4A7TA

Structure of human i113t sod1 mutant complexed with isoproteranol in the p21 space group
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
b'ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
molecule tags Oxidoreductase
source organism Homo sapiens
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
total genus 39
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7tA00
2WYZA 3KM1A 3KH3A 1OZTG 5CU9A 1SOSA 1BA9A 2C9SA 1OEZW 1F1GA 1SXBA 1COBA 1UXMA 2AQPA 1EQWA 1PTZA 4U4IA 1E9QA 2AF2A 2K4WA 1DSWA 2VR6A 4BD4A 2C9UA 3QQDB 3SODB 1B4TA 1N19A 3MKGA 3QQDA 2AEOA 1SXZA 3RE0A 2WYTA 1E9QB 2ZKXA 1JCVA 3ECVA 3GTVA 3MNDA 1E9OA 1XTMA 3HFFA 4A7GA 1EJ8A 1IBDA 4B3EA 4A7UA 4A7VA 1FUNA 1ESOA 2WKOF 3KM2A 1HL4A 3T5WA 1Z9PA 3HOGA 2R27A 4N3TA 2Q2LA 2WZ0A 1AZVA 4OJAA 4OH2A 4A7TA 2GBUA 1TO4A 1XTLA 1SDAB 1QUPA 3LTVA 2ZKYA 3L9YA 5KBLA 2XJLA 1IBHA 1F18A 2E47A 4A7QA 1U3NA 1Q0EA 5KBMA 4A7SA 1SDYA 3CE1A 3CQQA 2WZ6A 1BZOA 1OZUA 4MCMA 3H2PA 1MFMA 2WKOA 1SXSA 1CBJA 3H2QA 1OAJA 1SXNA 2NNXA 1N18A 3F7LA 3GZPA 1S4IA 4A7GF 1F1DA 3KBEA 1KMGA 3GZOA 1E9PA 3GZQA 1JK9A 2Z7ZA 5KBKA 2WWOA 1Z9NA 3KBFA 3K91A 4BCYA 1PU0A 3CQPA 2ZOWA 2Z7YA 1IB5A 2Z7UA 2VR8A 2Z7WA 4L05A 2LU5A 3S0PA 1SXAA 2SODB 1XSOA 1SXCA 1P1VA 1DO5A 1E9OB 2XJKA 4MCNA 4BCZA 2C9VA 3HW7A 2AQTA 1YSOA 1PZSA 2GBVA 1SRDA 1TO5A 2VR7A 2V0AA 3F7KA 2WWNA 3GQFA 3PU7A 1SPDA 1B4LA 2JCWA 1RK7A 1OALA 2AQNA 2GBTA 3ECWA 1L3NA 1E9PB 2AQRA 3ECUA 2AQSA 2E46A 2WZ5A 1F1AA 2AQQA 1IBFA 3KH4A 4FF9A 1YAZA 2APSA 1JK9B 3L9EA 1UXLA 1YAIA 1CB4A 1IBBA 4N3UA 2JLPA 1HL5A 3GTTA 2ZKWA
chains in the Genus database with same CATH superfamily
4X5LA 3WNPA 3V2AR 2E9IA 3L54A 4D9QD 3FHQA 4PRHB 4KK9C 4NNPH 4S1SL 2OZNA 3GXFA 1EO8L 4P4KD 3TP4A 4KKNA 4EKJA 2ARJA 4TTDD 3IDXH 5KSBF 3WY3A 2AK1L 3PG2A 4IMKC 4JVPA 4AQOA 2QPFA 4M4PA 3X3FL 5F1NA 2HT2C 1A4JB 4OKVB 5E6IB 1I1YA 4MJIA 1X9LA 1DSYA 4HJJL 3PXHA 4TF4A 4Y9EA 2DRUA 3QG7L 4DPAX 5H4ZA 3EGSA 4NNXA 4HIEB 4N24A 1JZGA 3MXVL 1AHMA 1ACYL 4UTAL 1XL4A 3AUWB 3U36A 3TNNB 3K0WA 1BZDA 1GRWA 3NCYS 1USQA 5CP3A 4AYID 3IKCA 2Q8BL 3EO0B 4MXWL 2YRZA 3V7AE 2ZKYA 1SQ2N 3OAYK 5DQDH 5I1JH 1A6PA 4Y9CA 5K9OA 4TOYL 2DBJA 2P3YA 2BDNH 4O2EB 1MLCB 2VZ3A 3EFOB 4H8UA 4GEJA 4HWNA 5LWYL 4ZAKA 3IMTA 3QEUA 5JDSB 3V0HA 3WMQA 1RZKL 3WE6A 2R2EA 4J12A 2XWTA 2F54A 3IE9A 1N8ZB 1F1DA 1LD9B 3C6LD 5DD6B 2WYIA 4WGKA 1KXQA 5ERWB 3EGDA 2GT9B 4R97B 1CYXA 3BQUD 2DQEL 1IKNC 2DW5A 1W72B 1T80A 4HIXL 5CF3A 2OX5B 4AENA 4X0KB 3EJQA 4FFYH 1JWMA 1MFNA 2MH4A 2PCFA 4MA1C 1SUHA 1A7OH 2P8MA 4JLRB 5IBUG 3DO7A 1KPRB 4HKBA 3V0VA 2OXGB 4FA7B 4RAHA 4N2IA 2FTAA 2WBWB 1EZLA 3SGEH 2UX7A 3AWEA 3U9UA 1IBYA 2AQNA 2CRZA 4ORGB 4WFEE 2A74C 1BOGA 1SN0A 5HI4D 2IADA 5IBLC 1NCAL 4JPWL 5KVMC 2VMCA 1XZ0A 2W59A 4XO5A 4D9RD 3I02A 4QRBA 1ETA1 3IGKA 2JI2A 1ZTXE 2LE9A 4X50A 3CCHA 4YO0A 1V7NH 4ESKA 3LJ3A 4LSTH 4Y2NA 3PHOA 3NFNB 5GRJH 4AV4A 2DLEA 2B5IB 1S7RB 4NQEE 1I1FA 4OFPA 4JGMA 4TQ8A 2ZWNA 1MAML 4KNQA 3NA9H 2P49B 4NN5B 1LE5A 3J8F7 4QOKE 3QRLA 3WO4B 2B7DT 2HFFA 3EYUH 1IGJB 4NRYB 4BD4A 2H3NB 1FNLA 3HZVA 2WLZA 1AD0A 5IROA 1P9MC 2ROXA 1EFQA 3ZZLA 5A3ID 2XICA 4DAGL 3KYMB 1U8MB 3U82B 1TTRA 4D0CA 3PL6B 4IDJL 2XWBA 4JFFD 4BJLA 2X6CA 4AEIH 4R96B 4QMEA 5CP3H 1PKOA 2GCYA 4K7PL 1EHXA 2YQGA 5F89A 2R27A 2Y6SC 2I9TB 3S35L 4FQLH 2GBUA 3VQ2C 4Y1AD 4QNPF 4WTZG 1FFNB 3QEHB 1V8HA 5CD3B 4KXCA 3U0TB 2W07B 3QI9C 5M7QA 2X53A 1ZT7A 3U2SB 1Z2KA 4ANVA 5LXGL 3EXJA 1EJOL 4ZD3H 2WZ6A 5E08H 3ZT6A 1AXSA 2ZUYA 3FYEB 4OCXL 3SEPA 2J8UA 2MOVA 5KSBA 4CN1A 5CBEB 4MAUH 3V0AC 5GXBB 1BMWA 4FLHA 1U93B 4S2SA 3HUJA 4H25B 2XTJD 4AYBA 3INUH 3PDOB 3PDDA 3QAZC 4YSQA 4YXHL 2O61A 5ESQB 4U1JB 1GC1L 2CXKA 2D3VA 2NZ9C 3TBSB 3PJLA 2PMZA 4BSWB 1H0DA 2IAAC 4HUUB 1VESA 3ZK0A 3S2AA 1UC6A 3E8UH 3RFZB 2QGEA 3VW3L 4NS0A 2H6UA 5AB0A 5JZ7C 5BMFL 2UYLA 2APTA 3CSYA 2YFNA 3GSRB 4MCNA 2GEQA 1V7NL 4KOCA 4Z7UB 1E3ZA 3QJXA 3GMQA 1P1ZB 3IMUA 5GJTH 1JZ2A 4JB9H 5DRWB 3OKEA 3CX5J 1TO5A 3GMPA 3NCXA 4IOSA 3FTWA 3DOIA 3WE6B 5D7JD 3CVCA 2EKJA 2Y7NA 3MRKB 1MCHA 3DX6A 5DJAA 1YNKH 2GBTA 3IU3A 1INEL 4OFDA 3H9YA 3G9VA 4IIQC 3WEXB 2CO7A 2MPAL 4WUKH 3LQAH 1A3LH 1UJ3B 3APCA 4P4RB 4QY8B 1PVHA 3ZTCC 3BSHA 4AQ1A 5IB4B 1FYTD 2JLLA 4N0UA 1E30A 3K46A 2W9EH 1OK0A 5CJQL 4WY7H 4I48B 3BCDA 3M1OA 4EUPH 1FFPB 3TASA 1IQDA 4OGQC 3BN9C 5I1IL 1BF5A 12E8H 1IARB 1VFBB 3ARFB 3SCMD 3EYOB 1COBA 3D48R 1PQZB 3T1WA 5K1VA 3AC0A 5GRVL 1DJZA 3CK0L 3QRFM 4BZYA 3PPSA 5C08E 1FZJB 3FOMB 5GS3A 5IVOA 5JIDA 1Z5HA 3D12B 2VT0A 3DX8B 4UILL 1V5JA 2AKRA 4NRXB 4G8GB 3OKYA 5JXEA 1CD8A 4Y0GA 1OTSC 4CKQA 4U6HA 5E6ZA 5IKCA 1GY2A 2JXMB 4LLUA 3PP3H 3TCLA 1Q4NX 4YBQC 4F8NA 3ARQA 4PGBB 3GUTB 1KBWA 4P59L 1NIFA 3OWEA 3IYLW 3IAPA 4U1JA 2DWEA 5L8KB 1MVUA 1N5AB 5HDOA 5DRNB 5T1DH 3TONA 5IEKA 2WQRA 4V2CB 1RJLA 4GNKB 1OF2B 3VE0A 4FCAA 1U92A 5GGRB 2ZAGA 4QHKI 1M6OB 3RWHB 5FGRA 4CW1B 1IIIA 3IS0X 4GJTB 2VXTL 4XPGL 3I6KB 2GI0A 2ESVA 3LZFL 4KDWA 1CTMA 2KZ1B 3BKMH 4LEBA 2AQ1A 4QRSB 3X14B 5D93C 5F8RC 3OMNB 4APXA 1SM3H 1NGQL 3IXTB 5FYKE 2DJMA 5C3TA 3C8DA 1VFUA 5ENWA 4F8QA 5F89B 3CZFB 4BH7A 2X9XA 1I7TA 