2DWSA

Cu-containing nitrite reductase at ph 8.4 with bound nitrite
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title pH Dependence of Copper Geometry, Reduction Potential, and Nitrite Affinity in Nitrite Reductase
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwsA02
2AZAA 1TU2A 4DP0X 3TASA 1A4CA 2QPEB 2H5UA 3KW8A 1NIBA 3PAUA 1A4AA 2QPDB 4FA7B 4AKPA 3CVDA 4Q89A 2TSBA 3WI9A 3T9WA 1J9TA 1GR7A 2R7EA 2GHZA 2QT6A 2GSMB 1OE1A 3OMIB 2PP7A 2I7OA 2EIJB 1JZEA 2OCCB 4KOBA 1NWOA 1OCRB 2YAFA 3S3DB 4DP6X 4QLWA 3NJGA 1DYZA 3KW7A 3UABA 1AZRA 4G7SB 4YVNA 1AR1B 1SFDA 1CC3A 3FU7A 2RACA 3NSFA 1NICA 1XMEB 1NIDA 5F7AA 1BXUA 1ZV2A 2A3TA 3QPKA 1PLBA 1SJMA 2BZCA 1WS7A 1AZCA 2FQEA 2YXVA 3S3CB 5B1KA 1XB3A 2DWSA 1JXFA 4YSAA 2BW5A 2H3XC 3ABLB 4QKTA 2MRYA 2JKWA 4YSEA 1KBVA 4UF7C 2BWDA 4X4KA 1IUZA 1ILSA 3NJFA 5AKRA 1PZCA 5TK2A 1YLBB 1ILUA 3H4HA 2YXWA 3BVDB 3PCYA 2CBPA 4JHVA 1N70A 2XV2A 2IWEA 1W6LA 3OD3A 2UXGA 1PAZA 1FWXA 1BQ5A 1WA0X 3CVCA 3OM3B 2BP0A 4FAAB 5E9NA 3PAVA 4YSSA 2N0MA 1NIFA 1IKOP 5PAZA 4E9SA 5B1JA 4HALA 1KDIA 1JOIA 3HB3B 2EINB 3PLYA 1SDDB 1E65A 1W8EA 3EH5B 1L9TA 2J56A 2YAOA 3FT0A 1OE2A 2VW4A 2WO3B 3SBPA 2PP8A 3S8FB 1QHQA 5B1AB 1NPJA 2YAEA 1AS7A 1NPNA 1ZPUA 1KCWA 4P5RA 2UXVA 4KNTA 4BDVB 2DV6A 2BW4A 1E5YA 4N8UA 1TKWA 4A66A 2PP9A 5B1BB 6PCYA 2XX0A 3TBBA 5PCYA 5I5JA 2YAQA 1AIZA 3NJKA 3PPSA 1EHKB 4DP9X 3RYMA 3NP4A 3WNJA 1V10A 3C75A 5B7EA 3T6WA 4HIPA 3T71A 1AG0A 3TU6A 3FYIB 2AFNA 4E9RA 3G5WA 4CSPA 1AG6A 2IAAC 1JXGA 1A4BA 2UX7A 2CJ3A 1J5DA 5TK4A 4DPBX 4DP5X 1SF3A 2Y1AA 1PCSA 3ZIYA 4DPAX 4E9YA 3FPXA 1PY0A 2IWFA 4YSOA 3EF4A 2ZXWB 2Q5BA 1AS6A 2HX8A 7PCYA 1E5ZA 1J9SA 1V55B 2X88A 4DP7X 1XB8A 1WA1X 5D4JA 3GDCA 1PLAA 3OQRA 2BO0A 2CUAA 2FNWA 2HRGA 1OCCB 4AKQA 4KO5A 5I6PA 1RZPA 2XXFA 1QNIA 1BYOA 2TSAA 3QQXA 4E9XA 3GXUB 2J55A 2VSMB 2HX9A 3NJIA 4NAJA 4A2HA 2JFCA 1GYCA 4W1TA 1MZZA 4HCGA 1MG3C 1JZIA 3S3BB 2YAHA 3EH3B 3SQRA 3U25A 3IE9A 1CUOA 3SBQA 4ZK8A 3AW5A 1NDTA 3NSYA 1PF3A 3BQVA 4GP5B 4P5SA 2MTAA 2QDVA 2W8CA 4PAZA 1WA2X 1BXVA 1URIA 2PPAA 3WG7B 3NJHA 3UAAA 3V9CA 1AAJA 4AZUA 2FQFA 3ASNB 3H4FA 1HAWA 4UANA 5I28A 4KOCA 3FYEB 1SFHA 3SBRA 1PLCA 2EIKB 2UXTA 4YSTA 2X87A 3IN2A 1L9SA 1HFUA 2J5WA 9PCYA 3QJQB 1JVLA 5D4HA 1AANA 3UADA 4W9ZA 5I6KA 1OCOB 3IN0A 3NJNA 4UAHA 4DP2X 3ASOB 1IBZA 3T6ZA 