2DWSA

Cu-containing nitrite reductase at ph 8.4 with bound nitrite
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
publication title pH Dependence of Copper Geometry, Reduction Potential, and Nitrite Affinity in Nitrite Reductase
pubmed doi rcsb
source organism Rhodobacter sphaeroides
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwsA02
3MBWB 2ZOOA 1GSKA 4CSPA 2YAFA 2FT7A 2HX7A 1TEFA 3L45A 2DY2A 3DTUB 3V9EA 3SBRA 5E9NA 1OCRB 1FFTB 1X9RA 2P80A 6PCYA 4A68A 2IWEA 2CCWA 5I6KA 1IBZA 2YAEA 3OMIB 1SFDA 2AZAA 4PCYA 3NYKA 3SBPA 1CUOA 4UF7C 1JVLA 2XWZA 5D4IA 3TBCA 3CZUB 3CDZA 3S3CB 2VW4A 3DIVA 3JTBA 3PAVA 2VM4A 2GC4C 2VN3A 1VLXA 1B3IA 4KO5A 2EINB 4BDVB 2XV3A 3WKPA 2ZWNA 3S8GB 1J9TA 4KO7A 3GYRA 3SQRA 2BWDA 1R1CA 2QT6A 1QNIA 3WNIA 3CG8A 2YAPA 3NJKA 5TK2A 1NDTA 5LDUA 2FT8A 3OD3A 2GI0A 4MFHA 4DP6X 4DP8X 1E5YA 4E9QA 5I5MA 3UAEA 3EHBB 1OCOB 3CVDA 4RH4A 2PPAA 3IEAA 4F2EA 1WS7A 1M56B 5I6NA 1MG3C 1BAWA 3ABLB 1CYWA 2HX9A 4NAJA 1JZEA 4YSDA 1NWPA 4KOBA 2W88A 1NIFA 3T71A 2CUAA 4YSQA 2BZCA 2I7OA 4A2FA 2QPEB 3OM3B 3FU9A 1AS7A 1OE3A 3T6XA 2PP8A 1BYOA 3PLYA 4WTQA 3WNJA 4DP5X 4E9WA 3EF4A 3EH5B 5B7EA 2P80D 2OV0A 2BP8B 4DP7X 3NT0A 4HZ1A 2XV2A 1OF0A 3KW8A 3CVBA 3MX0B 3UACA 7PAZA 1PAZA 2FQEA 4N8UA 1ID2A 4KO6A 3S3DB 1ETJA 1L9TA 3DKHA 5D4JA 1SDDA 4AI7A 3WG7B 3FT0A 4A66A 2HRHA 1AR1B 3H56A 1OV8A 1WS8A 1ZDSA 4E9XA 4G72B 4KNTA 2IH9A 4KOCA 1JXGA 3ERXA 4DPAX 1MDAA 3WIAA 2PP9A 1SJMA 3QJSB 4G7RB 1ET8A 3AY2A 4W9ZA 2FNWA 2TSAA 3UGEA 4E9YA 1ET5A 4P5SA 3PXLA 3NSFA 4GXFA 1ASQA 4DPCX 5PAZA 3NJLA 1JXDA 3FQYA 3OMNB 1WA1X 5I5JA 1QHQA 2DYSB 1TU2A 2IH8A 3CDZB 3G5WA 1WA0X 1SFHA 3NSYA 4HHGA 3T9WA 4E9SA 1PNDA 2CALA 2PCFA 1NZRA 2XU9A 5B1BB 2J5WA 2YAHA 2Q5BA 5B7FA 1ILUA 3X1NA 2GSMB 4DP2X 4DP9X 1MG2C 1SNRA 2B08A 3FYEB 2X87A 2B3IA 3CVCA 3HB3B 5F7AA 3H4FA 3X1BA 1ZV2A 5I26A 1N70A 2IDTA 1OE2A 3ABGA 4AZUA 3NJJA 2CAKA 2VM3A 4F7KA 4AKOA 1X9UA 2OCCB 1KV7A 2AZUA 5B1KA 1KGYE 1GS6X 2TSBA 3EH3B 4G71B 4P5RA 3IN2A 2CBPA 4PAZA 4K9JA 7PCYA 2E86A 4GP4B 1KCWA 1IUZA 4HHWA 2FQFA 4HCFA 1PY0A 4E9VA 1F56A 6PAZA 1KBVA 2GBAA 4NERA 4ENZA 2IDUA 3FSVA 1M9WA 3UABA 2XLLA 4Q89A 2XVBA 2YAQA 1AACA 1ADWA 1V54B 1TKWA 3ZBMA 2ZXWB 3AW5A 1DZ0A 1SF3A 1W6LA 2IWFA 1PCSA 2CJ3A 1A65A 2YAOA 4AX3A 1I53A 2EIKB 1ZIAA 4BXSV 1SDDB 2N0MA 1OOWA 4HIPA 2XYBA 5I6PA 1DYZA 2IDSA 3QQXA 4YSOA 1A8ZA 2BZ7A 2YARA 3KW7A 1NPNA 2UXTA 5B1AB 2FQGA 3AG4B 2UXVA 2GB2A 1AG6A 3BQVA 9PCYA 1JVOA 1AANA 1ZDQA 2QDVA 1V10A 1JZHA 2W8CA 4Q8BA 4EF3A 3GDCA 1AQ8A 3PCYA 3JT2A 1ILSA 1PMYA 3FSAA 1AS8A 4G7SB 5I5IA 3FSWA 1E5ZA 1L9SA 2PPCA 1AZBA 1HAUA 3HEIB 2BP0A 2HLEB 1AIZA 1W8EA 1E67A 2YQBA 2DV6A 4GY4A 3NP3A 1AS6A 4DP4X 3QJRB 3S3BB 2BWIA 4CSZA 4HAKA 3WI9A 1HAWA 1BXVA 2YAMA 1RKRA 4NB7A 3AG1B 1A4AA 2X88A 1KCBA 2H3XC 3IN0A 1PLCA 2PPDA 3T6WA 3D12B 2J55A 2UX6A 4YSEA 1L9RA 3PPSA 3TASA 2WO2B 5AKRA 1J9RA 3AZUA 4AKQA 1HFUA 3NJGA 1E65A 2VW7A 4YVNA 3FU7A 1M57B 1KDIA 5AZUA 2AFNA 1NPJA 4F2FA 2WSDA 1PLAA 1CC3A 1J9QA 1BXUA 4YSCA 4W1TA 2Q9OA 4YSTA 2PPEA 1URIA 1NIBA 3QPKA 1RCYA 1V55B 3SBQA 3FU8A 1AAJA 1KBWA 2HZHA 1NICA 1PZCA 4A2GA 4DPBX 1GR7A 4GYBA 4QKTA 5B3SB 4ZK8A 1RZPA 4A2DA 2XV0A 3NJHA 2QPDB 3C75A 5F7BA 3H4HA 3X1GA 1PZBA 1IC0A 2IDFA 1JZFA 2IWKA 4A2HA 3FYIB 2RACA 3OMAB 2VW6A 1WA2X 2IDQA 3OQRA 2XUWA 1CURA 3NSCA 5AFAA 2BHFA 3QJUB 1JERA 3X2QB 4BWTA 3QJQB 3GXUB 4AKPA 5I28A 2MTAA 1E30A 1L9QA 2FJSA 3AG3B 3T6ZA 1JXFA 2FTAA 2ZONA 5I6LA 2DYRB 1N68A 4JHUA 1T5KA 1EHKB 2EIMB 1AZNA 3ZDWA 1L9OA 1ASOA 2BP0B 2I7SA 1JZGA 1XB3A 1SF5A 4N4YB 1GS8A 1IKOP 2GIMA 3ZIYA 1JZJA 3FS9A 1NTDA 3ZX1A 4A67A 3QJVB 1NINA 3ABMB 2HXAA 3IBOA 3TBBA 3ASOB 1RZQA 1EZLA 1A4BA 1ASPA 2R7EA 3NJNA 4HCGA 1ZPUA 2VMJA 4KNSA 1JOIA 5B7MA 3BVDB 2FT6A 4FAAB 1OE1A 3QJTB 4YVUA 1XB6A 1GS7A 2PLTA 1WAEA 1KDJA 4UAHA 2PP7A 4BWWA 2VSMB 3U25A 4YSAA 1IBYA 3N55A 3TA4D 2BW5A 2EILB 3FQ1A 4BK5C 3NJIA 2HRGA 5B1JC 4GP8B 2H47C 2OJ1A 3FU7B 1AZCA 1TEGA 1BQRA 4E9RA 2BW4A 1OCZB 1AZRA 1CYXA 1SHXA 2YXWA 2XX0A 3N2JA 8PAZA 2JKWA 4GP5B 2J57A 3NSDA 1ZIBA 1BEXA 1MZYA 5EHFA 3NP4A 4BXVA 4G70B 1J5DA 2DWTA 1A4CA 2UX7A 2JXMA 4YSPA 2AVFA 2WO3B 2YXVA 3IE9A 3FPXA 2XXGA 3NJFA 1A3ZA 3PAZA 2JFCA 2XXFA 5PCYA 3UAAA 2J56A 2PCYA 4BDVA 1OCCB 2QDWA 2XX1A 1NIAA 1XB8A 2Y69B 3NJMA 5I6MA 1XMEB 3S8FB 1JZIA 1SHWA 1GYCA 5B1JA 4M3HA 4BWUA 3FPYA 4YSUA 3TU6A 4DP1X 2PPFA 4M4RB 1PNCA 3X1FA 2IAAC 1YLBB 1PZAA 3FQ2A 4HCIA 1PF3A 4FA7B 3X1EA 4X4KA 3ABKB 1KYAA 3V9CA 1PLBA 1UATA 1AOZA 4A2EA 5I6OA 2FWLB 1MZZA 4WKXA 3PAUA 4E9TA 1GW0A 4KO9A 5IY5B 2NRDA 1BQ5A 2UXFA 3ASNB 5ANHA 4KNUA 1L9PA 1GY2A 1W6WA 2I85A 4G7QB 4YL4A 1NWOA 4L0PB 2H5UA 2UXGA 3EH4B 2A3TA 4YSSA 5D4HA 1QLEB 2HX8A 2AANA 2LLNA 2DWSA 3AG2B 3T6VA 4UANA 1NIDA 1AG0A 4HALA 4YSRA 1BXAA 2VSKB 3FSZA 4TXVB 4DP0X 1ET7A 2R7EB 2EIJB 2BP8A 5TK4A 1GY1A 1FWXA 4JKNA 1J5CA 2BO0A 4QLWA 1BQKA 2MRYA 1AZUA 1J9SA 1NIEA 2FQDA 1BYPA 2GC7C 5FC9A 5A7EA 2GHZA 3RYMA 1FA4A 2Y1AA 3WKQA 3UADA 4JHVA
chains in the Genus database with same CATH superfamily