1XSIA 1V05A 3H4HA 2TSAA 1NGYB 4PTUA 3GT6A 2JB6A 1BWMA 4M8QA 2YXMA 4ZFOL 3KYMA 4BINA 3CV5A 2H8PB 2Y24A 1ZXKA 1CR9L 1JNLH 5ECGA 5FB8A 1JN6B 3MNZB 5JW4N 3EUDA 1PQZA 4JVWA 3U6XA 4Z3TA 3NRQA 1RVFL 2JKJA 3KR3H 5L88H 1QHQA 2HH0L 2JCWA 3UBXB 2EILB 2H0PA 1EZVY 1MCBA 5J89A 3KR3L 4RDQG 5EPMA 4RRPM 1BF8A 2XKNA 1SVCP 1SLUA 2QEJA 4W9LC 1O7VA 4YBQD 1MLBA 3DETD 4PJGB 2OMYB 2B59B 2NR6C 3OKDA 3SBQA 3HI6L 3DO4A 1E5ZA 2BMKA 4ZO9A 4ZXBB 3IEAA 4R4NC 2YGVA 1H5BB 5MEOA 5IROC 4GAYA 4XB3A 1YEJL 3MLWL 1SY6A 5GGRA 4MJ5A 5DDHA 1DTUA 4KBPA 3B83A 1K5NB 4IIQB 5D7LB 3JT2A 1NFAA 2VSMB 3SYQA 5KSBE 4XPBH 4L0YA 3O6ML 2Z8SA 2ARJQ 2BC4B 4YUEL 4LEOA 2E9WA 3BXNB 1JF1A 2H26A 4HCIA 2VH5L 5AW7B 5TDNA 5FO7A 1HSAA 3CN2A 3L3HB 5TE7L 2MCG1 2WJ5A 2EDYA 3MI6A 3O0LA 4APXB 1HEZA 4H0IA 1G7LA 1WAAF 3MLRL 1J5DA 4MXVE 1A6TA 1J9CT 4JFDE 5AB9A 1NGWA 3ATFA 3KPNA 5DC2A 1IAIM 3MX0A 1M2OA 2BVUA 6PAZA 3KXFE 4N3TA 1X6LA 4MXWH 4H44C 4GUQA 4OB5H 3BKYH 4ZUWA 3R8BB 5EULV 3EYUL 4KVPA 5ANHA 5TPWH 3U4EA 5SV3A 1GVIA 4ZW6A 4POYA 2AVGA 5JPNB 3ZE0B 3B37A 2IDSA 4FZEL 1ZLWH 4FJYA 1RZIA 4Z7NE 4YHOH 2BVQA 4LDCA 1EEUA 4JPVH 4E9VA 3BP6B 43CAB 2MEJB 2WW8A 2Q76A 3QJOA 4QAMB 3TZVD 1B3JA 4H2CA 4YZFE 1ORSA 3E1ZA 1TZIB 5JHBA 3OX8B 1X7QA 3K72B 3K2UL 2W0LA 4YE0A 1NDGB 3KBEA 3R7RA 2IFGA 2WXJA 4X5XB 5E1HB 3CLEH 4KGJA 3WYRA 1MZYA 3FZUC 3HRZB 2WCSA 2NQ3A 4GLRH 1I9EA 1RPKA 4R2GD 3V5HA 1JUFA 1ZHKB 1JHLH 1P6AB 5CZKA 4HMDA 1UKQA 2XZCL 4ELMA 1R75A 1JGUL 4YHYB 5KWYC 2ZAIA 3MCKA 2JJWA 4OZIF 3B5HA 2PWEA 5B39B 3LB6D 3MRBA 1MHCB 3WEMA 1I1AB 2FIKB 2OQJB 4PJ7B 3J07A 3KWXA 3VXRD 1U95B 1INDL 5D4HA 1HQRB 5J6HA 2A1WH 2VL5B 4HZLA 2AQQA 3MLSH 4BK5C 3RGHA 2ITEA 1EAQA 1Q0YL 4HXAH 1ODUA 2MQCA 4N2HA 1OHZA 3VYNA 3ZQXA 3X11A 4YHPB 4Y8AA 4NWUL 4H88L 1USZA 2WBJD 4KKBD 3L7EA 1DUZA 1RZ7L 4IMLB 5BUPA 1C12B 3V0FA 4C59B 4DP0X 2OJZL 3D25A 1EBPA 2BSRB 3C8KA 1GMIA 1X44A 3LPPA 5KVFL 3LS4L 2AEQL 3LSOA 1MF2L 2J12B 1JGDA 2WO4A 4Y8DC 5EFIB 1JGLL 4PIBA 2PO6C 3IMSA 3IM1A 4ES9A 5T3ZE 1KB5B 1MG3C 4U31A 3RWCB 5I73C 3HLAB 1FCCA 4Y5YC 2FEJA 1OPGL 1BVOA 4AMWA 3ARWA 3BP7A 4XAWH 1F4YL 5EZIH 1RHHA 1N6QL 2ZSWA 4WQOA 1ZJAA 4Z78B 2A38A 4AXWB 2GCYB 4UINL 2VXSH 3OWRA 1MPAL 3GJEB 2BIOA 3I2CH 1CGWA 1ZV2A 5I66B 1BMGA 1X5IA 4PB0H 5EUOF 4AI7A 1NGZA 3CQFA 4I0PA 4L4TE 1NLBL 1IAKB 2DQ6A 1P4UA 3PNWA 2FQEA 1I8AA 1K4CB 4WV1B 5EIVA 1EH9A 3VM7A 1TZGL 1NLBH 2DICA 2E76C 3DJSA 4M29A 5GRXG 3WNKA 3ZLQC 5JXAL 5FGSA 1Y1DA 2B1AH 1LO2H 4RSYA 5FA4A 1YNTB 4U2YA 1N0LB 5I75C 4UQAA 4KNSA 1SJVA 3PNRB 1DEEB 5CCHE 4MD0B 2BMKB 2EIZB 2XKSA 4JFFA 1PNCA 3R8QA 1BREA 3N41F 4PVLA 4YHZL 5E9AA 6FABH 1OD7A 3V4UH 3QYMA 1JDDA 3EYQD 3SYPA 1NGPL 2FK9A 2PXYD 4OD2A 4C58B 4HAKA 4NM4H 5DJDB 4EIUA 1Z9NA 5I30H 1E5BA 2ZWZA 1G7PB 1U91A 1UA3A 2FNWA 2H0EA 5C71A 2NX5A 5L0QC 4WFFE 1S7XA 3EH4B 1BW8A 4XCNB 2CGYA 2QKIB 3QUMA 1M7UA 3H9SE 4LKCB 3VH8B 1YN7B 3ZN6A 3S48A 1FVEB 2K0RA 3MCYA 1NICA 2XBTA 1WCQA 1OAKL 4HEPG 2GIMA 4WW2A 4CC0A 2GBVA 3CHPA 3MYJA 1Y18A 2D3NA 3MCLH 3WCYA 4WHYG 5D7HA 3ARGD 4AW4A 3RUGA 4UDTA 1P69B 3F64A 3FSOA 4TRPH 3L3IA 4FDWA 3IFNL 2PPCA 2FBRA 4AYEC 5HJBA 3K6DA 3F01A 3N1QC 3KPRA 2ZE0A 2KYIA 4P2OB 3RWDA 1B6UA 2G2PA 5I74B 4IK6A 4C55A 5FF6A 4PWJA 4Y1TA 1VFOA 3L16A 4BH7B 5GHWL 4JDZB 3C5ZC 4K7FB 2AJVL 2YD7A 1AACA 2E7CA 4HG4J 1FFTB 3GIZL 1UG9A 3MC0A 1CFVL 2P5WB 1JTPA 4P5TC 3B6SB 4PJHA 4HSCX 4XBPB 3Q48A 1UOKA 4WFGE 1JN6A 2BOCA 4O9HL 3MV7E 5GS0D 3T4YB 4UNIA 1LO4L 3T77A 2PW1B 3MN8A 1A3QA 1QO3A 4HS6B 4UB0H 1IC7L 1WGOA 4ODVH 3CXDH 1G9EA 1KELL 1A7NL 1JI1A 2WXIA 4X5QA 1NCBL 5EF2A 1T03L 1U8JA 3MJ8A 2AEPL 2EIMB 5K1NA 3E3QE 4MNGA 1BIIB 2MTAA 1WZKA 4ZX3A 4WU5B 1KEGH 4AIOA 1PX4A 1TU2B 2DIEA 2EXWD 1S5IL 3FB5B 1F2QA 4UDUA 3NSFA 1TXKA 3RPKA 5IV2B 5GIRB 1A6VL 2N1TE 2QVMA 4N5UA 2VLJA 1KT2B 1IEAB 3DX7B 2WVTA 4N2BA 4X98A 1CE6B 5GJSL 3TH4T 3A4EA 1D9KC 1JHKL 1RUML 2A4EA 1XXFC 3K1KC 4P46B 2I69A 4YIQA 4XO9A 1M71B 3WDJA 4U7MA 1MEXH 4IMLA 4JQIA 3W39B 1EZUA 1S7UA 4HFUL 2VH5H 4P4KB 3W81A 4L8BB 2B0SL 3NYKA 4MGXA 2J25A 4PJEE 3PAZA 2W0KA 5DI8A 4DZBA 3IJSA 1T6VN 5FO7B 3UC0L 5IQMA 3BVTA 1TLMA 3J27A 3BQUB 1KFAL 1CE1H 3L6FB 2MPVA 4RDBA 3DLQR 4FI7A 4WW2B 3RWGB 2ITDA 3HMWH 2BRQA 3I74A 3KLQA 2GFBB 3RIFK 1E28B 1R6VA 4I18B 3KWVA 1U8IB 1OLLA 1AYRA 1XVSA 2YPVA 3RDTB 1QPPA 4FQQA 2I9LA 4MD5A 4PJAF 4GKZB 1NJ9A 4HPOL 1ACZA 4QYAA 3T77B 3VA2C 4N0YL 4EZMA 1OP3K 2OMVA 1SYSB 1PG7W 3DK0A 4OGYH 5D2NC 5TE4L 1BQSA 3QRGH 1WZ1H 2GITB 3KS0J 4ELMF 5LNGA 3UGEA 5HJDA 4PCKA 4HJIA 4MJ6B 1NAKL 3VSTA 5HPOA 3NCFB 4EN3B 3ASWA 2HFGH 5C0BE 3VWJA 2E8YA 1G7HB 2EYRB 2BIIA 1AMYA 4PBVC 3ZT5A 4NSKA 4A2DA 1HCZA 1IGML 3D87B 3BD3A 1DP0A 1UGNA 2F53B 1KBGH 2Y6SD 5JQ6H 3T8XB 4W9CC 1F56A 4U0QB 1ZPLA 3FT4A 3QFDA 1OCOB 2PYFB 2NW3A 43C9A 1BV8A 1XGUB 3D52A 4LP4A 4OVVA 5I8KH 5EOQH 2H2PC 1HYSD 3O4LB 1DQVA 1CI5A 1SXZA 3M88A 2WYTA 1FDLL 2WBJB 4KJWC 2PO6D 4HFUH 2MWCA 1XR8A 5BRQA 3K8LA 4ZO8A 1IBDA 5CGTA 4DNLA 4R90L 1NANI 5TPWL 1T6WA 1YQVH 3BIKB 3QQ4B 5GGVH 4PJCA 3ROLA 1WAAA 3FJTA 4K3GA 5D71H 1AH1A 4Y4FC 2DQCL 2WXKA 5I8CB 1XTLA 1NFIA 4JZJC 4PH8A 3WFDL 3PCYA 5I19L 1AP2A 4OF8A 1E3XA 5T3XL 