MLSL 3KG5A 5C0ND 2WUBL 1EFXA 1A4KB 2VH5H 3EJQA 4XMPH 1U3HA 2HJLB 4I3GA 3S35L 5I1KH 1BBJB 1J12A 3R7QA 1OAXL 5DUBA 3MO1A 2Y36H 1T1WA 4CVUA 3BP7A 4LEXH 4DQOL 1RUML 4IEFB 1OAQH 1M53A 2DQDH 4UT9A 3EH1A 4BZ2L 4JKLA 3QG6A 3B7UX 5F1NA 3U6RB 1P53A 5C0IA 3D85A 4N9OB 2WCPA 1UFGA 2O61A 1RZPA 5GGRA 4TNVF 1O6VA 3CIQA 4G9FD 4YR6A 4HFUL 1SZNA 3BH9A 3RL1B 5IROA 3U7YH 4JRXA 1FN4B 4DN3L 3V52H 3EYQD 3H7LA 1QUNA 4XPAL 1UXWA 4GUPB 5EBGA 3WJLA 5DR5H 2HT3D 3UJJL 1DUZB 3TN0B 4HZLA 4N0UB 5D1XB 2GB2A 3ZRSA 2W81C 1OAUH 1X9UA 4RBPH 5F89B 3D39B 2W9EH 3HCVA 1W72B 5CWSA 2OTUA 2V9RA 3IMBA 4FZEL 5KS9E 3FRUB 3HBZA 1T0PB 4XPHL 4EVNB 3U9UA 2CMRH 4XN1A 5IZ7A 1CVSC 4XAWL 2ICWA 3HC3L 3MBWA 3CN3A 3HAEA 2BNRD 1MLBA 1SJMA 4DQAA 2CRIA 4XMVA 3KL5A 4AENB 4I3RL 2FRGP 1NH6A 3MXVL 3MKGA 5T33L 2I9TA 3HC2A 1IGMH 1KYOJ 1KN4L 3MV7B 3I2CL 4PYHA 3X1FA 3BKJH 2AF2A 2VN5A 1A25A 4N87A 1MF2L 1Z0NA 1ZHKB 5K5YA 2VABB 3BVNA 3G6AB 4ODHH 3UJTH 4NN6C 1ASOA 1KCUH 4A6YL 1H5BA 1A4BA 2BVPB 2E9IA 4M48H 1JD9A 4J3XA 3VH8B 4WDIB 1NWPA 1JGDB 2WJ5A 4Y9FA 3NG5A 1PU0A 1A9VA 3R19A 5F44A 3FT0A 3ZN6A 1CD8A 4LGRB 2IWFA 3AFLA 4JGMA 2J20A 3FF8A 4KDTA 1E4KA 1IM9B 3LEVH 3HUJF 4RGMC 5I82A 1NBVL 1SXCA 5F9WB 3KR3L 3LTVA 1L9NA 3IAPA 2CZNA 3W0WB 5KVEH 3ZR5A 5J5EA 1MFDL 3MUGB 2BSBA 3KXFA 3T3PF 1HHHB 4OQ1A 4G71B 2ZE0A 4OIAA 4CVWA 3VM7A 1NDGA 1NCBH 1BD2E 1TZHA 3PWLB 4ALAL 4NIKB 5C07D 2C26A 3ARYA 4QRRE 4P2QD 1EAQA 3SE3A 5F88B 3GSUB 1H19A 1U3ZA 5F97E 2OMUB 4D0BB 1GS6X 1TR7A 3D2TA 5H2BA 4K23L 4QLWA 5F7AA 2JELL 4P46C 2DQGL 2OCJA 1P9MC 5BS0D 3WNIA 4IHOA 5GJTH 5K1NA 1QBLH 3FBKA 1QW9A 2R56L 4N2AA 3MLSH 4ZS6D 1KWGA 2WUBH 4FAAB 3RVTD 1EGJA 1UJ3A 2HP4A 3WLBA 1LDPL 3POHA 