4A7TA

Structure of human i113t sod1 mutant complexed with isoproteranol in the p21 space group
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
153
structure length
153
Chain Sequence
ATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCITGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
publication title Ligand Binding and Aggregation of Pathogenic Sod1.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 153
sequence length 153
chains with identical sequence F
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2011-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 4a7tA00
1SXCA 4A7GF 4N3UA 1U3NA 1SDYA 2Z7WA 2Q2LA 1TO4A 3QQDA 3ECVA 4FF9A 1IBDA 1P1VA 3GQFA 3F7KA 3CE1A 2AQQA 2AQPA 2AQSA 4A7TA 1L3NA 1YAIA 3L9EA 2C9VA 1N18A 3HOGA 1SXBA 1RK7A 2WWOA 2GBUA 1F1AA 1MFMA 2WYTA 1QUPA 1UXLA 3GZPA 1JK9A 2WKOA 1FUNA 1N19A 1OAJA 3CQQA 3HFFA 4BCZA 2ZKYA 2NNXA 3ECWA 2AF2A 2C9UA 2VR8A 3L9YA 3GZQA 1S4IA 3MKGA 3KBFA 1OEZW 1OZTG 3F7LA 1BZOA 1E9QB 1HL5A 1PTZA 2AQTA 1SXSA 4BCYA 3H2PA 1IBHA 4B3EA 2VR6A 2GBVA 3ECUA 1YAZA 2WWNA 2E47A 3GZOA 2ZKXA 2XJKA 3S0PA 1XSOA 1E9PA 2AQRA 1IBBA 3KM2A 2WKOF 2E46A 2WZ0A 1E9OB 5CU9A 2LU5A 2Z7ZA 4A7SA 1XTLA 1IB5A 3GTVA 5KBKA 3KH3A 4L05A 2AEOA 1F18A 1UXMA 1COBA 1XTMA 4A7UA 4U4IA 3K91A 4N3TA 1SRDA 3RE0A 1SPDA 3SODB 2C9SA 4OJAA 1DSWA 3LTVA 1EQWA 2JLPA 1JK9B 4MCNA 1KMGA 3T5WA 1F1DA 2ZKWA 1EJ8A 1PZSA 2SODB 1IBFA 3GTTA 3CQPA 4BD4A 2Z7YA 4A7QA 3KH4A 1SDAB 5KBLA 2XJLA 2ZOWA 1SXZA 1YSOA 2Z7UA 3QQDB 4A7GA 2R27A 1Q0EA 2AQNA 1SXNA 1JCVA 1CBJA 1OALA 2V0AA 1E9OA 2WYZA 1SXAA 1DO5A 1B4LA 1SOSA 1Z9PA 3H2QA 1E9PB 2JCWA 1PU0A 1B4TA 2APSA 1AZVA 4A7VA 1Z9NA 1CB4A 2GBTA 1ESOA 1F1GA 3HW7A 2WZ5A 3KBEA 4OH2A 1E9QA 2VR7A 3PU7A 1BA9A 1HL4A 5KBMA 1TO5A 4MCMA 1OZUA 2K4WA 3MNDA 2WZ6A 3KM1A
chains in the Genus database with same CATH superfamily
5HYJE 2G9HA 3K6NA 1WBXB 1U3NA 3QJRB 2X87A 5EU6D 2NUTB 5BJTB 5IHWA 3UPAA 4JFXB 2Q7YB 2GAZA 3NCXA 5CEYB 4XPFL 1KPRA 5GGRA 5TFSH 1VFAA 3CMOH 2R2CA 3FB7B 3M7FB 2M2DA 2Q8BL 5AKTA 3AUVA 1PDKB 4HS8L 3PHOB 3V6BR 4AQ1B 4KJWD 4PG2C 4IOFD 1NDMB 3C75A 4OIFA 4PJ9D 1KN2L 4ZTPH 4UNIA 1IE5A 2XWJB 1FFNA 3A6CH 3PXHA 2FEDC 4M8QA 4ENZA 1LL1A 1WAAF 4JPQA 3SDAD 2ZX5A 3SOBL 1F6LL 2WUBH 3N41F 3QPXH 3IXTA 4KDTA 4PRAB 3D0LB 5SWZB 4WHTB 2DQCL 5E51A 5ALCH 4MMZA 3QEQE 3V0VA 2BSED 3KGRA 3VFWA 4DOHE 2BCKA 3NIFB 3GIZH 2K7PA 2NXYB 2GBVA 3EJQA 3I3EA 5I66A 1HH6B 2VLJE 4Y7OC 3VGDA 3KXFA 4ENEC 1QRND 4DGUA 4RAUA 4Z95L 4BDVA 4LE8A 2VISA 4EQ2A 1RZ7H 1BG9A 2VMFA 2G2PA 4FL4B 1MXGA 2BDNL 2DB8A 3FBKA 4U0RC 1VPOL 3RUGE 5IROD 4ZTPL 4X9FA 3KJ6H 3P73B 3UERA 5IK3A 3UTTD 4OCSH 3E6FA 4EZLA 2WUBL 2RBLA 5J1TC 1UJ3A 3S4SB 1FVDA 2GB2A 3PXJA 4N0RA 4JFEE 1BAFH 5GIRB 3VXMA 2APWA 4XXDB 4NI6A 3HKFA 1EHXA 1YC8A 5E5LA 3QEUB 4PJEF 3VI4A 1Q0XL 3IF1A 3PREA 1OGSA 1B2WH 3GIZL 5DJDA 2QLVB 4ELMA 1QFWH 4W9LC 4K71B 3ZL4H 3FQRB 1ZT1B 1IC7H 2PPEA 1JRHH 2X10A 4KHTH 4Z78B 1BREA 1DVSA 4PJ8D 1LO5B 1FBIH 2HFEA 3DUSB 2FYVA 5AFAA 3O9WC 1MFEL 1RZ7L 2A4CA 3PE9A 1QAWA 3RU8L 3U6RA 4F8OA 2BVTA 1SY6A 5FGBC 4LCCA 4KK9D 3LB6D 2R7EA 4IBVA 3CGTA 1NC4A 1KB5B 1HN1A 4PB9L 2O5ZL 4BEIA 5E2JA 3LH2H 2QPEB 4FQJH 4OLYH 3ZE2E 4KVNL 3GSOB 4OCSL 5A2LH 3ZHFA 3OKYA 4GIPD 2QPSA 1A25A 4N8VG 2ADGA 3WUWG 4ZMPA 3F64A 5AOJA 5BXFB 2FB4L 3D0VB 4HEME 3GMNA 1AGCB 4GBXB 5D1ZD 4E0RA 3PPEA 2PYEB 1B2WL 2FSEB 4Q0XH 3C6LB 2QDVA 4S10A 1QFWL 2D2CC 2CLRB 5E6YA 5SWZE 2AQPA 2Q20A 3TFKC 4G1MA 4J3XA 1KLFA 2NR6A 4KHTL 4Z3FA 3MOBL 2C9VA 4AYGA 4NKIL 5BRZD 1CFTA 4NQCB 4NUQA 4PP2B 4OV5B 5EU7C 1M1SA 1W91A 4M1DH 4QYAA 5JUEL 1I1FA 4M7KH 3TNNA 4ODUA 2XXFA 3US9A 5E5MB 3WN5C 2XWBB 4KDVA 3E1F1 4PW9A 3SBWC 2IXQB 3BZFB 4LKCA 2I5YH 1OHQA 1I8MA 1JZFA 3G04B 4MNHA 4A1RA 1BZEA 3LH2L 4AE0A 5JQHC 1FE8L 2IH1B 2ZSWB 1K2DA 1CK0L 4DF9A 4AITA 1JMXA 1A2YA 4G8IA 1NCWH 1N8OE 2EE9A 3JWOL 3D39D 5TDOA 5C09D 4Q6KA 1GPOL 3GUFA 3DURB 3E1ZA 2GK0B 4A2FA 2BIPA 1F4WL 2Y07L 4DGIH 3E3QC 4F2FA 4XMLL 1AD0B 3O9WA 1TVDA 4J39A 1F18A 1WCBB 1MHHB 5HHNB 4AIZB 2BVOB 4DZ8B 4OGYL 5I5IA 3UBGA 1R46A 4KRPD 4NN7C 5JNYB 4A39A 1OGTA 4KX9A 1S7QB 2UVFA 3EXJA 2V8LA 5T1DH 4G6KL 3SQBB 4FMKA 1A7OH 5DRXB 3BAJA 3AY2A 2EYTB 3OMAB 5IFJB 3RL1B 4FP8H 3H3KA 3QR2A 3B7RL 1SF3A 3SKJH 4YHNB 2WUCH 2A0LC 4PJIB 3IFLH 1NCWL 1VZHA 2LTQB 1UT9A 4I13B 5FR3A 3QCUH 1Q9LA 2WYZA 4WTQA 1IGTB 2VITA 1K8DB 1NBZA 3MCKB 4K5PA 4PCTA 3QR1A 1S2EA 3Q6GH 1G0XA 1OW0C 3ZIYA 5DA4A 4PAZA 4B7LA 4J8RB 5DJYA 1E42A 4X0KA 5C0EB 2FJHB 2NT1A 5PAZA 5GZOC 4F7EB 4XN7A 3IGFA 1A7RH 2OJZH 4UTBA 3B2UC 3SBWA 4M6NH 4I3RH 3IDXL 4NQCE 3HTLX 4M1CC 3PP4H 4B97A 2XXMB 4R2GB 4OUUB 2OCFD 3VXQB 4ALAC 5T1DL 2ZOKA 3MBED 4ZFFA 1QTSA 3ZTJH 2Q2LA 3POHA 4AQ8C 4EZMA 3MRHB 3IU3B 1H9DA 2OYMA 1MFBH 4WEMB 1P4BH 2OSLA 2P5WB 4ZUVA 4XP9H 3PS6A 4KY2A 5E24E 4X7TA 2AEQH 4CJ1A 4V1DE 2CRZA 1NPJA 1I9JL 1K6QH 1SMAA 3QVAA 3CMGA 3QXDA 3UBXA 3RVTC 1FP5A 5SWSE 2PNDA 2CIKB 5ETUB 4YPGB 3T77B 1RI8A 1QI4A 5DVPA 4RLDA 1AC6A 2EXYC 1TNMA 2YXWA 3DV6A 3IJSA 1G9NH 4R7DA 2M8XA 1B88A 1HINH 2IANA 3H2WA 5F0JB 3UBFA 2W60B 2JJSA 1MFCH 5J11B 5L7XH 4UZSA 1J5DA 2KBGA 4I3SH 4UIKH 4WWKB 