3GB7B

Potassium channel kcsa-fab complex in li+
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords antibody Fab fragment heavy chain
publication title Mechanism of potassium-channel selectivity revealed by Na(+) and Li(+) binding sites within the KcsA pore.
pubmed doi rcsb
source organism Streptomyces lividans
total genus 45
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2009-02-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gb7B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gb7B01
1J1XL 1MJJB 4NHCH 5GZOC 1F4WH 3LEXA 5AZEL 3JTTB 1C7TA 3AM8C 2GQHA 4DVRH 3CVIH 3NACL 1F45A 2VQTA 1FPTH 2WWKT 3FN0H 5IVXE 4QOKD 4HXBL 1CD8A 4KZEH 4EDWL 3QO0A 4DCQB 5LGKA 2X1WL 3G5YA 1MF2L 3MUHL 3OF6A 3T4AB 3MGTA 3O4OC 4JN1L 2A9ML 3OB0K 1GOHA 2BC4A 5ETUA 2VDKH 2ZJSH 4NO0A 2R2HB 4MJ4A 1FL5A 3BE1L 1SBBA 5KSAC 1KXVC 3FQRA 4PJ7A 5GRUH 3BUYA 1AGBA 1N5AB 2E7BA 1CICD 4JY6A 1JWMA 2QJDA 5KOMC 1YEHL 2W60B 1FN4B 1RZ8B 3BKJL 2Y9RT 4P48A 4FXKA 4KK6D 1PAMA 3RVUC 1KEGH 2C3HA 4LVHB 2R8SL 2FZ3B 1QBLH 1SJEA 4ZTPL 4RA3A 3RP1A 1UZ8B 1LK2A 3ALPA 4G3YH 4W4OC 2R69H 4CNIB 4NUJB 4O9HH 1NCWH 2WUCL 4HIHB 4QRRD 3NIFE 3S5LG 5IV2B 4L9DA 3SEPA 4KJYA 1Z3GL 1MSPA 1KFAL 1GL4B 3B3IB 3F6LA 5D7SL 3FCTB 2VXTL 1N5YL 5DYOB 4N8CH 3PWNB 5F7WC 1QR4A 2HFFB 1U2CA 1GHFL 2VKWA 2DLTA 3FB7A 1AD0A 4U1SA 2BOBA 3CVHA 1P5UA 5E94B 1XMWA 3ET9F 3PGCB 2QQLH 2YN3A 4Q6YA 4Z95L 4XVSH 1BQSA 4LEOB 3RA7L 3R8QA 2NXYC 1CD1B 2DKUA 2YD1A 4X98B 4YX2L 3L5JA 1QRNB 3MBEA 4H8WC 3V5DA 3MRRB 2OL3B 4LQFH 4S11A 5IB3A 4KHTH 1YJDH 2VN4A 4PGJA 3QDGE 4WUKH 5ANMB 4L1DA 1LDSA 3OKDA 5CJBA 3MFGB 3NIDE 2AJZA 3M1BA 1TCRB 3O3EB 1MLCB 3BPOB 1DEDA 3O6FC 1TLKA 5FYJD 1NCBH 1IL1B 2VLJE 2FJFB 5BOPA 4Q2ZA 3D85B 1UWEH 4HBCH 3DV4B 4Q97A 5CINH 5DD6B 5E2WL 2EICA 4P2RB 1BBDL 2ZNWA 2EYRA 3VA2C 3ARSA 1CBVH 4GS7B 4FFYH 1K8DA 4QTHA 4E41E 1SQ2N 2E6PA 4XHJD 2YSSA 4Q74A 4F7PB 4PJIA 3EYOB 3QZWG 3AAZB 4G9DA 4HKBB 5LCVL 5L9DH 2FJGA 2VLME 3H9SE 3S34H 4CJ0A 5FYLH 1S9KC 1F58H 3MRCA 1EX0A 4P2YA 4KKLC 4LNVA 1FVDB 5I71C 4FQXB 5C08A 4G8IA 5DWUL 1MHHA 4HH9B 2MMXA 4ODWA 1VKXB 4RFEB 4WJ5B 1FO0A 3UTPD 5EIVA 3EHBD 1OD7A 3QIWD 1NSNH 4S1DC 3CFBB 1FYTE 2BVPA 3FMGL 4XH2A 5FDYA 4OLWH 4J23A 2Q8BL 4NUGH 3GSXA 4OZGF 4HCRL 2DWDA 4PRID 3U1SL 4NC2B 1GRWA 2F8OA 4K94H 4A6YB 5E8DH 4XPGL 1HINL 5D5MA 4ODHH 4CMMA 4LSUH 2VC2L 4FFWC 3MRGA 1JV5B 3BX7C 1BJ1H 3B4NA 3GMRB 2DIBA 2WP3O 4RQQA 3CMOL 3RWJB 3LS4L 5AG9A 2P24A 4LPXA 1OWRM 4XP6L 3PDOB 3RTQA 4GAFB 3T2OA 1IMHC 3MV7A 3BWAA 1XR8A 3MNVB 4LLVB 1KXQE 1P7QB 3QEUB 3U2SA 2YEZA 3DTXB 2HWZH 4ODXA 5ERWB 4NHUB 3H9HA 4F15C 2VLRD 5FHBH 4YHLL 4KMLB 4M4PA 2CLVB 4LCCA 2AV1A 1MCKA 2AQ3A 4RSVA 2X1XR 5FYLE 5D7IE 1U91B 2IFFL 4LAQL 5EUOB 5I66A 1D9KB 3MJ7B 1M7DB 3CSPA 2ZUWA 3VWKD 3BZ4A 5HHME 3T0AA 4CRPA 3IF1A 1RUPL 3IGAB 4OZHA 4GLRI 5JR1H 4LLMB 3ZE2E 3MREA 3QUMB 4OGZA 3OWEA 5BW7A 4MJ5B 4L8BB 4GW1A 5GS1A 2D0GA 5D7JB 2CIKA 2XG5A 3VG9B 4QY8B 4QF1A 4NCC2 1GPOL 3T3MF 4YBLC 5EFIA 5C0GB 3VA6A 4NN7C 2BXYA 3HNTH 2CO6B 1JFQL 5CEZD 4ZFGL 2EH7H 4PJ5B 3SDYH 3WSQL 2X4TA 1ETZB 5IEHB 3JTSA 4Z7NF 1ZEAL 3DETC 4LHUB 1N7MH 5E8EB 1I8IA 4K7PX 4JFFA 3U7AA 3KPMA 3MUZ1 4C57C 3MRJB 3HS0A 1X4ZA 4MAUH 4HK3N 4P5TD 3WHE0 5I19L 5IFAH 2YRZA 3QWOB 4MJ2A 1YEJL 3V5KB 5D7LB 2EE2A 4JFDA 4PJ8C 3O9WA 4JG1H 1MHEA 4C56E 4M8VA 5HYSB 1QNZH 4K3HA 4ACPA 2CRZA 3X11A 1T1YB 4NKMA 1ZMYA 3MLRL 5EU6A 5IJVA 4PGEB 5K9JH 3SPVA 2PCPA 3BISA 2NW3B 3H0TB 3G5VA 3S35X 4QT5A 3GM0A 3VI4F 2VWEE 2XNAB 4P5KB 4NQCE 1OPGH 5ESVA 1CLYL 2IPKA 1IM9A 4MJIE 5I8KL 2Q3ZA 4QHUA 4YFLI 4N68A 2BK8A 3HC4L 4ZFOA 3ESVF 1P2CB 5J1SC 2YBRB 1OL0A 2NY0C 4GXVL 3IDMB 4N8VB 4Q0XL 1Q38A 5ABDE 3SGJC 2C5DC 4Y19A 4YC2B 4GW5A 3I2CH 4G6KL 5E8NB 2AK1H 1I1AD 3NAAH 3SDAC 4O2FB 4F8QA 6FABH 1A7BA 4A2MA 2HVKA 4R26H 3I9GL 3K2MC 1E4XI 1NGXB 1FBIL 2LV4A 1A1NA 5IHZA 5DEFA 2ZZUT 5E0QA 5J57B 2CQVA 4ZAKC 1E4KA 1M4KA 3FO1A 1EPFA 1F97A 2VE6A 3PL6C 2VWEC 5DJ6A 5EZOH 2OSLA 4IM8A 1WWAX 4CDGC 3NA9H 3DRQB 5I1GL 1IC4L 4PP2B 2D31B 3RZCC 5D72L 1CCZA 1G9NH 2XZQH 2BDNH 1UA6H 2NX5B 1A02N 4M5YH 4JZOB 2BNQE 1CGWA 1Y6KR 2XA3A 2ICEB 1U8LB 5EIIB 2P5WE 3MUGB 1Q1JH 3DLQR 3G6DH 3SE4C 3B43A 4X4ME 3D2UA 1TNNA 3PHQB 3IKKA 3TV3L 3IU3B 5GJTH 2FBOJ 3QIBB 1RZFL 2NY3D 4JLRB 1JZ7A 4UOJA 3LZFL 1DUYA 2WNGA 4R6UA 5LQBL 1N6QL 1UH2A 4WWKD 4K9EH 5D2LB 1IZJA 1IGCL 3L3GB 2GITB 5E00B 5T3ZH 4F3FB 2HT3C 5HPOA 3LEVL 4U0QB 1MIEL 2IH1A 3O6LL 1O5DT 2DTML 4Z7UA 5JXED 4XBGA 1TCMA 3GSUA 2GUOB 1FHGA 1XH3B 2HJKA 5DVKA 1QZ1A 1GXEA 1MJUH 4UAOC 1UG9A 4M1GH 3L5WA 4WFFD 1X6NA 2ZOLA 3VFNA 1XIWD 3V6FA 4KQ3H 5DVOA 4EN3A 3TYGH 4J4PD 3UMTA 2HMIC 4D2NA 4NHCL 4Y8DC 3U7WL 2V2TA 2PUQT 3QXUA 2NZIA 5GGRB 2QTEA 2R29H 4LFHG 3BD3A 2VDOH 2YN5A 4AEHH 4F9LC 1SJHA 3FN0L 4WUUE 3PWPA 2DMCA 4X9FA 3NBNA 4IRZL 3KPSD 4YXLL 3ILPA 3C60D 2RR3A 2YK1H 3MOQA 3VFRA 2FGZA 1BIHA 2IBZX 2NPLX 2VDKL 1BFOB 3MRQA 1IGJA 5GRUL 4MWFA 5ACLA 1RJZA 3KJ6L 5KG9B 4QHKI 4NQDA 3DMMB 5EOCH 3MRLA 4LMQI 1A9BB 3QUKB 2Z92A 4JFED 1U58A 5T3ZE 5IMMA 1WTLA 1EAPA 3PIQB 1DQJA 1S7WA 3KPNA 5C9KA 1O7SA 1XEDA 1HWGB 3NTCL 1C12B 3KWWB 1PZ5A 4DN4L 2JF1A 