4XN7A 3S35H 3MYJB 2XN9E 5AKRA 1WBYA 1GJUA 2KI6A 4G6ML 1OAXH 2DEWX 5ITFA 3SDDB 2JSFA 4W68A 4YDLC 4DQOH 1RUMH 4MZIA 3B7TA 5HYJE 4BZ2H 4LEBA 5DJ6A 5DQ9B 3QDMD 2GEEA 2Y7MA 2IH9A 1KZYA 4FJ6A 4F8NA 2IPTL 5SWSB 9PCYA 2OULB 2AJYL 4HFUH 3VXPA 5MENB 3KHOA 2VXQL 3HB3D 3QULA 1HH9B 4DN3H 4LNVA 2B39A 1GW6A 4XN8A 1Z7JA 4WO4B 5EO9A 4OZIE 4RDBA 5H35B 3MUY1 4NFCA 4U3CA 3CX2A 4Q4EA 1T7WA 4NKQB 2O6DA 3UJJH 1S78C 1ZD6A 3FUMA 2DQ6A 1JWMA 3KDMB 2O4EA 3K5RA 4V1DB 4QR7A 4PLKC 1BQLL 3Q8AA 5BNXD 3UBFA 1X5ZA 2QLYA 2VSMB 3TZVD 4KITB 1WUNT 4C57C 1FCGA 1M05B 2P5ED 5CSZA 4FZEH 4ETQB 4H0IA 4N1HB 4XPHH 1MNUL 4AEEA 4QWWC 5B39A 1CXFA 4XAWH 3DA0A 4MJJA 4P2AA 2VDMB 4U1LA 5DJXB 4I3RH 4O51A 2BVQA 4BYHA 3IPEA 3MXVH 5T33H 4RAUA 4PWIA 4H1LA 4R90L 1KN4H 2JCCF 3HZMA 3I2CH 3TCLA 4G8GD 1K72A 1MG2C 2VW6A 5AOZA 4OLXL 3PREA 2FHCA 1AO7E 3B4NA 1MF2H 2NDFA 5BO0D 4CU7A 3BDXA 2CJSA 4A6YH 1EVUA 5DUJA 4MA1C 1Y07A 2ICWI 2WCGA 4KROC 4E9WA 2WP3T 4RGOL 3L5IA 1KV7A 1AHWB 1IUZA 3L3IB 1KPRB 1DQVA 3G5YA 1L5GB 1XF4B 1OL0A 1T04B 1HZKA 3BAIA 3BPCA 1Q9WA 3QUKB 4L2YA 4G8EB 1X5LA 5EOCJ 5I6OA 3DX7B 1RVFL 1NBVH 5I8EA 4U1HB 2EUVA 1G0DA 2DLIA 3KR3H 2EILB 3GXIA 1W8OA 2G0KA 5CEXB 3QJHA 1GGYA 1MFDH 2NPLX 2CHNA 1ILSA 1NDMB 5C0BE 4HSAC 4P59L 1FAIL 2XXMB 4IS6B 2PCPA 2AKRB 4JG5A 4OR1A 4ADJA 5IEHB 4OV5A 4ALAH 4NC1E 2MHAA 4N2EA 3VRIB 3K1DA 2E86A 1J88A 3IBEA 1B4LA 3I3DA 3K80A 1IE5A 2DH3A 3N40P 3DXAE 1O75A 4PTTA 3ZBMA 3MFFA 3PF2A 4I9WE 4JFEE 3OAYK 4FQ1L 3D18B 4LGPB 4K23H 3SGKA 3QNXA 4ADGA 2VDRL 2JELH 2DQGH 3GI8L 3AS2A 2VWEC 4XMWA 3P40A 2J57A 5FCSH 1IC5L 2ICCA 5KBPA 2F08A 2R56H 2Y7NA 2IQ9L 4FYQA 1BX2A 2DM2A 3ZZ1A 3AS1A 1WPCA 3KPLA 3MRCA 2EXWC 4WI2A 