4A7TA

Structure of human i113t sod1 mutant complexed with isoproteranol in the p21 space group
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 39
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7tA00
1IBDA 1SRDA 1E9PA 1HL5A 1IBHA 2VR6A 2WWOA 2Z7WA 1IBBA 1S4IA 1AZVA 4MCMA 4BCZA 1PU0A 4OJAA 5KBKA 1Z9NA 3KBFA 1SXNA 2WKOA 2XJKA 1P1VA 2AEOA 3F7LA 2WKOF 2AQTA 2Q2LA 2SODB 2VR7A 2AF2A 1B4LA 1EJ8A 1YSOA 1F1AA 3KM2A 1IB5A 1SXBA 1BZOA 2E46A 1SXSA 1EQWA 1TO5A 2WZ6A 1OALA 2K4WA 3CQQA 4L05A 3T5WA 4A7GA 1JK9A 1OZTG 1XTMA 2AQSA 3GQFA 4A7GF 1F1GA 3QQDA 1U3NA 1E9PB 2VR8A 3F7KA 1ESOA 4FF9A 3HW7A 3QQDB 2XJLA 1YAIA 1FUNA 1UXLA 2Z7UA 1UXMA 2ZKYA 1F18A 1L3NA 2AQNA 2E47A 3LTVA 2WYTA 4B3EA 2GBUA 4MCNA 1SXAA 2C9VA 1F1DA 2R27A 3L9YA 4OH2A 5CU9A 4A7SA 2WZ0A 1TO4A 1MFMA 1PZSA 1JCVA 1OAJA 3GTTA 3MKGA 1E9QA 3GZOA 1HL4A 3GZQA 3H2PA 4N3UA 3PU7A 3L9EA 1OEZW 1Z9PA 1DO5A 1E9QB 1SXZA 2AQRA 1IBFA 1SDAB 1JK9B 2ZKXA 1B4TA 2APSA 2LU5A 1DSWA 5KBMA 1XSOA 2WYZA 1BA9A 2C9SA 1QUPA 1XTLA 2WZ5A 3K91A 3KM1A 2JCWA 2Z7YA 3ECUA 4N3TA 1SPDA 3GTVA 2WWNA 1KMGA 2V0AA 1CBJA 3KH3A 1Q0EA 4BCYA 3KBEA 5KBLA 1OZUA 2C9UA 3ECWA 4U4IA 3SODB 1N18A 2JLPA 2ZOWA 3HFFA 3GZPA 1COBA 3H2QA 1E9OA 2Z7ZA 2AQQA 2ZKWA 2NNXA 3S0PA 1SDYA 3CQPA 4A7UA 3RE0A 1E9OB 1CB4A 4A7TA 3CE1A 3HOGA 2AQPA 3KH4A 1PTZA 4A7QA 1RK7A 4A7VA 1YAZA 1N19A 2GBTA 1SOSA 3MNDA 1SXCA 3ECVA 2GBVA 4BD4A
chains in the Genus database with same CATH superfamily
5IBTH 5HGBB 3LXBA 5CGYC 4ATTA 1RZ8A 3GBDA 5DRWA 5AOLA 3SYOA 1KGUA 1TETL 4RZCA 5KSVB 3B3BA 4MNHA 3OAZK 3KPLB 3KPRA 3KVQA 1CL7H 3O0RL 2AAAA 5AOZA 3JVGC 3MLXL 2BXZA 5TK4A 1NPUA 3FZUD 4U6HB 4UZSA 3VFPA 2Z8RA 3VXPB 1BIHA 1I1RA 3KYNB 3OQRA 5KG9B 1MW2A 4LLQB 3GGWA 1LP9A 3WFEL 1U8JA 2EDKA 4HJ1A 4AQAA 3FCSB 3DOSB 1JYNA 3FC8A 1F86A 5I82A 1FCCA 4WO4B 2YA0A 2A9AA 2DQMA 3UO1H 4A2LA 4UV7H 1D3CA 3BWAA 3U30C 1NFIA 3KLHC 4Y5VC 5J8OA 1WP6A 4MJJA 3LNFA 4I18C 1V3JA 4F3FB 1WZLA 3CXHJ 3FH5A 5IOPB 3AQXA 3O6FA 2IWFA 1ZEAH 3C6LD 5E1AA 3N42F 5F9AC 3S4SG 1AZNA 1E8XA 1X6LA 4L9DA 4NQCA 3MUHL 4Z7VF 3RWFA 1DFBL 4KQ0A 1YN6A 1SFHA 1QPKA 2ZUYA 5DMKA 2AAVA 4LRNH 3CPLB 2QVKA 1AIFA 3QC6X 4XBGA 5CZVL 1J0JA 3O6LL 1Y7VA 5AVSB 4LAQL 2LU5A 1AR1C 3M1CA 2MCPL 4L4TD 1RUQH 4KU1A 2OR7A 3TO4D 3VSUA 1BA9A 4GS7C 4QTIL 5EUKA 5D7IE 4G82A 4S1SH 4ERSL 3RTQD 4FXGB 4A2MA 4PVBA 6FABL 5HYEA 4YOKA 2JXMA 4BWTA 1UG9A 2NXZC 4EXPX 2H0EA 4FFVD 5E4EC 3LQZA 1QLEB 4TL5A 2EEFA 4IS6B 4NWUL 1QLFA 3CVIH 3LXAA 4JO4L 3BKCH 1SDYA 3QS3A 1FO0B 4JPKH 1M7IB 4FQQB 1PCXA 4QNPF 2JB6A 2NY6D 2OP4L 2VLKD 1BJ1H 4NT6B 4XCCH 4BGDA 3QEHA 4A7VA 2ADGB 1B6UA 1M9WA 2WSKA 1JDDA 2V2XA 4WKXA 4U1LB 5CZRA 5C7ZA 1JRHH 1VKXB 2V8MA 1XSIA 4QXTA 4Z7NB 5KYWA 3ULVD 4ATWA 3ULVL 1M3IA 1T83C 3SE8L 5KEZA 3MLWH 4FQ2H 4Q58C 3UJTH 1ACXA 3H3KA 4XPFH 4ZFFA 5DJ2B 3G6DL 1ZXQA 4G8FB 5LN4A 2O6DA 3PDOB 2OMYB 1XGPA 4IMKA 3X1NA 1IZKA 4X7FC 1HXYA 2MHAA 1MRFL 1YNTA 2ICES 5ALCH 1MY5A 5JHAA 3WIAA 4Y2DD 3FONB 1QMUA 2WNKA 3MV01 4B0MB 3TA3B 3Q6GL 3JWOC 4M00A 4H25B 4NQDD 1AXSA 2H6PB 1U33A 4NOBA 3D18A 1ACYL 2H7WA 2DW5A 3C2AH 4M7ZB 2E8YA 2F9BT 1FA4A 1XAKA 3FQNA 1AY1H 4J8RB 4PJ7E 3WFBH 1OZTG 3JT2A 2FQEA 4WO0A 2CLZA 4NKIL 3BP4A 1H3GA 2NQDA 5I6XC 5DJCB 1BXUA 4R4FL 1QW9A 5D7SH 1QSFD 4FF9A 5EU4B 2OMVB 4U7KA 2OL3H 4PJGE 4FQIL 3BVNA 1U91B 2TSBA 2H1XA 1H6EA 5GZNA 3VE0A 1KXTA 4NQEA 3IDMB 2CKNA 3A22A 3LS5L 3QHZL 2FO4B 4HPOL 3WDIA 1N5YH 2XZQL 4ETYA 5D96B 3MMEB 1LE9B 4JPVH 2HAZA 5FFOA 2X10A 5TPWL 4ZZKA 2VSKB 1NUFA 5LGJB 3GZOA 2Q1EA 1JDCA 1KGIA 3PWLB 4RGOH 3I6LE 4OZGE 3H85A 3UZQA 4LASL 3VWKB 2E9BA 1A3LL 4JY5H 4CVXA 1NLDL 2EVIA 1KJ3H 3FB5B 4PJDA 4QAMB 4CSZA 1IGML 5EZLA 1JV5A 4YDMA 2HJKA 2R51A 1W8OA 3OKLB 2XKUA 4MCZB 5F1KC 3QCVL 5FECB 4Z95H 5EBMB 5EFIA 4OI9A 5IOKA 4ODTH 1FV1B 3MV9B 4GINA 1OT4A 4GSDL 5IB2B 3HIZA 1KXQA 2IF7A 5SWSB 4DNLA 4ZUTA 4QGTA 4GOSA 1MIEL 1UD5A 3B7RL 3VGHA 1D5MA 3ORJA 1LNUA 3REVA 2VQ1B 4L3FA 1AZUA 1O6SB 2O5NA 4UM9B 1QFHA 5H35B 5E9DE 4PVNA 3QUXA 5AKTA 2CGYA 1P4IH 3RZWA 2DQFA 1CXLA 3GSXB 4KX8A 3R8QA 1ETB1 3D07A 4OF3A 5ES4B 1GTFA 3J27A 1IX2A 3HTLX 5DD3L 1SMOA 2EADA 3MV8D 4JFZH 4K5PA 4GSRA 3L2MA 5IWLA 1JPGA 4A68A 4BFFA 4YK4C 3O2VH 2P5EE 3GIZL 3HC4L 2EKSA 1CF8H 5LO7A 3ZTEA 4B53A 5HYJA 3L2LA 5J12B 2YD3A 5J1SC 2BSSA 2P45B 1NEZG 2AV7B 4QCIB 4MVBD 5D2NE 2D0HA 4PJ5E 1GHFH 1BBJB 2EC8A 4EXKA 1ZE3H 3V55A 4Q97A 3K2UL 3TZVD 3CHOA 3LYRA 2AK1L 4ZMZA 2PTUA 2WCPA 1TZGL 2VLRA 3D25B 5JQHC 4R4BB 3T65B 1YECH 5BPPA 2X44D 4J8QA 1PQZA 3MLYL 2NTSP 5TFSL 1S7SB 4GKNB 5DC2A 4EN3A 2X05A 1CLZH 3QUYB 3DXAB 3O8XC 2I9TB 1H3XA 2XU9A 1DSYA 1NINA 3O9WD 4J6RH 5K93A 1XR9B 4X9BA 1BP3B 1U42A 1OIOA 1WBZB 1T3FA 2CCLA 4LNRA 4XCFL 5FB8A 2MKWA 4MD5A 4OJFH 5JIMA 4OH2A 4ALAL 5L8LB 3P73B 3W0WA 1WTGT 1MCDA 3U46B 3P4NA 1RLBA 1NLBL 5GPRA 3WJLA 2BNQE 2WLLA 4M8UA 3WMSA 4L8BB 4YDIH 4ZFOB 2OJEA 4AGMA 4BKLB 4H8VA 3VJ6A 2HT2C 1MAML 4L3EE 3PXLA 5EU3A 4EUPA 3MV7D 3T1FB 2FHBA 3DV4B 2GCYB 2ZG1A 5D6DC 4QJ4B 5AOKA 1AYRA 2GHZA 2UXFA 1WGVA 1W0VB 2B1OA 2QGEA 2YGPA 4XP9H 4XZUB 4RRPM 4DUWA 3AT8A 2JNZA 1J1XH 3UYPB 5D71H 