5IR1B 1LNUA 3OB8A 3HE6B 3V5HB 4O9HL 3SJVD 2EEAA 4HPOL 4KXZI 4PJDF 4K3EH 5DMGC 4QHMB 1NC2B 5INDB 2JELH 1M6OB 4WV1B 4N8CL 2FX9H 3GZKA 4M5ZH 1BQLH 4L8DA 1JZ8A 4YAQA 4HZLB 1X5IA 1WZ1H 4OV5A 3KYKL 4ZXBB 3FT3A 1CN4A 3O3AB 5ITBL 1H9VA 1HIML 3WE6A 1BX2A 4PFEA 3RKDC 4U1HA 4OLEA 3FFCB 3KR3L 2O5YL 4I0PA 3IJHA 1BIIA 1RAMA 5FYJH 4RAVA 4LQFL 1IKNC 1NFDB 1HOCA 2VLKB 3ROLB 1YPZA 4KHTL 2DIJA 4Y5YA 1MJJA 4WUKL 1M71B 3IDNA 3JTTA 3F7VB 3NZHL 4ORGB 4QRRE 1NBZA 1KT2B 2VZOA 3BZFB 4KPHH 3B9DA 3FL7A 1NCBL 2DLHA 3R06A 2AERT 5GGUB 1D6EB 4GG6B 5HHXH 2GTWB 5I1EL 1LO3H 1UWEL 4BUHA 1CIDA 3C09C 2UUDH 4JHAH 3T2NH 4DCQA 4OLVH 3S3PA 3A6OA 4OLUL 3KLDA 2GCYB 5EBLB 1I8KB 4GUPB 4FFYL 1XGRB 4U1NB 2OXGA 3QQ9C 2EDBA 3MOAH 4L4VA 1DQDH 2W0FB 1GGCH 2VERN 3VG0H 4RZCB 2VDNL 3HG1B 4P2QD 1G0YR 2CPCA 1ULVA 3ULUF 1F42A 1IAIH 1JPSH 3N85L 3QG6B 4LHJB 3MRKA 1N5AA 2Q87A 1FZMB 3MJ8A 4MA7L 3S34L 4GBXD 1F58L 4PBXA 1FN4A 1JWUA 3VXTA 4BZ1H 3E2HB 2BNRE 5BW7C 3PHOB 1A4JA 1MAJA 3G6AB 4XPHL 5FYJE 2FZ3A 5DUBA 3LSOB 4Q9RH 4CNIA 4NUJA 1NSNL 3TGXA 4I3RH 1WFOA 3C87A 5IV2A 1MCFA 3QHFH 5T33L 3B3IA 4BK5A 2DBLL 4DK6A 2C9AA 5CHNB 4NUGL 2F5BH 4OTXL 1B0GA 4NQEB 1HHGB 4OZIB 1R5WB 3CFCL 5GGQH 1CXFA 2ADIB 4K94L 5E8DL 1Q9WA 4LSUL 1KTDB 5E94A 3NFPB 5ITFA 3PGCA 4ZO6A 1MFDH 3JUZA 5FYKD 3IFLL 3O8XA 1GOGA 1CD1A 2NXZC 4X98A 4H88L 1OAKH 3BXNB 1LE9A 3FO9A 1H0DB 3VWJB 2DQDL 2OL3A 3T0EB 4HCRA 2HTKC 5DD5L 2HWZL 2P5WB 5JMOC 4XMLH 5H37G 3OSKA 1TCRA 4NFDA 2AJVL 5TDOA 1MLCA 1Q72H 4LHQB 1NGQL 3MC0A 1P7KB 2ED7A 1RIUH 1U95B 5JOEA 1IL1A 5FEBA 3QULB 4R90L 3D85A 4HMDA 3DV4A 2OTPA 3B9KB 5DD6A 3SDCD 1CGSH 4KZDH 5JOPD 4O00A 5F7FA 2NY6B 5IBLC 3WN5B 4EDXA 1MFBH 4P2RA 2EYTB 1ZXQA 4GW4B 1IGIH 2RQ8A 3UTQB 5ELIA 2E9IA 5TPWH 3BW9B 1XGUB 1T83C 4F7PA 3HNTL 4WENB 3AAZA 4HKBA 4YGAB 3CFDB 5IB2B 2EH7L 3LKRB 1MRFH 3ZKMC 3FQUB 3SDYL 4X6CB 4L3ED 4AG4L 3SDDB 4OSUL 3SKNA 3SKJL 1S7TB 4P2CG 4L29A 3MLWL 1Q94B 2J6EH 5C2BL 1FVDA 4UT9H 4ZTOL 4X5WB 4HH9A 4XTRC 1J1OL 5I8EB 2VDMH 3KPPA 1QBMH 5HPMA 2I5YH 2BFVH 1VKXA 4JG1L 2ZUSA 5KVFL 2HRPL 4LCWB 4S10A 4FMFA 5KAQG 2OCFD 2AJXH 2NY1D 2XKNB 3DUUB 4PJHE 3MODL 1H3XA 3ZDZF 3HUJE 3CFBA 5MENE 2D0FA 5IVNA 2OZ4A 5K9JL 4DFHA 2FJHA 4GO6B 4GKOA 1ZS8B 4XNYH 3IJSB 3Q2CA 1MCWM 4AIOA 3DJ9A 4ZFFB 2A6IB 5I1AB 4YDJB 3ZE1F 2EH8H 5D1ZC 1OPGL 1A1MA 3D0LB 1KSRA 5L88H 1SVZA 4U1GB 1UJ3B 3P0VL 4HK3J 4PRDA 4K2UH 1S8DA 4FQQB 2D7MA 1G7MB 3RJQB 3GMRA 1RHFA 3RWJA 3RGHA 3OKNB 4DTGL 1PKOA 3DROB 1EEQA 3PDOA 1JJUA 1KLFA 4NWUH 5HHVH 4LLQA 4ZOCA 5CFHA 5E2TH 1P84J 1P7QA 3QEUA 1MJ7H 1Q9KB 3DTXA 5ERWA 2XICA 3FQNB 4NHUA 2AK1L 4V1DE 4WIQA 5IBUG 4QOKB 4H26A 2CLVA 1OP3K 5FGSA 1UKQA 5FO8B 1U8OB 3NA4A 4UT7H 3SGEH 1FNSL 1U91A 1GGYA 5EUOA 1D9KA 3VD3A 3MJ7A 4L8SC 2X40A 1J18A 3FAWA 3MZGB 4OI7A 4XAKD 3IGAA 4PLJC 3KS0J 4LLMA 1FZKB 4J3TA 4HUXA 3U30C 1DVFC 1Z0NA 3T8XB 5BV7C 1H8NA 1E6JH 5D7JA 5DI8A 5ECJE 1DN0B 4IRJD 2EDXA 5C0GA 4RA0C 3HPLB 3OJVC 1EH9A 2XZQL 4WVRA 1JZ6A 5K59E 2XQBH 1WTGT 1X5LA 4H5SB 4PGBB 4LF3B 3IYLW 1ETZA 2NY2C 5IEHA 1A64A 1Q1JL 3G6DL 2YZ8A 5E9DE 5E8EA 4EIZC 3MLUL 5HGBA 3RVXC 1JTPA 4P46C 3NCCB 1NAML 2V2WB 3QWOA 5F3BA 4DGYH 4G80A 4XHQA 1I1FB 3CFKB 1QO3B 4U7MA 1R3IH 2MQ3A 3V5KA 5D7LA 5FYKU 1S7UA 3GMLB 4HWBA 5IVXA 4HW6A 1DL7H 2LVEA 4RIRB 5HYSA 3QUZB 2FO4B 4YHKL 2FWOA 2E7LC 1T1YA 1PLGL 4OFYA 4PGEA 2X4PA 4OCSH 4EOWL 4PV9B 4YDKH 2NW3A 5DO2C 4JFPA 1J0YA 1HQ4B 1WUNT 3GHBH 3WFHB 3IKCA 4P5KA 4XX1G 2KDGA 4M1GL 1P4LB 1C16B 3VFTA 3TYGL 1IT9H 5GRJH 3WFCL 4R4NC 3IDMA 1MIMH 3BSZL 5I9QC 5LAXA 1YA5A 4E0RB 4WW2C 4D0DA 1RU9H 2R29L 1QQDA 3ZKQD 1JI2A 4UBDC 4LQ1A 5HHPB 2VDOL 5DUPH 2XOTA 3BHBA 3MXVH 3QFJB 3PWUA 5E8NA 1JNNH 2LTQB 4GXUN 2Z31C 4GH7B 4AZ8A 4ELKA 3UTSD 5BQ7B 4JO1L 5GGSY 4N1HB 4S0TD 4ZSOB 4LSRL 4Y2DC 2IH3B 3GBLA 2GFBA 4X7CC 5C0AE 4PJEE 3EFFB 4DKAA 5BS0E 5E24E 3WBDA 1KBGH 4AMKL 2B4CC 5M95B 4EXPX 5AD0B 4NYLB 2X2YA 4KJWC 3DRQA 4PP2A 1JE6A 2D31A 4OZHF 2J8HA 5I74B 2NX5A 2F19H 4NJAL 4Y4FD 5IKCB 4BKLB 2ICEA 4XVTH 4EBQH 3MUGA 2H41A 3IDGB 1OAQH 3EYUL 4L5FL 4MQXC 4YO0B 1WBZB 2EYSB 5F89B 3PHQA 1QOKA 2OP4H 5F44A 4Z7VB 3QIBA 1IEBA 4JLRA 1GZQB 4M5ZL 2FECI 3KLAB 5HD8C 5HYJE 5HSFA 1WZ1L 1ZVSB 2D4FA 1BBJB 2GITA 1W2KT 4PRIB 5E00A 1NCAH 5DDHB 1L7IL 3WS3A 4LVHC 1A3LH 5IM7B 1UYWH 3VJ6A 2CRIA 3GDBA 4IIQB 5DC0A 4NKQB 3HI1A 4JFEE 1XH3A 5FYJL 4ZQKA 2CGRL 2OJEA 3L5HA 4ZUVB 4Z8FH 4JN2A 2AJ3B 4I18B 4MXWH 1I4FB 1NUGA 1P5VA 4QGYA 2JB5H 2VLRB 1SVCP 4ODTH 2DWEB 3L3KA 3U9PL 5D8JL 1DQQB 3CNKA 4Z76B 4KPHL 1BWWA 3LQMA 4JY4B 3OAZK 2ENYA 4PJ9C 3PWLB 4CUCA 4OCXL 2J8UF 3RJDA 1NFKA 3EUUA 4X6FB 1T4KA 3T2NL 4YHOH 5GRYA 3VWKB 4JVUA 2ARJQ 4OLVL 2Z9TA 1LP9F 4JFOB 5IP4A 5K9KA 5TE7H 3KYOA 1YYML 2WIIB 4YK4B 3FKUS 1OY3B 4OLXH 1T3FA 4PRPB 2YS4A 2WWMD 2HJLB 3BPOC 4P4RA 1IAIL 1JPSL 4R7DA 3IS1X 4KKCD 4C83B 4HFWB 3DMMA 4G7VH 5AUMB 4NQUA 2IAMD 5CIPB 3QUKA 1KN4L 3KVQA 3PIQA 1ZHBA 2VR4A 4KVNH 2W0PA 4P5TB 1BQUA 2FX8H 4YHIB 1DQTA 1AFVH 4GS7C 3ZDYF 5IR1A 1YY8B 3DWTA 3D25B 4LPWA 4Q9RL 3HE6A 3V5HA 1QFUL 3N1MC 1T89C 1JPFB 3C8KA 4FNLH 2FIKA 4QHMA 2ZPKL 1KTLB 1ZHLB 3TO4C 1NC2A 3QHFL 5F1IA 5D7IA 5FYKH 2Y06L 1VFBA 1M6OA 