1BFTA

Structure of nf-kb p50 homodimer bound to a kb site
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
TAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The role of DNA in the mechanism of NFkappaB dimer formation: crystal structures of the dimerization domains of the p50 and p65 subunits.
pubmed doi rcsb
molecule tags Transcription factor
molecule keywords NUCLEAR FACTOR NF-KAPPA-B P65
total genus 20
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bftA00
4P23C 4O02H 4H25B 4CRPA 2CUHA 2JIXA 3QQ9C 5CEYA 1RIUH 2G5RA 4KDTA 1BFSA 3PWNA 4LCIL 2ADIB 1TFHA 2BVQB 3O6FD 2IGFL 4WRLA 1L6ZA 2OP4L 4TTDC 2AJZB 4L4VE 4NQUA 3S88H 2F19L 2A0LD 2DQEL 1NC4D 4WY7H 1W8OA 2KKQA 5CINH 5ESQB 5L6YH 5HYQB 3UYPA 5HD8D 2WQ8A 1QA9B 3IDYC 5D1XD 4H20L 1A7BA 1N7ML 1LILA 1I8MB 2J4WL 5K93A 5L2KE 1FZKB 1Q9KA 1BLNA 5FDWA 4UB0L 5CILL 1OAQH 2LQRA 1UWEH 4JFXA 5JUEL 5HHXH 4KTEH 4LSRH 2DYPA 3G5XB 2E8ZA 2H2PD 3O3AB 1U8JB 3L1OL 4LQFL 4Z7UF 4NWTL 5F70A 3RIAF 2OZ4H 1J9CT 1MFBL 1HQRA 4L8SC 1JHKH 1ZHBA 4D9LL 1UZ6F 5KVGL 4LLWB 3DSNA 4MB4A 4OF7A 3VFUA 1BVZA 1R5WA 4F57H 3HKFA 3V6FA 3WIHL 3UJTH 1M71B 1VDGA 4LLVA 2VLRE 4PUBL 3OKMA 3DMMD 3SE9H 1ONQA 1HHIA 1YC7A 2N7BA 4QRQB 5ERWA 5J13C 3SGJA 1V3KA 1PDKA 1MIEL 2DKSA 1LP9B 4GSDL 3BD4A 3EO0B 2F54D 2BSRB 3SO3C 2UZIL 4YFDB 3RL1B 3FRPA 3NCMA 2VXVH 2J12B 2NY6B 5BV7C 4HBQA 1A9EB 2WUCL 1U8OB 5GQBA 4YDKH 4GSDH 4FG6C 2NY2D 2VQ1A 2DD8L 3QAZB 4J7RA 4U3CA 1HCVA 4M03A 3UEZA 2AJYH 4HMDA 1X5YA 1FO0A 5I1JH 4OZIB 3C2AH 2Y23A 5DHVH 3QR2A 1MAMH 2DDQH 4UIKL 1BHGA 2KZ1B 4TSBL 1RUPH 2EECA 2B4CL 5IJVA 1NGQL 1P1ZB 1GSMA 3H7LA 3PDOB 5F71A 1AC0A 3KR3H 5D1ZB 5CBAA 2WLZA 1A22B 1WFNA 1UVQB 2Z92B 1LMKA 5D6CA 5FUZL 5CKGA 3LN5A 5DD0H 3QJHB 2D7PA 5E70A 1JV5A 5F96H 5KOMC 1T89C 3EIFA 3O2DL 3HRPA 4LDLB 2ARJA 3OXSB 4HUVB 4ZSOE 4M5ZH 4N9GA 4NP4L 4NYLB 2BRRH 1FHGA 5IB1B 2R4RH 5HVWA 2QR0B 4JDVB 1D5ZB 3HR6A 2VL4A 1E6JH 5IW3A 2CLVA 1OSZA 3C6SA 3MRPA 4JY6A 5J89A 1N4XH 1YY9C 2G75B 5GSRB 5IROA 5EC2B 1ND0A 2BVQA 3NIGF 3R4DA 3JV6A 2DM4A 4JR9L 4JFQB 1FZMB 5L8KB 1NKRA 5EA0L 3L3JB 4NHCH 1N2RB 2H32A 3DUSB 4L4TA 4NO0A 4JPKH 2P5ED 3OKLB 3C08H 3I75A 4HBCL 3SPVB 5FECA 4I9WD 4G43A 1KEGH 4JY4A 3RGVD 1IT9L 4Z7WB 1T4KB 1C8PA 1ETZA 3BSZH 3KPSB 1WAAE 5DJXA 4FQ2H 5DRZB 4LCYB 3BPNB 3QUZB 3V5DA 1K8DB 3GI9L 3N9GH 1QEWA 2HT4C 1RZKC 4RAHA 5C0BE 3HZYB 2LFGA 5LQBL 3C2SA 4OCSH 3PHQB 1P7KA 2OM5A 4RA3A 4PBVC 1BBJB 5HY9A 1K6QL 5C6PB 3RX7A 4L1DA 3VFMA 4JQVC 4G9FB 4H8WC 4OLEA 3FFCE 1T80A 1JPFA 1TNMA 1OAKL 2DRUA 3MRNA 4Y16C 1AD9B 2YXFA 4Y19B 2HTKD 2H8PA 4KVCH 5C09A 4RA0C 5LGHH 3L5WB 1UYWH 1QNZL 3VGAB 4OAWB 2AJVH 5JPMA 2F54B 4QRRB 4PJEF 5A2KH 4G6FB 4JN1L 1JNHA 3OKDB 1E4WL 3AROA 3G5VA 2APXA 1OHQA 1FG9C 5B38G 1IAOA 2OYPA 3W2DH 1ADQA 4OM0H 1KLGA 3CX5K 3WNOA 5TE6L 3IDJB 3S34L 4D0CA 4PG2A 3HE6C 5K9OA 5EOQL 4KI5F 3D3VE 3QA3A 5IFHL 4HH8A 2HLAB 3O2DA 4XPAL 4MNQD 3CFEB 3B2VH 4IRSB 1I1AC 2FZ3A 4HWBA 1CR9L 5F9OH 4RFEB 2BOCA 3AM8A 1HXYA 4M1DL 1CICC 3KYNB 3G6AA 4B7IA 4IRSD 1I3UA 1JF1B 4ODTH 5EU3A 3EDKA 3GNML 4XC1L 4N0YL 3CC5B 3G5YA 4FQIH 5TDOB 2J88L 2XRAL 5L0QB 4Z7WF 1CTOA 1MRCH 4TSCH 1BZ7A 3QI9C 3QXTA 3G5ZA 3RDTA 1I8LC 1VA9A 2FIRT 3S36L 2HKHL 1NBVH 5I18H 2HT3D 4YQXH 3DV4B 5K9JH 2DI7A 3WHE0 5HGHA 1G1YA 3VI3E 4LSQL 1W0WB 4L29B 5CP7B 1VGEH 3VU2A 4ETQB 3D5OF 3S36H 5C71A 4QXWA 1DFBH 3VFNA 2ZSVB 1D6EB 3HC4H 3MLZL 2QQNL 3CZFB 3LV3B 5IM7A 2QKIB 1U8HA 4F33B 4C4KT 2VDRH 5AUMA 4H1LA 3Q48A 2JKXA 1MCOL 1XF2A 1C08B 1UJ3B 1G0YR 3HPJA 5GGVL 1U3HA 3ULVE 2Y36H 3QDJE 4WV1C 1K5NA 2R1XB 2HYMA 3FT4A 1BF2A 4NN5C 3TJEL 4O51A 4O9HH 4NRYA 2APWA 1S7QA 3BZFA 4CMHB 3C60A 2AJUH 4CVXA 4QHKJ 4RMWA 4RQQA 1GC1C 3IAGC 3FAWA 4Y5YA 1MNUH 4HF5L 3MREA 1YEEL 4R2GB 4YIQA 2Q6WA 1VADA 4EI5B 4KKBD 1SM3L 4IRSA 3LKSB 3R06B 2AJXH 1JGVH 4N8PA 5IQ9B 3CPLB 1I3VA 4BSJA 3EFFB 3RKPA 2F74B 2MWCA 5M94B 2BVOB 3ROLA 1MJUH 1GGIH 3SE4A 3V5KB 1QLEL 1A7RH 4XMLH 4FABH 2E27H 4ISVA 2D9QB 1BPVA 1NUDA 2YPLB 5JPMB 2X1OA 1X9QA 4YH6A 1ADQH 2ADJB 4RMRA 1I8IB 2OQJA 1A6UH 3E2HB 1NBYA 2ITDA 4XNZB 4YUEL 1FFRA 1AY1L 1QBML 1MCNA 3QI9B 5T1KB 5LQBH 4JFDE 4QNPE 3I02A 4RFOL 1PG7W 4X9BA 3WD5L 1T1ZA 3PQYD 4PP1D 3MREB 4YO0B 3UBXA 2VDLH 5C8JA 1KIQB 3I2CH 3HNVH 4Z7OF 2MKWA 2YXMA 2X10A 3LS5H 3VXMA 1ZE3C 3DO7B 1XGYL 1QFWM 4MJ5A 2QQQA 5GZND 5C3TA 5CJBA 2A1WL 4KKCC 5ID1B 4O51B 5B39B 4OCRL 4YHPA 3BHBA 4YBLC 1H5BA 3F7VA 5MENA 3GK8L 4JVUA 3VXPB 5E8PA 2PN5A 4HCRL 3I9GL 4LPXA 3RNKA 4GKOA 1CGUA 4LVHC 5EORL 5C09D 5BS0E 3U7WL 3E6FB 3UTOA 1FNLA 3TVMB 4PTUB 1NCDH 4QXTA 3EFFA 4WFGD 1FYTA 5LWYL 2NY3C 4FQHB 5KW9H 2NY6D 3QXAA 2IAMC 4KC3B 3RUGA 3WLBB 1N0XL 3I84A 3QPXL 4XRCA 1DBBL 2FX7L 1NC2A 3QRGH 4JY6B 4OCWH 5GISL 1PKQB 1N6UA 4U31A 3QDAA 4S1DC 5KJRL 5KW9L 4HJGA 2BRQA 5F7DB 4FQHA 5FUCC 1DUYA 4G3YH 1NEZB 3RTQD 2X1PA 4MSWB 2NMSA 4JZJB 2R1XA 1JPSH 4ODHH 5JW4M 2WK2A 4B50A 3MGOB 5LGJB 4PJDE 1EO8L 4AH2A 4KY1L 1JPTH 3DV6A 1UJ3A 4ZAKC 2GK0A 5EBMB 2NCMA 3DX7B 4Y5VA 3MLSH 1NDMA 2DAVA 3B2VL 4AEEA 5HI5C 2FECI 1AH1A 1BX2B 4ODSL 5E6IA 2Q7YA 3GJEB 3ARGD 2IEPA 4LSTL 1MPAL 3MJ9H 5M95B 4ZUWA 1XEDA 4NNYB 1J12A 1EBAA 2RGSA 