3QIBD 2VWEC 1WGOA 3WFDH 3H55A 2PPFA 3S96B 3KPSA 2AJZB 2IPUK 4MHHI 4CDGC 2KPWA 5ESQA 2DQEH 1Z1WA 1IQDA 5JIKA 2ED8A 1R34A 1M6OA 3QUZD 4XPBH 3U1QA 2EAEA 5JHMA 1U8HB 5DEFB 3OPUA 4U0RC 2OK0H 3HOGA 1W72L 5AENA 5SWZE 5DHYA 2R83A 3IDXH 1QR4A 4JHWL 1UOWA 4B95C 5FW8A 3M17B 3KJ4B 4HX1A 2QV2A 4JFPB 1O6TA 4JX0A 2PP7A 2E86A 2YD7A 1CLCA 4X6FB 4Y4KB 3WS3A 2V33A 4M02A 1SJHB 3KXFA 5JPMA 3IJ8A 4N2NA 3GBMH 5DUBA 1V55B 1BVNT 1G4RA 3FZUC 3EXJA 1M56B 4LLAA 2OSXA 3VGAC 4NWTL 4IBQA 3S34H 3KPQB 4NN7B 4CKVX 4AE0A 1HTYA 4HKBA 4X0KA 4ZNCD 4FADA 2WO4A 2B7DT 4CMMA 1HSAA 2D3LA 2AQTA 2NSXA 4AKPA 2VDML 3FTSA 3E0GA 4ZW5A 3NABH 4PIRF 3QWOB 3FU7A 4JDEA 1KN2L 2WB1A 1IB5A 5DGQA 4GW1A 5L2JA 3HPLB 5D5MA 2NZ9D 3GUTA 5B3JF 1VGKB 5CIPB 2ZOKA 5ALBH 4HGKC 1QYGL 4K3JL 3VU1A 4ZO7A 3TJEH 4L2YA 3QPQD 2L4OA 2BRRH 4J39A 3RDTC 3F7YB 3BJLA 5DVKA 4AGQA 4BSVA 2YD1A 2HX7A 4LIQL 4JRFA 1F11A 1NZRA 1P6WA 4X6DA 1EHNA 4WWKB 2ITDA 3C6LC 1U95B 5F0JB 4WV1A 5IMKA 1CGWA 4JVPA 2R7EA 2G75A 3QEQE 4N2GA 5D72H 1B2WH 4UNVA 5C86A 3ESVF 2XN9B 2Y6TE 5DJZB 5BRQA 1WA2X 1DN0B 1XGUB 3ME0B 3E6HB 3LVTA 3VX1A 2YUZA 1KIUB 3BKYH 1LLAA 3B9KA 2PYEA 2H6UA 1ZT7A 4OZ4A 4PJFF 5HDQH 1T20B 1E65A 1U3HB 3TO4C 4R26H 5B38A 1KLUA 5K33A 3QRGH 4JCWA 2Y07L 5DEJA 3A6OA 4XP4L 4CKQA 2OMWA 3P0YL 2DRUA 3RTQC 1U8KB 2I7OA 1AGCA 2C9SA 5BZDA 1EHXA 4CGTA 2QQKL 1LM8V 5EIIG 2ESVA 2FIRT 4QRRA 1DEEA 4YGAB 2QBWA 3V52H 1OCRB 1FAIH 2PWDA 3T6WA 3MLTB 2D0GA 3AU1B 1YCSA 1KIQB 3FB6A 2NY6C 1YN7B 3VXME 2J88L 2UWEE 3F00A 3ZDYE 1I8LC 5TK2A 3ZMEA 2ZT9C 3HVNA 3ULVC 4RAVA 1TVBA 3TS8A 1H5BA 4F20A 3MNDA 3NRQA 1FNSH 3H7LA 5I16A 4M7JL 3MGOA 5F88B 2FVNA 3QFDB 1OTTD 4FXKA 4LKXB 5ICYB 3N43F 4BE5A 2BWDA 1HL9A 1GL4B 5ACMA 4JQIA 2ERJC 2VR6A 3LKRB 2XCMC 1LILA 1BVOA 3ZKXC 4WI3A 1UD4A 2FHCA 4Y2DC 5F72S 3LZFL 4G8GD 4QKXB 4MNHB 1CFNB 3GPSA 5JIHA 3BQVA 3V5KB 4HU8A 4YVUA 1P1VA 2IH9A 3MBWB 2HFTA 2GPZA 1B4JL 4HJUA 1SJVA 3BLKA 5E08H 4WVRA 2CHDA 1SEQL 4U6VH 3FBQA 4Z7QF 3UTTA 5IKCA 4OBSA 1L7TL 3EHBB 1BYOA 1QVOA 2WZAA 4POUB 3QFJB 4G7VL 4ELMF 2QSQA 5GGVL 4DZ8B 1MI5B 1ZOXA 1LP9B 4N9OB 4NSKA 5GIRB 1ZVYA 1J0IA 4AQAB 4I48B 4P2AA 4DN3H 1S7XA 1FL3B 4ILDA 5C0BD 1WITA 4P3CL 1F3JB 3LEYL 1UJ3B 1WD9A 1RZ7L 5I1CH 3EYSL 3HS0B 4UF7C 2WYHA 2YJQA 1WIPA 4B41A 2WINA 2VQTA 1EAOA 1NFIB 3BAXA 5MI0B 3GMQA 3L9YA 4Y2LA 3WD5L 3JWNE 2BXYA 2Z4QA 4QXWA 3O6FB 1CU4L 1Y0LA 4BK8A 3N04A 3N9GH 4WW2C 1RZGA 3T09A 4Z7WE 1JN6A 4EIGB 1KJMA 1Y6NR 4IBLT 1LYQA 4PLJD 4WHYG 2AJVL 3RWFB 5I1HL 3S8WA 1UEMA 3X12A 3EOAB 1JGDA 2GUOA 2VXQA 4FE9A 3W5MA 2OS7A 5FAAA 5DMKB 4FKKA 1EEZA 2LOEA 3EH1A 1WAEA 4YPGA 4XXCA 1DSWA 5IW6B 4TSBH 4XBGB 5C0GB 1AZCA 1A0QL 2WYZA 1IM3B 3UYRL 1D6EB 4NYLA 5E4OA 5IJVB 2YAMA 1JJUA 3Q6FB 5KVGE 4PP2A 3R0MA 3ZL1A 4ZSOB 2EJ1A 4UOJA 3UG5A 4GP5B 4JKPH 1BMGA 2O5XL 4P5TA 3D3VE 3SCMD 4HSCX 4JG5A 1OB1A 4IMLB 1ZAGA 2CZNA 5EUKB 1U8IB 4ELKA 3DSFL 3QJSB 1XF4A 4WUUD 4D0DB 2XYCA 5FFLA 1COBA 3SJVA 4RGMC 1CICD 2DBJA 5C08E 5B1AB 2W0KA 2NMSA 3QJOA 4HWBH 3SD2A 3O11A 3LH9A 3O41A 4RISL 3UTPE 4EUPH 4ONFH 3LPWA 1QLFB 1MJJB 3IGUA 1ZLUH 5KVMC 2H1PL 1NCBL 1GGBH 2VH5L 4JRWA 4J3OD 4L0YA 1YAZA 5FGRA 1FYTE 1BCIA 2FQGA 5FM5O 4J6IA 2LTQC 4DKDC 3FUIA 4FKHA 2YBRA 5K5YA 4NC2B 4JFQB 3TZVC 2E6QA 1E9PA 1MF2H 4IKIA 2BIMA 5KYWB 4JUTA 5CZXC 4A6YL 2FO8A 3BISA 5DJYA 4Z7OE 5IMMB 3SY0A 5ADOL 4HEPG 4J3SA 3X3FH 1U8PA 3S8GB 4OVVA 4BV1A 1UCBL 5C0JA 3OKNB 5E94B 4PB9L 1XGPB 2R2CA 3A4AA 2YN3A 4P04A 1YYLL 5EU6B 3RNKA 3RGVA 2MHAB 1IGTB 4NUPA 2NUTA 4LZKA 1AG0A 2FX7L 2OQJA 4RESB 4RWHA 2Y2TA 3UO8B 2Z8VC 3EOYG 3OJMB 5DD0L 4M62H 4M43H 3LEVH 1D7BA 4CC4C 3VG0L 4AMKH 4DGYL 4E9LA 3O9WC 4YSAA 4HETA 3MJ6A 2WZ6A 4I8DA 1A9EA 2J5LB 2MPVA 4P0DA 2EH7L 1WO2A 1P1ZA 1ZK5A 2CM5A 3PY9A 3FQNB 5CEXB 1Z3GH 3IN2A 1R3LB 3SN6N 4ALAC 1UOKA 2CLZB 5GS0H 4GKLA 2ZSVA 1X9UA 2FJUB 1B6DA 5DHVA 5DYFA 1X5XA 3IE9A 3VRLF 1A66A 3TCLA 4X6CE 3BVNB 1L0XA 1GGCH 2YXWA 5EG6C 4HMEA 2LR4A 1IM9A 3K6IA 4UINL 4NQEB 3MACL 5IQ7L 5AZ2H 4FC3E 5C0IA 1G6RH 4I87A 2BJML 2F0CA 4R5XA 2Y36H 1AD9A 1FJ1A 1HQRB 2GJ6E 3QA3B 4JZJA 4Y0GA 5I1KH 3BGMA 2AXGB 2CR3A 3VFRA 4IKKA 4KZ0A 5KW9L 3DIFA 5K9KA 5DMIH 2MRYA 5DLMH 3BIKB 2HTKD 4UT7L 3N50A 4FYSA 1UB6A 2IAMD 5DQDL 3ZT5A 3NP3A 1X5IA 3IJSB 2XZCL 3H6AA 4D0CA 1CDHA 1V7NL 4DHLA 3KS0H 3SDXE 1RZFH 5IW3A 2A9DA 4JM2A 4PJ9D 4JRXD 3AS0A 5GGUA 3QUZC 1XXFC 5EFIB 3CFJB 3F5WB 2QKIA 1N18A 3I9IA 2AHIA 3ZDZB 4XN1A 3NGBB 4GB9A 3D52A 3QQ9D 3T2NL 2ZAGA 4B9ZA 1D5MB 1LNUB 3QO1A 5CP3A 1CN4A 1NKGA 1A1OA 2DQUL 3P1VA 3GMRA 1HL8A 2E74C 5E9NA 3BGAA 1IBGL 3DIDA 5DJ8B 2VDNH 2B0SL 3G5YA 4QUOA 4NI3A 4LCWA 1Q9WB 2DQFB 5EIIB 2VR3A 4KXDA 3QXUA 3AG2B 1QI5A 4XCYA 1B90A 1VGEL 4MNQE 3QRBA 2G60L 2Y1AA 3C5XA 3VXSD 2WGNB 1RD6A 4JO2L 4X80L 4NO0A 3U6XS 4ADIA 1JPGB 4DKEL 4E9SA 4NGHH 1JHTB 3TT3H 2H26B 3S37L 4MCMA 3DOIA 2V4LA 2X89A 4XP6H 5LAXA 5EO0A 3NFSL 4J3XA 2C9RA 2OSYA 3B7TA 3IE4A 4LKCA 1I9JL 1J48A 1MWAA 4HT1L 2FDBP 5DRXA 1FH5L 2OTUB 4W9CC 4BQ9A 4DF9A 2FBRA 2FJSA 2NZ9C 4JPIA 3UJIL 3ARSA 4TQPA 3QPQC 3U9UB 2VLRB 1TPXC 3OKOA 3ZPDA 3QIUA 2WVVA 3RL2B 1QSVA 5A3ID 1NC2B 4X8XA 4JQIH 3TBYB 