5AFAA 2UXFA 4G72B 1PZAA 2GI0A 4KNUA 2FJSA 4JHUA 2XV0A 2IDSA 5AZUA 1RKRA 1GY1A 2HZHA 1SHXA 1GS8A 1GW0A 4YSPA 1QLEB 1J9QA 1OF0A 4G70B 1I53A 2FQDA 4JKNA 4GYBA 2LLNA 1OOWA 4YSDA 3L45A 4EF3A 1R1CA 1PNCA 3FSZA 3S8GB 3ZBMA 3T6XA 2DWTA 3V9EA 1GS6X 3D12B 6PAZA 4F7KA 2CAKA 3EHBB 8PAZA 2AZUA 1PZBA 7PAZA 2OV0A 2PCYA 2XYBA 1X9RA 1KDJA 4BDVA 4HCFA 3TA4D 4ENZA 4YSUA 2PLTA 1NIAA 1ASOA 2IWKA 3FQYA 2QDWA 2FT8A 4G71B 2FT6A 3WKPA 2VN3A 2AVFA 1NINA 4CSZA 2FWLB 2YAMA 2EILB 2VM4A 2B08A 4YSRA 4E9TA 1NZRA 4K9JA 3NYKA 1JZHA 1EZLA 3T6VA 5I6NA 1GS7A 4DP8X 1SDDA 3FSVA 2PPEA 3AG4B 4BK5C 4GY4A 1JZGA 2YAPA 1PNDA 4KNSA 2VW7A 3X1GA 1ZDSA 2CALA 3GYRA 1A8ZA 1N68A 2BP0B 3QJSB 1JZFA 4GP8B 4GXFA 2NRDA 3X1EA 1ETJA 5I6OA 2HX7A 1KGYE 1X9UA 2JXMA 2DYRB 3JT2A 3WKQA 4E9VA 1ZIAA 2H47C 1MZYA 1GSKA 3DTUB 2Y69B 2VSKB 1RZQA 4BXSV 1FFTB 1JXDA 3QJVB 4NERA 4YSCA 3NJJA 3DKHA 1W6WA 2W88A 3AG1B 4A2GA 2IDQA 3CVBA 4E9QA 4BXVA 1BEXA 2OJ1A 2WO2B 4A2EA 1M9WA 2ZOOA 4E9WA 2YARA 4AX3A 4HCIA 4F2EA 4KO7A 4M3HA 1MDAA 1UATA 1OV8A 1WS8A 3CDZB 3FU7B 2IH9A 1BYPA 1L9QA 2I7SA 3FPYA 3QJTB 1ADWA 4HZ1A 5F7BA 4BWWA 4L0PB 2XX1A 3FU9A 4KO6A 1PMYA 1AOZA 1ASPA 2HLEB 1SF5A 5I5MA 1M57B 2GC4C 4M4RB 1KBWA 3N55A 4A67A 5IY5B 1RCYA 1CURA 3NSDA 2DY2A 4Q8BA 1KCBA 3QJUB 1F56A 1B3IA 1JZJA 3MX0B 1DZ0A 3N2JA 3X1NA 1KYAA 2BP8A 1CYWA 1BQKA 2HRHA 4DP4X 4WKXA 2XUWA 5FC9A 5B7MA 1ZIBA 3ABMB 3AZUA 3FU8A 4RH4A 4YVUA 3UGEA 3ERXA 4N4YB 3QJRB 1FA4A 5D4IA 2P80D 5I5IA 3UAEA 3ABGA 4GP4B 1A65A 3MBWB 2IDTA 4YL4A 3UACA 1ET5A 2FTAA 2FQGA 1J9RA 1NTDA 3FQ1A 1JVOA 4A68A 1ET8A 4AI7A 1L9PA 3CDZA 3IEAA 5A7EA 5I6MA 2E86A 2B3IA 1XB6A 5EHFA 4PCYA 2ZWNA 3TBCA 4A2DA 1AZBA 1KV7A 2IH8A 1OCZB 1E67A 1M56B 1IBYA 3PXLA 4TXVB 3PAZA 1V54B 1SNRA 1ZDQA 5B1JC 2GIMA 4WTQA 3NJLA 2XVBA 2VW6A 2XXGA 1AZNA 2IDFA 1NWPA 1JERA 2IDUA 4HHGA 4YSQA 1WAEA 1CYXA 3OMAB 2BWIA 2UX6A 1AZUA 3H56A 3CG8A 3NSCA 4KO9A 1BQRA 4DPCX 2YQBA 3NT0A 4G7QB 2I85A 2XLLA 1IC0A 2WSDA 1SHWA 1AQ8A 3X2QB 2EIMB 1TEGA 4G7RB 3X1FA 2PCFA 3NJMA 1AACA 2BP8B 1AS8A 2R7EB 1BXAA 2BZ7A 2PPCA 3NP3A 1A3ZA 1L9OA 5B3SB 3X1BA 5B7FA 3DIVA 3OMNB 4DP1X 1OE3A 2CCWA 3ABKB 1E30A 4MFHA 4BWTA 1J5CA 2PPDA 2GB2A 3WNIA 2ZONA 5ANHA 3WIAA 2PPFA 5LDUA 2HXAA 2FT7A 2P80A 2XU9A 5I6LA 3HEIB 1ID2A 3AG2B 3AY2A 4BWUA 3ZDWA 2GBAA 2VMJA 2BHFA 1BAWA 3FQ2A 1L9RA 1NIEA 2GC7C 1HAUA 3IBOA 2VM3A 4NB7A 1ASQA 2J57A 4HHWA 1ET7A 1T5KA 3AG3B 3FSWA 4HAKA 3ZX1A 1TEFA 2XWZA 4A2FA 4F2FA 3FS9A 2DYSB 3CZUB 3EH4B 1VLXA 4AKOA 1GY2A 5I26A 3JTBA 2XV3A 1MG2C 2Q9OA 2AANA 3FSAA