4LLMA 1KTDB 2NY3B 5TF0A 5D1QD 3R0MA 2VR4A 3T77A 1IZKA 5LGHL 3MUJA 1V3LA 4PJHF 1KT2B 5GGVH 1BOGA 2OLDA 4WU5A 1TZIA 3AGVA 5E8NA 2W38A 5FAAA 2LTQB 4YHIA 4U1IA 5C0CA 1UZ6E 1U8KA 2EH8L 3MRLB 4NRZB 4QYOA 5DEZA 3UJTL 1HKFA 2DB8A 3WSQH 4UAOC 1HDMA 3UPRA 1OW0A 5SWSE 5AZ2H 1RHHA 3W11C 3V4UH 3H9SB 2L0DA 2JB6B 4BQ9A 1CZ8L 1FDLL 2YS4A 1FO0H 3TH2T 3NPSC 2AK1L 1JGVL 3CVHL 1TZHA 3LKPB 5HDBF 4FFWD 1ZANH 2R0KH 1CFTA 3UDWC 3AREC 1X5LA 2EO9A 5IESL 2DMKA 5JIIA 5DGRA 3DYMA 1RVFH 4KXZI 2A6IB 5D2NE 2DQTH 3FQRB 5KSUA 1H0DB 5F97E 4LKCB 4X9FA 4WWKD 1OARH 3Q5YA 3UTQA 4DZBA 4JO2L 1FQ9C 3HPJB 5D71L 4C56E 3VWKA 4LNRB 4KRLB 2BP3A 3FFCB 4F57L 4OLVL 3RTQB 2MCPL 4LSQH 3VI4E 4OIIH 3MJ6A 1KELH 4MA3B 1DQJB 3N50A 2EDFA 4JDZB 2DWEA 2XV6B 3WL9B 2MQCA 3KJ6L 1H8SA 3DWTA 3HNSH 2NZIA 3LAFA 4OFDA 3VD5A 3GIVB 4TSCL 5F96L 3SKJL 5I8OH 5ALBH 5I8KL 3VDBA 4NPYB 1UC6A 2X1WL 3QNZB 4I4WB 5EU6B 1RY7B 1GGBH 1KULA 3GMNA 3O6FA 1FNEB 4OFYA 5D6CB 3OWEA 5ETUA 5B8CA 3FRUA 3SKJH 1UH4A 4PJGF 4GMSH 5GGTL 2HFFA 4DWHA 2OZ4A 5HGGS 2NY1D 1TTFA 1XGUA 4JG0H 4LEOA 1A6WH 1VENA 4XAKE 3QEQE 3JWDL 3GBML 3SKUD 1GHFL 2FX9L 4NQEB 3IU3B 1KB5B 4PGBB 3KPRD 1MHEB 3DUUB 4CN1A 1PW3A 1DQLH 1S9YA 4YNYB 3FFDA 3L9RB 1A6ZB 2V9RA 2HG5B 2NY5C 5TDPB 1WBZA 5DRNA 3WXVH 4GXUN 1KB5H 3NPZB 1RUKH 4R7NB 2VL5A 4QOKD 1LDPH 4PRPA 4Y4KD 2VRAA 3PWPB 4DK3A 1T0MB 1U36A 1RAMA 4LSPL 3IJYA 2D7NA 4M8QB 5GJSH 4ZYKA 4OUUA 4X9HA 2B8OT 3BIBX 2P7TB 3TT3H 1QBBA 1KV3A 5ERWB 3RVTD 5DJZA 4NKOA 1MHCA 1KYOJ 4X4YB 4EJ1C 2WBWB 4W4OA 4Q7DA 3IDJA 5C08B 4ONOA 4KDWA 1LP9E 1F6AA 1H3XA 4X4ME 4OI8A 1F11B 1HZHH 1NANH 3O2DH 1G9NL 1RJCA 4K94H 5IVXB 5LJYH 4IMKC 4HPYH 5SX5H 1HKLL 4QT5A 4S11A 3V4VL 1J05B 4TYUA 4U1NB 2OR9L 5MEPB 5F7UA 1RZKH 5FGSA 5T3ZH 1JVKA 3BKJH 3GSVB 4MA3A 1GGUA 2YWYA 4X6BB 3K8MA 1Z5LA 4XNUH 3ZLQC 4UQ3B 4R97C 1Z9SA 5E8OA 5JXED 1NMAL 4LNRA 1H3WM 3OKKB 2HVJB 4D8PA 5KS9E 1A14H 2E9BA 3CLEL 4X4YA 3VXRB 5GSVB 1N5AA 1L7IL 3W2DL 3QUXA 4WHDA 2X4SB 4LKXB 3IF1A 5E56A 3F6LA 3SDAC 5IVXA 5IF0A 5IWLC 2WINA 1CGTA 1W0VB 2CK2A 4NZTL 4Y2DA 3MRFB 1BFOA 3ARBB 2CKBB 3HC3L 4GW1B 1JPSL 4ZPVB 3FCTA 3VWJA 1HSAA 1KCVH 3RJQB 4MB5A 2VLKE 3G5YB 3JWNC 3QIBA 4S1SH 5DJZB 3KYNA 3MFGB 3HI1B 1P5VA 3C5ZC 5LCVL 2E7LC 3C6LA 3ZYZA 5GS2H 2ZOKB 1T22A 3B4NA 4UIMB 4CMHC 5J9PA 1G7JA 4MHHG 4N9OB 3U0PB 3RIAK 3HI5H 2HT4D 1G7PA 1I7UB 2MSPA 3TNMA 4APQA 5I71C 5IUSA 4L3EA 4NO0D 3P4LA 4JM2A 1C16A 2FYYA 4O58L 5K9OB 1L7TH 1A6VL 1KOAA 2Z9TA 4XBGB 3Q5OA 2ATPB 1YN6B 5C0RL 4I0KA 2Z8SA 2FD6H 4MB3A 4GKZA 2VUOA 5I8OL 3MRFA 4JFFB 4P4RB 1X3DA 5EIQA 2IANB 2NX5E 2PNDA 2WBJA 4K7PY 4Z95L 1O7SA 5TQ2L 4HIHB 5EB9A 2HTKC 3OHXB 3ULUD 2F5BL 4DUWA 5BV7H 5TDNA 3SDAB 4WFGE 1LO4L 4OB5L 4OTXL 2W92A 3KLDA 2KL6A 1IILE 4KJWC 3MV8B 3D1MC 5I1CL 1XF1A 1ZHNB 2R15A 3NZ8B 2Q8BH 5BRZB 3M07A 3SGJC 1GHFH 4Y2DD 4U1MA 4BKLB 2VR9A 3MV7A 4APQC 1NAMA 1FYTD 3T09A 3IDNA 4LCIH 3FO1B 3WN5A 1F3RB 3UTPD 2VLJD 4OLWL 5IB3A 1KCUH 4AL8L 1MCLA 4G8IB 5K9QI 3KPSE 2GJ6B 1I1AD 4Z8FH 3B6SA 2NW3A 4U1NA 1DJSA 4LCUB 1ROWA 3OKOB 1JHKL 5HI4D 4XCNA 4IJ3C 2I07A 4QRPB 5DUBB 3QWOA 1CICD 3GMQB 5DD6A 4IRSC 2VWEE 1CK0L 4JHWH 4FXKA 1JZ2A 1GGIL 1FO0L 5HVHC 1HE7A 2FX9H 3F65A 3P4OA 3EJZD 3QCUH 3HC0B 2EYTB 3F58L 2FLBT 3UTQB 1QFPA 1SYSB 4RGMC 3MJ9A 4QRSB 3ARBD 2PR4H 4DUVA 4OIIL 4MJIE 4FXKB 1FIGL 2HT3C 2P44B 5DA4A 5E8OB 3FO0L 5C07B 1PYWB 3UTZA 1UEMA 3BGFC 4F9LA 1P7HL 3KPOA 4TQEL 3BDXA 1OTTD 1GCFA 4NC1E 1ZS8B 2J8UF 1Y6NR 1Z9OA 1WZLA 5I0DA 2HMIC 4FQJH 1QLEH 1KJMB 5I8KH 3GBLA 3VXMB 2L7UA 5AWNH 4JFFE 4NKMA 4OCXL 4ERSL 5C0BA 4NGHL 3U4BL 4M3JA 4V2BA 5E1HB 3D18A 4XCYA 4MMXC 1SM3H 1EFXB 3ZDYE 3QCTH 5T33L 4PJIE 5ESQA 1ORSA 1F4YH 5I75C 5IW1A 1YUHA 3TBYA 3O4LE 3QDHA 1CD1A 1TDQA 1UWGH 4EOWH 1BD2D 3H6JA 1NLDL 3IDYB 5TPWL 1IAII 2IH1A 4HFUL 3MBXL 3SDXB 3GB7B 2OR8A 1W0YT 3KPRA 3IDUA 3VI4F 4BQ8A 3PWUA 4PGEA 1WBZB 5DRNB 1RZFH 2BVOA 4R90L 1FFOA 3AREB 3AS1A 1NCWL 3QULA 3EYVB 2VC2H 3U0WH 1K85A 4PJ8A 3R06A 2DJ4A 5JW4N 4Q9QH 5EU6D 5FO9A 1P9MC 4PJCB 5DJ8A 3G6DL 3WXWH 35C8H 3THMH 1UJTA 1WTGT 4PLKC 3OL2A 3QFDB 1PX4A 3JWDC 4JM4H 3VW3L 4P2OC 5HGAA 4X7SH 1F3DH 2EDWA 4Y4KB 4HUNB 2X4UB 5CHNA 4I18B 2IQAB 3BE1H 2AEPL 3NIDE 5LGJA 3CFBB 4NZRH 2HKFL 4K2UL 1EHLH 2YUVA 3C08L 4GBXA 4HH9A 5F9WC 4OM0L 2BCKB 2CD0A 3C9NA 5D7KD 1UWXK 4H1LG 4XCCL 4YXKL 3O9WA 5T3XL 3MNVA 1KFAH 1I3RB 3MA9H 3EUUA 2XTLA 5BXFA 1ZEAL 3VRLF 1BWMA 2YD9A 2ITCA 4PJEA 5CLWA 1YMMB 5MEPA 1CR9H 1M7IA 5CD5C 1SJHB 3QUYD 4P5TD 5MERB 4LCCB 1G9MC 1DBML 1HSBB 1VGEL 4J3VA 2YUXA 1YEFH 2R69H 1X6NA 5BV7L 1FV1A 3GGWA 4WDIB 3DROB 3MLZH 3MCLH 5FO8A 2DL2A 4G6MH 4J6RL 3EO1A 3E1F1 1UKSA 3BEVA 5C0DA 1N6VA 5HPMB 5J11C 4XNYH 2C5DC 2VLJA 3RGVA 3VXPA 2R2CA 3RPIA 4YHIB 4NQDA 2ENYA 1IC5L 4FZEL 4MCYA 3TBVB 1P53A 4POYA 4UINL 4JQIL 4GG6F 4QTHB 4KMTL 3PWNB 1D9KB 3DVGA 5ALBL 5DRWB 1CFQA 2PW2A 1IC5H 1AXSA 2BMKA 5ANMB 3FFCD 1G7LA 4NQSB 3ZKNC 1PAMA 2IPTL 5HDQH 3CFEA 1MRFL 1TZHB 3KXFB 1CDJA 4K71C 4LVEA 2AERT 3SKOA 2JF1A 5F9OL 1A4JA 2W0FA 3UDWA 1K4DB 1RIHL 4G42A 4NQSA 1ERNA 3FQXA 4GAYB 4LLQB 4EN3A 2NPLX 3LQAL 1MHHB 3WNLA 2FJGA 5CJQL 3KHQA 3HC3H 1A6TA 5IOPB 5D6DA 5JHDA 1UM4L 1YC8A 1C7SA 