3US1A 1F6FB 4NKDB 3BUIA 1G4MA 1PQZB 1JNNL 1PEZA 1FCGA 1I1AC 2WTRA 4NN6B 5BQ7A 2VDKB 3VTMA 5J0BA 1PG7X 3PS6A 5FYJH 2UY7A 4AYDC 4HS8L 3OAYK 1AO7D 3VDCA 1HCZA 3RWGA 3I9AA 3QGVA 4APXB 2JCCA 3SDDA 3K74B 4X7SL 1T3FB 4ZPVB 1FL5B 1KOAA 4QGYA 4LQFL 1UYWH 3CG8A 3K6OA 1NCJA 1OAUL 4KJYB 3D69A 3KL5A 1MHEA 1OAJA 3NACH 3W0WB 1HKFA 1XXDC 3HMWH 4KKQA 3SQOH 1BVKA 4NDMA 2ZSWB 4PJAA 2WLLB 3BKML 4FQLL 2NX5A 5E6UB 5GS2D 2KLRA 5C3TA 2HVKA 4KZCA 4NP9A 2NQ3A 2FEEL 4XHQA 5F1IB 3HE7A 1HI6B 3LRHA 4HF5L 2Q6WA 1GC1H 2VXSH 3CH8A 1IU1A 1KLGA 1X7QA 3LDBC 4EUPB 4L8SA 1N3NA 1ZIBA 3TONA 2R0LH 2FB4L 3DV6A 3EF7A 4LRIC 1H3PH 5FIEA 3R7QA 1UGKA 4OI8A 1SOXA 4OZHA 5F8QC 5ADPL 2X4PA 3ULUF 1YEDB 2HFFA 1X5MA 1FIGH 3S97C 1PPIA 5HI4D 3RWHA 4AW4A 1FNHA 2UUDK 4OT1L 3ZE0B 5A6MA 5ESQB 3WTVA 5J13C 2HRGA 2MKLC 3UAAA 3IGLA 3CN0A 1M6OB 4BZ1A 4YHLL 2F54E 1ZKAA 1WBYB 2WLIB 3L4XA 4Y5XC 4U1MB 1R24B 5AW2B 1Z5YD 4LSQL 4OGYL 5DHYB 3ARED 2DLFH 1JZEA 2GK0B 2HRHA 3SOBL 2IOMA 5DVPA 5HHPB 2UY6B 1UKSA 3MN8A 5IVZA 2OI9B 1HCYA 1E4WL 1UWGL 1VIWA 3KXFB 4QTHA 5J9PA 1J9SA 3B2XA 5DUBB 5F3FA 2X3CA 3W11D 1HCFX 2XWTA 5ILTH 1TTFA 4BSJA 2R59A 2FBOJ 5D93B 1J18A 1FSKC 3MI6A 2XTJD 5E8NB 1EZSA 3SDYL 4CMMB 1NPNA 2BFVH 3HJ0A 4Z7UA 3TJHD 3P0GB 1P9MA 3WO4B 5T1JA 5T1LD 1ZA3A 2TRYA 2QDVA 5DJ6A 1JBJA 4GW1B 3ABGA 3GUTB 5IMLA 1N67A 1JWSB 4JQXC 2P28B 4JREB 3UIZA 1M71A 5J11B 2JVUA 1LD9A 5AYQA 3FB8B 4WW2F 2P8LB 1BDYA 4CVZA 1OAQL 1MAKA 1ET8A 1F11B 4U31A 4DN4H 3TLRA 1V8HA 2YGQA 2ITDB 5C2BL 2DQCL 3GJFB 4IDJH 4PG2C 4GI8A 4K73A 3FB7A 4WV1B 2EE6A 1ROCA 4D0BB 3S6CA 4PLJC 3ZKQD 1PAMA 2CRYA 3VFTA 4ZFGH 1HE7A 3FSAA 2QHRL 3D39D 4K4KA 5IF0A 4UBDD 4XMTA 5JHBA 1YEWA 4PJ7B 1ZT7B 4OZ4B 2IMMA 3U0WL 4X8GA 4QHNA 3ABKB 3K6NA 2CRMA 4U1GC 1SVZA 5DHVH 4GRLB 3SCMC 1KLUB 3QAZC 4WFHD 3OZ9L 4A67A 2X4TB 4RGNB 5HDBF 4PJGB 2GJZB 3IJEA 4DGUA 4UTAH 4K3EL 3PIQB 2G9KA 5DC9B 1ORQA 2EICA 5TE6L 1AGFB 4PG9A 4Q6KA 4EDWH 2Q87A 2ESVB 2OXHA 2ZOWA 3ARGD 4AGOA 4YGVA 4DQOL 4N0UE 2O1AA 4PREA 4DKAA 1N6VA 2IV9A 2Z7ZA 3O0LA 4J3OC 2XQBH 1HNGA 2YQ3A 3DI2B 3HEIB 4ORGA 2P80D 2CO6A 2WQSA 3UTSD 3FW6A 5LGHL 4JFOB 1YQVL 3P3TA 3WFHB 3WO3B 3ATFA 3M1OA 4UOW1 1KTKE 1IV8A 4MJ4A 2QT6A 1ZWIA 4RAHA 1J1PL 3M45A 3OAUH 3KDPB 1TVBB 1ECYA 3GLAA 1PW3A 1RZKL 4Q9QL 2BNUB 2VDQL 3MGOB 3EGSA 2C9XA 5KYUB 4ANVA 3GBNH 3HHRB 3T0EB 3AXLB 4R4ND 5AW8B 3ARVA 5K9JL 5AB1A 1XBRA 5FYKD 5CP3H 4MAYB 5FYKL 5F7DA 2EDLA 3NAAH 1NAMA 2J7LA 2H0FA 2F18A 4AYGA 3KPMA 3I3DA 1F4AA 1H9VA 1SQMA 4WGKA 2N01B 1XEUA 3TASA 3TBVA 3CDZA 1DLFL 4JHZA 4DFHA 1AC0A 5DR5L 4NRXA 4UAOB 1A7RH 3QQ4A 3WTTA 3V6ZB 4MXQD 4JR9L 3TF4A 1CZ8H 3ARDD 3DX2A 3R06A 4GMSL 1YY9D 5GGTH 1RP9A 2P5EB 3CVDA 4XP5L 4AZUA 1HWWA 5F89A 6PCYA 2KPNA 3EBGA 1ZTXL 4KHXL 1DJGA 4GIAA 5DZVA 5CD3A 1ZGLA 1B0IA 2FT7A 2ZWKA 3U0PA 5IJCC 1K6QH 2QLVB 5IIEA 5IBLC 3LTVA 2VZOA 2AQNA 3MODH 3RYMA 4AJ0A 2XRAL 5A2AA 1N0LB 1P4BL 1AQMA 4Z7VA 4HLJA 2VC2B 4XE0A 2C1PB 4ENZA 1W6LA 4GW4A 3WN5A 4YHNB 3RNQA 3JWNG 1PDKB 1RZJH 1RZGB 2WLHA 2HTKC 3F83A 5GSRB 2AK4A 2IAMC 4YDZA 1IL1A 2E7BA 2FLMA 4WQOA 5JW3H 2WAHA 5L8KB 1IJ9A 4NLAA 4FQ1H 2D8KA 2DQJH 4LLWA 4RX4D 2GUOB 4PJ9C 4BZ2A 2JB5L 1CO1A 2IADA 1EEZB 1NFDF 4GQQA 1AVAA 4L9LA 4S1RH 3Q1EA 2AJUH 1I3GL 4R96A 3WKYA 3WNNA 5AAWA 1BF8A 1AFVL 3DGDA 3ECUA 3QQ9C 4LFHG 3RB5A 4NO3A 3FNKA 3IXAA 4LSRH 1PNDA 1VDGA 1ZHLA 4DGWC 4P5TB 1T03L 4MJ5B 2BM3A 4M6MH 2WOYA 5FM4A 1J9CT 1NUNB 2EH8H 3FXIC 25C8H 3EBAA 1ZV9A 2DDQH 4AEHL 4OCYL 3KNBA 1TUPA 5ICUA 4I3RH 2IO5A 5LXGL 2NY0D 5IGXH 4OQ1A 3O41B 4H2AA 3POHA 3MRPA 5I71C 5F0LB 1BZ7A 5IB5A 1AQDA 4GJTB 1SLVA 4NQTA 4LL1A 6CGTA 3AITA 3KGUA 4NB7A 4PW4A 1INEL 3D12B 2D2OA 4OQTL 3U0TA 1LDPL 1RP8A 4DP9X 5KJ4A 2CHWA 1W8NA 3W56A 1Z2KA 5B8CC 1CJYA 1NM4A 3AQDA 1B0WA 4DESA 2JKLA 5FHBH 4M6OL 4CUCA 2DM3A 3Q5OA 1F3RB 3OB0H 2GY7B 1LTXA 2X70A 2YPLE 3L6FB 3E9TA 2F1AA 2XWZA 3O3BA 1E4KA 2Q2LA 4KDWA 3H3PH 5ICXB 4ETQA 1QFUH 3RWDA 5A3IC 3MBEA 3B83A 2Z8WC 1J8HA 1EVUA 3HFML 4TQIA 3RX7A 4ICWA 4BK4A 5JOPE 4HXBH 3LNHA 4Y4HA 4P23A 3K1DA 3RGVB 4UILL 1ZVSB 1CDUA 4M4RA 1PAZA 2NUTB 2QPDB 4PRPA 3ZLQC 3MRLB 5EEZA 1A7PH 1OALA 1TQWA 3CQQA 1GYAA 1ZLSH 2HMID 4M4PA 5LJYH 1D2PA 3BDYL 5GS1C 5C0RL 4N2CA 1IGCH 3KVDD 1A9EB 4R0LA 1MEXL 1CBVL 2ZCZA 1X5HA 1SBSH 4V2BA 4AZ8A 4Z76A 2WLNA 1HYSD 2AI0L 1OTSD 5AVZB 5F6IB 2UZIH 2PXYB 5CBAB 4MCNA 5HJBA 2NNAA 3IBOA 3B43A 1F1DA 5DHVB 5K9OB 1HJCA 3EYQD 2Q8AH 3DO4A 5T5FL 4EQ3A 3T8MA 3CHPA 5DSCB 5CJBA 3ZDXE 1JTOA 2IQAB 3MRNB 3WFCH 3DX8B 1NKOA 3RA7H 4XPTH 3CFDB 4J28A 4OUOA 3MRRA 4OGAD 1Z9PA 4JZJB 1FJ1B 1J7VR 4TF4A 5L9DL 1SYSA 1DL7L 4F93B 3MRJA 2HFGL 4G6AC 3VFRB 5BZWA 1MFAH 5J1TC 4QXUL 1ZT4B 1YEFL 2YZ1A 4QMEA 1JVOA 2CKBB 3DIFB 4YXKH 1MRCL 2VN3A 3CZJA 2XYBA 3NIGE 3BESR 4LPWA 3QEQB 4HHWA 1CD1B 3MJWA 3PWPE 3CZEA 3UBXG 5HI4C 2X1QA 2XLLA 4FFTA 3TIDA 1SFDA 3U2JA 3A6BH 1G1OA 1NKRA 1H0DA 1K2DA 3H2QA 5GGUB 1H19A 4LMQI 3QHFL 3US9A 2O5YL 3VW3L 4WF7A 5C0CA 1JZ5A 4HZ1A 3GXDA 3POCA 1CB4A 1NBVL 4R5VA 3T0DA 3AREC 3FO2B 3FTGA 4Q89A 4H40A 5FV1L 1FZKB 4XMLH 4HCGA 5CUSH 1RI8A 2GSIA 5JHDA 1BGXL 3DK0A 3SEPA 3R18A 3P3SA 4NZTH 