1DJWA 5F1IB 3VXMD 1FAIL 3HZVB 1KTRL 5AW8B 3GMRB 1QNZL 2Y2TA 2XN9A 4ODWB 2WUBH 1FAKT 2B20A 2YPLB 3RHWK 3VI4A 4M61B 1QKZH 2G60L 3QUYB 3CFMA 3U0TA 3WDHA 2FE0A 2O26U 2EAEA 4GFXA 4PRPE 2GITA 1KBPA 1ZVSA 4HMCA 4MMZB 3ETTA 3M1BB 4L4VB 5EBWA 3H56A 1CDHA 4I85A 2PETA 3O3EA 1QAWA 3HBPA 2NQDA 4Z0XA 4L3FA 2WWKO 5B1BB 2FRGP 3HVNA 3VTTA 4ERSL 4KMLB 5AVYB 5C6TL 5L9DL 2XPZA 5CD5D 1TDQA 1U3HA 1G87A 3JV5A 1MJJA 4XTRD 4DEWA 2EKSB 2C9XA 3DHUA 3DUUA 3MV9A 1JERA 3FQRB 1FI8C 1M53A 5DZOA 4U1HA 4NZUL 4F7PA 5H2BB 1E5CA 1EZSA 3OJDB 4E41D 3KYOA 5I76B 1QBLL 3N42F 1I9RL 1DVFA 1KCRL 4MJJA 4Q89A 1RUAH 5I1LB 4L3EB 5C0BA 4HLEA 5JW3H 1MCWW 3BAYA 3LKSB 1THCA 1ZRUA 1BVLA 1BZQK 4H2AA 4HPHA 1GY1A 4M7JL 3OSKA 4G7VH 2FZ3B 4UM9B 2X1PA 3OD3A 2DYRB 5C97A 2YAOA 4B96A 2W60B 3BLBA 3KG5A 3MV01 3R0MA 4OGAC 1GXEA 3VGHA 4GO9A 1FFQA 1F97A 1KLGA 5FYJH 4Z7UF 4WEMB 2VLJD 4POZC 4LDOB 1CFBA 2C9UA 2Y9RT 4JDEB 3S7GA 1BQ5A 1H3TA 2HWZH 3PWNA 4AZ8B 3W5NA 3FQ1A 3HN5A 4AJYV 1D5MA 5H94B 4CL7A 2H6PB 4UQ9A 1UVQA 3L4TA 1VDGA 5I6XC 3BWAA 1QZNA 2NY5H 4E2OA 4U1LB 3GS0A 5KS9E 2LOEA 3APFA 1A21A 5IFJB 4J3OD 1FORL 1WAAE 4L4JA 2KZBA 4LRNH 1FL3A 4UNVA 4XX1E 1F42A 2NDGA 4CU8A 5LJYH 5D4JA 3OB8A 2VITA 5BVJB 1W0WB 2GUYA 3NIDE 4ODWA 2KT6A 2R2BB 4GSUA 2LU3A 2VIRA 1V3LA 3QEUB 5DHEA 3K2KA 3RWJA 5C0JA 2VR3A 1U36A 1ZEAL 2BIMA 3L95B 5E2JA 1SN2A 2XJLA 2YIHA 4ZNEA 2NY0B 5ISZD 3VXUA 3T4YA 4OD1L 4H8HA 4X6EB 3FQNB 3T3MF 3DTUB 3TVMA 5D1ZD 1AR2A 1D5XB 1D2OA 4JY5H 2V2XA 4DAGH 4HFWB 3ETSA 4NZDA 1KXQE 2JKXA 2R4RL 4OAWA 4OI9A 5J06A 3LAFA 3EO1A 2ED9A 1XF4A 4LVEA 1OAZH 4WGVB 1PCSA 5KYXA 3MFFA 1ZHLB 3SE4A 3U4KA 2Z7ZA 3JBG7 1G9NH 3BT2L 3QXWA 4HWEH 3EGXA 4M02A 1RSYA 3KHQA 2DWSA 4BIKA 1FLRH 3S8GB 3ARDA 1KPVA 4OF7A 1FYTA 2XSKA 4LIQE 5F1NB 1BYPA 2Q20A 4MNQA 4MRCA 2DWDA 3KGUA 3NZSA 4RGND 2CAKA 5F0JB 3EGSB 4NNXB 1BVNP 3L9BA 1VGKB 2K6YA 2WXHA 3QEGL 3H9HB 3UO1L 3KDPB 5F8QC 1Q72H 2WV3A 3CFCL 2KL6A 5F9JA 1SPDA 5F9OH 3RNQB 4F27A 1L3WA 2MRYA 1A4KA 1FNSH 2YPVL 2IDTA 2BHZA 2AI0H 3ZVVA 2Z31C 3BZFB 2VXVH 1BXUA 1YA5A 2XWZA 5I82A 5L4FA 1QUNB 3VYPA 5B39G 1S5HB 3G5YA 3WNJA 4JPSA 1NH6A 3QH3A 1MWAA 4PWKA 5BZWA 4BGLA 4PJFE 4Q9BA 5T5FA 5IBTL 4YNYA 4R9HA 5DJXB 1UD6A 2VR5A 2IQAA 3GB7B 5AZEH 2KERA 1F3JA 1XB6A 1YEGL 3FUMA 2W9DH 4HK0B 4BUHA 3Q05A 2WVSA 2HPTA 1KTJA 3AG2B 4N6QA 1SHWA 1IIKA 4ICWA 2KLRA 4E41E 4PY7A 2IAMC 2N7BA 6FABL 5ACLA 3T3PB 2AEWA 4O51A 5F1SA 4B9IA 3ME0A 3K8KA 3DIFB 2W91A 3G6JB 1I8LC 4AENB 4ECNA 3PAVA 1KEML 3QG6A 3LD8B 4NPYA 4UT6H 5AVRB 3NPSB 2EUZA 1JUFB 4ZMPA 5IHBA 1W0WA 1Z9LA 4GUOA 4K8RH 3VXOB 2IG2H 5I1DB 4KX9A 1UXSB 4K8RD 3ZHKA 3D3VB 4FI8A 5KYXB 1XCWA 1OT4A 5DFTA 1LEKA 5IFAL 2GJZB 2HAZA 3TS8A 4UQBA 5G55A 1J5HA 1NSNH 3IMWA 4PRPD 4OB5L 1KENH 1HL9A 2WWKT 3LXAA 1T0OA 4F9PC 3VD4A 4LP5A 1R5VB 4JDEA 4HUNB 1SHSA 2K7PA 2FDBP 3ZHDA 3ABZA 1ONQB 1ZVYA 2X4QB 3DVIA 4YFLF 4OJFL 5FAAA 3BGFB 1R47A 2UV3A 1M3JA 4MNHB 2X38A 3ABKB 5DZ9A 5JPNA 5DUBB 5CJOH 3TV3H 1FVDA 1J5OL 2YD4A 3Q1EA 2GSMB 5GGRY 5E0FA 1K6QH 2AMGA 1JNNL 3GHBL 1FL3B 4NQQA 1VADB 4HPYH 3HB3C 3LS4H 2VL5A 3QQ9C 4XO8A 1IAIH 1QTSA 5A16A 4X4XA 1G0YR 4QRFA 5DS8B 4N4YB 4LCUB 4RGMB 2F18A 3T0VA 4LSUH 5DRWA 2IG2L 4FG4A 2YAHA 1FNAA 1JPSL 2YXFA 3BAEH 2QLYA 3ARSA 1A4JA 5HYJE 4G82A 2PYEB 1OXYA 5BV7L 4GXUM 4OVUA 3P54A 2VZSA 4QTIL 3BAWA 2PCFB 5ITBH 2OW6A 1OTTC 4ONHA 1XR9B 3QZBA 2RFXA 1HESA 3SO5A 5I2IA 2WQSA 4RZKA 3GM0A 1ZT1A 2OYMA 5GGTH 4MVBC 1NCDL 3ATDA 5EO9B 1CGYA 3FCBA 4MHHG 4EUPA 4R8WL 4J1UB 2Y1AA 4K3DL 5T1LB 4XWOC 4XHQA 2MTPA 3ZO9A 3SJVB 1CFNA 2IGTA 3M1BA 1J9RA 1AXSB 3OAUH 3OAYH 1GYCA 3P9WB 4G7QB 4KUZH 3QA3B 1A6AB 2ZXGA 2P42B 4HFWA 5DZVA 1HSBA 4I0PD 4XXDA 5JORA 1A7RH 2R51A 3QPXL 1X5XA 5B38A 1LTXA 2B2XH 3LH2L 3PQYE 4ABWA 4MWFA 1KTCA 3R19A 2KBGA 4NQDB 4MD4A 5GZOC 1BJ1H 1X3DA 1WWCA 2EINB 4IRZH 4NUJB 4IHOA 5G5DA 5D2NB 1ASPA 3Q8CA 3ZDYB 3UMTA 4GIAA 3CLWA 4I9XA 3KGRA 1WHOA 1NDMA 2ZSVB 4AM0Q 2FH6A 3BAJA 4J6RH 1HKFA 3GLEA 2I07A 4IRJB 2KUTA 5LQBH 1LK3H 4YDKL 4LLYA 4NHUB 3BT2H 2DQCH 2YLHA 4X7SL 4Z78A 1KOAA 4TS6A 3FXIC 2E8ZA 1L5GA 4P3DA 2ATAA 1SY6H 1IQWH 4DP7X 2HN7B 2N3JA 4PY7B 3OL2A 3TWCL 2ZCKL 4AKPA 3MBXL 4NWTL 1WC7B 1YC8A 3QWOA 5ICXA 2OL3L 2CJSA 3II3A 5DMKA 5DJXA 3ZGHA 2IQAB 1QLRA 1MCPH 3G6JF 3QDJB 4M7ZC 3FCSA 4EN2A 3HZKB 1WA2X 5DHXB 5KSAB 2YRLA 4MJ4A 5HTSA 2EVFA 5FCSH 4B53A 1WYJA 1J0YA 2GJ6D 3UACA 5J11B 1I7RA 1FL6A 2KI6A 3QO1B 4G1MA 5C2UB 3KL0A 3KVDD 4XN9A 5ETUB 3V8OA 3C08L 2VR8A 1J0IA 3NP3A 1IAOA 3I3BA 4FNRA 5FOBA 1OF0A 2GJPA 3A4FA 1B90A 4M48H 4ABUA 3OAUL 2FJHB 1J1OL 2ENPA 2XN9D 3UBXA 5T1KD 4P2RA 3BQUC 5E56A 3ZL4L 1XH1A 2OMTA 4DF9A 4X8CA 3ZTJH 1WLHA 4GG6B 1QVOA 5D1QD 3D4GA 3N55A 4PGCB 3BKJL 4KJYB 3QULA 2AQSA 1CXHA 4L48A 4L1BA 3WI9A 4TVPH 2M26A 2V3EA 1WVZA 3CVIL 4OLUL 1AQKH 4B7LA 2Z9TA 1A7BA 3FU7A 4YFEA 4ZFFB 3EJPA 4PJ8D 4JRYA 1JMZA 3CPLB 4YHLH 4FXKB 1IBGL 4XC1L 2FT8A 4EBQL 3ESPA 4Q4EA 5DTFA 3KYNA 3CFQA 1Q1JH 1AQKL 1NMAL 5LBVA 3SGDI 2GIXA 1KGCD 1VSCA 1JK8B 4NO0B 7PCYA 3LS5L 1C16B 1WQVT 3QUZB 4KX7A 3UC0H 5D4QA 2N1KA 3FTZA 4N2CA 1K9TA 3HI1A 1HEJC 1NDMB 1O75A 4HK3J 4XVTL 1UOWA 1U0QA 4KK6C 4P46A 5AKVA 