5HGBB 4R4ND 2J5LC 3LPWA 3V0VA 4YBLB 1AP2A 5B22A 2X2YA 1MIEH 1U3YA 2CDGA 3BD3A 3HE6A 4NSKA 5AYUH 1BQUA 1KTDA 5ADOL 2BNQA 1UACH 5D1QC 5E6ID 3BPOC 2D7QA 4NPYA 2F15A 4M61B 4L5FL 3TVMD 5HY9B 1WFTA 4PJGA 1I3GL 1P69B 3LV3A 3KYOB 1DEDA 2B2XL 4YBHA 2PXYA 5SWZD 5KVDH 1OP9A 1OAYH 4M1GL 3OAYK 4XPFH 5TH2B 3OJ2C 4N8VG 1NDMB 4XNZC 3EDEA 2XTJC 1IAIL 2B39A 3KG5A 4MD5B 4YHOH 3KPQB 3ARVA 3GIZL 1R5IA 5GPRA 2CK0L 4ONGL 4G9FE 4HWBL 2CRZA 3MA7B 4U6VH 1IAIH 1VFBA 3V0VB 2E27L 5EZOH 5ICXB 1T5WB 5C0EB 3B9DA 1CTNA 3H0TB 4LCWD 3I2CL 2FIKA 3SGKA 3SE8H 4MCYB 5C8JB 2X6MA 4R7DB 5HHME 1YMMD 3C5ZA 5DJ8B 3W9EA 4HG4J 1WBXB 4FTVD 3WFHA 1OCWH 4LAQL 4HKZB 3SE3A 3MRMA 1A14L 3U2SA 1YPZB 4JO1H 3MODL 4OF5A 1RK0B 2XYCA 2X5PA 2LVEA 1B0RB 3OJDB 2EDXA 3VG0H 3SJVE 1CDCA 3K81A 1SEQL 3SQBA 4BA8A 4C54A 5EU5A 4QRUB 4W70A 4XPHL 4NCC2 4LP5A 5T3XH 2JJTA 2Z91A 1BD2E 4J1UA 2JJVA 2D7MA 4PJFB 1FZJA 3UBXG 3RU8H 1ZWIA 5CCKL 5D1QB 4UILH 2CDEA 4G80A 1UENA 3GBMH 2VZOA 2YPLD 1IGYA 1B0WA 2EEAA 3VE0B 1T89A 3LIZL 3X12B 4XCYB 5E03A 2VTFA 3OB0K 2MTPA 4HGWB 4PJBB 5DVKA 1RV6X 1YMHA 1K3IA 4G80B 4ZFZA 3U36B 4OZHB 2NY1C 2ITDB 2I5YL 3TPKA 1T1XA 5EFIB 4H8WL 5DRXB 3VGEA 4EI5D 1JGDB 1CGWA 3S5LB 2HLFC 2P5EB 3LDBB 4NQDB 2X4NB 3GSQA 3PJSB 2J8UB 4FQIL 1T4KA 5ACMA 3V52H 4EIGB 4IIQC 4WHTA 4A6YA 4ELME 3B9AA 2CXKA 4YDLB 4HIXH 3VXSD 1UCBH 2DJUA 3DRQA 5BJTA 5GRXG 5FYJU 4WWID 3RVUD 1QSEA 4XCFH 2YZ1A 2X4QA 5SWSA 2K3TA 5CBEA 2EH7L 1B6DA 2A38A 1U8LB 4HKBB 4KKAD 4TTGA 4LSSH 3VFNB 1TQCC 1QRND 4BH8B 1S7WA 3MNWA 2CPCA 4R26L 2VZUA 5GGQL 3SDDA 5BO1L 4RGND 3IGAB 1INEL 1UB5A 3GSNL 1AXTH 4Q9RH 3KNBB 1FH5H 4PB9H 3ZMRA 1KG0B 5IQ7H 3KWWA 5AZEL 1TVHB 2XXMB 1KJ2A 3D0VA 1Q9KB 3IFPB 4E41E 3A67H 3HRZB 5LVEA 1DP0A 1FIEA 4LMQE 5F7KC 4F7EA 1VFMA 2P5WE 3W82A 4XPTL 1JF1A 5IV2B 4QXGL 1AGFB 3L3DA 4X7TA 5IR1A 2VLRA 4YHNA 1ZA6A 5IFJB 1AIFB 2UV3A 3QQNA 2KH2B 3JBG7 2CUMA 2CLVB 5IIEA 4MJ5B 1L0QA 1RK1B 4IMLA 1BZ9B 4EVNA 5EWIH 2APBA 2FH8A 2NX5D 4M6MH 1VFOA 4BUHA 4BELD 3T3PE 2IANA 3FQTA 3O9WD 1MY7A 1TQCB 3ZYJA 3G5VB 3UTTE 4MNQB 2QL1A 3U82B 5FK9A 3P73A 4ZAKA 5DSCB 1YA5A 2CSPA 3C8HA 1NMBL 1F3DJ 4IBLT 4NNXA 4NM4H 5DFVD 1RVFL 1DBKH 5CP3H 3L3HB 2AJXL 3RL1A 3BVNB 3S98A 4HCRA 2GJ6A 3SDAD 2FJGB 1FFPA 3QG6B 3CMGA 1XIWA 3MV7D 4HAGA 1IKNC 2XZAL 2BOCB 3KLHD 3QEQA 3WJLA 2DJSA 1HYRC 3JWDH 1LNUA 2PR4L 3WIHH 1Q9OA 3S8WA 5EU4A 2VUYA 5T3ZE 3TYGH 2YKLL 1WISA 4FQPA 1N64H 2RCSH 4KQ4L 1DDHA 3ULVF 2ED7A 4WJ5B 4GRWE 1A6PA 1MCHA 5DZOA 2OQJB 5D7JC 5CEZD 1MFBH 2ADGA 1MCKA 1T0PB 1MI5A 1SYVA 5I1IL 2E5EA 1F90L 1MJ7L 5FB8B 5J12C 3L5WA 3BPNC 3QUZC 5DC0A 4F37K 2R4SL 5E7BA 2EEDA 3O8XC 3OAUL 3RWIA 3KYKH 2YWZA 2VLJB 2XKNB 4YHZH 4MD4B 3BKCL 1MNUL 3RY6A 5EIVA 3VXOB 4B41A 2R0ZL 1U8PA 3QEHA 1WEJH 5CP3A 4PYHA 1R0AH 3TJEH 1OSPL 3DVNA 1KJ2H 3KJ4C 2QADB 5I0ZA 4XB8A 1JBJA 3IAQA 5EO9A 3L7EB 3LRGA 1OP5K 1YMME 2AEIT 4KJWD 5DEFB 4NHUA 3WIHA 3HFML 1JYVA 1CLZL 2IMNA 1AD0A 3IFPA 4D0BB 3RZCA 1OM3H 1MFEH 4GRLB 3NFSH 4P2QA 3L3JA 1MRDL 1I9JH 1OWRM 1NEUA 5GS0D 4Q9BA 5DJ2B 4J3WA 4D94A 4K8RL 3VW3H 4QGTA 3IRZA 4UI2A 5CWSB 5KS9A 3PDOA 5KVMC 3H7BA 4PG9B 1FIGH 3CLEH 1KTRL 1A3LH 5D1ZC 4C4KO 3G6JB 4TUKL 4BH8A 3Q3GA 1MFAL 3PWLB 1QZ1A 1I8KA 4OBRA 3T2OA 1F4WH 4P46A 5CEYB 1PG7H 1G7QB 1I7RB 2P8PB 4ZUSA 4P3CH 1N6QH 1ACZA 4X6CA 4N0UA 4X7EC 4N90E 4OF6A 3IKCB 1FGNH 5I16B 4RFNB 3QIUB 4OZ4A 1NGPL 1G7HA 1VSCA 3D3VA 4GKNB 1T3FA 3TWCH 4O4YH 1IBGL 4NWUL 3E3QC 2F54A 3ZKSD 1JRHI 1MUJA 4F3FA 4UIMA 4DFHA 3RWCB 4XVUC 2HMID 1M1SA 4MCZA 4JQXA 2EZ0D 4L3ED 5SWZB 4OI9A 4KK9C 1DN0A 4P57A 2WIIA 3D25A 5F88B 3BH9B 4WIQA 3WCYA 2RFXB 3MJGX 3D6GA 2W65A 5F9JA 1MREH 3OJVC 1IGYB 5CAYB 1DDHB 1JHLH 1PY4A 3GMNB 4KXZH 5TE6H 4N0CD 4UZGA 4FMFA 5SWZA 4D0BA 4I8DA 3JZ7A 1Q9OB 5FOBA 1DSFH 2KQNA 5DEFA 1XGQA 2NNAA 3UTSB 1MJ8L 4P23B 3VFWB 3A6BL 4YHKL 5CS7A 3WUWA 1LO5A 4S2SA 4KY1H 4PP2A 4LLAA 5I74C 2PW1A 3PGFH 4ONFH 1D9KC 2EDBA 4KZDH 1V3JA 3RRQA 1DFBL 3MYJB 2QHLA 5J1AA 1A7NL 5F3HB 1I7RA 4JVWA 2DQGH 4FOMA 2OTWA 3BP6A 3RUGF 4R0LC 3M8OL 4IS6B 4UOW0 4S1RL 3UO1H 4HUKB 1MIML 4OIAA 3MRBB 3RIFF 1EH9A 4PLKD 4GG8B 2NXYC 1CXLA 5IVZB 3DOSA 1IL1B 4XP4H 1MOEA 5L9DH 1T21A 1N2RA 1DE4A 2H32B 3DUSA 3O6FB 3OG4B 4FFYH 2CIIB 3P0YL 5DC4B 1U95B 3LZFH 1HINL 4KHXH 3H3BC 4UV7L 4JO3H 1YDPA 1CLYH 4NN7B 3HRZA 1DN0B 2Q20A 4NHUB 2Y9RT 3VRIB 3IXTB 1H15A 1S9YB 1R3HB 4G6ML 4J6RH 4P3DB 2AGJH 3T8XA 5D7KE 3MLUH 2VH5H 3I50L 1G1CA 4MA8H 5DHVB 3VFTB 1HEZB 2VQUA 3MRRB 5HYJB 1J0JA 2VDNL 4HIJB 3P77A 4W6WB 4PJGB 4PJ8B 1FVEA 1FNGB 3TN0A 4YX2L 4ESKA 4IDJL 1S5IH 3WN5C 1N3NA 3NABL 5F7MC 3BGMB 3H3PL 3DETD 4M7JL 2ZZUT 2F8OA 2H41A 3TO4C 4X6CB 2WBJB 1U8LA 4JANA 5ITFA 3QDME 5C9JB 3FQTB 4HC1L 1KCLA 4WCYL 3ULVH 4RWHA 3TO2A 4AEFA 2OBGA 4MQ7A 1KB5A 4PGBA 5KOVC 4BQBA 4MAUL 5T1DL 5KG9B 5FV2A 3PWVB 2HJFB 4JM2B 3VFVA 4K7FB 5EWIL 1JK8B 3SEPA 1A6VH 2HJKB 3Q5TA 5E6IB 5GZOC 1T04A 2CGRH 4YHMH 5CZXD 5ISZE 2DF3A 3OR6A 3BAEL 3WE6A 3ARTA 1WTLA 4D9LH 3IFLL 3AC0A 1IGJB 3MLWL 3O0RH 1UM6H 4NZJA 5FYKD 4Y88A 4GAJH 3TH3T 4O9HL 4LU5H 1OM3L 5GJSL 2CIIA 4P2CG 2EIZB 4UBDC 1R5WB 4DOHE 2CKBA 1I75A 1R3IH 3T1WA 1KNOB 1ACYH 2DIBA 1YYLH 3MJ8B 1KLUB 