1YMMA 2HRPL 5C0JB 5CAYB 4HKJB 4EI5C 2IBZX 4DKFH 1T5WA 3GMQA 4MQ7B 3EYQC 3IETA 5DYOB 2QR0A 4PGCB 1WD8A 2NPLX 2GIMA 5D1QC 5I2IB 5F9OH 4P2AA 1AIFB 4ZJ9A 2HJLB 5EF2A 3N9GH 2WLIA 5I8KL 3WO3B 4L1LA 3CSBA 1Q94A 3FB6A 3KPNB 4I85A 4PJIE 2FK9A 1QZNA 2OKMA 4HWEH 3S3BB 5GZOA 5LGKA 3ZRFC 4HPOH 3FTZA 1C16A 3PWVB 1KXQE 3HAEB 5JORA 1G9NL 4HUWA 1SJHB 1T66D 1A65A 4W9KC 3WHXA 1B9KA 2YQBA 3VX1A 1JHTB 2NW2A 3TZVC 2BNRB 1EK3A 4I3SL 1M9SA 2C3HA 2VRQA 4NQSA 5E8OA 4G7SB 4C4UA 4ODSL 4YLCA 3TYGL 4WEEA 3HMXA 1KJVA 1ROWA 3KH4A 3LZLA 4X8XA 3MJ9A 5C0BB 4ODXA 3UACA 4DKEH 1GZPB 4CN1A 3VFVA 1CU4L 5F88B 5M94B 5ISZD 4UV7H 1E9OA 3GSRA 5DJXA 1IU1A 1EMTH 2VXTL 1T20A 4PY8I 5F9OL 1T1XA 4S0SD 4UTAL 3CSYA 3KS0J 4WI6A 2GT9A 2P5WE 3C8KA 1JGLL 3BZEB 3ASWA 5JIKA 2VLKD 3CHPA 1GA2A 1I3UA 2XZZA 3EG9B 2X6VA 4GAYA 4AT6A 2FAUA 2EEFA 3CFDA 3LS5L 2Y7MA 4TNVK 2VSDA 1KLGA 3L7FA 4HW6A 2DM7A 3ORJA 5KUKA 2VMEA 1JXGA 4N0UA 1XGPB 3TJHC 4NNXB 2NYKA 5TDPB 2C7UB 1F2QA 1VCAA 3HC2A 2F1BA 2L7EA 2WXHA 1IM9D 4F3FB 1WP6A 1F3RB 4UV7L 2V7HB 2B20A 2FR4A 3ARRA 2QVIA 1LXMA 2JI1A 4WHYG 3VRJB 2OSYA 4PJHA 2K8MA 4H26B 4OFDA 5E4AA 4LP8A 3ZE0B 4CW1A 2MOGA 4Z8FH 1HKLL 2AANA 5E6IB 1N5YL 1U8PA 3RLSA 3FUNA 5JHDB 4NGHH 2OMYA 3CTTA 5AVUB 3LRSA 4GAGH 4ABQA 1MEXH 1Y6NR 3EUDA 3TS8A 1ID2A 4U2ZA 5G4NA 1SXSA 3TZVA 5E6RB 4P2RA 2VXQH 2EICA 3FK3A 2D0GA 4XCCH 3MRBA 3OR7B 2OXGA 3OWEA 5HSFA 5J6GB 3EJJX 2IG2L 3JT2A 5JYMA 1IAII 3AJ7A 1V10A 4L23A 2BNRE 2VE6A 4RGMB 2UZIH 3ASOB 1FNLA 2DQFA 3T3PF 5C0BE 2D7MA 2DQDH 3T08A 5KANG 3FYEB 4FTVD 4H8UA 5F7HA 3QZLA 5J5EA 2ATAA 4HEPG 4NUJA 4Z8FL 4N90E 1TTAA 3ZZ1A 3LV3B 1KGXA 3N44B 2H26A 3J2PA 3UO8B 4JDVB 4HOXA 1ES0A 4GMSH 1FRGH 1CT8A 3WNIA 3T0VA 4LB8A 5DZJA 2Y36H 4OF3A 5EU3A 2KDGA 5F8QC 2AK1H 3HHSA 3RFZC 1T7WA 3SY6A 4JNXA 1UWGH 3EOTH 3ZMNA 5KVGH 3OV6A 3E2HC 2GQHA 1OSZB 4JO8A 3S4SG 1SEQH 4HDIB 3S37X 3TFKD 1KBGL 3JZ7A 2XBZA 4WEUD 1VGKB 3QORB 1QR1A 3SDDB 5KG9B 2C3GA 4GO6B 1M71A 4I4WA 1YEFL 2F54D 1MRCH 5BRQA 2AZAA 4UANA 3K72B 1TZHB 1IILE 2XQYK 5FW6A 1CMOA 4H25A 1W9XA 2FHCA 2DQDL 1PFCA 3B9KD 1MLCA 1SHMA 4HJGB 1ZA3A 1ZANH 5EB9A 5F3BB 4LIQL 4DWHA 1YEGL 3KPRB 3MV7B 2A6KB 4OCWH 5KOVC 3STLA 1FNEB 1FRGL 2G2NA 3G6JB 3ILDA 3ZE0E 4JPKH 4GSDL 3VD4A 4HAKA 4JANB 3CPLB 1JNHB 4ES8A 1I1YA 4EN3D 2OMXA 2YEVB 1D5ZB 4HG4K 5AZEL 1KIUB 2AK1L 2IAMC 4W1TA 5JHDE 3HCVA 1OOAA 4F7PB 1CGXA 3EOTL 3Q2CA 3IFPA 4YC2C 2J25A 1FSKB 2DMCA 2HUEA 5DU7A 3HLAB 2OTWB 2QEJA 4G80B 4MXVE 1U2YA 4GY4A 1W2KT 2E9WA 1KDIA 5DQ9A 3TT1L 4PMEA 5A6IA 4LEOB 5FA3A 4MD4A 1XSIA 1RUKL 4PJAA 2ZCLH 3D4GA 4X80H 3ME0B 2DBLH 1JDDA 1JIBA 2R29A 4ATWA 1KSRA 2RFXA 5DYFA 4F2EA 3IGAA 4OCWL 3KYKH 4NDMA 3PIQA 4ZSOA 3T65A 4AQ1C 1A1MB 4JPKL 1YMHA 3SD5A 2IADA 3MJ7B 2A0LD 3KPTA 2JKLA 4ZODA 1NKRA 3NCFB 2J88H 3N43F 2CG9X 1MCIA 2WNXA 2WOYA 3ENEA 1TSRA 2V3DA 2UZXA 4YNYA 1WC7A 3CXDH 4IHOB 1ZLSH 4PJGA 5ESVA 2H2SD 2Y7QA 4GP4B 2J3SA 4FXTA 4JO3H 1NCNA 5HVHB 5ID1B 3NABH 1GS8A 4OF0A 1HZLA 1S7WA 2EXWC 2NOYA 3B2UD 5I8EA 2HN7B 2EVHA 2VDPB 3WOVA 3B5GA 5LBSL 4YDKH 1UG9A 3E8UL 4RGOH 2FWOB 3BKMH 3H4HA 2ZCLL 4LLWB 4ELDA 2BVPB 3VG0H 1IKOP 2DBLL 4DP6X 4FADA 4MCYB 1KV3A 1GGTA 3RY6A 1L7TL 4LSVH 5EFIA 1R0AH 1UUNA 3HI1B 2BZCA 5DUBB 5CFAA 1JN6B 3FTVA 5F7MC 2AEIT 1GGCL 4RWYH 4U7KA 2IAMA 4S0TD 1TZIA 1LEGB 4AJ0A 4PLJC 1UB5A 4BV1A 5IBUG 1FZKB 3KPRE 3MV7E 1OGAA 5LUMA 4RRPA 5HHQA 1UT2A 2J1ZA 3AQDA 5E8PB 2OMUA 4L8DA 4ZTOH 3G6JE 3NRPA 3ZTEA 3CXDL 3DROB 1IM3B 3AACA 3NPSB 3HRZC 4HC1H 2AV7A 4XCEB 1AKJB 2A6JB 4JO3L 1J8SA 1DJZA 1QOKA 3QWOA 4FFWD 3NABL 5LBVA 4XNZB 3MO1B 1C1EH 3V0WL 3LQAC 5BV7L 1YDPB 5CBEB 5I1GH 3CH8A 4BWTA 1HYSC 4OF8A 5D7LB 1FC1A 5GRVL 1ID5I 3SDCC 4R26L 3ULUE 3IJEA 3AW5A 3O41A 4PJBB 1SJEB 2H6PB 3BUDA 4B9YA 3BKML 4WU5A 1C08A 3NZUA 4PMFA 2Z7WA 4EI5D 1AR2A 1FZJB 1PZAA 4BK4A 5IW6B 5M95B 3C87A 4NHCL 1YEEH 1R0AL 2J6EH 4LSVL 1BM3H 1IC5H 3K74B 3Q13A 3ABGA 3GMOB 4N5EC 4HWBL 4LRIC 4RWYL 5D1QD 2NY6C 4B9IA 4IJTA 3QEHA 4JFUA 4AJWA 5DHYA 3ZUCA 2JKXA 3UFIA 4ANVA 1PLCA 4PGJA 5L9DL 4NN6C 1FL3B 2DKMA 2BSTA 2B1HL 2B59A 5ACLA 1ZTXE 3MV8B 1QUPA 3GMLA 4QTIL 4HC1L 1QBBA 2GFBB 1OAZL 2VERN 1T1ZA 2DQJH 5CKGA 5FYJE 5I1GL 1BFTA 1RU9H 3QCVH 5AW5B 1PZ5A 1S4IA 3WTWA 15C8H 3SCMB 2Z31B 5CD3A 1XZ0A 1QNZH 2VWEE 5C07A 2MNWA 3F7VA 4YSUA 3FQ4A 3BH9A 1RMFH 4H1LA 3FW6A 1T2XA 1YEEL 1AZRA 5E23A 5D1XD 1IC5L 4BGLA 4QRUA 2ZIDA 1WBZA 3RJQB 2AEPH 4KKAD 3NCEB 1WCQA 5KBKA 1CI3M 1UH4A 3HRZA 4Y4FC 1UXSB 1NTDA 1XF5A 3DGGA 3DPBB 1REIA 3UYRH 2WQ8A 4YSQA 2AJVH 2GIXA 3PQYB 2YD5A 5KJ4A 5CWSA 1N3NB 3L4XA 3IMSA 1KN4H 4JPWL 1T83C 2MCPH 3PWUA 4P2OD 1EHLL 3QCVL 2FEJA 3GKZA 3QIWB 4UQ3B 3DO3A 1E28A 1FVEA 3DBSA 1NGZB 3VXRE 2ZP8A 4PREA 3UMNA 4XN9A 4X5XA 3W82A 2IPTH 1SNRA 5D7LE 1PF3A 4IRJC 4R7VA 3OXRB 4JVUA 1XGYL 2RCSH 1LDPH 4H0HB 4LRIA 2Q86B 5LGJA 1KPRB 1PKQA 1SUHA 2XN2A 5GGRB 2FL5B 1VFAB 4YXKH 2FX9L 4IKLA 1OARH 1DQJA 4P5SA 5LG6A 3QUYD 4HZ1A 4MQTB 4XPGH 4GKZB 2AEPL 3MRLA 1IBGH 3O8XC 3JWOC 3QYMA 3V79C 2R15A 4OLEA 1LP9E 3F05A 2ZCZA 3DX8A 4NOFA 1CFSB 2X05A 3B9DA 4OJFH 1KT2A 2LTQC 4C56B 3NCYS 4W6XB 2XX1A 2R4SH 1KN4L 1EX0A 5GRJH 3WTXA 3MV8E 3W2DH 3NCJH 4ZUUB 5T1JA 5HYJD 