4LMQI 1GZHA 4WJ5A 5DO2D 2RH0A 1DVFD 4J23A 5AVUB 1MEXL 5BS0A 2XWXA 4GXVL 4AVKA 2FUTA 5CLTA 1U3ZA 3VFTA 1XX9C 4ZK8A 1W72H 5ANMB 1NKGA 4C56A 1EJOH 3KXFA 2RFXB 2WB1A 4ZSOB 4A67A 4PJ9B 4X8GA 1FC1A 4IRJC 1Z3GH 3VB9A 2GJ6A 3SE8H 3FHEA 1DBKL 4MNGB 3ZE1B 1JD9A 1BFSA 2FQGA 3S88H 2LLNA 1H8LA 4NP4L 4B0MB 1U3HC 3HMXA 3P77B 3N43B 2ODIA 3NJJA 2ODHA 3MLTA 3ZY7A 1SMOA 2Y7SA 2QZ5A 3PE9A 1PIFA 5CBEA 4N86A 3U1PA 1RUPH 3U83A 5LUMA 5DYFA 4JHWL 4P2YA 4IKNA 3VFWB 3GZKA 4R3SA 5I16B 1XGTB 2HX8A 1A14L 2DH2A 4CADB 3D39A 4PUBH 4WWKB 1R0AH 3CC5A 4N8VG 5GGQH 3WJMB 3MJ9A 3ZYIA 2ZP0T 1XCTA 3LB6C 4HSQA 3PWJA 4AYGA 2L4OA 4X9GA 1BVKB 3NFSH 3O81A 4NNYA 4NUQA 1I8MA 5KBKA 3LIZL 3LVTA 3OVUB 3Q5YA 5G2NA 3U4AA 1ZGLP 3GF8A 2BJMH 2CLVA 3KNBA 3RU8H 3T1FA 2ZUUA 4P23D 2V8LA 4JJ5A 4MZIA 3GK8H 3PGDB 1KG0B 2AV1A 3RKDD 1GJUA 1I8KA 4OM1L 1H3WM 3BO8A 2EO1A 3GTNA 4W93A 5KOVC 4NX0A 4PS7A 5ISZA 2RMNA 1XEDA 5L2KB 1PAZA 2WHVA 2B9BA 1FN4A 2IQ9H 5JW5B 2A3TA 2AQTA 2OMWB 4B50A 5DRZA 2IPKA 3MUGB 4J3UA 2O5ZL 1IC4L 4M56A 3QDHA 5KS9F 1UM6L 5DFVD 1NTDA 2E46A 3ES6A 2OJEA 4TNWK 4YR6B 5AVVB 1D7CA 1KUMA 5E9NA 3UO8B 1RUQH 1O9ZA 2VAJA 4ERSH 4K71C 1XF2A 2O1AA 3GXTA 2XCMC 4TM9A 3WTVA 1CBVL 4LK4A 2FH8A 1AIFA 2DM3A 4DW2L 4D94A 3D0LA 3WIHA 3KLDA 2C1OA 4JM2A 2EUVA 4X4YA 3BVDB 4ZW7A 2BNQB 3FQTB 3QSKB 4PJDE 1KLFA 2LFEA 2BFVH 1TTGA 3QFJE 3QPQC 4MA1B 3TO2B 3NDYE 1U8HA 2VISA 4P3CH 3VD1A 5I1KL 2FBJL 4A2LA 1MCJA 3O0RH 4LOVA 4Y2OA 1T4WA 2VABA 1PY0A 2Y1ZA 5DC0A 5ANMA 5FK9A 4E9YA 4I7ZC 1NC4A 5F7MC 2Y36L 5T1LD 2HFTA 2WZPA 1ZVHA 4CSPA 2EIKB 1NFKA 4BRVA 2V3FA 1J5CA 1KF9B 3JV4A 2KC0A 3MCG1 4K5LA 4AUJA 1EANA 1MNNA 4XNQA 3RBSA 2ZWYA 4A2HA 1LEIA 2IIJA 2OR8A 4A6YA 4G6FD 4Z76A 1OP9A 1DUYB 4GRLB 5I23A 1KFAH 1ZAGA 1ZANL 3D2UB 3GFUA 2NTSP 5F7BA 3VGGA 2CRYA 3PF2A 3K2MC 4ACTA 1R5IA 4PJ8B 3FT3B 3FU9A 4WUUB 4WAFA 4NQTA 4Z18A 4J4PC 3VXSD 3EJZC 2VMFA 2F2HA 2CKBB 4MDJB 5CLWA 3CD4A 1DBBL 3SDXE 5I1GL 1BZOA 1OSYA 1B88A 3LKSA 2XPYA 2HTKC 2P80A 3MGTA 5HGHB 3CCHB 2NZ1A 1AGFB 1QI5A 2NOYA 2QTVA 4NXSA 5IBTH 5SX5K 3AUVA 4LP8A 2ICCA 3PV6A 5IB3A 3P4NA 2A6DB 2ZOTA 1QRNB 2VC2H 2DIAA 4P5TA 3OJDA 2FEEI 1MF2H 5AW5B 5H2BA 2FNBA 4QKXB 5BOPA 3WLBA 3SY6A 4LLDB 3GSUB 1U8CA 3F7RA 2DQMA 5DD0H 5HDQL 4EN3D 1H9DA 4HKXA 1MREH 1G9HA 3N9GH 3FRPA 3HMXL 4HJ1A 3NIFB 2ZSWB 1FFOA 4W9KC 3IFPA 2DM4A 5HDBE 4HLZH 3FFDA 4P5RA 1GCYA 5ALBL 4DN4L 2YGQA 3VFRB 1J8HA 3QQNA 5DU7A 5C2BH 5HVHC 5SWQA 1TSRA 5IB2A 1HHJB 2CGRL 3DMMD 1AS6A 3K0YA 1A0QH 1GR7A 3NRPA 1BM3L 4RWHA 5IJVA 4FJZA 4XX1G 4YDZA 3UGUA 1NCJA 1I85A 2CBQA 3MRLB 1JHTB 3QE5A 4KK5C 4NIYE 2BERA 3WS6C 2H9GB 3SBRA 3HZKA 1A0QL 1YEGH 4F57H 5HYSG 4PJ9D 1JF5A 4FF9A 3VFWA 4YDVA 4Z23A 4ADJA 4KFMA 1E4XI 4NENB 1RMFH 5DD3H 3VFVA 4MS6A 4BQ9A 2Z92B 1YYLH 5TF1H 5JHDB 2R1YB 3CSTA 4OGZA 4TN9A 4I1PA 1Z66A 1WTLA 2M8XA 3D2UA 4P2RD 1R46A 3EYVB 4E9RA 5BVJA 3HNVL 4HUKB 1ORSB 3IB4A 3PP4L 2SEBA 3G6DL 4IOSD 4P2AA 1EO7A 1KPRA 4HKBB 3V0VB 4HAFA 3VFNB 1JNNH 1K6QL 4HDIB 2PNDA 3V4PA 3KPRE 2DB8A 5DLMH 3OXRA 1QBML 3KLHC 2LHAA 4X7TB 1NBYB 1H0DB 3O6FA 3UTTE 3F2LA 1GGUA 2APWA 3CVHB 1UWEH 4KPHH 5KANI 4M3JA 3SDDB 4NC1C 4TMPA 5DMIL 1KTKE 4TSBL 4AE0A 1JV2B 4XTRC 1IBZA 2D8KA 3G6AA 5DVOA 4X4KA 3NJNA 4PJAE 1F6AA 2C26A 4LO9A 3MA7B 2A73A 3B3BA 1OSPH 2X1OA 1NAMA 5JHMA 5CZXC 4Q9CA 4Q52A 5I18L 3VFGL 4GKOA 5FXCH 3BP4A 3OBAA 4FZ8L 3R1GH 3N40F 4HT1H 3TLRA 5ADOH 3MRHA 3HAEH 1OE3A 4K94L 1RZFL 3TBTB 1P7QD 1OZUA 3DROA 3CZLA 4QRAA 1K8DA 3KPLA 4S0SD 3UMNA 5KUKA 3C8HA 4QRUB 1Y6KR 2V5SA 1BGXH 2YMTA 2P28B 2QSTA 3SQOL 1I9RH 5T3ZL 2BP3A 1WFNA 1F45A 4FKHA 2UUDK 3OTTA 4ZS7L 4L8CB 3WBDA 1HDMA 4QRPD 1FORH 4BZ2L 2JQZA 2H2SD 4TSBH 2XQBL 4L23A 5EBLB 4QJ4B 1XSJA 2CH8A 1LEIB 1IVLA 2ICWA 3G5ZA 3AREA 4MAZA 2CO3A 3UERA 4NT6B 5C0AD 2CK0L 4HIIA 4CMHC 4OZIE 1PKQB 3RFZA 2I5YL 5F1KC 5DEGA 1XBDA 3K5RA 3SDCC 1NCHA 3PUUA 4HX1B 4F9LC 3QZWA 3ECWA 1QWHA 5CLZA 3AY4C 5GS0C 2FATH 4BKLA 2NT0A 5BCAA 4K2UL 2AXWA 1YEFL 4U6TA 1RFDL 2F7OA 2HP4A 1LEGA 3FBKA 3TH3T 3IJEA 2LVEA 1RZ8B 4PRPB 3REWB 3VAEA 1T5XA 3ULUH 4LHQB 1WS7A 3D18A 2BS9A 5JNYB 1ONQA 2NYYD 2TRYA 3DUHA 3OLEA 4XODA 3W0WD 4BGDA 4Y9FA 4QGYA 4JCWA 1RZQA 4IU2B 3HZYA 4ZODA 1J88A 3U48A 2PCYA 1YECH 2WTPA 4KVNH 3QCVH 4P99A 4Z8FL 4KZEH 5IMMA 1NGPH 3EJTA 1BX2B 3DBXA 4N20A 3RDJA 4NQDD 3PWPA 1F3RB 1NDTA 3GMMB 4NKOA 2VUOA 5K69A 5I6LA 3RGVC 3QQDB 2NY5C 4CW1A 1QRND 5J7CC 1MJ7H 3QUKB 5IQLA 4X7SH 3AM8A 3EG9A 1D7FA 3ARBC 2JJUA 2UWEE 3VU1A 3UYPB 1IGFL 3MRFA 1AXTH 1FV1B 4Q0XL 4BSVB 3QXAB 3EYSH 4FNSA 2AJSL 2OXHB 1JFQL 1T0PB 2F54B 1UWEL 4FQQB 2XG4A 3VI4F 1RHHB 1CGTA 1KIUA 2EDLA 5IF0B 5C09E 4PGEB 3S88L 1GOGA 4MA7H 1U3JA 1T1XA 2ZF9A 4GAFB 3TYFA 3L1GA 2YC1A 4LCVA 4CBPA 4FX5A 1FL5B 4QYOA 1FH5L 1WBYA 5ICUA 3SOBL 2PXYC 5E5LA 5AW2B 1WT5C 2C3VB 4GIPD 4ZUSB 4WF7A 3DA0A 4OT1H 1JRHL 2RQ8A 2Y06L 2WUBL 1QSEE 5T1LA 2DAVA 4JHUA 4Z0BL 3H2WA 5A2CA 1TQSA 4I0CC 1J8HD 3QHZH 1I3GL 1IAMA 4MKTA 1UD3A 3GNML 3CZNA 5J5EA 1A3RH 4JANB 1HAUA 2QPDB 2AJZA 3C75A 3FULA 4JN1L 2KMWA 4Y16C 3TPUB 2X9ZA 5IR1A 4QWWD 1FSKB 3Q2VA 4M62L 4RA3A 2NPLX 3TA3D 3SHSA 5KVEE 3GZQA 4ZAKC 5KBNC 3OGCB 1TJHL 1AI1L 