1E30A 4NIKB 4I77H 3GSQA 3MREA 4U3SA 1HEJC 3W11C 2J1WA 5CWSB 2QSCH 3LN5A 1NFKA 2BOCA 4IBUA 2HZHA 4KX7A 3ISWA 1SDDA 1M05B 4GBXA 1KIRA 1NCWL 2XTJC 4Q4EA 5MEPB 3BE1H 3TA3D 1NH6A 3LV3A 4OGZA 5LCVA 5FWQA 3TJHC 3FN0L 1LE5A 3BFOA 2XETA 1WYJA 5EO0B 4PB0H 5L2KE 4NUMA 4LKCB 4JG0L 1MWAB 4ISVA 1A7QH 3A67L 4IJ3C 3UACA 3OV6A 4FFWD 2KMWA 5DRXB 1F58H 5FO8A 1JHKH 4IOIA 1EERB 2BZDA 4NP4L 3VXNB 3IDNB 1NTDA 3A3YB 3EUDA 4HEMA 4LPYA 4MS6A 2VQUA 5HYJE 3DX0A 3FQYA 4OLXH 3V79C 3OR6A 3O4LE 3AM8C 1F1GA 1GZPA 1EVTC 3GM0A 2OMUA 5BV7L 4RMSA 5KYYB 3Q1SL 3INUH 3N3EA 3NFPB 4X7TA 4CU6A 3FN9A 4AT6A 4XNMB 2IH3A 2WJ5A 5FKPA 2OX5A 4Z0XA 1IARB 2OMZB 3ILDA 3BCDA 3RWGB 1DANT 3BO8A 3BLPX 4E5XB 1NDGB 2CIKB 4MXVF 2OJZH 1AGEA 5KSBF 4U6XA 2JCCB 4UBDC 1KFGA 2UZXA 4XHJC 4MMYA 5F9JB 5C0DB 2AABL 1KTLB 3MJ9L 3VWKD 1JUFA 4EZJA 4DP4X 4LSDA 2P8MA 3GSUA 3OHXC 3D69B 5HYQB 4L48A 4G6KH 4X8JA 5K39B 4TPRL 4WFFE 3PG2A 4B60A 1BVKB 3MUJA 3CUPA 2ZQKA 5GGQL 1D9KA 4ZDHA 3VI3E 4MJHA 4QXVA 1J5DA 1RZQA 3SKOA 2FE0A 3U9WA 4KQ4H 5EUOE 3N2JA 1TVDA 2RCSL 1LMIA 3HE7B 2QADB 1QUPA 2Q6WB 4J3OF 3ARGC 5EC2B 4BZYA 2UX6A 3X1FA 4JFHD 5E2VH 5MENE 4MAUH 2V2TA 1N3NB 1AP2A 5KVFH 3VNZA 1WAAF 1A7OH 5A2LH 5I66A 2NDFA 2VMFA 1DZ0A 1J0ZA 3L2NA 2YPVA 3DV6B 5TF1L 2GITA 4DO6A 3WNJA 3D06A 2L0DA 1EFXB 1I75A 3MLSH 3WU1A 2X4PB 4I0KA 4RAUA 4X99B 4N8CH 2OAAA 2HFFB 1U30A 4OIIH 5JIIA 4TNGA 1P7KB 1S9YA 3RWHB 4BZ2H 5I1GH 4ZI8A 4ZS6D 4IU3B 5C1MB 1HT6A 1RZKC 3AFLA 3OWEA 3WAJA 3JVGA 1G1KA 1M1XA 5DURB 4QRPE 1M7DA 4R4NC 3CH1A 2MQ3A 5DS8B 1EK3A 4PS7A 4MXWH 3TPUA 1S7VB 1NUGA 2H3KA 4JZOB 3KPSE 3D3VB 3DGGB 3LKOB 1DJSA 1I4FA 1N4XH 3MA7A 3RUGB 5DFVD 4QKTA 1CLVA 4TQEL 5AG8A 2X4SA 1N2RA 2WCGA 2D03H 1KJ2A 1KTDB 2DZEA 5IVZB 3RTLA 3UIYA 1JZ3A 4AVIA 5GS3A 3FT3B 3SKJL 1DANU 2EDEA 2QLYA 3UBGA 2YMTA 5J9PB 4JKWA 4RLDA 3J2PA 1MOEA 4W4NA 4FYTA 4ES9A 2I9LA 3SIKA 3ARDC 2KL6A 2PYFA 2FECI 1YY9C 5IFHL 4Y5VA 5GISH 4AEFA 1AHMA 1GRWA 2CLVB 1EZUA 2HLFD 3NJGA 4I18A 1FYTB 3DXAD 3NJXA 3RG1C 5LG1A 4Z7UB 1OQOA 1JYWA 3SBQA 1FDLH 2WN2A 2LFEA 3CC5A 1U3NA 4XT1C 2H32H 1L5GA 4ZMVA 5IMLB 3AGWA 4JNXA 3AG4B 4YUEL 1SM3H 4P2CG 2HP4A 5E4IA 1FVCA 2WLMA 4KXZH 2H8PA 3X3GH 2FWSA 4TS6A 1L3NA 2WQVA 1QZ1A 5AW4B 4JB9H 1FZOA 3HB3B 1ICTA 4ZTPH 4HZLB 3WJMA 4ZFOL 3CDGA 2VMJA 2K7PA 2XIIA 3FB7B 1I9IH 4UANA 5AW0B 1HHGB 3ZHFA 1KBGL 4PJFA 1HJBC 2FEEI 1MPAH 3KJ6H 4O9HH 3NZHL 4Y9BA 5LLIC 4ZW8A 2FJFA 1QFWL 3PL6B 4HUMB 1LO5A 3DC0A 4AJVA 1CGXA 5FWRA 4XTRD 4BKSC 4W9HC 4X6DE 2DM4A 2BIPA 3B56A 1E3FA 2IDFA 3I50H 3STZA 1FFQA 4KNSA 2XTLA 3GRWA 4CGUB 5M95B 5IB3B 1IKOP 1YJDL 3FH7A 4LPTA 1IC7H 4XNXL 4X6CB 3GTNA 4NUGL 1U6AH 2EQDA 2X9ZA 3IJEB 5DK0B 3B6SB 1OM3H 3NIFF 4MQXD 1MHPH 3VH8A 4N2LA 4HKZB 4K5NA 2PR4L 4NZUH 5HJ3A 2DB8A 1K5NB 2NY0C 4OKVA 4PG9B 2YUWA 2EDYA 4JFED 3TOPA 5EF2A 5TGBB 1J05A 2DWYA 1T83A 2UZYB 3QZNA 4JG1L 2BVQA 4HW6A 1SYVA 5I76B 4ZBJA 4AVKA 4ORGB 1RHHA 2XN0A 5F7NC 5EU5A 3WXVL 5KVDH 3CVBA 4IIQB 3ZHNA 1C5DA 3F7VA 4FTVB 4Z3GA 2SEBB 4W70A 1I8MB 3FHEA 4U4BA 5FCUL 3PAYA 4PRHA 4Z8FL 4MNGA 5MEOA 3OR7B 1KGXA 3QR1A 3UC0L 5KSUA 1DQDL 5FA3B 4NQUA 1NSNH 3L1OH 3L1FA 4F2ME 5L6YL 2ZCHL 1T4KA 2DM7A 2DQDH 3CX5J 4DCQA 3I75A 4YSDA 2YD6A 3UC2A 1ONQA 4PRNB 5F7DB 2WUCL 2W5PA 3HG1B 5KAQF 1NAMB 2R0KL 4B9YA 5KVEL 3KPMB 2F8VA 2HMIC 1JF1A 3FAXA 3B4NA 4ELMA 3TBVB 2Y3AA 5KJRL 3QQNA 2BDNH 4LLYA 5FK9B 4MQSB 2TSAA 4TUKL 5ETUB 3QT2A 5B21A 1KFAL 1RU9H 2G5BA 1HYSC 1KB5A 4HKJA 5L0QC 4O2EA 1OTSC 3R06B 1IKFL 2WBWB 3NSYA 3OMAB 4Y8AA 3S8FB 4HJGA 5LCVH 3EYQC 3L4WA 3MLUL 1ZGLB 5FYJE 3TF7C 3BPCA 2EXYD 2COQA 4ODVH 1OAXH 2NY1B 4N9GB 2Z35B 3U0PB 5C0AA 4LCYA 5IIEB 3WY1A 3MRMA 5DK2A 4LLVA 1FGNL 5EOCL 4OGAC 2FYVA 2NUPA 3N42B 1ED3B 5IT2L 2XA8L 3B8YA 3EJTA 4HDIA 4MJIA 2YD8A 1DSFL 2G3NA 4F5CE 4KHTL 3E1F1 4XP1H 5I9QB 1BD2E 3QUMB 1HKLH 4XN4A 4FXGC 3PQYA 4C83B 4LSTL 1TJHL 2LVEA 3IKCA 4WHTA 1G7HA 4WI0A 3MNZB 3V7AE 2VW4A 1WBXA 2FT8A 3V4LA 4FXLA 1JZFA 2AK4B 4KRNA 4NQSA 1OE1A 2EIKB 4G6FD 4GRWF 3LZQA 2FH8A 4PJCE 3PJSA 4LLWB 4MA8L 5EU7E 4MWFA 3AWEA 4TNWK 5J6SA 4N3TA 4I89A 4L9LB 1KB9K 3APDA 4R96B 5JXAL 2YKLL 1L6PA 4LLUB 3E38A 1WPCA 4L1SA 2B1AH 4PRBB 2WQRA 2JLPA 3VD7A 2CGRL 3IXAB 1A4KB 2YD9A 1ZHLB 4XMKH 4EOWH 4AV0A 2ZUUA 3CQPA 4AKOA 4OLYL 4OLVH 1KYOK 4ZTOL 1KBVA 1D5XA 4Q4IA 1T7XA 3GLZA 3R19A 4ODXB 2JTYA 3BJ91 3QORD 4HLEA 3ZTJH 3SD5A 4YQXL 4FG4A 3BVDB 4RSVA 3BZDA 2GJRA 1JFQH 3STLB 1AQDB 3R0NA 2YPVH 4WDIA 4F7MB 1URLA 3TA3C 1I9RH 1G9NL 2ATAA 5F3BB 1A6UH 1GAFL 3NH7L 4BCZA 1MCOH 5I8KH 2Q2EB 3S88L 5A6LA 5C7XH 4FFWC 4PGDA 2YLHA 2WM0A 3CFCL 3FFCE 3O8XA 5I0ZA 4OTXH 4QPEA 3EHBD 2PCFA 1DBBH 3C08L 5IM7A 3QFJD 1B4LA 1NAKL 3O3BB 2Y3NA 1Z66A 2Y1YA 1TXKA 4ETQB 1AIZA 1DVZA 1XIWA 5BV7C 1X5LA 4WI8A 2MTAA 3JV6B 5FOBB 3PHQB 5MEQA 4P23B 3D05A 3K4DA 1DQML 1WV7T 3WEAA 2RR3A 3S3CB 5D96C 1KJ2H 3IMWA 2EACA 4NUQA 1GKEA 2VAAA 4U2ZA 2R4SH 2VLMD 2P7TB 2OSLB 3GHEH 1QX1A 1TG8A 1GYCA 3WS6C 3K6SA 1NGXA 3IRPX 2XWJA 1GOHA 2DWEA 3IFOB 3EIFA 1QW8A 3EJQA 1MCSA 3ML8A 5D4JA 2G2PA 2N0KA 3VWKC 4AZ8B 2Z9TA 4AITA 1V3MA 4Z76B 2GT9A 1JL8A 1OTUD 2W91A 2F8XC 1VFMA 1KBKA 