2LAAA 5CIPB 5IVOA 2UYLB 3MFFA 2UZIH 3EYFA 4Q2ZB 1YQVH 4QRSA 5DMIL 5INCB 2V9TA 2IBBA 5BCAA 5DMGC 5AD0A 3RWDA 3JSSA 2M1KA 3WD5H 5SX4I 3BAEH 3AS2A 4KKNA 2JB6A 5F6IC 5T33H 3KPLA 5I2IB 5E5UB 2GFBB 3VFUB 5D2NB 5BW7C 3TVMC 5DD6B 2JCCB 5T3ZL 4PJDA 2N7AA 2VC2L 5F3BA 2R2HA 5EPMB 4ZQKA 2R1YA 4WUUA 5FUOH 4LRNH 3KYKL 5D1XC 3S3PA 2UWEB 3UTSA 1VCAA 1HZHL 3V8OA 2FR4A 2BC4A 3ROOB 3A67L 5GGUA 1I85C 3VXQA 5EOCL 2XN9B 3MOAH 4KUCF 5JNYA 3S37X 3ZE1E 1C5CL 1WV7T 2EC8A 4GRWB 4HC1A 4MD5A 4JM2C 4PJXA 3RAJH 2XWJB 4ZUVB 1R6VA 2ATKA 2DM3A 3K1KC 1KTLB 3AMKA 1JK8A 2E3VA 4UOW1 4JJHA 4RNRB 4P4RA 1ZV5A 4ZNCD 5J7CC 4GKZB 4W4OC 2VDKH 3FB7A 4ODHL 2DQDL 2MJWA 2ZNXA 1WIUA 1YNKH 2X05A 3MV9D 4XP9L 4Y5VC 4PJ8C 4N0UB 2OL3A 3CVHA 2VZ3A 1RZJL 3HCVA 4WNQA 3X3GH 4L3EB 1I85A 2XZCH 3S5LA 2PUQT 3SDDC 5ID1A 4OLZH 4YIQB 5IROC 2AV7B 1NFDA 4CMMA 1RZIA 3B8YA 5F21B 1IFHL 5E4EC 3SDCB 2ORBH 4LSUL 5DHVA 3VFTA 3Q1SH 4F58L 4Q0XH 3U83A 3WEXA 5DTFA 3MROA 3S3JA 3VE0A 4M1CC 1SY6A 2ESVB 3VGDA 4NWUH 1WIPA 1ZTXL 2Q3AA 1NCCH 3WLWC 4LPYA 4DTGH 1BD2B 5AZEH 2VLLB 1XF2B 1UB5B 3O8XB 1T0NA 4P9HC 5LG1A 4PJ7A 3LQMA 3VFGH 4U1JB 1PSKH 4M4RA 3ARDA 2R29H 1G6RL 5E9DB 3MTRA 1P4IH 1T1YA 4XPBH 5CINL 5E99L 1VGKA 1RD6A 2FGZA 4RMSA 2MOVA 5KN5A 1H5BC 3BPLB 3MRIA 3ARWA 1QP1A 3MLRL 1AXTL 1B88A 3E8UH 2AXGA 4PREA 3RWDB 5I1KH 4POUB 2BNQB 3L7FB 2K1MA 3GSWB 4Q2ZA 1I7TB 2GUOB 4PY8I 4EI6B 3A6BH 5ENWA 1U41A 3C6LD 4IOFD 3LKQA 2QADD 4WTZG 4JKKA 2FJHA 4QHMB 3SGEH 3VJ6A 3ZT7A 3MLYL 3RZCC 4RGNC 1WWAX 1KCKA 1TQBC 1MWAA 1XGTB 5A16B 4G8IA 5T1MB 1F00I 1JTTA 1KEML 1K5NB 1PZUB 1A4JB 1R5IB 3ZE2E 1YY8A 4LAJH 4QXUL 3IS0X 1JF6A 4NNPH 3HZVB 3RGVC 4GBXB 4HH9B 3O0RL 5HHQB 4WI2A 1NBYB 3MROB 2YA2A 1MAML 4G9DA 2FBOJ 4OGAD 4HWNA 5J06A 4HWEH 3LN4A 4Y1AD 2BMKB 5D6DC 4Z7UA 3WMSA 3DTXB 4M9PA 1UZ8B 2X4PA 5C09B 1KIUA 1ZOXA 2PTVA 2X89A 4KZEL 5FO9B 5AYUL 2WLYA 3VGGA 4HLZH 3U2SB 1JFQL 3QFJE 4LHUB 4L3AA 5D9SA 3EFDL 3BKMH 2V7HA 3EO1B 4I77H 4F7PA 1ZVSB 4H1LB 1MCPL 4YAQA 1DANU 2OI9C 3L3OA 3NN8B 4LHUD 3VD3A 1DANT 3T2NH 4CMMB 3C6LB 3LPFA 4HMCA 1K8DA 4TOYL 5HGHB 1MCPH 3DMMA 1WIOA 1YEDA 3HE6D 3W0WE 3DX9B 3DHMA 4WTWA 2I26N 2PF6A 2VZSA 1NMCB 4ELMA 2BNUA 3O3DB 4P2RE 5F1NA 1RJZB 1BFOB 5ANMA 3DURB 1U8HB 4F33A 2APTA 4JZOA 5D7JD 5DURD 5HI3D 5IVZA 4JRYB 4I18A 5JA8B 1LO0H 5FYKE 1YQ2A 2BDNL 2XKUA 3MLVH 3SOBL 3BQUC 4QEGA 2OJEA 4WGVB 2R2HB 5EPMA 1YECH 4ENED 2QQKH 5L88H 5HDLA 2HRLA 5F7WC 1UWGL 4LK4A 5L8LB 1JHTB 4JJ5A 1JGUL 2F5AH 1FVDB 2R9HD 4LLDA 4NYLA 2OSLB 5DQ9B 3DARA 4YBQC 1P4BH 5IFAL 1JNNL 5TDOA 5IJKA 2DS4A 1A6AB 1FL5B 1WBYA 3RWJB 1NCNA 2VLKA 5CKAA 3GB7A 3V95A 1FL6B 2GAZA 5DVMA 4ZTPL 5ESVA 4F9PA 1YEJH 5I9QB 1OAXH 2OI9B 2P45B 4ZQKB 1OAUH 1FNAA 3WJJA 4Z7QF 1CDIA 2VLLA 4P99A 3WHXA 1I4FA 5D5MA 3TNNB 1YJDC 1S7TA 3VWKD 2FEDC 3QQ4B 4JO1L 1MSPA 5DD3H 1FH5L 4IRZH 3B5TA 3QNYA 4D9QD 1ZHLA 4DKFL 4XCEB 5KSVA 1GC1L 3HPLB 3TFKC 3BZEA 3T0VA 5DD3L 5KZCB 5GS0C 5A2LH 3GMRA 1YEIL 5I66A 4ZD3L 2EO1A 4OLYH 1Q38A 3HZYA 5BZWA 5J56B 1FZJB 2NX5A 2EXYD 1A0QH 4HXAL 4Z7VB 4JFHE 4YXHH 1TENA 1P6AB 3C60C 5L9DL 5DJ0A 5IK3A 4LPCA 4J4PD 2BVPA 3I6KA 1OQXA 4LMQI 2FSEA 3RL2A 3ZL4L 3KPNA 1Y18B 3HB3D 2FECL 3NCFB 4N8VB 2E7MA 1JJUA 3GMMB 5B38B 4YHKH 4XXDA 4MNQA 4IDLA 3U9UB 2Y25A 5E5MB 2P8MB 4MHHI 1YPZA 4UTAH 3MV7E 1UVQA 2NY0D 4V1DB 5LCVH 3IRPX 4ZNEA 2RBLA 2Y7QA 4NFBA 2RCSL 3B3IB 4JN2B 1J88A 3RJDA 4ALAL 3MV9B 4G7VL 5IEKA 4OZIF 1CD1B 4GQPH 3KPSA 3O6MH 4ZO9A 9CGTA 1S7VA 2WBKA 2E6QA 1MI5E 2A9NL 2H1PL 3GJFB 1S78C 1T5WA 4J3XA 2HJLB 3WYRA 5J6GB 1M4KA 3DGGB 3T3PF 2E7HA 3GBNL 3Q0HA 3NFNA 2VR5A 1PFCA 3SDYH 3GM8A 3ARGA 3GJFK 2VXVL 2YPKA 1E4XH 1R3LA 2YUWA 3EW3B 3MMEA 3PHOB 1A8JH 3E0GA 3QHFH 4WO4D 5BMFH 2MFNA 3PG2A 4WUKL 5IB2A 4JPIB 2H32H 4DQOL 2ZPKL 3MGTA 1T2QH 2QSCH 3GHBH 1WZKA 5EZJB 5F1OB 4BFBD 2OR7A 5DJCA 4A6YL 4M6ML 2YN3A 1X44A 4FQ1L 4JN2A 3PHOA 3FKUS 2V17H 4UIKH 5B3JE 2ARJB 4OV5B 1J8HD 3HC0A 5KVGH 4JFFA 4Y4HB 4LPUA 5J1AB 3CFKA 4M6OL 4WU7B 3VFGL 2B5IC 2Q7NA 3VFSA 1T20B 3NFSL 4I9WE 5JIHA 1FZOA 5FCUH 4S1DD 1HXMB 1Q0XL 5CILH 2E7BA 4YFLI 2HFTA 1CIUA 3HMXH 2GCYA 5E8EB 1XCTB 4X6CF 4YXLH 1MCCA 3LKPA 3H42L 4K3GA 4WWKB 3R8QA 4ZFOL 3PP4H 4M5YL 1YDPB 1ORQB 1BM3H 1HH9A 3KPRE 2DLIA 3BSZL 3BJLA 5DD5H 3N1GC 1T1WA 5ADOH 3JUZA 3BN9D 1W0VA 3PV6B 5DJ0B 1JNLH 4L4VD 4ZO8A 1G0DA 1FPTL 4FQJL 4LF3A 1D5XA 1BOGB 1H3PH 4YGAB 3BP5B 4QRRE 3HUJE 5I66B 2C7UB 3T0AA 2AVGA 1QLRB 3NPSB 3AY4A 1K3ZA 5LGKA 2C3WA 4C83B 2WP3T 5KSAA 2AXJA 3TJHC 1SYSA 3PL6D 4WW1B 4F2MA 3G9VA 1U3HC 1A7RL 4XMLL 4X9IA 4P2RD 4HJ0D 3IFLH 3M17B 3O4OB 4BSWB 3CNKA 2BVEA 2XY1A 3SO5A 1I7UA 4ZTOH 3ZTNH 4YWGH 3HMXA 4TSBH 3ZT6A 4R9HA 1OOAA 3L3IA 3CU7A 5E94B 1S8DB 5EOCH 2XN9D 2VLRB 3FB5B 1I1CA 4PJEE 1T3FB 1A1OA 4LDOB 5BVPH 3MUZ1 4BZ2H 4V1DD 3DJ9A 3LHPH 1A2YA 1LO3L 2AJSL 4MSWA 3TA3A 3DXAB 3LS4L 5JIKA 2OK0H 2CKBH 5E6ZA 4OV5A 2AK4B 4UBDD 1IFHH 1AR1D 3L3KA 2EDOA 5EA0H 4G8GB 3EJYC 3QWRA 1D5IL 2C3HA 5GS1A 3F5WB 2ZSWB 3BXNA 4S10A 1EJOH 2NY7L 4ODWA 4K23H 3HUJF 5C0AA 1U3ZA 2PETA 1ZGLB 5DJCB 4Z78A 4EUPA 3M45A 4Y5XB 1PLGL 4WWKC 2AK4A 5KSBF 1U58B 4AQ1B 4D8PB 5GRVK 1MRDH 4JZJC 3NCYP 4EN3D 2OJZH 4DN4L 5IMLA 