chains in the Genus database with same CATH superfamily
5D4QA 1TU2A 5BQDA 3T4AA 4P4KB 3VE0B 1I8MA 1QVOA 2GUOA 4QXGL 3DX7A 3EDJA 1JZ5A 4IRSA 4PWKA 2Q7AA 4IHOB 1JYXA 1HS6A 3E6FA 3S3SA 1E2WA 4HJGB 4BKLA 2IQ9L 3KMDA 1T22A 5E8OA 3WDHA 1E5BA 3CBRA 4MZ3A 4Y1AD 3L81A 2R29H 1IC7L 3BH4A 1Z5LB 4RAUB 3T3MB 3U30B 5D1XA 1N2RA 2R0KL 5F7KC 1ZLWK 2C9UA 1U3HC 4ZXBC 4DEWA 1G7HA 4JPKL 5DRZA 2VQUA 5AG8A 4N0FA 1RURL 1JGEB 3WYRA 5ADOH 4RMWA 4KQ3L 1DBMH 1ZLSH 5ESVA 3V4VB 2WZ0A 1ACYH 1KCUL 2XT1B 5E5MA 2WQRA 4EDXB 1UEYA 4RQQA 5JHAA 1C8PA 3DO4A 2NXZC 3QPKA 4MMYB 5DWUH 3JTTB 3NACH 1XF2A 4NP4L 4KQ0A 1MIML 4Z7VE 1CICB 4AEHH 4LDOB 5I1IH 1JRHI 2DWSA 5GQBA 1TT6A 4ONHB 4F7EA 1YQ2A 2JKWA 1BBJA 3KWWA 3BVDB 4GQZA 1CICC 3OAUH 2HN7B 1JI1A 2XN9D 1KJ3H 4PWJA 2X9ZA 3ZTJG 4TVPL 4YHNB 1FWXA 1CLYL 4MMXA 3VH8A 3TIEB 4MMZC 4L8BB 3O6LH 3IU4H 5AEAA 4RFEA 5LGJA 3ZDZF 4PVNA 1IKOP 1N19A 1Q0YH 3KJ6H 4XPFL 4NXSA 5LDSA 2ZD0A 1GMEA 4DAGL 2DICA 1DHKA 1DQDL 3O4LD 3G6JB 4MJ2A 5DQDL 5KVFL 2YAOA 3KYKL 2FH6A 2ZUWA 1G0XA 4G82A 5I1HL 2G3XA 2HJFB 1I1YB 1Z3RA 4QHLB 3M17A 1U8PB 4D9QE 1IC1A 3HE6B 4NZRH 3VI3F 1G9MC 4Y19A 4MJ4A 2DLGA 4JFQB 4OZGA 3X12B 3TN0C 2BLFA 5KSVA 4KZDL 4LSRH 3V5HB 4E5XG 3RTLA 4JBSA 4ZD3H 3D69B 4XNQB 5C08D 4PRPD 2OI9B 1SVZA 3CVIH 4NQDA 4YDVB 4UTAL 1TZHA 2IG2H 4ZQKA 2WV3A 4F15C 1BG9A 1I7UB 3DSNB 1DBBH 5DA0B 2Q76A 4M3KB 4X9GA 2GT9A 2XTLA 4XCEB 1IQWL 3BWUF 2OYLA 3WL9B 2EVFA 5I5JA 4XPTL 5LHDA 1H0DB 3K8MA 3CZFA 1EHKB 3HOGA 4X8JA 3SY0A 3CSPA 4LEXH 5CP7A 4I18A 4NUJA 1N6UA 3AS2A 5INCB 5CBAB 4JFHD 2AFNA 3R06A 5DR5L 4NN7C 1Y0LA 2NOYA 5FOJA 4DKFH 1INEH 3N1MC 4N2KA 3U9PH 3ZE1B 2CJ3A 4AQ1C 4EN2A 3BKYH 5IQ7L 3W0WE 3BH9B 4GRWE 3Q0HA 4U6VL 3ZIYA 5I1DA 4WO4C 3FONB 1OGAB 1TJGH 1IGCL 4S0TD 3K91A 3H1ZA 1JHKH 4G7YH 3ROOA 4Q74A 7PCYA 3MLZH 4P06A 1E9QA 1MF2H 3ATEA 2F1BA 5HYQA 2XN9A 2OJZL 1ICTA 4NP9A 4NNYB 4Z7UB 4ENEC 3OAWA 3NFNA 1IKFL 3MLYL 4UQ9A 3MRJA 5FDYA 4H40A 3FNKA 4L1TA 5ICYA 5BJTA 1QA9B 4TRPL 3LKNB 4W9JC 2FLMA 3GBNH 2OCJA 3LNGA 1ZTXH 4Y1AB 1DBAL 4HCGA 5JHMA 3B7RL 4G43B 1TZIB 1MQKL 2HSIA 2NXZD 4MDJA 3RWGB 5IROD 3DX6A 1BA9A 1FHGA 3D0AA 