1BFTA

Structure of nf-kb p50 homodimer bound to a kb site
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
101
structure length
101
Chain Sequence
TAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords NUCLEAR FACTOR NF-KAPPA-B P65
publication title The role of DNA in the mechanism of NFkappaB dimer formation: crystal structures of the dimerization domains of the p50 and p65 subunits.
pubmed doi rcsb
molecule tags Transcription factor
total genus 20
structure length 101
sequence length 101
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-09-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1bftA00
4MA7H 4S2SA 2YRPA 3IDYC 4UAOB 1A4KA 3EFFA 2A38A 1CD0A 4DEPB 4JFDD 3RWFB 4Y1AB 3PXHA 5DR5L 1JWUB 2FX8H 3F6LA 3ZE2F 4G3YH 7FABH 3KPOB 5D1XA 1TZHB 2KZ1B 1JGDB 4QXWA 3WFCL 1RZ8A 4TSCL 4ZFFA 4PRAB 5DHVB 1H8OA 2K1MA 2YD2A 3FCTA 3MV9D 4PJ9A 3SKNA 4LSQH 3O2WH 1OCWL 3HZVA 3GB7B 3ROLB 2XICA 4G43A 3TT1H 1JF1A 4WFGE 1ZKAA 1U8JB 4BQ9A 2OI9B 1NBZB 1RJLB 5MEQA 1A21A 1KG0A 2EXWD 5I19H 4R0LB 1P4BH 4TUJB 5TE7H 3GBNH 5L88H 5MP6H 3VXSB 4JFED 3DGCR 2LVCA 4CNIA 3MV11 4JKWA 4YUEL 5DI8A 1C7SA 3GNML 1NC4A 1GGBL 4HKXB 3MLTA 3SKOB 1UQSA 2IAMA 1FNLA 3MRLB 1TVHB 2IG2L 2R0LH 1QFWL 1GC1H 3ULUD 5C0AA 4FQPA 2ZSWB 2DKUA 4P0DA 5EBGA 1A7RL 4CDHA 3GMNA 4LL9A 4NN5B 2F53E 4GXUN 1BVLB 4MXQD 4RAUB 3O4LD 2GYSA 3NVQA 3AY4C 3WJLC 5I8CB 3FB6A 5HHXL 4U1MB 3MRDA 5GS1C 3UJIL 3VFNA 2R29L 1BX2A 3JWDH 4UUJA 4L9DA 3QULB 3PWJA 4S10A 5EWIL 4PRPD 3STBA 3U1SL 5DQJA 5GSVA 1EAPB 1R3KA 2BSSA 1CGWA 4JPVL 3ARZA 4JLRA 3QUYD 1J10A 3H2WA 5IROA 4FNLH 2X4UB 2FECL 5EH1A 1W0WB 4IS6A 1QFUL 3GMRB 1KLUA 4YQXL 1M6OA 3BHBA 1U8NB 2ZUVA 4Z0BH 1CK0L 2R1YB 1AR2A 4MCZA 1V05A 4B7LA 3KLAA 4LLYA 4ODWA 5F9OL 4MAUH 5E8EB 3FZUD 2VABA 3OGOE 4ZUTB 1QNZL 3T0EC 1RAMA 1MFCH 5DD3L 2XV6B 5DD6B 4S2SB 1D6VL 1A4KB 3D0LA 3EFFB 4ZD3L 1U8MA 4I2XB 3BGFB 4YDLB 5IFHL 3SHSA 5D1XB 1EHLL 1FBIL 1T6VN 4OGYL 5FHBH 1TJIH 3CDFA 3AFLA 4ZFFB 2VIRA 1ORSB 4P59L 2MOVA 4PJ9B 1G0XA 1UVQA 3SKNB 4QO1A 1KB5H 3V8CA 4QXUH 3RJQB 1I7RA 4UMGA 3FTGA 1JF1B 1AI1L 15C8H 2MNUA 1JP5A 3QUKA 5I73C 1MLCA 1S7UA 5MEQB 1KG0B 2DB8A 4LSSL 4M7LT 3DGGA 4OZHA 2DJSA 2QEJA 2WWKT 4U0RC 3UMTA 3GFUA 4R90H 4HZLB 2IPKA 4Q9CA 2XG4A 4D9RE 4CNIB 3VWKD 4HWUA 4PUBH 1MVUB 4WW1B 3P4MA 4V1DE 4Y16C 4UTBH 4Y2DC 1OWRM 2SEBA 3EYFA 5IMMA 2N56A 2AI0H 4C55A 5GS0C 5C0NC 4JG1H 5GS2H 1AJ7H 1UQSB 2IAMB 5E94A 4PJBF 4R4FL 2BVQB 3A6OA 4PJGB 1RZ7H 4ODUA 5E70A 1TTGA 3U36A 5FDWB 2AXJA 4TSAL 3P0VL 4NQSB 2AEPL 5FYJL 1J0HA 3HE6C 5DS8A 2Q8BL 3MRDB 4HKZA 4WHTA 4Q0XH 3VFNB 2WIIA 1PX4A 1BX2B 2FO4A 3BMVA 3DI3B 3BKYL 3NTCH 4OGXH 3PWJB 4Y4FA 1FL5A 1DCLA 1J05A 4F9LC 3FJTA 2HG5A 1S9WA 3RL2A 3TCLB 2BNQA 1NL0H 1XIWD 4K2UL 3LKRA 1R3KB 1WJ3A 4KKNA 5EU6E 5D96B 2BSSB 1F6AB 5F7FA 3REVA 5J8OA 4LNRA 3ALWA 1XAUA 1SY6A 4MAYA 4J3VA 3WIHA 4JLRB 3REWA 1OVZA 5T5FH 1RUMH 1CDCA 1WZMA 1PLGH 4IS6B 3MLPA 1FORL 4AT6A 2AJYL 4KRPB 1M6OB 3BHBB 4WFEE 2EYSA 4MCZB 1R3JA 4X99B 3KLAB 1V7MH 2X1QA 4ODWB 5DVKA 3LRHA 2C4FT 2UWEB 2VABB 1UCBH 5I1JL 4JY6B 2G5RA 1ZHKA 3PWPA 1D5XA 5BMFL 1WFNA 4FXGA 4ONHB 4ZO7A 3O11A 1IAKB 5TQ0L 2IADA 1WF5A 3CFDA 1CF8H 4PJFB 4KC3B 1ZT4A 3MGTB 4PRBB 5I9QB 4PJXE 2DM3A 2EIDA 4HMDA 3VGHA 3S36H 3UJTH 1RJZA 2DQJH 2V7NA 2XQYK 3OL2A 1AXSA 1UVQB 3C60A 4LPXA 3TM6A 3RWJB 5F9WB 2D7OA 1DLFL 4ZUSB 1I7RB 3FTGB 1OWWA 1QSVA 2R1WA 4OQTL 4AL8H 5ISZD 1W72B 1RVFL 3QUKB 3LIZL 1MLCB 4JKMA 5EU5B 1S7UB 4EQ2A 1MJ8H 4PP2A 3ES6A 5DSCB 2Y36L 3EJZD 3DGGB 4OZHB 2R4RH 4OCWH 3H9ZA 2YUXA 2IPKB 3GHEH 5JIHA 3WKML 4ZFZA 4HKBA 2H3NB 5CILL 5FHAH 1IC1A 2X5PA 4GAFB 3P4MB 2KQMA 2LVEA 5DTFA 2HH0H 5C0RL 2ADJA 3EYFB 4RGMB 4LCIL 5IMMB 5IMKB 1R3LA 1W0VA 3P2TA 5E94B 3DXAB 2XA8H 5H94A 4P4KA 4ODUB 1MCBA 1BVKA 3VRLE 4FP8L 4AEFA 1Q1JH 1BD2A 2QJDA 5GGVL 2X1OA 1LO5B 4OCSH 3I9GL 2A1WH 3TFKC 4YEFA 3T2OA 1VCAA 3OXRA 3X17A 4XP4H 1X5JA 5CIPA 4K8RD 4HKZB 4WHTB 5GJSL 1ZTXL 1RZGB 2WIIB 2FO4B 1BLNA 3SKMB 3SN6N 1I7TB 4NQEE 2HT3D 3CIQA 5FM4A 4ZPTA 3C6LC 3S4SB 1J05B 5FM5M 5FYKL 3VE0A 1S7SA 1S9WB 2HG5B 5AZEL 5MENE 2RGSA 5ACLA 3LKRB 3REVB 4AIOA 4LNRB 5B38G 1BZ7A 5BXFA 4YX2L 1UEYA 2EDBA 1TTFA 2ZG2A 3T2QA 4AT6B 2B2XH 4QYOA 5E2VL 5ESQB 2IQ9L 2YEZB 3HZYA 1R3JB 4Y19D 1EGJA 3TYFA 2DD8L 4XPFL 1KCUL 4U1IA 2DQTL 5CJXA 3MJGX 1JYVA 1ZHKB 3PWPB 1D5XB 2FR4A 3W11C 1BOGA 2ZUWA 3SQOL 3BN9C 1FG2A 3CFDB 3CMGA 3OBAA 1F3DH 3QCUH 4OBSA 1CIUA 1KCRL 1JBJA 5CJ5A 1FO0A 3RWGA 4Z7NE 2F58L 2XT1B 2BVEA 3LN9A 3CVHA 2UYLA 1RJZB 2V7NB 3CXDL 3C60B 2QQQA 3MJ9A 3RHWK 2MWCA 3I3BA 1NAKL 2ADFH 3NZHL 4DVBA 1BJ1J 4W6YB 4DZ8A 4OF5A 2HT4D 4HK3J 2YD3A 3CZJA 5IVXE 3OGCB 2EZ0C 3P30H 2NXYD 2IALB 4GRLA 1VSCA 3ES6B 1MEXL 3E8UH 1ZGLB 5CMAB 3ZKNC 1MRDL 2WBJA 5T3XD 1AXIB 2XY2A 4G7VH 4RAVB 3QSKB 4ZFZB 4HKBB 4RA0C 5ADPL 1F6FB 4N9OB 4U49A 4LVEA 4LRIA 1P2CA 2F54D 2ADJB 5E1HB 4U1SA 1DANU 1DSFH 4YHML 2LFGA 3BKJH 2DQIL 3EUUA 1MFBH 5H94B 3CX5K 1FN4A 3V4UH 1BD2B 1CDGA 3BFOA 3X13A 5IFAH 2OYPA 1F4YH 3CDGA 4WW2F 5ACZA 4YHOL 3BAEH 3ZE1E 1R3HA 1JGEB 1YMHB 3ARQA 1VKXA 3OXRB 4JO3H 1JHKH 5CIPB 3G9AB 5IBLC 3TT3L 3TVMD 4JY5L 3EFDL 3VW3L 2A9NH 4L5FL 5F8RC 