2Z93A 3I6GB 4H20H 2O30A 5ITBL 4HOMA 5K9QG 1F4XH 4YSOA 5JQ6L 4NOFA 1XH0A 4KRPB 5FUCC 4AEEA 1ZANL 2Q86B 3MOQA 1ZCRA 2NR6D 1E90A 3MLPA 3ZE1B 5DMJB 3FQWA 4LSSH 1FZMB 4U1HB 4WFED 4YEEA 2VO8A 2FRGP 3U25A 2ZKXA 1NUDA 1JWMA 3S37X 4NKOB 1SYSB 2W59A 3MRJB 3PWNB 4KKLD 4JFFA 5J6HB 1F90H 2CSPA 1KCUH 3ILEA 3LKQA 3QPXH 4K3GA 5FHAH 1J9RA 4AYMC 4OZIE 1BXXA 1TTAA 3EO1A 2IPTH 1KWGA 3FCGA 1NCIA 2FYYA 5I1JL 3D4ZA 4JN1H 3RWEA 2MJWA 3BUTA 4M7LL 5T5NG 1TZOA 3ZKMC 2GY5A 1Z7JA 1QWUA 2F7PA 2AC0A 3THML 4ZS6C 3P69A 3ZGHA 5ID1B 2YLKA 2ZX8A 3HS9A 3HI5H 1BFOB 2HLAA 2J8HA 2BP8A 4FP8H 3TNMB 2FQDA 3EO9L 4OD2A 3L16A 1HHIB 3OQ3B 3V5HA 2DTMH 3EJRA 3WLBB 2JKXA 3CU7A 4H8WL 1JP5A 1LO0H 5D9SA 4PWFA 1EEYB 2IXQA 3FTGB 5EEVA 3ZJAA 2GSIB 1S7UA 4AI7A 2CDFA 4XVTL 2AGJH 1IAKA 2W9EL 2R29A 3CMGA 4I0PB 5EN2B 3DHJA 3HLAB 2NY7H 4NNYA 3WTYA 3E9UA 1YDPA 4U3SB 3G5VA 2ZKHH 4K8RD 5I30L 3EGXB 4K8RL 4N0UB 5EU6D 4BH8A 3RDTA 4HAFA 1II4E 1FBIL 3PV6A 4GKSB 4NBZB 3RRQA 1A8ZA 3QUYC 3ZU8A 1YNKL 1W15A 1KIRB 1QRNE 1KZYA 1CYXA 1AKJB 3LV3B 3AROA 5C07E 4X4XB 1LE5B 1F1AA 5I1AA 2Y23A 2CE6A 4GT0A 5DHMC 5HY9A 4LCCA 1Q9OA 3CSYA 4ISVB 4YDVA 3MCG1 4TLUA 4IOIB 1MJUH 1IFRA 3JWOH 4XPHL 3EOTL 3TYGH 3LIUA 4NN5B 1S3KL 2XX1A 4HWNA 3B3IB 3OPZL 4NM8L 4WI7A 5HD8D 2XWRA 1GZPB 3CZUB 2GEQA 3D0LA 5D4QA 1YEEL 1V7ML 1JZHA 4G5ZH 5I8EA 4Y1SA 4KI1A 4PWJA 5EOQH 2IH3B 1JMZA 3OSKA 4TUOB 4Z0XB 4OV5A 3ZO9A 5HI5D 3F7QA 3RTQA 2Q76A 5DFAA 2ZCLH 4U6XB 4XTRC 4LU5H 1VACA 3IJHA 4RETB 1TJGL 3RHWF 1KB5H 1DEDA 4TVPH 5BO0D 1LO4L 1OEZW 4P4KB 3E8UH 4TSAH 1JUFB 1QKZL 4EI5A 4WHDA 4AIXA 1EMTH 1YJDC 3TT1L 1AR2A 1JVLA 1K8IB 1NMBH 1VA9A 5D6CB 1SEBB 3VDBA 4DK3A 1THAA 1UUSA 1L0YA 1XSOA 2VLKA 5FUZL 1YEHH 5I74B 1IVTA 2IANE 4ZDHB 1BG9A 4MQXC 5AAMC 2N4IA 3SKOB 1I8LA 3TWCH 1S8DB 3MRBA 4C55A 5KSAD 3B2VH 4FN0A 4G1MA 4HGWA 1RUAL 4GAYA 3ZR6A 5BOPA 1PG7H 2YXVA 2LLGA 3F05A 1WFJA 1HZLA 2V2TB 2YD5A 1RZIB 3P9MA 5CZKA 2X2YA 3LSOA 1U8NB 5I66B 3DVGA 5FA4B 2X6BA 3IVKB 4Y4KC 2NX5E 1FVDB 5T1DH 2GITB 3LXCA 4G9FE 2Q3ZA 2F7RA 3TVMD 4Y1AA 5B1BB 4A7QA 4Y2DA 3D9AH 1MCKA 2R2EA 3EJUA 2VL5B 3FOLA 4NN7C 4YHZL 1S9YB 3QXVA 5I1LB 2ZYSA 1F6AA 4NQDA 2EYSB 4XBEH 1X7SA 2Z31D 3PUUA 2D7OA 2YEZB 1NL0L 1I3UA 1M1XB 1R3KA 2G0KA 2JELH 1M7DB 1D5BB 4EBQL 3UGXA 4O02H 3QS2A 4X5RA 4V1DE 4OZHE 2X4OA 3BP7B 4Y9CA 1FFPA 1U93B 3D2TA 3BWZA 2G3MA 3VXUD 4HOZA 2ZAHA 2M26A 1QSFA 3MRDB 3EGDA 3V7MA 4KTDH 1BQLL 4NRYA 4Y2NA 5DU7A 4F92B 4MRBA 1NC2D 4NQVB 5HHVL 4MZIA 2AQ3A 4NNPH 3KCPB 4LARH 5BXFA 5LWYH 1GGIL 2HX8A 4JJ5B 4GH7B 4JFYA 4OF5A 1KC5H 3TV3L 1GPOL 3AZUA 2VDKL 1WDAA 4AKQA 4C56B 2W0FB 4I18B 2GC4C 1CDYA 3RVVD 1SUHA 3MBXH 2A5UA 3PGDA 2EXYC 1E28A 3K81A 4MQ7B 2XKNA 4WW2A 4HH9A 4XMVA 5EBLA 4ZODA 4YZFF 1MRDL 5AL8A 1MQKH 3ARFD 3KLLA 3QXTA 1KCSH 4U3HA 1MN4A 1U3HC 3L3JB 2YPLB 5CMAA 1SXAA 1K5WA 4AG4H 3NN8A 1RLWA 2H8PB 2JKRM 3CVHA 5FO2A 1H3TA 2EE9A 4ABVA 2WIMA 4E9YA 2EVJA 2B3IA 2GSGA 1AR1B 4KAQL 3OXSB 1GY1A 5H8DA 2V2WB 5BS0B 4GS7B 4LL4A 3T4AB 5DJDA 2ZXDA 1QBLL 3V6OE 4S1DD 1EBAA 4GW5A 3D51A 4OBRA 4DGIL 1HEZA 1LO5B 2Z65C 4JE0A 2NXZB 2F7QA 4FFZA 4WNQB 1AXTL 4Z7NF 3MV8A 1E6OL 2EVGA 3T3PE 1JXGA 3B1TA 3PP3K 1YG9A 2YARA 2GKIA 3BEVA 3STZB 5E8DH 2WMPA 2V37A 1LWJA 1BBDH 1WCQA 3IWVA 3ZDXB 2BX5A 2IQ9H 1QWHA 2ZUXA 2O5ZH 2BSDA 4KOCA 4DEPC 3H42H 1NCAH 1UJTA 1DR9A 2DQTL 2E9GA 2HH0L 4L0PB 5A1AA 4YSEA 4JS7A 4RFOH 2OV0A 5C92A 2YSSA 2ZCKH 1HAWA 2X4UA 5F21B 1EHLL 2PF6A 3QDGA 5DJXA 3WNMA 5I6KA 1NICA 5ACLA 1SYVB 2IFFH 1G9NC 1KELL 3O3DA 3GSNB 4PJXE 5B38G 4ONGH 2CHNA 3PNWA 4M8RA 2GBVA 3NIGB 4S11A 2HVBA 1TETH 5KBNC 3N43B 2RQEA 4PRHB 1IMHC 4YSSA 2MFNA 5AVXB 2AQ1A 3QZWB 4FEIA 3EHBC 4CC4A 4L3CA 1CGTA 2QR0B 1DBMH 2JJUA 2VDOB 3HVDA 3CFQA 3NQKA 3O9WA 5D1QE 5GGSA 5GZOD 4N2FA 2X3AA 4XO3A 1T4KB 5GRJL 3ES6A 5J5EA 3OAZH 4CA4A 1G5AA 4Q52A 1UJ3C 4NJ9L 4F27A 2B39A 3PCYA 4AYSA 3PXHA 3QQ3B 1EDYA 1NIAA 1ONQB 2WY3B 3BQUD 3HS0C 5B1JA 4FMKA 5I6XB 4KUZL 5JR1H 2HFEA 3MFGB 4BK5C 1IGFL 1OSZA 2C9AA 2R29H 3GJFK 1UVQA 4DUVA 5MI0C 3JBG7 3G04A 2CK2A 2MWCA 3MRKB 5C09E 1CFTB 1G1CA 4M8VA 3CZSA 3MV7A 4HKJB 4A37A 4O2EB 5G4OA 5C0ND 4W9KC 5L88H 3FQTA 2ZKYA 4LOFA 2WYTA 4TL4A 3GK8H 3BPCB 5L2KB 2C1OB 2NR6C 4WZ9A 3FTXA 1MLBB 1UA3A 5AVQB 4BEIA 4DERA 2APVA 3RIFK 3MRMB 5DK2B 1MXGA 4HWZA 1CIUA 3ZOAA 3S5LB 4NIYE 1DO6A 3QDJE 4JFDE 5JDJA 5CZVH 3IJ7A 3L3GA 4GRLD 1CT8A 4R84A 4MZ2A 3V4PB 3HR6A 5BVPL 3TCXA 4LAQH 3O4LB 2MCPH 1D6VL 1W72A 1NFDA 3PQYB 2AJYL 2A1WH 4RMTA 4WI0B 3B2PA 3EG9A 5FF6A 5HYSB 4QTIH 1PS3A 3DDFA 4JKLA 5SX5H 3LNDA 3V7AG 1T22A 2EDHA 5IHZA 1AE6H 3PJSB 5EPMB 4ZXBB 4HIIA 4ZUWB 4DJMA 1T2JA 4Z7VE 1I3RA 3MLVL 3EDJA 2A6KA 5KVFE 1AANA 1IVLA 1G94A 3M86A 1L6XA 1VFUA 5DEZA 3I6LD 1N7ML 1T7WA 4JO4H 1MZYA 1T89C 1CGSL 4X98A 4Z78A 4H8WC 3G08A 1A65A 4L4JA 3F6LA 5ESAA 1XWVA 2GAZB 4BSWB 1KB9J 3TH3T 1MCWW 2BMKA 3IPFA 4MA3A 3X13A 1FNFA 5LBSA 4PY7B 2ATKA 3CPUA 2EEXA 3VSQA 1JNLL 3IS1X 5EUOB 1LWHA 3LN4B 5CCJA 4X5XA 4K8RC 3SE8H 5JMOC 1KYOJ 5MENB 3EW3B 1USZA 3PYCA 3ULUH 3IDJB 4K7FB 1EAQA 4W6XB 2H0JA 5E9DD 4WDIB 1CE6A 4YPJA 1Z9NA 3SGDH 3KCWA 1KBWA 2J6WA 4JGMA 3U82B 