4BUGA 3BP5A 2PW2B 3TV3L 3REVB 4QXWA 2JCCE 1F4YL 4G6KH 4Q0XL 4LLQB 1CVRA 4RVBA 3RWDB 1UACL 3ARFA 4H2CA 4QYOB 1C5CH 3O2DL 3HE6A 3AB0B 5AOIA 3TT3H 6PCYA 3CFMA 3CZSA 3QDHA 1YEFH 4HV8A 1UM4H 1GIGL 1S5HA 3EFOB 4HUVB 2NNAA 3BI9X 5I1GH 4E0RA 4ETYA 3L4WA 4DUVA 4PJAB 2OQJA 4AYID 1X5GA 3M88A 4ODWB 4NQDE 4I4WB 3BZFB 1KG0A 2VW4A 2X2IA 1I75A 3IU4H 2OX5A 4ADIA 4H0IA 5ESVB 4AXWA 1UTDA 1N5AB 2MQ0A 1KBPA 1I8LA 4XCYA 4HLJA 3BP6B 4APQD 3F12B 6FABL 4FRWA 2DEWX 3HBPA 1RFDH 2AVGA 3Q8CA 1NAML 4XXCA 1U3NA 3N91A 1H8NA 2JKLA 2XRAL 1KCVH 4AV0A 2VMFA 3NN8B 2DMGA 4E9QA 2DIAA 3UAEA 3UTTB 15C8L 2XWRA 3LXAA 2XIBA 1BIHA 1VFUA 1I3GL 4WSKA 4Y4KD 5AYQA 1PEWA 4H1LH 3TN0B 1RP9A 2FRGP 3FCGA 4ZMNA 1OZUA 4F8PA 3DX4A 5CINH 5HGDB 1LP9E 2OMUB 5BS0D 1V27A 2DAVA 1GPOL 2PETA 1IC4H 2V2WA 2V6HA 1BVZA 2ZX9A 4U1LB 2MPVA 1MI5A 1S7VA 3LEYL 4NWUL 4F15C 2VZVA 5IJCC 5DJDB 4C58B 3WHE1 5DQJA 4Z7VA 3LCYA 1NLBH 3QXDA 4FL4C 4NM8L 5DZOA 4AQ1A 4XTRC 3TJPA 3VXNA 3B83A 1OF0A 3GTTA 4RZCA 3NJVA 3CU1A 4IIQA 5C08A 4M7LT 3A0OA 4ACPA 2ESVA 2Q87A 4UIMB 4Z3TA 1ETJA 3JV6A 4PLKC 1X5KA 4XI5C 1T20B 3HAEG 5DZAA 3RJDA 5IVXA 1YYML 4MB1A 2X6MA 5JYLA 2EYTB 2W9LA 2ZT9C 4Y5XA 3ZE0E 1K8DA 4P2YA 1FL6A 2R56L 1IM3A 1Q90A 4ZFOB 2JLPA 1HNGA 1SJXA 2CXKA 3QRGH 3Q2NA 1GW6A 2C26A 1B9ZA 4CVXA 1LDSA 4G82A 3P3YA 3V4PH 2YC1B 3JTSB 1ET5A 4X5XA 1J1XL 3NCYS 5F1IA 4UT7L 4DPCX 1E7UA 4NQVA 4DJMA 3DC0A 4RFNB 5MEND 4Z0XB 3DXAA 4CN6A 1CL7H 5E2JA 5JORA 5SV3A 1JP5A 4FTDA 1VADA 4HXBH 1A14H 5B1BB 1L6XA 3H3KA 4WWKA 3MBEB 3QZLA 2AMGA 4JR9H 2BVQB 3CSTA 1MY5A 5ICUA 2IALA 1KFAL 5D1XD 3IU3A 4V11A 3HB3B 1IL1B 1F4XL 3GSUA 3U6XA 5HP5A 3QQ9D 2IPUG 3WIFB 1WUZA 3K8LA 1AI1H 1EDQA 3I9PA 4TNVK 2DQHH 4ZS6D 5J11B 1TQUA 5I5RA 2OCCB 3WY2A 1LGVA 3DX0A 1YO4A 1IRAY 3RZCA 1IEHA 1JWMB 3A6CL 3Q6FB 1OM3L 1MIML 2JKSA 4NQQA 3PP3H 4NUQA 3MLWL 4OJEH 3QQ4B 2CDFA 2AQTA 1JWUB 4BQBA 1I1AC 2R2EB 1L7IH 5T3XL 3RUGE 5L2JB 2CXGA 1E5AA 3MUUA 5CR8A 1RK0B 1X5LA 2P42B 2E9IA 3QC5X 4LHUB 3BP7B 2DJ4A 4HJSA 4Y19B 4D3CH 1GXEA 4G6FD 3HG1A 1UZ8B 2VJ0A 4BHUI 1TVDA 3OZKA 3QEUA 2V5MA 4Z7UA 4JY5H 1AXTL 5GGRY 3ZGIA 1ODAA 2VJ8A 1KC5L 2BRRH 4IRSD 3V4VL 3ZBMA 4HS8L 3ALXA 4P9ML 3NSJA 3L3DB 4HS3A 1G5AA 3OJDA 4WV1B 1A7PL 5GGRB 4KI5C 5B1CA 4I3GA 1QRNB 2EIKB 1XHHA 3ZHNA 4RA3A 4R96A 4PJFF 4HIPA 4JUSA 4KX8A 1PSKL 5E1QA 1B0RB 2GJ6D 2MOVA 1UM6L 1A3QA 3IDGB 1WCBA 3SGDH 3AG4B 4YUEL 3APMA 3LSOB 1DQTA 3KCWA 4N0YL 1NAMB 4ZUWB 5C3TA 3VFWA 5F9DC 4F27A 3KPLA 1UXWA 5B3JF 3NUKA 2PW1B 4EVNB 2YPKB 4H4NA 4MXWL 4O51B 1WV7T 2VXVH 4MDRA 2CUIA 3M7FB 3GRWA 3OR7A 1PMYA 5I5IA 1OAJA 5J06A 3GTVA 1DE4B 1G6RL 1BREA 4RFOH 4J3OD 2IQAB 1QR1A 4OF7A 4WJ5A 1XGPB 4Q56A 3KPRB 4FFWC 2DV6A 4NC1C 1OGAE 3GXDA 5J9PB 3QJRB 4F8TA 2X09A 2DLEA 5JOPE 1G0DA 4PGEA 2R15A 5E8NA 2WIIB 5CP3A 4NKIH 4MX7A 1IT9H 1JZ3A 2RCSL 1FAIL 1VPOH 3QWNA 4EKJA 2VRKA 2X4SB 3ROLA 4NO3A 3MJ8A 3RGHA 4K23H 3VW3H 5E5UB 4NQSA 1JAEA 5H2BB 3X3GL 5SWQB 1T3FA 5KSAA 1AVAA 1ZVHA 3PGCA 4PJCE 4B5EA 1IE5A 1F90H 3EAKA 4KROB 3VXRD 1GZPB 4KI5E 2PABA 3G9AB 3G04A 2X4QB 3GI8H 4MBOA 3O8XC 5CZVH 3QNFA 5G4NA 3QDMD 5IB5B 3VI4E 4Z0BL 5EZIH 3EJTA 4EQ3A 1SXCA 4O58H 3ARGD 1M57B 4OD1L 5AZUA 3MJ9H 1GYUA 3OPUA 3S5YA 4OCWL 3M8OH 5F1NB 1PG7X 5D2LF 3V0WH 1O7DC 1PKQB 5DEGB 1S6NA 2KZ1B 1V5JA 1BZEA 4JQIA 1G7PA 3STLB 3GHPA 4ESKA 4LPUA 4FG2A 1EUUA 1YPZA 3DPBA 4XOAA 3DURA 4Q2ZA 2NT1A 5FB8B 5E2UL 2EIDA 3WSQL 1PZCA 3CFJA 2AK4D 3WY3A 2V3EA 4NC1E 1NGPL 5BUPA 4QMEA 1MNNA 4X4ZA 1WAAF 3WXVL 3CV5A 3I75B 4OD2B 4NPKA 1XF3B 3ARED 5F7BA 3H3BC 4N90D 4IJ3C 2B4CL 3O2VH 4OF3A 4PM1A 4MA7L 4BCZA 2NQCA 4H26B 5L0QC 2WQWA 1KLGB 2DL9A 4HQQL 1ZLSL 2Z4QB 2DDQL 3IT8D 3WGVB 3VAEA 3VXMA 4CVZA 2B9BA 5EBWB 3K1DA 5DZJA 3Q9QA 2E59A 5GSVA 2DWYA 5FW7A 3O9WB 3T6ZA 1B4LA 3P02A 2PMZA 3RVWD 2YUZA 1C5BL 3QQ3A 4KK9C 1I8IA 2WHVA 2OMYA 4YLCA 2C7FA 3PGDA 1RPQA 3EO1A 4YDIL 4WUKL 5D5MB 3W57A 5AW1B 2BSEA 3NCCB 4RLDA 5AW6B 1O7DE 3NZHL 4HSAC 2BFVH 2CK0L 3L1OL 1KPRB 4WI0A 4C4KO 1XH0A 2QFPA 1ZRUA 3HRZC 3GDBA 5I8EA 2R7EA 2AJYH 1UA6L 3EDJA 3V52H 3LXCA 2AJUH 3D2TA 1Z9SB 3HZYA 2J25A 3ZUCA 3CWGA 5IJDC 1A1OA 2HFEA 1KDJA 2PCPB 2H1PL 4WFGE 1JN6B 1IKFH 1U3HC 2ZOKA 1CK0H 2NNXA 3V4VB 4LF3A 4TPRH 4HJ1A 1I7RB 3B2DC 3UAJA 4MD4A 2EILB 2R4RH 3CXDL 3DO4A 3FUMA 2QMJA 2FL5B 2V3DA 3TEXA 2NXZB 3LKQB 1E5BA 4Q6YA 2P8LA 2OJ1A 4HKZB 5H4YA 3C6LD 4OM1L 3VSTA 4AEIL 3DRTA 3UJTH 2RQEA 4JFFD 3PWNA 4ZFQA 3FB5B 1UKTA 1FDLL 1FFNB 2H6PB 2DH2A 4JFEB 1OF2B 3SPCA 1JSYA 3CSYA 1NOFA 2J57A 4UMGA 3VUAA 4OUUB 3MRNB 1BZ9A 3ZDYE 4Z3JA 4U7SA 3NP4A 2PTVA 3TT1H 1MH5A 4G70B 4LZKA 1TEYA 1A6VL 2XWJA 5SX4H 3WIHH 2D03L 4C56A 1MLBB 2IEPA 1DBAH 5LQBL 3FB6B 2Y5EA 5D1XA 3KDMB 4KX9A 5D9SB 4XPFL 2WM0A 4YZFE 1K6QL 5EUOA 3ULSA 3RAJL 4CN1A 1G6RB 2EH8H 1F3RB 3G6DH 3INUH 4GIAA 1FG2A 1C12A 5DJ6B 1T5WB 2Y1VA 2XBTA 2COVD 2FJUB 2J1XA 1LWJA 2ZOTA 3MA7B 3NZ8B 1JZIA 4HFUL 3S8FB 2OMZB 1I1FA 5T1LB 3RDJA 2CO1A 4KVNH 2NXYC 1E27A 1QEWB 1Q4NX 2ZXQA 4FTVD 4AQ8A 5JHDE 5KS9F 4L3EB 1R3LB 5IVZB 1YJDH 3EUUA 3G5YB 4HCRA 4HD9A 2MCAA 5TTRA 1PL3A 2DQFA 4Y2DD 4PRHE 3T77A 3X1EA 1JTTA 4I2XE 2W07A 4ZUVB 1DN0A 4LLVB 2DB8A 4MJ6A 4BBWA 5E4EC 1UENA 4GQ9L 5CHNB 4I89A 4WKXA 5DHEA 4MA1C 2PXYA 4OFIA 