3QDGE 5DD1H 4KKCC 2YS4A 4ZPTB 1CG9B 1G7JA 2DJUA 3U7AA 5D72L 1KJ2A 4LSPL 3VE0B 4DFIA 4ERSL 1IGMH 3RY6C 1G7LA 4QHMA 3DRQB 5EZOH 5IWLC 3VXOB 2OSLA 2CUHA 3WXWL 1BZ7B 1H5BC 3HE7C 2VLJE 3H42H 4URTB 5DMGC 4D3CH 4LSUH 4YFLI 1YMMA 4QYOB 1NCNA 3BPCA 4TNWF 1IKFH 1Q9WA 3HZYB 3D9AL 4UTAL 1B3JA 4M1GL 3RVTD 3TYFB 1QSFA 2H9GA 5GIRA 5I1IH 1QUNA 3LS4H 4K23L 4U1IB 1HILB 4HC1A 4I0PA 1CICC 2Q3AA 1N59A 3MROA 5GRJH 2P48B 4FTVE 2OJZL 3QDJA 3T2PA 5HI5D 1FO0B 3RWGB 1JTPA 3J7HA 1KTDB 5JQHC 1A14L 3CVHB 2UYLB 4WHYH 1IGJA 4X6FB 3BE1H 4PJIF 2YRLA 4ZFGL 1LP9A 1UWGH 4R7NA 1S7TA 4QXTA 4JDTH 2XTJE 4O5LH 3MV8B 2BRQA 1MIML 3SQBA 3HPLB 2FL5A 4L4TA 2AEQH 4GRLB 1FZMA 1ZA3B 2F74A 1WT5A 2VXSH 3KXFE 4P5KA 5FGSA 5KJRL 2FD6H 3F58H 2GITA 2WBJB 4HFWB 3E1F1 1IMHC 1WCBA 2IAND 4HJ0D 5HYIA 3VXUA 2ZPKL 3B2VL 4LAQL 4LGSB 3ARBB 4LRNL 4ZYKB 3QNXA 2V2TA 1P53A 4XXCA 5KVEL 1P2CB 5HGHA 4UNVA 4U1SB 1MF2L 3DLQR 4FS0A 3RNQB 4G9FD 1II4E 3SDXA 5IEKB 5LG1A 2F8OA 3VA2C 3UTSD 1ZA6B 1A1NA 3HR5B 5FYJE 4WU7A 3X13B 1GYAA 1P7HL 3CDGB 3BEVA 2DM4A 1KEMH 1NGXA 3BIKA 1I8IA 2FHCA 2DIJA 1R3HB 1VKXB 1F8TH 4FG6C 1I85C 5SV4A 1IKNA 3SCMC 4G6MH 4AENB 1P4IL 4WDIA 3VWJC 5SWQA 4TRPL 4LARH 5HSFA 4S0SD 1QFPA 1TFHA 1G7JB 3WUWB 4MLSA 4JKLA 3S5LB 4OUUA 5DJCA 2CH8A 3UYPA 5J4MA 4QHMB 3DVGA 4P48A 3CH1B 3W9EB 3SE8L 2OSLB 4PGCB 4U1GB 4JB9L 2YPKA 3CSGA 5KVGH 4NZJA 4LLQB 3BPCB 1Q9WB 4P2QD 4FQ1H 3QDHA 4KGJA 5TJWK 3RTQD 1YNLL 1CL7H 2H9GB 3VXTA 3O6FC 5DHYA 3KLHC 3TJEH 2A83A 4JM4H 3QUXD 4I0PB 4CU6A 4LPYA 4FFYL 1N59B 3MROB 4F33A 2UVEA 1IC4L 4MMXC 2DF3A 5TPWH 4ZODA 4CU7A 3FN0H 5GGRY 5HY9B 3I02B 3MCKB 3RVXC 5FO7A 1WAAE 3QXDB 4D2NA 1OAQL 2FATL 1HWHB 3MJ8A 3BQUB 3HMXA 1GCFA 4TSBL 1OF2A 1S7TB 5GISH 4QXTB 2B4CC 3RIAK 1OAXH 4UT9H 2DOCA 1OW0C 1U8KA 5D9SA 2FL5B 4L4TB 4LLAA 4M1DH 4G6KH 2WINA 4XVUD 1FNSH 1FZMB 4P5KB 4PJGF 1QLRA 3ZKXC 1RHHB 4IMKA 5J57B 1CZ8H 4NO0A 5J06A 3TP4A 2GJ6D 1P7QD 1VGEL 5FUOL 5MI0B 5F93C 3HFMH 1ZS8A 3QNXB 2V2TB 1BQHA 2FHFA 4NUJA 5HGHB 4M43H 2YRZA 3VFMA 2WK2A 3MRBA 4GAJL 3SDXB 3TBTA 2X4QB 2DQUH 5TF0A 3WLWC 3BX7C 4Z77A 1A1NB 4WU7B 2A0LD 3BEVB 2N4IA 4MLIA 1A6VL 1I8IB 1WBYA 4P2RA 5I74B 1KBGL 2V5SA 1IRAY 3CFEA 1D3CA 1CE6A 4XPBL 1UZ6F 1WFTA 3RDTA 4GRWE 1JGVH 1IC7H 1N5AA 4CL7A 4WDIB 5FYKE 5LQBL 5GGQL 2XTJC 3FN9A 3NCYS 4MB5A 3PP3H 2QL1A 3MA9L 4DGYL 1K4CB 5FUZL 1ZGLP 4J12A 4RGNC 4FQCH 1K8IA 3Q6FA 3MBXH 5TDPB 5E08H 3W2DL 3V6OA 4ZNEA 4N8CL 1IGCL 4WI7A 1P7KA 1LHZA 2UWEF 2P5ED 3NAAL 2MFNA 5GJTH 25C8H 5DK0A 3K2UL 2VR4A 1JPSL 2AK4E 2YPKB 1IAIL 1G7HA 4PJFF 4YXHL 5EN2A 3QB7C 3HC4H 5DEFA 5GGSY 4MXVE 3CGTA 5DUPH 2JIXA 2YZ1A 4NM8L 4XCCH 1S7XA 1C1EH 4PY7A 4C56A 5JHLL 3VXTB 2O26U 2ATKA 4MJIA 1SVZA 3PABA 3DUSA 4F33B 3VDCA 5E4EB 3HNSH 5KVFL 4HMCA 5AWNH 3EO0A 1S7VA 3C5ZC 3EDKA 1PBYA 2P24A 5FGCB 1NFDA 5I6XB 1TQCC 5D2NC 3LMJH 1SMOA 3RNKA 3FRUA 4UOJA 4XAKE 1CLYL 4OLUL 4E41E 1UWEL 2APBA 1MQKH 3MC0A 4M7JL 4HPYH 4YHPA 5CCKH 1EA9C 1U8KB 1ONQA 5A3IC 4F7TA 1LO2H 1FPTL 5E6ID 3IU4H 1N5YH 3EYSH 2YC1A 5JXAH 2WINB 4MCYB 2JJVA 3OJDA 2YWYA 4X5LA 4WHYG 4XWGL 1J1OL 1QLRB 1LDSA 4MA3A 1E4XL 4K71C 4NO0B 5BRZD 3WXVL 4OV5A 2FHBA 1Q0YL 3PP4H 2HVJB 1FFRA 4PG9A 1MJJA 1T03L 2A77H 6FABL 1ZS8B 5GRWA 1BQHB 1UB6B 1TZGH 2R9HD 4NUJB 2OZ4A 5IVOA 1MCSA 3BD4A 2CJUH 1F3DJ 3VFMB 3MRBB 5EU3B 5CP7A 4WHDA 5C71A 3Q5YA 2KBGA 5HDLA 4K7PH 2FB4H 1I7ZA 4O2CA 1MHHB 5TE4H 3TWCH 4I3SH 2PYFA 4P2RB 1IQWH 3CPLB 4ZUVA 1CE6B 3TN0C 2V9RA 3RDTB 2HT2D 2NY4C 1N5AB 1AGEA 1NMBH 3NFSL 3LOWA 4L3ED 1B6UA 1GGCL 5D7LD 1K8IB 3MOQA 3Q6FB 4XNYH 5I30H 1VGKB 4M62L 4LBEB 1T20A 2ADGA 2Q86A 1FIEA 4TVSa 1T89A 3T8XA 2D03L 4R97C 1LK3H 4Y4HD 3LD8B 3BP4B 1FL6B 4JKKA 5DK0B 3QUMH 3G5ZB 4N0CC 5IFJA 1U8HB 4FOMA 3MACL 43C9B 2EDDA 1OGAA 3HA0A 3P3YA 5EN2B 2OL3L 3EYOA 2BCKB 2EDNA 4G9DB 1AE6L 1UB5A 2Z4QA 1S7XB 4C56B 3H9SE 2ATKB 4MJIB 4YDVA 3D6GA 1D5MA 5GRYA 4X83A 1ZEAL 5L2KA 1U3JA 1J11A 4XP6H 3QWRD 2AQ3A 5EO1A 5EZLA 1JN6A 1DVFC 3EO0B 4HS3B 4G42A 1B4JH 1L7TH 3MBEA 2P24B 3BH9B 4BSWA 5IGXH 1NFDB 1AHWC 1A6UL 1WISA 2A6DB 1U3HA 4QWWC 5JORA 3B9KC 3RNKB 2XKSA 5AYUH 5FO9A 1QLEL 5HGGS 3L5WB 3TA3D 1JUFB 2L0DA 4MZ3A 4M7KH 1QFOA 2MCPL 4JVUA 4HXAL 2YC1B 3BO8A 4TPRL 3EOAA 2VZOA 3VFWA 3PQYB 2BRRH 4WUUE 4QY8A 2OQJA 4KTEH 1AR1C 4MA3B 4LEOB 4HS6A 1IAOA 4FMFA 4TVPH 1FGNH 3ARSA 2B39A 4P46C 4IOSD 2QTEA 3QQ9C 4ZXBC 2XWJB 4N1HB 4NKOB 3FT4A 2LTQC 5JA8B 5CZVH 5C07B 2ENSA 2APWA 5CP7B 1UJ3C 5HGAB 1A3LL 3PV7A 3TNMA 4ENEC 4O2CB 4WCYH 3QG6A 1RIHH 2BX5A 1A3RH 2PYFB 1TVDA 3ARPA 4MD5A 1DQMH 2H6PA 3VXRE 5C9KA 3IYLW 4M5ZH 3HI6H 4WI3A 4ZUVB 3S34H 3D3VD 3EKCA 4KTDH 1S5HA 5JW5B 1G9NC 3MZTA 1AGEB 4U1KA 4JM2C 3ZDXF 1ZHLA 3W9DA 2FX9L 4JHZA 1MIEL 2PW2A 2FGWH 2W0PA 4OBRA 1MCFA 2X4PB 4KQ4L 1T6WA 2LU7A 3PHSA 3DARA 4WHCA 4BQ6A 3EOTL 4DN3H 2J88H 3ULVF 4FQXD 1MI5D 1P1ZA 2VL5A 4LMQE 4PV9A 3ZYIA 3O6KH 1QBLH 2BVTA 3T8XB 4BZ2L 4JPWL 1CL7I 2ARJA 4P9HC 1JNNH 5F1OB 1L6XA 4JN2A 1DBAL 4X6BA 3NN8A 2FEEL 3QCTH 5IFJB 4LHUG 2ZUQC 4UNUA 1OGAB 3IXAA 3ULUC 3EYOB 3LEXA 1XCQB 1UB5B 4PJ7A 3SJVE 1V3MA 2VLRA 5DUML 1IEBB 3OF6A 4CMMA 1EEUA 2DL2A 5GRUH 4GW4A 1MAMH 1D5MB 2I26N 4UIMA 3T0DA 4KJWD 2HRPL 3QXTA 4BJLA 4NFCA 1JJUA 