4N87A 2J20A 4MMZB 1RUQL 1Z0MA 2X9YA 4OT1H 1G84A 5I66B 5I30H 2FVNA 3M1OA 4PV8A 2AMUA 4RAVA 3CLWA 2GJ6A 1LO4H 1Q0YL 2V33A 3L3IA 3T2PA 4RAUB 1RZKH 2J8OA 4PRPA 3QG6B 2YN3A 2VISB 1HH9B 4N22A 3LZOA 4XPGL 4LEBA 4EDXB 2PWHA 1LDSA 4ZFZA 3B2PA 1IBGL 1GOHA 3CN2A 4K2UL 4NO5B 4X8JA 5AUMA 3SPVB 1U9KA 4KMTL 1J1XL 3L4TA 5AVZB 3O6ML 2VXVL 1T83A 2EIDA 5KUMA 4QGYA 1WYJA 3L5JA 3B1UA 1AAJA 2VR4A 3ES6B 5IK3B 4OIIL 2ENSA 5CLTA 2R4SL 4HH8A 3R8BB 1KTRL 1E9QB 1BAWA 4U1HB 5AVRB 4B9ZA 3RB7A 3PQYE 3QEQD 4UQEA 1XAKA 2VDOH 4PJXF 4BFGA 2O4EA 1P4LA 4KZEL 4IRJA 4U3HA 2X4OB 2EO9A 3SGEI 35C8H 1GC1C 2J5LB 2PKDA 1MAKA 1W0VA 3EYOB 4MB4A 2QADD 2VLJD 3QCTH 4RNRA 2Z9TA 3PV6A 4RVBA 1J1OH 3KJ4B 4UUJA 4DESA 1RULL 2X9ZA 4UM9B 4NZDA 3H54A 5CCJA 1LO4L 3RZCC 4IMLB 4KJYB 4NNYA 4UILH 1X9UA 4JGMA 4UM9D 3GSWA 4YZWA 2LV4A 2XKSA 2DWDA 4OZFH 4N6QA 5HI4C 2YR3A 4LNVA 4K3JH 4NRYB 3D2UA 1QD0A 1BVLA 3BAXA 3CVBA 4LCCB 5E6ZA 3WNMA 2ZSVB 4HJ0D 1XIWD 3BIKB 4LHUB 4F8LA 1J0ZA 5ICZA 2Z1KA 3IU4L 1MI5A 4H20L 4NUGH 3UAFA 1S9WA 3GJEA 4HHWA 2W88A 5TQ2L 2ADGB 3F85A 3IFNH 2MWCA 2XZCH 4GP8B 4BA0A 1CGSL 2VDOL 3GMNB 4C56E 2PXYC 4E0RB 2FLBT 3U9UA 2BX5A 3JV5A 4JBSA 3B56A 4X4YA 3QCTL 4WI3A 2CUMA 3OGOE 1XGQA 5I18H 3L3GB 1KLFB 1CXHA 3EGDB 3MNMA 2ORBH 1CFTB 4WI7A 3QJZA 4XI5D 5E2VH 5FAAA 1WAEA 1I1FB 4K3JL 3KBEA 4OLXL 5E6UB 4ODUB 5I75B 2W8CA 5F0MB 1T4KA 2CO3A 3CCHA 5DZVA 3VFUB 4CSZA 2JSFA 1ACCA 3GXNA 2ADIA 3EOAA 4HHAA 4BFRA 4LKCB 1L6ZA 1I8MB 4G1EB 2AJXL 4PU2A 1WBYB 2XTSA 3KYOB 3OG4B 4HLJA 1MHCA 2E9JA 3II2A 1J0KA 4NUGL 1K4CA 3SE6A 2R0KL 5CSZA 3UL4A 3QDGA 4UBDD 4DAGH 2ZXGA 3IFNL 1DJYA 1A2YB 4L8BB 2XZCL 5KSVA 1RJYB 4N68A 2WTRB 2ITEA 5I1KH 2CMRL 5SWZD 4DGYH 3RZCA 3ZSTA 3HZ3A 2E27L 4ERSH 3NG5A 5IESL 1MWAA 1IGJB 2EXWD 3WDIA 4AGNA 2NXYD 3TVMB 3T09A 5LNGA 1CQYA 2X4UB 1JK9A 2NMSA 2G0KA 1OK8A 2APXA 5E2VL 3VSVA 1RSYA 4N8CH 3MLRH 3VWKB 4KY1L 5DVLA 1DLHA 2OZ4L 2F8XC 2CGRL 1I1AB 2MMXA 1JRHI 1OEZW 4YSTA 4XP1H 1XH3A 3ULVH 1O6VA 1QBLL 2DLFH 1P7QB 4IMKA 1FVCB 2IMNA 2V2TB 2IDSA 3S6CA 2IO5A 4MNGB 1EFXB 3V52L 1F3JA 1GJWA 2E59A 3N5AA 3LX9A 5DRZA 2PXYA 5E6IC 2ZX8A 4QRSA 1ADWA 2ZF9A 3LD8C 4C83B 1F56A 2WXPA 2JB6A 3QZBA 5T3XH 3VWJA 3GF8A 2LT9A 1Q9LB 3IDYC 4Y19B 1DQDH 4JFPB 1BJ8A 3OBAA 1XWVA 4F5CA 4ZW5A 3WKMH 25C8H 2G75A 1LO0H 1GKOA 4ERSL 3APCA 1SM3L 4XXWA 2QFRA 5DJYB 1GOFA 1SYSB 5DD5L 1S6NA 2BIMA 1ND0B 2HRLA 3MRMA 4HMEA 4X0KB 5EV7A 2ICEB 3U7AA 3V0JA 4FX5A 5JW4N 2EECA 2HMID 1ZT7B 1RK1A 1UEMA 4WW2A 4RZCA 4FNLL 4JFZH 5GPRA 3M45A 3CZFB 4OF7A 3L7EA 1INQA 2CK0H 2ERJB 3T8MA 3ULVL 1U36A 1THAA 2ZOKB 5ITBL 4XMWA 4N5ED 2Z6FA 4XODA 3AG1B 1IGMH 4XCYA 2Q3AA 5LHDA 3RNQB 3M6DA 1X44A 4R97C 3FNKA 4XHJC 2YJLA 4QLRA 1ET7A 2WKGA 3OJDA 2HT2C 1WIUA 2R4RH 3QXDB 1Q9OA 2IFGA 4PW3A 4N4YB 1XMEB 3WKML 4KUCD 25C8L 2WXLA 2Z34A 4GBXD 1LO0L 3W0WA 2E9GA 1AI1H 5GS2H 2PYED 4LARL 5CJ5A 2OL3H 3C6LD 3LZFH 1S7XB 2JI2A 3NIFF 4TSBL 1T7VA 2ADFL 4NIKB 5F72S 1LK3H 2AABH 3L5XH 2WTOA 4KO5A 2ZT9C 4MJIA 4UTAA 3SDDC 4NQCD 1SOXA 1HEZB 4J28A 1YEJL 4K8RC 1BQUA 1SDYA 3O4LA 1MLBA 4XX1G 4QOKA 1PPIA 1TJIL 4TVUA 3ESVF 4RQQA 4W9FC 5D93C 1JZIA 4HWZA 4YBQD 3GFUA 1T5WB 2VZVA 3ECQA 4HIIB 3V7AE 4HUUA 4KTEL 3F3HA 5EN3A 3DVGA 1RV6X 4IS6A 2F8VA 3MBWA 5H37H 4MNGE 4FZEL 4B53A 1JZ3A 2WYTA 3MRKA 2WLIB 4K7PH 3A3YB 1PY0A 5FFOA 4KZDH 1Y0LA 2A83B 4OCYL 1A6ZA 5EN2B 3KLDA 2HG5B 2VLRA 2OL3L 2XV6B 3DX9B 3LZFL 4Y19E 4EI0A 1RZGB 3BP6A 4HUWB 5EBLA 3FQXA 2FJFA 1LK3L 2CBQA 2EADA 3CZEA 4MVBC 1KFAL 5TE4H 3RVXD 4P3DB 5H2BA 4XAWH 2NW2B 2R2HA 2ZUVA 2BH0A 3BQUA 5IR1A 3BFOA 5C2UB 1T7ZA 1KZQA 5JW4R 1JNLH 2C1PB 4DTGH 2FYYA 3EYFA 4UAHA 1S78D 4F15C 3KGUA 3UC0H 3MZTA 4GXFA 3NFPB 4IU2B 5T3ZE 1E9OB 5DJXB 4G8AC 1IQDA 4M03A 5I1CH 3F83A 3ZTCC 4ES9A 2FT6A 4GRWB 1QPXA 4JRFA 3TEWA 3C8KB 1BIIA 3DVNA 2F7OA 4HS3A 1DUZA 4F7MA 3VW3H 4AGOA 3RX9A 1RUPH 4G9FA 4X6BB 4KUCF 3M07A 2ENJA 5JA8B 3Q2VA 1KJMA 4GAYB 4AT6B 1PZSA 4M62L 5MENA 4IRZH 3PABA 5BQ7B 4PR5A 4HH9B 3KVPA 5DLML 2AXHA 3QUMH 3PXLA 3ZXAC 2F7IA 1P9MA 4AVIA 1RERA 1I7ZA 4N0UB 1OCRB 1UA3A 1E3FA 1JNLL 2J72A 1I1RA 1T2QL 1UADC 3MNWB 3T2NH 3VVWA 1JYXA 2AQ3A 4R2GD 1LO2H 4Z7OB 3O4OB 2WBJB 2FHFA 2BSCA 3EO1B 5DJ8B 4KK5D 1UYWH 3D9AL 2UWEA 2X88A 3QUZB 5EUOB 1U8IA 4CW1B 2P5WD 2N1TE 1BF5A 2B4CC 3ARDA 1U8PB 1R3KB 5FEBA 4KKCD 3PRZA 4UNTA 3KD4A 2IOIA 5CILL 1D9KB 2WC7A 2NZ1A 1KDJA 3B2DC 2FQFA 1NPNA 3GI9H 2CJUH 5I26A 1CGYA 4G3YH 3OGCA 3EBGA 2Q9OA 3LNDA 4GXVH 1J05B 1K4DA 4FERA 4XNZC 1IFGA 3FCTB 3NRQA 3QUML 5FM8A 3UTOA 3MODH 1P1VA 3MRBB 1Q9KB 2OXGB 4TUJA 2JWYA 3DTDA 4ETQA 3C2AL 2EDTA 3APDA 3CE1A 2H4EA 2HKAA 3P2BA 4PBVC 1NM4A 5L8LB 2Y69B 4WWKD 3T2NL 5CSGA 4XTRC 1N64H 3FXIC 4QHUA 1M7UA 1WIPA 4Q9BA 3ALXA 4IOSD 1BZQK 3CN4A 5HJBA 2YEZA 2ZXDA 5FHBL 1JWUB 5D4QA 1R3LA 2OA9A 4WK4B 1D5MB 1X7TA 2OMVA 4K3HA 4YBHA 5KS9B 2DW5A 1SOKA 3C9NA 2WLLB 4L4VB 2AVGA 5HYQA 1ES0B 1JXKA 4JHAH 1CT8B 1W0YT 4C57C 4WI9A 1KIRA 4GRWE 5IMMB 5I19L 2NNFA 4B3VA 3HG2A 4YR6A 2CO1A 3FAXA 3LEYL 3ECUA 1R1CA 2NY2C 4G3YL 5KVFL 4F7CA 1TJXA 3MNVA 1FO0L 1KXHA 2CDEB 4QF1A 3T0EB 1UB6A 1BX2B 3SCMC 4ONOA 2BNRD 1JNJA 4I4WB 2WXRA 1RJZB 1IKFL 3COOA 1N64L 3MRIA 3RI5K 2VQ1A 