2EECA 3DKHA 2W0FB 1O7DC 1PEZA 1J12A 3BKCH 3OZ9H 1XD0A 4KKCD 4M5SA 4M5YL 3O11B 3B43A 4FQIH 3T4AA 4JUSA 1U33A 3V0IA 4DGWC 1A1OA 4IU3A 4TQEH 4F7EB 1P1VA 3NIDB 3PLYA 5B22A 5KSUA 4JFOA 1XAUA 2QVFB 3HG1A 5EOQL 3HHSB 1SLWA 4LSSL 5K39A 1KCRH 4I88A 2CKBH 2PP8A 4WNQB 4GSDL 4AIZB 4XNDA 3V0WH 3ASOB 2FJFB 5EUOE 1HWGB 3J2PA 3DYPA 3QUMH 3MRDB 1CPUA 2BOLA 2VNCA 2VC2B 4HIJB 4LBEB 5EMYA 3V6OE 3FFCE 1HL8A 2I5YH 3F7QA 3VD7A 1NM9A 4OLEA 3ZDXF 3RY6A 5I1CL 1D2PA 2CJUL 3NZ8B 1A5FL 3NSYA 1AVAA 2VXUH 3VI4B 3VSVA 4PJAA 4XZUA 2QGCA 5E99L 1YLBB 1PD0A 5C0NC 4N0FA 1QYGL 4HEPA 2D7NA 3IKKA 5LO7A 3B8SA 1TR7A 4G3YH 3BLKA 4XN2A 1OEZW 3ULVL 1HVXA 2VYRE 2FR4A 5C07A 4YHYC 3U4EB 3W5MA 4K7FA 3BWUC 4GRWH 1EQWA 3OLGA 2DD8H 2QADD 1WICA 3FRUB 4FFTA 5DWUH 3NZUA 4OLYL 1UB5A 4DP1X 1OSZB 2WLMA 1G6RA 3X1BA 3DJRA 3FQYA 5EO9A 5IFJA 1EHAA 2E7LC 3Q2CA 3FB6A 3FDWA 3MDJA 3BEVA 4TYUA 1E9OA 3T65B 2XTJC 4NT6A 2PW1A 5AAMC 4OZGE 1MHPL 3O6FC 3OR7A 4UMGA 4KHTL 4JRXA 3B9KC 1P4LB 2PCPB 1JV5A 4H0HB 1T21A 5BZDA 4WI8A 4WI9A 1T6BX 3MRQA 5CEYA 4G1MB 2CGZA 1CG9A 1J48A 1CLZH 2XWCA 3K1DA 3L5HA 2VDNB 4J3XA 4I9WE 1K2DB 3CH1B 1MY7A 4PJBA 1J0JA 4JZNA 5E8OA 5F6IB 1QX1A 4GAGH 2L3BA 4E41B 5HGGS 4LOEA 4YQXL 2PO6B 4K73A 4KH9A 2BNRA 3JYCA 1ZHLA 3N5AA 4XAWL 4L3EE 4OT1L 4WK0B 2LVCA 3LEVH 1I31A 1A9VA 1TT6A 1A6VH 1AE6H 1TQVA 1WC7A 2G3MA 3QWOB 4H1LH 1SHMA 2YKKA 4WWKC 2DJUA 4PJ7A 1XBRA 3WS6A 2WTRB 3PWLB 4Z7QE 1OCZB 4TSAH 2IAMA 1PGRB 3VB8A 2Z4TA 1OY3B 2WWMD 4L8SC 3QJQB 3THMH 4U6VH 4ZS6D 4AQAA 2WO3B 1J8KA 3U0WH 1Q72L 4OD3H 5IK3A 5FKAA 5B1CA 5FECA 5DFVC 2P48B 5GZOA 1XF5A 2ZYSA 5D1ZA 3MLVH 3QUYD 1NCTA 4TQEL 4W9EC 2TAAA 1SVBA 4MB3A 1KGCE 2ID5A 3H85A 3VXQA 5JOFA 2X5PA 4CVZB 1JPGB 1OALA 2FX8L 4F57L 2FD6L 3UPRB 4PJIF 1KJ2L 4PJFA 2UZIL 4K5MA 2ED8A 1JNLL 1PG7X 3BAIA 3SKNB 5ADPH 4NO3A 5EBMB 3AWGA 2X7LB 2FLBT 4HG4K 3EYVA 3AVEA 1A7QL 5D7EA 2RBLA 2XN9B 4XNYL 2EE6A 5GS1A 4CADA 4DHLA 3DETC 1H3PL 4PRNB 5DJ8A 2MFNA 4TNWF 4JHAH 5D1QE 2HJLA 3W82A 1E7VA 4L8DB 4HS8H 1UM6H 4F8OA 3A6CL 3TYGL 2J1XA 5C3IA 4XXCA 4AGNA 3DO7B 2VC2L 5MI0C 5EIIG 1HOCB 3MCLL 5JPMC 3EOAA 4TNVF 4TSCH 4G8IB 2RR3A 1XR8B 4HZLB 1YDPB 3POHA 4LMQE 3KYOB 3PWNB 4AZ8A 15C8H 2VXTH 3VXPA 4LSQL 4R4FL 7FABL 3HR5B 1NFDF 1Z3RA 3MJ7B 3JWOH 1DVYA 3Q1SH 1FN4B 1SJXA 4H40A 4M7ZB 3HZMA 2YJQA 4XNZB 3VFMB 4GG8A 4BFOA 4PGZA 2CA3A 1OAUH 5FGCE 3GXUB 4TLUA 3BCFA 4BFJA 3WY1A 5DF0A 4XZ4A 1KIPB 1M9WA 3SKJH 1D7BA 2BNRE 1K8DB 1ET5A 1ETB1 1XH2A 3KPLB 4K3JL 4CJ1A 1LE5B 1DBJL 1SEQL 1YJDL 4MCMA 4W81A 1UACL 4LAQH 5IW6A 4LPTA 4ODVL 5FM4A 4HOWA 2OMZB 2YQ2A 1IC7H 4RMRA 5LN8A 3E6HA 3UZVB 5T1JA 3IDGB 4FJ6A 2WIIB 4ZI8A 1KCVL 5I16A 1CDUA 1LDSA 2F7IA 2YMXL 3FUIA 4PI2A 5E8DL 2HT3D 2CR3A 2VXQH 3CN4A 3F83A 1VFMA 2NZ9D 2HJFB 3K91A 1S9YA 4DESA 3ZKXC 1MRDH 5EEZA 1URIA 3NEOA 4OCMC 3FO2A 5GS1C 1HH9A 1TYJA 4Z7UE 3KCPB 5D5MB 4IBSA 1AD9A 1TKWB 3GSVB 4UV7L 1L7TL 3PGDA 2QDWA 3S96A 4U0RB 2VL4A 1NBQA 3AACA 3B9DA 5BV7C 3L13A 3OGOE 1E9PB 4TVPD 3CFDA 1DQJB 3TPUA 4QRRD 2IGLA 4UT7L 1FNGB 5TK2A 3VMNA 3X12B 3BHBA 3L95A 1HNYA 4M7LH 5JHLA 5C0CA 5KJ7E 4DWHA 1HE7A 4UM9A 3TN0A 1M71A 3VD2A 4XRCB 4MNGE 4Q6IC 4UIMA 2UZIH 3HG1D 3VDAA 4N2AA 3UZEC 5CJXA 3GK8L 5CSZA 2AJUH 1I1RA 5C0AA 1X5HA 3FCTB 5KSAC 3OKLB 1CF8L 1INDH 1EEYB 2WXMA 4EJ1C 4OCWL 2UWEF 1QSZA 2BH0A 3MRNB 1CLYL 4PJBE 4N9GA 1MAKA 5HI3D 3VX0A 5F3HB 3U7AA 3MBED 4JFEA 4Y4HD 2ADIB 4AZUA 5F9JB 1YUHA 5KBDA 4R5XA 1N19A 3MKGA 4E36A 2LFGA 4PRAB 4UOQA 2YQ3A 3TBYA 4CU7A 4AC4A 3FFDB 4LSPL 5IKCB 3R18A 2E27H 3H0TB 3AS1A 2BNUB 4XNZC 2LABA 1WH0A 1MIMH 1OV8A 1WF5A 3MMEB 5AVZB 3HAEA 4TNEA 1N26A 5FYKL 3FS9A 1AXIB 1S9YB 2VUYA 3FSAA 3KPQA 3OMAB 3LV3A 3QDAA 5D72L 5FC9A 2DLHA 3B6SA 4PJHB 1FNEB 3PL6D 4PB0L 1VFBA 3D30A 1Q38A 2BM3A 4X2UA 3L9YA 1LQSR 3EH3B 3T6QC 1F18A 3K5SA 4BFNA 4A7QA 2QL1A 4LIQL 1TCRB 3HI6H 3BAXA 4RFEB 4GPVA 1QR1B 3QNXB 4JREC 3BZEA 2FWLB 1T0NB 2AANA 5EF0A 2G2RB 3E80A 3BESR 3DMMA 1H5BC 1C5DA 3WJJA 3LEXB 3SKOA 4N8CH 1ET7A 4YX2H 1NFDA 1BMZA 1DHKA 1EUUA 1TTCA 4HK3N 3OSVA 1S7WB 4DP6X 4HQQL 5MENA 1HQRA 2FJHA 5J6HB 5LBGA 2NY4C 3U46B 3LRSB 3QR1A 2O5YL 2ZOWA 2QHLA 4NFDA 1TF4A 4PR5B 5JOPE 3QJHA 4Z7UA 3VFPB 3V0WL 4KK8D 2DQHL 3MO1B 5GIRA 1I9JH 1G9ML 3TN0D 1RJLB 2JB6B 3DX9A 3H42L 2E9GA 1P7KB 3ALXA 3HR5A 4ZZFA 2ZUQC 1P2CA 3RWIB 3QIWA 5FX3A 4DN4H 4LCWE 4DCQA 4NC1E 3BUDA 3OXSB 2UWEB 3DGGB 3RUGF 3VJ6A 5CCGE 5I1HL 2V0AA 2FBJH 4U1SA 2D7MA 2VQ1A 3MRNA 4XVOA 4NZUH 2JCCA 4PTTA 3ALPA 4WW2F 4KY1L 4TVPL 4GQPH 3US9A 4PVBA 1DJYA 5BRZA 5H35B 2HFEB 5AFAA 5EU6B 4C83B 1HEHC 3F05A 1XMWA 5IHHA 1A7OL 2DWYA 3OM3B 1EAJA 2Z4QB 4H0LC 4ELME 3CFKB 4LE8A 1AOZA 2FWOA 1XH0A 3KWTA 2L8AA 1TNNA 2FO8A 4LLMB 4L37A 1JOIA 1V3KA 5KN5A 1IEBA 7CGTA 4YDLC 4JK0D 1YYML 1Q9WA 3CFEB 1K4CA 3IKCB 2XN2A 3AY4A 4JFEE 4QGTA 3EO0A 1B4JL 5E94B 5C09D 1JXDA 3INUL 3MRMB 4TVUA 4L4TB 3UZQB 4PY8J 1P53A 3LZRA 1B4TA 4UNTA 5JOFB 4DGYH 5CWSA 1JI2A 4F24A 5GZNA 4QRQB 4G7RB 4WO4C 5TDPB 4AYMC 2NUPA 3GUFA 4P59H 4GRMB 4IKJA 4X7TA 5AOZA 4GG6A 1KELH 3L3DA 4PV8A 1WEJL 4ACPA 3ULUE 3QK0A 3FF7A 3WFBH 3MRIA 4UTBH 1OLZA 2CUMA 5DJ2A 4DVRH 1Z32X 3QZMA 4JN1H 