3ARVA 1X5YA 1BECA 1BAFL 3HR6A 4G42B 5K9QG 3CFKA 3O3DA 4PJEA 4NN7B 3O9WD 3S6CA 5T1KA 5C0BD 5FYLH 5JORB 2OMBA 4APQD 4FRWA 4NKDA 1F5WA 3OKLA 3D39E 3QAZC 1CLZH 4XPAL 4X4ME 1NAML 2ZP0T 3ZE0F 5BVJB 4LCCA 3SGKC 5ERWA 1KCSH 4U6YB 1G7PA 4NZRH 1FVEA 3QUYC 4RGOH 2XPGA 4M00A 3LN5B 1CXEA 3BO8B 1E6JL 3EOAB 4UINH 4PG2C 3VFWB 4EZMA 4EDXA 4QY8B 2OQJB 1MCWW 5K59E 1I3UA 3MGOA 2B7DT 4PRHB 4D0CA 4MQTB 2Z91A 4KKBD 3OAYH 5TH2A 1C5CL 1IAOB 4L4JA 4UIKL 4UB0L 5KVDL 4MNQE 4N0YL 4OF8A 3FZUC 4PJ8A 3JV6B 3FQRA 9CGTA 1HE7A 2IQAA 3UP1A 3QQ4A 5J13B 1BQSA 4EN3D 3GGWA 1O7SA 4HH8A 5A1AA 4FQHB 1CDUA 2EIEA 4U7SA 4XP5L 4HBCL 4OD2B 1I1CA 1NFIA 1QPXA 4JFHD 3SDDD 2R69L 4K3HA 1G9MC 1EUUA 4NQTA 4YPJA 5L88L 3TNMB 1YDPA 3AU1A 3QG6B 2A73A 4PJ5A 2LU4A 4WO4B 4Q9RL 2R0KH 1T04A 4MD5B 3P73A 1INEH 3UC0H 1UKSA 1PSKL 3VGGA 4PJAA 1S5HB 3L6FA 4U1KB 3BGAA 2XN9D 3P11L 5IQ7L 1ZHLB 5C70A 4MA1C 2PW2B 3RGHA 3UO1L 1GGIL 4QRQA 4KUZH 1JL8A 4KPHL 2MQ0A 3H7LA 2YKLL 4MB4A 2AJUL 2VL5B 5IV2B 5K9QI 4XT1C 4FHBD 4Z76A 2PR4L 1AKJD 1JWSB 2GAZA 1A5FL 2E7MA 4X6BB 3WHE1 1RUKH 5E2UL 5ALCH 3JWDL 1U93A 1BBDH 3MXWH 3SDCD 3IXAB 3P0YL 3MV7A 1NUNB 2FIRT 3LEXB 5D7JB 5DK3A 1OSZB 2D9CA 2VLRB 5ICYB 4CMMB 2ESVD 1CDYA 4OLXH 1QKZL 4GW4B 4HXBL 3M8OL 3PDOA 4UIMB 5KW9H 1ADQA 2B0SH 5JOPE 3OR6B 2VKXA 5CZXD 1S9XA 2X42A 4RMSA 3O3DB 1MHEA 3HC0A 4PJEB 1GH7A 1CGXA 2VUOA 5GS1A 2BP3A 5DMYA 1W72L 3C5JB 3THMH 3U9PH 1KB9J 5FK9B 1GL4B 2OP4L 3OKLB 1XIWC 1J1XH 3OG6B 5CINH 5A43C 2Y5TA 2OXGA 1WZ1L 1G0DA 2D7TL 4KHTL 5ERWB 1HHHB 5CS7A 1G7PB 4UNTA 1XR8A 3VFVA 1FVEB 4PGZA 3MFFA 5E9DA 4R3SA 1PZUB 5B39A 3FFCE 3SDXF 4HG4J 2V17H 1RFDH 4ORGA 3MLUH 1WBXA 5EB9A 5D8JH 4D0CB 2NCMA 5CEZL 3C5SA 1IM3B 5TH2B 1Z6JT 2CLVB 4CW1A 3OKOA 4PJ8B 4QXUL 3FQRB 5DZNA 4JR9L 3Q5TA 3SOBL 2FYYB 3QQ4B 4PD4K 3KPRD 4JPKH 4KH2A 1JFQL 1JI1A 3JVGA 3FOMA 3T0EA 4I13B 3ARGC 4O2FA 4JKPH 5CJ8A 1NFIB 5HVGB 1J5OH 5FCUH 4JRXE 4RX4D 4FQJL 5D1QD 2BERA 1IM9A 2IPTH 3IDYB 4W4OC 3H8NA 5DURB 1AO7A 3L3JA 1I3GL 2ED9A 2A73B 2D0FA 5J0BA 2ZCKL 4PJ5B 3WIIH 4TOYH 1X5XA 3V0VA 3QQ3A 5C09E 3A6CH 1U8PB 3TYGH 3MUY1 5I1EH 3BI9X 4DUVA 1SY6H 1AJ7L 2ZUSA 3WIHH 1G7IB 4NJAH 2C3VA 2HA1A 2VNCA 4TTDD 3EJZC 1OTSD 3OJMB 3P77A 1CR9H 5SWSE 5BW7A 1EHXA 2BOBB 3DVNA 2UZXB 3TZVC 1NGWA 4Z76B 12E8L 1HEZA 4QOKD 1FAIL 3W81A 4OKVA 4PRID 5C8JA 4S1SL 1CLOL 5FYJU 4HDIB 4Z7UB 5TE6H 4NO3A 4B0MM 3O3EA 3S37H 1NCDH 1F4XL 2XKUA 4ODSH 1U93B 4Y16A 4Y2DA 4Y4KD 1MCWM 4OGXL 4UV7H 1RZJH 1ZLSH 1DN2A 2WUBL 4LHQB 2NY5H 1I9JL 2HKHL 4QHUB 1IGFH 4CAGA 5DJDB 1EEQA 4GJTB 4HWEH 1UYWL 1A3QA 4EOWL 3C08L 3NA9L 4P5TD 3RHWF 1S9XB 1PKQB 35C8H 2V7HB 1MHEB 5HHPB 3E6FA 5T1MA 1G6RB 5GS1B 2HT3C 3QEQD 4KJYA 4YBQD 4TQEH 3BXNA 2Q76A 1CGSH 3O41A 4P3CH 3MO1B 2NXZD 2OTPA 2ZKHL 4PJIE 2Y5TB 2AABH 3VXMB 1PGRB 5I8KH 5J6HB 5LJYH 3QUZD 4X80H 4YXLH 2DQGH 4QRRD 3C6SB 2DDQH 1AD9A 3QXWA 4IRSC 5LGHH 4MDIA 1CFQB 3IFOA 3VFUA 3MFFB 5E9DB 3CXHK 4R3SB 5BS0B 4NC1C 5CHNB 4ORGB 1WBXB 1EERB 1I8MB 5F9AC 4EXPX 4ONOA 3S36L 4ONGH 2CLZB 4FQQA 3OKOB 2JF1A 1AD0A 1WSST 1GAFL 3F7RA 4G6JH 1K4DB 3HNTH 1U3ZA 3T0EB 1W2KT 4O2FB 2XFXA 5CIPH 1RUPL 5JHDD 1R0AL 2F53A 3BD3A 3WN5C 1IM9B 4EDWH 1AO7B 2E9BA 3L3JB 3DUHA 1F45A 5HDBF 4RCAA 3ARFC 4G7YH 1CQYA 3LZFH 1DEEA 1E28B 3QQ3B 1B6DA 3V0VB 1A4JA 5C0CB 4Y5YC 2LV4A 3CMOL 2XY1A 3HLAA 1JMZA 3I2CH 4PFEA 4HS8L 4LLWA 2FBJH 3B8SA 4R8WL 5LCVH 2FEEI 4KI5D 4C59B 4M7ZC 2IBZY 3QIUD 2C3VB 2NXYC 4BKLA 4BH7A 2LABA 4Z78A 4HFUH 5I73B 3DVNB 2R2HB 5IJKC 1NGWB 4HQQH 3P0GB 4JRYD 3V4PL 2P1YA 1HEZB 3ULVH 4OKVB 1KEGH 3DUUA 2BJMH 5C8JB 4MVBD 4F37K 1V3LA 1U8OB 4OCYL 4LHUD 3O3EB 3JWOL 5EOQL 2O5YL 3QI9D 1GZPA 4Y16B 2WP3T 4P2QE 4Y2DB 4B41A 3WFHA 5HPMA 5TDOB 3WNMA 3SPVA 5J11C 1KLGA 1FO0H 4JQIL 2AK1L 4NQCD 5FYKU 1XGTB 3CVHH 1UXSA 4XP1L 2BK8A 1BF2A 4LU5H 5C2BL 3MJ9H 4OCRH 2ARWA 4O00A 5HYJD 5L9DH 3TVMC 2UY7A 3L5JA 1H3PH 3HC3H 5EIIB 1EUTA 2W9LA 2CQVA 4GKZA 3HE6B 3K80A 3OQ3B 3VMPA 4Z95H 4U1NA 5HHQB 4GSDH 5T1MB 1PG7L 5DJYA 1ZVYA 1YNKL 3FONA 3BXNB 4DJMA 3RAJL 5FA3A 1IZKA 3QYCA 5E03A 3MLRL 1OPGL 4DQOH 1OGTA 4S1QH 1S7WB 2COQA 3PGFL 5HJ3A 1HSBA 2V5RA 3OKDA 2Y6SD 3IFOB 5KSVA 2XZAH 1JYNA 4H20H 2EYTA 3GSXA 4JJ5B 4DKDC 4F7EA 4K3DL 4V1DA 4FQ2L 1XZ0A 3BWAB 5DF0A 2GJ6E 2VDKH 4WI5A 2A74A 3K1KC 4JE4B 4F15C 1YEDA 3RVTC 4YZFE 3BN3B 2E6JA 2GUOA 2XI9A 1AD0B 1KPVB 5KS9E 3T0AA 1WK0A 2OR7A 1BIIA 3WE6B 3MLZH 1MFEL 4P5MA 2M26A 1DP0A 2BNRD 2F53B 2MPAL 4G6FD 3RIFF 4XBGA 1JNLH 5B3JE 2DIAA 3UAJD 2E7CA 1BJMA 3BDYL 3BP5A 3TPUB 3UTTD 2EH8H 4N9GB 4PTUA 2GTZB 1MH5B 3OZ9H 5E2JA 5K9KA 4KHXH 1B9ZA 1DQJA 1KJ2H 1A4JB 1DBJL 2ERJC 4RIRA 1A6AA 2A6KB 1Q38A 1YQVH 1UZ6E 2DYPD 5TFSH 4LLWB 1CFTA 3L7EA 3KYKH 1DSFL 4X6DB 4K3EH 2GSGB 1CD8A 2JB5L 5EU6A 2EIZA 4BKLB 4BH7B 5JPMB 4KK6D 1RZKC 4M5YL 4U6VH 1YN6A 5DC4B 1CFNB 4HJ0C 2GCYB 3AUVA 3KDMA 4NC0B 2PTTB 4G8GE 2UWEE 3KPSE 1G7MA 1Q94A 4JO3L 1RU9L 5ENWA 4KAQL 3DUUB 4XCNA 4JCMA 1YJDH 4EBQL 5IBUG 1EO7A 3MRJA 1J1PL 4HK3N 4HC1H 2A9NL 4NDMB 3DETD 2NW3A 5EBMA 4XNUL 4PJFE 3WFHB 5HPMB 1YEFL 4L3CB 1LO3L 3PV6A 2JB6A 3O8XD 2EKSA 1CGVA 2CUIA 3SBWC 5HYSA 3GO1L 1KLGB 3LQAH 4HMEA 4KMTH 4XBEL 2EDWA 1K5NA 4R4BA 3MOBL 3BDBA 3MZGB 