3ZE1F 1EUTA 3PJNA 1LDPH 1VFMA 3CBKB 4RMTA 3TO2A 3D2UD 1D5IH 2V2WA 1HOCB 1HHIA 1JI2A 3C60D 4G6MH 2QL1A 4UUJA 3EG9B 3MRMA 2YAEA 4JFWA 3WFHB 4NC1C 3ZXAC 3H9SE 4HJEA 2JTYA 3EJZC 5HTSA 5T1MA 2XKSA 2IPTH 1V27A 3F7YA 4NPKA 2W07B 4QPEA 4PGEA 4XN5A 4ZFOB 1N18A 2EINB 3KWVA 4NQEA 2MOVA 2AJYH 3MLXL 3JV4A 4U4IA 2P5PA 3NJFA 2VXQH 3RLSA 2XX0A 3MJ7B 4K15A 1T5XB 2K9FB 5CLYA 5M94B 4Z8FL 3KMDA 4QKTA 5IF0B 3QHTC 1MCHA 2O72A 1QEWB 5CSGA 1KTBA 3EGSB 8FABA 1A7QL 3CZLA 1BQLH 1BJ8A 4JO1L 3SYAA 5I8CA 2I07A 2E27L 3M45A 1JGUL 1QHOA 2YSSB 3PQYE 2VR5A 5JPNB 3BQUA 3SBWC 3PAVA 4X5RA 1BD2B 1MNUH 2X9WA 3HNSL 5CR1A 2PCXA 2BOLA 4KGLA 4QRPE 1V3LA 1JTTA 5CP3A 3TA3C 1BIIA 3QR0A 4LE8A 1QA9A 2F61A 3RGHA 3EZ8A 4PJXA 4U1MA 4DO4A 3UPRA 3PDGA 4R90H 2WP3O 2VGLM 5DK2A 4MAZA 2K4WA 4X8JB 4OLXH 2LOEA 2AK4E 2CXKA 3STZA 3GMOA 1MAML 4OGXL 1A9EA 1XBRA 3VQ1C 4OZHF 2AS5M 2BY1A 3ZHDA 4XWOD 1T6VN 3IM1A 4RGOH 1Z9MA 1URIA 2P1YA 1MQKL 2NLJB 4HJ1A 5EO0A 3T5WA 4LDLB 3EOBB 1KB5B 4FQXC 2P8MB 3O4LD 2HG5A 2CG9X 3EOAA 3OJMB 4Y0GA 1OGAE 4UU9A 2UZXA 1RVFH 4DPCX 2HUEA 4PVLA 2D9QB 4FXGC 2D3JA 4JFFE 4XCFL 2WQUA 3HR6A 2ZOKB 2J8UA 3QQ4A 4FG6D 4WFHD 4OI8A 2IOIA 4N2CA 3L3DB 2H3NA 2NYKA 2JCWA 5D9SA 5ABZA 3S97C 1ECYA 5C09D 4YFEA 3M7FB 2WYHA 4P59H 1FAIH 3VWJD 1NEZB 4XN9A 1S8DB 5CGBA 3ESVF 2PUQT 3EGDB 3QARA 5EZPA 1SLVA 3QZWB 4K73A 2W8CA 2ZXDA 5LGKA 4EI6A 2LW3A 1SOQA 1ORSB 3U0TA 1JF1A 4G9DB 1A3RL 1XX9C 3OPZL 1S7RA 2A0LC 3U25A 1XGTA 4FQ1H 1ODUA 1AAJA 1IL1A 2YAPA 3FU7B 3M17B 5JDSB 3GXPA 4W9KC 3LRKA 3QGVA 1H8SA 2VDRH 3PPSA 5AKTA 2CPCA 5E5LA 4AJ0A 1HJBC 4L0PB 5KYUA 1DSWA 4JE0A 2QVMA 3HRPA 2WXMA 2C3VA 2IQ9H 1QOKA 1H15A 2ERJB 3P9MB 2TSBA 1JZ8A 5BZWA 4TN9A 