3QEHB 5EU4B 1UC6A 1OSPH 5IEKA 3WIIH 2BOCA 5FUOL 3LKNB 1EJOL 4HZLA 5HXMA 1J8KA 3P0GB 4FQXC 1MLBB 4YLQT 5LXGH 4LHUG 1UXSA 3NPSB 5L8JB 4QWWD 3L3HB 5KVMC 2NY5H 2APWA 3OV6A 3FFCA 4U6HB 5GGVY 5F6IB 3UBXI 3ZHLA 4KUCD 4TTDD 1GC1H 4PRHD 2QKIB 1OAKL 5F96H 2P45B 3GJFB 2R0ZL 4XAWH 1FG9C 3RY6C 1XF4B 2ADJA 4Y16C 2QSQA 4UZGA 3TYFB 3U4BH 1DLHB 2ARJB 4I0CC 1M71A 3IFOB 4JANA 1JI1A 3SBWA 3KPRE 4ORGA 1YEDB 1KT2A 1Q72L 5MEPB 3D9AL 1URLA 1RIUL 3DBXB 2VNCA 3L1OH 5GGUA 5I18H 4GG6A 3B2VL 4JDVA 2K3TA 1CQKA 5LGHH 2EDWA 3UEZA 4C56A 4KZDL 3TJHC 3UROR 2MNUA 3TESA 1A22B 3LRGA 2GCYA 5EBLA 4DAGL 4XNUH 1BGXL 1KIQB 3NPZB 2OBGA 1KEMH 4N8VG 3L3OB 5F93C 3HG1A 3HZVB 2XACC 4G42B 4PJGB 4BSVB 5F7DB 3LKOA 3WJJA 3OKKB 1MRFL 3DRTA 3QG6A 4UMGA 2ZCHH 5CBAB 1FZMA 4HIIA 4Y7MA 2R2EB 4MQ7A 4ZO8A 3LDBB 2J6EL 2EKJA 4JPKL 2YD3A 4OCMC 2W65B 5DJAB 1S5IH 2A77H 4MCYB 1FRGL 2DLGA 1E0OB 2F58L 4MNQD 4DFIA 3G6AA 2NY3B 5LBSH 4KRPB 3VXME 1YNLH 3WDHA 5DRXB 5JOPE 3L6FB 2E27H 3Q6GH 1KN2L 5E08H 3LKPA 5CHNA 2NW2A 3SGKC 3HZKA 4EI5A 1A7NL 4OCRH 4NQEA 4OZIA 1R5WA 4PJEB 2ADIA 2I07B 1R24B 2EH8L 2QADB 2OR9H 4GRWF 4JG0H 3MPCA 5L88L 2LAGB 3NFPA 5IW3A 4AM0B 3ARFD 3DHMA 5I76B 4L4TD 4P2OD 1KXTB 4WW2F 3BXNA 3MCG1 4NWUL 1H0DA 1ZHNB 4ZUWB 3T0EA 4OF0A 2IG2H 2EXWD 2BNQA 3NIGE 3OXSA 3PQYD 3VW3H 1MJ7L 1TZHB 4M7JH 4PJXB 2P5WA 2OQJB 4ONFH 4ELMB 2EIDA 4LRIA 4DUWA 4XP9L 1A47A 5DR5L 1TJGH 3DARA 3FRUA 5INCB 4LLUA 5DQ9B 2C26A 3KPSB 2B4CL 2IQ9L 1U95A 4OAWB 5IMKB 1YPZF 5KSUB 1SY6H 1TVHB 2BVOB 2VB5A 1Z9SA 2PN5A 4I2XE 5F1NA 1MFCH 5TFSH 2HFTA 3TCLA 1D5BB 2BVEA 4HHAA 1ZTXH 4Q58C 2OS7A 4LNRB 4K8RD 4YC2C 4Y89A 2EYTA 2MPAL 4WTWA 4GW4A 1AY1H 4OLYH 1S5HA 2QHRH 1T7WA 3OR6B 4DUXA 4X80H 2XN9E 1XGUA 5EBMB 4WEBH 3MRHB 4F37K 1CT8B 4WI8A 3NFSH 5IB2A 1J1PH 3LKRA 3FQUA 1F4YH 3JVGC 3K0WA 4FQ1H 3SDDA 3ZKND 1S7TA 4PB0L 2H1PH 7FABH 1MCPH 3BQUA 1YYLL 5HI5D 3SJVB 4X6EB 4K07A 4BQCA 1I1CA 1WC7B 5CGYD 4YXKL 4BQ8A 2AJSH 3DUUA 1S7VA 2XKNA 1DL7L 4PY7B 3VFUA 3IETB 4AL8L 3O11A 2IMNA 3BN9D 5T1DH 5DJ8B 4DQOL 3H9ZA 4IRSD 1ZS8A 1QKZH 3IJSA 4HGWB 1WIPA 1YEKH 2A6IA 3ILQC 4YDJA 5TDNB 3GHBL 1S9VB 3V0AC 7CGTA 3D0LA 4RX4D 1KELL 4HSQA 3CCHB 3ZL4H 4FQQA 3EYFB 1N0XH 1G7MA 2A38A 4JKLA 5IB1B 5GRJL 2FYYB 1ZHKA 3MNZA 4QXUH 3OKNA 4CU6A 3DROA 4NZUH 3FQWB 5EORL 3RVWD 1ZLSH 1WZKA 2N1KA 4HJGB 1Q9KA 5EOQH 5C6TH 3I02B 4NRXA 1IGYB 3FQNA 4KJQC 1IJ9A 3UJTH 3UPCA 3L3DB 3N9GH 5FO8A 1U8OA 4Y4KD 5KS9E 4PIRF 2W9DH 4HIJB 1IBGH 1CGTA 3SKOB 1IQDA 2D7PA 4Z7WE 1LO0L 3WFZA 4R7NA 1KBGL 1JZ5A 2O26U 4P2QB 5IW6B 4BQ9A 3T8XA 3JV6A 4M6AA 1DN0A 4Z5RB 4XNZC 5DHXB 1CICA 1AD9B 4JY5H 2ICWB 1H5BB 4GBXB 5DVMA 4UB0L 3T08A 2G5BA 4FFZH 1WK0A 4H5SA 4XVTL 5KVEH 4EBQL 2NNAB 2R2BB 1J7VR 1R5IB 3S8WA 4ZYKB 1HKLH 4TUKH 3RNQB 4Y2OA 1B0WA 2V2WA 5DMKB 4RMWA 2F53E 4XP1H 1ZT1B 4TVPD 4H25A 4F33A 4QRRA 3DXAD 1QO3A 3BIBX 4H1LH 2NR6C 3B8YA 3DMMC 4G43B 4Y1AE 4MB4A 3GMLA 4Q7DA 5HDBF 4BK4A 1ZLUH 3HR5B 4XXCA 5EOCJ 4QRUA 3VRLF 2FO4A 3OZ9H 5ESAB 4Y5VA 4QCIB 5F7HA 32C2B 3CLFH 3EYVB 5TGBB 1RZGA 2DQCL 4PV9A 3ME0A 4MGXA 2DN7A 4CVZA 1Q0XH 1UYWL 5KN5A 4TSCH 2BHYA 1UH4A 2Y5TB 3HE6C 1HQ4A 1IGTA 2R23B 1MVUB 1ZANH 4HX1B 1J86A 5E1AA 5H94A 2COQA 4FG6D 5DURD 1P4LA 1EHXA 4WV1C 1S7QB 1ACYL 4MXWL 1ZSDB 1QBBA 4HXAL 2JB5L 1FNLA 1XGQA 3BI9X 4ZXBC 1BVKB 2NMSA 3MJGX 1K3ZA 3QIUB 2BNRA 3DO3A 2IF7A 4M9PA 5IMOA 1O7VA 5HHPA 5L2KE 1KCKA 2PETA 1KPUA 1N64H 4OD2A 3W2DH 2FATH 5TH2A 2HN7A 4YHOL 4AIZA 3SDCB 4RGMB 5BQ7A 1YEFH 3QDJD 4P3DA 4ZSOA 4GOSA 1D5XA 2IH3A 4MA1B 3HMXH 1B2WH 2EDQA 1CDYA 2V2XA 3EFFA 1WWWX 3TF7C 5BRZD 3QUML 4HQQH 5MEOB 5J6HA 4XMKH 5EUOF 5AD0A 3J7HA 4WFHD 4JFZH 1YMME 3UYRH 4L3EB 4I3SH 1I1YB 2H3NA 3DX8A 3VXNA 2J4WL 4AJ0A 2ID5A 5AAWA 5D1XD 5IKCA 1T22B 4UDUB 3GO1H 1KLUA 1CDHA 3WFEH 2CH8A 5DMYA 4GKSA 3GJEB 1AXSA 2WBJD 3O6MH 2EYSA 4N1EA 1XR9A 3DURA 3QIWA 2DB8A 2NY1B 5T3ZD 4FNLL 2BXZA 4G6ML 4UQ3B 3RWFA 4Z7VA 5EH1A 3WJJC 1EXUB 1QLRB 1GZQA 2FH8A 3F12B 1DANT 1OSPL 3D18B 3WIIL 1QEWB 3SDXE 3KLAA 1ZVSA 1WIOA 2HFEB 1IKFH 5SWSD 3MOBL 1TITA 4X6BB 1KCSH 2OTWB 3H42H 1WFUA 4U1LB 2X70B 5IVXF 5LG1A 4IIQA 4OGXL 2FBJL 5F96L 2DQEL 4NM4H 4X8JB 4XAWL 4JVWA 3IRPX 5L8KB 5ALBL 4ZODA 4I1NB 3LOWA 4E5XB 4GLRH 4I18A 4JDZB 3U4BL 1I3RB 1I4FA 1JPTL 4R0LB 1ORSB 2VLRA 2C7UB 4YHYB 2DWEA 2DF3A 4KK5D 4WY7H 4G5ZH 4HUVA 1DQQA 4Y88A 4Z76A 4OV6F 5DUML 3AS2A 3P4MB 1F3DJ 1S9YB 2QSCL 5K9OB 5I18L 1CXLA 3PWLA 4IMLB 5ESQA 3VGGA 4X6FA 4S1SH 3WCYA 4PJHA 5J0BA 3VWKA 2DTSA 3VWJC 4XNUL 2CKBL 1P6AB 3MMEA 2SEBB 4NSKB 2WIIA 3HCVB 1QRKA 5SWZE 4JKWA 1FC1A 4QNPE 1F02I 3QQ4B 4HWNA 4IRJB 1INEH 2FX7H 3TIEB 2YMXL 3AMLA 3ISWA 1J0ZA 1I7RA 3VXSD 5D96B 3QPXL 4HFWA 3CPLB 5CCKH 2FEDD 3BP5B 5AUMA 2B2XH 5CIPA 2OX5A 1W72B 5B8CA 3B9KC 1EDQA 1KJ2H 1K2DB 5T3XH 3PGDB 1S5IL 2NY6C 4P5TA 5IJKA 4LOUD 3WN5C 3HR6A 1KB5H 4YHIA 1A21A 1BQHB 1CFSB 3LPGA 3D25A 5LBSL 3P73B 1FG2A 1YNLL 4JO3L 1WITA 1JPFA 2X9XA 5GISH 1EFQA 2KZWA 1KTLA 4KUZH 3Q6GL 1PSKL 1EAJA 5E08L 2VXSL 4CMHB 1NMBH 2J6EA 3QEHA 3SDDC 4OCRL 2H2PC 1PZUB 3UTTD 1EJ6A 3KPQA 1DANU 1OTTC 5CZXD 1WBXB 3JWDH 3AUVA 1MLBA 4ZG1A 1DBKL 5EA0H 3VDCA 3TPUB 3WHE1 4HS3B 4I13B 2AJUH 