5LBGA 3TM6A 5C0BD 2F19H 2FCBA 2HTLC 5HDLA 5AAMA 4WU7B 4BFJA 5JMRA 1N59A 4H25B 5CZRA 5AD0A 5D2NC 1X5MA 5K9QG 2H47C 3D85A 2CGYA 3PUCA 5D70H 1MLCB 4X7FC 3ATAA 2E0PA 1AYOA 1FZOB 4GYBA 1BVKA 4N90D 4Z7OE 3TBTA 1BG1A 3QQXA 5AEAA 5EG6C 1UUSA 4OFKA 3RWDB 3TIDB 1HDMA 2H45A 4R9HA 4X4ZA 1P7HL 4KXBA 2CNZA 5EUOE 3FOMB 5BQDA 3KPPA 1KTLA 4LLDA 2J71A 2OMXB 4GSRA 5LBSA 1TJHH 1A6WH 1ET5A 1DFBH 2XACC 3BJLA 3V6FB 5IBLD 2X4SA 4OZGA 3ZVVA 3QIWC 4U1NB 1E65A 3H55A 4HK0B 3FHQA 4O2EB 2YQGA 3F12A 1YYLH 1F1GA 3MLZL 3TJEH 1A5FL 1EZVX 4YVUA 3FAWA 2OK0H 7CGTA 5IUCA 1MJ7L 5EZIH 3ZRCC 5FA3B 4ZX5A 4X9YA 1MCEA 2HFTA 1DJHA 4PJAB 2APVA 4X7SL 5TH2B 4ZD3H 1FYHB 3BRFA 4JG1H 3LCYA 3MLYH 2ZUTA 4NC0B 1AQDB 3PIQB 3QH3A 2J4WH 2P80A 3QQDA 3A6OA 3SBRA 5JHDD 5KS9E 1M56B 4L4VE 5HDRA 1S5HA 1RSFA 1DVZA 3BYYA 5J1AB 1DFBL 1HXKA 1NICA 1BFOB 2P44B 4PJGB 1BXUA 4FQCH 5IFHL 5ESVB 1AJ7L 3LZQA 4QIRA 2VSKB 2XWTB 1UZGA 3CHSA 5AOZA 4R5VA 1PD0A 1JXFA 1ZWIB 2ALWA 3FHAA 4YHMH 4NNPH 2VMDA 1O7DC 2NSQA 4HWBA 2YEQA 3QQ4A 4R4FL 4N20A 4YAQA 5D2NA 1YYLL 5B7EA 3NPZB 3TJEL 4CVZA 3T0EE 4E9WA 2HLAA 4UYPA 3R0NA 4RX4A 4GI8A 1RPKA 2F6AA 3MLUH 4TVPE 3CLEH 5HHPB 4CDGC 4ZMVA 3ZL1A 2EDHA 1MWOA 4ZD3L 2YFNA 1H3GA 1MVYA 1XGUA 1W16A 1RFDH 2EKJA 3OWRA 5HD8C 3NAAL 4WY7L 2K70A 2V9QA 3MYZA 5KVDL 5IIEA 5EEXA 1GY2A 2P5EB 3ATDA 4YFLI 1HOEA 4XXCC 4WI2A 1OGAB 5CP3A 5EZJB 5JIHA 2FX7H 1FG9C 3IS1X 5HHQB 2OMUB 1HHJA 4L8DB 4FG2A 2OTPA 2X38A 3SYAA 2IPUK 4A7SA 4N5UA 2IDCA 3JUYA 5E00A 2W80C 5HDQL 4CC1A 3REVB 2NYYD 4ORZC 1UM4H 3C60B 1P5UB 3BHBA 4IBLT 1XL4A 3A4EA 5J1SC 3WTYA 3GS4A 2R0ZH 3QORD 1HXYB 4IU3B 3IJEB 3SDDD 2EYRB 6FABL 3VDAA 3V6OA 3MLUL 4FMVA 5FA4A 3Q8AA 1BV8A 4WU5B 3F65A 5F9JA 1T1YB 3B6SB 2E7HA 4L5FE 3CU7A 1IIKA 2I69A 1BYOA 2XJLA 2VDLB 1J5HA 1XGRA 2CM6A 3CDYA 4AH2A 3TBSA 3NJMA 1D5IL 1HL8A 1CDHA 3NIGF 1A4AA 3AM8A 4FA7B 3KPRD 3MV7D 3QEHB 1OALA 4QHLA 5DHYB 3NCWA 4I1NB 3Q2WA 1ZLEA 3L1OH 1F11B 4JRXB 4MKMA 3TEUA 1M6UA 4WI0A 4O4YH 3CDFA 2KLRA 2MKLC 5BOZG 4ZFGH 1O5PA 3RKDC 1ZLUH 1URIA 1AG6A 3ARGC 4UDTA 3RGHA 3NUKA 1ORSB 3TIEA 2OAAA 2PABA 3ULUD 3D05A 3DMMB 1BQKA 4WUUE 3UBXG 4G83A 2R0ZL 4KRNA 4NRXB 4ZFOA 1RAMA 4A6YL 4IBUA 2UYLA 1QHOA 1DP0A 1PD1A 2HT4D 5L4IA 4B41A 2EVGA 3FUJA 1XZ0B 2YIHA 3RWHA 5EDXA 3RGBA 1A1NA 1MW3A 3G6AB 2BHZA 3RDTC 3MGTA 3ISWA 3QXVA 1YNKL 4XXCA 2KS0A 3BSZH 4QRUB 1LHZA 3WEBA 4PRIA 1OTSC 1DZ0A 3U7WH 1C5BH 1WBZB 2L4OA 4XVTL 3VMNA 5IUSA 2HVBA 3L1OL 1AS6A 1K3IA 3V4PL 3OAWA 3DGGB 1J5IA 4YVNA 3EKCA 1O0VA 2P5EE 1QFUH 1RP8A 1L0QA 4W4OA 3R06B 5D7KE 2R1XB 5FYJD 3RPKA 3NEEA 3ZU8A 5IQ9A 2FATL 4PUBL 1HVXA 1RIUL 4HFUL 3HZVA 4GRLB 5GISH 2CU9A 3WO4C 1BYPA 3G08A 4XNXH 4TL5A 3WN6A 1IMHC 3TVMC 3D18A 4PJ7A 1WE5A 32C2A 3H3BC 4Z7AA 1PKQB 3VWKC 1WITA 4UU9A 3CVHH 5EZPA 2O5NA 3BSZL 4HUXA 3WNLA 5E1HB 3A22A 4APQC 3W9DA 1JV5B 1J8HB 2BJMH 3MRLB 3GSUB 4Q4EA 3BCDA 3K91A 4JFOB 3PWLA 4AQAA 1QABA 1QNIA 3P4LA 2Y6SD 3ARGA 3E80A 4FFYH 1UGNA 4OJAA 3U4KA 4JRXE 2BIIA 5I6XB 2C3WA 4L0PB 2FX8H 1OKEA 3GSQB 2FH8A 5HGDA 1IM3D 4XBGA 3E9TA 3I6KB 4LQFL 3NZHH 4HSCX 4RFEA 1AKJD 4LK4A 1DUYA 1WV7T 5GISL 2RQEA 4WO0A 2CRYA 4E36A 1I31A 1DQKA 1E4XI 2CO2A 1NMBH 3ZYJA 1QACA 2OSXA 3H3PL 1UTDA 5D7LD 1WUNT 2ICEC 4OB5H 1UXWA 5I6LA 4FDWA 4MA8L 3RDTA 3BAIA 2D31A 4N1HB 1BJ1J 5CZVH 5B1KA 4OBSA 3O3UN 1KPUA 1QEWA 1KENH 1M2VA 2VIRB 3CVHL 4M8UA 4UOJA 4CSPA 1TEGA 1XCTA 5LQBL 2ITDB 2YD9A 4ZFZB 2IPUG 5AUMB 1NIAA 3WIIH 2E7LC 2QPUA 4FFYL 2Z93A 2X89A 3QNXA 2AK4A 5DJ2B 2H3NB 5J3HC 2KQNA 1K85A 3MV8D 4G9DA 3UTSB 3AS0A 5DQJB 3GBLA 4YFDB 1T0PB 4G8FA 4DVRH 5DZPA 4LVHC 2R1YB 4Y5VC 3N40F 5EZOH 5I15L 3NA9H 1IC0A 1NMBL 3QGVA 5FO7B 1FG2A 1IAIM 3SCMD 4JO4H 2Z31D 2P8LA 2BMKB 4LFHD 5D6DC 1A4CA 4APQA 1SXBA 5FCSH 1QHQA 1V05A 1KENL 2CJTA 4BFIA 4Z76B 3ISYA 4JG0L 3FTSA 4L4TA 2P8PB 4JDZB 1JZHA 1J0YA 3WEXA 1OTTC 1W15A 3C09B 4LNRB 4D94A 4HCFA 5E9DB 5BPPA 2M1KA 5L2KA 4BUHA 4KUZH 5DJ6A 3HN3A 2VB5A 4AXWB 2H32A 3MRNA 3OKOB 3JV6B 4JM2F 4Q4IA 3DLQR 1LEIB 5F44A 1J8HE 1ACYL 4FNQA 4PJCA 3SO5A 2ZKHL 3VXTA 2FGWH 3WNOA 5TE7L 1NCJA 1UWXH 2QGEA 2VUKA 3OKLA 1U0QA 4MA3A 4P5MA 1R75A 3PQYD 2DIJA 3RIFK 3MRPA 4O58H 2OZ4A 1P6AB 5EZOL 4FQHB 3QIWD 4X4YB 1I82A 4LU5H 3FTWA 5DWUL 5CEZH 5C3LD 2ZWLT 1XGQB 1S8DA 3DETD 3E7JA 4P9HC 4PJBF 2CHNA 4CJ0A 5FYKH 5JO5B 4ZO9A 4YMPA 3IAPA 2YJQA 5JQ6H 3OPZH 1DBAL 3VG9C 5D4JA 4P4RA 4ZBJA 4M48H 1UEYA 4M5ZH 3L54A 5BZDA 1IGYA 3CCHB 4KUZL 4OW6A 1CWVA 3EOAB 3RILA 1T5XB 1P6WA 4P4KC 4OD1H 2B0SL 3H8NA 1IBFA 3GJFH 5ESQB 4TNEA 4Y0GA 4J2XA 1MHCB 2FGWL 1U92B 1VAHA 4OIBA 2EINB 4C56D 5IEKA 5FWRA 2P46B 2X42A 1TIUA 3WS3A 4KO9A 2GKIA 4JHBA 1ODAA 3UTSE 1FLRH 5EO1A 3BWUF 1OAKL 5HHOB 3QPKA 3RA7H 2HKHH 1CFVL 5IV2A 5CEZL 3T9WA 5KTEL 1PG7X 5FYKL 3QB7C 4XBPA 2W0LA 1SVZA 4XP6L 3Q9PA 4GLRH 5ALBH 1CF8L 4ZPVA 1TO5A 2R0LH 4M5ZL 3L3OC 5K69A 3FQ1A 2XXGA 1QW9A 4QTFA 5HD8D 3O4OC 1XH3B 3PGFL 3VRLF 1KGJA 5E9DE 3TO4B 5F6HI 1U95A 2CDFA 3PLYA 3QUZC 5DVKA 4LRNL 3SPJA 1G9MH 1CDIA 1KTKE 1MCSA 3WAKA 4HOZA 1CL7H 4AMKL 2RTTA 1SYVB 1H5BA 5GS3A 2BVYA 3G5VB 4GS7B 2PN5A 3QSKB 3BDBA 4M56A 4WK2B 4XNBA 4Z0BL 3TT3H 1E6JH 2UY6A 1XL6A 2BP5M 5BS0B 3RA7L 4OCLC 2XIIA 