2WP3T 1L6PA 4GP5B 3LKRA 1KJ2L 3IXAB 5IVXF 4LFHG 3F2LA 3HHRB 1URIA 3WFEL 5HVGB 4KY2A 5IG7A 3RPIA 5C0AB 3U0PA 2MNJB 1IBGL 5F1KC 4L3ED 1MJ7H 4FQCL 2VLKE 3KJ4B 4MD0B 2NNAB 2H0EA 4OD3H 4FTVD 2F19H 2HFTA 1XZWA 3W82A 3P69A 4HCRA 4GKNA 1XSIA 4L5FE 3TZVB 4LDEB 4I89A 1PFCA 3GMOB 4GBXB 2L7UA 1SXZA 3QJQB 3SDAA 1MKFA 1JF5A 5MEND 3RX5A 1M2VB 1WC7A 3ZE2E 4G3YH 3RWIA 1XGYH 3E8UH 4NM8H 4Y9FA 1OT1A 4JMXA 3VFVB 3P1VA 2BP3A 1YN6A 2OJEB 3NCJL 3N44B 4G72B 1QWHA 4KHTL 3TIEA 2ID5A 3Q2CA 1PKOA 1VCBC 1PG7X 2A6IB 2QZ5A 4JHUA 4XPHL 5GRUH 1R3IH 5C07B 3ME0B 4XNZC 2OMYB 4J3SA 5HY9A 5I18L 1AQDA 1YEEH 2PUQT 4MNQB 1MPAL 3WNPA 1OB1A 2Y06H 1J0JA 2BH0A 1IBHA 4ANUA 1LNUB 4L4TB 4ODTL 1MCIA 5CBEB 1KSRA 4NM4H 1YEFL 2XPYA 2E27H 2JKXA 1RVFH 5C09E 3HNSL 1RJYB 3UPRA 3IJ9A 3NPZB 2DPKA 2JSFA 3QJOA 3LZPA 3WEXB 5LAPA 2AXWA 1DVYA 5IHUL 4BFBD 2R29A 5CWSA 4KUCD 3BEWB 1BM7A 2GQHA 4W68A 1NANH 3ARBD 4QR7A 3DDGA 4PJGE 2EUVA 1CN4A 3V4UL 4N90D 2C1PA 4FGMA 2VRKA 3V4VH 3VXQB 2MQGA 3QAQA 5T3XE 5D6CB 3SODB 4G43A 4KKLC 4NWUH 3UO1L 1NINA 2DEXX 4E9TA 2X6CA 5ALCL 2P8MB 4WTZG 1YNLL 3ECWA 5GJSL 3TJPA 3DVIA 3MNVB 3WFBH 4M5SA 4HIJA 1ZJBA 2IFFL 3LKSB 5E6ZA 3ILDA 3WD5H 3BZ4A 1EX0A 3BE1H 4P49A 5DC2A 1TPXC 4M7KH 5IVZA 3ULVC 3U0WL 3NEEA 4R4NC 4PG2C 4JO2L 4QHNB 5L2KD 1KNOB 1RJLA 3CK0H 2EE9A 3KPRA 4F3FB 3K71B 1AIFB 3MA7A 3KPMA 4NKDA 4RSYA 3WJLC 4LRNH 2RD0A 4X6BA 1I3VA 3HBZA 4GXUN 1H3TA 1ZT4B 4YBQC 2WCSA 3Q8AA 2IQAA 1SLWA 1EHLL 1FFPA 3QDGA 4GXUM 2EDLA 1Y0LB 4LARL 1J1OL 4LL9A 5INDB 3K4DA 3MRHB 4YLCA 3ARXA 2J8UF 1NFDF 4NERA 1NUDA 1P5UA 5E5RB 4JRXB 4OGXH 2ZPKH 2B7DT 3B8SA 3L5IA 4NRXB 4OLYH 4P3CH 2IDQA 4JRLA 5A16B 4YHYC 3QG7H 2J7LA 1M9WA 4E9WA 4OUUB 2ENQA 3GD1C 1LO2L 1UATA 2GI7A 3CDZB 1ZS8B 5LVEA 1PG7W 1E6JL 3UBXI 4B7IA 1PYWA 4D9LL 3WUWA 5IB5A 1NC2A 3OAZK 2X1PA 1BPVA 5FFGA 12E8H 2IADB 3X12A 4I13B 4QRRB 1TMQA 3N55A 1CBVL 4TQEH 3C08H 3ZZ1A 3V4PB 1QUPA 4PJXB 3LDBB 5FCSH 2AJZA 3I9PA 1TQBC 3VW3L 1YMHA 1TLMA 5TE6H 5T1KD 1A6ZB 2GBVA 1TQCC 5B7MA 4HOWA 4KMTL 1V3KA 4Y4FB 4G6FB 2IGTA 4LIQH 4F92B 3ABGA 2EDRA 4KBPA 3M86A 2GJ6A 1JD7A 4UUJB 3L1OH 1XFPA 4N0UE 5G4NA 4JDZB 3U1SH 2FQGA 3UP6A 3DJ9A 1BLIA 2LGNA 5TE4L 1G9NH 2WVSA 4EN3D 2EVHA 2ZF8A 2EABA 4WHCA 4B9YA 3H2QA 3DX9A 5JHDA 4IIQA 4PJIB 5EBWA 4CC0A 4PV9B 4JW3A 2COQA 3C2SA 4Y5VB 3VNZA 4X7FC 1I3RB 1UXSA 3FTZA 