2B1HL 3G6DH 4PJXA 5I1KH 2H8PA 4HK0B 5F7LB 4LSUL 4GKZB 5F6HI 4Y1AD 5F7DA 3MLSH 2WLZA 2OK0H 5DJYB 3O3BA 3WHE0 1HCVA 3FONB 3CFIC 3MNVA 3TV3L 4FZ8L 4AEIH 1Q0XL 3FB5B 4MJ5A 4G9FA 3C6LB 3RX7A 4KVCL 4LQFH 2ATPA 3T0XA 4TULL 2P44B 5HJ3B 1HSBB 3RY6A 1OSPL 2MKLC 5CEZE 2EYTB 1A9EA 5IWLA 4F7EB 2OTWB 3HZKB 4X7TB 4Y5XA 1A02N 2NY2B 4V1DB 3NGBC 1XZ0B 3OAUH 2A74B 1S7QA 3VXSD 1TJGL 4NGHL 3RTQC 5GGSA 3BE1L 1UM5H 2GUOB 1INQB 5HDQH 4JQVA 4EVNA 5JZ7C 3CZFA 4V2CB 1OAZH 2HLFD 4XNZC 3BSZL 5ITBH 1BIIB 4D94A 3HMWH 4P5MB 1JNHA 5D2LA 2PXYD 4EI6B 1GPOH 1CICA 5JW4N 4TVPD 1C5DA 5D6CB 3BP5B 5C0IA 1C8PA 2QADC 4R26L 1DZBA 2R8SH 5K9KB 3Q48A 3ZKMD 1DQJB 3WKNA 4J3SA 1A6AB 1F13A 4NQEA 5F6HJ 1Z0NA 4O4YH 4B50A 2UY6A 2BFVH 3BPLC 2R2CA 1CFTB 5BVPH 3O2DA 3RWIA 2VDLH 1RK1B 1FNEA 4LASL 5EU6B 5T3ZL 2EIZB 1T4KA 2ZCLH 4XVUC 5LGKA 1R6VA 2P8LB 3EO9H 1YN6B 2ZJSL 4IOIA 2ICEA 3QDMB 1ETZA 3KDMB 2HJLA 5FM8A 1AFVH 3D85A 4N90E 4LF3B 4HUXB 4XI5D 1WFOA 4XP9L 3SE9H 4KFZC 1Q94B 1BF8A 4RFNB 5ENWB 3DRTA 3OAZK 4FQIH 5ESVA 1LO0L 1I7UA 1ZVHA 5EBMB 5TGBB 1JRHL 4U6XA 2JB6B 1F90L 2VZUA 1Q72L 5JOEA 4Z7OF 4JFPA 2QSCH 1XGUA 3QEHA 4K7PY 3U83A 1SBSL 1NCCL 1SM3H 3BPNC 1YN7A 2XZQH 3HMXH 1J0JA 3GI9L 4PJXB 1MWAL 3UDWC 2H8PB 5GZNC 4XC3L 5F7DB 4OLWL 1MPAH 3MLXL 3O3BB 5D1XD 3LN4B 2EDQA 1XF1A 1N6UA 3RI5F 3CFCL 1EXUA 2I24N 3MNVB 7CGTA 3FT2A 1QFWM 4PJ9D 4EXKA 5CP3A 4LLVA 4MJ5B 4MD0B 3S96A 3TIDA 1KCKA 1A7PL 3V52L 2ATPB 2HTLD 3T65B 1FIGL 3JWDC 4X8JA 5D7SL 5FYLD 3LHPH 1A9EB 4F7CA 1NCWL 5I0ZA 4Y5XB 4LCUA 4XMKH 1H5BB 5GGUA 2RQ8A 5I1HL 4FQLH 3R0NA 4HGWB 3JUYA 1HNFA 5GGSB 4YGVB 3B6SA 5DJ2B 3VI3E 3KR3H 4Q6IC 1QLFA 4OIIL 3OG4B 2YXMA 1KN2L 1RIUL 1YZZA 3O6FA 5GS3A 5HGBA 2IAMD 5C6TL 1JNHB 4G6KL 1CICB 2VXQL 2ZOKA 1C5DB 3IF1B 3R1GL 4KQ3L 4PRNA 1JV5A 5C0IB 3MLVL 3L3GB 5C08E 3QDGA 4NQEB 5DD0L 3WNPA 1IZJA 2VB5A 4Z7UF 5IP4A 2O61A 3RWIB 5MENB 5K9OB 1FNEB 3DSFH 3ZDXE 1BVZA 1JYXA 1T4KB 1U8IA 1WVZA 3ELAT 2FO1A 1LE5B 4KUCF 1S9VB 4EUPA 3KG5A 1B2WH 3B9AA 4IOIB 1ETZB 3SE4C 2HJLB 1GIGH 1GVIA 2VLJA 3D85B 4PREA 1R3IH 1DBKH 3P9LA 3DRTB 1I9IH 1KGCD 4Z5RA 3U0TA 1CDBA 5E8DH 1XF3A 4RA3A 1IC7L 2CXKA 3LAFA 1ED3B 1I7UB 1PYWA 4FABL 4JO2L 4XHQA 5A2IH 4J1UA 3O6LL 4O58H 4KRPD 2PKDA 2ZG1A 4JZNA 4UILL 4JFQA 1I8LC 4CVUA 1A0QH 3VXPA 4JFPB 3IFNH 1XGUB 4FTVA 3QEHB 3ZL4H 3RBSA 5E6IA 1YN7B 3WFEH 1UJTA 4AQ1B 5JQ6L 4PS4H 3MV8E 2HT2C 5BRZA 1YEHH 3QXAA 2R0WH 2GFBA 3SCMB 4I3RH 3RY4A 5CKAA 5IW3A 1E4JA 3HG1E 1CVRA 2J6EL 3I50L 2O5ZL 3VWJB 1N0XH 2J1KA 3WIFB 1EXUB 3L5HA 5HHNA 3CU7A 5I75C 1XR9B 5CZKA 3ZE0E 5IVXB 3GMLA 3TIDB 3S96B 2AJ3A 3VG0L 3QJFA 1JZ4A 3KXFA 3MOAH 1IFHH 4Y4HC 1MJUH 5EO9A 3W5MA 2XQYG 2EDKA 4X8JB 4RBPK 3LQZB 2OZ4H 2JJWA 2NY7H 4GMSH 3RPKA 4H25A 4JDVA 4LCUB 1U6AH 5GGUB 2D4FA 4LLDA 2AXFA 2KUTA 5E2WH 3EJJX 3IJHA 3B2UD 4MJ2A 4RWHA 5IHUH 3LY6A 4QT5A 1XGPA 3ETBF 1T0NA 3B6SB 5JIKA 1OAYL 3KNBB 5D7LA 2WWKO 3HPJB 3O6FB 1LO2L 4WVRA 1F4WL 1OP5K 4JFHE 3DXAD 3LKSA 5JW4R 3NH7H 1ZWIA 2J8OA 2E7BA 2ZOKB 2CKBA 4G5ZL 5EULV 4OSUH 4PRNB 5BJTA 1I4FB 2C1OB 2D2OA 3C5ZA 4JFXB 3QDGB 4I18A 1FVDA 5E24E 1TNNA 2GKIA 1QBMH 2BHYA 2WIMA 2XN9E 5EOCL 3TA3C 2O61B 2VC2H 2IH1B 1LDPL 4XVSH 5ICZA 5E5MB 5IJVB 3VFGL 2FEDD 1JPFA 3M45A 3X3GH 1DJSA 2CDGA 3L3KA 1U8IB 2EKJA 2JK5A 4Y4FD 5I1GL 1F3JB 1VADB 4EUPB 5TE4L 3IJYA 2BNQD 1D9KC 1UH4A 3ZKXB 5IMLA 1LD9A 4UU9A 1JGLH 4K94L 1GGTA 3U0TB 4Z5RB 1MJ7L 1XF3B 1X4XA 2AV7B 2VAAB 1PYWB 3HAEA 4YDJA 4YFEA 5FF6A 1DTUA 4J1UB 5GSRB 4JFQB 3RVUD 3ILQD 2QSVA 2J8UE 3EYVA 5GHWL 3VXPB 1IT9L 2B8OT 2ID5A 4YAQA 4FTVB 1BFVH 4NFDA 4D0BB 5JIPA 4ORZC 1T0MA 1TQBC 3PWPD 1UZ8A 5L8JB 1Z3GL 4UI2A 5H8DA 1WAAA 3S3PA 1PD6A 4KKLD 4YIQA 1B0GA 1ZHNA 4OQTA 1SMAA 4N0RA 3QXAB 5D6DA 2GFBB 4KZDH 1KELH 3BZDA 3TN0A 3FQTA 4I9WE 1UM4H 5J3HD 1WEJL 2XTJB 2DQCL 2C1PA 1J8HE 3U4BH 2D7QA 5HHNB 1BZ9A 3C60D 2G60L 1C16A 3CSPA 3GMLB 2AJ3B 1MHCA 3QJFB 4ELMF 2RCSL 3F5WA 3MXVH 2YPLE 3A6BH 3JWOC 5L6YL 1IBGH 4J8RB 5IBTH 2I07A 4HV8A 4JDVB 4F57L 4F7PA 3S88H 5CJBA 4LLDB 2GK0A 1OM3H 4F9PC 2AXFB 3D3VA 3I85A 3IJHB 1WTLA 1MFDH 3IETB 3TIEA 2E27H 1XGPB 4MDJA 5FGBA 4DGVL 2DKMA 3PL6C 1QO3A 5IB5A 2O93L 1KIUA 3ME0A 1BQHG 1S5IH 2X1XR 4KJWC 2PYEE 1AY1H 4X6DF 3VFTA 2J7LA 1J8KA 4FQXA 1LNUA 3LKSB 4KZEL 4JDZA 1FSKC 3O9WC 1CGUA 1ZWIB 2DM7A 5ADOL 1E4WL 5F7YC 1BD2D 4YXKL 2VDRH 3TJHD 4JO4L 3C5ZB 1HOCB 5SX5K 1YPZE 4NWTL 1L6ZA 5I15H 1DQLH 3ZHLA 1MCEA 2KL6A 2YUVA 1FVDB 3CLFL 5T3ZE 2X7LB 5FECB 1DDHB 2DS4A 1KNOB 1QSZA 4ONFH 3PDDA 1ES0A 1BGXL 4QLRA 1JPFB 3L3KB 1ZMYA 2JK5B 4X6CF 4XCYB 5CJOH 5IB4A 1RIHL 3QPXH 1HIML 4LCWE 2G5BA 2XZCH 3LPFA 3MUZ1 4JPIA 2WZPD 5IMLB 2AK4A 1L7IL 3FRPA 4K71B 2WBKA 2B1AH 3N85H 5BZDA 3IS1X 3FO1B 3OKEA 4EN3C 4RFOH 3ET9F 4XTRD 3HAEB 1X5LA 4P46A 4H0HB 3SDDC 3FMGL 4M48L 2APVA 3ULVD 4ZTOH 4WTXA 3W5NA 2UV3A 4XX1E 1UJ3A 5MEOA 1IILE 1T0MB 2Y1VA 5BZWA 3RA7L 1EFQA 1JTOA 1C5BL 2R39A 1B0GB 5HGDA 4PJCF 3PUCA 3UCRA 4QNPF 4PJHF 4E41A 2BVUA 1JVKA 4OM0L 2BY2A 4POZC 2I60H 3TN0B 4YWGL 3KYAA 3FQTB 2NY4B 3BW9B 4JM2A 2C1PB 1A8JH 3STZA 1BZ9B 1C16B 4DVRH 5GRUL 4IBLT 3LPGA 1MHCB 2G2RA 1VFBB 3V5KB 4S1RL 3G5XA 3SGJC 3BKML 2IGFH 2I07B 4HV8B 4CN4A 5SX4H 5E6YA 4ALAL 