3QI9C 4P46C 4ZXBB 3HBPA 1MDTA 3QWRA 5DMGC 3VDCA 2YARA 2X1OA 2XBDA 3MRMB 1NCAH 4I18B 2NY0C 3H7BA 3BVVA 4JG9A 5HGHA 4BCZA 8FABB 2IOOA 4P9ML 2DH2A 4JB9H 4NJAH 2Q8AH 5I0ZA 3Q8CA 2WIMA 3N85L 1KPVB 1R5VB 2X4TB 4P4KA 4FFVD 4LSRH 2HLEB 4KTDL 2ZYSA 2XI9A 5GRUH 4LOFA 4QRRA 4HJ1A 4EUPA 4DUVA 1UKQA 4LHUD 2E8ZA 3QEGH 4FZ8H 3WNPA 4D7BA 4OM0L 1G9ML 1JWSA 2YD1A 5EIQA 2BM3A 4Q7DA 3CC5A 1CL7L 5DVNA 4GIAA 1UHVA 4OLZH 5FYJU 1CDCA 1ZCRA 1ITCA 2G5BA 4PJ5A 4RMWA 2JF1A 3W0WB 5JIQA 4RRPG 3EO9H 1O9VA 1BZ9A 1L9PA 2DM3A 5CUSH 2IDFA 3LKPA 4HJTA 4K0OA 4KO7A 4OCNC 5HHOE 5EC1A 1U91A 2R0WL 3L3OA 2ICCA 4JRYA 4RWHA 3T0EC 4Y4KC 2AGJH 1T89C 3K8KA 5DHVH 5HHMB 3FUKA 3SKOA 4B60A 2VR9A 1G6RH 3LXBA 2B77A 5EO9A 5CHNB 4XO8A 3OZKA 4RQQB 5EBGA 3NH7L 3SGJA 1S7UA 5D7IA 1Q8MA 2A6DA 3ZSSA 2V9RA 1MQKL 1Y07A 2ZX7A 2P8MB 4PWEA 3V0DA 4CC0A 4MNQB 4G82A 4TSAH 4NKQB 1GRWA 3FMGH 4NQDB 3QI9A 1JPFB 4YO0B 2JJVA 5CD5C 1BFSA 2JKWA 3BP5A 2Z91B 1Y0LB 2QKIC 4GXUM 4E5XB 5F8RC 5CGYC 1A6ZB 3EFDH 3T4YB 4EMZA 3GSVA 1V54B 4YIQB 5CUSL 2JKJA 3EDDA 1Q1JH 3VI4F 5JXED 1F4YH 5BS0E 3UZEA 3FQXB 1JMZA 1OAYH 4M61A 4PCYA 3LKSB 5I6KA 4ELMF 1RHHB 4MTMA 4D9LH 4ONFH 4FXGC 4W81A 3DX7A 3L4UA 2R2HB 4QYOB 1OP5H 4JAMB 3BQUB 5IR1B 1KEGL 1DR9A 1EPFA 4WTZA 3VWKD 3TFBA 2FYYB 3EYFB 1I1AD 3FTGA 4YH6A 4ZUWA 3DK0A 3KWWA 4CILA 1EHNA 5LJYH 4H1LG 1P7QD 1RVFH 2ITCB 3R8QA 1IQDB 4N1CA 3OAZH 5AB1A 3RGVA 4PJEA 1EFXD 5HVWA 1CICB 5DZNA 3A21A 4TSAL 4X9BA 1MSPA 4CBZA 3SSGA 4YHZL 4Z7WE 3CX2A 3WKQA 1BIIB 4HULB 3WDJA 5J12B 1EGJH 2AF2A 3WKPA 1UWEL 4Y19D 4WHDA 3RIKA 4R4NC 3RTQC 1HCFX 1CLYH 4Y4KA 1Q1JL 3FBQA 3S36X 2DQEH 4A2EA 1S9XA 2ILLA 5MENB 3W0WE 1FFPA 1OAYL 2NCMA 2VC2L 3MLXH 3QYCA 3QZPA 4PIRF 3DUUA 2ZP9A 4PR5B 2HX8A 2PCXA 1AQMA 1J8RA 5E95B 4D9LL 2X1QA 1JPGA 3OKDA 1I7ZB 2J6WA 3VJ6B 1MW0A 3KWXA 4FYRA 2QGBA 3OMZA 1NLBL 1QX1A 2YS4A 5A43C 5FO8A 5HHME 2HTKD 1HC1A 1ZS2A 4GSQA 2EDWA 2JMRA 5T3ZD 1JZ2A 5C8JB 1H6UA 4KK6D 1ADQL 1U8CA 3HZYB 4TS6A 4DK5A 1FO0A 2UWEB 3QP3A 2QKIA 3INUH 4L3EA 3LNGA 3ARDB 1HNGA 1KMGA 4MNQE 3F58L 1IAKB 4R7LA 5AWNL 4CMHB 4NQDE 3CSPA 3MLTB 4WNQB 2F5BH 2DQEL 1WFIA 5I71B 3HS0B 1I9IL 1F6AA 1MJ8L 4FXGA 3MRDA 3OX8B 3BT2H 3C60C 3CX5J 2W1NA 1XBDA 2IAND 4NZJA 4ETQB 1XCQB 1M3IA 4IOIA 2EEXA 4TUJB 4I77L 4Q6IB 2O6PA 4H8WH 1CYXA 5FOBB 2NRDA 4MHHI 4OJEH 3UTPE 5HGGS 1N10A 5FCUL 3MJ8A 4CBPA 4FRWA 4NO0B 5C70A 3GMMB 4J1UA 5KYXA 3EJYC 3U0TA 3U4BH 3RVWC 3S5ZA 3MLSH 2OMVB 4JUTA 5HYQB 3Q48A 5EF0A 1XD1A 1WFNA 1JHLH 3FT4A 1KC5L 3V9CA 3DARA 2WBWB 3HPLA 2YD0A 4TUKL 4EOWL 2CCVA 3E9UA 3LKNA 3K6SA 4HXBL 1S7RA 3UTZA 1U8MA 4F7CB 4PI0A 3MZGB 2AHIA 4N2GA 4JMXA 3W38A 4HGMA 4QF1B 3HZMA 2YUZA 1UB6B 5LG1A 4H8WL 3D09A 3HC3L 4KROC 4AEIH 3IGKA 4PVNA 3LKQA 1JPTL 2LVEA 3QJHA 1N59B 2YBGA 3N50A 4JKPH 4YK4C 2GSIA 4AZUA 3GC3A 4S1SH 5AD0B 5GZNC 4OZIA 5HDBE 4BK5C 5GRYA 3EDEA 2AJSH 2HH0H 4LHJB 1BVKB 3TBTB 3WGUB 5AZ2H 3ZQWA 1PZ2A 3OKEB 3UTQA 4F7KA 1WD9A 2QV2A 2PF6A 1JHLL 3DSNA 4D0DB 1MH5B 2N7BA 2ZOOA 2CBTA 3PFQA 4QKTA 1EZUA 3FB5A 2OPCA 5K59E 5MEQA 1AHMA 4PSRA 3BKYH 3ARBC 3HB3B 1OLZA 3EFOA 3R1GL 5CZXC 2VW4A 3RIAF 3WFZA 2WP3O 4GUOA 4AEIL 5HI5D 2WHVA 4AVHA 1MFAH 5I6OA 1M7IA 3F6JA 2CKBL 5J9PB 1JFQL 4JKPL 4WKXA 1A21A 4F1ZA 4WHYH 3K46A 4F92B 2WBJD 3H9SA 3KCWA 3GBMH 1FORH 4JFQB 3FU6A 3I2CH 3LMJL 2EUXA 4G6AD 3QUZD 5KVGE 1EAJA 1DSFH 5F89B 1J9QA 4A7QA 3CFEA 4JHZA 1Q4NX 3V8CA 4NUMA 1OCWL 3LN4B 3QQDB 1AR1C 2VDML 3GBEA 1C5DB 1D9KD 1P4IL 3BWZA 2DYPB 4Y2NA 4MXWL 1A3LH 4K55A 4A55A 4CN4A 2QSQA 3P69A 3K4DA 3BKYL 4U6YA 2I07B 2ZOLB 4UQ9A 5FO9A 1N6VA 3QUKA 5DMGD 2J8UA 2BVQA 3HG0A 4YAQB 1LLAA 4XNYH 4OCXH 3BO8B 2BNUB 3L6FA 4CVZB 3DRQB 3LXCA 4KVPA 1ZXQA 3O3BB 1KTBA 1RUMH 1XCXA 1FHNA 3OSKA 2XRAH 1IEBA 3QJOA 2R69L 5KYUA 1BFVL 2Y23A 2Y9RT 1PIGA 3GBML 2CHDA 1KBWA 1B0GA 1HHHA 5KN5A 1A0QH 1DSFL 1HEJC 5DD3H 4YSEA 4A6YA 4L4VD 5HPMA 5IF0A 5DEFA 4CSTA 2YA1A 3R0MA 5IOPB 1ZE3C 4B0MB 1A9BB 1CPUA 1JFHA 3ARBA 3W11C 1HHJB 3TF4A 1RHFA 3IYLW 3OXSA 2DQHL 3D0AA 5FB8B 4UYQA 2OYLA 3KR3H 2IFFH 1LWJA 4K9EH 4DERA 4I0PC 2P52A 1ANUA 3B4NA 2PETA 4I5BA 4NQXB 4XNYL 1P1ZB 1P7KA 3UPRA 3V4PA 3EGXB 4TVPD 4WK0B 4L8CB 5CEXA 2V7NB 4JG5A 1PTZA 5D1ZI 3O11B 3NSXA 1QI3A 4ZYKA 3KE0A 4OZHA 4Q9RH 1ZJBA 5ANMA 2YPLA 2FIKA 2PTVA 3IM1A 4G7RB 3PY9A 1X5JA 5E2WH 5SV4A 2D9CA 2XZAH 3IWVA 1XGRB 2XJKA 2DQTH 4KK8C 4L0ZA 2HLFC 1ZSDA 1UCTA 5DD3L 4AH2B 4ZMYA 2XIDA 4PJHF 3CBRA 4FQLH 2BSBA 4MA7H 1KLUA 3GSNH 1B4RA 3UPCA 1EO5A 3HG1B 4LVOC 3B1TA 4ZUSB 5L0QC 3RPBA 1FJ1A 1Y1UA 1DL7L 1HI6A 1I3RA 1U3ZA 1WS8A 2COVD 1OPGL 2Z92A 3QISA 2Y3NA 1DN0A 4UDTB 4DW2H 4NUPA 2VZ1A 4E41B 5FGCB 2Z0UA 2G9KA 2V3FA 1J12A 4MZ2A 2Y06L 3NIDB 3JWDL 5TDNA 1WA2X 4QPEA 4RFNC 2K6YA 1RIVL 5IQLA 1WEJH 1VZGA 2X4QA 3AXIA 4S1QH 5A2IH 1XV8A 1LEKA 1E43A 1A1NB 3U0WH 3PNWA 4AV5A 4QNPE 3TTYA 5E2WL 2XZAL 2XWXA 2DQTL 2H1PH 4QI3A 3BESR 1NWOA 1O6SB 1OIOA 4PRIB 2XYBA 4FQLL 1GZQA 1FCCA 1Z9PA 1D7DA 1UD5A 3CFQA 1E9PB 5DMKA 3GHEL 3UYOD 4GW4A 3MREA 2FIRT 2SEBA 3E6HA 3LPOA 3TL5A 4DKTA 1PG7W 4PGDB 4MJHA 3TA3B 1PAZA 5K1VA 2IGFL 5AVXB 4I0PA 1ZDSA 1E8XA 4QWWC 1YNLH 4YBLB 1Q9WA 1DJWA 2WO4A 2AI0H 4DW2L 4Y1SA 4QLWA 2B3IA 5JYLA 