2OZ4H 1VPOL 5AOLA 4CNIB 4J8RB 4ZFZB 3VXRE 1TYRA 4N26A 5T3ZE 3FFCD 3QNFA 4CU7A 3UTSA 1QRNA 3RKDD 3L54A 2IOIA 4TPRH 4QRUA 2BWIA 2CKBB 1TJIL 2ADGA 2UX6A 4PJ8C 4U05A 4S0SD 2W9DL 4EXKA 3EOYG 4XP5H 3GBML 3AITA 4KU1A 2OSWA 2WLJA 1G7HB 4QJ5B 2AXGA 4HEMA 4K3EL 4Y4KD 4X83A 1N2RB 4IRZL 3GUTA 3QUXC 2VQ1A 3C6LB 4QGTA 5FGCB 4NQSB 3Q6GL 4PJ7F 1CLOH 3ZE1E 1IGJB 2PCFA 4XCFH 4B9ZA 4TKWA 1QPKA 5GGSY 1QSFD 3N40F 3HAEH 5K9JL 1P84J 5DJDA 5B7FA 3QHTC 4ILDA 1B3JA 1U93B 1OAXH 3VXME 3FH8A 3TH4T 4BQ6A 2WXRA 4OM1H 3P9MB 5ERWA 4KTEL 3QPXL 3VH8G 1TU2B 5BV7C 3DDFA 1P7QA 1F3DH 3APCA 4RA3A 3IGUA 3PQYE 3S96B 2AXGB 3SDCA 3UEQA 3MRFB 1T80A 1BAFH 4BFIB 2VERN 5C97A 3LXAA 5AZ2L 1DQML 4HBQA 2IIJA 1RPKA 1HHJA 3MRMB 4NHUB 1J8HD 3ZQWA 1ZT7B 3OTTA 1FO0A 3SQOL 3RWJB 1IAKB 4GG6E 1U91A 1G6RH 1BD2A 2ZJSH 2VRAA 1XR9B 3FQ2A 4U3SB 4WWKB 2VUKA 3APMA 2JJTA 3EGXA 4LVOB 2ICWI 1KIRA 5GZOA 1WK0A 4ZMWA 5K39B 5A2BA 4OZIF 2QQNH 4TQ8A 4LPVA 1Q9LB 4J3UA 1DANT 3UAJA 5J8OA 4A7VA 1YYLH 4QUOA 4XO8A 1FNEA 2JLLA 3HCVA 4MDIB 2ZNWA 4QXUH 1Y1DA 4WI2A 1GZHA 5D9SB 3R8QA 1JYNA 4POYA 2R1XB 3NA9H 1WBXA 4JPWH 4AIZB 2CMRL 4ZNCD 1KJVA 4PW9A 4FFZL 2EYTB 1EFQA 2XV3A 4FQHB 2GFBB 4S2SA 4GJTB 4AYGA 1HKLH 4L9LB 2ZG2A 5EO9A 1MQKH 2GPZA 3HFML 4X5XA 2IBGA 2P42B 5FM5M 3X14A 2LLLA 2PXYA 4KKQA 3OAUL 4YXLL 4Y5VC 4ZMQA 3CAFA 2FSEA 1JIBA 2JQAA 2QPDB 2X4NB 3APDA 4Q89A 2CLZB 3B9VA 4Z3IA 1AD9B 3C8DA 3JVFC 3V5KB 1KWGA 4Y7MA 4N8PA 2UZYA 2XBDA 4DIXA 3RURA 3DPDA 1GW6A 1X5JA 1KT2A 2WUBH 3OMZA 3WIIH 4HISA 4G8EA 4BCXA 3ZOAA 2ZQKA 3E38A 4OLWL 4TLSA 4YVNA 3WEMA 4NC2B 1VACB 2Z8RA 3NSFA 3EH1A 4ZT1A 3IM1A 4NQDE 1NIDA 5F7AA 3D2UB 2VRQA 1ZV2A 1N0XH 1NLDL 1GRWA 3X11B 5IOPA 1IFRA 4AYMC 3X13A 4QOKE 4PLNC 4OH2A 1I3UA 3HS9A 3EGSA 4FLSA 4HHAB 4Q9CA 1C5CL 4NKQB 3I75B 2N4IA 4M93B 1UOVA 5J0BA 1UD8A 1ILUA 1A1NA 2VKWA 1AFVL 1HL8A 3GT6A 3PCYA 1EFXA 3V55A 1G7PB 3KXFA 3MLVH 4YXHH 1TCMA 1CFVH 4OZGF 4TUUA 3BIAX 2Y3NA 5H35B 4YHYB 3MLWL 3QPXH 2N0MA 2XN0A 4BH8B 2QFPA 3GMRA 4L4VE 4E9LA 1UCBL 5DEJA 4DVRL 2Z7YA 5HGDA 3ZHNA 3F5WB 1D5IL 1DVSA 3LKSA 5GGVH 5FB8A 4KVCH 3QHZH 1MCOH 1RQ5A 1U2HA 1BECA 4NO2B 4PRDB 3SYPA 1JHKL 1Z3GH 3KHOA 4BEIA 1J5OH 4KK8D 2YD2A 1DFBH 3BEVB 4RDQF 5L0QC 1YN7A 4GAGL 1IILE 2XTJD 2F74B 5JHLL 2XG4B 1XCWA 1P5VA 2O5YH 3AY4C 3I85A 4W93A 4X80H 3CDFA 4NFCA 1ZPUA 1BCIA 3QUHA 