3L3JA 2J8UE 4XP6H 4ZTPL 5TQ2L 2IOMA 3FT3A 4UT9L 5A3IC 2WVTA 2H5UA 1FL5B 2KYIA 5M95B 3CFBB 3CPLA 4NFDA 2W0FB 1U8LB 4P2QA 3U4EA 1NIDA 1QWNA 3SBWA 3C5SB 5CEZD 3QYMA 4Q4EA 4TXVB 3ZHFA 1JJUA 4MB3A 3PNWB 2G3XA 5IEKA 1HHHA 5BW7A 4E36A 1DVYA 3AGVA 1OWRM 3F00A 3SGKC 2ODIA 1PGRB 2EUXA 1GY1A 3WFEL 1FWXA 2GJ6A 4HIJB 5AOLA 5IQMA 5E6IC 1R3KB 2AABH 4W4OA 4PGBA 3FTWA 2IWGA 4IBTA 3WKYA 2GTWA 1LEIA 1BPLB 3POCA 5IBTH 2Q86B 5A7EA 1RIVL 5E6UB 1T7YA 2IAMC 2FATH 5DHVH 3VA6A 3S37H 4JB9L 4CSPA 2FT7A 3QP3A 4Z5RB 4LB8A 3PIQA 3T0ED 1DJXA 1MFEH 1RD6A 1RUMH 4ES8A 1XR9A 1MFAH 5IFJA 4BSVA 3BYTA 3CU7A 1KJVA 2YAEA 4K3HA 3U7WL 3D87B 3E9UA 3O6LH 3LHPH 5EORL 5JW3L 3HN3A 4O9HH 5B8CC 4XP9H 4DFHA 4TULH 1YNKL 4OCXL 2GY5A 1KTDA 2WB7A 1BBJB 3CDZA 3H9HA 4HF5H 3K72B 3VSUA 5G4MA 4XPAH 2VXQH 3LXUX 4P59L 2HAZA 2F74B 1HKFA 3BZ4A 3RGVA 3HS0C 3TP4A 3WKPA 5I1JH 4OI9A 1BOGA 1DEDA 3GYRA 1BJ1H 3GJFK 5EB9A 2FLMA 1Y18B 1INQB 2G5BA 3W0WB 2A74B 1MEXH 3QNXB 2WNGA 4P2CG 3SD5A 4ABVA 2ZPKH 2FT8A 1Z3GH 2IH1B 2KKQA 3ARGA 3W2DH 3RVXD 4UQ3B 1ROCA 3IGLA 2JTDA 4XP1L 1ZHBB 1ZLVK 1DQLH 4KKQA 1KCSL 4F93B 1UWFA 1JD9A 1D9KD 4HIQA 5HHME 3TNNA 2H32B 1ADQH 4XVSH 3W9DA 1SXZA 5DRNA 3GLZA 1VZGA 3WOVA 1ED3A 4JQVA 3IDMA 2RMNA 3FTXA 1MHCA 3DROA 2Z93B 2NX5A 1A3RH 1DJHA 2Y7QA 3ZRFC 3SDXE 3KLHC 3OAZK 3MI6A 3JV4A 4IMKA 4Y5VB 5HVFB 4PCTA 1AS7A 2X41A 3GB7B 2PP8A 4OZGF 1BYOA 3RB5A 2DQEL 2YKLH 4ERSH 4F7CB 3T0VA 2OAAA 2XBDA 2P80D 3BLKA 4YDLC 3GUTA 4QRSB 5LGJA 1Q1JL 4KRLB 4HHAA 4CC4A 3DOIA 3JSSA 1M71A 5I8CB 3OB8A 3QDJE 5GSRB 4LSDA 3RWIB 1LM8V 2OKMA 7PAZA 2E46A 4W4NA 5IQLA 4F7MA 4LARL 2WKGA 2XWXA 1ZD6A 3JWDL 3O6FD 4RGMB 2B9AA 1CE1H 1TQSA 4GRLA 4Y1AA 4JLRA 3C8KB 3QG7H 2G3MA 1CZ8L 4NUMA 4P2OB 3IJHB 4Z78A 2OW6A 1R24B 3VTTA 4KQ4H 2ZCHH 2Y07L 1L0QA 1NKOA 3TXAA 4K5NA 1S9KC 3DVGA 5KYWB 3QUHA 1I3RB 5HYSB 4OZHB 3FQTA 4FQPA 1H9DA 4FQIL 5KTEH 1TCRA 5F72S 5KYUB 4JG0H 5EN2A 1FL3A 2OSXA 4F92B 5D8JL 5D7JD 2L7EA 3CIQA 1EK3A 4WHYH 1Q9KA 1MIEH 5CGYC 4G6ML 3FHEA 3K8KA 3HE7A 4JG1L 4NDMA 1EHLL 1OTUD 3GSVB 2ZWSA 5D2LE 2OW7A 2XTJC 2X38A 3OC8A 3WS6A 2CHNA 3IETB 4TUKL 4X4YA 4L4TB 2EYSB 4R9HA 3OKYA 1UOWA 2UWEE 3WNPA 1ZV2A 1F42A 1F11B 3I50H 3L9EA 2GI7A 2GG1A 3QFDA 5FUOH 3HUJF 3B1TA 4FN0A 1BD2B 5DYOA 1GTFA 4PS4H 4NNYB 4K8RL 2DQMA 4F5CA 1DQJB 3HPJB 1AHKA 2EDMA 3DO7A 4NZ8A 3O3EA 3R4DA 3HPLA 3FU0A 3GMLB 5BRZE 2CO4A 2CBPA 3BQUA 2QQLL 5DJCB 2X70A 2R0LL 2L04A 1B4TA 3T2QA 3PGFH 4HHWA 5D96B 1F1AA 3IDNA 3FUNA 1NCAH 4B3EA 1A6TA 2APBA 3K81A 4PREB 3TH2T 4PJ8D 3ZYJA 5GRUH 3UIZA 4M6ML 1ZEAH 2EKSA 3OAYH 3VFOA 1IGIH 2P5WD 4XPBL 3OZ9L 1WWCA 3F5WB 2BSTB 4M1DL 4EKXA 1INEL 1B6UA 2P5ED 4FTVA 1RIUL 3CQQA 2Y2WA 3BC9A 3HZVA 1EMTL 2BVYA 2E27H 3FOMA 5I1CL 1TMCB 4Y2DA 2EUVA 1E90A 3T2NH 2A9MH 3X13A 3MR9A 3GPSA 2XTJE 1XBRA 4Y16B 3MCKA 3PL6B 1KWGA 1I53A 3FFDB 2VDOL 3SGJC 1SYVB 2YK1L 5CUSH 2ITFA 4A7QA 5JHLL 1CLCA 1E8WA 5J6GA 4H8WC 3P4MB 1WTGT 3QCUH 3N1FC 3UO8B 1QX1A 2AV1A 3O4LE 3ZHKA 5L6YH 1FC1A 3IFOB 4DVRH 3H3PH 1XL4A 1JV5B 1JZHA 4N6RB 3CVHA 2E74C 1IGJB 3CK0H 4ZAKB 3ASWA 5DZPA 1T1WB 4I9WD 1HX0A 3L3OA 4FQJH 2VQ4A 5EFIB 1VB9A 1OP4A 4WF7A 1HINL 3LV3B 3PHOB 5HDWA 4Z3IA 3U79A 3WEXA 5JDSA 4PRDB 5F8QC 1ACYL 3PV6A 4CSZA 1AHWB 2VDQB 4PJHF 4YDVB 2EC9U 4ORGB 1RZFL 3BAXA 1VENA 1VFOA 2NW2B 2A9NL 4DVBA 4B27A 3S3SA 5SWZB 3RIAK 4CW1B 1RH8A 4HJIA 2ZJSL 5EU6D 1OY3B 4DTGH 2B1AH 4XPHL 5E5MA 2ZUQB 2NY7H 2VLRE 4KK6C 1AO7D 3A4DA 3FO9A 2YPVA 1UZ6F 3THMH 2UX6A 2V3FA 3OPZL 3LKPA 2A1WL 3I2CH 3LZOA 2JKRM 3HNTH 1X5IA 1X6LA 2WO2B 4WGKA 2ZG2A 1YMMD 5JIMA 3ULUC 2QKSA 4ZUUB 1J1OH 2EAEA 2XFXB 5HDQL 1YC7A 3CFDA 3HI1B 5I66A 2WN2A 3N1GC 2Y06H 3UZQB 3VA2C 3WDJA 1I1AD 1NPJA 1QBML 5DMIH 1O6VA 4R0LA 2DQDH 1WLHA 1OGAD 1A4JA 3UTSD 4EIZC 2F61A 1DLHB 4WRLA 4Z7WA 3DHMA 3KWUA 2QSCH 5J1AB 3SBQA 1V3JA 3DSFH 3G5VA 3TIDB 1HI6A 5GGUA 2IG2H 3ZTJH 3F85A 4LESA 3SCMC 2O6PA 5DZVA 1LNUA 3EOYG 4M9OA 3ZZLA 3FB7B 1LO3H 2J2ZB 1N9PA 1PPIA 2VR3A 3FF8A 4A2HA 3NQKA 1UB6A 4GKNA 3WJJA 4HUNB 2X4RB 3EJRA 3S6CA 1A8JH 5E9DA 4ELMF 2JJUA 5IB1B 2ITCB 5AB9A 5B38B 1HIML 3QJUB 5H37G 4M5YH 5A2KH 4ZD3H 4PWJA 5AG8A 1CI5A 2VWEC 5EZPA 1E9PA 3BVWA 3ETBJ 3OKOB 4FQXB 4HYTB 3RTQB 5DRWB 1HHIB 1JF1B 3QO1A 5DSCB 3JZYA 3ULUE 1SYSB 1T5KA 2VLJE 1CN4A 1WZ1H 2OR9H 3UG3A 1R0AL 4F1SA 4BFOA 4NN6C 3IK2A 3FT4A 4PRAA 4M43L 4QLRA 2I7SA 3VFUB 1JZGA 4JFDD 5DD0H 3TCXA 1M7UA 5IF0B 1P69B 3K4DA 4EQ2A 4NKQB 5C7ZA 1U4FA 4PW3A 4WU5A 5JZ7C 4LKXB 5F96L 1KXQA 2BHZA 4N8VA 1FYTB 3AB0C 4FFWD 3ATEA 2HKFH 2EO7A 1F41A 5F3HB 2O4EA 4X9YA 3X14A 4B9JA 3ISWA 2C7UB 5DC2A 3MPCA 1EO5A 5ITFB 4ZNEA 3HC3H 2HH0L 3Q43A 1KV3A 3V5KA 4MB5A 5D72L 1A6ZB 2ENQA 1XTMA 1UG9A 4FAAB 3FN9A 3VWKA 1GOFA 2OXHB 4LCWA 4QRUB 1WBYA 3P3RA 4UM8A 1DDTA 4IRJD 1TJIL 1EAQA 2E7LC 4JNXA 4P5TC 4UUJB 4LVHB 4AJYV 3RFZB 3N55A 4KTDH 2E7DA 4NZJA 3QCVH 2NY2C 3HCVB 1QWUA 3UBXB 3FQWA 3FU7B 2CLZB 5IBUB 3UH8A 5HYSG 5ID1A 3C5ZD 2OSLA 3VWJB 1RSYA 2VDOB 1AZRA 2F1AA 5EEVA 3S98A 4JM2D 4GP5B 1DVFB 1RUQH 2VWEE 4XOBA 3G5ZB 5C0IA 2QKIB 4ONGH 2KPWA 4V1DE 1M1XA 1PW3A 5IMOB 4XPTH 5IMMB 4GT0A 1P7BA 1VFAB 3TN0C 4L1LA 1KB5H 1R19A 3QUZD 