1EO8H 1NGPH 4N5EC 4MD4A 3C09C 3MLVL 1UCBL 4P2YA 5F8RC 3LKRB 3WIIL 2AK1H 3PWLA 2X4PB 3HR5A 5H2BA 1G9NH 3UJJH 3H9SE 2AEPH 3QZWB 5EO0A 3QRFM 2I5YH 4GQ9L 1X7QB 5EUOB 5BW7A 1J1PH 2R2BA 5I8EB 1KACB 4NNPL 5BO1H 4X7FC 4U3XA 1XIWD 2XICA 5JMOC 4AZ8A 4XNUL 3SBWC 1IAKA 1HK6A 3JV5A 1NGXB 1Y6KR 3GO1H 3KXFA 5DHXB 2R23B 4FFVC 1AD0B 5I1EH 1K8IB 1TXKA 3MC0A 4PGCB 5JW4Q 1RZJH 5HHOD 1PQZB 5KBNC 4LGPB 3PXJA 4M6AA 1J1XH 4UQ2A 5FKAA 5IHLB 2DMCA 1N5YH 3WO4B 3V0WH 2H26B 4QHMA 1JF5A 2IH3A 4QO1A 2PYFA 3QIWC 4OKVA 4JGMA 2Z31D 3DXAE 4KROD 4WHYH 5F1IA 5LKNA 3BDBA 2QHRH 4KGJA 3V2AR 4OI7A 5CEXA 5HPMA 3STLB 3OPZH 4PJ8D 4LLVB 1B2WL 1MAJA 4LL9A 5HHMB 3I6LE 3ULUH 3SJVB 3V6FB 1ZT4A 3SE4C 1ZLUK 1CFBA 2X1XR 5D8JL 1DCLA 3CLFH 2HFEA 1EEZB 4IHOA 1DVFA 1HHJA 1XGUB 4ZPTA 4DCQA 5KVFH 3OAUH 2P47B 4QXUH 1T83A 4FFYL 3EOTH 1AFVL 2FRGP 1RJLB 4PTTB 4LGRB 4KRMB 3O9WB 4MQXC 3CAFA 1JZ7A 3O11B 4AK1A 2P49B 1CT8A 2E7LA 5D7JA 4JY5H 3WLWD 1A7OL 5EO9B 1IM9B 2ICWB 5C86A 4WI4A 2YKLH 1RUPL 4TPRH 4MNGE 3O4LD 3SBWA 4GXVL 1IGML 3FOLA 5EZJA 3WDJA 1OP3K 5F1SA 4O2FB 1U91A 4LSPH 2C3XA 1BD2A 1FE8L 2BZDA 2YR3A 5JDSB 2NR6D 1B3JA 4JO2H 3BZDA 4HUVA 4M7ZB 5JR1H 3MRHA 4Y5YC 4LKCA 3D0VB 4MX7B 1B0GB 1JCKA 2X4QB 5SWSB 3HNVL 4CAGA 2OL3L 5EZOL 1NLDH 3MODH 1RUAL 1AO7A 1R3IL 3C6LC 2W1NA 2OX5A 2H9GB 5DJDB 4KK6C 4OZFB 1CE1H 3DUHA 3KYMA 1UKQA 4PJXE 1JNJA 1ED3A 3EHBD 1QPPA 1IJ9A 4RFNC 1D5IH 1DQLL 3WIFA 5B8CB 5FHAL 1UH3A 3RNQB 1FNEA 2IG2L 5LWYH 3W0WD 3BZEB 5EZLB 4ZUUA 5DJAA 1OQOA 1DR9A 3C5ZD 3DBXB 4ZTPH 1XT5A 1CS6A 3FCTB 5T1MA 3OKDA 1JNHB 3C87A 3UAJC 1TVHA 2UUDH 5HHOB 1D9KA 4OGAC 3BDYL 4GLRH 5J57B 1CVRA 4Y1AE 3VXNA 2UZXB 1IGIL 4I3GA 4CKVX 2X4SA 1G6VK 2W60A 2X1QA 3IDIB 3IETB 1T03L 3VXUE 1F42A 2M26A 3MCLL 2FATL 4GBXC 3AS0A 3LS5L 3O6KH 5JOFB 1PYWA 3UTZB 3V7AG 1A7NH 4JFDD 2DM7A 4KJQD 4U0RC 2P8LA 2DN7A 3DX8A 4JO4L 4QHNB 4FQLL 2KUTA 1QSEB 5C0GB 4XI5C 1SBSH 3NACH 3FQRA 4LCWA 1HSBA 4PLJD 5KSUB 1AGBB 4MZ3A 3S34H 2EH7H 1S9XB 4HCRH 1NAML 1Y6MR 3TYFA 3ULSB 2EKSA 5MENB 3QDGA 4HUUB 3QYCA 2YRZA 1LO2H 4KKLD 2BHZA 4Y8AA 4Y16B 1BQLL 4JKMA 2BNQD 1U8QA 3OKOA 2ESVE 1FN4A 5EU7C 1BLNB 4JFFD 3NCBB 4MJ4A 1YEJL 4AENB 1J0HA 1HYSD 4FQQA 2QSTA 4JAMA 2QSQA 5GGTA 2PO6D 1MCDA 4O58H 2MPAH 4X7SL 1UWEL 4NQCE 2H6PB 1TCRA 5JOFA 3DECA 3MBEC 1MLCB 2EE9A 4YK4C 2DWDA 3LB6D 3TT1H 3TV3H 4Z95H 4KJYA 1JPTL 4O4YL 4PRHE 3ARDB 4GH7B 4OCNC 3WBDA 3GSRA 3EYVA 4YAQB 2UY6A 4JZOB 4M7ZC 1MFDH 1J0YA 1KCSL 2OL3B 12E8L 1E28A 2GJ6E 5E5MA 4PJFF 3MA7A 1X4ZA 3ILQD 3NTCH 2XQBL 1L7TL 1E4XL 4I0PD 4M6OH 3EOTL 3E3QE 5CZVL 1KPVB 1GJIA 4GG6A 1EEYA 4QWWD 2PXYD 3DX9A 4PLNC 3FONA 3NBNA 2P48B 3SKNB 4X5WB 2O5ZH 2CUIA 1KN2H 1N3NB 2QJDA 1JZ3A 1T04B 2GT9B 3MV11 3PP3K 2VSDA 3C5ZB 5JZ7D 4E9LA 3V5HB 2DL9A 2NXZB 1YPZF 1KPRB 4WW2A 1MCFA 5D4QA 1YUHB 5HHVH 1TVBB 2GT9A 5C6WH 5JDJA 3D48R 4BUGA 4KV5E 1WSST 2NYYD 4XCEA 3QA3B 1JZ4A 5JXAH 2HKHH 1ZLVH 4E0RB 5EULV 1DLFL 1U3HB 1C7TA 1S7TB 3S35L 1DE4B 4Y16A 2VO5A 5HJ3B 2BJML 5ISZD 4J1UB 5EOTB 3TZVA 1HINH 4XWOD 3VH8A 4BH7A 4YGVB 4KK8C 1M05A 3GSNA 2EXYC 3EKCA 2JCCE 3OF6D 2D3VA 3GNMH 4XC1H 1EIBA 3M8OH 1HHJB 4ZPTB 3EOYG 4J4PC 2IC2A 1DQQB 4ALAH 1BIHA 1TCMA 4NT6A 5E2TL 4MYWB 4TVPE 5EBLB 4P5MB 4E5XB 5I1DA 2UWEE 1U0QA 1F3JB 2IALB 4P5TA 3RQ3A 1H9VA 3O6LL 2ZOLA 1ZT1A 5HYEA 3U4EA 4XWGL 4P2OD 1W2KT 4IHOB 4TSAL 3ZHLA 3QHFL 6FABL 1S9VA 1ZT7B 3JV4B 1LE9A 2VLMD 2VDPL 3HMWH 1A7PH 3LMJH 4G6JH 1B4RA 2EKSB 2J8UE 3A6CH 5IB3B 5T3XD 1N64L 2V2XB 3H9HB 3KJ6H 1U42A 3STLA 2H3NA 3QI9A 3MXWL 1EAPB 3OR6B 3RAJL 4LLYB 5C0JB 4PRIA 4N0UE 3RBGA 1FZMA 1G7LB 4NRXA 1TMCB 3EYOB 3QUYB 4P5TC 1YQVL 3ELAT 1KLFA 2YPVL 4UQ2B 5E2UL 5FKAB 3AXLA 2G75A 5GSRA 3MLPA 4PJ7B 1R3JB 3TWCL 3QFDA 1S7UB 5IEHB 5A3IC 2F54E 3OKNA 1GOFA 4AG4L 7FABL 4L8DA 1JWSA 4YK4B 4U1GB 2FHBA 3ARXA 4PV8B 1LEIB 4JKPH 2HFGL 5DLML 4F8QA 4F80A 4KRPC 1OAKH 4GG6B 4P3CL 1N6QL 4MWFB 1ZA3A 3CVIH 3M1BB 3NOIA 4DKEL 4HAFA 2XPGA 5HGBA 3TA3D 4G7YH 4OD1H 1BBJA 2FH6A 4YNYA 2P42B 2DDQL 5SWZE 3BIKB 4NQEA 3JWOH 5FIEA 1HEZA 1KIRB 1EEUA 1SEBB 1IEBA 35C8L 3THML 2DQJH 4G42B 2D31A 3TPUB 4BJLA 1QVOA 1B4JL 4WNQB 4QRPD 3QIBB 2C3VB 3O11A 3JXAA 5FUOL 4AM0A 5DMYA 3RWEB 5GGRB 1PBYA 5CJOL 4DGIH 1J7VR 1MFCH 1QSVA 5I15L 5EOCJ 4MNQE 2BC4B 1PLGH 5C0FB 1AGCB 1J0IA 1ZGLA 1A1OB 2B0SH 1GZQB 2B1HL 3HFMH 2V9QA 4HJJL 4WFHE 2X70A 5FGCB 2DWEB 1OGTA 3KVQA 2HT2D 3GSWA 3P2TA 1BEYL 5E6IC 3TJHD 2BY0A 5FYJD 3O6FC 1NBVL 4DAGH 4L4JA 3T0EE 1TIUA 5EZIL 3P3YA 4TTDD 2XTJB 1M71A 1OTUC 4X6BA 1W8NA 4ZXBC 2R29L 3D85A 2NXYB 4RISH 5HSFA 3LS4H 5C2UB 2R1WB 4GKSB 1XCQB 3CXHK 4XBEL 4N0YH 3BHBB 1CFNB 3OBAA 3SPVA 5FECB 3JV0A 5C07A 1BOYA 2PTTB 1V7NL 4MVBC 4S0TD 3C9NB 3W39B 4RMTA 2H2PC 4EIZC 3BT2L 2H2SC 4Q9RL 1NAMH 1RZGB 4P2OB 2DQGL 5AD0B 1F4XL 1RURH 4C83A 3K1DA 4PLOB 15C8L 3QUKA 4J3UA 4ODUB 3KPTA 4NKMB 4KJPC 3DRTB 3ZDXE 3RWCA 4OTXH 1SMAA 1RPQA 3ZYIA 3KPNB 2PYFB 2VZ1A 1EMTH 4PJCF 3HS0A 4ONFL 3MJ8A 3LQAC 5DJ6A 2DQIL 1D5ZA 1VESA 2AJ3A 2BX5A 1GYAA 5EUKA 1J1OL 4ORGA 3CFCL 1UQSA 4G5ZL 3T4YB 5DVLA 4ODXA 5GRJL 3X13B 2NXZD 3RX8A 4N0FA 3OKMB 1DQMH 3FO0H 1IGTA 5C0ND 4LOUC 3UO1L 4Y5XA 1MHEA 2AGJL 1J87A 2MQ3A 3G6JA 5I1GH 