3HVDA 1P5VA 2CBPA 2OR9H 1EWHA 1R1CA 3EDEA 2H7WA 4K71B 1LQBC 3GSOB 5E2VH 2Q10A 4HF5L 1A14H 4X9FA 4M1DL 5EN2A 3TIDB 3SJVA 4YN3A 2WLHA 1AS7A 5IGXH 5HGAB 4OF6A 5D96B 5I6MA 4FL4C 4HGWA 4XC1H 4EI5D 4HUVA 5DMKB 4U1SB 3MYZA 4YHLL 1V27A 2B08A 4B9PA 5AOMA 5D7LD 4G6AC 3X1NA 4KKLD 4JKPL 3KHOA 2VDKH 1P7KA 4LASL 2NNAB 3IFNH 2IH3B 1ID2A 5SV4A 3RIAF 3ZKQD 4RIRA 5IEHA 4UU9B 5C0CE 3L48A 2G3NA 4PP1D 5CIPH 4MTMA 4DIXA 4E5XB 4YDNA 2Z8WC 5A16B 5TGBA 1VEPA 3F7VB 4LPWA 2ZPKL 2R83A 4L8CA 1PPIA 5AVSB 1YEDB 3SGKA 3F7PC 4JN2B 1RULL 3DJZA 3WHXB 4NQEA 1L0XA 4OCWH 2Y25A 4XT1C 2XWDA 4FYTA 5ERWA 3BGMB 1QFOA 1F02I 1CLCA 4K3HA 3RFZC 4OZ4B 3ESOA 4PRNA 2R15A 3KZ8A 4P07A 4PJXA 1SBSL 2BVQB 5EA0H 1LM8V 4KRPD 1G9MC 4JRYB 1Q1PA 4LQFH 1JZ3A 4YE4H 3VDBA 3MU3A 1CVRA 1SOSA 2UVFA 3CMOL 3S3SA 3W37A 4XNMB 3CDGB 4F20A 3UTSA 4P5KA 2LR4A 1IILE 2PPDA 4XB8A 1FC2D 3HI5L 2Y3AA 4IOIB 1RUKL 3N85H 3QZWG 5D1XA 3DURB 1HSAB 2VERA 2NNFA 3L3HA 4WO4B 3ZDWA 1WCBB 5I0XA 1XIWC 3VRJB 4HOZA 3JV6B 1J1OH 2A83B 1WIUA 5C0BD 2EE2A 3GMMA 4OU3A 3REVA 4GG6E 4WV1C 3ZHNA 1ZIAA 5E2TL 4IIQA 5D7LA 1VGKA 5JW4M 4X0NA 2R0WL 1QRKA 3C6SA 5CNHA 4UIMB 3SGJC 4YXHH 3O6KH 4XVUC 5GSRA 5AZ2L 2X05A 2K8MA 3EH5B 3N1GC 4JO4H 5I0YA 4G80B 1S3RA 2W60A 2Q87A 3H9ZA 1OB0A 3V6FB 1AJ7H 1CF1A 1VENA 2JNZA 4O02H 3UBHA 3NCMA 3WJLC 1GKEA 4AGOA 1EAPB 1MWAL 5EUKA 4X80L 1Q1JL 2OW7A 4APQD 1HC1A 3WV0A 1N10A 4ENED 5T3XH 3ARRA 4PREB 4XOAA 2F8XC 4CMMB 4ALAH 4ZXBC 4EI0A 2FX9L 1BDYA 3Q5TA 4Y16A 1S4IA 5E8EB 3WXVH 2OYKA 2R8SH 1S78C 1XIWA 2ZKHH 1Z9SA 4G71B 4JM2F 5DSCA 5DJCA 1F8TL 1WA0X 5CKAA 5DWUL 1J8HB 1IC5L 1NCNA 2H32A 4W70A 1NQBA 5C0FA 2BFVL 1JPST 1MCRA 4FS0A 4JM4H 4QHNB 3S34H 1BFVL 1BZ7A 5JLZA 4Y5XB 1DE4A 1XGQA 4OCYL 1OSEA 2W9EL 4DOHE 3QI9D 4UF7C 4OBSA 2R0LL 1KCWA 3GLAA 1O7DE 1ZCRA 3RTQC 1OPGH 3V8CA 1KPVB 1PLGL 2Z1PA 3LPWA 1RZJH 3TH2T 1BQHB 1X4XA 3HBQA 3D3VA 4HULB 1ORQB 3EAKA 1N3NB 2XZQH 4G9FD 4UT7H 2VXVL 2HCZX 1W2KT 2YPVH 4LU5H 4QHLA 1XCTB 1XV8A 3ZQWA 1H3VA 3QXVA 3KLHD 1NC2A 4I89A 3LZPA 2XZQL 3TTSA 1RZ7H 2YXVA 4MDJA 2DTML 5CEZD 3IJYB 2IMMA 4QJ3B 1Q0XH 5DHYA 2Z64C 5DVKA 3FCTA 4KUZL 4M1CD 5FGCB 4N3UA 3W57A 5J9PB 2D2OA 1J10A 4GI9A 3SDCB 3KGTA 3FU8A 1I8IA 4AGMA 1LEKB 4HBQA 2JQMA 4PJ7F 5FLUA 1E6JL 5M95B 4QOKB 4EDXB 1EDQA 1S46A 2X6AA 3O2WH 5ABDE 4F7TA 4IJ3C 1CI3M 2AF2A 1WFIA 4DVRL 2YWZA 3K2IA 5FOJA 2GAZB 3C5JA 5HHMB 3U79A 5DS1A 2CMRH 4A2EA 4OCXH 1XSKA 4PJBF 5F2FA 5ALBH 3M1CA 3MXVH 1JCVA 1B0RB 1EFXA 2JFCA 3VD0A 3DRQB 4BEIA 4QLWA 1QFWI 1TG8A 5E8EA 1J9QA 4X42A 3QFJD 4Z7VB 2X2JA 1MW0A 1T5WB 1Z5LB 3AWFA 3GRWH 3M86A 3WU1A 4Y88A 1RU9L 5EWIL 1JXGA 1MCSA 3O6LH 1ZIBA 2D9QB 2PUQT 1CGSL 2ZX6A 2A9NL 2FEDD 5DWPA 1EXUA 4EN3C 2CD0A 5F44A 2X44D 3DMMB 1IBHA 3LPFA 5SWZA 4EMZA 4JFFB 5EZJA 3WD5H 4S1DC 4DP9X 1CLOL 2FLRT 1GYWA 2NRDA 5TH2B 4NKMA 2B77A 2MCMA 3ULUF 2G4EA 1CZ8L 4K15A 2JIXA 2JKNA 3AB0C 5E8NB 1EEQA 4FNLH 4R5TA 2AJXL 4CVXB 2Q9OA 5KYNA 4KXAA 1FP5A 1IM9B 2CO4A 3MV8D 2YRBA 2VSDA 4C57C 4GBXB 4R5VA 1K72A 3GBMH 4PJIB 4A55A 1DUYA 3FTVA 3VGAB 3VTMA 3BPCA 5BNXD 1BLNA 4WEEA 4XBEH 2QJDA 4TUUA 1P9MA 4HS3B 3O2DL 1A22B 2IAMB 3QR0A 1R3LA 4KMQA 4LQFL 3PIQA 2VMJA 3SJVD 3L9RA 2HLEB 2JCCB 3T0WA 4EUPG 4XCYB 2CO6A 4XCEA 4BQBA 4ZQTA 1XGPB 4Q14A 4AJ0A 4UTCA 2P7TB 3F7KA 1W0VA 3PL6C 4OM1H 5CSGA 4BBWA 1LVEA 3MGTB 1KBGL 2HLAA 1HOCA 1RLBA 2DQIH 4OM0H 4TUOA 3U9PH 2JKLA 4JAMB 5BXFA 5J6SA 1CE1L 3HUJB 1TTFA 3HG5A 3WN5A 2D3LA 4UTBA 5C6WH 1HXYA 1PIGA 4LSDA 4YZWA 1Y1UA 3UAFA 2Q86A 4DVBB 4AK2A 3NZHH 3BVNA 3P0YL 2J21A 2KPWA 5A2JH 3P4OB 3FN3A 4GUPA 3RB5A 1CS6A 2CUHA 1T3FA 2ZJSH 1T7YA 1UQSA 4C47A 2J88L 4RMSA 2NZIA 4PRIE 4G8EA 2CLRA 5J6GB 3TV8A 1WP6A 4LLVA 3X1EA 4XNBA 4ZUUB 1O9VA 3CFBA 3SQOH 2NDFA 4OZFH 1AKJA 3LOWA 4GKNA 2EH7H 1KXVC 2I60L 4JQIH 3RIFF 4S1RL 3X1GA 3QDME 1WWBX 2ZYRA 3OLIA 1QLFB 4ABQA 1RKRA 3RL1B 3BMVA 3S37L 2BVPA 3VFRA 2QADC 4L5FE 4B3EA 1OTUD 3WEBA 1IM9A 4UT6L 1M7IA 3Q6GL 2OKMA 1KEMH 3D06A 1EXGA 2ZOLB 2LTQB 1OAZL 3FOLB 2B1OA 4GMSH 5B38B 4IRSB 2B4CH 4O2CB 5T5FL 2YSTA 4HUCA 4WTZA 2RJMA 5D7IE 1YNTF 5DUPL 3HS8A 5JMOC 3TEYA 2XFXA 3D4CA 2JIXB 2GAZA 4W1TA 3FU7B 1CXIA 4KROB 4ZFFA 5BQ7B 3SDDD 1HWWA 2E9BA 3CWGA 3MRHB 4A66A 2VN5A 5I8KL 1TZGH 3IJHB 1D3CA 2X4PB 4LHUD 3GXPA 1D5ZB 2OMNA 4IDLA 4V1DB 1E0OB 1TEFA 1JE6A 5C0AB 3CVHL 4RMTA 1S7TA 3FAWA 4YDIL 2HKHL 1C5BH 1ERNA 5EOTB 4N28A 3TO4A 5K9QG 5DXWA 1B4JH 2AXGB 3BQVA 2R56L 1UT9A 2VE6A 3MA9L 4MMXC 3U1QA 3UIZA 1NFIB 1C8PA 1FLTX 1R33A 2YAEA 1FGNH 1AQDA 4K3EL 5FEBA 1WZ1L 3PWPE 3QRGL 2BP8B 3KS0H 3O4OC 5JUEL 4YGVB 5I26A 4MAYD 3FCSB 5HHPB 5C7ZA 4BA0A 3GRWA 5KVDH 2AQRA 3BVNB 2NY7H 4WJ5B 4AMKL 1JZ4A 4BQCA 3WS3B 3NP4A 3NPZB 1PDKA 2DDQL 5FUZH 5BO0D 1G0DA 4KK6D 1BAFL 1V7MH 3MLTB 4OGXL 4XN1A 3VXNA 5L2JA 1ZHBA 4G9DA 1IBGH 2WXQA 4AYFA 2DI8A 2GW5A 1ZDSA 2GY7B 1JZJA 1OGAB 3P11L 1U8LB 1AR1D 2F53A 2JWYA 3OKNA 4I5BA 2IANE 3DHMA 3JTTB 1WBXB 1JBJA 2RD0A 1HCFX 3PHOB 3GS7A 2C9RA 3H1ZA 4MKMA 4FFVD 3UTZA 3OAZK 2D0FA 2YPKB 3VWJB 4H4NA 4XPAH 1AI1H 4X6CB 1TTUA 2H0JA 2CIKA 5DK3A 1FCGA 3CFNA 2UY6B 3MV9B 4B95C 1THAA 3EHBB 3MRCA 3N1FC 4MCYA 5IESH 4HIEA 1NC2D 4JG1H 4QKTA 