5C0AD 1VZHA 3BOVA 1E9QA 1RJYA 5TDNA 3FTXA 4I4WB 5FK9B 4AIEA 2V7HB 3O8XD 4LLYA 1X5MA 3QDJA 4HHWA 3BLKA 1CU4L 3FT4A 4OM0L 5EZOL 4CJ1A 1EJ6A 4TTDC 1B4TA 1WS8A 1AO7B 4L29B 1U2HA 1FYTA 1OHZA 5I6XB 3TBBA 4FQJL 4AL8L 3PWPE 1KCVL 4J3VA 4ZYKB 2HVKB 2WNKA 3FXIC 1VADB 2ADJA 1KTDA 3UBXA 3BEVA 4QYAA 4TUKL 4RAHA 3I50L 5HYSA 4JHZA 4P49A 3BIBX 1Y6MR 3MLXH 4WNQA 1MCNA 8PAZA 3SIKA 1MCPL 4S0TD 5CJBA 1VKXB 2FK9A 4Z8FH 5KZCD 4P9ML 1NC4B 1EK3A 1XIWB 43C9B 2CQVA 5BJTB 4L3EE 2GAZB 4ZW3A 1EAJA 2P8LB 1FVCB 3A3YB 4GAGL 1A7QH 1U8KA 1D9KB 2R1XA 3EDJA 3OR7B 3M6DA 3HG4A 3QPQC 3B9KD 4JO1H 1WA0X 2E27H 1G9ML 3KYOB 1JGUH 3A4DA 1TG8A 1YNKL 5C0BB 1A2YB 5HYFA 4E42B 3EUUA 5SX5K 5E00B 3BX7C 1FG2B 1RUQL 3F04A 4A2DA 3HNSH 5L4IA 3WE6B 4PJ5D 2VISA 4DCQB 2BSTA 3P0YL 2BPBA 4MXWL 3OWEA 4QXWA 3DXAB 1IARB 1PVHA 3QIWD 3TEUA 1GZPA 5BV7C 2VZ1A 4WENB 3IMUA 3B6SB 3SEPA 2HT2D 2Z31B 1CK0L 1D5ZB 2PYFB 4KKNA 5IWLA 1L6XA 4PJCB 4W81A 3TBWB 1GKOA 2X05A 4QHMB 1MAMH 2W65A 2NNRA 4OGXH 3WUWB 3FK3A 5T1LA 5IIEB 3RWIA 2BIPA 1KTCA 3OKMB 4HJ0C 4JCLA 2XN2A 1ZLSL 3MGTB 3RAJL 4KQ3L 1RJZB 1MQKH 2HKAA 3A24A 3K2MC 4R7DA 4YHIB 1XF3B 3ZT6A 1GZQB 3GSNB 3PJSB 4WU7A 4BQ6A 1B90A 1UXSB 1Y6NR 3MV11 2EKSA 3PP4L 1G7PB 5I6KA 2WZ5A 3BWUC 3BO8A 1AYOA 3STLA 4BKLB 3H9SB 3N43B 3NDZE 4BZ1A 3V4PB 3AMLA 4ZQKB 5E6IB 2YA2A 1MCQA 4XCFH 1OCRB 1DEEB 4JLRB 1HYRC 3NOIA 3RTQB 1G1YA 2CCLA 5AW7B 4FP8L 3SYQA 4IBLT 1TEFA 1ZSDA 3ARFD 1ITBB 3CX5J 1MCOL 3MCKB 4EZKA 1I53A 3CHPA 4NZRL 3N0PB 3GINA 2OMZA 1ULVA 4BFIB 3QUXD 1LNUB 3HR5A 2IAND 1ZEAL 2X3AA 5DVKA 4K8RC 1A3RH 3OPZH 2IH1B 3WIHL 5MHSE 4NO2A 1CGTA 3X11B 3JUYA 4ZPTB 1MRDL 1WBXA 5A7BA 4AV4A 4BJLA 3LKNA 4OJYA 3EH4B 1CF1A 4NQCD 