3HNSL 3I6LD 2XZCH 1YEIH 4M6OH 1AO7E 4MNGB 5D2LF 3ZLQC 5HVHC 5D2NE 2QKIA 1E4XH 3GJFA 4MX7B 5EPMB 3N06B 1BREA 1I9RH 2IG2L 4KI5D 4QXTA 3GRWH 1MCDA 3ZYIA 2OLDA 3T77B 5DFTA 3H2WA 1JYWA 4WHYH 5E9DA 5EWIH 4GFTB 3AC0A 3O81A 4K8RH 4NZJA 3IFPB 5C09E 3IFOA 1CK0L 4KKAC 2JIXD 1CDIA 1I1AA 4APQC 3MRFB 1YEDA 2IPTH 5MEPA 4U1GC 1UJ3C 1K6QL 4MXVE 1T66D 3UTSB 3DBXA 3UZEA 3KPLB 5LKNA 5T3XE 2FGWH 2DDQH 1MFCL 3MTRA 1FZJB 3IDXH 5F88B 4RGNB 3TJEL 1ZTXL 3WNMA 3UYOD 5DEGB 4DKFL 1ORQB 4JCMA 4UV7L 4NBZB 3F58L 5F7LB 3PP3H 1CWVA 4WEBL 3UXFA 3HZVA 4BSVA 4PJGA 5C0JB 5T1LB 3PJSB 2ITDB 3OKKA 1F4YL 4Y4FB 5CBAA 1Q9OA 4JRYD 5I0ZA 2P5ED 4S1RH 2BJML 2CD0A 4GKZB 3GUTB 1OM3L 1B3JA 5FGBA 3PP3K 1YN7B 2A6KB 4CN4A 4MCYA 1VGKB 4MB3A 1C08A 1TDQA 1SEBB 2WINB 2NZ9C 2AJSL 1SYVB 5GQBA 5I8CB 3B6SA 2B1HL 2I25N 4WWKA 3EOAB 4ISVB 5K93A 4HS6B 5DRXA 5HI4D 3T0BA 4GQ9L 1QKZL 4FTVD 1YEKL 1HK6A 1FLTX 4U3CA 4PJEA 5LGJB 1TQBB 2I07A 3S6CA 1NEZB 4NBYB 4S0SD 5BS0A 5I1IH 4K23H 4MAYC 3T0VA 3FOLB 1FE8H 3QB7C 2ED8A 1IGMH 1XIWA 3JV4B 4J4PA 5E2UH 3QUZC 4NZUL 3CJJA 3D3VE 5FHAL 1F13A 1ZHNA 4BSWB 4ZUWA 2CSPA 4GKNB 5A3ID 1ZLSL 5EOQL 1TZHA 4PJXA 1DN2A 4PR5B 1UH3A 2QEJA 4ELMA 1U8IB 3K46A 3N9GL 2DKSA 3KXFE 4P0DA 5INCA 1FNEA 1NCTA 3FT4A 4C58B 3KPSA 1NFDF 4LP5A 3C60A 2P4AB 4OAWA 1IBGL 5IMKA 2BVOA 2X1PA 4YQXH 43CAB 4X4YB 1A8JH 2VXQH 4HIEA 3QYCA 4LNRA 1U8JA 5FGCB 5GS2D 1ROWA 2VDPH 3PG2A 1OT1A 4GG6F 4KXZH 3W11D 3OR6A 4DZBB 4EVNB 5KSBB 2LTQC 4H0IA 3C08H 1NBYA 2DQGH 4GRLD 4TVPH 2IAMB 5EBMA 3S4SB 4MVBC 4JFEA 1F4XH 3MRHA 4N8PA 5E4IA 1CT8A 4FFZL 4Z0BL 4EEEA 3C2AH 5KVEL 1XF2A 1UWXH 2HVJA 1UKTA 5D1QC 3ARDB 1HKLL 3LY6A 1EEZB 4XHJC 1V5JA 4FXLA 5D7KD 5JW3L 1G0XA 4XP1L 4WU7B 5BOZG 4X6EA 5DJ2B 3W81A 1WC7A 1HSBB 4G7YH 2JCCB 1FFNB 4ALAL 4D9RE 2OI9B 1FLRH 4OBRA 4PY7A 2AXGB 5AYUH 3U36B 4D8PB 2YWYA 4PUBH 2A6DB 3QG7H 5JHDE 3CLFL 5J7CC 4XCEB 4YXHH 3EDJA 5C9JA 5J13B 4KWUA 3MRIB 3VGHA 4F58H 3QEGL 4NFBA 4NZTH 4HGWA 1B9ZA 1A3RH 5E8OA 4KTEH 4WO4A 3GSOB 4OZFB 5TDNA 4LMQE 1S9VA 5DJZA 4MD5B 1HHKA 1ZANL 4PRHB 1G1YA 3CCHA 2G9HB 1ONQB 2QQNH 3EGSB 2DQUH 5EU5A 3EYFA 5JPNB 3S88H 4XP5L 4OZIF 1KTKE 1FV1B 1RZKH 5IB1A 2FYYA 1NDGB 3BVNB 2BVUA 1IM9D 3Q5TA 4FS0A 4I48B 4P23C 2ADGB 3QCVH 3MRPA 4HFUH 1AP2A 3IDYB 3QCUH 4DGVH 3LIZH 4HJGA 5DQDH 3VXRD 1MCLA 1IGYA 4U6XB 5DHYA 4G8GB 4M1DH 4P9HC 5T1KA 2ZUUA 4WCYH 1S78C 2R0LH 3CC5B 2XTLA 3L3DA 3LN4B 4Y19D 3N0PB 3MV9D 2BCKB 4HIJA 5C70A 5IT2H 1LO4H 4PRNA 3CUPB 1KG0B 12E8H 4OZ4B 2Q86B 1KCVL 4JPIB 3V6OA 1FFPB 2CXKA 4P2QA 5IW6A 3WYRA 4XMKL 3RI5K 4JFZL 4Z5RA 1PG7H 4NDMB 5HJ3B 2ICWA 2QR0A 4GBXA 4KROC 3CK0H 1EMTL 4NM8L 3P30L 5IHLB 1NMAH 2GSGA 3GO1L 4X9HA 1AQKL 1MRCH 2NNAA 2R2BA 3WFEL 4KFZC 2ICWJ 4YK4C 3TA3D 1NC4D 4DWHA 4MA8H 4MNQB 2DQIH 3WNLA 5DMKA 2G60H 3KPRA 5J9PB 5AEAA 1JK8B 2APVA 4X6CF 3VXUE 3WFDH 3D2UD 2JB6B 2C3VB 4XXDB 3HR5A 4X6DB 3RWGB 2L7JA 32C2A 3EYVA 3NCJL 3E1F1 5TGBA 1KCSL 4YZFE 3OKLB 4F7EB 3C5ZD 2Y5TA 2VIRB 3ARFB 1XGYH 1HCVA 1CD0A 3BP6B 4L4TB 1T03L 1MY7A 15C8H 4P2OB 1ND0A 3GMOA 4NM4L 3ULVE 4JM4H 3NH7L 4RWHA 1KJVB 3TZVD 3U0WH 3PQYB 1S7QA 5C0EA 1ZSDA 3CIQA 1P1ZB 5JXAL 2QQKH 3OKMB 2VL5B 4CU7A 4WY7L 5MERB 1DZBA 1G7LB 4X7TB 3NPSC 1F6LL 4QXGH 1VENA 2AGJH 1T6VN 4MXQD 5F6IC 4F7CA 1VACB 1MH5A 5CJQH 2DD8H 3X13B 4HDIB 2ZWLT 3SDCA 3C6LB 4UQ2A 3UC0L 3M17B 2NTFB 5TJWK 3UTZB 4Z7OF 3AU1A 3KYNB 4UTBH 1INEL 2FX7L 4OI9A 5CSZA 5FF6B 2XY1A 2HH0H 3F7YB 1DCLA 5CCKL 3ULVC 3L3IB 4MLSA 5JHLL 3D39B 4WFGD 1FVCB 4L3EA 1I1YA 4M02A 3X12A 4POYA 5T3XL 4I0KA 4NQDD 4KHXL 1T22A 4JKPL 4P5MA 4UDUA 1K4CB 2IC2A 3GJEA 2YXFA 4WDIB 2VYRE 2UYLA 5GISL 2W59A 3T65B 3O4LD 4MSWA 1KIRB 2LE9A 3F12A 1Y0LB 4L3CB 1GJIA 3NOIA 4XVUD 4IRSB 1DUZA 3D18A 1FCCA 1PKQE 2IANE 1MFEH 5H8DA 2HFEA 1MHCB 3JWDL 1HZHL 4NNXA 2XYCA 5EA0L 3VXPB 1A6WH 4DGIH 3AXLB 2A2QT 4MS8C 1H3UA 2X70A 5IMLB 1TJHH 3IRZA 2VISA 4KRPC 3DUSB 5JW4M 5GHWL 3VRJB 1AE6L 1AC0A 3MRBB 1SBSH 4X8JA 1I9RL 5EC1A 4YR6B 3UPAA 4E5XA 3ZHDA 5DVNA 3PE9A 4R96B 4PG9B 2VR9A 3IDIB 2RBLA 4FQJL 4R0LA 2AKRB 2C4FT 3QUYD 2QADC 1FGNL 2C7UA 5EO9A 5JXEC 4BUGA 3TT3H 3TN0C 2H8PA 4Y4KB 3TBYB 1S9YA 1FNFA 1JF1B 4MD0B 2FGWL 1QSZA 2YC1B 1IGFH 3BP7B 4J4PC 2XI9A 1ZGLB 2HAZA 5C0CD 3IDXL 2MCG1 4JPWH 1DDHB 5C0NC 2SEBA 4YH6A 4D9QE 4NSKA 2OJZH 3I6LE 5TF1H 5DK0B 4U3XA 3HE7D 3QQ4A 3ZYJA 1YQVL 4IRJA 5FECB 3RUGE 1QHPA 1NCDL 4HLJA 5K33A 4XWGL 5FO7B 1SY6A 3BRGC 3UTOA 4L4VD 5IUSA 2HJFB 4PJCE 4GJTB 3MA9L 3GSWB 1OD9A 5ALCL 1W72A 4HV8B 3EAKA 1K2DA 3GBML 1CFTB 4IMKC 1QA9B 3PGDA 5DRZA 5JPMB 3JV0A 3MYJB 3DXAB 5D6DA 2IADB 2XQYK 1JN6B 4PJBB 1MCIA 1F00I 2R1XB 3P73A 1AH1A 4UIKL 4NT6B 4W6XB 5TDPA 5KS9A 4JFHD 1Z5LB 2WP3T 4LKCB 3K80A 3M8OH 1QACA 3VXQB 5I1IL 4K23L 4Z7VF 4ERSH 2GJJA 1CLZL 3KDMB 3TPUA 4LP4A 3T0DA 2FLRT 1K5NB 3C6SA 3J8F7 5JW5B 3V8CA 1IGML 2C3XA 4CN1A 5DURB 1MUJA 3UPRB 4MNGA 4OM0H 2P5EE 4RAUB 3DI3B 4OFDA 4OD3H 2GTZB 3V95A 3WUWB 3GIVB 5C92A 2W9EH 2N7AA 1A1OB 5EPMA 1UENA 3F8UB 1J5OL 1XF5B 2AI0H 1HEZB 4AT6B 1JTTA 2JJSA 1JIBA 1T1XB 3IFPA 4HUUB 3UJIH 3KYMA 5GS2H 5JDSB 2F53A 4FQ2H 2V6HA 4QO1A 4RISH 2C4FU 3UTSA 4WTXA 3KPLA 3QDJB 1XZ0B 4YQXL 4FTVE 5HGGS 