4MZ2A 4EDWH 4LO9A 4FHBD 3VXOB 3FRPB 4P06A 3VJ6A 3V4UH 1ETZB 1DQIA 2J56A 2DQJH 5LG6A 3O11B 1KTKE 4Y8DC 1MHPL 4LK4A 4XNYH 5B1JA 5E70A 5SV4A 3APCA 4QF1B 2YD6A 3C6EA 2AQ3A 5FXCH 5IVNA 1QI4A 4HA1A 1RXLA 3QUKA 4OIAA 3GSQA 5FWQA 4QRAA 3X1FA 4LCYB 4EXKA 4S1QL 1TTCA 2XI9A 4WCYL 2FO4B 1MUJA 1NCDL 1UJ3B 5FA4A 4ZMXA 3ZW3A 3RL1B 1BG1A 1A1MB 3ARBA 1AJ7H 3P77B 4YS4A 4PJ8A 1MVUB 1KMGA 3HAEH 4JPWH 5AD0A 1UT2A 2JTYA 2AQSA 2F7OA 5HGBB 4E9TA 4AMXA 2PYEB 1VERA 4CSSA 2C3VB 4M5TA 4JL1A 2OCJA 4AEEA 1SJHB 4YO0B 3MGTA 1SM3H 4OLZH 1WISA 2XZQL 4MTMA 2VL5A 3O4OB 1JMZA 5DK0B 3MOAL 3RI5K 3UTTE 3PABA 3FFCA 1HCZA 1KELL 4L18A 3WNKA 4QI3A 1NLDL 3QUYC 5DQDH 1JGEB 1NBVL 3D2UD 2OJEB 3DARA 4YXKL 3D9AL 1MPAH 3KNBA 3U36A 4Z1PA 4XCNA 4D9LL 5DWUL 2VDLH 1EJFA 4RFNC 4G43B 3V6ZB 2DLFH 1HILB 2JKXA 4H8WH 4YR6B 1RZIA 2GC7C 3RPIA 2O6FA 3CQFA 3P9MA 4ANKA 3X11B 4C8XA 2K6YA 4CGTA 2OMNA 4RGND 4JMXA 2FLBT 4B96A 1DUYA 5D7KD 2HX7A 2XQBL 2ATPB 4WFFD 2HVBA 4U1GB 4FFZH 3HB3C 1ZLUK 1VDGA 3OKMA 4NRXB 3SBRA 3MBXL 5MI0C 1X9RA 3HS9A 5EC2B 5KVGL 4PRIB 2CCWA 1B9KA 4LHQB 3BAIA 3DJTA 3OMIB 4XR8C 3MNZA 1GC1L 3QIBA 1FNSL 3I9GL 5KZCD 4EI5B 1BXXA 3NYKA 4QJ5B 2V2XA 1NL0L 5CLXA 1D5BB 4E5XA 4M61B 1Q72L 1U91B 1S5IH 2CR6A 4GPVA 2CA3A 2YPLE 2BNRE 4FF9A 4YPGB 5EU6A 3MRFA 1OSPL 4MJID 3JWOL 3I6KB 4YGVA 2R69L 3VM5A 2I07A 5ALBL 2E76C 3DMMB 5E95B 2ADIA 2FHBA 3FF7A 3QWOB 4P23B 1MRFH 2H8PB 3I74A 2VH5H 2AV7A 35C8L 4NOFA 3QI9A 2VLKA 5F7EH 4YDJB 3VXUE 4HKXA 4HSQA 1C08A 2GI0A 4PUBH 1BV8A 2WNKA 5D71L 5I5MA 3ULUH 1MJ7H 4ZFZA 5A2CA 3EHBB 3NOIA 3FHQA 5JHBA 3CVDA 3O41B 4QCIA 4WHCA 5EA0L 1RUKH 5FHBL 4WTZA 5KVMC 3Q1EA 1KEMH 4K9EC 5ADOL 3SQBB 2NZ9D 4YX2H 1W8NA 3BUQA 3FTGA 4NAJA 3QUMH 1LD9B 4FLRA 5AOMA 4GBXA 4X5PA 1DEEA 1SOKA 3CNKA 4GQRA 5K9OB 2FBJH 2CSPA 2VXUL 1R5IA 1OE3A 1W0WB 3BJLA 4FULA 3IFNH 5C0DA 1ZS8B 3LQAC 3LKRA 1CFSA 3LN9A 5IHZA 3C09B 2CO6B 3QWRD 3P3SA 1EXHA 4HZ1A 1WEJH 1ZLWK 1BJ8A 4ATWA 1BOYA 4H88H 5ADPH 5C0CE 4NIYE 5ABAA 4AVJA 3AAZB 4HUMB 2I24N 1KJMA 3MRDB 4HLEA 2PTUA 4MQ7B 4ONFH 3IFLH 1CF8H 4N6QA 5E6ID 1FLRL 2DLGA 1CS6A 5D1QB 2A9CA 1DVUA 3VFRB 3GJFA 4Z7OE 1X7SA 2J88H 4ODHL 5B38G 5T5FH 4Y7MA 4AT6A 5AVXB 1B0IA 3BKCL 3MXWH 4XBPA 4HETA 3FQNB 1JV2B 3SPHA 3NRPA 2CDGB 3ERXA 3E9TA 4AQEA 4KUCD 2ENJA 4R3SA 2Z65C 1YEGL 3E6HA 4YLQT 1S9YA 3HG0A 3J7HA 3WN5B 1FGNH 3PDGA 4B0MM 4NKDA 2RQ8A 5AQ0A 3KZ8A 5C0BD 1SOXA 5MEOB 4ZYKA 4JL2A 2HRLA 5CF3A 3NEEA 1LILA 2FYYB 4YBQD 2MMXA 3AGWA 3DV6A 5J56B 2JIXD 3G3LA 3D0AA 1VKXA 1NCWH 1WC7B 2AGJH 3KGTA 5JQHC 4PJGF 2J1ZA 3NCWA 4FADA 4L4VA 4PJDF 2B3IA 4P46A 5DDHB 5HHNB 1T04B 3BVUA 3D3VA 4LHJB 4IS6B 1MHEB 4OLVL 4PEEA 3MLTA 3FH5A 3FSOA 3KPRE 3FB8A 3PFUA 3PWVB 3DJ9A 4JM2A 4XP5H 1E9QA 1KGCE 4XNQB 5AVRB 3HUJB 3EW3B 3UBXG 3GMRB 4JN1H 1BDYA 5IBUG 4RDQF 4KKZA 1E4HA 3ESVF 4UTAH 3W5NA 3IN2A 1P9MC 4H8UA 4UIKL 3NDZE 4Y7OC 3TF7C 2Y6SD 1W80A 1UH3A 4QXGL 3F62A 5TGBA 1FNFA 1RLWA 3U0TB 1G0XA 2J5LC 3KXFB 3JVFC 1U8NB 1R9FA 5C7XH 1DJYA 4A39A 1P6FA 1EFXA 3WCYA 3PP4L 4JFHD 3ZSSA 3O9WC 2N7BA 5ICZB 2YBRA 5GZOD 2DRUA 1SMDA 2KBGA 4OCRH 3RKDD 3FRPG 3W38A 1JNNL 3RWJB 4BZ2L 4JBSA 4X7FC 2OR7A 1TKWA 5J12B 1DZ0A 1Z32X 1IFGA 4GG6B 3TPUA 2AS5M 3GZKA 3QA3A 4E41D 1D5MA 2FX9H 3WEBA 1SXAA 2XG5A 1PKQE 1BM3H 2AQPA 2FSEB 5E08L 5K1JA 4O2FA 3Q7JA 3SDAA 1MRDH 3RX7A 1WFUA 4JCWA 1GZHA 1DYZA 4HC1L 2CRIA 3BAJA 4XOCA 1NPNA 1KXTB 4X6CF 4PJBF 3GSOA 2F5BH 1OAUL 1YNLL 2KHAA 4FXGC 1Q9LA 4FYRA 3P0VL 1KXHA 4HDIB 4J1UB 3S4SA 5IW1A 3OKEB 5CIPA 2ADYA 3QARA 4WK2B 1AZBA 2Q1EA 3BFQG 2I9TA 1B4JL 3A6BL 3EZ8A 1AE6L 2MNWA 3K6IA 3L9RA 5CBAB 1CICC 3L5WB 5FOBB 4K71C 3WL9A 3H9YA 4MCZA 5C2UB 1GOHA 4R5TA 3BYYA 4OIFA 4ZPTB 3BIAX 1YN6A 2L7QA 3GK8H 3NRFA 4F3FB 4ZSOE 1K72A 1NKGA 1SBBA 2HJFA 5DVOA 4NZRH 3MLSL 1YEKH 2HVKA 3TJEL 1A7QL 2G3ZA 4KQ3L 4PJHB 2C9XA 3KL3A 5I17B 4OKDA 5BZWA 5JTWA 4R8WH 2QELA 1JPGA 1YY8A 4OI7A 3QUXD 5FA3A 3VQLA 4YHOL 4HIHA 3J07A 1NJ9A 4DERA 1OQOA 4ZX3A 2WXLA 1INDH 3MRIB 3HA0A 2RAMA 1T2JA 1XV8A 2Q8BH 5T3XE 2ADJA 1DBBH 5CD5C 1RPKA 4NO5B 4LRIA 5DHMC 3UBGA 4LLDA 4F2ME 1J05A 2BS71 3N42B 4KXAA 4NJ9L 3JYBA 4MJIA 1SDYA 3BWSA 4Z7UF 4TMPA 2OMXA 3H85A 3RNKA 2JB6B 1KIPA 1XIWA 1N8ZB 3S2CA 4JANB 1FVCB 4ZPVA 4AY0A 4AL8L 1IX2A 4M8UA 1KBWA 4QHLA 3LEVL 2HZHA 1YA5A 2J1YA 2M2DA 5T1DL 4PJEA 3TV3H 3QT2A 4FXTA 2XA3A 4GYBA 1F4YH 4OFYD 1UACH 1BAFL 4PQXA 3O2DH 5E6ZA 3D0VB 4JFEE 4FFYL 1GIGH 1JRHI 3CZGA 4U1MA 3E38A 4BKLB 3B2UD 3RI5F 3FYIB 4WUUE 2HT3C 2RACA 4QRPB 4CADA 2VOTA 2APFA 1D7CA 2Z9TA 1CURA 1UVQA 1RU9H 4K9EH 2EDWA 1OAZL 3VRIA 5IROD 1DQQA 4MLIA 5LCVL 3UJJL 5DMKB 1UWGL 1NEZG 3QORB 2OXGB 2YD8A 3QZBA 3FDWA 4Y0GA 2D0FA 3T4AB 4GKSA 4ELMB 5LAXB 1X4ZA 3DX9A 4N2IA 3AG3B 4I48A 3GBML 2DYRB 2TRYA 4MD5B 3JYCA 3NEXA 5DZNA 4TSBL 5IKCB 1VZIA 1AGEA 1NAMH 2BP0B 1HKLL 2BCKA 2XN9A 2XRAH 3KG5A 3R06B 1JPEA 2BIMA 1JGUL 4L3EE 2B4CC 5BO1H 4AH2A 1T6VN 3QCTL 2R0KH 4RWYL 15C8H 1AD9A 1NTDA 2R2BB 1I3GH 2JXMB 5F1KC 1HZHL 2VO8A 3IGKA 3OB0H 5ICXB 5I15H 4NNXA 3P54A 4G9FE 5C70A 5BVJA 5K39B 1GOGA 4MDJA 4F58L 3KYNA 4N3UA 1FNAA 4LEXL 1GPOH 3U1SL 3QEHA 4PRBA 3WAKA 5DRXB 4PJXF 4Y9FA 