1MNNA 1F97A 1E42A 4GXFA 3WUWA 1I1AA 3P2DA 1KYFA 1U8QA 2LW3A 4OB5L 1MSPA 2CHZA 4KROD 3ZTNL 5BRPA 3AT0A 2NY2D 3Q6GH 1E27A 3B9AA 2A9ML 2RACA 2GW5A 3NT0A 4JY6B 4OR1A 2ZP9A 3O8XB 3PWJA 4QJ3B 2N59A 2Y6SD 2P5ED 4IU2B 5EEUA 5DMYA 1S7RB 3FTVA 4XCNB 2Q3AA 1DBJL 2AERT 5CJXC 4QRPB 2VLLB 4NUJA 2E8ZA 5HD8C 1A2YB 3FPYA 4PJ5D 2XHNA 2AQSA 3F62A 4LEXL 3TESA 3Q13A 1MCFA 3DTUB 4NZFA 5AW1B 5MEQB 2P8PB 3IFNH 3BKJL 3RJDA 2VAAB 2VRKA 3KGSA 2NZ1A 3LS5H 4OVUA 2KHAA 2XZQH 1J8HE 2D9CA 2ZOOA 5TPWH 2CUMA 3DIVA 3TBBA 5IUSA 1KTBA 2IV8A 5GRZA 4AGNA 2MQGA 2Z93B 4DGVH 5F3HA 3DX9A 5JIDA 4P2RA 5CEYB 3D7PA 4WENB 1NLDH 4LRIA 3NCYS 5HPOA 5GHWH 1IGMH 4H1LH 2FJHA 5J6GA 2WOBA 2VL4A 2FCBA 2YGOA 3G6AA 5KSAC 3DPBA 5KBMA 1IC0A 3FQWB 5PAZA 1FN4A 3G3LA 4K9EL 4UIKL 4ANUA 1I7RA 4LCUA 4FI7A 5GRUL 4ZMLA 1IQWH 4GXVL 3FF7A 4J27A 3CVHH 8FABA 5ITFB 4KVNH 4JFFB 2BNQD 3LKQB 4TQ8A 3PRZA 1EGJL 4U0RB 4Y5XA 1AMYA 1P6AB 3EO1B 2XBDA 4PTTB 3BPNB 3TVMC 3SKMA 5BQDA 3VACA 1K72A 4L3ED 1FZJA 2QPEB 4XN2A 3T6VA 4G83A 1HDMA 2HPOA 1T1XA 2D7QA 5DD3H 4NFDA 2K78A 4FFZH 1FHGA 1JK8A 1IFHL 3K6DA 4ZOCA 1T5WB 4LBEA 4W6WB 1K3ZA 4Q74A 3KYMA 1S5IL 5DHXB 3V5HB 3MHZA 2JI1A 2DPKA 5D9SB 1AHWC 5JXED 1BAWA 2IXQB 3KWXA 1X5ZA 4K94L 4X6BA 3LH2L 4XZ4A 2DYPB 1S7UB 1WLHA 5I17A 4CADA 2ZZUT 2CDFB 2X6MA 4MD0B 3HCVA 1IAKB 3VRIB 5IY5B 4P05A 3K2UH 4KO5A 5EIVA 3OJDA 5C0BA 2AK1H 2BZ7A 4M29A 1YDPB 1TZGH 5ISZE 3G5VB 3GDBA 4P2QE 4ABQA 5C0CE 1NC4A 4AIEA 5SWZD 2DKUA 3HBPA 4YDJA 1OV8A 1DVYA 3SYAA 1E4XL 3HC2A 4E36A 5BO1H 3EDEA 1JS4A 1ZJBA 3PV6B 3RDJA 5CJ8A 4EMZA 3MLYH 3VXQB 1OSPH 5TFSH 2DWXA 4P5RA 3C6LB 3UZEC 2XXGA 5HY9B 4PG2A 2J5WA 4IOFD 4XAWL 2XVKA 3F6IA 4JFVA 4YDVB 4HOXA 4RMRA 4XNYL 1TR7A 4WTXA 4B7LA 2PXYD 2WWMC 4F2MB 4XCFH 1JOIA 3ZR5A 2PTTB 4DTGH 5DYOA 3SBPA 5A6IA 3FO0L 3DRQB 3R1GL 4ALAH 5I5IA 4QOKE 3U4BL 5KSBA 3WTSA 4L4TB 2VXTH 3TO4B 1C1EH 4HJJL 4M3HA 3SCMA 1NLBH 1F00I 1E67A 3II1A 3EFOA 3ESUF 2BERA 1BREA 4QHMB 4L8DB 4AQEB 4HCFA 2FO1A 4WUUA 1R3JA 1ULVA 4G8IA 2P49B 4S1DC 4AQ8C 1Q9KA 3QZPA 1AD0A 2ZX7A 1A3ZA 2ITEA 3Q2NA 1VACB 4JZNB 1UWFA 1GYVA 3UG4A 1R5WA 7CGTA 3BWSA 4GMTL 2DD8L 4APQB 4XOBA 5JA9A 3LZLA 3NTCL 2QL1A 3QEQD 3NBNA 15C8H 3BSZL 4PP1D 2IG2H 5JO5A 2NY6B 3MCLL 3BOVA 1U8OA 1OAKH 3L95B 3FT0A 2WUBH 1GA2A 1J5OL 3ECWA 4NXKA 4G1MB 5B39G 4GAYB 3CLFL 4EI0A 3OJVC 4PV8A 3RWIA 4KV5E 5FYLH 3L4VA 1G7QB 5SWQA 4CJ0A 3TPKA 1KWKA 1W72H 1DBKL 2OI9C 3K80A 2ERJB 1RK7A 4JHWH 4ZQKA 1RJZA 3BXNB 4BFKA 5E1QA 4LHJB 2DWTA 2WIIA 2YHGA 5DFWH 2CXGA 1OANA 3GFUA 5EEWA 4GLRI 2DICA 2EXSA 4NQDB 4J23A 5GZOC 2VDPL 1S9XB 4ZMTA 5I15L 3GJEB 3D39E 3KLKA 4JLRB 2V7NA 1A6TB 5IVXA 1TQTA 3KBHE 4NWTH 1R3KB 3VXMD 1IT9H 2ZYRA 2BH0A 3WO4C 3V0HA 3G9VA 1H15B 2X4OB 3BQUC 4PJHA 4ZPTA 4R7NA 4WFHE 2X88A 1QSFB 4JREC 2DYSB 5LBSH 3P2TA 1EWHA 1KN2H 1BZ9A 5AYUL 4YHKL 3PGFH 2ALAA 3QG6A 1UWEL 2CNYA 1BZOA 1QYGH 4BFRA 3V10A 4Z0BL 1LJMA 5CF3A 4YSTA 1N10A 5I1IL 2AEPL 1RURL 5C0NC 3GQFA 2CH8A 3LRGA 1OCZB 4LIQH 1V54B 4XGZA 3REWB 4A7GF 4YR6B 5IFAH 2DJSA 3LJ3A 3PGDB 3FUJA 5KTEL 4GQRA 1E28B 2Z8SA 5ACZA 3LHPL 2XKNB 3VG9C 4WKZA 2VR4A 3TX4A 2WD0A 5EBLB 2DBLL 2X4NA 2XQYA 2YK1L 4IK7A 3FFCB 2R27A 3P4MA 3K8KA 4Z77A 2Y7NA 1NIFA 3CFKB 4PJ9A 4GRLC 4JRXA 1IGIH 1VEOA 3I2CL 2GIMA 3MZGB 4OCXH 3S35H 2OA9A 2XPZA 3RJOA 1PZ3A 5I28A 3NCFB 3K71B 2ZICA 2DJUA 3RIKA 4QHUA 3H0TB 2A6IB 1ADWA 2ZPKL 4F1ZA 5C3IA 3S7GA 1TQCC 2Y07H 1JK9B 5HGDB 2Y0SA 4XP4H 5HI3D 1FNGB 4CNIA 3J7HA 3NSCA 1N6QH 5KWYC 4N5UA 1FFNA 1WEJL 2HRPL 2Y06H 3NUKA 5DUJA 2QQKH 1UT1A 4GW5B 4PJEE 4RGMB 1HEZB 5D7LE 5EO9A 3UJJL 2M8XA 5JOFB 1I31A 3MFFB 3MV8B 3VXSA 3N85L 5KBLA 1YEKH 2EVHA 1S78D 1QBML 3BEVB 1XGRB 4CJ1A 5AD0B 2LQRA 4PJFE 1UZGA 3IGKA 1NJ9B 2GBAA 1E9OA 4Z6AT 1GYWA 2IWGA 2VIRA 1AZZC 4LDEB 4FZ8H 5CJQH 1NMAH 3FQUB 3VYOA 4LFHD 3MJ7A 5AYTA 4FRWA 1HIMH 4J3WA 5DURD 4G2AA 3TZVB 2X1WL 1RJLA 4I5BA 3VFWB 5KVGL 4XPAH 4FI6A 1CYWA 4N8VA 4MAYC 2CXKA 4F15B 1TZIB 2YSSB 5J7CC 3D3VD 1XD0A 3H1ZA 3ZGIA 3AB0B 3ERXA 4XH2A 4CC1A 1IAIL 1FL6A 5JPNC 3O3DB 3BP5B 4M5ZL 1KCBA 4CN4A 3VYNA 1BW8A 3N0AA 1LL1A 2HJFB 3C5ZD 5C08D 3UMNA 2X28A 5GRVL 1RUPH 4KROC 1D5ZA 2NY2C 3UTPD 1T04B 2E76C 3FCBA 1JPTL 1UT2A 4K0OA 1FFOA 1AO7A 4F9PC 4K71C 1B4JH 2Y6SC 5HHQA 5GS1A 3SPGA 1C12A 4P5KA 1FYTD 1SEQH 3UAFA 4HP5A 3ZX1A 5D2NC 3ES6B 5DWUL 1ILSA 3MXVL 3FQ2A 4GG8B 1Z32X 4ZO6A 3TEZA 3HRZC 5BZZA 5GGVH 3LHAA 3VD3A 3EFDH 3QNFA 1ET7A 5E6IB 4F7CB 1FRGL 3Q44A 2CD0A 2HFEB 1BQ5A 3Q2CA 2IGFL 4PIBA 4P3CH 3LEYH 2YN5A 1RZ7H 1BZEA 1T0MA 4XVOA 3EYSH 1AGDA 2YA1A 5JUEL 4QLWA 2WANA 5T33L 1T4WA 1W0WA 4H4NA 3G5WA 3BX7C 2A73A 3WD5H 3FOMB 3MKKA 4WUKL 5CU9A 4JVWA 1QRNB 1CU4H 4Z7QE 2CDGB 3NA9H 3IDIA 1AXIB 2J57A 3ZDZF 4D2NA 2VAJA 3QIBB 3L3OC 3KPNA 3S5ZA 32C2A 3PL6D 3VI4E 4TLTA 5I1HH 2AJVH 5F71A 2ORBL 4OLZL 5EA0L 5DA0B 4K9EC 1NBZA 2ZE0A 3BEWA 3L13A 5EORL 2DOCA 3QUGA 4OZFA 3U2IA 1A0QH 3HZMA 3QUZB 3UYRH 5I23A 1T7YA 3UAEA 5HSFA 3MUUA 1J8RA 4RA3A 5IB1A 5E4AA 2R0ZL 4AENA 1U3YA 1O9WA 3AREA 3OD3A 1RAMA 3OKDB 2FT6A 2YC1A 4M5YH 1T21A 5FF6B 3U4KA 5AB0A 4N0CD 4S0HA 3DSFH 2GJ6D 1T22B 1WE5A 1H6FA 2PCPA 