5E24E 1U8NA 4WW2C 1MWAL 3ECBB 3FMGH 1NAKH 2HVKA 5FDYA 2ID5A 4Z7WA 2GSIB 1UEYA 2FWOB 1PJ9A 3IVKA 3BEWB 3PP3H 5MEND 1MRFH 4N5UA 3GI8H 2ICEA 4TNVK 3MLTB 2VXUL 2OMBA 5A40E 1JRHH 1Q1JH 5C07D 1OAZH 3D3VD 3ULVL 4EKXA 3LSOA 1II4E 3GI8L 5C0RH 4ZODA 1NCTA 3MLTA 1ZHNA 4L4VA 4LLDB 2VIRB 3W81A 5IKCB 1OTSC 4RZCA 2F53B 4A6YH 5I76B 3QISA 3TCLA 4P46D 4J3TA 1Z2KA 4J2XA 4YX2H 1QTYT 3EYQD 5H37H 4LKXA 2VAAB 4GRLD 5J6HB 3MBEA 3L5JA 1OARL 1GZQA 3VXMD 2Z31C 4PR5A 1FYTB 1QFOA 1MCWM 4JRYA 4DZBB 2J2ZA 4ZFGL 2BJMH 5E5RB 4RX4D 4I18C 3PUCA 4JFZH 4P2QD 2VOTA 4GMSL 2AQ3A 1IBGH 2CO7B 1C1EL 4Y2DB 4N8VA 3BMVA 4OFKA 1ZLUH 1BECA 5D5MF 4U7KA 5KANI 3PGDB 4LDEB 3OTTA 3MV9A 2Y07H 3U0PA 2NY5H 1S9WB 1TJGL 3SCMD 5EH1A 1P4BL 2W9DL 5BZWB 1FZKA 5FDWB 2WSKA 5JMRA 2R0ZH 3HI1A 4YDIL 5F7NC 1KN4L 1MJJB 4FNLL 1B4JH 2MQ0A 2HVJA 3C5JB 1DVFC 4IRJC 3D39E 4MQXD 5H94A 2GTZB 4JFYA 5GGTH 4D0CB 1ZA3B 3RKDC 1YN7A 5EUOE 5D7LA 4PJIB 3L95A 2X09A 1XCTA 2YD8A 2I27N 3ILPA 4F7MB 3T08A 1FZOB 2Z35B 4HS3A 5EFIA 2HWZL 1WCBB 4RISL 1NFDE 4FS0A 5INDA 1HHIB 1NCAH 5EDXA 3FQNB 1A3LL 1T1WB 1NH6A 2YD1A 1MAKA 4PJ9D 3VDAA 4HKJA 2DI9A 4AM0B 1QSFE 1UH2A 3MCG1 3HG1A 4ODSH 1HHKA 1KXQE 2AEQH 1X5HA 1Y0LA 1N4XL 5HVGB 2A9ML 2AS5M 1HQRB 4GAFB 1BX2A 1I9IL 3TCXA 4AT6B 4WI3A 4UMGA 4S1QL 5FGBA 3LKRA 2A73B 3TIDA 2Q87A 3F7RA 3EZJB 2R2EA 2D0GA 3GMPA 4OQTH 4Y89A 4POZC 1OT2A 4QRPE 3CSYA 1NCBL 3WNNA 3ARFA 3V7MA 4P46B 4JO4H 3ARUA 5IFAH 3UYRH 1L9MA 3K46A 4S0SD 1IEBB 1VGKB 4LNVA 1DTUA 4Q9QL 2FL5A 3NN8A 3D2UA 3QPXH 3GKWL 4IEFB 1X6LA 2AV1A 2VXSL 2JIXB 4EXPX 2XA8L 2W0KA 3P40A 4FTVA 1LK2B 2XQYG 4R7NA 2F53E 3PGCA 3DRQB 3A0OA 1A2YB 5KSBE 4O5LH 1Y18A 4Z7NE 3HZKB 3RL2B 4PLJC 3CH8A 3QUML 1T7WA 4DGVH 4XBPA 3WJJC 1UYWL 4Z7VE 4OV6F 4HULB 5E8DL 1GPOL 1I1AB 3FO2B 1SEBA 1EK3A 3MXVL 5DXWA 1PD6A 4IOSD 4XMKH 1LP9F 5FM4A 3GIZH 3W0WB 5F7EL 2XPGB 5F7YC 5IT2H 1J11A 5HHQA 5IGXH 4GW4A 1U8IA 2JJSC 4KH2A 2WW8A 4L9LC 2GW5A 3LQZA 4X6EB 3O3BB 3MBED 6FABH 1KPUA 3EFDH 3BP5A 3UC0H 2Z91B 4DVRL 3DTXA 1VFAA 3JTSA 5BQ7B 2C4FT 2VQTA 5EUKB 4FZEH 3OG6B 1G7HB 4UNTA 1A64A 1MIMH 3MR9B 3O3BA 1K4DA 3DXAD 3S4SG 3OGCA 3B9EA 3N1PC 2A1WH 4ZAKB 1KELL 1Q94A 1S3KH 3CK0L 4LEXL 2YPLE 1S9KC 1NANI 2P8PA 2IPKB 5I1GL 4MAYB 4JAMB 4XAWH 3MO1A 4CVXB 1DQQA 3BVNA 5I1AA 2IAMA 2G5BA 3H7BB 1T83C 5E95B 3X11B 3DO3A 1FG2B 1P84J 3EOAB 3J8F7 4KQ3H 4M6NL 2ZPKH 1T20A 2B1AH 3EDJA 4XVTH 1RIVH 2DOCA 3MGTB 4K7PL 4P2RB 1GGYA 3SKNA 4OZGA 1XZ0B 5DI8B 3RI5K 3L6FA 3TIEB 1KB5L 2BNUB 4QHUA 2XXCB 3MNZB 3LDBC 3I75B 4I0CC 4D3CL 2H45A 5F89A 5GZNC 4F8TA 5TQ0H 5E4EB 1A5FL 1IKFH 1LVEA 4FABL 3P4NA 3FHAA 4YFLF 2XTJE 4D0DB 1TVBA 3T0EB 5HYSA 4HKZA 1P7QB 4NO2B 1PKQE 4J3SA 4RIRA 2V6HA 3FZUC 3IDIA 2W9LA 1HHGA 4Y5VB 1T5XA 2GQHA 2OJEB 2DQUH 1AIFA 3F58H 3QZWG 4DKEH 1JFQH 2ADIA 1P7QA 1PX3A 2DQCL 4LASL 5BVJA 1XF5A 2DLEA 3NZHH 4H0IA 3U0TA 2LE9A 1I7ZA 4G3YL 5F1NB 2BNRB 3GMMA 3REWB 3Q6FA 1HILA 3G6AB 5TF1L 3OR7A 1YEGL 1WF5A 2DQHL 3WFDH 5C2BL 4NZUL 4XCCH 3IS1X 4YXKH 5DJYB 4YHPB 5I73B 4PV9B 1DSFL 4R2GD 1XGPB 1BEYH 4HDIA 4PJCA 4YDIH 3IDXL 1OPGL 3FL7A 4Q9CA 3O2WL 2EE6A 5I1AB 5IJVB 3U36A 1R3KB 3IAPA 2APVA 3OR7B 2BSED 1YMHB 4YZFE 4LSSL 1P5UA 1RUAH 4YO0A 4Y0GA 2C3GA 4HXBL 1Q0YL 2B1HH 4OZIA 4N1CA 1FGVH 1INDL 3FQWA 4QY8B 1U93A 3MUGB 4YC2B 3F7YA 4A6YB 3WS6A 1EMTL 1JIBA 4CDGC 3VFPA 1J1XL 3G04A 2J8OA 4HS3B 3HS0B 5E8NB 2BSTB 3LKOB 4JREB 4UB0H 3DO7A 4K8RD 2IJ0C 5A3ID 3GRWH 4IMKA 1FC2D 1MLCA 4K94L 4PRDB 1EVUA 1CIDA 4NJAL 1JPFB 1VFAB 3JTSB 5L2KD 1CQYA 4EN3B 1BQHA 5JHLL 1JTOA 1FVCA 1SJVA 2Q1EA 3ROLB 1IC7L 5KSVB 5E1AA 3WFCL 3V4UL 2VLME 3ARFD 3GUTA 3SOBH 2EIBA 4WVRA 5IT2L 2GTWA 2Q86A 2X7LA 1UADC 2ADFL 4R4BA 1TZGH 5D1XA 4MA7H 3W11D 1N8ZB 2ADJA 1WC7B 1H3GA 4JE4B 4M7KH 3HAEG 1MH5A 1EO5A 1H8NA 4HHAA 4LP4A 1AO7B 4XPGH 5BS0A 4IJ3B 1TETH 5TE4L 1QNZH 1M7XA 3DMMC 5F6HJ 4CDHA 5JW5B 2O61A 3G08B 3ARED 5JO5B 3EDDA 1FYTE 1NEZA 3EGSB 1UCTA 4JFQA 2YC1A 3F6IA 3RUGE 2IFFH 4MD0B 1IGJA 3NA9H 1IC4H 3UXFA 2DTMH 2ZG1A 3AUVA 3NZ8A 5ABDE 2WM0A 1GRWA 4L9LB 3ZHDA 2YSSB 4OLVH 3X3GL 1CCZA 5I1CH 3BP4B 4YPGB 5F93C 3WUWB 3D87B 4WFFE 4LVHB 5ICXA 3BESR 1FFOB 2AJVL 2HT2C 3AREA 4M7KL 4YDVB 4AQOA 5CZVH 2F5BH 2A2QT 4NUJB 5D2LA 3S7GA 5IG7B 1WFUA 3FO1A 3WN5B 2RAMA 1N5YL 4I2XA 2G9HB 1MCRA 3O2VL 2V2TA 4EDWH 4AMKH 3L6FB 3TIEA 2C3VA 5DD1L 1RIHH 2J88H 3MRKA 5AUMB 3QFJB 5MEQA 2QKIA 1J8HE 3T0EC 1LEGA 2R8SL 2X4UA 5HHOE 5DJYA 3CU1A 2PXYB 1AC6A 2BSSB 4FQ1H 3GMLB 1BVKB 1ORSB 1SJXA 4BK5A 3QIWA 4NRYB 2HP4A 4M93C 3ME0A 1XH3A 3HUJA 1H15B 4LCCC 3HLAA 3PDGA 5IMKA 1MCEA 3HA0A 4KI5C 5FM5M 1N0LA 3RU8L 2DQCH 4C58B 1NSNL 4PJFA 1QSFB 2FYYB 4N8CL 5D2LB 5C0CE 1FVEB 2YN5A 1BAFH 1I9RL 5IM7B 4RGNE 5JORA 1I8KB 3DVGB 4Z6AT 3U7YL 4NC1C 5T1KD 4ODWB 4RFEA 1F2XK 4PBXA 4AYFA 2HFEB 2XACC 5F1KC 4EXKA 4HZLB 2A77L 2LU3A 1A1MA 5L2KA 3AAZB 5DURB 3PP4L 4M5YH 4Y19E 2QTEA 4JZNA 3MRMB 3EYUL 2NXZC 1CL7L 3EYFB 1BBDH 2ZCLH 3W39A 2Q6WB 4LOUD 4XMPL 3VD7A 1BF8A 3GMOB 3MYJA 1JP5A 1IGIH 1ACYL 4MNGB 1NMAH 5C0BD 4Z0BL 4DGIL 4TUOB 4FQXA 5H35A 2FEEI 3IDGB 1FN4B 1NSNH 3H9YA 2IAMB 2HRPL 3BGFB 5I1LB 3QUXB 3ZYOA 1N5AB 4YHOL 1SY6H 4OT1L 1T66C 4P4KC 1D7FA 