1UACH 3S8WA 2MCG1 2O5YH 3VH8A 2QQNH 1KV7A 2VL4A 1DFXA 3QR0A 4X7DC 3GMPB 3V10A 3STZA 3ZRSA 1AKPA 3CFNA 4FQ2H 4S1QL 3OJMB 3FU7A 1Y6MR 4ZQKA 4UINL 3GPEA 32C2B 5ADPH 3FSAA 3EF4A 3V6OE 3K1KC 1HWHB 1OPOA 4UT9H 2H5UA 4KQ3H 4NX0A 4XB8A 1QBMH 5AL8A 5D4IA 1YN6B 5D9SA 4XNQA 3W9DB 8PAZA 4J6IA 3N06B 3UZVB 2P5ED 4QXTB 1F58H 5MHSE 4TPRH 2HA1A 1OGAD 2YMOA 4XB3A 3EZJB 5I73B 4P57A 3HG1E 4B9GA 3IMTA 1GSMA 1YC7A 4O51B 4HLZG 4JLRA 4AK2A 4RFEB 1T03H 4Y2LA 1DUYB 1OY3B 4F93B 4BZ2L 1I1CA 3C60D 3LNFA 3O2WL 2YRLA 4ZXBC 4G8EA 3S88H 2A4ZA 2W0KA 4NKDA 4EDXA 1TQBB 4JRWA 1KCKA 2NX5A 5D55A 5FGCE 4I18C 2UXGA 1AZCA 2X70A 2X40A 4FQ2L 2O61A 1BIHA 1SDDA 4LHQB 3NIDE 4LPXA 2D31B 3R7QA 1KEMH 4KVCH 1F86A 1KPUB 1MRDL 1XCWA 1FL6B 4UT9L 3MSPA 2BIOA 4KQ3L 4OJYA 3LZNA 4YQXL 2HVKA 4PJAF 5B3JE 4LPUA 2VDOB 3EJYD 4NC1C 1UATA 4V33A 2GUYA 5D6CA 1SPDA 4OI8A 1UM6L 3QJVB 4WENB 4PRIE 2GCYB 4JRXD 3PV7A 4FYTA 4HD9A 3J7HA 3R7RA 2AK4B 2X7LA 3GSXB 4QXUL 5HJ3B 1YUHA 1XH1A 5FKAB 3KLAB 4G9DB 3ZE1F 1H3TA 4F57H 2YUXA 4OZFB 4NN5B 2A2QT 2B16A 4PJGF 1T03L 2I24N 2HWZL 3WJMA 4NRZA 4CC4C 3DMMD 4APXA 2VDQL 1F2XK 4URKA 3FO1B 5EDSA 4L2LA 1SXAA 2N3JA 2ZAHA 1EFQA 1SJVA 2VQ4A 3HNSL 5H35B 4X6CB 2FRGP 5FV2A 5E8NA 1RD6A 1JBJA 1A3RH 1EAQA 1EANA 3RWFB 3HG4A 4YHOH 4BFIB 3REWB 3H0TB 4P5TB 4Y2DC 4C4KO 1WWBX 1N2RA 4LLMB 1G7QA 3BYTA 2ZUXA 4GUPB 3VFPA 1DO6A 1E27B 3PU7A 4IJ3B 4MXQC 2CLVB 1UFUA 5E03A 1CDBA 5DJCB 1HCZA 1V3MA 3LPGA 4ZOBA 4DUXA 3K8MA 2D73A 4AM0Q 4QRQA 1PJWA 1IUZA 1FYTB 2DLHA 4KKPA 2Z1PA 5MERA 3VXTB 2RH0A 3BC9A 4LSUH 2BOCB 3OKLB 4MA3B 5B1AB 2V37A 3Q05A 3L3DA 2BFGA 1KTJA 3FT0A 1V55B 4D7PA 2DQGH 2WQXA 3MTRA 2YPKB 4B9KC 5KBPA 2VN7A 3BFQG 4GRLD 2QT6A 2R83A 4XPTL 1Z2KA 2P45B 2TSBA 4YWGH 3VD7A 1R3JA 4M7LT 4L8SC 1TYEB 5D96B 3IFOB 3QA3B 3S97C 4Z7NE 5GS0C 1PNCA 2IIJA 4O2CB 5FIEA 2XCMC 1WPCA 2EIJB 3LEXB 4X4XB 4X7CC 5F9WB 4JM4H 4KFMA 4DP2X 1R17A 5SWQA 1EXHA 2V2WB 1IGYB 3DJTA 1NFDA 4JUSA 3MCG1 4HKXB 1JF6A 5T5FL 1J8HD 2OULB 4WHCA 5BZWA 2BW4A 2JE8A 3FUDA 4ZRGA 1CICC 4HAGA 4LSUL 1NEUA 4JX0A 5J12C 2LAGB 2AK4E 3Q5TA 5DZLA 5IEKB 2OMTB 4LP5A 4UZUA 2UX7A 4LESA 3S5LA 1CFBA 1F90H 2DQUH 3BUBA 3L9BA 3MDJA 2C4FU 2FD6H 3K2KA 4UMSA 3F8UB 3N2JA 3WDHA 5IV2B 2E7CA 2CO7A 3T6VA 4F2MA 4Y2DA 5F7EH 4MA1C 2ZUYA 2PW2A 3ZUNC 2O5XH 1CGTA 3FT2B 3L3KA 1MKFA 2YPVH 4PCKA 1KIQB 3RWJA 4X6CE 5CLWA 5I9QB 4ZPVB 3HE6A 1Z5YD 5TJWK 5F1SA 3S35L 4P5KB 1C7SA 1KBBA 1FNHA 2CRMA 4HCRA 3I6SA 3UG5A 1DJGA 1LGVA 4AGLA 1SDAB 3BMVA 2XWCA 1U95B 3D3VA 3LHPH 4CKQA 4EDWL 2XLLA 2X4PB 4PJFA 4NENB 3RBSA 5IW1A 3DDGA 3ZKND 3WTSA 3W11D 1FYTE 3VMOA 3EDFA 4OGXH 3UTSD 1H5BB 4YDVA 1AY1L 1MJUL 1F90L 2DQUL 2EDRA 4N0CD 2UY6B 2OMZA 3FC8A 3G7TA 4MJ5B 5IB2B 5IB4A 5CBAA 3HS0C 3A4AA 1Z0NA 3PL6C 7FABH 5F7EL 2DEYX 3MYJB 2ED8A 3H7BB 1NAKH 1NINA 4WJKB 4NZTH 1UVQA 4NHUB 1I8AA 2H1LM 4YDZA 3V0GA 2PUQT 4NI3A 1PBYA 2LU3A 4QEGA 3I6LD 3QDMA 3DO7B 5LXGH 5E9DD 3D2UD 2J1KA 3O6FB 3ZDYB 4Q8BA 2OL3B 3KGSA 1E5ZA 1HZHH 1U8HA 5CGMA 2NNRA 5DFVD 2JJTC 4NT6A 2F8IA 3GBDA 1T0NB 1CR9L 5JPMB 5DHVA 4OGXL 1PSKH 4HF5H 1FZMB 3MMEB 4AV4A 2G5BB 4XOAA 1ETZB 4IEFB 3FN3A 2BOBA 2NNXA 2V5TA 3M1BA 3PGDB 4ZOAA 5HY9A 1GAFH 3L9YA 1DVUA 3ULVE 4ZMLA 2XN0A 4JRYB 3SEPA 2B9BA 1BP3B 1KB9K 1YEHH 5DGRA 1RURL 4NYLB 2XNAA 3IN2A 4B3EA 3KNBA 2NLJA 1EA9C 1GGIH 3KVQA 5I1IL 1BEYL 1N0XH 3BH8A 4AYDC 5T3XE 1U8LA 5LXGL 2Z4QB 3S98A 3V9FA 2X6MA 2P3YA 4LEXH 1ZEAH 4JFFA 4DZBA 3N41B 5C7XL 1HZHL 5GS1C 4GLRI 1LYQA 2XYCA 4Y5YB 4ODWA 3UG3A 1A66A 5BZZA 3VMPA 3FH5A 2R9HD 1E50A 1OM9A 4PRDA 2RJMA 1PSKL 3N1GC 3MLPA 1R6VA 1MCFA 3QDHA 3NGBB 4EBQL 4PP1C 5AOMA 1DEDA 3EOBA 5A7BA 1M6OB 2KI6A 1XGTA 2CO4A 2GITB 2YD4A 3J07A 3PL6A 3QC5X 4I0KA 3WHE0 1U93A 4Y1AA 4GO9A 1KG0B 4RA3A 2IQAA 2O6EA 1QLEH 3H56A 1U2HA 5HHOD 5I1JL 4F58H 3AY4A 2WIIA 1ADQA 3HB3C 5IFAH 1I3GH 1ZHLA 2VT0A 4OU3A 2C9AA 5KAQG 5C08A 1YEHL 3QXUA 3SN6N 4Q6YA 5FHAH 3ILQD 3OD3A 4PBDA 2O72A 2OTUA 3ROLB 3NRFA 1NEZB 2JJTA 4U1KA 1XSKA 4LEXL 4AV0A 1GW6A 1UCBH 4MDIA 2X53A 4AG4L 3WXWH 4ZUWB 4EVNB 3KWWB 4NZUH 2RD0A 4XO9A 3KL3A 3TO4D 2A99A 3MRQB 4DHLA 3P4NB 1I8UA 3QUMB 4PJEB 1D6EB 3OHMB 2XFXA 1K3ZA 4RISL 2A6IA 3F04A 1ETA1 2VO5A 1AGFA 5EA0H 2VH5L 3CSTA 4JJOA 4RA0C 1A7PL 1Y7VA 3Q3GA 5GHWL 2EDEA 3MLVH 2DEWX 4JPSA 4X99B 1CBVH 1J0JA 3C6EA 2FWSA 5BS0D 3Q1SL 4I9WE 3DTXB 3WKYA 1KCUH 5IFAL 1ZVSA 1I3GL 1FFPB 2Q7NA 2Z8SA 4ODBD 4TQEH 4V2CB 5GGQH 4ZXBD 2D7PA 2FEEL 1JPGB 3B2VL 5B38A 1OP4A 4JRYE 4OFYD 4DCQA 5GS1A 5D2LA 2X2HA 4F1SA 2EDDA 3WEMA 2P24A 2JTYA 2VXUH 1UCBL 4M5YH 1VCBC 4AENB 1A47A 2Z35B 2W0FB 3AAZA 4BH7A 1OCZB 3K6DA 4NQQA 1IL1B 1IE4A 2MPAL 4UOQA 3PP3H 4O2FB 1WAAE 2RHEA 2PCYA 1U8CB 3NCBB 4DUWA 4ONHB 3H6AA 4WFGD 5CMAB 3K4ZA 2AJUH 2XKNA 2YD7A 1R9FA 2PMZA 5EA0L 2BFVL 2IDQA 3LN5A 1CBVL 2FWLB 3TWCL 2VSMB 4GAJH 1VACB 3BZDA 5T1KB 3W0WD 3GTNA 4Y1TA 5GGQL 4BZ1H 5KEZA 1FV1A 1BD2A 5JW3H 4FE9A 2E5EA 1FLTX 2HJFA 2YXVA 1S5IH 4IOIB 3RWEA 3NJHA 3TNMB 1L9NA 3GRWH 5HHMD 3MROB 3P9WB 4OR1A 4RMUA 2GI7A 5KSAA 4FD0A 1ED3A 2X2YA 1DZBA 4MDJA 2IALA 4B5EA 1XEDA 3TPKA 3MJ8B 1ZTMA 3QNYA 4GQQA 2BSSB 4CMMA 3RWIB 5GJTH 2XQBH 3EH2A 4OD3L 4WI8A 4MXQD 1WLHA 4J1UB 3U0TB 