3QQDA 4D3CL 5CAYB 1M7IB 4PMEA 1JTOA 4W6YB 3FQUB 3UIYA 4M8RA 3RYMA 3VW3H 2QKSA 2VB5A 3QFDB 5ISZB 3C08H 2MKWA 4NZTH 3FSZA 1VZIA 4FQ1L 3R06A 2PW2B 2GK0B 4P49A 3PQYD 3KNBB 3V4UL 4MYPA 2WZ0A 2P24B 3SE9H 1JGDB 1TO4A 3C09B 4OCLC 1DBAL 2CLRB 2OMXB 2XTLA 4PP1C 3RILA 4KZDH 4F7TB 3TX4A 1XZ0B 3H9SA 3L5IA 4I4WB 1E4WH 1SDYA 3S2CA 4NN7C 4X99B 3UP6A 1UCBL 1F3DH 5F96H 2G30A 4LCYB 2XVBA 5HI3C 5ACMA 3H2QA 1FVCB 3I9AA 1NOAA 1DJXA 3PFQA 4NJAL 2NXYC 5C0GB 3H7BB 3DRQA 1QQDA 3N41B 1I4FA 3HZ3A 5ICXB 2Y7QA 5TTRA 2O72A 5CJBA 1GYVA 3T04D 5F6HI 4D7PA 3MLRH 1KBBA 1RCYA 1JS4A 3KPOA 3TYFB 3DJ9A 4ZMOA 3L5JA 4BSWA 1E9OB 3T65A 1WFMA 1MW1A 4P8QA 5C2BL 1JPGA 1J8SA 1LO5A 4XVSH 1E4KC 4LGPB 3MRFB 5D6DC 3IDNA 1INQB 3ULUL 3S37X 1Q94B 3BAEL 3SZ6A 4MD0A 3FUFA 3EFDH 4KO6A 1U8HB 1BEYL 1G7MA 2E56A 2WPGA 4L4TA 2FWUA 3UZQA 4F15C 2AHIA 3IU4H 2ERJC 3MBEA 4JFED 4Y4HA 5GS1B 3SKMB 3ML8A 1NKOA 4GT7A 3L3JA 3GMLB 1BQLL 3DVNB 3JTTA 2YAPA 4GINA 4HWUA 2I27N 4TQPA 3MZGB 5DD3L 2XXGA 2FGWL 4PAZA 4ODTH 4GKLA 3DX1A 4ANWA 4I48A 3RDTC 4WSGA 3N2JA 1KYOK 1ZK9A 3QHTC 4NM4L 2CBMA 1IC1A 3LQMA 2CIIB 1UD8A 2N0KA 3X11B 5AWNH 1NSNL 2JJTC 3N0PB 2J5WA 2DV6A 5BRZB 3QPQD 4I3RL 2BCKB 1BBDH 2TSBA 1I1YB 1VEOA 5FECB 1I1AA 1E8XA 1HEZB 2H3XC 2HSIA 4KMTL 5E1QA 2ZD0A 3FUJA 2O30A 4CC1A 1JVOA 2Y5EA 5TGBB 1MELA 1OE2A 2XT1B 2AZUA 4LRIC 3A0OA 3DOHA 4S10A 2NY3D 4Z7QF 1J0ZA 3C6LA 4AL8H 2ZF8A 4K3JH 3DI3B 2J8UF 3S36H 1EZVX 5AW4B 5F7NC 1TZAA 3L6FA 3ZDZB 4HPYL 5JHDE 4B9GA 1KDIA 3MUJA 1DO6A 2BCMA 3ZMNA 2LLLA 2QT6A 3BUBA 3KPTA 4ZMZA 4PJ5B 4PVMA 4ZNCD 4B7IA 1JGIA 4AW7A 1J9SA 1PEWA 5HHVL 2MNWA 4P57B 4WWPA 2VW4A 3FHAA 1NANH 1QUNA 1V54B 5LWYH 3OB0H 3MLZL 4PJBB 2J3SA 3S3PA 5DJDA 3C5SA 3S5ZA 3LX9A 1X7QB 3K72A 3RL2B 3BFWA 4L1HA 5AZUA 2XQYA 4LT7A 3HE7C 1CICA 1RD6A 2CM5A 5J13C 3P77A 4KX8A 3SDAC 1IGCL 3BKYL 2VDKB 3MTRA 3SDDC 2LW3A 5DD5L 2OK0H 1JK9A 4B5ZA 1E6JH 3N40P 4YMPA 3B56A 4OGYL 3QYNA 1TYEB 2OTWB 4X0KA 3JWNC 2GTWB 5KJRL 2NY1C 5AVQB 1BAGA 4UBDD 3QEGH 3SBWA 2W9LA 3HE7D 3RLSA 4Y19B 1T2QH 2OA9A 3RKPA 1DVZA 1XF3B 3TVMD 3IT8D 5CEXB 1K4DB 3FONB 3GXNA 3DK2A 3DARA 3DUSA 4MS8C 5F9WB 1ROWA 3CK0H 3GQFA 2QV2A 4QCIB 3QUYC 4HMEA 3OG4B 3TZVC 1JWSA 3HIZA 4FFZA 4KRMB 1IJ9A 3LKNB 4WENB 4K9EL 4F91B 3Q6FA 2PXYA 2LLGA 5FYJU 1RJZB 2Y7QB 3O2DA 1UA6H 4PGDA 3BP7B 1KTLA 2W94A 4YS4A 2NNAA 4B27A 3CU7A 4HZ1A 5EF3A 3ZDYF 3KPOB 5T1KB 5LG6A 4K5NA 3PHAA 1CK0H 3MGAA 4LB8A 1PLAA 3F84A 5CGYC 4P2RE 1ULVA 4N2OA 1JCKA 1CDGA 3LSOB 4GRWF 3IDMB 2EC8A 3F5WA 4NQCD 4QEGA 3DECA 1I8UA 1BXXA 4YL4A 2IH8A 1QG3A 2FO4B 3AM8C 1U58B 4YVUA 2D9CA 4PRDA 2WOBA 3FRPG 4LBAA 4LCWB 4ZOBA 1JHTA 3CLEL 5IZ7A 3E8VA 3WNIA 5D2NE 4LSVL 1UM5H 1ADQL 2IH1B 3Q8BA 2Q3ZA 1WIPA 2ZNWA 3I2CL 1NCUA 1P4LA 5AAPA 3FYIB 4UT9L 3PWUB 4IJ3B 2XRAL 4ZPVB 4QXTA 4LSRL 3W0WA 4Z7WA 3QZPA 4QTHB 2QR0B 3VRJA 2XPGA 1RZGA 1JTTA 4N0CD 5F7YC 4P4KC 4NAMA 4PW4A 4G7YL 4XMUA 1KC5H 3R0NA 4NUPA 5EZPA 5ID1A 5JDJA 1T0NA 4P5KB 3BD5A 3H3PL 3RAJH 2WLIA 5IMLB 3GJFB 3NQIA 3STLB 1TFPA 1LGVA 2ZP9A 3UAJC 1N0XL 2Y6TE 1OTSD 4PJGE 3LEXA 5CN1A 5E08L 3MJGX 3NCBB 2IWEA 3H8NA 4H20H 1G1YA 3H2PA 4RGNB 3PABB 1B9ZA 3HI5H 5DRZB 3BE1L 1R5VA 3UG3A 2ZUSA 3HZYB 4ODHH 3GBLA 5IW3A 3LCYA 3I6KA 2GJ6E 1EVUA 3NN8B 2FX7H 5AALA 4A6YH 3FUNA 3BEWB 7PAZA 4PRPA 1IGTA 1CURA 4G6KH 4XPHL 1W72L 1AP2B 3TBYB 4IRSC 5C8JB 3VG9B 5HYQB 3Q01A 5CEZE 4W68A 1QFUL 2IEPA 5INDB 5SWSD 5L0QB 5ESAB 3MNVB 4DW2H 2H26B 3PYCA 1NGYA 4PTUB 5JLZB 2X6BA 4Q6IA 3ZMEA 1NPNA 5DJ0A 3BDXA 1KLGB 1L9PA 1T5KA 2HYMA 3BH4A 3TNMB 5MEND 4WW1B 3CFKA 3F6IA 1B2YA 1MNUH 1ZY9A 1KNOA 3L5XH 5DI8B 4DZBB 3ZHFA 2HZHA 1TZ8A 3QFJB 4JHZA 3X3GL 1IC4H 1PNDA 4PCTA 3RGVB 2APSA 2ZYIA 1BM3H 4FQXD 4FQPA 3M6DA 4M5ZH 4NRZA 4LEXH 3RY4A 3RNKA 1WK0A 2QHRH 1N6UA 4M7KH 4E5XG 4NQCE 4YHPA 25C8H 2A9ML 1T66D 2MNUA 1NBZB 5EF1A 5LXGH 3UBXI 1KCKA 2J2ZA 4F33A 4TTDC 5FFGA 1TQBC 4FG6D 1WZAA 5KVDE 2B16A 1MLBB 1ZLVK 2EDQA 5BRZE 5FYKU 2CALA 3P4MA 2NCMA 1DJGA 3GHBH 3U30C 5FS5A 2XG5B 2ZUWA 2DQDH 4B9KC 3STBA 3W11D 1T83A 4Y2DC 2EACA 3L3DB 3FO2B 3MACH 1LK3L 5LQBL 4YHIB 3AQZA 5AW6B 1J7VR 4ZMVA 3SDYL 2ADFH 2VSKB 2P43B 3LNEA 1MAJA 2WINA 4KI5E 1EJ8A 1OGTA 1T2JA 1Z7JA 2JIXD 3KAAA 4QT5A 3TEXA 3KVPA 4PJ9C 1GGCH 4X7FC 4KPHL 1CL7L 3OPZL 4XWOD 2XDHA 3UYPA 3GI9L 4LLDA 4JFDD 1QBMH 4KUCF 4QXGH 4GG6F 3PAUA 2IF7A 1GPOH 3LH8A 2H1PH 3MNMA 4OR1A 1QRNE 1BPVA 1I8LA 3I6SA 4POUB 4M8VA 1MQKH 3U2IA 1CUOA 3ORJA 5KYWB 1NWPA 2NLJB 5A3IC 5KBLA 1IGMH 1MCPL 3QORD 2R7EA 5AVWB 4UZUA 3SE3C 2V2TB 2F58L 1CFQB 3K6NA 1JG9A 3VD9A 4MX7A 3NFPA 2VLKB 4I77H 2XYBA 1QNIA 4N2KA 3NVQA 4DK5A 4P9HC 4KWUA 5FV1L 5AUMB 4TQIA 1T20A 1QP1A 1ZE3H 3BPOC 3FH8A 2QR0A 5HHOA 5GRUH 12E8L 3FFCA 3S5LA 3BWUF 5LHDA 3CQPA 1YMME 3UPCA 3K6OA 2HJKB 1TITA 1WTGT 3O3DA 4BFBD 4K55A 4Y4FB 4NQSA 2DI9A 4N22A 1F41A 3VXMA 4WLCA 2LU4A 4QO1A 3VI3E 4LKCA 4RZCA 1W6WA 3TL5A 3EJZD 2IOMA 2LU7A 1BG1A 5DR5H 3K80A 2UZPA 4ZFZA 3QCUL 3RP1A 3CZKA 4ISVA 1MDAA 1EGJA 1AKPA 3D2TA 3CVIH 4OLUH 1Z1WA 3NJVA 1UXWB 3QISA 2L7EA 1TLKA 3NJLA 4OIAA 4WI0B 2NSQA 1G7IB 2QQLL 4J28A 1LD9A 4FQHB 3Q8AA 4WVRA 1S7WA 4BWTA 2HKFH 3BEWA 4HBCH 3U7WL 