3HZKA 2ZUQB 5T5NG 3VXRD 4HIIB 5JW4R 2AK4E 5F3HA 1TPXC 5A2JH 4P5MA 2B4CH 4KRPB 4U1SA 4JPVL 2G60H 1IAMA 2GK2A 5HTSA 5I75B 4U1LB 4ZTOL 5ADPL 1CL7H 5AG8A 3P4OB 1OTSD 3I9GH 4X6DB 4PP2B 4ZSOB 4JDTL 3QCTL 5INDB 2P7TA 2YRLA 3MV01 4X8XA 1PQZA 3ZL4H 5FA3A 3EYQC 4K07A 1JTPA 1TTGA 4O2CA 1T0NB 3BUYB 4GAGL 4MLSA 1I3RA 1FJ1A 1IEAB 4JFPA 3G9AB 5ISZB 4XPGL 3OXSA 2FEEL 3NAAL 1QACA 1NAMB 4HPYL 1FNFA 4U6TA 4HS6B 5KAQG 5HHMD 5E4IA 1OD7A 1KPRA 2VDLL 1JZ6A 3HI6L 4NQTA 1T22B 2VE6A 5BRZE 1NFDB 3GMLA 5FGBC 3HR5B 5GS3A 4HDIB 3OKEB 1XGPA 2ZSWA 2FZ3B 1JWMA 3BXNB 3PL6A 2ED8A 3HE7A 2XZZA 5D93C 2DKUA 1YZZA 4CN6A 3FJTA 1RFDH 3G6DH 4Y8DC 2HJFA 2NY0B 4BZYA 5HGDA 3V4PL 4JFHD 4OD1L 5D7IF 3CCHB 3DXAA 4ZS7L 1KEGL 5JUEH 1QKZH 5IJKC 3MYZA 1LK2A 4N0FB 3KPMB 1AXSB 3MRHB 1FJ1B 5I71B 4MMZC 3OKYA 1EHNA 1RZ8A 3MJ7B 5E2VH 3TBTA 3HAEB 4K3DL 5IVXF 4AEHL 4WI8A 3ULUE 3OZ9H 4F7MA 1INEH 3GSNH 1FNGA 4M7LT 4KU1A 1K4CA 4IM8A 5D8JH 1J10A 3ZDYF 5IIEB 5DEGB 5D7LB 1LP9A 5C70A 4Z7WE 5FM5O 1O7VA 3FRUB 1LO4H 1XGRA 2YUZA 1UKTA 1V05A 1AE6L 5E8DH 2EICA 3PGFL 4GXUM 5C0BB 3ORJA 1WAAA 3P11L 1E4JA 4P4KA 4WO4A 4S2SB 4F37F 2I9TA 2QBWA 4CU8A 5E94A 4HS8L 4F9LC 2PTTA 2WV3A 3QEQD 5LXGH 4KDTC 2I07B 3ARPA 4MNGA 3MRCA 1QFHA 3QUXC 4QCIB 3UTTD 3FFCA 5FGCE 1OSPH 4LU5L 1RURL 4HKBA 2P8LB 3SDCC 5HI3C 5I18L 3I6GA 5L2KB 5EU4B 5ICZA 2IPTH 5HDQL 1H0DA 3UJJL 5CJXC 2KQMA 4IOIA 4ZYKB 1G7IB 3ARDC 4ENEC 5CIPA 4RMQA 4WHTB 1OGAD 5FHBL 2DD8H 3TCLB 5D71H 1CL7I 3K74B 1MELA 4UAOB 4X5XB 3RVXC 2X70B 4L5FH 2J6EL 4L4VB 4LSRL 3ARBC 5HJ3A 1GVIA 1HI6B 3AM8C 3IYLW 1MJ7H 4ETYA 5J4MA 4YBQD 1F13A 4OZHF 4NM8H 5GHWL 3QPQC 4PB0L 1OTTC 4XTRD 2JK5A 1F11A 4YR6B 3QXWA 4WFFD 4DN3H 3QDMB 2ZUSA 1E0OB 3WE6B 1X4XA 5T5FH 2YK1L 1AI1H 5TE7L 3PIQA 5TFSL 3CVHH 5EUOA 1RK1A 3AS3A 1MFNA 3PGDA 3PL6B 2F8VA 4WUKH 4HKXB 7CGTA 1CFNA 3TBTB 4FP8L 4CU6A 2B7DT 1JGLH 2ZJSL 5DGQA 3RA7H 5C1MB 2R1WA 1FAIL 4NC0B 3VXUA 4GAGH 4PRPB 1MFCL 3C8KB 3DIFA 4ERSH 1AKJD 5I16A 4LPVA 2IAND 1ZMYA 5IMMA 2NY6C 1D5MB 3BWAA 1IQWH 5HGDB 3SO3B 4CW1B 4H8WH 3GSXA 3S97C 2VAAA 4QGYA 4IMLB 1NBZB 4CNIA 2NZ9C 3VMPA 1U9KA 4OCSL 2B2XH 3QIBC 3QRGL 1M7DA 2RIKA 4G8GA 3VDCA 2ZNWA 1U6AH 3MGOA 3WS6C 3ABZA 1OLZA 1OP3H 2C9AA 3VRJA 1NFIA 1DLHB 4OD2A 4L1HA 3DGGA 4Q74A 1IVLA 3CMOL 2BXYA 2ERJB 5EO1B 5TQ0L 4KHTL 4FQCH 1INQB 1LK3L 3DMMB 2PW1B 32C2A 5TPWH 2EXWD 3N1MC 4U7MA 5IQ7L 4HXBH 5I1LA 4AT6A 3CMOH 1TJHL 1I8LA 2EDDA 3U7AA 3GFUA 4UDTB 1ZLSH 1AJ7H 1QQDB 5F9AC 3IDNB 3SCMA 3HNTH 3CSGA 2XZCL 4ZXBA 3GKWH 2V5SA 2EKJA 4FTVE 4XXDB 4EQ2A 4WO4C 3HPLA 4B0MM 3S36X 3LN9A 1LQSR 4HK3J 3QUYC 1ZVHA 4P5TB 4LHUA 3T2PA 2B20A 1CD9B 4ONHB 3V9FA 3QNYB 4MXQC 4OM1H 1Z5LB 2H26A 4G6AC 4U1KB 5TDNB 4ORGB 4KHXL 5KSAD 5KSAB 5I17A 1OAUL 2UWEF 5DJ6B 4JM2F 2V5TA 4LHQB 4GMTL 1S7RA 1VERA 2O5ZL 4O2CB 4AJ0A 3E2HC 1Z6JT 1KSRA 5DUPH 1IT9H 1OGAB 3P73B 2DQFA 3GSNB 3FQWB 3L5HA 4HGMA 5FKPB 1F6AB 3RWJA 5DJAB 4JCLA 4PJIA 2ZCHL 4M48L 1TITA 1NQBA 4GW4B 5F9WB 1N0XH 5AAMA 4Q6YA 4MNHB 3HI5L 3FMGL 4X4ZA 1KCRH 4ZS6C 4HIEA 5IGXL 3TNNA 2DIAA 3QZWA 3UTTB 5MHSE 4MLIA 1JL8A 2VISA 1CI5A 3SQOH 3Q3GB 1MHPL 4KV5F 3IJYB 2WBJD 4BFEA 5E08L 2VERN 2B0SL 2JELL 5SV3A 3AFLA 3MXVH 4KVNH 5CFHA 1QLFA 2Y36L 3QO1A 1KENH 4V2CB 4JZJA 3TEUA 4MDJA 5TQ2H 3TBSA 1JMZA 2WUCH 4PJ7F 4M4PA 5FYLE 3B2UD 2AXFA 2JELH 4NQVA 2DQIH 1EXUA 2WINB 2VXTL 3BN9C 5HHNB 3CFJB 2O5XL 3DUUA 1IAIM 1U92B 4L8SB 4NBZB 1UM6L 4R4NC 3WDHA 4G7VH 4P23D 5FA3B 3WO4C 2JLLA 3QQ9D 1G6RB 1MCOH 2I24N 5J6HA 3HHRB 4JKLA 3SKMB 3H0TA 4XVJL 2BVYA 5JW3L 2CRMA 3VXRA 1M7IB 2BY2A 3LD8C 5AZ2L 1H8OA 3CDCA 2V5YA 3EJJX 5MEOA 3O8XA 5L2JA 2VIRA 5IKCA 4YXLL 4HJ0C 3IKKA 1A7OH 2E9IA 3LH2L 2A0LC 2OXHA 1P4IL 2HN7A 4AH2B 5LAXB 5HD8C 5FUZH 3ARFC 3K4AA 4Z0BH 1KCVL 1NUFA 1MWAB 3GO1L 5LXGL 4A2MA 4HT1L 1XR9A 2VDQH 4DEPC 2W0PA 3D9AL 5L6YL 1AHWC 1NC4A 4KQ4H 4ZFZB 4QF1B 1XFPA 3LKQB 4LPTA 3T0BA 1R24A 4O2EB 3WDIA 4H0GA 4XP6L 4YHLH 2WQRA 4PUBH 4EQ3A 4E5XA 4F2MB 4OZHE 1PEWA 4LFHD 3F12B 2GITA 1HHHA 3EJYD 3IU4H 4J3OC 4ODXB 1FL3B 3DGCR 3QP3A 3WXVL 4Z76B 5IB4B 4OQTA 43C9B 1EV2E 4QRUA 1CLZH 3GSRB 1S5IL 3BISA 2AI0H 2YPVH 4YPGA 3VWJC 2VISB 3CZJA 5GIRB 1IGFL 2FX8L 3GSUA 1QOKA 2ZKHL 5C09E 4RAUA 4Y1AB 4HX1A 2EDNA 4PJAB 4GXVH 1KF9B 3IDXH 4WGWB 5DQDH 1QR1A 1AKJA 4QHLB 4UT7L 2E7CA 3QEGH 4KMQA 4Y4FC 4WENB 2GHWB 4WEUD 5FKPA 3I02B 3QCUL 3QEQB 3SCMB 5JW5A 1NGQH 5KVDL 2O61B 3BW9A 4Q58C 4OZIE 1QBMH 4HEPG 4TVSa 4AENA 5E8EA 2OS7A 3QQ4A 2G2RB 4FNLH 5CSBA 5MERA 2ZWLT 5ALCH 2BSTA 2Y72A 1BQSA 1EZVX 2R1YB 1NDGB 1GOGA 4XBPB 3ZKMC 3GI9H 5JXEC 3VD9A 1SMOA 2XG5A 5IB4A 4OGZA 5I30L 2CMRH 1FNSH 2K7QA 3Q2CA 2R0WL 4NO0B 1X5KA 4KI5D 4PB9L 3MRQB 4NZTH 1YYML 4HFUH 4TVPL 3P9MA 3VG0L 3RHWK 4HLZG 1Q0YH 2A6DB 1NKOA 2YEZA 4KI1A 3UMTA 4L8CA 1HNFA 4KTYA 1MQKL 2CR3A 2Q7YB 4RAVA 2V5MA 4C55A 3RVUC 5GS1B 3STZA 3PWJB 2Z31A 4JHAL 4NN5B 1F8TL 4BZ1H 4JB9H 4Y2OA 3MXWH 3GEWB 2EDEA 4XP1H 4U6XB 1YY9D 1MQ8A 3B6SB 4NSKB 1T7ZA 4OCRH 3BRDA 4PGDA 2VDOL 1ITCA 3C8DA 2VITB 1TETL 5BRZD 4PD4K 1BFVL 2WWMD 5L7XL 4PRPD 1H3VA 4Y4KA 1WZMA 5K59F 4EUPG 4WUUB 1JNNH 1BVLB 1KCRL 2P5EA 4P59L 1OPGH 5I1EL 1IEHA 5DK0B 1A1NB 4OFYD 4RIRB 1HIMH 