2W65B 3C5ZA 2MH4A 2X4NA 5FFLA 3IDGB 2H3XC 2YGPA 4KZ0A 4PLKC 4MNQD 3QNZA 2WLZA 4NQDD 4XN2A 2WMPA 4U7MA 5EZLA 3FT4B 4BHUA 2CKBA 1X5XA 1ONQB 3C08H 3HFML 3U2IA 3LKNB 5EU6E 3ZYIA 2WXGA 3RB5A 4I2XA 1DVFA 2JIXA 4R3SA 5DC9B 5LGHH 4HUVA 1S5IL 1X4ZA 2DY2A 3HZMB 4F33A 5ESAA 4GFXA 5ICXA 3RTLA 3VFRA 1MY7A 1QWNA 4MMXA 4WW2F 2DJ4A 1KELH 1H8SA 3WL9B 3QIBA 4M43L 4NERA 1ZGLM 3BQUD 4KPHH 1XF3A 5D7JC 2FO4A 4M93B 3IJYA 1PZCA 3GS0A 3QJHB 5C0DA 4D3CH 4OZIB 2CD0A 4AL8H 1JWMA 3JVGC 1V3KA 1M3JA 1N6QH 1ZD6A 2PWDA 1GKEA 4NPYB 1JVKA 1X9LA 1BLNB 1NOLA 3C6SA 4M7JL 1ECZA 2DWYA 1CICD 2A9MH 3AXLB 3WIHH 4PHXA 5IB5A 1NCUA 4FEIA 3DSNB 2QSCH 3BAEH 3ECVA 1NUFA 1QEXA 3BZ4A 3RZWA 4BQBA 3PWJA 3CBKB 5DLLA 4AKQA 4KHXH 4OGAC 3BEVA 2Q76A 3C08L 1TTCA 3M86A 3JWDC 1TT6A 2WM0A 3QG7H 3CK0H 3EH3B 1NJ9A 2R69A 1HK6A 5MEQB 5MEND 2WXMA 5D7SL 3VGBA 4P23B 3P77B 2J55A 3X1BA 4YPJA 3WY3A 2WP3T 5I1EH 1NDGB 2EEBA 5HYEA 4KPHL 3DTUB 5IREA 1TTGA 1TJMA 5DCCA 3II3A 4ODHH 1H9VA 3DYMA 5B39A 2HVJB 3DUHA 4XNMA 1U8QA 4MMYA 4FQQB 4OGQC 1N6QL 3F7LA 4ONGH 3FONA 3H9SB 4H13C 4M7LH 4G42A 2ZP0T 3QUXB 3US0A 2A9ML 4J12A 5FDWA 3NP3A 3CFEB 1LD9A 4BRJA 5IJBC 3HNVH 1L7IH 5F9AC 2E76C 3ARDD 3D87B 5MI0C 2GTQA 1DSYA 2YGNA 1QSEB 4CN6A 5KSUA 4L1SA 4KHXL 4XC3H 1RZKC 4X5QA 3CK0L 1IB5A 3MXWL 4GW1B 4U6YB 4YX2H 2G2RB 2CR0A 2Z4TA 6PAZA 5D7JA 5C0RH 1JSYA 2J8UB 4BM7A 3CUPB 2BVQB 4UV4H 3D4CA 3D08A 4DVBA 4NKOA 5EPMB 1B0IA 5BVJA 1D7CA 3GT6A 2Q3XA 3JVGA 3OR6A 5AKRA 4PIBA 4ODHL 2ZWZA 3KHOA 3VYNA 2ENYA 2TRYA 2EACA 3ZKMD 4F27A 5FYLH 3EYVB 4NO0D 1IEBB 4ONGL 5DJAA 3T8XA 1JZ6A 4E9TA 4LSQL 4YXLH 4Q89A 5KBLA 3RKPA 3E38A 2BC4A 4M7ZC 1D5XB 4XWGH 5AW9B 1FH5H 4BELD 5KYYB 3OC5A 5AYQA 4WRLA 5HPMB 4G43A 1DEEA 1XR9B 3BP4B 4S1DD 1B3IA 1FPTH 1USQA 4BQCA 1FNSH 5EWIL 3GZKA 3MGOB 1TTRA 1PYWA 1HOCB 1JZGA 3ZDZB 3DBXB 3G5XB 3KDMA 5C0RL 1BZ7B 1MG2C 4UV4L 4GKSA 4Y89A 3FTYA 4MYPA 2X12A 1B4JH 1MCWW 3GM8A 3NFSH 4PTUA 5EOCL 4A2DA 2I25N 1WDAA 4ZS7H 3GLZA 3VXNA 5CEXB 5K33A 3I6GA 2G3MA 4IRSC 2JLLA 4JHVA 4OZHB 1KXTB 4URTB 5F7DA 5FYLL 4BA8A 5C0IA 1NBYA 1RJLB 1UKSA 4AYFB 1GJUA 1YEWA 5ENWB 5KSBA 1MOEA 2RALA 2J8HA 1RQ5A 1NIFA 2I9LB 3BKJH 5LDSA 1ZSDB 2YMXH 5C09E 2UWEF 2RR3A 1SY6H 3PHQA 3H9SE 4M6ML 1SGKA 2IH8A 4ZAKC 3L4CA 5BVPH 2E9IA 1KLUB 3MCLH 3QW9A 4XVJL 4ZQTA 3DJ9A 4L1BA 4EUPG 4WO4B 4KNUA 3P4OA 3MOQA 5C0NC 4JFDB 4Z7QF 4TTGA 1FJ1B 1QSEE 4EE2A 1NANH 1HI6B 3BPOC 3C5JB 3LS4H 4WQOA 5J6SA 5I0DA 2YK1H 3GEFA 4K3EH 2YMTA 1JF1B 1TG8A 1N7MH 1DN2A 2OQJA 5FK9B 2YLKA 3S8FB 4LMQE 1X7SA 1JUFA 1B4JL 1IAOB 1SN2A 2WBKA 3ALPA 2F18A 1YY9C 1YHPA 4FAAB 2X4QB 2Y5TA 1UZ6F 2BY0A 4WZ9A 4K23H 5T33H 3TC9A 2YWZA 4Y88A 5G4OA 3ILEA 4B27A 2EUWA 1HNFA 1A8ZA 1EDYA 2VMCA 2OXHB 1SY6L 4BZ2A 3RWGA 5BVPL 1C8QA 4ZMXA 5KANI 4YSPA 1PKOA 2F58H 2J43A 3X1NA 5IJKC 3B9AA 5I23A 3E6HB 1FIEA 3Q7JA 5B7MA 1G7MA 4HISA 5F1NB 2DYPD 2VJXA 1MFDL 1S7VB 5BO0D 3VI3A 5E4EB 4K3EL 1Q9WB 3CVHB 2P26A 2XDHA 3A5VA 3GI8L 4H8PA 5G5DB 3T3PB 2KQMA 4DKAA 4DQOH 2LR4A 2DJMA 3VH8B 2D03H 1VADA 4X6DA 3LPPA 3KVDD 5JLZB 1AACA 5LDUA 2E9BA 1WFOA 4L29B 4IGBB 4IDLA 3WE6B 1M7DB 2C1OA 3Q43A 3AROA 5I9QC 5T33L 4ZAKA 5ICUA 1RLWA 3BW9A 3BN9D 1LNUA 3ARYA 3KL5A 4JFHD 4QY8B 4KI5C 5AW1B 5I1AA 1XF2B 1EERB 1Q90A 2ZG3A 3V5DA 5F2FA 1KJ3L 5D9SB 4FQXC 5AAWC 3VFOA 4WTZG 2B1AH 1ZK9A 3KW8A 5IT2H 1U3HA 1OM3H 4UM8B 4C58B 3PWNA 2VL5B 3B7YA 5CJQL 5MEOB 5H8DA 4WAFA 3T3MF 3TCLA 5JHLL 4YHKL 3LNIA 4OAWB 5ADOH 2CJSA 1XH2A 4YLBA 1P84J 2JJWA 3GXIA 4JFDE 3BRGC 4BFNA 1TQUA 2VUYA 2X41A 1G7IB 4OZGF 4ZMZA 2ZUQB 4Z0XB 3ZMEA 3LSOA 4G8EB 3BPCA 4FABH 1E8YA 1JZJA 3CLFH 4M02A 4NKDB 1J1PH 2E7DA 2XV0A 3QFDA 5I6PA 5EEWA 4PG9A 4PGBA 4OI9A 3DKHA 4ECNA 3LKRA 3O3EA 3GO1H 4P3CH 4QR7A 3S48A 5L8JB 3FKUS 2AFNA 1QASA 2HCZX 4LLAA 4UTBH 5AW6B 4FA8A 3QDJB 3KWVA 1SN5A 1PJ9A 4BSWB 2QSTA 3GIVA 3M8OH 4U3SB 1T1WA 5IJKA 5BO1L 2Y4SA 1HWWA 3O6FC 3I50H 3ILPA 5IT2L 3ARWA 1BBJB 3UJTL 4X4ME 4PLKD 1UENA 4ZPTB 4RH4A 3HG1D 5JPMC 4K5OA 1OZTG 4PRHA 3JV4A 1EEYB 1MCOH 1H19A 4ANWA 1MF2L 3H2PA 4RGNC 5FUCE 1KY7A 3UZQB 3F01A 5B4MD 1NC2A 3ELQA 3BXNA 1OP9A 4U1LA 5DRNB 4E41D 4DO4A 2AV1A 2XWEA 5T5FA 4AEHH 4FABL 4APXB 1J1PL 4HZAA 2JCCA 5T1MA 3T3PE 4Y16B 2Y24A 2WQWA 4P3CL 2Y5EA 5E8NB 5IQ7L 4WDIA 2X0UA 1KJ2L 4YXHH 1M1XA 2CIIB 4GQ9H 2BZ7A 2YOAA 2D7TH 4OVUA 4ADIA 3M8OL 3SODB 4C4KT 3N43B 4YE4H 4YHLH 4JCMA 1EQWA 2NY3B 1FL5B 1EDHA 2W9LA 4N2MA 4PRID 4QKXB 1LE9A 1DQMH 2GTZB 3NSCA 3DV4A 4QRQB 1AO7A 1F97A 3FULA 2KZ1B 3PWPB 5MERB 3L9RB 3TA3D 2MHAB 3AREA 3QO0B 3QPQD 1G1OA 2BP0B 4XNAA 2J21A 3KCPA 4J27A 4OV6F 5MP6H 2OI9B 1MNUL 2N01B 1ZLUK 3NYKA 2LOEA 4AEHL 4N2FA 4PRBB 3E0GA 4RZKA 1IGFH 1HX0A 4UIMA 3RL2A 1TU2A 1W0WA 1WZAA 3GJFB 2G3NA 2D4DA 1UZ8A 1U8NB 3S35X 5E4IA 2VDKH 4TTDD 2A73B 3IVKA 3BVUA 4JDTL 5IBTL 1A02N 2J1YA 3KBHE 5I17A 4JDEA 3L48A 4WKZA 1WFJA 2JV6A 1JE6A 3D48R 4YHLL 3MJ9H 3QDJE 2WYIA 1RZJL 4NWTL 2FQGA 3DSFL 4FI7A 1NL0L 3VXOB 3IJ8A 2WXIA 3KAAA 3ARFC 1Z9LA 1HHKA 1HHGB 4U0QB 4I89A 4FEMA 1RZ8A 4AZ8A 4OBRA 4X5WB 1EZLA 1F3DJ 5KAQF 1QUNB 1NBVL 2LVCA 1WRFA 1JTOA 2NY7H 3C8HA 4GMTH 1IGFL 4QO1A 4ACPA 3U1QA 1G1KA 3FU9A 3KS0H 1EJFA 2NTFA 2MFNA 4OLVH 1PY4A 