4P2RD 3LEYH 3EGXA 1XDTT 2ZCKH 3FQ1A 5EZJA 4ZUTB 5CM1A 4NM8H 5AYTA 4KV5F 2O5ZL 5C0BA 1L4IA 3H7BA 3JT0A 5D6DC 4LDOB 3RWCB 2QQNL 4N1HB 1KUMA 1NBZB 3BWAB 1RZ7L 1MZYA 1P7QD 2D3JA 1YPZF 3T8XB 3RVUC 4NP9A 1S3KL 4LASH 4D9RD 2NDGA 3CPUA 4MA3B 2QHRL 4M1GH 4XO8A 1A4CA 1NUGA 2AERT 3FBQA 2NMSA 1IFHL 1D5IL 2AVFA 1YNTA 1YYMH 2YXVA 2V9QA 4AE1A 2VAAA 1JGLL 2XXGA 4U3SA 3AWGA 1QI3A 2ZIDA 4XC1H 2R56H 3G6JB 1OCCB 4CU7A 4YDKL 2Y69B 2QGDA 5EEYA 4GLRI 4N2OA 5ENWA 4UOW1 2NTFB 3EGSA 1Y6MR 1J1XH 2N1TE 3K8MA 1HT6A 3MV7B 3OBAA 3Q1SL 4M4RB 4UT7H 5FO7B 4C83A 3N1QC 4APXB 5F0MB 3EJZC 5E4AA 3KLKA 2NCMA 3ECWA 4TKWA 2AXGB 4G8IA 4OD3L 3SDDA 2WVVA 4Y4HC 4HPOL 4K0OA 2YKKA 3QFJB 4XMKH 4AIOA 2FIKA 2EDQA 3GJEB 4JRXA 4RGMC 1KFAH 4NQCD 3EXJA 4ODUB 4V1DD 1MW0A 4LSRL 1F4XH 4AIZB 4WEBH 2BOLA 4KHTL 4P2OC 3SE6A 3GXTA 5A16B 2R29A 1JDAA 5DJXB 1XF4B 1MJ8L 4UANA 2BY2A 4XB3A 3A6CH 1OM3H 3KYKL 1OB0A 2CE6A 3EZJB 3VXPB 2P8MB 1R3JA 5I1KH 3R18A 3Q2WA 3SE8L 4GW5A 5AW3B 3F7RA 5F0PB 5CR1A 2IQ9L 5AW8B 5T3XH 3VG0L 4BUHA 1GCFA 1IIKA 2MRYA 1OHZA 2GTZA 1I9RL 1NGZB 1TETL 3OJ2C 5LGHL 1FF5A 3W39A 4H8PA 5GS1B 1WG3A 3CH1A 4PVMA 1HOEA 2WWKO 2IANE 2IXQB 1YEEH 3IYLW 4HBCL 4LSSL 3SE3C 2QQKL 3KL0A 1TEFA 1K4DB 3L45A 3DTUB 3MRLA 4LPYA 3MRCA 2VT0A 1KC5H 5GRYA 3V4VH 4HS8H 1YVLA 4A68A 1W8OA 4RESB 4ZODA 5HDBF 1PFOA 3P30L 1YQ2A 4P9MH 5IG7B 4CA4A 4MMXA 4P9HL 2ICEB 1P6AB 4JFXB 1ZGLP 1C1EL 2UYLB 3V0DA 2J8HA 2A99A 4QRRB 4CAGA 2MTPA 1UOVA 1DDHA 1JNHB 1N3NB 4Y4FA 4XVUD 1PG7W 3I02A 5DHDA 1PSKH 3ALPA 3FQUB 4UAOB 1RZJL 3W9EA 3S3CB 1RZKL 4ETQA 3DIVA 4HKBB 1JL8A 3OX8A 3TN0D 3ZRCC 4F9LA 3MJ7A 4NQEB 1DCEA 3C60B 5JO5A 3EBGA 4FS0A 3RWGA 3B7TA 5D96C 3I6LE 4OGAD 1O9VA 3PJSA 3SQRA 4MXWH 5CLTA 1KF9B 1ML0A 4F7EB 3CG8A 3UL4A 2VE6A 4HZLB 3TBTA 4G7YL 2QL1A 5AW9B 2V2TB 1G9NL 5TDNA 4DP8X 3A5VA 5GZNC 2DWEB 5A6MA 3ZKSD 3EOAB 2CK2A 5FKPA 4WDIB 2WZPA 1BSIA 4G9DA 4Y16C 1F1GA 3BIBX 4L4TE 2RCSH 3AS0A 5HD8C 4DGYL 4I0PB 5CWSB 5FW6A 2YJLA 2EP6A 3FC8A 3Q8EA 3R1GL 4P4KC 5HHOD 3X3GH 4OFYA 3T2LA 4BGLA 5IB3A 1BD2E 3L95A 1K4CA 2A6IB 4OBRA 5EBMB 4TVSa 1RP8A 4TV3A 2DBJA 4HUUB 2X1PA 1UJTA 4PWHA 4DKDC 5JPMA 5J4MA 4Y2OA 4XMXA 4DUWA 4U6VL 2A83A 2EABA 4X8JA 4Z0BH 3QNZB 4EZMA 4TTDC 1A7BA 2MCMA 4PWKA 2BSRA 3DBXA 5I1AA 4A04A 4OD1H 3V5DA 3CVBA 5DT1H 1JZ7A 1JPST 2ZKYA 4DKFL 3TOPA 1IGYA 4NNPL 2YO3A 2A6DB 1AHWC 4WO4D 2GW5A 4J3OF 4ZXBB 3H6JA 1HXYB 2UVEA 1PZUB 2BNQB 3BP5B 3H56A 5E2UH 3TWCL 3NABL 3B9KB 3MBED 3ARFB 4V2CB 3QIWC 3HE6B 1JXGA 1NGPH 4XN1A 2EIBA 1TNNA 3L2LA 1LMKA 4HV8B 4JO2L 1XH3A 1S5HB 2FJHA 3WIAA 3WXVH 3TZVD 2NNAB 2M1KA 3F3HA 4MNHA 4E0RB 2EIZA 2OYMA 1N0XL 2B4CH 1KTBA 2OQJB 1IC1A 4FGMA 4OIIL 3GBDA 2NNFA 5E1GA 1JXDA 4GSDL 1VACA 1II4E 5I74B 1WA1X 4DK3A 3HJEA 5I5JA 5DVKA 3ZTEA 5AAMA 1KCLA 1EJOL 4HQQH 1ZLSH 2DDQH 2OX5B 1SFHA 3CZNA 3JWDC 4HX1A 4E9SA 4U1SA 4AXWB 2JLLA 4PJFE 2JMRA 2W94A 4XCYB 5BJTA 5I73C 1TVBA 2K9FB 1E8ZA 2Q5BA 4P2RA 2O5XL 3EO0A 3CVCA 4HFWB 4WI6A 1C5BH 5F7AA 5L4JA 2JKJA 3QYNA 3ZKND 4Y19D 2ICWJ 5B3JE 4U6HA 4CVUA 4KFMA 4LDCA 4PJDB 3NCXA 1U2HA 3GRWL 4WUKH 2G0LA 2YD3A 4WWOA 3NZHH 4KJYA 4UNTA 1QFPA 1CLOL 2K0RA 5C6WH 5ISZA 4PAZA 2OTWA 1MJJA 2YOAA 1UA6H 2Z64C 5SWZE 2J73A 4FNLL 5KANG 5I8OL 1IQWH 1QRND 5H37H 2J1WA 1U0QA 2FQFA 2Q0ZX 2H32H 4Y9GA 3TEWA 2V2WB 4NN7B 4F1ZA 1JZ6A 3QIUA 1MI5B 1S7VB 4N26A 5F7YC 3TO4C 3IVKA 2Q10A 1OTSC 2XVLA 3MQIA 4CVWA 5DQJB 2X4PA 4Z7VB 2IDUA 5J1SC 3SDCA 2I5YL 3LD8B 3QXDB 3RTQC 4AQ1B 2PKDA 3WEOA 3MV11 4GQPH 4X4XA 3VXNB 2X05A 3DSNA 4JY6A 4OM1H 4RZCB 4IIQB 2AMUA 5D6CA 1FDLH 4PWEA 1P5UA 1EIBA 2ESVB 2X9YA 3LOWA 1UGKA 5FFOA 5KW9H 1S7XA 1A22B 5GRWA 4YHKH 2Y2YA 5IJVA 1ZIAA 1R34A 3KBHE 1A6VH 1NUDA 5IVXB 1B90A 1E4WL 2HG5A 1THCA 1VIWA 2AITA 2D03H 1BZ7A 3CBRA 4RMSA 1ZLEA 2EADA 4JQIL 4Y5XB 5LQBH 1K8DB 3I6GA 4XPFH 1FL6B 2RALA 1IM3B 1K6QH 3U6RA 4AM0A 4N2FA 4PJIF 2ZYIA 3RAJH 4UQAA 4QHUA 4CVXB 4EF3A 1D7BA 5JMOC 1QUPA 4PJBB 1QBBA 3BZEA 4X5XB 5F1IB 1T0MA 5K5YA 1HAUA 1WAAE 3RFZC 2FGWL 4NQVB 3DX6A 1W8EA 4KROD 4J8QA 2WLLA 3NGBB 3ESPA 5JORB 3K6SA 2Z6FA 4LCCB 2B14A 1VADB 4JVPA 3VWJC 1KEGH 3M07A 1PY9A 2HP4A 3VRJB 1F4AA 1NBYA 4WY7L 4A7GA 1DVFC 2YAMA 3P0GB 1RKRA 2QKIC 2ADGA 2IALB 3LNDA 1T83A 3IU3B 1QFHA 5KEZA 4PB9L 3GSUB 4YHIA 2PPDA 3T6WA 4HWNA 5TQ2H 2YUVA 2J55A 2YQ3A 4GRMA 5HHQA 4UT9H 2BPBA 1T21A 4M6OL 5CILL 3RDTA 3WNNA 2E6QA 3RZCB 5BUGA 3WKNA 1GGBL 5A2JH 5EO0A 1FYTE 2J71A 3TA3C 4TLKA 4DGUA 2CDFB 4GRWF 5HGHA 3NPZB 7TAAA 5KVEL 1H3XA 1RJLA 1UOLA 4S0HA 3AROA 3WFEH 1NGWA 5F7MC 3RTLA 2AXWA 4IBLT 3MXVL 1CC3A 2E56A 3B4NA 2CKBA 3BWZA 2ICES 2JI2A 4JDTL 1S8DA 4URTB 1M42A 3C87A 3HG1B 4X7DC 1RIVH 5L4MA 1ZOXA 4Z7UB 3QEUB 3QC6X 2XJLA 5E8EA 1QSEE 2B2XL 4I0CC 3IMVA 4N0UA 5BOPA 2Y5QA 1XTLA 1ITCA 4JB9H 1OL0A 2B0SL 1FFOA 3ATFA 4BH7A 5IT2L 1GR7A 2YD4A 3RIKA 1S7UA 3NJHA 4HS3B 3OJDB 4OCYL 3X1GA 1J0IA 1PZBA 3O4OC 1HL8A 4G8FA 1S3RA 1NFDA 5E0FA 3OMAB 3QXAA 4LRNH 12E8H 2C4FU 2G4GA 3BSZA 5HI3D 5JW3H 2NY3B 4EOWH 4MCYA 1YNKH 2BHFA 3MKKA 4OCXH 5T3XD 1URZA 1BVNT 3ZQ9A 2O61A 4U6TA 3UDWC 1LQSR 3VFWB 3QJQB 4CL7A 3KPLB 1UXWB 4J8RA 4XNZB 5DJ2A 4UYQA 4Q9RH 2FJSA 