3X11A 1IRAY 4UU9A 3QH3A 3X14A 1DVFB 4X5WA 3QDJD 4ETQA 1GGTA 3DYPA 3QJFA 2WNGA 3Q1SL 3QFJD 4KROB 4P59H 1V7NH 3REWA 5CBEB 2X4TB 5IMMB 4I0PA 4I3RH 4PRPE 5DR5L 5ELIA 3OB8A 4WW1A 3IFOB 2XQYK 4GS7C 2CDFB 2FLRT 3BYTA 3UC0L 3T1FB 1JN6A 1JI2A 3RWGA 1Q9WB 3V6BR 3QQ3B 4YE4H 1S7RB 5E2WH 1K2DB 3ZKXB 3U9PH 4IDJH 3BMWA 4O02L 3VGHA 4OLUH 2IPUK 4OUOA 4WU5B 3O9WC 4NKDA 3S9DB 4K7PX 2WMPA 3VXUD 1CDUA 1T6VN 5HHOA 3RGVB 4PJ5E 4PGCA 4O00A 3RI5F 3SE9L 4C56D 2QQNH 43CAA 2AABL 2XN9A 2EDYA 4BSVB 2C1PB 4DN3L 5I8CA 5JQHC 2HLAA 4ZUWB 5B3NA 3C5SB 3TP4A 4NDMB 5GGSA 1RZGA 4P2OA 1CT8B 2VQ1B 1TQBB 2EYSA 3QJFB 4MXVE 5SV4A 5HI4C 1FBIH 5DUMH 3JUYA 2DQTL 5A16A 3MOBL 1J86A 1QR4A 4ISVB 1G7IA 1OAQL 1QSEE 3OKLA 1PVHA 4CVUA 1EEZA 4CJ1A 2R0KL 3BYYA 1WEJL 2FD6L 4OD2B 2EIZA 4GAJL 1Z9MA 4Y4FA 3BI9X 4ONGH 2YHGA 3KDMA 3RPIB 3IXAA 3UAJD 2MMXA 2OSLA 4XNMA 2XKSA 5MENE 1TLKA 1NFDF 3FOMA 5DVNA 1NUNB 5SWSD 1BJMA 1ZSDB 4HUXA 2I60L 3QUZD 1X5AA 5E2UH 4QNPF 3TH4T 3DROA 4LLUA 1KTKE 2XOTA 3INUL 3MRCB 5ESAB 3L3GA 3STZB 5LBSH 1D6EA 1UACL 2Z8RA 1K4CB 2XZAH 5K9QG 4LCUA 1QEWB 4JPIA 4LSDA 5HVFB 3O45A 4HS8H 4KJQC 1W0WA 4PJAF 5I1IH 4PJEB 1JPGB 3MOBH 1VFBB 2P5WA 5KTEL 4AEIH 1CFVH 3DLQR 4K3JH 1UM4H 2YBRB 2IG2H 4P5KB 3D39A 3ZE1F 4OZGB 1VPOH 2W65B 5DI8A 5F9JB 4X6DF 4DW2L 2DLFH 2SEBA 5F9DC 4KKLC 2HVKB 5D7LE 1G7PB 3TNMB 4OZFA 5ADPH 1J0ZA 1HYSC 3INUH 4IS6A 2IANE 3S5LG 3O41A 3OX8B 2XIDA 2VB5A 4OKDA 2ENSA 1YECL 3HMXL 4JDVA 4JY5L 1HWHB 2AXFB 4NQVB 4X99A 3UZQA 1DQTA 3VXTA 4MJ6B 4CW1A 1QR1B 4PJ9B 4M00A 2YMXL 5D1ZD 4KTDL 2D7TH 5FOJA 1T21B 3KPRB 4U49A 1HNGA 4XAKD 1RZFL 3HG1E 4R90H 1WJ3A 3ARYA 1ZVYA 5EU7E 4J8RA 5GS1C 43C9A 4OZFG 1A21A 4G8GD 2VE6B 1WVZA 2X9YA 4U33A 3RVXD 2YOCA 4NO5A 3H9SD 4X0KB 4R97B 3EYUH 1IC7H 1AQDB 3MRNB 3QEUB 3OB0H 1Q9LA 1IAKB 3CH1B 5E00A 4GOSA 4XTRC 5IFHH 1I9JL 4WEMB 4HKJB 3MRDB 1E6OL 1IM9D 4U6HA 3PNWB 1CE1L 4FN0A 2F53D 4NFCA 1YJDL 4KK9D 4PRBB 4RDQG 1ZLSL 4QRPA 5DUBA 1NC4B 4XXCA 1A6UL 4NIKB 1BIIA 1EA9C 3S4SB 4ZFGH 1RU9H 1J05A 2NYYC 3ES6A 3DYOA 4JY4B 4PRBA 3U4EB 1BJ8A 4KKCD 2DBLH 4JQIH 5HYIA 5C0DB 3GMOA 1I8MA 4JPVH 5FA4B 2VNCA 1XGRB 3X17A 1NJ9A 2NW2B 3VCLB 4DVBB 1RSFA 2ICCA 1QFWL 4Y4HA 3FO9B 4EBQH 5K9JL 2FJFB 4WI9A 1Q9LB 1P7KB 4JRXA 4EUPB 1T2JA 5INCA 1NCBH 3MOAL 4LHJB 3QT2A 4JM4L 4C56A 4P0DA 3GSOA 2NZ9D 3DI3B 3HAEA 3UYRL 1W72L 2BVTA 4QT5B 5C7XL 4LF3B 1LGVA 3ZKND 4XT1C 3QAZC 2NY4C 1BMGA 2ZUTA 3U7WH 1RJZA 1OP5H 3IKCA 3QULB 3BH8A 4B53A 4DKDC 1NFIB 4PGEB 3O4LA 4NFDA 5EZLA 4ZUUB 1JV5B 1KC5H 1VEMA 1A1MB 1AO7D 1XH3B 3HUJB 1SVZA 2W9EL 1F8TH 2ICEB 1FBIL 2DM2A 1XF4A 3IFNH 4OD3H 2EXWC 3MLUL 3PHSA 4ZAKD 4IRZL 5H37G 4NKDB 3O2VH 4X6CE 1NLBL 5IB1A 3MPCA 4QOKA 4PY7A 3R8BB 3UTPE 4KUZH 3TO4B 5IHZA 4JLRA 3KS0J 4EDXB 4MJ6A 4G8EA 2M2DA 4H88L 3PWPD 5ITFB 1JYXA 4WEBH 4MXQD 2V2WA 3MACH 4MGXA 5DMKB 1FAKT 5FYJL 3DETC 4OJFL 4ZSOA 1A47A 2BVPB 1KCSH 4UU9B 3QUYA 2VDML 5HBBA 1KJ3L 1AD9A 5FHBH 1G0XA 2BSRA 2D7OA 4NQXB 4U1LA 1JPST 3NCJL 1QBAA 5DA0B 2FJFA 4L9LA 3WNMA 2GJZA 1X5IA 1PSKL 3K8KA 4GRLA 1FLTX 3TA3C 3VWKB 1E4KA 1SVCP 5GS0H 1NGWB 4XNMB 3L5XH 3B9KC 4RRPA 5I1JL 2AAVA 5IHUH 2XRAH 4YDVA 1F90H 1KJ2B 5DFTA 3VRLE 2VWEC 2ICES 2NQCA 2XWBB 1CDHA 4L4TE 3KXFD 4JDZA 4OLWH 1XR8B 1UT9A 4NZDA 1PKQA 1ZT1B 2YSSA 3NABH 3SDDB 4XVSL 5GRUH 3VA2C 4O5LL 4JFZL 4HQQL 2VLJE 4D9QE 2EE3A 1ZT4B 1JZ8A 4OB5H 2I25N 4TQEH 4NN6B 4Z0XB 3IXAB 4WHYG 2VDRL 4XVSH 4U1MB 4BKLA 4XP6H 1FLRH 2GJZB 5D70L 1LO3H 2AJSH 2NY2C 2R56L 4DZ8B 1KLUA 5GGRY 2CKBL 1M05B 1CGXA 1N8ZA 4BFGA 1UXSB 4GKSA 5C9KA 3MCKA 1CFVL 4L4TD 1N26A 3G04B 3L3DB 1O5DT 1RZ8B 4ODBD 2JJUA 4HK0A 5BZDA 3ULUF 3CJJA 3CFDA 5GS2D 5DWUL 1UB6B 1OW0C 3VGBA 3W9DA 3HI6H 2ZUXA 2YD4A 3QG7H 4UT7H 5IW6B 5JHDE 2GCYB 4U1IB 4Z5RB 2FB4H 3V0AC 3WUWG 3AMLA 2HFFB 3CFIC 4OLZL 5DSCA 1V8HA 5ACLA 3QDMA 1FL6A 2GAZB 4WHCA 4JM2D 4M43H 1IGFH 5IG7A 4JLRB 4NUJA 4CUCA 1YN6A 2JTDA 2GITB 4GW5A 3T65A 4ZPVA 4DAGL 3FFDB 1JNLL 4JB9L 4FP8H 3G6JF 3IJSB 1CFSA 4HIJA 3FQUA 3BE1L 1V3MA 2HH0L 5C0IB 1BJ1J 3VD4A 3VWJD 3FOLB 1E4XI 3GMRB 1ZAGA 5CIPH 4UT6H 3DV6B 5F72S 1KBGH 4HS6A 5D93B 3FB8B 1TJIL 4X6DA 4YC2C 4XNXL 4YDJB 5D72H 4E41B 5GGVY 3WXWL 1GAFH 3M1BA 4IRJA 4ZO7A 5I15H 1RHFA 5C92A 1EJ6A 4QCIA 2B4CC 1EUUA 1HKLH 3V4VH 1RJLA 1IL1A 2KZWA 1EFXD 1AGDA 3FB5A 3GIVA 5F3BB 3AXLB 2BFVH 1BIIB 4I3RL 4PY8J 3DVNB 3EZ8A 2CIKA 3RY4A 3X3FL 2XWTB 5ITBL 3AY4C 1I1YA 5KVFL 2Z4QB 3P4NB 1KJ3H 4MAYA 3U9UA 2NW2A 3SJVA 3SGKC 1SJEB 5BMFL 1EXUB 3D85D 2VH5L 4NO3A 4JZNB 5J12B 2YC1B 4P46C 3F62A 4WI6A 4QYOB 3WIIH 3OAZK 3MFFB 2IFFL 5DFVC 3VXSB 3NGBC 4EDWL 4LARL 3E6HB 3QUMB 1GGCH 4ELKA 1JGDA 1QLRA 2DYPD 4GRLC 1S9VB 1ZT7A 4ZOAA 5DRXA 3MRGB 1HQ4B 3T0DA 2C4FU 1J8HA 3QO0A 4MJIA 2K7PA 2ESVD 3U30B 4ZD3H 5CSZA 4CVZA 4PD4J 4NCC1 1KIQA 4H25A 4LIQE 2CDFA 4IOFC 1EZVY 1CFTB 3UTSD 1QHOA 2QADC 1X4YA 3MRDA 3LEYH 3RZCD 2VXUH 3GUTB 3NH7H 2BHUA 4JQXC 2ADFH 3HZMA 2W9EH 2WWMC 3MGAA 4XGZB 3S37L 1DBJL 4HZLA 1B90A 1MHCB 4H20H 1MY5A 4M1GH 3PQYB 4PJXF 1A7QH 3IU3A 4OUUB 4UV7H 2ORBL 5E2TH 1BVLA 4G6JL 4M8QA 5EO0B 5CEZE 1LE9B 4HT1H 2X42A 3QUMH 3QI9D 5EBMA 1YEHL 2O26U 4PJ5B 1T7VA 2BOBA 3NCEB 5B4MD 2IGFH 3QIUA 4TRPH