3O0RH 4KKZA 4FTVE 4GKNA 3EDKA 2BSDA 2QV4A 4J3VA 2R2BA 5EBWA 2DDQH 1WSST 4IOFC 4ALAL 3CFKA 2ARJA 4HJJH 1UASA 3OTTA 3PPSA 3QIUB 4PJ9C 4S0HA 1FAKT 3JTTB 4HFWA 3CDZB 5KBDA 1WF5A 3MUJA 4UB0L 3BLBA 5CJOH 3SDAC 4YHYB 1M57B 4MS8D 2WCPA 5E8EA 1OQXA 5JPNC 2OLDA 3CN1A 3ARUA 4R0LB 5EHFA 1N4XH 4OUOA 4AE1A 3LXUX 1RIHL 5F93C 2IQ9H 1JZ7A 5F9DC 5CEZE 4DP7X 2AK4D 3BAKA 4JO2H 5F96H 5EU5A 2LU5A 5FYKE 3QK0A 3PWPE 4EKJA 5GJSH 2X0VA 4PS4H 5JOFA 4AJVA 1I85C 2OMZB 4GMTL 4GINA 3QFGA 5A1AA 5A16A 3MRRA 1T0MA 1BECA 2GSGA 1Q72H 3ELAT 4OLVL 1W72L 4IK6A 1AP2A 2XN9A 3VFSB 5DD0L 2MNUA 4DH2A 1AQKH 3GRBA 1UJTA 4N8VB 1NAMH 4PJ7F 2HKFH 1YQVH 1K9TA 4U1GC 3AZUA 5IROC 1BVNP 2WXOA 3UXFA 1I8IB 3KLKA 1ZMYA 4P5TD 1IFRA 4R90L 5F7LB 3TBYA 5I1LA 3QDMB 3NESA 2BZDA 3EHBB 3L4VA 3ARFA 1PLGL 3O0LA 4XAKD 1N4XL 3NEOA 3OKKA 5DMIH 4DP8X 2R1WB 4YHIA 3KWTA 3F62A 3TASA 1FYTD 1NCDL 5DK2B 1ORQA 2ZF8A 5DHVB 1OF2A 3IRZA 2HJKA 4Z3TA 3IJ9A 3O3AA 4JO2L 3KEHA 5C0CA 4XX5A 1AZUA 2DWTA 1G6RB 1VFBA 1ZPLA 1TVBB 2FWUA 3OSVA 4HV8B 1V7NL 4JFTA 5GJSL 5A2BA 5HYSA 3HW7A 1DQVA 3BUYA 1SLUA 2PTTA 3X3GH 1TZ8A 1L0YA 2C8NA 3S37H 5KBMA 3V9EA 5FFGA 3RAJH 1OE1A 4K73A 2F15A 3BVTA 4XCFH 1AQKL 4PJ9A 2VERA 1YY9D 2ZWKA 3LB6C 1NAML 4KK9C 4AWJC 4XB7A 3HC0B 1YQVL 3B7TA 3SDAA 1KZYA 1EEZB 2XNAB 1AE6H 3QFJB 2YZ8A 1TO4A 5JPNA 3RYMA 3KNBB 4RFOH 1NZRA 3UYPA 4HIEB 5FUOH 3KPLB 3DHJA 4LO9A 4TRPH 5KWYC 3HG5A 3WE1A 1L3NA 3QZMA 4OFIA 2LW3A 5D1ZC 3LNEA 3CH1B 4LSPL 3QJFB 3M1CA 2K8QA 2VW6A 4PRDB 2NY5L 5K9KB 4F91B 4XCNB 5IG7B 3TBWB 1UWXK 5GGSB 43C9B 1AD9A 3QXAA 4HMDA 5TQ0L 3EOBB 4D8PA 4Y9CA 1XGTB 3SD2A 4A2LA 3ATBA 5HVFB 3UBHA 1DTUA 1ZA6A 4KX7A 1E8ZA 3ULVD 4GW5B 2NY4B 3OJVC 4DGVH 2Y7LA 4XCFL 1I7TA 3SY0B 2VR3A 5ABAA 3UTTA 4HU2A 4PD4K 2A9AA 3WKNA 1QLFA 2JJUA 3A6BH 4ISVA 4MGXA 1YA5A 2PPAA 4OF6A 5KOMC 3F00A 5LAXA 3PNRB 3V5KB 3NJNA 3S0PA 5C3TA 7PAZA 3NVQA 3OAUL 3TONA 4N2IA 3SE3A 1L4IA 3FT1A 1X4YA 3D7PA 3T0XA 4CUCA 1LO3H 3QDME 3W9EA 4JN2B 3ECBB 1KIPA 2AEOA 5EORL 1N5AA 2CHXA 2I60H 2WCGA 1SEBB 3ESOA 4CVUA 4PJXB 5IJDC 2QMJA 5CGTA 2KZBA 2R29H 3GJFK 2MJWA 4PJ8A 4PJCF 2XFXB 2VAJA 1FF5A 1V5JA 5LLIC 3O6KL 1DQQA 4RAHA 4FLRA 3EGSB 5DK0A 4ZMQA 2UZPA 3GKWH 1VRSA 2VLLA 3U79A 5INCB 2G60L 5ANHA 5F1KC 1N8ZA 2PCPA 3Q6FB 3FFCA 2PR9A 4KRPC 3EOYG 3WXVH 2J5WA 1B0RA 2AJYL 5C7ZA 2B14A 3A6BL 3HE7B 5F1IB 2AQNA 5IMOA 3TO2A 3ZZLA 3ZOAA 4H0IA 2ZAIA 4RCAA 4TQ8A 4UI2A 1G87A 5D1ZA 1TQCB 2EE2A 3QFJE 3V2AR 1AGBA 3S3SA 1AHWA 1LO3L 1DBBH 3O6FD 2OZNA 1A6UL 1ZOXA 2EIZA 2P7TA 1I8LC 5BRZA 3AT9A 4M6OH 1INDH 2R23B 3VFGH 4M00A 4FQIH 2WZ6A 3GKWL 4WTXA 2RB8A 3WFEH 2Q6WB 1AFVH 4L37B 4AGPA 4ZMOA 3QE5A 4I9WD 2WZPD 3BWAB 5I8OH 1DVYA 2ZCHH 3CN0A 1RZFL 1U6AH 3F7YB 3I85A 1U42A 2K9FB 4WWID 5AOIA 2NXZB 3ZKSD 4OM1H 2UXTA 4ZNEE 3MBEC 3VQLA 5C0GA 2YD3A 4JRYD 3DVFA 1OAXH 2FNBA 3NFNA 4NAMA 4BWUA 4NFCA 4LKXA 1E7UA 3D39A 4D0BA 1NGPL 5KSAB 4HOWA 3WTVA 1IVTA 4AUYA 2C9XA 1OAJA 3A67L 3HFFA 5CIPH 1Y18B 1JJUA 4WFFE 1N12A 1X9RA 3C5ZB 3QJQB 3LJ3A 4FHJA 2VDLH 4BQ8A 1QVOB 4JS7A 3D69A 3SQRA 2FO1A 4PJXE 1I9RH 1A7NH 1MREH 2OJEA 3WFEL 1AFVL 5DD1L 1F8TL 3X1FA 3RHWF 2I9TA 2OX5A 4CVXB 1BZDA 3L95A 1TCRB 1QI5A 2E6JA 2AJ3B 4XOCA 4QJ3B 1V3LA 4LBEB 1U6AL 2OMWA 4ABUA 4OF5A 4P04A 3MUGA 4XPFH 1G7LB 3H42L 4I9XA 2BIHA 4OJCA 3C5XA 1DVFB 2GUOA 1CXFA 1MZYA 1BZ8A 2Q8BH 4F33B 4M5SA 4DEPB 4GG6A 3CFIC 2WXKA 3EAKA 4HS8H 5DSCA 4POUB 5K39B 3RRQA 1S9YA 4EPSA 5CN3A 3QIBB 4E9VA 1DLFL 1FC2D 4Z5RA 3VXSA 3UC2A 1DQLL 5K93A 2D7QA 2YRPA 4NQEB 4H1LH 1JWMB 3ZDYF 1WZ1L 1VSCA 1JL8A 3HI6L 3C6SB 3CFBB 4OZ4A 4QHMA 1A7NL 5IQNA 4BFFA 1T66C 1W6WA 2KC0A 3LH8A 5FUCC 1A6AB 3T1FB 5ACZA 1OB0A 5MEPA 2Q76B 1P2CA 5BNXD 3ZR6A 3MBEA 1FGNL 5DI8A 2OMNA 4Z95H 4UQ2A 4XMVA 2PWEA 3MR9B 5B8CA 1QO3B 1YEKH 2AVFA 4N8PA 3FRUB 3U46B 2BDNH 4DNLA 1AXTH 4XVUD 5C86A 3RPIB 1VPOH 1OP5K 3VGHA 3FTXA 5BW7C 2C34A 2NUPB 5B39B 3FCGA 4XNMB 1GGYA 1MPAH 1D5BA 5EOCJ 3BVWA 1CE6A 5D7IF 1RXLA 1OE2A 4OJDH 5AOKA 4QHKJ 4YUEL 3DPDA 3OAZK 1HXMB 5C9KA 1A6TA 1LD9B 2BPBA 1Q0XH 2ADJA 1XR8B 2A74A 5HDOA 3VYOA 1LWHA 2IWFA 2X6AA 3WFCL 1YN7A 5KSUB 5EEZA 3K0WA 4WEBL 2WVVA 4F24A 4JEGB 2CUAA 3HR5B 3ROOA 4JZJB 1PEZA 4Z3IA 3HOGA 3LQAL 2WWKO 5T1KD 5DRWB 4G6FB 5EC2A 2WKOA 1MFEH 1YEKL 3RU8H 2ZUQC 3EYSL 3S5LG 4YOKA 4M4RB 5FF6A 4DVBB 1AXTL 4HETA 3SO3B 1INEL 5F3HA 4OD2A 4PB9H 3VFTA 1QYGL 2O5ZH 1J88A 2P43B 3EW3B 4HBCH 1HL5A 1N26A 5FC9A 1WTLA 4KVNH 1MPAL 1CN4A 5ITFA 3L45A 5IEHA 4R84A 4FNTA 4BZYA 2X09A 1KB5L 4OTXH 2FT8A 4MX7A 4YDIL 2VJ8A 3V0IA 4BKSC 2G4EA 2GY7B 1KBVA 4NQEE 1L6XA 4A67A 2FB4H 3S3DB 1HYRC 1JZEA 3ZZQA 1K5NB 2GW5A 5J6HB 3TURA 3ZK0A 3S34L 4G43B 2C26A 2VM4A 1LMIA 5C9JA 2ICWJ 1X7QA 2IDTA 1OSEA 3MOBH 3BISA 3P54A 4NKIH 5EOQL 2FDBP 3DC0A 5ISZA 1U58A 5JUEH 1PQZA 3O81A 5DUPL 4AY0A 2V17L 3PJSA 4YDJB 2LLLA 3FQTB 4PG2A 3LTVA 3KDMB 3OKMA 3X13A 2ICWA 3TN0B 5BW7A 4GKSB 3GSNB 4Y16C 3X12B 3ZZSA 3LZPA 4HKBA 1AXSB 4PTUB 3GUTA 1CIUA 3RX7A 2A38A 3FUEA 2VLKA 4UNVA 1DBML 4HBCL 3VXNB 2VQUA 2BP8B 1KGYE 1FE8H 4J3OG 3OHXB 1I7RB 3X1EA 4LVNC 5C6PB 1CK0H 4OTXL 2E4TA 3L3HA 2X9WA 3JWOH 2CO6B 2NQCA 4QT5A 1GPOH 3EFFB 2VABB 3TEXA 3QZNA 1B4LA 1HHIA 1XF1A