3GEFA 3UX9B 4G80A 4QGTA 2VC2H 3OR7B 4BSJA 1DSYA 2QPFA 3BDXA 3ZYZA 2X12A 1T4WA 4U1KA 2OZ4A 1E4KC 1TOXA 4DEPC 3QEQA 4WJ5B 1QR1B 3WYRA 2P43B 4AQZA 5GIRA 3SO3B 1NAKL 3KEHA 3ZIYA 3VTAA 1E0OB 3OF6D 3WFBL 4XP1H 5E8NB 2NXZD 4NUJB 1AQDA 2F54A 4QT5A 3FCBA 4L1BA 5AVZB 1KCSH 5KS9E 2Y22A 4HCRL 3KBFA 4MX7B 3C08L 1EZLA 1XCWA 4JFED 4WO4A 1JRHH 1IAOA 4KXDA 3ROLB 4NO3B 1AGDA 3MJ8B 3K4AA 3O45A 3BH8A 4PSPA 2FWSA 4NQSB 4LLAA 5JW5A 3U7YH 1ZT7A 1HCYA 1M9SA 1T3FB 4OU3A 5KSAB 3PGCB 4WI3A 2E0PA 4DGVL 4FI6A 3MVSA 4P3WA 1IARB 5JQ6L 3TZVA 4N2DA 3G04B 4Z3HA 4U3CA 3MUHL 2FECI 2DI7A 3UC2A 3CVIL 3OG4B 2XJKA 3RB7A 1KB9J 1NCOA 4HJ0D 1Q1JH 2GT9A 3AUVA 1QG3A 2BY1A 2L8AA 1U8HA 3D85D 1RZGA 4J7RA 5CD5D 3KYOA 5L7XL 4XX1E 2WLKA 5JPNA 5J3HC 1G7PB 1EDHA 2AQNA 5I0DA 3ABZA 2DWTA 1BQLL 3JWDH 4EE2A 5HGAB 1D7DA 1YPZB 4GKOA 3DPBB 3DURB 4Q2ZB 5I18L 4J3SA 3CFJB 1JHLL 3FPXA 1CZ8H 4UDUA 2IFGA 3PAZA 4OH2A 1HCFX 1IGTA 4BDVA 5F9WB 2G3NA 2ZAIA 4YXHL 1XB8A 2QLVB 1IC5L 2NYYD 3L4XA 3ZLQC 2YA1A 5DMJB 4FQIH 3SJVA 3K2MC 2ZYRA 3TU6A 3DHPA 2XC8A 3UZVA 5D8JH 1IFRA 4PJ5A 4AC2A 3C09C 5MEPA 1Y0LA 4FA7B 5IQ7L 3OXSA 3HG5A 3VXMB 4MZIA 4QJ4B 4CVZB 4L0YA 3KWTA 1J11A 4QOKA 3HZMB 3LX9A 4A2EA 4N0CD 2IGTA 3D69B 2XWBA 3SQOL 4MMZA 1RY7B 4TUKH 3II2A 3QQ3B 4LL4A 5F70A 1I8IB 2OMYB 1WK0A 4TUJA 5G5DB 1KN2H 3PGDB 3EO1B 3F84A 1OM9A 1Y07A 1WFMA 3LRKA 1T7VA 3V8CA 2DD8L 4WI0B 1KENL 3V0AC 3P2BA 5IB2A 1FFPA 1RMFL 2V0AA 5I8EB 2JJSC 4QTHA 2R7EB 4NYLA 1T7XA 1EHAA 2FNBA 3WN5C 2EXYC 4GLRH 3DOHA 2QQLH 5C97A 3HZYB 1HK6A 2R0LH 4FHJA 1QLFA 1A1OB 3NPSB 2HFEB 4I88A 1HEJC 1CFBA 2G4EA 3S97C 2E4TA 2ZOKB 5TE6L 1Q0XH 4LF3B 2D4DA 4M6MH 3AM8A 4NWTL 2GUOA 3H7LA 1CFNA 3DGDA 4MD4B 4XPBH 2V5YA 1QFWL 1KB9K 4QHPA 43CAB 4BQ8A 1NFIA 2P8LB 4M1DH 1INEH 1A6WL 3V5HA 3DRTB 4HJGA 4OZGE 1RIUH 3PWNB 2H9GA 3DETC 3F58L 4K5PA 3W0WD 2YGQA 3CSYB 4JG9A 5J6HA 1UKQA 1BZ9B 2UZIL 4UM9A 3RVVD 3EDFA 3VI3A 1DANU 1MH5B 5KUKA 1IAII 4XO4A 1TQCB 2XWJB 2PO6C 4GFTB 2VDOH 4IKLA 1G7MA 1OXYA 5JHLH 5IBLD 5D1XB 1A7OL 4KH9A 5EUOB 4KO5A 4LBAA 1YQVL 3VXSE 3ZDXB 1QTSA 1FG2B 2ZWNA 1C12B 1J9TA 1ZK5A 3ZKXB 4AIXA 3FULA 2DLHA 2J72A 1I1FB 4JKPL 1E27B 5CLZA 2DQTH 4U3HA 4I3SL 3OD3A 4X7SH 4XWOC 1HINH 3AACA 4X9FA 3OAYK 3T77B 2DQFB 3V4PA 1E6OL 1F4WL 1DHKA 3JVGC 2WKOA 4HMDA 3DIFA 2W07B 1DN0B 3V0EA 5J13B 1ACYH 3UBFA 1K5NA 4HS6A 1WS7A 4WI9A 5AB2A 2W9EL 4MJ6B 4RAUA 1BAWA 5HJ3A 3WNMA 1RZFH 3LDBC 4RA0C 4U7MA 1JI2A 3ULVL 3HG2A 3KPOA 2PXYB 2EDNA 4AGPA 5F7UA 3L3JB 1ICTA 3VD0A 5LWYH 3SKNA 5ILTL 3FT3B 1JZ2A 1FNGA 4XPHH 2WYHA 2FO8A 3CPLB 2QVKA 3V6FA 2XYCA 3KM1A 3OPZH 4LPXA 2A1WH 4P2QB 2XPZA 3U4EB 5DJAA 2F18A 4ZO6A 2JK5A 5IEKB 3HUJE 4JCLA 1HHHB 3EH5B 3I6LD 1J8HA 3MROA 4MQXC 3NT0A 5AAWA 2BJML 4KY1L 2GJ6B 3KW8A 4MBRA 1BZOA 4MASA 1YECL 3RUGF 2MFNA 4HOXA 4JKLA 4PGBB 4EN3D 2GTWB 1QBMH 4M5ZL 4AZ8B 4K7PY 5E1AA 1V7ML 5D7IA 2NZ1A 3VG9C 1FP5A 2NY6C 1KGUA 3BAYA 3GO1L 5JXEC 4LU5L 5KVGE 2HFTA 3PIQB 4NZDA 1F6LL 1ZS2A 3VFTA 4L4TD 5IFJB 1MREH 2VXTL 4TUOA 1IEBA 3FO0L 5AVTB 3HHSA 1KJVB 2PP9A 4WFHD 4K7PX 3OF6A 3VFGL 1G7IA 1N5YL 1UWXH 3B37A 3ATDA 2NDFA 1A2YA 1BD2D 3IAQA 1U8IB 1ASQA 1SLUA 5F7HA 3SPIA 3U1QA 5L2KD 5CKAA 1KTDB 3CDZB 3H9HB 3QNYA 2EH7H 2O93L 4UWQB 3BZ4B 3RGVB 3IJEA 1BOGB 1GYAA 2ZG1A 2G5BB 2HFGH 2X89D 5KAQG 4ZOAA 5LXGL 2NY4B 1MG2C 3FYEB 3X1BA 1NPUA 3N06B 4Q14A 3EFFA 2JKIS 3NMEA 3QDMB 4NQDA 3MLVL 1H15A 3CVHL 3ARGB 2VM3A 3MA9L 3D1MC 5CEZL 2WQ8A 3TCLA 2WC7A 4GO9A 3D85A 2FYVA 1KV7A 3P73A 1QPXA 3O6KL 4LLMA 1DQDL 4M8RA 1F4HA 5DRNB 3W9DB 1ZA3A 2NR6C 5AZ2L 1FVEA 1ED3B 4A7SA 5ABZA 3IDMB 4NRZB 1R3IL 2G0KA 2HH0H 5DMGD 1MHCB 1URLA 4PJHE 4BV1A 5D72H 2NX5B 2G5RA 2Y7QB 3PL6D 2YUWA 1LTXA 3JV4B 2YUXA 3DNKA 2E3VA 1LXMA 4LNRA 1MW3A 4X98A 3QORC 1KBVA 1GGIL 2YFOA 3NACL 1D7FA 3NK3A 2KPNA 4XODA 1M9WA 4N85A 4HMEA 3HG3A 4NC2B 5DQ9A 3QS2A 2YPVL 3Q2VA 5LGJB 4X80L 4HHAB 4NBZB 1LP9A 1M71B 1WGVA 1SF3A 4Z8FL 3CFEA 4ZAKD 2XQYK 1EGJA 4KRNA 4YH6A 5D7LD 4FMKA 4GO6B 2DI9A 2BC4A 4BK8A 4GNKB 2OJZH 4F8OA 1PIFA 1WT5C 2F5AH 2ZWKA 3MJ9A 4BXSV 4XN9A 3H9SE 4GRLB 2X7LA 1A6AA 4IRZH 3LZPA 4Y1AB 4JLRB 2E4FA 2VLMD 4WWPA 1YEJL 2ORBL 5B22A 3QQXA 4D9QE 5I76B 3ET9F 3H2PA 1BBDL 3IDIA 4Z78B 5C0RL 2UXVA 4GMSL 3DVGB 4A37A 2O26U 3FQTB 3NZUA 4JK0D 5IJKC 1QAWA 3GDCA 1MHPH 1TCRB 3DRQA 1U8CA 3PCYA 4OB5L 1FL3B 5EN2B 2AK1L 5C0AA 3NBNA 4TOYL 4ZMPA 1CFTA 2WXOA 1LE9A 1Q9KB 3ILPA 3SPJA 4S1QH 1RK7A 1OPGL 3HE7B 4NDMB 4OLYH 5EIQA 4TRPL 4WCYH 2OI9B 3NIFB 4N3TA 1NCDH 3GEWB 4HAKA 1S9XA 1XEUA 4QXTA 4ELME 4X4YB 2VGLM 3FUFA 1KSRA 4IBSA 3SE9H 4I1PA 3Q3GA 5CJ5A 2VZ1A 1XSOA 1OQXA 1ID5I 1G9ML 4EN2A 5ESQA 5DYOB 2XZQH 4U2ZA 1QATA 4U0RB 5DLLA 1EHNA 2UZXA 3PPSA 1M6OA 2VN7A 3MOAH 3DO7B 1J5OL 4OFQA 3O3EB 4NP4L 2KMWA 1OAKL 2MSPA 4KTGA 3HPLB 2R1WB 1QLEL 4AG4H 3II3A 3S36L 2X70B 4YXKH 5JLZA 5FCUL 3KJ6H 5DWUH 5C9JA 3IDNB 2APTA 3OG6B 1A6TB 3SYOA 3UG4A 3RY4A 3TVMA 2V8LA 5EOTA 3GHEL 3VFOB 1NGXA 3FU8A 1EZSA 1QBLH 4QRTA 3DVIA 4FTVB 2XQBH 4FQXD 1BFVL 4EI5C 3NJXA 4DO5A 3GM8A 3HZVB 4JFZL 3RTQD 3AS1A 3FOMB 4IYKA 3DX7A 3BGMA 4K8RD 4Y2DB 5KVGH 4RIRB 3H4HA 4OT1L 4GAAA 1NGYA 1J18A 3MCKB 