2UZIL 4GRLD 3SDCC 3UEZA 1VDGA 5JOFA 4K7PX 4F7PB 4XCFL 3CNKA 5HI4D 1NUGA 2GK0B 1XH3B 2WBJD 1IEAA 2JTDA 5GGTL 3ALPA 4JZOB 5INDA 4I77H 1VEPA 1A1MA 4FXKA 3TIEB 1T2XA 1NBVL 4MDJB 3ARBD 1N7MH 1TPXB 1QO3B 2AJXL 3BZFB 5IB5B 1X7QB 2G9HA 3KLSA 2P8PA 4HJJL 4PGBA 3V5DA 4HX1A 1L0YA 2YK1H 3RWHB 3VFTB 5CZXC 3U6RB 3IB4A 3C2SA 2VRAA 4JDZB 1NGQH 3MGAA 5JR1H 2K9UA 4NO2A 1XT5A 3EHBD 1DVFB 4NZUH 3GI8L 3LKOA 4GRWB 1RULL 2RHEA 1EK3A 5HDBE 3WHXB 2P7TA 3L3IA 2EXYD 1U92A 3B9KB 1MFAH 1FLRL 4ZSOE 5IEHA 2NY0B 4CVXB 2NY1B 3QXUA 3FQUA 3MRHB 3HZMA 1MUJA 3OKMB 4HIIB 2ZNXA 4I1NB 2VWEC 4NQDE 1ES0B 5IW1A 1NLBH 1XGYL 2CIIA 5J7CC 5E8OA 1KTKE 1OARL 1NCBL 3U0WL 4NYLA 3T4AA 3AM8A 4KY1H 4KVNH 5I8EA 2P49B 2YPVL 4HKJA 5IB4B 3FL7A 2PCPB 4MD4A 3X14A 2G5BB 4LCYA 4PG2A 1DL7L 2DJ4A 4JPIB 3NCJL 2IFFH 1MAJA 4XC1H 1XGQA 3UC0L 3GRWL 4YDKL 5EO0A 4PBXA 4I0KA 3CX5J 4YHIA 3OKEB 1HYSC 1OP3K 1EFXA 2W9DH 3TBYB 3BYYA 4F7MB 1ADQH 4XNXL 2WWMD 4ZUUA 4HD9A 4P46B 2Z0BA 5I0DA 1YMMD 4CADB 3EOBA 5D1QC 3AC0A 5LGJA 2ORBH 2P43B 1QG3A 1G6RH 4YH6A 4M03A 1QSFD 2WW8A 1UJ3B 3AXLA 2UZYB 5MEOB 2JKXA 4NOFA 2ADIB 1XF5A 5IF0B 1TIUA 4I0PD 4RISH 1S9KC 2VXTH 4IHOB 1WWAX 5DDHA 3U0PA 5J9PA 5HGDB 2XQBL 2EDXA 4D9QD 4HWNA 1A1OA 4TTDC 5D5MF 2ITDA 2JJTA 4JM2B 4W81A 3LEYL 1YA5A 4MS8C 5DQDH 2YSSA 3WSQH 2G2RB 4QTIL 5FV1L 1T7YA 3MLWL 4AZ8A 4DCQA 1YC7A 4GMTL 4WUUA 3G5XB 3GSNL 3VRLF 1NCAL 4LVOC 4WV1A 4OLVL 4MXWL 4X4ZA 5T33H 4L4TD 5C07E 1NLDH 3SEPA 5K9JH 3HUJE 4Y4KC 3QH3A 4WY7H 5JOFB 2JCCF 4H88L 5FOJA 4G80A 1IEAB 3VU2A 2ZUQB 4XBPA 2X1WL 3PHOA 4ZAKA 3EYUL 3VXUD 1MCPL 3U9UA 1A1MB 1B0WA 4FXKB 4DUXA 4JANA 3SO3C 4GQPH 3H9HB 2HJKA 5SWZE 1WCQA 3V5DB 4PGBB 1ZANL 4NRZB 3LKPA 2V9QA 4P5TC 2FJGB 4QRUB 2V17L 3ULSA 3MUHL 3KPLA 3OR7B 4KDTA 3VXRA 5KAQF 4YBQC 5IHZA 1RZFH 2IF7A 2BVOA 5IR1B 3K8LA 1EJOH 3OTTA 3C9NA 4JFZH 4YHLH 2PO6A 3WFDH 2P7TB 1IARB 5DWUH 3L3IB 1I1AA 3H3PL 3IGAA 3QFDA 1U92B 3QUZC 3A67L 3D18A 5IEHB 4NNYA 4RMUA 3WS3A 3QAZB 3T04D 3FQUB 1RUAL 2X1PA 2YBRB 3U7WL 2CIIB 3V7AG 3JZ7A 1M7DA 2VSDA 3IU3A 1M1SA 5DT1L 4G6AD 1D5IH 3V95A 4HKJB 4MD4B 3X14B 1YNTA 2NLJB 5FAAA 3PHQA 4LCYB 1R24A 4P23C 4ZS6D 4M1CD 5I1EL 5GS0L 5DRNB 5EO0B 2QQLH 4YHIB 2CRZA 5CD5D 4MJ4A 5DRXA 3SJVA 1EFXB 2AP2A 4KJPC 5A2KH 4OFYA 3QZWA 3H9SB 3EOBB 5D4QA 4YHYC 3KWWA 3NFNA 1FYHB 3S98A 5I1DA 5HI3C 4NKQB 2ZCHH 1M05B 3QIBA 4U31A 4MQXC 4KWUA 3JWNC 3SDYH 2BY3A 3AXLB 1JE6A 5IVXF 3NOIA 5DMIL 3OWEA 4PGDB 1XF5B 4W4OA 1MREH 4L8DA 1GOGA 3Q1SH 1HHIA 5DDHB 1CCZA 5TE6L 3U0PB 3FQWA 3IFPB 1N6VA 1QSEA 4H1LA 1QRNE 4KI5C 4HHAB 3D39A 4X4MA 4LSVL 5F1SA 4IM8A 2MTPA 2ITDB 5C0JB 4JN1H 4PRHE 2F5AH 4PP1D 4MA1B 2YSSB 3W0WE 4LQ1A 1J18A 4KROC 5JHDA 4DCQB 3TZVA 4L4VE 4WUUB 4JREC 3RX5A 2X4SB 4M7LH 2MQ3A 1AGDA 2I5YH 2Z31A 1E6OH 1HQRA 4WV1B 4ESKA 2VZ3A 3UYRL 1QQDA 3LKQA 4MNQA 1X5GA 5F89A 4NZTL 4U3XA 4NPYB 3C2AL 3QH3B 1F02I 3BWUC 3ZYZA 1K2DA 4NN6C 3F12A 4NO0D 4XBPB 3PHOB 5EU7C 4DTGL 4HLZH 5DMKA 4M3JA 3MJ7A 1FFPA 4JANB 2DMKA 4QHNA 1HKLL 2AVGA 1T1ZA 5A2JH 2WQRA 2X2YA 3LKPB 5HHOE 4OZIE 1GZQA 2FBOJ 2YD1A 1CS6A 3KPLB 2MCG1 3ZTNH 4QRPE 5IHZB 2BVOB 4Q9QH 2GI7A 1R5VA 4ZPVA 4HPOL 3TNNA 4I8DA 5F7KC 2PO6B 2GSIA 4P2RD 1I1AB 3IGAB 3QFDB 4AEHL 4XPTH 2E3VA 4HUVA 4X9IA 3D18B 2JLLA 3DX6A 3WS3B 3RDTD 5L7XL 1XIWB 2DLTA 5IW6A 4UT7L 2Y6SC 1E4KA 1N6QH 3CK0L 4NQCA 5K33A 3IU3B 3SY0A 3WJJA 4JRWA 1Y0LB 4IRSA 1CD1A 1KT2A 1R24B 2Z9TA 4Y88A 2RBLA 4LVHB 3CCHA 4JZJC 3B8YA 2VJXA 3CLEH 4NWUH 3SJVB 5DRXB 3QFJE 2YD7A 4GXVL 4HT1H 1I1FA 1KC5L 2QQKH 3QZWB 3OKNB 1YY9D 3KWWB 3UAJC 2BDNH 4Z7OE 1BM3H 3ARGB 2N1KA 1MHPH 4H0GA 4C56D 4OD3L 4LPCA 3CC5A 1OHQA 4XMLL 1AQDA 2K7QA 1M71A 2OR8A 4MJID 3M07A 4TUKL 4Y5VC 1EGJL 4L8DB 4IRJA 1HINH 1QEWA 1HHIB 4IRZH 1ZK9A 3ARFA 3LB6D 2DAVA 3FFDB 3FQWB 4UV4L 5CBAA 5HYQA 1PW3A 4M6OL 4HWZA 4PRDB 1OT2A 4Y5YA 3D39B 4L8SA 2GEEA 1H0DA 3U7YL 4KK6C 4LSTH 5SX4I 2VDNH 1IC5H 5DJZA 4OFVA 1K6QL 1FAKT 4K94C 4N1EA 1OTUD 3JSSA 2EE2A 1T2QH 3FFCA 1NMCC 4IMLB 3TZVB 5T5NF 3PNWA 4YC2C 1JWMB 3IJSB 4NJ9L 4YHKH 4NC2B 2Z31B 1HQRB 4ACPA 1CVSC 3K4AA 3BOVA 1QQDB 3L1OH 3LKQB 5MEPA 5B39G 4MNQB 2C3XA 3K8KA 5F89B 4OCLC 3PQYD 2CK0L 1QA9B 4OCXL 1K2DB 2F5BH 1DEDA 4BFGA 3ZDZF 1QRKA 1UWXK 1KULA 2CUMA 5DMKB 4M6ML 4ZS7L 3MJ7B 1FFPB 4EQ3A 3QIWC 4QHNB 4GKSA 5B4MD 4P3DB 1KENL 1T1ZB 3V0WL 1GXEA 3QHFL 1Z0MA 1AGCA 2NX5E 4U3CA 3BISA 2F15A 4UAOC 5C0AE 5E95B 4WW2A 1GZQB 5TF1L 1OP9A 1EO8L 5C09A 3L95B 1NGYB 1EEZA 2VDKL 1R5VB 4A6YL 1UT9A 3T1FB 1WUNT 3F7PC 4J6RL 3TNNB 2VDOH 1JF6A 4IOFC 4PJDB 2ZZUT 3DX6B 5SWSA 3OX8A 2H45A 2AJZA 1S9YA 1SEQL 3MCLH 3FQNA 1NEZA 2NY6B 4NP4H 4IRSB 1CTNA 4HF5L 5ALBH 2OL3A 1HHKA 3UZEA 4UT6L 5SV3A 2CDEA 4U7MA 4U1HA 1KT2B 1A7OL 1F58H 1KJ2L 1KGCE 2VITA 3MYZA 1U95B 5EZJA 3BGMA 3RP1A 3CCHB 3KPOA 1CU4H 2OR9H 1TZHA 1KFAH 3IFLH 1JGDA 1DQQA 4FN0A 4NOBA 1FG9C 5DLML 2IPUG 4PRAA 3PJSA 5DHVA 3CFJA 2I27N 1OGAD 1I1FB 2PXYC 4L29A 4LSRH 3GB7A 1FNGA 3ROLA 5D93C 3VXQA 3LCYA 5DJXA 4D9LH 5BO1L 2R4SL 1VENA 3CC5B 3WN5B 1AQDB 2CR6A 4ODHH 4LK4A 3I75B 1WWCA 5L2KD 4R0LA 2R0ZL 3ARFB 2EICA 4NHUB 2CD0A 5CBAB 5F7MC 5HYQB 4HUKB 4G8EA 4Y5YB 5BS0E 4L8SB 4PJIA 2QR0A 2GJZB 3G6JE 3B3IA 4GOSA 1T7WA 1RJCA 