5F70A 5BJTA 4ZPTB 1T20B 1FZJA 2WMPA 1I75A 1G9MC 4NJ9H 5F88A 1QSFE 4N90E 3HAEG 5BRZB 3HLAB 3SGDI 3KLHC 1X4YA 1ORQA 1TETH 2VITA 5GGVH 4JQIH 3JWOC 3T3PF 3C08L 2DQGL 2VDRH 3U79A 1JGEA 1BOGB 2YPLD 3BZEB 1RMFH 2IBZY 4Y4FA 4UDTB 5T5NF 5D1XB 1KCRH 3DGCR 2MQ0A 3OL2A 3GMMB 2D4DA 2BRRH 3WKMH 2WBJB 4JB9H 2A6KA 3NCBB 3SY0A 1BFVH 1VGKA 4IOIB 1SEBA 2WINA 3QXDB 5L2KA 2BERA 3IU4L 1R3LB 5I8CA 2CDFB 2F5AL 1H5BC 4KV5E 5AYUL 3EOAA 4ISVA 1R3KB 1JGVH 1OVZA 5HYIA 4HS6A 5SWSB 4YXHL 2UVFA 3ES6A 3L7FB 2J2ZA 4F58L 1DLFH 3G6JE 1A3RL 4KTEL 2AW2A 1PEZA 3V6ZA 5SX4I 2P7TB 3CXDL 3FOMB 5LGJA 1NEZA 4H1LA 2V9RA 1GAFH 2QQNL 2DQUL 3FOLA 3S88L 2Y6SD 1RZKL 3O45B 2CDGA 1F2QA 3JV4A 4XVJH 5C0DB 1JMZA 5D6CB 4HG4J 3ZTNH 5D7KE 4BSWA 4GKNA 4DGVL 4OM1L 3LIZL 1C5CH 3HPJA 5DQDL 4LSSL 3GBNH 1T04A 4XP4H 3WO4B 4Y5XB 1P4IH 3LQAC 4KQ4L 4M1DL 2DQFA 1U8IA 2R0LL 2XTJD 4LASL 4M3JA 4C55A 3LMJL 5GZOD 2ILLA 3FB5B 5IT2L 4G8FB 1LO4L 1CLOH 3FRPA 3ULVL 4UILL 3BGFB 3QO0B 12E8L 1RUKH 2AQ2A 2VXVH 2Z8VC 4I4WB 4N5ED 4PP1C 3VFMA 4X4YA 2DICA 1J10A 1EVUA 1NQBA 3D48R 3QIUC 3MGTB 4OFPA 5ISZD 1CI5A 5E5MB 2H32H 3IXAA 3HI6H 4HWEH 3VXSB 1PYWA 5ETUB 4XPBH 2DJSA 4RMTA 4CBPA 1MJ8H 5KSBA 2R9HC 1FL5B 3S4SA 2IAMA 4XT1C 5CZVH 1BMGA 3FQRB 1ZWIB 3MBXH 4PJ7B 3BUYB 3SDCC 1AGBB 3MLYL 4RGMC 3HMXA 2DQTH 2UZIH 4Z77B 3TNMA 3EOTL 5KSAD 1G6RH 5JA8B 1JWMB 1V7NH 1T2QH 1V05A 4AK1A 4MA8L 3V0VA 2DQIL 4PJGF 1ZGLP 2G60L 4KKBC 1UACL 3BN3B 2NYYD 5DJ2A 4FQLH 4CKVX 1HSBA 2UZYB 2X09A 1JGDB 1FFNA 3RVUD 1MCEA 5J1AB 3UTTB 2AXGA 3U36A 1HXYB 4KJYB 4XCEA 2C1OA 4F7MB 3K7UA 4W4NA 3W0WE 4OI8A 1MWAL 3MRIA 2BZDA 4ORZC 35C8L 3W5MA 1XGYL 1QG3A 4P99A 3UBXG 4MD5A 1BQHG 2NY1C 3O41B 4FA8A 1DE4B 4U1SB 4BH8B 2EDEA 2G9HA 3EGSA 3PGFH 4OB5L 3U0WL 5JPNA 5DHVH 1RURH 3T4YB 3X3GH 3NVQA 1FV1A 3C5SA 4OGAD 5DMIL 4PJEF 1R0AL 1WAAF 3BVNA 4TYUA 4I48A 1W8NA 2ADGA 4ZUUA 4PLKC 4HWUA 3IAQA 2NXYD 3HZYA 4ODSL 3X3FH 3RIFK 3TWCH 3EDFA 4TPRH 5D71H 3ZMRA 4U6XA 1J1XH 2D7QA 3OKDB 1CXIA 3LN4A 3CC5A 2AJZB 3DYMA 3M1BB 1KV3A 1G84A 5GRZA 2BCKA 4EQ3A 3NACH 3QXTA 4PJXF 3OGCB 4HXBH 4ELMF 3GKWL 5B39B 3CUPA 5L7XH 5B3JE 3O6FD 4EDWH 4UTBL 3RVVC 4R0LC 3ECBB 3TP4A 4OZ4A 2Q86A 1MF2H 4JPIA 1MCCA 2ATPB 4JN1H 2A9MH 2EYRB 1RUML 2HH0L 4U4BA 2RAMA 4QTHB 4OBSA 2YPVL 4JRYB 1FIEA 4KRMB 4PJIB 5D2NA 5E95B 4PJAE 43C9B 5J89A 1KF9B 2ESVE 1EHLL 5CD5D 5FB8B 3D6GA 4NKIH 1YEHH 1ZA6B 4IRJC 4LSDA 3BKJH 3AGVA 2WBKA 5D96C 2E9JA 4ODWB 2R8SH 1ZVHA 5H35A 3T0XA 2EDJA 4ZTPH 1KJ2A 3QDGD 2JB6A 3K1DA 2I9LA 2BNUB 4Q9BA 1EUTA 1KB5A 4X6DA 3RWGA 4BSJA 4WHDA 3FO0H 3RU8H 2BVPB 2M8XA 4XH2B 1UM5L 1U8NB 1Z3GH 4S1DD 4TVSa 5D7SH 2VLJD 1N5YH 2HP4A 4X0KB 1AGEA 1T21A 4Z9KB 1JZ4A 3GSXB 1TJHL 2DM3A 4F7EA 3RY4A 2P42B 2DWDB 2VIRA 1CTNA 3BP6A 4L4TA 1S7XA 5IIEA 5CLWA 3NCYS 3QQNA 1SBSL 4C59B 1N4XL 2X9WA 5D5MB 2BY1A 4CMMB 4QRSB 4E41D 2VDQL 1JGUH 3PQYA 1OGAE 4Z95H 5F7MC 4FQHA 4HS8H 4FFWD 1P1ZA 4UIMA 1G9ML 3VXOB 3OKMA 2VZ3A 2VL5A 5MERA 1XR8B 1G7LA 4X7TA 2EDTA 1J8HE 3ZE0F 2YEZB 3H9SD 5CSGA 3U4AA 4ODXB 5DGQA 1J0KA 1NEZG 1TVBA 4WI5A 3JWOL 4FQIL 2AV1B 2OMNA 2VQ1A 3GRWA 5IB5B 3M17A 4M6NL 1ES0B 5L0QB 2NTFA 2A73B 2ICES 2OJZL 5TF1L 3D87B 2F8VA 1YNKH 3IF1B 1U8KA 1FYTD 3MREB 5FF6A 4CVXB 1BBDH 1RI8A 3F7YA 3QR2A 4N0CC 1VFAA 1KNOB 3L3IA 1L0XA 5JZ7C 4RGNC 4C54A 3REWA 5FOBA 2X4TB 3V7AG 1K4CA 1EO8H 4AENB 1AC6A 4KU1A 3KPMB 3HS0B 1L9MA 1D5IL 5DWUH 5C0CE 1TIUA 4TUOB 4IDJL 3LN5B 3S4SG 4PY8J 1JYNA 1CGXA 3VFOB 1UT9A 4M43L 4R4BB 1U8MA 1MHCA 4NKMB 4ERSL 5IJVB 2KH2B 2OYPA 1YY9D 3K8KA 4RX4A 1BZ7A 3EO9L 1WBYB 5HHMD 1KB9J 4YBQC 5ADPL 3U1SH 4QT5B 4GSDH 3UJJH 4OD3L 5I1HL 3A0OA 3VRJA 5ESVB 2IPKB 1IM9B 3MRBA 3MV11 2W9EL 5A2FA 1MRDH 2VC2H 2AI0L 1V8HA 3LD8B 5GSRB 4PG9A 1Q0YH 3IDIA 4YDLB 1XAUA 3VXRB 2AKRA 1TQBC 4Y19B 1I85A 4RISL 1BEYL 1Z9OA 4Y4KA 2OK0H 1T7VA 3MV9B 1YN6A 4EIGB 4OZFG 2Z91B 4MD0A 4YHLH 3E8UH 3HZMA 2YC1A 4TTGA 2N7BA 3BP7A 1ZGLA 2UY6A 1J12A 3HB3D 4NJ9L 4POUB 1DDHA 2HVKB 1LVEA 4KC3B 2IFFH 1J05B 2X89A 5E70A 4L8CA 4R2GC 1IQWH 5DK0A 2R1WB 4JQIL 1RUPH 5DEFB 5FECA 5C07E 4HMCA 4PREB 1ODAA 4JHBA 5FO7A 4OZGE 2VE6B 3L9RA 2Q7NA 2FECL 4OGYL 2HJFA 1JUFA 3EO0B 1GPOH 3GSWA 3V52H 3PL6D 3TA3B 1NC4B 2P8PA 3SE8L 2BRRL 3DOSA 4NQCD 3WKML 4XMPH 4MJID 4JB9L 3ESUF 3I50L 5I1JH 1JFQH 1QA9A 3SCMD 1GYAA 1S7SB 2CK2A 4ZFGH 5JPMA 2WWMC 3MLTA 1PG7W 2MCPH 3GI9H 3DXAA 1E28A 2IADA 4ZOBA 1DBML 1KOAA 4PJBA 5KVGH 3D2UB 2R1XA 3IXTB 2IALA 3VRIB 3NGBB 5I19H 1JGVL 4NZDA 5ACZB 4LPUA 4NGHH 1DUYB 4LDLB 1Z5LA 1MI5E 4P4KA 1DR9A 3ARDC 2X6MA 5ICXA 3VXQA 4OF5A 1GAFL 2YPLE 1YMHA 4FABL 5JW5A 5DGRA 2IH1B 3UPRA 2OI9C 1V7MH 4Z7UB 1FL6A 3GSUB 4J3XA 2GTZA 3WUWA 1P6FA 4TULH 3MV8E 1YEGH 3ZTNL 1A1OA 3L5WB 1C5CL 1XF5A 5J13C 2IFGA 3GBNL 3T3ME 3VFNB 1QHOA 1T1XA 3I6GB 1UADC 4GXVH 1P4IL 4XPAL 3MACL 4DZ8B 4EUPG 1CVRA 4Q0XH 4BQBA 3DX6A 3P40A 3TBVA 4TTDC 3QEQD 4Z7NE 3HFML 5E8PA 3BKMH 1SJHB 5DS8B 3QDJA 4NFCA 4G6KH 5TE6H 1RUKL 5KZCD 4ZPTA 1T20A 3Q6FB 3TT1L 3ILPB 5FM5M 2DLEA 3VD7A 2YZ1A 3IDYC 3CZJA 5BRZA 5CJ5A 1ZGLM 1FBIH 3HLAA 2VMFA 4XPBL 5JNYA 2EKSB 1WT5A 1BOGA 4DEPB 4XBEH 4U2YA 4MWFB 4KDTA 2DQTL 1TPXC 5HHOE 2AEPH 4UDTA 4NQDB 5D1XA 