1XT5A 3FT4B 4N6QA 3U7YL 1EO8L 1WUZA 1KIPA 1YY8B 4F7EB 1PKQE 5LN8A 2K6YA 3EH5B 3H8NA 5JORA 1BIIA 2BY2A 1AQ8A 2H1PH 3VB8A 1NCBH 5KS9F 3AG1B 2PMZA 4J3OH 4JL1A 2MQCA 4NHUB 1V05A 4K94C 5JXEC 3ISRA 4TV3A 5BRZE 5CLTA 5C0FA 3FTUA 1TITA 1PG7W 1I8IA 2VDMB 4M56A 4N68A 4R90L 3VXRE 4N25A 2FIKA 3X13B 2VUYA 3HE6A 4L4VE 3ENEA 5T1LA 4S0SD 1KV7A 3CBJB 4EO5A 3V9CA 2GIYA 4FDWA 1AS6A 4RBPK 4X5XB 2IDQA 1KPRA 2XPGA 4KO9A 1JZIA 2X6VA 3G5ZA 4ZW7A 4M1DL 5ADOH 3MUZ1 1Z9SB 1CE6B 3B1UA 4Y9EA 5EBWA 3GXFA 1LQSR 1N0XH 1XCTA 3AM8A 4UB0H 4G9FB 1GOFA 1U8QB 4H44C 4IOFC 3DSNB 2LU4A 3FL7A 4MNQD 5DA4A 2X4RB 4PYGA 1E27B 4W9LC 4JKNA 3VG0H 4DGYH 3PWJB 1JGLH 4DPRA 3K4ZA 5F6IC 5IBTL 1FI8C 2PXYC 3ZK0A 5C9KA 5HHME 2EH7H 4NO5A 1T6BX 4BGLA 4HUUB 2CALA 1AQHA 4NUJB 3VXOB 4M7KH 4KKNA 5D7JB 5TDNA 2VERN 1CL7L 2ITCA 4W81A 1JGEB 1HHJB 1YEJH 3NJIA 6TAAA 3OHXA 4GRMB 1NGYB 5EF1A 3SQBA 1TIUA 2QEJA 4FTDA 1N8ZA 3I02A 4B50A 4UINH 2FK9A 3I9GL 4RDBA 5IQ7H 5HHOA 3Q9QA 3SKNA 2XSKA 3GHBL 3V0FA 2BJMH 3FU3A 3QUML 4XODA 3ARGA 3IDGA 1HL4A 1JPSL 1GCFA 2CK0L 4G80B 2A3TA 2V5RA 2B8OT 4OSUL 2Z6FA 5KW9H 1GYUA 2P80A 4PP1C 4UV7L 2MOGA 2J4WH 3I9PA 1RPKA 3D5OF 4DZBA 1IAOB 3IETA 4OCSL 4UT7H 3UTSA 2JJWA 4G42B 4KUCF 5DQDH 3WG7B 5DHDA 2XZCH 5EWIL 2LGNA 3L9RA 1V7NH 2JCWA 2WN3A 1SHXA 4F57L 5HHXH 3NJHA 3IKKA 4ZO8A 5ANMB 3QH3A 1ZEAL 1MJ8H 3DX7A 3FN3A 3U9PL 2Q5BA 3ZUNC 5T3XE 3ZYOA 2DMGA 2F53A 4J3TA 2HSIA 2CLRA 1L9SA 5DS2A 2ZP0T 3DX6A 2HB0A 5T1KB 4L8CB 2AV1A 4I2XE 1IBGH 5FDWB 2FZ3B 3DK2A 4G8GB 3ARBB 2D7TL 3Q8FA 4QEGA 3SDAD 1RUQL 1VGEH 1D7DA 2G60H 4H88H 4OAWA 1JK8B 1T7VA 1YNLL 2E7CA 3MO1B 5FW6A 3VD9A 2ARWA 2BVUA 4JO2H 2EIMB 4X80H 4YAQB 3T3PB 3KYMB 3ARDA 4S1SL 4DKEH 5DVNA 1GMEA 1E6JL 1AZBA 1QUNB 4KTGA 3WBDA 2K8MA 4X6BB 1NCUA 3NFSH 5I0DA 4CADB 1I9JH 3AQZA 3BRFA 1QQDA 4HT1H 2ROYA 4NHCH 2F54D 4AXWB 2AMGA 5E23A 2A7BA 4JE4B 1R46A 4IRJD 4L5FH 3L45A 1FWXA 2X9YA 5EDXA 4PJXB 3BH8B 3LMJH 1JNNH 3Q3GB 1EUTA 3MLWL 4FQ2L 4PJ7F 3Q01A 3UJTL 5TDOA 2WWKO 3N41B 4HHGA 1RKRA 1TVHB 4MMXA 5DD6B 4HS8H 1ESOA 5KUKA 1YRKA 4JRYE 4RX4A 1UXLA 4PJGF 3F8UB 4Z18A 4YXLL 3C6SB 1OT2A 1LEGB 4ODHH 1CE1H 2HKHH 4MSWA 1BYPA 2RHEA 5ALCL 4FMVA 1TT6A 3WIHL 1CI3M 1NANH 4ZOBA 5FYKU 3OAYH 4U1KB 2ZXQA 5GJSL 1MFDH 1JF5A 5GGRY 4IHOB 5AUMA 4WWID 2R1WB 3QAZB 4RMQA 5HI3C 43C9A 3BKMH 4FQLH 5GS2H 5INCA 3ZHLA 1AY1L 2EYTA 3O3AA 3QZMA 3JWNC 2B16A 3DUHA 2VZTA 3BD5A 1CICB 4HUVB 4YL4A 4UYQA 5E2TH 43CAA 4K23L 2OL3L 5C0EB 1IC5L 3H53A 5HPMA 3SYCA 3RFZB 5HGBA 1S78C 3FYIB 5D1ZB 2FB4H 2OXGB 2P52A 5KSVA 2LLNA 4PGBB 1DCLA 4OQTA 4H8PA 5ADPH 1S9KC 4JPVL 2ZWLT 2FX8L 1EZVX 4HFUL 4ZNEA 4JM4L 2NT0A 5CSZA 1R17A 4U6HA 4OT1H 3NK3A 4HCRH 4UZGA 2XWXA 4X5LA 3VXPA 5CLWA 5E0FA 4A6YB 4RGOL 4KK6D 3SB3A 4GRWH 4PV8B 3RWIB 4JY5L 3KYNA 5KG9A 1KJ3L 4LLQA 4H0HB 1QP1A 1K8DA 2CRIA 3FCSA 3DOSA 4LSQH 4I0PD 3IMRA 4OGYH 3C5ZC 2UUDH 3BYYA 3RPIA 3RI5F 4YJZL 2WBJD 3CGTA 4ODTL 3KGRA 2WIIB 3BYTA 2R56H 1VADB 4UT9A 1E4WH 3ULUE 1MXDA 3HHSB 4OGQC 5E0QA 4HFWB 1EJOL 3TIEA 4F3FA 4WU7B 3BSHA 4LDLB 3V4VB 1VFOA 2R69H 4N5ED 1AKJD 1EFQA 5IVXB 3OGCA 1S7TB 1P4IL 2PO6D 2E6JA 5D2LE 4LLDB 4MDIA 3SDYH 4Y1AE 4PJHB 5EB9A 4R7NB 2BW4A 1FG2B 2CR0A 3V0GA 5T5FA 4YHIB 3QCTL 1SXSA 4FLQA 1AQKL 3CPLA 1BJ8A 4WTQA 4GG6A 3O2VL 5IHHA 3CHRA 3PHOA 4JQVC 4F2FA 2H41A 1FVEB 5HTSA 1UADC 1GHFL 1OB0A 4UUJB 3S2CA 1JGUH 3MUGB 1L7IL 4OFQA 3SZ6A 4Q9BA 2WLZA 5ESVB 1E3ZA 3VB9A 3P0VH 5C70A 4FXGA 5ERWA 4HBCH 2BY3A 3L8QA 2VJ8A 2R4RH 3PL6C 1SF5A 4FHKA 2VMCA 2RIKA 2IAMB 1NEPA 4IS6A 1MNUH 3KL3A 4P4KD 1NCDH 3BUYB 3MLZH 4K55A 4OCWH 1FO0A 5DQJB 4JRXB 2E0PA 5GRWA 3VFVB 4FQQA 3CN4A 4JN2A 2PR9A 2VM3A 1CLZL 4F7TA 3OMNB 2APTA 1J5HA 4NT6A 3HHMA 2ADGA 5I8OL 4U1LA 3OZ9H 4J6RL 4MZ3A 1VKXA 3BD3A 3RY4A 3DNKA 3GUFA 3O6KL 4N0CC 5EH1A 4UM8B 4K3EH 1SMAA 1OGAE 5KVEE 4CNIB 4ZFZB 3WXWL 3W39A 4PBVC 4QI3A 5AQ0A 1KYAA 1JTPA 3ZRCC 5DJ2A 1MY7A 2GG1A 1SOQA 3UROR 4FL4B 3RU8H 3PDOA 4FNQA 4DQOH 5EO9B 3QVAA 4DSYA 4R6UA 1TQBB 1TYRA 3HFFA 5HVHC 4BDVB 4X5QA 5CCKL 5I71B 1TFPA 2A74B 4XPGH 1KG0B 5FW7A 3RVUD 3D85B 1E9OB 3TA3A 3ARQA 4H25A 1SHMA 1F8TH 4OLWH 4GQZA 4X0NA 3BUDA 3MJ7B 4KKAD 4OFDA 4NKQB 4XP9L 4Y5YA 2FL5A 5IROD 3NEXA 5B8CB 3CZNA 4J8RA 1J1XL 1JTTA 2F58L 2YQBA 1JI2A 2JF1A 3CSBA 4NQCD 2VDQH 3C8DA 3U36B 3WFDL 4Q9QH 3EFFB 3AWGA 1WUNT 5DJCA 1CI5A 3HZVB 1XD1A 1A47A 3CSPA 4M5SA 1ZGLP 3HG5A 1U91A 5FYKH 1BZDA 2DQEL 1IC4L 4BELD 1TJMA 2GB2A 2WKLA 1XCWA 4O4YL 3IDMA 4XPBL 4P2OD 2V8LA 4YL9A 3VH8G 4C47A 3ROLB 5I24A 1A6AA 1L6ZA 5LDUA 2OK0L 5F7YC 2C3XA 1KULA 1LE9A 1AO7B 2VDLB 5DR5H 5GS1B 2CUHA 5ECGA 3IDXL 5LGJA 1C12B 2OMXA 3T0BA 7PAZA 1E7UA 3S48A 4JR9H 3PWLA 4LSUH 1CMOA 1WIUA 3MJ9A 1V3LA 3VWKA 4XP5H 4EAEA 4KZEL 4O58H 1TDQA 4P4RB 5F7FA 3D4GA 3OKLA 2YAQA 4LP4A 1QHPA 2O93L 4MCZA 2YPLD 3LRKA 3S34L 3HW7A 5FECA 2VLJE 4JL2A 5EBMA 2RA1A 1FV1A 3MV9A 5IB2A 2ADIB 5ISZB 5I9QC 1NGWA 1UXMA 2XRAH 3WNPA 1I82A 4P2QB 2ARJQ 1P4BH 1WWWX 4JANA 3NPSC 4NBYB 5JOPD 2EDOA 1CWVA 3Q43A 4DEUA 3B7UX 1O6SA 1PYWB 3DRTB 3IGAA 3WGVB 3LRSB 2IH8A 3GSVB 5FS5A 2H6OA 3OLGA 2YAEA 5GSVB 5D7KD 2Y1VA 3L54A 5EOTB 1OP5K 