4YHZL 3AVEA 4M7ZB 3LQAL 1B0RB 5DJZB 1QYGH 1XCTA 4CGTA 3D69B 2GW5A 3MRLA 1TVHA 4KGLA 4XI5C 2E8ZA 3FFCB 1S78D 3HI5L 3PNWB 1Z5LA 3OHXA 5FOBA 1YEKL 3QEGL 4Z6AT 1OB1A 5MEPB 1KTRL 3RPIA 1ZOXA 4O9HH 2NZ9D 4CMHB 2EDLA 4RAUA 2AJVH 1V8HA 1MNUL 1T83A 1U58B 3LPWA 4F3FA 5I8CA 4TTGA 3V9FA 1UFUA 3I6LD 5EUKA 1BFSA 2EECA 3AREC 4KK8D 2H2PD 4GKSB 1CD9B 2VOTA 5J11B 1CFVL 4JRXB 3X3FH 4OT1L 5I8OH 1AGCB 1KXQE 4DAGH 1MCDA 1YEJL 2WUCH 5EZIL 1AP2B 4WW2B 4EI5A 3CD4A 2FGZA 5JA9A 3O2DH 5C09B 3P9MB 5D1XC 1EEZB 1FFQA 5AZ2L 1RK0A 3IAPA 3PWNB 1BJ1H 1W0WA 2P5WE 2DKSA 1SJXA 5E6ZA 1YYLH 3GMRA 1CBVH 5EC2A 1OAZL 1FFOB 3CX2A 4WEBL 2R1YA 2HTLC 5SWSB 3ZKSD 3OX8B 2AJZB 4MXVF 3O81A 3PGCA 3V6ZA 3FQNB 4Y0GA 1NEZB 1F2QA 1GPOL 1WWBX 3DMMC 5E8EA 2W0FB 5EORL 3TO4A 4DN4H 2APTA 4ZTPH 2BNQE 2Y06L 5IUSA 1HHKB 1SEBA 2CDEB 3JTTA 2N7BA 3S97C 4U1HB 2Y25A 3WMSA 2VITB 1V3KA 5EZJB 3BGMB 4I2XA 1CFBA 3T0WA 4F15B 4TSCH 2M1KA 2HMID 1DQQB 1RURL 3PJSB 2QBWA 1ORSA 1OCWH 2IAMC 3CFJB 4JQXC 4DGIL 2GTWA 4L29B 4N5EC 4YR6A 4DKAA 3ZT5A 4ODVL 1X44A 1FNGB 3GJEA 2Z8VC 4JM2F 2VLRD 3VXQB 1HSAA 5DJXB 3VFRA 3OF6D 3QCVL 3SE9L 3ARUA 4Q58C 4M8VA 1PVHA 4FQIL 5CP3H 5KG9A 2DRUA 4FFZL 3NPSB 1GGYA 4G8EB 5D7IE 2ERJB 4HZLA 4YUEH 4OCNC 4PJIB 3GNMH 3O2VL 2QR0B 5T1KD 1GGBH 1WITA 1MVUA 4WW1A 3B3IB 1DQTA 2AJSH 2DQFA 3ESUF 1XCTB 2DQHL 2IG2H 3ULUF 3GSUB 2BVQA 4AK1A 2CDFA 2XZQL 4PJGA 4ELME 2IANB 2J3SA 1A7RH 4WFHD 3IT8D 5E8NA 1Z5LB 3ARDA 1W8NA 3OHXB 5FOBB 2R23A 5IROC 4DKFL 2IMNA 1VFUA 1OB1B 4XWOD 4Q9BA 5FDWA 1BMGA 3RPIB 1MCOL 4HLJA 2XZZA 5HHXH 4NQSA 4UBDD 4OD1H 1UKQA 2EDOA 3UJIH 4F3FB 2R29H 5D71L 5EUKB 4PJ8D 5EWIH 2JJSA 4P2OC 3U1SH 3ARYA 3L3DA 1JZ5A 4GAGL 4LAJH 3LHPL 4X6DE 3TCLA 4EI5B 3T2NL 5J12C 3UTQA 1T66D 4JPVH 4XCEA 1F6AA 4XMKL 4UZGA 5A40E 5DURD 1GSMA 2HFGL 1TJHL 1RK0B 1QFUH 4PJ5D 2B4CL 4YQXH 4EUPH 4J3UA 1V3JA 1CK0H 1LVEA 5EC2B 3B5HA 1Z9SA 4NHCL 1T80A 3VH8B 3VFSA 3MPCA 5F9OH 4X99A 3PGCB 5GPRA 3V6ZB 1QNZH 5DD3H 4PLKC 3DECA 3TO4B 2UWEA 4X6CE 3KPSA 4JY6A 2BY0A 4MJ6B 4OGAC 4ZD3H 4ONHA 1ITBB 1SEBB 3JTTB 4WI4A 2Q8AL 1IAKA 1N3NA 2ZSVA 5IFHH 3JBG7 2IBBA 1EHLH 1OAUL 3NGBB 1FBIH 4P2QB 4PJFA 4OGYH 3MGTA 4PRBA 3RTQB 4P59H 4RGMC 1WIPA 2GTWB 4Q6IA 3QO0A 2AERT 4OJFL 3MV7D 4YR6B 3RWJA 1HH9A 1AI1H 1FHGA 1UKTA 4N0FA 4RZCB 4X5XA 1JTTA 4ZUSA 3GJEB 4UQ2A 1VA9A 4J3WA 5HYSG 1HSAB 2VR5A 1KJ3L 1W72A 3STLA 1GIGL 2BXZA 3VFRB 2VN4A 2MSPA 4LSSH 5EU5A 3GK8L 3NPZB 5T1LB 2QADB 5DSCA 1NAMB 4GKNA 2J5LC 4KXZH 2EH7L 5KG9B 1C12B 1P9MA 1NQBA 8FABB 4PJCE 4I0CC 1IGIH 4QNPE 4PJHE 2H3NA 1CQKA 5TQ2L 5MERA 4Y4FC 2YWZA 1TLKA 5ABDE 1JGUL 2DQFB 5AYQA 4R4FH 2EEDA 5IMKA 3FO2B 5A16A 3VXMD 1QOKA 3DXAA 1PG7W 2ILLA 2X09A 2CDFB 3VRJA 1T1WA 4MAYC 5E8NB 4HUUB 3ARDB 2GJ6B 2R23B 2A6IA 4Z18A 5FUCE 3EDDA 3MA7A 4TSAH 1LO5A 5E9DD 3P0VH 2AEPH 4PB0L 2EIBA 2Q8BH 5KS9B 2FSEA 3O0RH 3BPOB 2CKBH 4GAYA 3BKYH 4L8CB 1RZGA 4KKAD 2AQ2A 2PW1B 1I8LA 3SKMA 1I7TA 4X98B 1IFHL 3V4VL 3S8WA 1O7VA 4JFYA 5FEBA 1RHFA 3L3DB 4K2UH 4KKLC 5FGRA 3S4SA 1RZJC 3T0ED 5GXBB 1MVFA 1T5XB 3UTQB 3ZKQD 4XCEB 2VUYA 2DI9A 2NY5C 1IM9D 2XWTA 1AO7D 1GRWA 1N4XL 4GBXA 3QDME 4K3GA 3MNZA 4HCRL 2AJYH 5F1NB 2RIKA 5CKGA 4Z7VF 4GG6E 4U3HA 5ESQA 2YEZA 4M93C 3VFSB 3RU8L 2FRGP 2CMRL 5B38B 5I1JH 3NH7L 4G8GB 2A9ML 5BMFH 3HAEH 3KPSB 2H32A 4NQXB 2X4TA 4PD4J 5TQ0H 2YUWA 1KPUB 3OAZH 2YMXL 3GIZL 1LO4L 1N3NB 2F19H 2ZSVB 4JVWA 3BRFA 4KV5F 4QXGL 1ZLVK 3L5XL 2WM0A 3GUTA 4XRCA 1LQSR 1A6ZA 1IL1A 3IDMA 2BSTA 1X4YA 1YMME 4XVSL 1DLFH 4Y16D 4OLEA 4Q6IB 4Y2DD 3QO0B 2XWBA 4OB5H 1HH9B 4N0FB 4P4KC 2DBLL 4X5XB 4OQTH 1RVFH 1V5JA 1QZ1A 3LIZH 4UQ2B 3TJHC 3STLB 1BBJA 4C58B 2C3WA 2Y36H 3OGCA 4E9LA 1UM6L 2IALA 4RWYL 4GKNB 3QDJE 3ZSTA 5CMAA 3OJVC 3EDFA 5K59F 1Y6NR 2IMMA 2VLLA 3WKMH 5CILH 3HE6D 1JZ7A 4RAVA 1D6EA 4X9GA 5MERB 5C0RH 4DK6A 1JPTH 1MCRA 4LCIH 5D5ME 5ILTL 1T3FA 4WFGD 1D7FA 4GS7C 1BFVL 1LP9E 5IVZA 3BKCL 1RIVL 2R2BA 4LVNC 5A16B 4GW1A 2DWDA 4FP8H 3DPBA 3VRJB 1T1WB 5INCA 2Z93A 1X5HA 2PN5A 2K3TA 1C08B 3ECBA 5GGVH 1UACL 2X4RB 5D70L 3WYRA 2W9EH 1D9KA 4W6XB 5KANG 2A6IB 3I9GH 2KZWA 3MA7B 4XTRC 1CT8B 1JGEA 1YMHA 2V2XA 2XOTA 2NZIA 3U46B 2JCCE 3VXUE 4CVZA 5GJSH 4AMKL 1ZTXH 2FSEB 3MYJB 1V7NL 4GAYB 1JHTA 4Y8AA 1EAJA 4GRWH 4PJDF 3A6BL 5FYKH 4JFYB 1CG9A 1ZE3C 2V9TA 1INDL 1H3WM 5C08A 2M8XA 3UBXA 2F53D 1MQ8A 3DRQA 2XWTB 3DV6B 3DYMA 5KSBF 3VXOA 4YX2H 2LAAA 4GBXB 3MNZB 2VLKE 4OKDA 5E2VH 2IQ9H 1F3RB 2RB8A 1D5ZB 3CXHJ 5IK3B 4NT6B 1QR4A 1WIOA 4E5XA 1X6LA 3F62A 5JW3L 1UXWA 1OLZA 5I75B 2DD8H 4XPFH 1Y18B 4H5SA 1AY1L 1KCUH 1FYTE 2DQTH 2CRYA 4JJHA 3FKUS 4NUGL 5FUCC 3WDIA 4Y4HB 1HILA 2H32B 4NBZB 4XXDB 4U0QB 5ETUA 5HI4C 3SQOH 4EUPG 2X4TB 3RGVC 4F80A 4YE4L 1KCRH 5FKPA 2F58H 1SBBA 3GUTB 4XRCB 3HTLX 1A6ZB 2XTLA 1IL1B 4LRIC 2VQ1A 3IDMB 1KTDA 5AG8A 2BSTB 3CXDH 3TCXA 3PL6A 2X41A 3K81A 1FNHA 4X6FA 1NAKH 3INUL 3VD7A 2FX7L 4YBLC 2XWBB 3NZHH 2DN7A 4KK9C 4N68A 5KANI 3QPXL 4XVJL 1DFBL 3PE9A 3VI4E 3MV8A 1BBJB 1S3KL 3RX8A 3BUYB 3HPLA 1MEXH 3VGEA 4UOW1 3IDXL 3O4OC 1G9NL 2R15A 2WP3O 1MRDH 4O2EB 4UDUA 1ZA3A 4XPHL 1NSNL 3Q0HA 1QFWI 3HG1A 1P4LA 3Q6GL 4F2MB 2VLLB 2X40A 3FO9B 4HFWA 4K3JL 4OLZL 2HWZL 5ADPH 3CH8A 5CFHA 1D6EB 