5I75B 1V7NL 1T2QL 3BDXA 5I1GH 5HGDA 3GMMA 5IMMB 1IARB 4ZDHB 1DQJB 1S7WB 2JJUA 3I75B 3KPNB 1KPVA 4IOIA 4FQLL 1YC8A 2XZAL 2VXUL 3QXDA 1PZ5B 2FD6H 3O4LB 2O93L 4G9FD 4I8DA 2AJYL 1R3LA 4CVUA 2CDFA 3BQUD 3PXHA 1I8MB 3QWRD 1RZFH 5SWSA 5IK3B 5GS0C 4MQTB 3L7FA 3LZFH 4WUUD 1ZOXA 4QRPE 1Y18B 5LQBH 3AB0B 4L8DB 5DJDA 4YAQB 3FOMA 3X17A 2HTLD 3G5XB 5CKGA 5HTSA 4H8WH 3MJ9H 4U1HB 3LEVH 5LWYL 1RURL 3X3GL 3O6LH 2BSED 2DTMH 3Q5YA 4AH2A 3IJHB 3RKDD 4NIKB 3WIFB 4PRAB 5D6CA 2A1WL 1KB9K 2W91A 3QUYB 4WW1B 3QAZC 2R4SH 3X3FL 3FHAA 1HOCB 1RZJC 3ZKXC 2PO6D 4Y5XA 3ARFC 3CZFB 4CVWA 3QJFB 3U7WH 3IDNB 3AREC 1AHWA 5CGTA 4LFHD 3OB0H 4P2OC 1NBZB 2F9BT 3L5XH 3FB5A 4G8FA 4YFDB 4OIBA 3R06B 1UCBL 4X5XB 1LEIA 5L7XL 3ZDXF 5F1SA 4I4WA 1PKQA 4IRZH 2D9CA 2NY7L 3B2UD 3DGGB 4BFEA 4YXLH 5J4MA 5IQ9B 5E5MA 3L7EA 3VXSA 1PQZA 1BD2E 4L4VB 2O61A 4Y4HD 4FQPA 3P9MB 1ZWIA 2PKDA 3CMGA 3FB6B 3QQ9D 4XI5C 5F7EH 3C6LC 3KJ6H 4JFYB 4Z77A 1UB5B 3MRKB 1BAFH 2APXA 4OFIA 5IWLA 3MJ8B 4NKIL 2V9TA 1JWUB 1UFUA 3VXTB 4KK8C 3HMWH 4MA3B 4V2BA 3VE0B 1A4JB 3NTCH 3SKUD 5DTFB 1VFMA 4DN4H 5DUBB 1JGDA 2DYPD 4OD1L 5L6YL 5J1AA 2CUMA 3UTTA 4HPOH 3FO0L 1HCFX 4X4ZA 5GGRY 1FCGA 3RU8L 5A2KH 1H3VA 1HXYA 4QYOA 5IW1B 4F7MA 4TN9A 1NLDH 3WS6A 1B0GB 4ZUSA 4X8XA 1RUQL 4PD4J 1CF8L 3KYKH 3QBTB 5GGSA 4UUJB 3O41A 4PS4H 5ITBH 1DE4A 1Q9WB 4BH8A 1HIMH 3BN9C 4NCDA 5GS3A 5C0RH 3VD4A 5ITFB 1JGUL 3T4YA 4IRSC 3KR3H 2O5YH 4FFVC 4PJCA 4CAGA 2DS4A 3QHTC 3O8XB 4LVNB 4HS8L 4TSBL 3I3EA 1F4AA 4B7IA 3CSGA 1LE9B 3FO9B 3X14B 2R56H 1CQYA 1A0QL 2JIXA 4F80A 3S36H 5DJCA 4MB5A 3VGBA 1PG7X 2H9GA 1V3MA 1WZLA 4LSQL 2BNRD 2GY7B 3NZHH 1R5VB 5TDOB 5EOTA 4JO2L 2PR4L 2ZG1A 3RVWC 2O5ZL 3OGCA 3ZT7A 5B39A 1YNKL 3WUWG 3UDWC 4PJDE 5I1EH 5M7QA 3ECBA 1PD6A 5IROA 5FA4A 4S1QL 4OLUH 3MLSL 4KDWA 4POZC 4EDXB 2ATPA 1I85C 4RFNB 3QCTL 4O5LL 3AY4A 5IBLD 4JRYA 4KRNA 4JM2D 2P5EA 4N0YL 1CR9L 2VDNH 1KC5H 2DQHH 2JTDA 4R3SB 43C9A 3N85H 1OWWA 4NKDB 2X4SB 3OXRA 4LCUA 1EO8L 5FB8A 2WQRA 3SKNB 4MA7H 3E3QC 4L29B 5KSBF 4JQXC 4OF7A 4DOHE 2PYFB 1ZA6A 3SHSA 1UZ6F 3M45A 5IBTL 1Q9LB 1DBAL 3ZYOA 3KPPB 3O3BA 3S98A 3VH8G 4D9LL 5HPMB 2HG5A 4XPHH 4M3KB 3O2WL 3MLPA 1T2JA 4FTVA 4XCYA 2BNUA 2E6JA 5F1KC 4KDVA 5J56B 1HSAA 1MREL 1QSFA 1U8NA 5T33H 1L7TL 2DBLH 3OMZA 2FJHB 4X0KA 4OTXH 1AGDB 1EEYA 1LO5A 4HLZG 2JCCF 1QSEE 3QO1B 3CFCH 3FQXA 2OTUA 1NJ9B 4PJFB 4GSDL 3UJJL 1IC5H 4PGCB 3T0WA 1A1MB 5HDOA 2HA1A 1PY9A 1MRDL 4PRDB 5D1ZD 4QRSA 1S8DB 4HK0A 1QFWM 2ZNXA 1Q0YL 1DFBL 3IFLH 4H88H 4KUCF 3VXOA 4LLQB 1NAKH 2DQDH 2XTJB 3CSBA 2OK0L 5DD5H 5GJSH 2YD6A 5BVPH 2C1PB 3E8UL 5ACMA 4H26B 2N4IA 2AJVH 1I7UA 3WJLA 1NGQH 2EE6A 4JQVA 5IB5A 1NUDA 2R4RL 1AIFA 1CL7L 5ISZB 1ES0A 2XWBA 5DA0B 1F3RB 2A73A 2PXYD 5JIPA 4R90H 1A6UH 1IQWL 2XIDA 3G6JA 2Y23A 5KANG 4PG2C 5MEND 1JPST 2GJ6D 4GRLA 4AQOA 1TZGH 4HUXB 4CVXA 1E4WH 3LVEA 4PLJD 3CSYB 5DI8B 2QV2A 1VCAA 4LEXL 5KSAB 1PFCA 1DVFD 4OF6A 1KNOA 5HI3C 3V52L 4M61A 4UINH 3H3BC 4XMPL 2ITCA 5I1JL 2EDLA 2B5IB 4ZPVB 3ULUC 4QLRA 3H3PH 5IQ7H 1TNMA 5GS0L 2NY4C 2MCPL 3GI9L 4AG4H 1OAZL 4OSUH 4CN6A 3SKJH 2KZ1B 4AENA 5HGBB 3MLWH 5KSVB 5KVGL 1K9TA 1WT5C 1NUNB 5EB9A 5C2BH 2NY2D 3O2DH 4ZTOH 3WNNA 5F3BB 1BVZA 4G80B 1J1OH 4P46D 4TUOA 3LN5A 4NGHL 5D1XC 2EIEA 4PYHA 1S7UB 3VFOA 4V1DD 2V5YA 5KVFH 2HRPH 5IVXB 1UWGH 2O5XL 3MODH 3TBWB 2FWOB 2WBJC 4R4BA 4ZMAT 4JRXE 2X1OA 3E6HA 1AGFA 2VQUA 1AR1C 2X4PB 1I8LC 3BOVA 1RZJL 3GSNL 1WBYA 1M1SA 4JFPB 1NGPH 1EBPA 3QI9D 1V7ML 3ZHKA 3EDKA 4X6DF 1BM3H 3IKCB 4TULL 1YEGL 5FYJU 4F7TB 3P0VH 1BP3B 3CVHH 5GSRA 1MEXL 4OCWL 3VFTB 3IDUA 1T5XA 1T1WB 3VXRA 4DTGH 5LAXB 3JBG7 4IJ3B 5CWSB 5DF0A 5CJXC 4D0DB 1QQDB 1MAML 1U3YA 3BKML 5DC4B 4HJJL 3BHBB 4U1IB 3MV9A 2XV6B 5E9DD 2Z91A 3PWUB 3OTTA 4UBDD 5TE6L 3O6FB 4OKVB 2AXJA 4ELKB 1FNSH 4QHNA 4LVOC 1J05A 3GMQB 5E6IC 5E7BA 1CIUA 2Z31D 2FNBA 2GFBB 3ZDZE 1WV7T 3QUXC 4G6FD 1R3HB 2MQCA 2R1WA 3WO4C 1WCQA 2ARWA 5F9OH 5HYFA 4PREA 4XBEL 1P9MA 5ICZB 2ZG2A 5DD1L 1RIVH 3ZE1E 2AEPL 4X7SL 1MCOL 2GAZA 3S35H 2EIZA 3EO0A 3MX0A 3BPCB 1E27B 3KPOB 3TA3A 1NC4A 4KJWD 1A6ZA 2H32A 2ZUTA 5B38B 1S7SA 4M93C 3QEQE 1AJ7L 4N9GB 5B39G 1UEYA 2ATKB 2FD6L 4J3WA 3MLUH 2GSIA 4YGVA 2FEDC 3CDGA 4JVPA 3IXTA 3QDGB 1NAMH 1SJXA 1UXWB 3VRIA 4MQXD 1G6RA 4O4YH 1IEBB 5ACZA 4DKEL 1EK3A 5GGTL 4KGLA 4DVBB 1YEEH 1QP1A 2VLJB 4XZUA 4NQXA 2Z93A 3C5ZA 4YHKH 4UOW0 1PLGH 3RNKA 3DUHA 4OUUA 4H8WL 2YD7A 3QP3A 5HD8D 5C0IB 3MJ9L 4EOWH 3WS3B 3OKOB 3IB4A 1KJMB 3O6KH 5C0AD 3VJ6B 4E41B 3TZVA 5BS0D 3HI1B 1B6UA 4ZQKB 1MQKH 1KJ3L 1RK1B 3WNPA 2OJEB 2R4SL 1ZLVK 3BT2H 4ONGH 4JN2B 1AI1L 3H9SB 3WFCH 3I6GA 2NQCA 4G9FE 4BZYA 3MLZH 4DZ8A 3BSZH 5C0BE 1QR1A 3K2UH 3L3KB 4QRTB 5DHVA 2LABA 3L5XL 4TRPH 5DRWB 4F15B 1WFTA 5DS8A 5EZIL 1L0YA 4KI5C 3OPZL 4LCYA 3WLWC 1T4KB 3FT2B 3Q6FA 5I73B 4PJ9D 4PBVC 1FYTB 3MBEC 4JO1H 5K9KB 4NQSB 2BHZA 2P43B 3KYOB 3ARBA 3RWCA 4LSRH 4HKXB 2BVQA 1QRND 5C08E 3DIFA 5HYJD 1T3FB 2EKSA 5DZNA 3OJDB 4AMKH 4NC0B 5F7EL 4P4RB 1OB1A 4R7DB 1ZAGA 2UV3A 1BAFL 3CH8A 3HMWL 4ZDHA 1ZHBB 4K7FB 4NJAH 3L5IA 3I75A 2Y5EA 4PTTA 3BPLC 3CFJB 5BVJA 3EYUH 3O4LA 4L5FH 1OW0A 2M1KA 1NEUA 1BVLB 4YHPA 4XC3H 3C8KB 2FIKB 3RWHA 