4QXGH 3AT9A 4QAWA 5H4YA 4CC0A 4M3JA 2IAAC 4LSPH 1ZLWK 2XN2A 4OZFB 1DUZB 1LHZA 3HZMB 3C09C 1HU8A 2EDQA 3RURA 4K2UH 2AV7A 4QCIA 2FEDC 3SPVB 3A21A 3ZE2E 2E4FA 2WXIA 1HEHC 3HBZA 1U0QA 1BAFH 1U2HA 2EC9T 3NJNA 3BKYL 5CNHA 3AREB 1E2ZA 1BX2B 3EYUL 1GGTA 5HGGS 3HNVL 5ANHA 4JEGB 2J1KA 5AOMA 4W68A 2YMXH 4AEHH 1Y6KR 4OCYH 3SDAC 1P5UC 2UWEF 2NLJB 2VERA 4O5LH 5LXGH 5M94B 1KIPB 4N0YL 3B2DC 3GSNL 4YHOH 4QY8A 5F7MC 1CXEA 1NFDE 4HD9A 4MGXA 4HJIA 1BIIB 1U8LA 1S7SA 1CXHA 4LO9A 3AS1A 3BVTA 3PWPD 4PS4L 1ES0A 2AW2A 3IN0A 4GYBA 3U7WH 3QUYA 1QABA 3DXAA 1Q72L 5I8CB 2I9TA 3VQMA 1INEH 2OZNA 2XTJB 4OQTH 1LDPH 3FHQA 1I8IB 5TQ0L 1FAIL 1RK0A 1XR9A 4DEWA 5T1LB 1FNEA 4M6OH 1G0YR 5E2WH 2MPAL 2V7HB 4IRJC 4HMDA 1RK1B 3ALWA 3G5ZB 2A9CA 5CGBA 4NLHA 3MGAA 5IHWA 1T1YB 3APNA 3IT8D 3U46A 2H2PC 3WSQH 3HFMH 3WDHA 1UASA 3ZHKA 2JTDA 1XCTB 4L8BA 4UILH 3W57A 4ZFOA 1FNSL 3EDDA 4CU8A 4BKLA 3V0JA 3I3EA 4UT9H 4HS6B 2O72A 3T1FA 3DV4A 2GCYA 1BMWA 4P5MB 4XN7A 2JJTC 1CBVH 5F6HI 1W0VA 3D39B 4NO5B 4XZUA 1IEHA 3FRUB 1PSKL 1HSBA 1KT2B 3F85A 3TFKD 4KRPC 1QPPA 3WUZA 2RMNA 5L2KD 2AI0H 3WE6B 4DVRH 4E0RB 4Q8BA 3WEXB 3S96A 1EXUB 4OJCA 1A6ZB 2UXTA 2C9VA 4NO2B 5T5FH 2EC9U 1I1FB 3OHXB 5EZIH 3VUAA 5E08L 4U6VL 1R0AH 1B88A 3EJJX 3ESOA 3SQBB 1FHNA 1KJVB 2LFGA 4EZMA 4HWEL 4YHPB 5BUAA 5HYJD 1BZQK 3V4PL 5LQBH 1IGJB 1XF3B 1A1NB 2A9BA 3O4LD 4Y1TA 1CURA 5IEHA 2LLLA 4AH2B 4K3DH 2Z64C 4DN3L 4PHXA 2XA3A 2HFGH 1RPUA 2FQFA 1KYUA 5GXBB 4YX2L 1X5FA 5ABDE 5EEYA 1MRCH 4R2GD 2ALWA 4ZXBD 2TAAA 4Y4KA 1ZHNB 3IETB 4X6FA 2F7OA 2OYLA 1SJHA 3BVWA 1P0SE 3UTSB 5I6LA 3OZKA 1SPDA 3GTVA 1QLEH 2ENSA 5KOMC 1UD3A 3VVVA 1J5IA 2JSFA 4MB3A 3RUGF 2FHFA 4DFIA 1HVXA 3WNOA 4KK6C 3V0WH 1FO0H 3E8VA 3N9GL 4PJBE 4X9IA 3TNNB 1A9VA 4EN3D 3QHFH 4YSQA 1UM6H 4B9KC 1E5CA 1JERA 4OJYA 4WFFD 4UQAA 1VESA 4MAZA 4P2RE 4I0PC 1NBVH 3QWOA 2CLRB 4WAFA 4HKXB 4URTB 1QNZH 3ABLB 2PTVA 3DX6B 4P07A 2RD0A 1FE8L 3E2HC 4P46D 1BGXH 3HPLA 4TSBL 3FSVA 4FGMA 4ZRGA 1VGKA 5CIPA 3OX8A 1S6NA 5CSBA 1RIVH 4GUOA 4MDJB 3MYJA 4Z7UF 3HG4A 4JKPL 3JYBA 4PJEB 3P2BA 3RZCD 1QZNA 2F5BH 4N5EC 4KTEH 4DP0X 3K2IA 4OAWB 3P4OB 4WWKA 2YD0A 2PO6C 3TU6A 1U95A 4UWQB 3QNXA 4HLZG 4Z7OF 1VFAA 1PZCA 1KDIA 4M1GH 1NCWH 3ZKNC 5I1EL 2XN9A 5DJZA 4HWBL 3QJUB 4N1CA 4D8OA 4HULB 4MZRA 1DN0A 4JG0H 1XGUA 1DFXA 1QQDB 3A67H 1KIUA 2CJTA 3A0OA 4N2BA 4NN5C 3PWVB 4UDUB 1GGBL 5IFJA 4QRPD 1EAPA 3SE4C 4NP4H 5T3ZE 1T20A 4FEMA 3L48A 1U3HA 2BRQA 4BINA 1T0NA 3KPSD 5IUCA 1XF2B 4W9DC 4HISA 1NCCL 1MF2L 4XMWA 3VFOB 2E59A 3Q1SH 5G5DB 4FQHA 2R2BB 2GABA 2NYZA 2J12B 3BT2H 3X3FL 1OPOA 3CD4A 5PCYA 5AFAA 1JNHA 4L2LA 4BA0A 3GWJA 3ECQA 1ADQL 4P4KC 3DHUA 4IHBA 4QRFA 4X6CF 4YLQT 3D87B 3PGCB 1ZGLM 3MLTA 1C16B 1BQSA 2X1PA 3AU1A 5DFTA 2FWOA 2AABH 3IPBA 5I74C 1YN7A 3MJ9H 4PCYA 4PJIB 1MG2C 2IMNA 1E9QA 3T71A 1ET5A 4AMKL 3ZSSA 2ILLA 5AUMB 3TYFB 5CFAA 3ARXA 1ACZA 3JUZA 1Z3GL 2I27N 1SLWA 3EJSA 4CDHA 2KH2B 5F88A 4GPVA 3QFDA 3BAJA 2RCSH 5ICYA 4ICXA 2WZ5A 4H8UA 43CAB 3K91A 2NY0B 3LKRA 4MXVE 5HPMB 4L0ZA 4QT5B 4J1UB 3RL1B 1DQQA 3L4ZA 4NFBA 5TF1H 3EJYD 3RVUC 1CFNA 3V5KA 5B7MA 1MFCH 1G6RL 3KL0A 3MBWA 4ZS7H 4OLEA 4OFIA 3VI4B 1I85C 4KKAC 5IROC 5CSZB 3FCTB 4UV4H 3D2UD 3ARYA 4LMQE 5DLML 5L7XH 4RMUA 2BHZA 3T2QA 7FABH 1NEZA 3QFJA 5LXVA 3WIIH 4DZ8A 3AS2A 1MI5A 2FATH 2DYPD 5GIRA 1K8DB 1RULL 4JHVA 1BQHG 4I88A 1MCNA 4I48A 4U6TA 1WAAE 1FL3A 1F3JA 1UJ3A 1WC7B 3RPIB 4I85A 1UD6A 1BWMA 3HS0A 4KO7A 4P2OC 3HUJE 3EDKA 4PV1C 1GZQB 2JI2A 3B5HA 4BK5A 4KXZI 4HIJB 3TEYA 3SKJH 5LKNA 2YPKB 3QZLA 4P99A 5BNXD 1UH2A 1PKQB 3TIEB 3MAWA 4PMEA 1HXKA 3MXWH 2J8UA 4LHQB 3IK2A 3OGCB 2VDNL 5IFHH 2WVTA 2Y4SA 3B9VA 3FULA 1H3VA 5L0QB 5L4FA 2AEWA 4MDIB 2V17L 5GJTH 5BRZB 3I6SA 4ZO9A 2WNXA 3EOAA 3B37A 4TVSa 4A7GA 2VSMB 2CDEA 4L4VB 4R7LA 2NR6A 5IW6A 4Y9GA 3P11L 4GG6B 4KC3B 5C0GA 5SX5K 3NSXA 1IM3A 1Z9OA 1D6EA 4GFXA 4ZX6A 3PHOB 4YUEH 5IJVA 3Q6FA 4ZSOA 2YO3A 1CTOA 4FYQA 3LKNB 4WI9A 4XI5D 5E5LA 1SGKA 4IW4C 2JWYA 3ROOB 4F33B 4B3EA 4IMLA 1ZLEA 4ODWA 3P30H 1U8IA 3T4AC 3MROB 4M7LT 1MCPL 4GP8B 3OLIA 4D0DA 5ERWB 2IVFC 1KBGH 1XSJA 3IJ9A 4OF6A 1PX4A 2Z34A 3NFNB 3NZHH 4PW3A 4WK0B 3FKUS 1DVUA 2WXNA 3STBA 4APQD 1MJJA 1YPZE 4UI2A 5D55A 5AG9A 3AAZB 5E6ZA 2CJ3A 1WJ3A 4AQZA 2IH1A 4JN2B 2J55A 4G59C 3PXJA 5FYJD 4HUWA 5FYJL 4F7TB 4S2SA 3LNIA 2FH6A 1T89A 5EZJA 2WTPA 5F1OB 1UACH 4JFQA 4QJ5B 5HJDA 3GXPA 3MRQA 3KH3A 2WXJA 1UYWL 4H1LG 3P3YA 4E9QA 5IMMA 5DJ0A 3W39B 2W8CA 2OJ1A 5I6PA 4P3DB 4XNAA 3NACL 3KHOA 1BD2D 3FO1B 2WBXA 3OKNA 5E94A 3SGEI 4E42B 2ID5A 4YWGH 4PLNC 5EU6A 3A23A 4D7PA 1IGTA 5CILL 4ZMXA 1N5AB 1XZ0A 2ENJA 3WXVH 3HKZA 4IBTA 1GC1L 5E6YA 1THCA 3DUUB 5IESL 2ADFH 5D7HA 3L7FB 2BK8A 2JMRA 4D9RE 2FL5B 3U1SL 4IBWA 5A7BA 3GI9L 5MERB 3NIFE 5CEXA 1R3LA 1CGYA 1H3PL 5CJOL 5L6YH 1NBYB 2ZCHH 2BVPB 3JV0A 1QO3B 1FIGL 3PP4L 2JKIS 5BV7B 4E41E 4RIRB 2X1OA 1B2YA 4Y16B 2WUCH 3P9LB 4I2XB 2R0KH 2CO1A 2KDGA 5CIPH 1N70A 4G8EB 2JQZA 3SGJC 3QA3A 1HQRA 1A6AB 4L5FE 2AXGA 3N55A 4LEOA 2DLFL 1DN2A 1L9NA 4TUKH 2OMXB 3TFKC 2XG4B 3ZE1F 1G9HA 1CLOH 3K2MC 3BIKA 2P46B 1EA9C 1OCWL 1KPVA 2IOOA 3MLUH 2XZAL 3IJSA <