4HQQL 5FHBH 2WW8A 3RVUC 5JYMA 2R69H 2ZCLL 1YPZB 2GTWA 3KXFE 2XI9A 2XCMC 4AIXA 1E5YA 4XCCH 3H7LA 2BNQD 5HHOB 4LPYA 2DD8L 4Z7VF 1DO5A 1EV2E 1CZ8H 4PGEB 1FLTX 1IVLA 3ZMNA 4KC3B 5C3TA 1ZMYA 3A6CL 1HTYA 4X5WB 5C1MB 2YFNA 2NY7H 4F27A 2YMXH 2DL9A 1WZAA 3MR9A 3GEFA 5H8DA 4D8PA 5E24E 4CGTA 2R15A 5HJ3B 3EFFA 1OB1B 2IAAC 1BZ9A 1XR8B 1U95B 4PLKC 3LH2L 5EOTB 1F90L 1E8WA 3U4EB 1NMAL 3ME0A 3HLKA 3S5LB 4DCQA 3I3DA 1SBBA 1G5AA 2CBOA 3N9GL 4KMTH 1IC4H 4X42A 4AQOA 2VC2B 5AAWC 3VJ6B 5L9DL 1R3KA 1WHOA 1ANUA 2FX8L 4LXFA 4WO4A 3RI5K 2FNWA 3QFJD 4H88L 2B3RA 3RDTD 3GK8H 5DRXA 3Q8BA 1M71A 2QSTA 2SODB 3TJHD 3MI6A 2WLKA 1KTLA 5CN2A 1MCPH 4TUOB 2DEYX 3NABH 4KJWD 2WCPA 1I7TA 4QHUA 1NL0L 1ZT1A 3UZEA 3ZN6A 3NPSC 4RMQA 5IVXA 3I2CH 3SQRA 5EO1B 4QMEA 5BXFA 4MZIA 4LPXA 5T5FL 4OCLC 2EEBA 5TH2A 3HR5A 4Z3JA 2OL3L 4N6RA 4P23A 3RU8H 4UT9H 4ZFGH 2JB6A 2W8CA 4LHJB 4NIKB 5MERB 3S7GA 3RNQA 4AC4A 3D5OF 3WG7B 5ECGA 5JDJA 3FQXB 1HT6A 5I2IB 1AAJA 2C7UB 35C8L 1X5KA 1S2EA 5T5NF 1JPTH 1O7VA 4UTBA 1TETH 3SDDB 4DK3A 3CFIC 1V7MH 5T33L 2FD6H 1N59A 5C2UB 1HEZA 5ACMA 5EC1B 2XPGA 4QHKJ 4L9LC 5EPMB 1VRSA 3TPUA 5BQ7B 3O2WL 3FBKA 1UJTA 2PTVA 2LU3A 1SYSA 5I6KA 3DK2A 5K9QI 2AKRA 3PWJA 4LFHD 3PXHA 1BFOA 5FGCE 3MNMA 3NIFF 1S9VB 2GSIA 1X7SA 3ZZQA 2VSCA 1ED3A 4Y4KC 5KTEL 5E2UL 3ESOA 1T7VA 2F1EA 2FJFB 5BOJA 5GGRY 2NDGA 1ZLUK 2CWRA 2X1OA 4AQ8A 3HCVB 1SHXA 4HIQA 2R4SH 4MDIA 1AQHA 3QORD 2NPLX 2PW2A 2VZSA 3IXTB 3GSWB 3OVUB 3V0IA 1X7QA 3OWEA 5BRZE 2WYHA 4JFPA 3AFLA 3VCLB 3HI1B 3FCGA 3DUSB 4H1LG 5H94B 3L95B 4MJIE 2QADD 3T0BA 4WV1C 3KCPB 1BQLH 1C12B 1IAKA 1TFHA 1YMME 4I1RA 3NIGB 3WN5B 3B37A 3OJDA 3WIIL 4F5CE 2DWEB 3CCHA 1R24A 1MWAH 4LLYB 5E0FA 3ILPB 3L4TA 3SE8H 1JPGB 1OT2A 3B7UX 4ZSOE 2FEDC 4G8GB 2GJJA 4RGNB 4XGZB 5TH2B 4WU7B 2ZOKB 2BCMA 4NWTH 4MSWA 5C0BB 4O02L 3QH3A 1RZFH 4OZGB 2XWTA 4PJCE 2FT8A 3QNZA 4J4PD 3WKPA 5IVXB 1N5YH 5A43C 1ERNA 4TTGA 3R4RA 2J2ZB 3CSFA 2NY3C 4F58L 1TJIH 7FABL 4KXZI 1FNLA 3UP1A 4J2QA 3IMRA 1PZ2A 4I9XA 4P2OC 1LLAA 1HSAA 1FC2D 2WY3B 5J6GA 1KB5H 3WTUA 3GSNL 4ISVA 1PIGA 5AYUL 2XKNA 3MLPA 3U2SB 2XZZA 4HW6A 3UYOD 1YMMA 4UQIM 4XO3A 4JPIA 1UENA 4J6IA 2WQAA 3FZUC 4WWNA 5GS1C 1SXBA 2APXA 2HWZL 5AALA 2FGZA 3PFQA 1RZKH 1B88A 1SXSA 2DQHH 2I27N 1A7PL 5L4MA 4G3YL 2HX7A 3MJ9A 2OL3H 1T4WA 3JYBA 3L3HB 1XAKA 1YYMH 1ES0A 4N2MA 