4YBHA 3ARBA 4ZYKA 1T3FB 1U36A 2EO1A 2NYYC 4YHMH 5IVZB 4P9HL 2DQIH 2QQNL 2R2BB 4AIZA 4GW1B 3RNQA 2BXYA 2DWDB 4RBPH 1O0VA 1A6WL 5IEKA 5INCB 2Z93B 3ECBB 2Y72A 1ZA6A 4KI1A 1NKOA 3HR5A 1D9KB 2AGJH 4YHOH 3ULUL 5BV7L 4J3TA 2WWMC 3EOYG 4D9RD 2CRIA 5EIQA 2V2XB 3UPAA 2NY2D 3TT3H 4V1DD 4JFFE 4CVZB 5EPMA 4JY5H 4NNPL 1LGVA 3EFDH 3VW3H 4L5FH 1JHTB 4AENA 4DVRL 1IE5A 2FECI 1YJDC 3NCYP 5DRZA 4WFFE 5L0QC 1OP5H 1BWWA 3BH8B 4I0PC 4LSPH 5IIEB 5I16A 1FL3A 4X9FA 4ERSH 4D0DA 2AXGA 3WUWA 2NY3B 3S5LA 5C08B 1TQBB 1OLLA 3UBXB 3IAGC 3WXWH 1C7TA 3LQAC 3CH1A 3W9EA 3KPPA 4R6UA 3X12A 3GMOB 1FH5L 3UZVB 2VDPH 4PGCA 2XG5A 5HHVL 2VZTA 3D9AH 43CAA 4E5XB 4UTAH 2HKFL 2O5XL 3PP3K 1UXWB 4LLQA 4R2GC 4AIXA 1ACYL 4M1GH 1MI5B 1J0IA 4H5SB 4WRLA 2H2SD 4XAWL 1DLHB 5EU6D 3SGJA 2W65B 4Z8FL 2E7LA 3T3PF 5IESL 2PF6A 5ETUB 2OJZH 3O6MH 5HHME 2EZ0D 3RZCC 4LGRB 3RY5A 1BQLL 3D2UA 4F58L 5IKCA 3FT3A 5FKPB 4IIQA 3UJJL 5HY9A 3I02A 4WFED 3MCKA 1A14H 1X3DA 2H41A 2VQ1B 2Q6WB 2J8UA 3QXDA 4HG4K 4X0KA 3PL6B 1G9ML 3BQUA 3HAEG 4ZFGH 4HIXL 4KXZI 5KTEL 4OTXL 4TUOB 5EA0L 1SJHB 2YXFA 4M61A 4JG0L 4BZ1L 4BH8B 4BSJA 5JXEA 5D1ZA 1ITCA 2VYRE 5I1CL 3O9WB 4QRTA 4RGNE 5KJRH 2X4OB 4U6HB 4L9LA 4UDUB 3BT2H 1B90A 3QJHB 5FO8B 3HG1B 1IKNC 1P4LB 1RHHA 5DYOA 2ZPKH 4MNGE 5D7KE 3B2VH 1J8HA 4LAQH 4Y8DC 5KVEH 1A7NL 5AUMA 2YPLA 1OAKL 2OJEA 1HYRC 1MF2H 3C8KB 1QP1A 2GK2A 2NTSP 1DUZA 3WO3B 4AIZB 3KJ6L 1DN0A 4KKCD 3DVIA 2J4WL 3T4YA 2QHRL 3DO7A 5M94B 2RFXA 2X4QA 4Y7MA 2Z8RA 4DUWA 4X7FC 5HVHC 3WUZA 5CD5C 1ROWA 1RUQL 1J87A 2VXVL 4N8VA 1ZT1A 1E0OB 3RVVD 1UADC 1BPVA 3RIFK 5EPMB 4M6NH 1P4IH 3ZDZE 3ZT6A 2EE9A 4POUB 3ZDYF 4GQ9L 3GHBL 2DQEL 3MSPA 3JXAA 4TRPH 5DRZB 3D1MC 5D2NE 2HTKD 1ZVSA 4IJ3C 1K4CA 4KTYA 1WBZB 2P45B 5I16B 1FL3B 5TDPA 1OOAA 3QHTC 4D0DB 1I9RL 4JHAL 2AXGB 5E4EC 4GO6B 3DYOA 1DUYA 4ODTL 1RQ5A 3UTOA 1CICD 2IC2A 4O02L 3SE8H 4HSQA 3KPPB 1H9VA 3X12B 1JI2A 2XN9B 4JB9H 5C7XL 3TBSA 4PP1C 4LKXA 1MRCL 4KDWA 1U91A 3QNYA 4NKIL 1MCJA 2VQTA 3N06B 4NQED 43CAB 5DEGB 1CE1L 1AXTL 1VESA 1BEYL 1WGOA 1YNLH 4LDLB 5HXMA 4GT7A 5MEND 4OIBA 1PJ9A 4LCWA 2AS5M 3DOSA 3NACL 2B20A 1RZFL 3AROA 4IMKC 2Y7QB 1IC4H 1Z9MA 3JV0A 4HWBA 2BMKA 1RMFL 3SDCB 3D2UB 5IKCB 3FT3B 3NABL 1FDLL 3D85D 4MQ7A 3P9WB 4IIQB 2EDRA 1OAQH 3FRPG 2JELL 4KK5D 2FATH 1LK2A 2J8UB 2ESVB 3D0VB 4X0KB 1DBBL 3OMZA 3AAZA 5DUBA 4TSBH 2XACC 3UPRB 4H1LH 4IDJL 4M61B 5IB2A 2JE8A 2IFGA 3L3OA 4OLYL 5D1ZB 3WD5L 3MUGB 1K9TA 4KJQD 4QRTB 1FC2D 4L9LB 3GMQA 3VDAA 3N1PC 2Y9RT 4MCYA 1EDQA 5K93A 2Q7YB 3RDTC 5DYOB 3U2SA 4L1DA 1N64L 1J8HB 1EPFA 1VGEH 2OS7A 4FG6D 5LBSL 1BOYA 4YZFF 5C0EB 4Z0XA 5FUOH 2AKRA 3O45A 2HVJA 3MJ6A 4AG4L 5KS9F 1L9MA 1YEIL 5AUMB 1UA6L 2YPLB 1UB6A 2OJEB 1KN4L 1A7QL 1DUZB 1DN0B 4XMPL 3T4YB 5CWSA 1HN1A 1NBYA 3DO7B 2R1XA 2X70B 5EU3A 5I71B 2RFXB 5B3JF 4HIEB 4MNHA 1W0YT 1A6VH 1B88A 1MHHA 1KBGH 1ZT1B 4N8VB 5DD5L 4XPBH 3KPRB 1FCCA 3P4OA 5I2IB 3CPLA 3NIGE 4GFTB 2F5AL 4MWFB 2HAZA 2NR6D 3WNLA 4I3GA 5GGQH 4HIHA 3QEUA 1HXYB 2PYEB 3G6AA 3MA9H 4DGYH 5D1QB 5FUZH 5J56B 5F97E 4K8RL 1UH2A 1Q9KA 3BVNA 5LAXA 1ZVSB 3W2DH 3G04B 3K7UA 4XH2A 3PWUB 4N8CH 1VGKA 3O6FD 3S3JA 1IGCH 3RWCA 1DUYB 4LBEA 1YPZB 3E2HB 3NAAH 4PLNC 3CVIL 1Q8MA 2OM5A 4ZSOA 3BP7B 3K2UH 4L8BB 4N8PA 3BP4A 1FL6A 3G5ZA 3TBSB 4ETQA 3RBGA 1IAIH 4NQDA 4LKXB 1U8HA 1WFUA 4YXHH 1U91B 3QNYB 4JO1L 3CUPA 43C9A 3QDGD 1SJEA 1OTUC 3VGAC 1J0KA 4U2ZA 2BCKA 3NFPB 3BJLA 4G9DA 5JHLH 3GKWL 4DK3A 4LCWB 2OCFD 1CI5A 5MHSE 4LVOB 2CGRL 3VRIA 5DA4A 5KVFH 2BMKB 3FQXA 4PB9L 4JFDE 3RKDD 2VLJD 1OP3H 4HS3A 4XPTL 4MQ7B 3BH9A 4JGUA 1CLYH 4U2YA 1MRFH 2A6DA 3IDNA 1LK2B 4OLUH 3MV9E 1WLHA 1UWEH 3G9VA 4L1HA 5ICXB 4YFLF 3AAZB 5DUBB 1MWAB 4M7JH 4QRSA 3AB0C 5IB2B 3L5WA 3MLYL 4P9ML 4QGYA 4P5TB 3L3OB 1FPTH 1JUFA 1FE8L 4FTVD 2WAHA 3RI5K 2J6EA 3WLWD 4HULB 4GW5A 3UX9B 2D7NA 3KHQA 4XWGH 5FIEA 1J1OH 2V5MA 3GMQB 1E4XH 2XYCA 3PQYA 3WXVH 4JFEE 3U2SB 1Q0YH 5J6GB 3FAWA 4LEOA 5ID0B 3DJ9A 4MHHG 1T03H 4Z0XB 2AKRB 5T3XL 6FABH 3O45B 1OTTD 3GBML 5C9JA 3K46A 5IB1B 1SJVA 2XTJD 2XWJA 4NKOA 3MFGB 3ZT7A 2Y07L 3KYMA 3ULUE 5C07A 5CWSB 4GG8B 1NBYB 1L0XA 2R1XB 3QA3A 3HUJA 4OZFA 3KXFD 2VDQH 4ZFOL 1FJ1B 3MODL 5HGAA 4MNHB 4UOW0 4P23B 1FGVL 4W68A 3KPNA 3O4LE 4YEEA 3VD4A 3VGBA 3P4OB 5LWYL 1P84J 1LEKA 2HFEA 3OPZL 3GMMA 3NFSH 4HGMA 3QDAA 4HIHB 3QEUB 4R9HA 3QWQB 1EHAA 3G6AB 5JW5A 3MUJA 1H3UA 1I1YA 4YHYB 3VDBA 4PRPE 1Q9KB 3BVNB 3GZKA 5LAXB 5JUEL 1GHFL 2X4PA 3GJFK 3U4EB 4XH2B 2VR9A 2IEPA 3KYOB 4HUWB 3RWCB 1YEEL 2BOCA 4DW2L 2D03H 3MBEC 5LXGL 3WNOA 4C4KO 4WWKC 1U3HC 4ZSOB 4U05A 2AAVA 3C5ZD 3MACH 4ETQB 5C1MB 2VXUL 3LS5L 4NQDB 2OL3H 1UEMA 2DTML 3CUPB 1SJEB 1AE6H 5ESAB 4S1DC 1S78C 5FM5O 1XCQA 2Q7NA 3H0TA 1YEGL 2C3HA 4KROB 4DKEL 1DBML 3LH2L 3GIVB 5HD8C 1IEBA 4D8PA 4GH7B 5DHVH 1T22A 2D0HA 3PGDB 5A3ID 3VRIB 3GEWB 3FQXB 4MHHI 5KVMC 2R56L 1A6UH 4KK8C 1EBPA 2GT9B 4NN6B 4BK5A 5IOPA 5CUSL 5J13C 3KJ4C 1JPGA 3IDNB 2CLRB 2XKNA 3MV7E 1QLEH 3QIWA 3QZWG 5BVJA 4QRSB 4NM4L 5HYJB 3QG7L 4A2LA 1KCVL 4NBXB 5GZOC 4U6YA 2MCPH 2DI7A 4HXAH 4GW5B 4TPRH 1QRNA 2CO6B 4JFOA 3RQ3A 1BIHA 3LN5A 4NBYB 5CGYD 3RWDA 3S35L 1CU4L 2AEWA 3QHZL 1H8NA 3RVWC 1AGBB 4PRHA 1RZKL 4Q97A 1M7IA 