3MGOA 4PY8J 3RZCA 1LK2B 4RWYL 4CC1A 2R2BA 4GG6E 4Y9BA 5IJCC 5I76B 1WCBA 1JYWA 4EN2A 1X7TA 5KYYA 2E4TA 4O2EA 4MWFA 3WFEH 3JXAA 3D12B 1X5XA 2ADFL 3GLDA 5J56B 1NGXA 5HGHB 3MYZA 3LKQB 4RRPA 4LLUB 4ZXBD 2Z4QB 1CU4H 2E7MA 4OM0H 5EZOH 3I85A 3ZRFC 2Y6SC 2AK4B 3P4OA 4B9IA 2LQRA 3QAZC 5EEVA 1WF5A 1RIHL 4P9HL 3VXME 1CTMA 4JRYA 2QGDA 4FQJH 1XEUA 2VIRA 1U8HB 2C3XA 1KCVH 3KVQA 1NUGA 4AL8H 3HJEA 4BIKA 3GRWL 2YKLL 4G5ZH 4I0PC 2X4UB 3FSVA 3O6KL 3GTTA 2LLLA 2VSKB 4F3FA 3UTSE 2FZ3B 4TUKH 3I50H 2VLJD 2D0FA 5C6PB 4LCYB 2X2JA 2XOTA 4OCRL 4HLZG 3HFML 3ZL1A 1XH1A 4NBZB 5HI5D 4FHKA 1MCPH 2VM9A 1B2YA 5SWZE 3ZTDC 1KBWA 1ZT7A 4P9MH 5H94B 4PJFA 1OGAB 4FG0A 5GQBA 1NQBA 1RZJC 3MCYA 1YJDC 5IFJB 1ZLVK 1VA9A 5EOCL 5H37G 4JFFB 1XZ0B 1P2CB 3HS8A 1B6DA 4GAGH 4KTDL 2YQ3A 2ZTBA 3Q8CA 4K9EH 2JI1A 1WC7A 1KCKA 3DI2B 3UBXI 3PL6B 1G9MH 2AJZA 3DPBB 1QFPA 5FW8A 1YNKH 4X0NA 1HE8A 3QE5A 1RUQH 1TEYA 3L3OA 1NAKL 2VNCA 1RPUA 1OALA 4OW6A 3DUSA 2FJHB 3P0YH 5DXWA 1FL3B 4MXWH 4YHYC 1TYRA 4Y7OC 3WAKA 1NFDA 4H25A 1A64A 2OZ4H 5A3ID 3FT2A 2GJJA 2K3HA 5AL0A 1LE9B 3LH2L 3ULAB 3GJFA 3ASWA 1JJUA 1N12A 1CK0H 1U8QA 4KVCL 3MLRL 2F7QA 4B9ZA 4JN1L 4P2RE 2F5AL 1FWXA 5LLIC 3G04B 3SY0B 5L6YL 4ZUTB 3F7RA 3WKML 3ASOB 4NT6B 4R8WL 4F8QA 1ZLSH 3VWKB 1A6WL 1M1XA 1WTGT 2CIKB 4KO6A 3RAJH 4KQ3H 5EU6E 3C5JA 2CGYA 3FB8B 4YL4A 4LBEA 5DQDL 4PV1C 1B9KA 4BZ1L 5ITBL 5I0YA 4HXAL 4I18C 4WU5B 5HPMA 1B0GB 5DJ2A 1L9RA 4Q6YA 1WLHA 3PP4H 2BHUA 4Z0XB 4JL2A 4NQDE 1CWVA 5FYKU 5B1CA 2J1XA 4XMXA 5GZNA 3FB6B 5IB3B 1THAA 2IGTA 1BQKA 3ULVL 1ADQA 1Z3GL 4QHUA 3FFCA 5CF3A 1M6OA 2DWSA 2Y2YA 2BINA 4FP8H 3V6OC 4PJIE 1MCOH 3Q3GB 2GITA 3MRFA 1J0HA 4NZRH 2EXYC 4XOCA 2X89A 