4DKTA 1WG3A 2VSKB 5E70A 3HLAB 3NDZE 4LLDA 4PP2B 1XVSA 4M48H 2WBKA 2RBLA 5CJQL 3BVXA 4JHAL 2Z8WC 5D7JC 2Z35A 4FFVC 3KH4A 4V1DD 5CXPA 3UAFA 1DUYB 3R1GL 3DUUB 3VGBA 1UWGH 4YN3A 4XT1C 1ZHBB 2BSED 3V0WL 2MSPA 1QNZL 1FL5B 3ASWA 5F6IC 1KLUB 2YBGA 2RMNA 4HYTB 4FA6A 3P73A 3VG9C 2WCGA 1JK8B 2OQJA 3V6OC 2BNRD 3CFKA 3UTPD 2HUEA 3CDGA 3UFIA 1NAKH 5IBUB 4FCHA 3GNML 1EBAA 3DROB 3FU9A 1AOZA 1LO3H 3TL5A 4JO4L 2XG4A 3L4WA 4FX5A 5IWLA 1X44A 3UZVA 2J5LB 5D7LE 2J5LC 3GMPA 2OR8A 1KGWA 4Q8BA 4HG4J 1C5BL 4X0KB 1MFBL 1WQVT 3ULUD 3VD7A 1RUPL 2MTPA 5CEXB 1YMHB 1VHPA 3MPCA 2IH3A 3AXIA 1FDLH 1JV5A 3EJZC 1BQKA 4P23C 5CJOL 1ONQB 2V2WA 3OKNB 3LQAH 3ARDD 1XGRA 2V5SA 1IEAA 2VZOA 2YPLD 4HUCA 3RPBA 5FF6B 1VA9A 3II1A 3ZQ9A 4LLVB 4CDHA 3WTXA 5KVDE 3PJNA 5EA0L 2IAMB 5DJAB 5CGTA 2ITFA 2R69L 1DDHA 1KJ2A 5E2JA 5C0JB 3I9IA 1NMCB 3B8YA 1ZXKA 2L7QA 3BZ5A 1T3FA 2GSGA 4PJAB 3RWCA 4K7FA 1NJ9A 4Y1TA 1FFQA 4F93B 3BPOB 3T65A 3FTUA 1I8KB 1V54B 3C8HA 4JRXA 5FA3B 1JV2A 1SY6A 2VC2H 1CQKA 2CUHA 4K7FB 5CS7A 2ZX6A 1I75A 4EI5C 4H1LA 4BZ1A 4A6YB 2YPKA 3JWNE 4ELME 4Z3TA 5INDA 4Y16D 5BVPL 2VR7A 5DFVC 3DMMC 4Z76A 3KPOA 4PRNB 6CGTA 3UJIH 3H56A 1EEZA 5J3HC 4Q52A 1B6DA 1PZ5A 2Y2YA 5K9QG 2VLRB 3BPNC 5F88B 4NQCD 4XXCA 4BK8A 3MDJA 4MLSA 4GKLA 4P2OD 3EGDA 3BWSA 3V6OE 3MLUL 3SPHA 2WLLA 4N9GB 5DUML 1Z9PA 3QXDA 3NJMA 3L5XH 1QR1A 4E0RA 2A73B 5E00A 3ZTNL 1G9EA 1TSHA 2NX5A 3L1OL 2XQBH 4K5PA 4EQ2A 1CFNB 2B20A 4HKZB 1J87A 1HINH 3N91A 2V3FA 3WJMB 5GS0D 4X5XB 1NH6A 3IU4L 4U0QB 5ICXA 2E4TA 2XV6B 3P77B 4UQCA 4CMHB 5C0DA 4HMEA 4W9CC 3J8F7 3Q8FA 3LRMA 2IO5A 2OQJB 5HDBE 3K5RA 1C7SA 5IQNA 1HZLA 1EZUA 3QG6B 2FR4B 2JKJA 5CWSB 4HP5A 4JFFB 3O45B 1U3JA 5KANG 4ZX3A 2RFXB 2EDMA 2VE6A 4TL5A 3VYPA 1HHIB 4KHTH 3CMOL 4M9OA 4UOW1 4ZMYA 5IHBA 6FABL 3IVKA 4PSPA 4ZFOA 2Y7QA 3F58L 5CUSH 2QADC 1V3JA 4F1SA 1CF1A 1ET7A 1QKZH 3HHMA 4XMUA 4EI5D 3D25B 2V5TA 2W59A 4U3XA 1WD8A 2ZOUA 4P3DB 4OV6F 4BCZA 3BW9B 3CN4A 3S2AA 4UV4H 5GRVK 5EIIB 3O6KL 3K72A 3HFMH 3TJEH 1MWAB 1GL4B 4BSWA 4FYTA 1A7OL 3UAJC 1ROCA 2YRBA 3VRIB 2FX9H 5BS0E 7TAAA 4FQIL 1KGJA 3NZUA 4DZBB 2FWUA 3DO7A 3DJZA 1HYSC 3BUBA 4MA1C 1F00I 1NGQH 2CU9A 3SE9H 5IJCC 5E2VH 4FEMA 4Q9QH 3OZ9H 2UY7A 4OJCA 4GQPH 4ANWA 1WGVA 2VYRE 3KPLB 2NT1A 3SE8L 2A6JA 3TT3H 4FA7B 1JGDB 3KLAA 2H6PA 1D5RA 3KHQA 2H7WA 3MROA 4XMLL 2LTQB 