1I8MA 4RDQG 5F1IB 5IK3A 5D7IB 1NLDL 1VFBB 1HH9B 5FV1L 5IEKB 1Y18A 3TO4D 1CGUA 1EUUA 2BOCB 3MV7E 4PJBF 4YUEL 3U6RA 1QLFB 3RBGA 5HHMB 4DK3A 3G5XA 4PS4L 1UXSB 1L7IH 3PP4L 5C0RL 5HI4C 4WO4D 5BZWB 3OJMB 4XNQA 3WIFA 4PRAA 3L95B 2R56L 2CGRH 3QUYA 4R8WL 4WW1A 3SO5A 1NBQA 1LEKB 2ADJB 3S36L 4LRNL 1CFQA 3LKQB 4Y16D 2EDKA 3CZFA 3QJFA 4JANB 4JR9H 1KIUA 3FJTA 3U9PH 5D8JH 1X5HA 5C0CA 2WIMA 3BAEH 2YRLA 5A3IC 3S3JA 2X1QA 5MI0B 1JHKL 5T1KD 4IOFC 4JDVB 3F62A 4X5XA 4NO2A 4OCXH 4ENEC 3SE9L 1MFNA 4C56B 3HE7A 3DGGA 3RTQC 1FORH 1AR2A 5HY9B 5IQ9A 3ULUL 4F9PA 2Q7YA 4JFFE 1WQVT 1YYMH 3TJHD 3K3QA 4U3HA 3FONB 3P9MA 1KC5L 4LCCC 2DQHL 3PL6B 3FB6A 3LKOB 3EZJB 4JFDE 4NQCB 4MJIB 4DJMA 4JFYA 3DRTB 25C8L 1UB5A 3SCMB 2ZOKB 5L0QC 4HIIB 5JOFA 1EGJL 3BEWB 1EFXD 4LSTL 1KN4H 1UVQB 5EU6E 4MQ7B 2KUTA 4W6WB 2KQNA 4MA3A 3BDYL 3VE0A 5GS1C 3HHRB 5DTFA 1U6AH 5FCUH 4I9WE 4NP4L 1QFUH 3KPRD 4KJPC 2X4QA 3BO8B 2DM7A 4OFVA 2ZPKH 5IW1A 1DBBL 2J8UE 2Y06H 3LKPB 2JK5B 2NW2B 1J0IA 1LEGB 3HZKB 4EI5B 4NN5B 1LWRA 1U8PA 1LP9E 5FUOH 1UQSB 1EJOH 1GGUA 5H2BB 3PDGA 3BGMA 2ZSVB 1IC5L 3S37H 4LHUD 3LN9A 4UUJA 5MEQB 5H37H 2VDLL 4F8TA 3O9WC 4WGVB 4WNQA 1SMOA 1GCFA 1RJCA 3WD5L 4F57L 2P8LB 3ARZA 3K4DA 1D5ZB 1HHJB 2R0ZH 3X14A 3SGDH 1NAKL 4XBPB 1GGIH 2BNQB 3OXSB 5FCSH 1A6TB 4LLYB 5C86A 2V7HA 5GJSL 4M00A 3PUCA 5BVPL 2W0LA 1R5VA 3FRUB 4LLUB 3ZDYE 1IAMA 3D9AH 5BV7H 5EG6C 4E42A 1SM3H 3B2VH 1BJMA 1A6UL 3VXMD 1C1EL 5F1NB 4YDLC 3ZSTA 3TCLB 2YA1A 1TZGL 4HHAB 2RGSA 3EKCA 2YKLL 4DAGH 2HKFL 1E4WL 1BGXH 2YPLA 1MPAL 4NC1C 3SE3A 4ZNEE 1S5HB 4N0UE 1PVHA 4QRQA 3OX8A 1M05B 2WLZA 3EOBA 5D93B 4UINL 4YIQB 3QA3A 1F5WA 5J3HC 3MLVL 2WZPD 4R3SA 1FIGH 5HBBA 3H3PL 5IQ7L 2J88L 4K3JH 4NKDA 4CL7A 2X4SA 5SX4H 3P2TA 4WHTB 4FP8H 4HD9A 1DJSA 2CK0L 1G7HA 2P48B 4NQVB 4NCC1 4X99B 2PYFA 3O3DB 4JPKH 1KYOJ 3O2DL 1CU4H 4PJ7F 1SEQH 3BQUB 1Q9LA 3IFNH 4YDVA 1E4KC 1FRGH 2GI7A 3VFVB 4HUWB 2CRYA 4OLZL 2F58H 2DI9A 1H8OA 4WUUB 2Z35A 3CXHJ 1UWGL 3RDTA 3CD4A 1S7VB 3BH8A 1UGNA 3VFUB 3MROB 3GSVA 3O11B 4HT1L 2C3WA 2GJ6E 3FQTB 3LPFA 4DKDC 1KN2H 1JTOA 3ARPA 2EEDA 1AGDA 2Q8AL 1A7NH 3ABZA 3AROA 3QNZB 3QO1A 3VI3F 1NGPL 3KHQA 1NJ9A 4PJFA 1BM3L 4EJ1C 3VCLB 2L7UA 3NGBC 4PGCA 1N6VA 5F3HA 4JZJA 1QFWL 2D03H 3PWPE 5TF0A 3CVHL 4I5BB 5CEYB 4LLDA 2DL2A 2XN9D 1ZHKB 1DEEB 3MNZB 1OP3H 1H8SA 3WFBH 2PO6B 3DSNA 1G6VK 1NMCB 4Q6IA 2D3VA 4K7PL 5IF0A 4NRXB 4KI5F 3H7BA 3DVGA 2DAVA 3QH3A 4ZS7L 4XP9H 2C1PA 3AM8A 3RHWF 4PPTA 1JRHL 1ZA3B 5DR5H 3NMEA 4XCCL 5E1HB 2B4CH 2IQ9H 5ISZA 4EN3C 1B4JL 1IQDB 1VB9A 4ZFZA 2QLVB 4MXQC 5KW9H 5F9OL 5ILTH 4U6VL 4M7ZC 4NPYB 4R7NB 1Z6JT 3K1KC 4Y4HB 1R3JA 5J8OA 1OARL 4TUJB 1RIVL 2MPAH 3JV6B 3CSYA 5FA3B 3S35L 5KSAA 4GRWE 1CICB 4MCZB 2Q6WA 9CGTA 4KK9D 3JSSA 1EHNA 4KAQH 1RVFH 2G5BB 4ZPVA 3OR7B 4HKZB 5MP6H 5ID0A 5DJ0B 4PB0H 1VHPA 1I9EA 5KSVA 1ZT4B 1RJYB 3OAYH 4YPGA 1RSFA 4D3CL 4PJIF 4DEPC 1YYLH 4NRYA 1TQCB 3LRSB 4H25B 4O4YL 4QRRB 4F33B 4QEGA 4W4OA 3RWDA 4MNHB 4YXKH 1YEEL 1FO0L 1ED3B 2H2SC 3QDME 4QRUB 1A7QH 2NR6D 3TBWA 4AL8H 3OAYK 4M03A 4Y5VB 3RVTD 2HKHH 4DQOH 1YPZE 2XWTA 2ICWI 1RZGB 2FHCA 4CVZB 3O6KL 5F1OB 3AFLA 2XZZA 3GHEL 5KN5B 1OW0C 1OHQA 1IGTB 2QQQA 1DSFL 2YXMA 5T5FL 1MQKL 4F7TA 1KELH 5E1AB 5H94B 5LJYH 5F9DC 5F8QC 3BT2L 4ONGL 2FRGP 3WXVH 3MRMA 1RZ7L 5IVZA 5ENWA 4U0RB 5EZLA 1T1WA 3MLZL 3TH4T 1XGQB 3MJ9A 5FUCC 5CWSA 3NZ8A 3K2UL 2BNRB 5EORH 4HUKB 1OAUH 2WQ8A 5D5MF 5IMOB 2OL3H 4TRPL 4BELD 4U1IA 3V4UH 1KPUB 4OD2B 2X10A 4I0PC 5TH2B 2HN7B 5C0FA 2F53D 3O6FA 4OKVA 4AIZB 5DEZA 4M1CD 3ORJA 4AEIH 3GMQA 3QISA 4P3DB 1D5XB 4Y1AD 5JORB 3SKMB 2K9UA 4X4XB 4Y5YC 1R3HA 2V2XB 4OQ1A 5BO1L 1LO0H 4HEME 4XX1E 1S7RA 3RL2B 4JM2B 2QL1A 5ICZA 5J6HB 2AP2A 5DD3H 1JGLL 1BLNA 1G7PA 3BPCA 1E27A 3KPOA 2H3NB 3DX8B 1OP5H 1KGCE 3VXNB 5B38A 4UB0H 1FP5A 4WI9A 1F8TH 4F9PC 4Z7QF 3BJ91 4N9GA 1KLUB 1B88A 4U33A 2ATKA 3WNKA 4RDQF 4GKSB 1MHPL 1AXSB 2YUXA 3QDGA 1UXWA 1SMAA 1XR9B 3DURB 3QIWB 4LLWA 4RCAA 4XC3L 3S5LA 1OP5K 3RWFB 5L2KD 1KYOK 1CXKA 4FN0A 2QBWA 4DVBA 2V9QA 2VLJA 1NGZA 1QRNE 3BMVA 4PJDA 3WEXB 1ACZA 3QXAA 3U82B 2CDEB 1G1CA 2OZ4H 2BX5A 5C0IA 4LBEB 2DQCH 5ANME 2A0LD 3OKOA 2EEBA 3BRDA 1KJMA 2E3VA 1CDUA 2JLLA 5D1ZB 4E41A 4FZEL 3BP4B 3I3BA 4FHBD 4X83A 1RK1A 4A6YH 3MCLH 1EO7A 2CR6A 3OAZH 1YMMD 3NCMA 4ZFOL 2I27N 2AK4D 4J3SA 1ACYH 4ZD3L 3H9SA 1M7IB 5JUEH 4HXAH 5FK9A 4P2RE 4JR9L 5GZND 4PGDB 1HQRB 2VH5L 4QRTA 4TNWF 2Z4QA 4HUVB 4FQCL 3IVKB 2HLAB 5DRWA 3BAEL 3SO3B 5DD0H 1U8QA 5ESQB 2PXYB 2UWEE 1P84K 3DV6B 3O8XC 4LVNC 3FT2A 4PJHB 3HUJB 1FORL 1NCCH 1FYTA 5MENB 4L8SB 4NQSA 3KS0H 5HDBE 1TVDA 3MMEB 3WL9B 4HKXA 3VRLE 4KTDH 1YQ2A 1QSEA 3U30B 1DVFB 4H20H 1CE6B 3OJDA 3BMWA 3QZWA 4NN6B 3QUMH 1I7RB 1KPRB 3HRPA 5JA9A 2ZKHH 2IBBA 3OAUH 3V2AR 5B8CB 2A74B 2R1YB 5M94B 4K7FA 2RHEA 2J4WH 2NY2B 3QRGH 4TNVF 4N0FB 3NN8A 1AGCB 4Z78B 1FAKT 3B9KD 4RFNC 3HNVL 4P46B 3CFJA 1U6AL 2NY6D 5FCUL 1G9EA 4V1DB 1FG2B 1BVLA 1INDL 5BCAA 4G6MH 1NDMA 5IG7B 3WXWL 4PJ8A 1AXIB 5D4QA 1G7IA 4XNMB 1D5MA 1HH9A 2IQAA 1X5KA 2RCSH 3KPQB 3NCEB 1QLFA 4EI6A 3QI9B 1BECA 2JE8A 3S37L 3MOBH 2H2PD 4WWID 3W9DA 3IAGC 2G75B 1OTTD 4L4JA 5KOVC 5SWZD 1A5FL 5BZWA 