1FNSH 5IW6A 4KJWC 3S7GA 1I8KB 5IIEA 3DK0A 3GZQA 2CM6A 1NL0H 1EQWA 2I9LB 1CG9A 2QLYA 2ICWA 4NLHA 1QSVA 3V6OC 3DBSA 4NI6A 4Z9KB 2AV1B 1OSPH 4QTIL 2R69H 3UGXA 2XOTA 4JPKL 5ALBH 3RURA 3BXNA 3V7MA 5C07E 4HAGA 3CVHB 1XGUA 1BFSA 1E4XL 5HGGS 35C8H 5GS1C 3L3OB 2O6EA 5DVLA 1W72A 4XXDA 4KJPC 3LH8A 3IMUA 3LN5A 4LOVA 4N4YB 4K73A 3WEXB 5D71H 2WBJC 5C0EA 5JDSB 3PV6B 4KKCC 3FS9A 1CYGA 1N4XH 5EA0H 4MB4A 5E6RB 5GJTL 2EDDA 3MFFA 4NKOA 5AB0A 2IPUK 3VWJD 5ADOH 3B7SA 5EOQL 2ICEC 4GW4A 5FIEA 4DVBB 1OSEA 3QFJE 5GS2D 1MFBL 5E5MB 4F91B 3FO9B 4A6YA 4YHNA 5K9JH 4NZUL 2PP7A 2ZCLL 5IUCA 4HEPA 3C60C 2VXUH 4TSCL 4JY4A 4W9KC 5DEJA 4HVBA 4NO2B 2LLLA 3VD3A 3IFPA 2A9DA 3CFDB 4XVOA 5GRVK 5SX5H 5I66B 4L9LC 3VQ1C 1ZANL 4E9RA 5L2KA 3V6OE 3N2JA 4AUJA 3Q06A 4PJCA 4OZIF 1BF5A 1GAFL 1JHKH 1G94A 4R0LB 1F02I 32C2B 1A4JB 5F9OH 1R4XA 1FLRH 4PJEF 5CCKL 3D52A 4G8GA 4GS7B 3G5VB 3VI4A 1HI6B 4ODHH 5GGUB 3D06A 4CGUB 1LNUB 2AJSH 4MAYC 3QPXL 3T3MF 6CGTA 4OVVA 3SHSA 3S34L 3T3PB 1ODUA 4R90L 4PGCA 2PYED 1IB5A 1MVYA 1J10A 3FTZA 4DIXA 4Z3FA 1UB6B 4GKNB 2PPFA 3HMWL 2X5PA 5F88A 1PNCA 2EXWC 4QY8A 2OTPA 5E9DB 4L4JA 4QRRE 1KTJA 1ZV5A 2YSTA 1FORL 5E4OA 3SODB 3TO2A 4CSTA 1E9PB 4OGXL 1LLAA 4FNSA 4GUOA 1CXKA 4EDXA 3MRBA 5ACZA 3MTXA 3QO1B 1T1XA 2XVGA 4KO9A 2VXQA 1GJUA 4LT7A 2XNAA 4HJJH 4KNUA 4ZXBC 4PRAB 3FT4B 4P4RA 5JIHA 4X83A 4BA8A 4PP2A 4XCFH 3QJHA 3X3FH 1G7JA 2UXGA 4OLVH 4WU5B 1QLEB 3B9KC 5EU4B 3ARFC 4N8VB 5D7LA 2ZD0A 4P3DA 3T6VA 3MNVA 2J6WA 1DBKL 4WW2F 4FQ1H 3GXFA 4EI0A 5KYXA 3O8XA 3X14B 5ECGA 3S36X 4PRID 2EDFA 1WUNT 2EIJB 3DJZA 3V5KB 4YMPA 3PWUB 3VCLA 4UIKH 3LKNA 3VWKB 4JO8A 5I74C 4LCWB 1ADQA 1WBYB 2C3WA 4UM8B 4KUCF 2WLNA 4ZQKA 3VNZA 4KZDH 4QXGH 2ZSVA 2XACC 3C12A 1ZSDA 3QZNA 1T2QH 3RYMA 2IMMA 2JCWA 2NUTA 1PIGA 2ZXAA 5GISL 2AXHA 3MRPA 1GSKA 1EHXA 1BGXL 4AMKH 3FQWB 3N41F 3L2NA 3DMMD 8CGTA 1JNNH 5ID1B 1AC6A 4P23D 2OSLB 3CC1A 4HAFA 5E9NA 1KJ3L 5GJSH 4POZC 4KY2A 2EO9A 5FM4A 4NZTL 5C0IB 2YD2A 4TL4A 3MRRA 3KPSD 4PCYA 1FIEA 4UT6A 1M1XB 3EJYD 5B39A 5E08H 4KXCA 5J3HD 3EHBD 2ZP8A 3FJTA 3L3KA 4ONOA 2E6JA 4HC1H 4HLZH 3KLAA 5GRZA 3VJ6B 3ZKQD 1QSFE 5IHUL 3A23A 4XRCA 1BMGA 4HPYL 5DO8A 5JOFB 1OAUH 4NN7C 3P0VH 1X5FA 1OGSA 3BW9A 4FFVD 4MQSB 3QUKB 3GSQB 4OM0L 3LNFA 3R7RA 1G7QB 5LDUA 4PY7A 5HI5C 5ID0A 1MUJB 3FQXA 1H8OA 4J4PC 5FA4B 1HWWA 4DN4L 4IIQC 3ARBB 1Q9WA 4TVPD 4PJ8B 2Y1YA 3RNQA 5E8DL 3GS7A 5AD0B 3O0RH 1RZKC 2UY7A 3MLSH 4FFTA 4OLEA 3TJEH 3WO3B 4KVCL 1JZEA 4JREB 2UWEF 3TBYA 5LHDA 3MNWA 4EIUA 1UC6A 1P7KA 1U8JB 5D1QD 2DTML 3QPQC 4PRHA 3CDFA 4I2XA 4J3VA 1CD1A 2N7SA 4YHOH 4PJGE 2VL5B 5D2NA 2I7OA 4ZW7A 4YSQA 2ATAA 4PJDE 3HVDA 1U3HA 1EXUA 1NBQA 3PLYA 2Z91A 3PABB 4N9OB 3FFCB 5IWLA 1OARL 3K4ZA 3WXWL 4MKMA 3SDYL 4WZ9A 5BQ7A 3FT2A 3U36B 2J8UA 3QG6A 3PF2A 4XCNB 3PQYD 4WHTA 3EJSA 2BVPA 3R0NA 3N1MC 1VESA 4N8UA 1HSAA 3F64A 3NGBC 4NJ9H 4IBVA 3S3DB 1RZIB 3RPIB 4LCCC 3P9MB 1U8MA 3L4ZA 3OQ3B 3U2IA 5LBSH 5FR3A 3CJJA 1MI5E 4FMVA 3VYOA 1DO6A 1OW0A 1U36A 3BVVA 3NK4A 1DUYB 4FEIA 4QO1A 4DO6A 1AR1B 3LEVH 4U0QB 1HQRA 1JFHA 4IBZA 5T1DH 3GMOA 3EYFA 3OKMB 1EH9A 1XZWA 4PY8I 5SWSE 4FI8A 4QNPE 4PI0A 1BAFH 1PX4A 1KYUA 4X7CC 3MNZB 4JHWL 4ZQTA 2B1HH 3UGEA 4FFYH 2DLIA 4DN3L 3RZCC 4ELKA 2V2XB 1VFMA 3AC0A 1OAYL 4ZDHA 1WZAA 1IC7L 5IQNA 4E5XB 1DBJH 3J27A 2RH0A 3FQYA 5KYNA 1L0PA 4O4YL 1DQVA 3HBZA 5BZZA 5EU6B 1OAZH 3MRFB 1WA0X 4HHGA 5LCVH 4YGVB 2PCFA 3UJJH 1UWGH 1UWYA 1JGVL 4KRPD 2GJZA 5FGSA 3IDYB 2XTSA 2ADIB 4J39A 1CGXA 1FCGA 2AV7B 2X4NA 4LP5A 4PJBE 3QI9B 1A5FL 2VLKB 3MCG1 2YLHA 2FX8L 4TSBH 2Y1ZA 3KXFD 4NUPA 4HKXB 1C08B 1PD6A 4IOFD 1JGUH 1ORSA 4QCIB 3ZMRA 3QCTH 4ISVA 5F7KC 1LK3L 1VFBA 1KGYE 2TRHA 1GS6X 4HIIA 2ARJQ 4L3CA 4AYBA 2W65A 5C0FA 3FTGB 5JIDA 4Z3GA 1FZKA 3SGKA 3AT8A 2E86A 1M7DA 1UH2A 4XH2A 3C9NA 3MLZL 1KCWA 3FOLA 4GBXB 1DEEB 4GIOA 1U8KA 2BWQA 4F58H 3LEXA 1JXJA 4LEXH 3U1SH 1ZAGA 4C54A 1MQKL 1R5IB 4U05A 2GBAA 1V7NL 5C0DB 4XNZC 3O3BA 1G43A 4TQHA 5DC0A 3FSVA 2RD0A 1CFSB 1FNEA 4ODTL 1XR8B 1WBXA 5IHZB 3QW9A 3MUY1 4Q89A 5CSBA 3VFNA 4B60A 4NHCL 3SDXA 3SY0A 3PHAA 1W91A 3FNKA 1LO2L 3FTYA 3F05A 4W9GC 1KJMB 5FYLE 3SO3C 2YGPA 1RZ7H 4KKBD 1IBGH 4R4BB 1E28A 3GJFB 4BJLA 4N8CL 5A40E 5B8CA 2QHRH 4NUGH 4AT6B 3IMRA 1IFHH 1D5IH 4Z7UE 1J0YA 1EEZA 1G4RA 2CD0A 4XBPB 3QDJA 4PHXA 1JGLH 3AU1A 2ETWA 1RJZA 4P8QA 1PZ2A 4S0TD 1JZDC 9PCYA 1RL1A 4AQEB 1E3ZA 4B9PA 4KTEL 2OR8A 3OB0K 2W8CA 4R3SB 1QNZL 4YDKH 5KSAC 1K9TA 3APFA 3E6HB 5EOCH 1AQHA 4JRYE 1AQ8A 1S9YB 5F8RC 2R8SL 1M05A 4NKDB 5T1JA 5ITBL 1HH6A 2D3VA 2J1KA 4ZYKB 3UROR 1NCNA 4OQTA 4N8VG 2YQBA 2GQHA 3DV6B 4DP4X 1I9JL 3S3BB 5I2IA 3VD2A 3L9YA 1UD3A 5DJ8A 1VAHA 1WZMA 3BZDA 1VKXB 4OD3H 2IADA 1QFWI 2D0GA 3GSRA 1ERNA 3AG1B 4GXUN 1I4FA 3CCHB 4L4VB 4P46B 5EIVA 4H2AA 4ZMTA 3D3VB 5CZRA 5MHSD 4LSRH 2XQYA 3MLTB 1PZSA 3TONA 3FBKA 1WDAA 1DQMH 2GBUA 3FB8B 3D39E 3UYPA 4AEFA 1XD1A 2LVEA 2HKAA 3L7FA 4JM2B 1E9QB 1TMQA 3D4CA 3AT0A 5AZEL 1OALA 5F9WC 3SEPA 4L1HA 2BIPA 3KYKH 4M8QA 5I0XA 1EERB 1NCIA 1TPXB 5IFAL 3Q6GL 4Y4KC 1CDHA 4BELD 2OYPA 1OIOA 3SE8H 3F65A 2JQAA 4S10A 2IQ9H 5TGBB 4QRPD 3O2WL 3CSBA 2TAAA 1M2VB 1FZMA 2OA9A 