2EZ0D 2X4QA 4FQIL 1ANUA 4LKXA 5D2LF 2UZYA 1ZEAH 1GC1C 4FCAA 4BXVA 5AZUA 2ZWSA 4KV5F 2CUIA 4WEMB 2AV1B 3OZKA 5F1KC 5D7JB 3WIHH 5JIQA 3FN0L 2NZ9C 4WW2F 1P4LA 3CSYB 1MRDH 4XVJL 4AMWA 3ZYIA 1RQ5A 5CD5C 4ZW7A 2NUTB 2C4FU 2P80A 5D5MF 3GJEA 4RWYH 3VDAA 3E6FA 1NIEA 4BE6A 1CE1L 4MB1A 3T65A 2ID5A 1SUJA 5JIKA 2ADFH 1ZPUA 4WVRA 3UDWC 2QPSA 1KTKE 4UDUB 3TIEB 3QPKA 4P57A 1KGCE 1OSPL 1S7QB 1T22B 1C5BL 1JGVL 1RIHH 3BGAA 4P9HH 2C9SA 3L5WB 3HZKA 1IGFL 1KACB 4NNYA 3L3GB 1BOGB 3GRWH 2YKLH 4HF5L 2D0GA 3O6KH 7CGTA 1TTFA 3V4VH 2VLKA 2H6UA 3K6NA 1WAAE 2W38A 3LMJL 4O02B 4P4KC 1IM3D 4OCRH 1EXUB 2OK0L 1WD9A 3HFMH 2BWDA 3O9WA 5J11C 2RB8A 1A4KA 1L7TL 3VI3F 5F6IB 4HETA 5JR1L 4IRSC 2HJLA 3OAZH 1BFOB 2XV2A 4ZNEE 4B97A 1BBJA 1BLNB 4PJHE 5EOCH 3X13B 1RIVL 4X4KA 2PO6D 4KTDH 5GGTL 1QSFE 4C4UA 2XWZA 2BVUA 4GXFA 4YBHA 4D9QD 4IEFA 2GBAA 2ZKYA 3U6RA 1HCFX 1J9CT 2Y5EA 3VD0A 1P6WA 2WZAA 1NAKH 2WINB 4M9OA 3L1OL 3RVUD 3E9UA 3RL1A 2F7IA 2JIXB 1FN4A 1QFUL 1AIFB 3Q6GL 2Q20A 3HS0C 4O9HL 4GUPA 2H41A 2WBJD 3LH2H 1DUZA 3KL3A 2HFTA 3TN0A 1NEUA 4N0UA 5D1XA 5F7YC 3EDEA 1N6UA 4KVCH 5G2NA 1M3IA 4XE0A 2RR3A 3MLRH 4JN1H 1KEGL 2F5AH 1EZSA 3UGUA 5BUAA 2WYZA 3D39A 1L4IA 3SYCA 1W72A 2R0LL 4ABQA 5L6YH 1IV8A 3FCSB 3T3ME 4ZMZA 2DD8L 2P49B 3WKMH 4R8WH 3FRUA 2J73A 1V3KA 3ETBF 5D96C 4EVNA 1J5HA 1A6WH 1YQVL 5I1LB 1GZHC 4JDVB 3UXFA 4BZ1H 5DQDH 3L13A 5ITBH 5L0QC 2VDLL 3A5VA 4HXAH 2Z8WC 3Q06A 4AENA 1TFHA 5F9OL 4OU3A 4Y4KB 3VXMB 4F8LA 3AACA 3MV7A 3B34A 3N0AA 4WI4A 3G6JF 1MEXL 3HE6B 1ZHKA 3PUCA 3UTSB 4F7MB 2VABA 3CSGA 3T04D 3G6AA 3ULVH 1Z3GH 2HFGL 3IDXL 2FJGB 3SQRA 2BVPA 3VH8A 1KOAA 3KPQB 2OJ1A 3IDNB 4WDIA 2Y69B 1EHAA 5SWZB 4ODUB 3SGEH 1JGDA <