1UM4L 3IPBA 1CD1A 1R3HA 1W6LA 1UEMA 4KU1A 4L1LA 1N9PA 3FW6A 4NKQB 4AGQA 4ZDHA 1IT9L 4Z5RB 1EGJL 3GTTA 3KYKH 2IBZX 4XI5D 2ARWA 5CHNA 1QWNA 3S36X 3PL6A 3QDGD 4KZ0A 4IBLT 2GHWB 2IPKB 3VVVA 5FGBC 4E41A 4BSJA 3AS3A 4EOWL 4PS8A 3IS1X 2X42A 2KZKA 2ERJB 4HHWA 2AK4A 1EDHA 2O4EA 5IK3B 2DLFH 3TBBA 1PBYA 1FJ1A 1X9UA 3MNDA 3F12B 4KKAD 4R84A 1BP3B 3IGAA 2ZXBA 2FJUB 2RGSA 4L5FH 4PIRF 1CN4A 1JGEB 4JZOB 3AB0B 2VN4A 1MH5B 4YH6A 3MYJB 3VFUA 5DUMH 5HYFA 2EVHA 1IAIL 5HHQA 5EUOA 5FYLD 3T0EA 3QIBD 1DVSA 1KACB 1NUNB 1TSHA 4MMZA 1RK0B 4UCFA 4L4VA 1HHGA 2ZNXA 4BZ1L 5I1KH 2EXYD 1IEBB 4JQVC 3GBEA 3EDJA 4S1SH 4NO5A 3IDUA 2DQGH 3SDXB 2RCSL 3SD2A 1LO3L 2EZ0C 4GB9A 3C09C 4BFIB 3GEFA 4IRSA 5DO8A 3GGWB 3V4VH 3TEWA 4LKXB 4UBDC 1A65A 1R3JA 3NK4A 3TIDA 5D7LE 15C8L 5CJQH 2Q5BA 2WQXA 5D6CB 5DJ8B 4FCHA 3SQBB 5HHMD 3ROOB 1F4YH 1HQ4B 1DQIA 5CD3A 2ITCA 4HXBH 4WI0A 2EDKA 2ATKA 1JGVH 1N0LA 1PYWA 3GSWA 3NSXA 1N5AA 3AU1A 4YL9A 4PJFB 1JWMB 5DHVB 5B3JF 4ZXBD 4DEUA 1B0GA 1NAMH 3KPSE 2MQ3A 2BNQD 1A6UL 4G8IA 1GJIA 2DF3A 1UT2A 2ATPB 3G04B 4JGUA 4P48A 3GBDA 4U3CA 4HUUA 4Y4KC 2IBGA 4EDWL 4FLOA 4BUGA 3BSZA 4HU2A 4DP5X 1UWGL 1TPXC 2APXA 1PZSA 2D03L 2OMUB 1CWVA 4TLSA 2BWDA 4PU2A 3NTCH 2W81C 4LOFA 4D0BA 4G5ZH 1RURL 3SN6N 2ENYA 4P4KA 4IBYA 4JKNA 1L7IL 3OKOA 5DQ9A 1ANUA 4JFOB 4NCC2 1ZD6A 1BEXA 4RA0C 4CN6A 4X83A 3PQYB 4NO2A 5GZNC 4JFXA 2VDPH 5MI0B 4F7MB 3UG5A 1EK3A 3GSUA 5C0IB 1KGXA 1RULH 2ICWI 4LLMA 2IALB 3HEIB 1ZPUA 1E2ZA 1OQOA 3Q9PA 5IIEA 1T1YA 1TUPA 4J3OG 4JY6A 4G6KL 5IVXE 2BSRA 1G6RH 1GTNA 1AGFA 2W8CA 2MPAH 4WUKL 4O00A 5CINH 3T0EB 4U3XA 5CGMA 3P9LA 2EE9A 1AGCA 1QMUA 2DI7A 4M03A 4MQ7A 1YPZF 4U4IA 3ZZ1A 1T4KB 3VXTA 2DMKA 1TETH 1F58H 1T1ZB 3S35H 1MUJA 4N2FA 1FO0H 2V5TA 1CXKA 4QTHA 3E6FA 2Y0SA 3LZOA 2BOCB 3UEZA 4FQXA 1M2VA 3UEQA 1MPAH 1MCIA 1JPTH 3W3BA 4CILA 5C92A 3TEUA 4FABL 4F7CB 2NW2B 4LCIL 35C8H 4ZFZB 1KYFA 4MDIB 5CP7A 5HHOE 2FJGA 1YDPA 1YQ2A 1Y0LB 1HZHL 5HJ3B 4ODUB 2BOBA 4IBZA 5D96C 2WB7A 2BIPA 1KENL 2F61A 1U8PA 3OGCA 4MMXB 3TJHC 5CCJA 3BZDA 2E5EA 1JZ6A 1HXKA 3FO9B 3VI3B 1UTDA 4PLJD 2J2ZB 1N7ML 4F33B 3S97C 3CDGA 3CPUA 2WUCL 3O8XC 3MROA 1OAXH 1T0MA 2A0LC 5GISH 4Z7VF 4UWQB 1LO2L 2X3CA 5I8OH 4R90H 3QIBB 4AMXA 1TJMA 3MRQB 1HTYA 4YBLC 5HVGB 5CEYB 2DQGL 3GSQB 3IJ8A 3MJWA 1P5VB 4KQ4H 1WPCA 3RWEA 1DJHA 3N91A 4M6NH 2F1BA 3C60D 5FYLE 5EIIB 5AG9A 1HOEA 1JL8A 2VDMH 4QRTB 3MV8E 2PTTB 1FQ9C 3CFDB 1S7SB 3L08A 1AAJA 2PW2A 4OQ1A 4NO2B 3WN6A 4NLHA 4DZ8B 4DO6A 4P2CG 2YK1L 2IPUK 5FO8A 1PD6A 2QKIA 3GPSA 3VH8A 4EI5C 1XGPA 1YVLA 3P11H 1Q9LB 1EHLL 4JN2A 3NQKA 5SWZD 1HHKA 1BPLB 1J05B 3DYMA 4KUCD 2QDVA 2E6PA 4FG2A 3N42B 2YO3A 4KQ3H 4M7LT 1JZHA 4QR7A 3SCMA 3LZNA 4E5XA 1D6VH 1AR1B 3KBPA 1OGAD 3OX8A 3TT1H 3HB3D 4LLQA 1A8JH 2AI0L 2HT2D 4ICXA 5E70A 4G6JL 1J11A 2A6KA 3G08A 4QRSA 5D1XD 1PYWB 3GSWB 2OM5A 4Q6KA 2OFQA 3HR6A 1TEGA 1TOXA 3QUML 1JDCA 4QRPA 4JPKH 2VXQA 4E9SA 1BBJB 5DQJB 1T2QL 1ETJA 4F9LA 5KOMC 4ZFQA 3FO1B 1E90A 1T5XB 3Q5OA 2BY2A 4GXUN 1PZCA 4YZFF 3HMWL 4C56E 1G9MH 2EDDA 4FTDA 1JPSH 1KBVA 3ULSB 1ED3A 3IDNB 1YY9C 4TPRL 1QVOB 1M7XA 3QAQA 4GS7C 4PS3A 3VD5A 2ZUQB 5E7BA 4BFFA 4HIPA 2PPAA 3TN0C 2WY3B 3ZE2F 1QLEH 1EMTL 3ZT7A 1XR9A 4CU6A 3CHOA 3CHSA 3SZKC 3ILEA 3BIAX 3WFZA 3WELA 4TQHA 2PPEA 1RXLA 3QZOA 3ZTEA 4U6YB 4YVNA 1ACYH 1K5NA 1FWXA 4UQ3B 2AJ3B 3U7YH 4AQZA 4WEBH 2ZCZA 3HJEA 5IT2H 4N5EC 4X7CC 3FOLA 5EZOL 2G9KA 2J5LB 1SHXA 4MXVF 2WJ7A 2B4CC 3DURA 3FT1A 4XPGH 5DHDA 3VWJC 5F97E 4PJCF 1FUNA 1JZFA 3ARBA 4GI6A 4GMSL 3UCQA 1H6FA 1JRHI 5D7IA 4JREB 2W80C 3KPSA 3OKDB 3JWNE 4FULA 2Q8AH 4DKFH 4Z77B 1GGTA 3QWRD 4UANA 3ZHLA 2ALAA 4M00A 1GOFA 3VWKA 2IV8A 3VM5A 5KVGH 4D2NA 2C3VA 5AYUH 1CDIA 5D70L 1DSFL 4NP9A 5T1KA 1DZ0A 3G9AB 4ORZC 3SE4C 4Q0XH 4P04A 2FWOB 5I15L 4L0PB 2Z31D 1Z5YD 3BP6A 4LLQB 1DFBH 3H3BC 4PJHE 1VB9A 4MS8D 3LKNA 2Y5TA 2PR4L 4BSVA 1GKOA 1GL4B 1W15A 2YBGA 1AHWC 4JPWH 1P7HL 3TVMC 4RH4A 3PNWB 3H54A 2IH9A 2P5WD 4FTVE 5IHZB 4PRHE 3FTGB 5I9QB 1DQQB 2X88A 2XIIA 3BD4A 2C4XA 3VCLB 4NKIL 1MFUA 1SXAA 5ITBL 4RDQF 4M9OA 1X5MA 1D5IH 2ZXAA 5KSAD 3JWOC 1R24A 4RISL 1KY6A 1Y0LA 4XN4A 3FK3A 1DE4B 4PRIA 3CFEA 5BVPH 1CICC 3FQXA 4QIRA 1MHEA 1QA9B 4AEFA 1EHKB 4KY1H 1RFDH 43CAA 5E6IC 3LHPL 1IL1A 4O2FB 2HLFD 3KWWA 4P46D 4NBXB 4YSDA 1H3UA 2OJ1A 2HTLD 2ICEA 1JPFA 3F58H 4OJDH 3SCMC 5A2LH 4Y5YA 1L9NA 1DN0A 3KJ6H 2HFGL 3II2A 4F2EA 2V9UA 1ZT7B 2A9BA 2Y1YA 4UT9A 5EN2B 5IJBC 1X5KA 1FBIL 5AL8A 4BCXA 4ZW3A 4RRPA 1YN6B 1A3ZA 4FA6A 1I82A 1NL0L 4OJFH 3WIIH 1TQTA 4U1MB 4WHCA 1VF5C 4IRJD 3QGVA 1OGSA 1PF3A 5D8JL 5ACZA 2HVJA 5DEFB 2AGJL 1T7XA 1IQDB 3BGAA 2P45B 1HXMB 1PZUB 3CN3A 4XCYA 2J6WA 3WUWB 2K70A 2BW5A 3SOTA 3WAJA 1XGZA 2QPEB 4KJWD 4N8CL 1XDTT 3IF1B 1N4XH 1DVTA 2A6KB 3G08B 2ORBL 1BECA 1DVFC 2GK0A 5J11C 3VXSE 4GUCA 4N2MA 2AKRB 4JY5L 4NHUA 1MFAH 3GIVA 1FZOB 3MA9H 5FDYA 4JFSA 3ZL2A 4AOFA 5CWSB 5I6OA 1JZIA 4HUWB 1IGYB 2BHFA 3SOBH 3UAJA 2HXAA 3MBXH 2XQ0A 4KDTA 3SO3C 2ZUXA 5L7XL 1AYOA 2ENSA 3DGCR 4UB0L 3HG2A 1YNLH 1PKQE 4Y1AE 2R0ZL 1VZHA 3NJMA 4OQTL 1QW8A 2EIZA 5L4MA 5LGJA 3DSFH 4XB7A 4FP8H 3NCCB 5TQ2H 3ZTNL 5IMOB 2W88A 1FZKB 1D5XA 3SGDH