1BXUA 3DLQR 4YSCA 5C0JA 1ORQA 5LGHH 5DUPL 1IVTA 2WBWB 1EFXB 3IJ9A 4N5ED 1QA9A 2YBRB 1U8PA 4X0KA 5BRZA 4PV8A 5CBEA 4HBCH 8FABA 1VGKA 2Y7LA 3ML8A 4KNQA 4XVTL 2X3CA 3CHPA 3NIDF 2P4AB 4EZKA 1TKWB 3IMBA 4BGDA 5JHMA 1TZAA 3TPUB 2F1BA 3QA3B 2LU7A 3IPFA 1CD0A 2H0PA 1MFUA 4NAQA 1D5MB 5EZOL 1JF6A 2IBZY 4KV5E 3P30H 4AGMA 2X1QA 2IWKA 2XG5B 4MA8L 1FO0A 3VFPA 1LE5A 1C1EH 4O2FB 2PUQT 2IDQA 4RMRA 3SDAB 1YPZE 1YEIL 4FJ6A 5GS0D 3S3PA 3B8SA 1RZKH 3CUPA 5GGVL 4HD5A 3GSOB 5EEUA 3PYCA 2F08A 1DVZA 3HG4A 3DUSA 2IBZX 2WBXA 5I28A 1Q9LB 5DZ9A 3WN6A 2MIZA 1MAMH 2VCOA 2YA0A 5CFAA 5IW1B 1MELA 2D7TL 3S4SB 5CIPB 4QRFA 2XZZA 1EAPA 2JJVA 2I9TB 3MV8A 3L9RB 1DJWA 4A2LA 2PF6A 4PJAF 2BIQA 3WL9B 4G7YH 5K93A 4MCZB 5KJ4A 3V2AR 3B6SA 2GIMA 1IKOP 2L4OA 3PQYA 4C55A 3O4LA 4DWHA 4U1NA 5J7CC 3TH3T 5FGRA 1B2WH 3V79C 1LDPH 5BS0E 3FUHA 3TGXA 4OFPA 5FGCE 2HJFB 3QJVB 5GGTA 3NA4A 3TBBA 3BX7C 4LQFL 3HRPA 4P49A 2HVKB 3AXLB 3H6AA 3MMEA 5T1MA 1NSNL 4Z7QF 3VGEA 3BVDB 4RGNB 5BZWB 4XMLL 2C9QA 1JPGB 1YY8B 5FA3B 4I8DA 5D1XC 4HIHB 4N0FA 5DJ0A 4ZRGA 2GIYA 1NJ9B 1JFQH 3CD4A 3QQ9C 5LNGA 4UV7H 1CWVA 4IJTA 4YHPA 4JG5A 4ZS6C 5KZCB 3ZKXC 5D93B 3MBWA 1ECZA 3QYCA 4RDBA 2R29L 4ZW5A 2R1YB 5TF1L 1L6ZA 3I6SA 4LLDB 8PAZA 1J05B 2VLRA 1IAMA 3MREA 2F8OA 3MV7D 4MJIB 4D0CA 1NEUA 4ZOCA 4DKFH 2OMXB 2ZNWA 4E5XG 3RNKB 1UOKA 5J13C 1EA9C 1KIPB 1J5DA 1XIWB 4NNPH 4FYSA 4HIXL 4ZPVB 2UX7A 3L3GA 3LKSA 3P9WB 1IKNA 1Z5YD 4QHLB 2DWDA 3EYOA 1ZHNA 4PJEB 2FR4A 2L7UA 2DJSA 2WO4A 3TWCH 4HWBA 4XBEH 2D2CC 3B5GA 3LNGA 3QFJD 1ZE3C 1NFDF 3S96A 4Z7IA 2XX1A 5MENE 1CL7I 3CFCL 4IRSC 4JO2H 5F1SA 3T3MB 1BVKA 4U1MB 4FFZA 3WIIL 2N3JA 4M3HA 4BE5A 5C8JA 1N0XH 5AVWB 3SBWC 3B9VA 4CADB 2HB0A 1C16A 4XN8A 2Z8VC 4OIIH 5HDBE 2KLTA 1UVQB 1OPOA 2YQ2A 3KR3L 2DJMA 4GSDH 1BF2A 2EUWA 4RX4D 4AW7A 3VRIB 3MYJA 1DQQB 2LLGA 4WGVB 4X50A 5D1XE 4WTZG 1EJOH 4PVNA 4JMNA 1R5VA 4DHLA 3BE1L 1OSZA 3FAWA 4GKSB 1AXSA 1KYAA 3DX9B 2LT9A 3BJ91 4JZNA 3ZDZF 4EUPA 3UJIH 4I48B 3WEMA 4WQOA 5KUMA 3AQYA 2DIBA 1QUNA 3GS4A 3MLYL 5ANHA 3G08A 1AGEB 2O5XH 4AVIA 4OJFL 3MU3A 1JDDA 1WWAX 2BCKB 2XN9B 4YL4A 2CA4A 4NCC2 1YN7A 5KBPA 4AH2B 4FZ8L 2DWSA 3KJ4B 1BXAA 3BPOB 3MN8A 4R7LA 3ZK0A 1CLOH 4X6BA 4Q97A 2CRMA 3LYRA 5A7BA 4NNXB 4R7VA 4JKNA 2OL3A 5BVJB 4BUQA 2GY7B 4MDJB 4FNLH 4ZBJA 2CJSA 1GGUA 3KYNB 4ZG1A 4O00A 4B9GA 4J23A 3QEHB 1MCSA 3L5JA 4IGBD 2JQZA 1NIEA 4PRBB 2DH3A 3H53A 2DM7A 1NM9A 2BZDA 3Q8AA 3QUMA 3UTZA 3EGXB 5DGRA 4PMFA 4P2QE 3ARDD 4J3WA 5AOJA 5EZJB 4NQED 5ALCL 3C60D 2I5YH 3TBWA 1T0PB 4JGJA 4R7NA 3SCMA 5C0BB 3C5JB 3HZKA 5DK3A 3ALWA 5ECJE 3H7BB 1TYRA 2XWEA 2B39A 2GJ6E 2BDNL 3ARGC 3N41B 1BAGA 1FIGL 3UFIA 1NFAA 2WCPA 4TSAH 2YXMA 3L81A 4PBVC 5F21B 4A55A 2HN7A 25C8L 3GSNA 1D5ZA 4XC3L 1L6PA 2LU5A 2XWZA 1JPFA 1YNTB 4B97A 1E4WH 2PR9A 2CR3A 1E40A 1SDAB 2VAAB 4JQIH 1S7SA 3ZT6A 4TQ8A 4JQVC 1XH2A 2GEQA 1AGBA 4U3SB 1VLXA 2NY1B 4B3VA 2R83A 2V9UA 5T5FA 2XY1A 1CVSC 2BM3A 4KO7A 2Y0SA 5LN8A 3B2PA 2A9AA 1DJSA 4IMKC 4I0PD 5GQBA 3K7UA 3MV9D 3RHWF 1F18A 4WW1A 5ENWB 2WCSA 2BWDA 4XNUL 2QT6A 4DW2L 3AREC 3EGSB 2CUMA 4K5OA 5C0ND 4C83B 1K3ZA 4C4UA 4CC4C 4RAVB 2XA8L 4LLQA 4UI2A 2E9WA 2P26A 2H41A 3BUYA 4XHJD 2XY2A 4G8IB 3SDDB 2WVVB 3K6DA 2FIKB 4JRXB 4BA0A 3VXRE 4ADJA 3CMOL 3M6DA 4ENEC 3RVWC 2Q6WA 1D5XA 1U8OA 4FP8H 3QDME 2CUAA 2I69A 4FNQA 3B34A 4UINH 2E7LA 4JO1L 2BNQD 4M6OH 4HU2A 4P5TA 1JGDA 3CFUA 4OCLC 4E9WA 3ARFD 1BMWA 3HE6D 5B7EA 4D2NA 1R3JB 1KN4H 3V8OA 5L4IA 1GMIA 3CBJB 4GW5B 4BYHA 4QUOA 1DL7L 2X40A 4ELDA 4K3EH 1PAZA 3O3AA 4UTAA 2DM4A 1FE8L 2GTZB 4NFBA 2AK4E 3BPCB 4XBGA 3UTTA 3W39B 1FFRA 1VA9A 1PY4A 1WYJA 4JDTH 2VDNL 1N64L 3CH1B 1U92A 2IDCA 4PW9A 1MFCL 2CJUL 3WS6C 3BDBA 4N90E 2Q3XA 5HYJD 2A73B 3MRLB 1B0GA 2MQCA 4WSGA 3HLAA 2B0SH 1NDGA 3MRCB 1H6EA 5I1IL 4GAFB 4MHHG 1SVBA 5IT2H 1KY7A 3S4SG 3C6LC 3ETSA 4N5UA 4XE0A 4MMXB 4OCYH 2FNWA 4W9ZA 2D7QA 3T08A 3OL2A 4U0RC 3RJQB 4JPQA 2DMBA 1FV1A 5F3FA 2WQAA 1DDHB 2EDTA 1RUPL 4Y4FB 5D7SH 3W9EB 3I02B 4B53A 4HG4J 1H3VA 3KM2A 4Y1AE 2XKNA 5AW7B 4BZ1A 4ETQB 4W70A 3OX8B 4KC3B 3MJ7B 2M26A 2P45B 4LBEA 5JO5B 2XU9A 3RWGB 2D7OA 2ODHA 1UYWL 2EDHA 3GIVA 1SBSL 5IQ9A 3PJSB 1H8LA 2PCXA 4JUTA 2HTLD 2DWXA 3HLKA 1Q0YL 1Y1UA 2WKOF 2VE6B 3D0LA 5I26A 3TBTB 2YPLA 1OE2A 1UQSA 2BNRA 3Q8BA 2EYTA 5TDNB 3NJJA 2CAKA 1E2ZA 3HNSL 2WTPA 1HOCA 4PJ9A 2FEEL 3D25A 3WFBH 3B7YA 2AZUA 2OM5A 4Y2DC 5HI5D 3O6ML 5HVHB 4G9DB 5I75C 2EE9A 5C08D 2TSBA 4HCRH 3MGOA 3QUYA 2YC1A 4G71B 4MNGA 3LRSA 4P5RA 2BNUA 4K9JA 3RX5A 3VXUA 2ESVD 4CJ1A 2H6UA 5IHLB 4HUXA 3FO1A 4MJ5A 5IB3B 4QDGA 3L95B 2EEDA 1K4CB 1U6AH 5D5MF 1NA8A 1MWAA 1ES0A 4KMLB 4NERA 4DGVH 4AGLA 5JQ6H 4OQ1A 1ZE3H 5JPMB 3EYQD 2A4CA 2APSA 3L5IA 4Y2OB 2OMTA 2X2UA 2EC8A 3CVIH 2A83B 3F7KA 4X8JB 4XMPL 1HZKA 3L1EA 4GAGL 2BSRB 3DBXB 3T0WA 4NS0A 3V5DB 4RX4A 1W6LA 5L7XH 5D7IF 1AGFA 4GRWE 4GEJA 1IGYB 2YAOA 1ZPLA 1EO8L 5K59F 1TJGL 5C0GA 3DXAD 3QDGD 4I1RA 1M7IA 2QVTA 1BQLH 5EZLA 5EF1A 4BKSC 3KGSA 1ZJAA 4YSOA 2CKBL 5I18H 3U46A 3DUUA 4WWKD 4MS8D 3QB7C 5C0CA 4FTVE 4AVHA 1MJUL 5J1TC 3PV7A 2FJHB 1XH3B 4PBXA 3T0EC 1RK0A 2QDVA 4KZCA 5KJ7E 4MNHB 1CDUA 3NFSL 4YXHH