4H1LG 3H7BA 3W0WA 5DEZA 3TN0D 3VCLB 4LSRL 4LEXL 5EFIA 3VI3F 3JV6A 5C9JB 4L4VA 3SDAA 1FRGL 2J8HA 4D9LL 4WUKL 4OAWB 4FQHA 3KYMB 4OD2A 1A3LH 5IT2L 1FNAA 1AGFA 3QA3B 3HUJB 1K3ZA 4OZFB 4J4PA 1KYOK 2IH3A 4B5EA 5I18L 4WO4A 2BSED 3KPNB 4JZJB 3WFBL 1FCGA 4LDEB 1ZT7A 2XXMB 2R2EA 5SWZB 3DO3A 1LEKB 2HFEB 1CDHA 2NTFA 3GMMB 1AQKL 2FX9H 2BNRB 5HHOA 4OZIA 1MIEH 1I1YB 4LMQI 1JHLL 4KQ4H 3UTTB 1HHGB 5T1DL 3V8OA 2EXWC 4QRPA 5KSAA 3EOTH 3B9EA 1JZ2A 1X4ZA 4OM1L 2BOCB 4H26A 4BZ2H 4HAGA 3ARRA 5IV2A 4JPWH 5CSZB 2DYPB 2X6MA 1DBAH 2X05A 1JWSA 1DVFD 5AD0B 2EC8A 1X5IA 5FYKD 3QP3A 5C2UB 4LCCC 4Z7VE 2XIDA 3B9KD 3B4NA 5DJAA 3I3EA 5BV7C 2NY0D 5DUMH 1VACA 3H0TB 2NY1D 1OSZA 5D7JA 2VAJA 2P42B 4JY4A 5ICYA 5DQ9A 5CSGA 4YC2B 3T1WA 5F7EL 4D8PB 4MXQC 1XF4B 1T22B 2HRPH 4P57B 5F9DC 3K0WA 2W92A 3OR6A 5KOVC 3QFJA 1EMTL 1UGNA 5AAMA 2AK4D 4KV5E 1AR1D 4HGKC 1TENA 5IOPB 1YYML 4OFIA 1MOEA 1JPGB 4XVTL 1NGPL 3C5JA 3DIFA 4HEME 4XPAH 3AREA 2XKNB 3QRGH 3QIWB 5FK9A 5ID1A 4P46D 1NEUA 1T66C 3BESR 4KU1A 1HHHA 5ISZE 2XRAL 1CXFA 4MMZC 3V2AR 2WLYA 4NFBA 4MA7L 2F8XC 1MCCA 3VJ6B 3W82A 1E6JH 1QRNB 2LQRA 4JFOB 4NZDA 2FX8L 4GRMB 4G3YL 7FABL 4ENED 3RWDB 5M95B 2EC9U 3DX7B 1C5CH 1VB9A 4UIKH 4UB0H 5KVDH 4XAKD 4PLOB 3QR2A 4N0YH 1IM3A 3VFPB 1BP3B 1M7IB 1JZ3A 2CLVA 3H7BB 3W0WB 3SE3A 4E41D 5HPOA 4LSQL 2HLAB 3O2WL 2HN7A 5EFIB 5TDNB 3TT1L 2NNAB 3L3HB 2FYYA 1MFNA 4L4VB 4WU5A 3J8F7 4JM2D 3SDAB 4XP5H 4HBCH 3DMMA 1LEIA 5GGTA 2R69H 5C0GA 1NDMA 3C87A 1AGFB 1GGUA 4I4WA 5I19L 2AV1B 2IH3B 1P4BL 5TE7L 4Q9RH 3GBNL 5MP6L 1UWXH 3NBNA 1U8PA 1ZT7B 2R2EB 4QGTA 1EV2E 1LMKA 1PSKH 2YN3A 1UCTA 2AJSL 3B43A 2NTFB 4JQXA 3P11H 2NX5A 5IQ7H 2PXYB 4RFEA 2IWGA 5HHOB 4OZIB 2JJUA 1G7IA 1OD9A 2R0LL 3UO1H 1GGIH 1GC1L 5D93B 1QR1A 4KPHH 1PX3A 2ZWLT 4PJDE 5H35A 1IAII 4QRPB 1NCTA 5KSAB 2YKLH 2AJUH 4MX7B 2BOBA 1VHPA 4H8WH 4H26B 2PR4H 4EIGB 3BUTA 3U30C 1WICA 3JUZA 4BQ8A 2WANA 1A5FH 4OD1L 3VWKC 4BA8A 3GJFA 3VGFA 1HHJA 2VZ1A 5KSBE 4U33A 5E2UH 3I6GA 4NC1E 1HKFA 4HDIA 4Z7UA 3EJYD 3P0YH 3PF2A 4PLJD 4QHLA 3V5HB 4X7SH 5DJAB 2F9BT 2N7AA 4HUMB 1VACB 2Z8SA 4Y19E 3RUGB 2J8UF 3GRWA 3I84A 5GGVY 4JY4B 2FWOA 1QKZH 2ED8A 4HXBH 3M8OH 1NEZG 4QHUA 5DQ9B 5CGMA 3Q2CA 3PIQA 4AEEA 5DJDA 1CLCA 4CN6A 4FNLL 2G75B 3QFJB 3EYQD 4KKAC 5HBBA 1PKQA 3WJLA 3AY4A 3S9DB 2V7HA 1W72H 5HHPA 2YZ8A 4Z0BL 1G6RA 1ZLUK 1U2HA 2OP4H 3DIFB 1EFXD 3AREB 3JVGC 1E4XI 1WZ1H 5CJQH 3MO1A 2D7TH 4KHTH 4P2OA 5F3BB 4LLUB 4MAUL 1F42A 5ID1B 3H9SD 5F88B 3VXMA 1HH6A 1MFCL 5J6HA 5J89A 3C6SA 1CGTA 1CFQA 4I5BA 2VLMD 5BS0A 5CHNA 4XB8A 1RZ8B 5T3XE 5L8KB 1ZLWK 5CEZH 4AQOA 4X7DC 3G6JA 3FCTB 1I8MA 1QHPA 3MCG1 5FHBL 1TJIL 3GSNA 3HZVB 2I9LA 2CLZA 4JR9H 4G43B 3KPMA 3SOBH 1KB5L 2HN7B 3C8DA 2F54E 5BW7C 1JFQH 4PIRF 4WU5B 15C8L 3S7GA 3DMMB 1K4DA 4BELD 1LEIB 4OF0A 4FQJH 5EDXA 1KOAA 4GXUM 5C0GB 3DX8A 1NDMB 4I4WB 1I3GH 4WUUD 1YC8A 2ZCKH 1REIA 4R90L 5DI8B 1IGIL 1T0PB 1YPZF 5KZCB 3HN3A 2AEIT 1E28A 1NC4B 5C0CA 3MLTB 4PUBL 1JPST 1ZXQA 2Y4SA 4UTBL 5CAYB 4ZAKD 2BVYA 2NX5B 4RFEB 2AI0L 4ZO9A 4JG1L 5C0AB 2BNUA 4XB7A 1RZ7L 1QR1B 5H35B 1SVCP 1RD6A 3GMNB 1CN4A 2R2HA 1DR9A 12E8H 1FAIH 2P5WA 3FB6B 3VXRD 4JVPA 4JGJA 4S1SH 1CLOH 3GJFB 1MSPA 1HHJB 3O0RL 2CKBL 1F4XH 1U8OA 3I6GB 2H32H 1X6NA 1IAMA 4UUJB 4Q0XL 2PO6D 2WQ8A 3Q3GA 1KLFA 1I1AD 5I66A 4NIKB 3NTCL 4QHLB 2WUBH 3VH8G 2OXHA 5DQJB 5TDOA 5GSVB 1I9JH 4HBQA 2HKHH 4ZOAA 2FWOB 1HNGA 1NL0L 1MY7A 1XGTA 3PIQB 3ZO0A 1QACA 1Z9OA 3T3PE 1UYWH 4EOWH 3C08H 3HS0A 3NA9H 1BWMA 1KLUB 4K8RC 5T5FL 1RUML 5EIIA 1PLGL 3HE6A 4BQBA 5KBNC 5B8CC 5HHQA 1EJ6A 4LLYB 4LP4A 2ZKHH 3SJVD 1V7ML 3OB8A 3NA4A 4P2OB 3AS1A 4OFYD 2VISA 1UCBL 3N1MC 1HH6B 2ICWA 5JO5A 1CFSA 1S7WA 4F9LA 1NMAH 3TEUA 3D0LB 3DWTA 3QIBD 3ARGD 4P3WA 4RAHA 1U8MB 1JNJA 1D5BA 5J12B 1VEMA 1Q9OA 2F19L 5C6PB 5GRVL 4I5BB 5D7IA 4JJ5A 3GDBA 1CF8L 2F8VA 2IANE 2VIRB 3VMOA 3G6JB 3BWAA 1FVCA 3UJTL 1Y6MR 1KF9B 1QSED 2DQJL 3GSNB 3P4LA 4FFWD 3VMNA 2I9LB 3D39D 1CGYA 3KPMB 4OB5L 1X5ZA 1GAFH 1KPVA 3E6HA 3Q5OA 3UPCA 4ELMA 4AL8L 2H1PH 4OZGE 2YA2A 3WE6A 3DHMA 2DLGA 1RUPH 4G9FE 1R0AH 5ELIA 1KCLA 3DX8B 1MJ8L 3UTSE 3LRGA 3TZVD 3EO1A 2R4RL 3TPUA 1MELA 4YO0A 2Z31D 4N9GA 2KKQA 4OCWL 2GTZA 1MH5A 4OZ4A 3GHEL 4MNQD 3CMOH 2FH8A 5FHAL 2NMSA 2SEBB 5M7QA 1JPTL 4HS8H 3I6KA 1KXTB 2A6KA 4R8WH 2HH0L 4KI5F 3ZDYE 3R8BB 2C26A 2HT4C 4X6DA 2BNUB 2GSGA 4X7CC 2XA8L 4JAMA 5JPMA 3U36B 1Q1JL 2W9EL 5IMOA 5D2LE 1CFNA 3V4PH 3ZZ1A 2GCYA 4OCSL 2A1WL 2DMBA 2PTTA 5IM7A 2P5WB 5DS8B 2J5LB 2VERN 3QPQD 4U0RB 4XP4L 4OCYH 1YY8A 3JWOH 5EOQH 5FA4A 2O5YH 1H8SA 3DROA 4NDMA 3Q3GB 4Y4FB 1FL5B 5DGQA 5EUOF 5I66B 4DOHB 4L3CA 4X6CA 3RL2B 2BNQB 4JQIH 2AK1H 3O3AA 3TBVA 2NY6D 4MAYB 4XP1H 1A22B 2YA0A 5C2BH 5IBUB 4IRSD 3HHRB 2NY2C 1NPUA 3REWB 3RFZC 1EIBA 3FAXA 3HS0B 5FKAA 1TZIA 3EDJA 4HK0A 1WTGT 1ZSDA 1PG7H 2EYSB 1YNKH 3FO0H 2B2XL 2D0GA 1XFPA 4RNRA 1HQ4A 3RAJH 3RWEA 3MLRH 1OPGH 2VISB 3T77A 3FB5A 3WS6C 4FXGB 3PGFH 2ICWB 3C6LA 3O11B 5JO5B 1CFSB 5DC9B 2YOCA 2IADB 5JOPD 1D5BB 2EDEA 2C4XA 1Q9OB 4CU8A 4PJCA 5E7FA 1ZT4B 5D7IB 5A2FA 3QCUL 4K3DH 4IRJD 4PJHA 1VPOH 3GSRA 2OTWA 2ZUUA 3HUJF 3HZKA 4FQ2H 4JHWH 4X7TA 2APXA 4HZAA 5AEAA 3X11A 3ARFD 1AXSB 1I75A 1FVCB