3Q1SH 4L3AA 4OGXH 2FBJH 5EUOE 3STLB 3L95A 3MRDB 4OCNC 3U7YH 2DQEH 2VR5A 3FN9A 4IHOB 4XPFL 1MNUL 2X42A 5ALBH 1GGIL 4NNPL 1LEKA 4QXTB 1FFOB 1IAKB 2CXGA 2Y36H 4BZ2L 3LKQA 5HYSG 4RMQA 5E9DB 4Z7UF 1JPTH 3SGJA 5IBUB 2Y6SC 4K3DL 3K81A 1I1AB 2YUWA 3EJZD 2PNDA 3RWIB 1CZ8L 2EO9A 5DJXA 5DUMH 4KKAD 5BV7L 2QSCH 4APQD 1SM3L 2Z0BA 4PJ5E 1T6WA 4G6FB 1BJ1J 4LPCA 1FSKB 2JJWA 4JRXA 5HY9A 5HYEA 2XTJC 5FOJA 2CKBH 4ZUTA 3FZUD 4GT7A 2P49B 5B4MC 4HZAA 3BGAA 1OQOA 1VPOH 3CDCA 4ZAKA 3FONA 1CD9B 2EZ0D 1CXEA 3DECA 2YMXH 4CU8A 1OTSC 3PL6A 4N5EC 5D7LE 4NQCA 1FIGL 4Y8AA 4MJIA 1II4E 5AWNH 1LO2H 3SCMA 3QPXH 4K3JL 2ZOKA 1FJ1B 2P46B 4P3CL 1Q9OB 1D9KC 1AO7D 3LEYH 3ROOA 4J3OC 3RZCA 3BEWA 4FP8L 4LKXB 1HE7A 4YNYB 1UVQA 3DX9B 1CU4L 1SEQL 3IFNL 4ZO7A 3SE4A 3TNNB 4HPYL 1C08B 1X5FA 2DLFH 2ZUVA 5D7JC 2X4RB 3VG9C 1VEMA 3TM6A 5C09D 3B6SB 1B4RA 1QSVA 3D0VB 2NZ9D 4JO3H 4WWKB 3BO8A 3G9VA 2B5IC 3EZ8A 2A6JB 3S36X 1PSKH 4P3WA 2VXSH 2JK5A 2NYYC 1W0WB 1LEGA 2XY2A 5T3XD 3O2DA 2PW2B 5B38G 1UQSA 5C0AB 5H2BA 1A2YA 2ZSVA 5BS0B 5MEQA 2W92A 3EJJX 1DBKH 2D03L 2VAJA 3HNSH 4MAYD 4YHZH 3JZ7A 2WK2A 5DJYB 2EDRA 1XIWB 5K9QG 3MXWH 3ELAT 1EERB 2MOVA 2V17L 2P8LA 3DVFA 3WFBL 5IOPA 3GIZL 1D5ZA 1HHJA 3P0YH 5FIEA 4XBPA 4WEUD 3QEQA 1A6TA 1N59B 3QUZD 4LLYA 3HN3A 5GSVB 4X4MA 3H6JA 1Z0MA 2YPKA 1CK0H 4OGAC 4F9LA 1FNEB 1A7PL 3FT4B 4PJ9B 3C60B 1K6QH 2NX5E 2XPGB 5ILTL 2ZSWB 5KW9L 5HYJB 5CILL 4IJ3C 4HIEB 3TJEH 2HT2C 3EYQD 5EIQA 1U8JB 3NFNB 1LK3H 2NLJA 4DKFH 4UV7H 3F58H 4M7LL 5CGMA 4U1JB 1M05A 1NBYB 1GIGH 4YIQA 4JFEB 1T2XA 3QFJD 4KAQL 2GK0A 4RMRA 1RVFL 1UM6L 2B20A 4RGOH 4XC1H 5MP6L 2Y7QB 5D2LE 1WF5A 1XF2B 4MVBD 5I2IB 4NQTA 2HVJB 4WHTA 2BP3A 2YA0A 2HT4C 2BJMH 4NQVA 1FDLH 4X99A 2XXMB 3O3DA 4G9FA 1OM3H 3LHPH 2FB4L 3D3VD 1NBVL 2HLFC 1WFNA 4R97B 2IJ0C 3VDBA 5D1QD 5C0BA 3Q0HA 4JFXB 4HUWA 3VFVA 1A6AB 1YC7A 3QWRA 4M9OA 1OSZB 5CD5C 4WUUA 3ARUA 1L0QA 2B1HH 3GI8L 3ZO0A 2UWEB 1A7QL 2VZSA 3KXFD 3TO4B 3MROA 2HKHL 3KJ4B 5EO1A 3UZVB 3FQTA 1HDMA 5C9JB 2W1NA 2IEPA 1FAIL 1NAMA 4GQ9H 5E8OB 3QNZA 4WO4B 3GK8H 5DJZB 3VCLA 1CG9B 1HHKB 3EO1A 1MCNA 3QIBC 3RIAF 1O0VA 1CDJA 5EU5B 4I5BA 5CEYA 3WXVL 1WCBB 5ID1A 1DEEA 3CU1A 1XGTA 4LSPH 2PO6A 4Y16B 1IKNA 5FHAH 3MRPB 1OAUL 1AP2B 1WWBX 2OL3L 4WGWB 4HIXL 4M6MH 4P23D 5IFHL 3F65A 3KYAA 3V4UL 5FUZH 1H15B 5DHYB 5D70L 5T1KB 1A9EA 1VGEH 4FXGA 1ZA3A 1KENL 1FNGA 1H3PL 1N2RB 1MCRA 1PW3A 1TXKA 1RULH 4AEIL 2UVEA 5E03A 1S78D 4PRNB 2QSVA 4D9RD 3MUJA 5E99L 3THMH 5I30L 3OGOE 2AAVA 4JHWH 1J0JA 1QYGH 2VZUA 5JHDD 3BFOA 4NPYA 4O51A 2X89D 4Y4HA 4TUJA 2RJMA 5DD3L 5BMFH 1I7TB 4ETYA 1W0YT 1JF6A 5FA3A 3VMNA 1WISA 1OAYL 4MCZA 4HC1H 2QR0B 1EFXB 5F6HI 5MHSE 4EZMA 5I73C 2FEEI 4U05A 1F8TL 4Z0BH 2KQMA 1YDPB 1YJDC 2K1MA 3OR7A 4HKZA 2GSGB 4YHNA 3MGOB 4KROD 5DJ0A 4JJ5B 1U2HA 2XKSA 1CDGA 4G6JH 5LVEA 1IC7L 1CL7I 1ZT4A 1RJYA 3CH1B 3BH9A 2DYPA 5JW3H 3GGWB 3KPRB 1RHHA 2ADFL 3EDEA 4JAMB 3FFCE 3LRSA 3EJYD 4PRPD 4XNXH 4YFEA 4NWTL 2W9LA 4MNHA 1ED3A 4ALAH 3TLRA 3DVNA 1NFDE 4B7LA 1FZOA 2VLKE 5JO5A 2OZ4L 4P4KD 3QEGH 2Y25A 1IRAY 1XF1A 1OAXH 2VN7A 3QQ3B 1X7QB 4PV8B 3MR9B 1ND0B 2EXYC 3GMOB 4A6YL 4GG6E 3MCLL 5DQJB 1SJVA 1HNGA 3CLEH 1RFDL 4XP5H 1YY9C 5C0EB 5JUEL 5JQ6H 2R0WH 4PJFF 1K4DB 1IC1A 3MJ6A 1KCLA 5JIKA 3O2VH 4HF5L 4U7SA 1GZPA 2D9QB 4B5EA 3HG1E 5EUKB 3UYPA 5DD0L 4F7CB 1JHLL 4WEMB 2M2DA 1MH5B 1N3NB 3VXMB 5F9JB 1F90L 5A43C 3WLBA 1NCCL 1F11A 4UQ2B 5DK3A 1GGTA 3VXUD 2J8UA 5JORA 4M7KH 3SKMA 1V3JA 4KTDL 4X4XA 3SOBL 3T1WA 1VERA 3AU1B 4K94C 1LP9A 5E2VL 4H20L 3SBWC 3RL2A 1KCVH 5CSZB 2XWJB 4JM2A 2P1YA 1JWSA 5J06A 3HB3C 2CUIA 2ZKHL 1OCWH 2X9YA 3TH2T 3OAUL 5MI0C 1T83A 4NKOA 1OGTA 2AK4E 1TTFA 2ZCKL 1A4KB 4GXUM 2CKBB 4UT6H 1EMTH 3X12B 1GSMA 4NM8H 3P30H 3ULVD 3NABH 3QRGL 4NQEE 4OZIE 4P5MB 1AQKH 5EC2A 4ESKA 3KAAA 2VAAB 4Q9CA 5CUSH 1FH5H 1REIA 5HHQB 2CLRA 4NO5B 3BRFA 2UYLB 1FQ9C 1TENA 4YEEA 1A7OL 3SCMC 4MSWB 4LAJH 3LH2H 2XT1B 1DUZB 4MQSB 1X5GA 3D5OF 4PLNC 1BZ9B 2RCSL 4HWBL 4I2XB 4MJ6A 1WLHA 3T0EE 3VFPB 3E2HC 3WEXA 2Y07H 4NNXB 5CEXB 3NCJH 2CDEA 4LBEA 4XCNA 3FHQA 4ZNEA 3PHSA 5D1ZA 4N0UA 3LV3A 2APBA 3BP4A 2VISB 3Q1SL 3BEVA 2ZP0T 2XN9B 1T03H 4MS8D 3U7YL 3C9NA 3RX5A 4PY8I 4U2ZA 3S7GA 3NH7H 4KRPD 3IJYB 5EC1B 2Y36L 3M07A 1MQ8A 4EI5C 4NN5C 4HWZB 4UV4H 1M7IA 3PDDA 5JXAH 2WUBL 4FMKA 5EO9B 4NOFA 1HQRA 4PGDA 2YR3A 2H8PB 3IDJB 3IVKA 2HLAA 4K71B 2EDYA 2QADD 5J6GA 3TN0D 1S3KH 4I77H 1CDCA 2PXYA 3DV6A 3HI5L 4PLOB 1DQMH 4X6CE 3HUJA 5JIIA 4J8RA 5A16B 5MENA 4L8SA 3T0EC 1I9JH 2GJ6A 3UC0H 2HRLA 3WL9A 5J1TC 4CADA 3QPQC 5BZDB 1F4WL 2A83A 1VPOL 2IAND 5C0ND 2X4UA 3DSFH 4LRIC 4D0BB 4DVRL 1DVFA 1VADB 3CVIL 1CE6A 4X9GA 3OHXB 2AXHA 3NIFF 1FPTL 1KPRA 4LCWE 4XNZB 5AWNL 1LO2L 1OQXA 3G5ZB 3TFKC 4KZEL 2JJTA 3LEYL 2Q20A 5JHLH 4HJ0D 2A74A 3B9EA 2R1YA 3D1MC 5DRNB 3BYYA 5EU7E 5DRZB 4N0FA 4KHXH 3P3YA 1AGCA 2WM0A 4JKPH 2ZJSL 4Z78A 2DLFL 4UU9A 2FSEA 2H6PB 4P46A 4GMSH 4L1HA 2FH6A 3DO7B 4V1DA 5D93C 5HDLA 5TDPB 4FOMA 5IG7A 1IAIM 5KS9B 1F2XK 5A40E 4WU5A 4J3UA 4XNMA 2FO1A 3UX9B 1HYSC 5E7FA 2E7LA 1XCTB 3F7RA 4PB9H 5FAAA 4RWYH 4Z7WB 3QI9A 1KEGL 1HZHH 3NIDF 3BQUC 1D7FA 4LU5H 2G75A 1QBLL 4J6RH 4D9QD