4OCWL 1FRGH 1MXDA 1MCLA 1FH2A 1MWOA 2I7OA 1PZDA 3QUZD 4M7LL 2X12A 1RIVL 3QNZB 5F6HJ 3V0FA 4WF7A 3BDXA 1B4LA 5IG7B 2CM6A 1U3HD 4XPGL 4ZXBD 5I1JL 1N4XL 4NC1C 4HV8A 4WJ5B 1JDCA 4L9DA 2DLFH 1A0QL 1GC1H 3SCMA 5CR1A 3ISYA 3S5ZA 5KVDH 4FEIA 1YNLH 5D70H 1A02N 1IGIH 5DGQA 2C3XA 3QUML 3SPCA 2PTTA 3TCXA 4IMLA 1AR2A 1ETA1 3EYFB 3QVAA 3L95A 4J8RA 1TJGL 1M4KA 1OAQH 3MYZA 4IRJA 1MFVA 1WS7A 5CIPH 3WJJC 1MFMA 1XB3A 1X6NA 1NCBH 5HYSA 3KXFD 4NUPA 4OD2A 4JEGB 4GSRA 3NA4A 1O5PA 4PV8B 3IF1A 2V5YA 3IAQA 2UZPA 3SDYL 2DQIL 3PE9A 4B5ZA 1CXEA 3TJHC 1CDBA 2XV2A 2QSVA 2YSTA 4MGXA 4OJFH 2D9QB 3CC1A 2FJFA 3D0LA 3IJSB 5IBLD 1I7ZA 3BT0A 2IAND 4LDLB 4OVUA 2F54A 3VW3H 3SJVE 3TVMD 3ORJA 4HEME 4WUUA 4EIZC 2R1YB 3WNOA 1UUSA 2GAZB 4NKMB 3D7PA 4G2AA 4P99A 2Z4QB 1MQ8A 2CA4A 3LQZA 1XGTA 5FWRA 2CHXA 2J43A 1NAMH 2BZDA 2DTML 3RWEA 1PDKB 1KCRH 1BREA 3BDBA 3Q1SL 1UGKA 1G0YR 1E65A 2WQ8A 3FFCA 1L9TA 3BDYL 5T5FH 1FSKC 4UIKH 4HKXA 4HXAH 1PG7L 3GSQA 2ZOTA 3WELA 2ZXQA 2UWEF 3VXTA 5EUOB 1DQQB 3HG1D 3W0WA 2OI9C 5CILL 1PL3A 3WBDA 2YAEA 5B8CC 3L13A 1XH0A 1HNFA 3RIFK 5GHWL 2EYRB 1TZHB 1W0WA 4JO3H 5CJXA 3ECBB 2FH8A 1IAIM 3GB7A 1G43A 3AY4A 1E5AA 4JM2B 4LCVA 1BQSA 3UBXG 4A66A 2GJ6D 2KMWA 2CO6B 1F3JA 4N2BA 4L3EB 4UDTB 4W9HC 4XN4A 2WZAA 2YMOA 4Y4HB 5B39B 2E46A 3PIQA 2WVVA 4DQOL 2YAQA 2FYYA 3AGVA 1E9OB 4P8QA 1BLNB 5LLIC 3ULSA 1PBYA 2HJFA 3JTSB 4JN2A 4C4KO 3HUJB 4KK6D 1DN0A 3WNJA 4MB3A 4XBGB 5B7EA 4AT6A 2OMXA 1SEQH 4YO0A 4EPSA 4JRYA 3VXNA 3ZR6A 2EC9T 2VO5A 4JDVA 3SKOA 4AYID 1HYSD 4BKSC 4PGBB 3GPSA 1Q8MA 1A4BA 2LVEA 1RXLA 4R2GC 1C7TA 4XPAL 2QSQA 3Q44A 1NCCH 3NGBB 4Y5XA 3RUGB 1B2WH 3A4AA 5LG1A 2MCG1 1T04A 2X6BA 4U7KA 1FJ1A 2OXGB 2HX8A 3MV7B 4LHUB 4YK4B 3UO1H 1E5ZA 3EO0B 1PLAA 1ZLDA 1GZPA 1QRKA 2IANE 5IW1B 5IHLB 1SZNA 3BT2H 5B3JE 4WHDA 1F3RB 1RZJL 2WWKO 2R2HB 1AHKA 3O6KH 5F96H 4LCWA 4CU6A 3BKCH 4JG0H 4KAQL 1RURH 7CGTA 1EJOL 2LR4A 4C83A 4HQQH 3U82B 3MNVA 3UTTD 2YEZB 2JH2A 1KF9B 1PY4A 2FSDA 2OZNA 3FHEA 3LEYH 4P23D 5C7XL 3B9KB 1E3XA 1XF2B 3DOIA 4QRFA 4PRIA 1XD1A 5E5MB 1UACL 2VAAB 2EUXA 3MUGA 1CF8H 1E4JA 1OIOA 1X5MA 1JPFA 1IU1A 1JNHA 2BIHA 4KKNA 1P9MA 4AYFB 2ARWA 2Z91A 4NYLA 1HXMB 1Q1JL 2OP4L 4R97C 3VSQA 3ZTJH 2XJKA 4IM8A 1P2CA 5I16A 2OULB 1JZDC 2XICA 4RAHA 2EO1A 4X6DF 3ZO0A 5D2LB 5FW8A 4FMVA 1RHHB 4YUEL 3NZ8A 2R1WB 3QDHA 2IH1A 2H6PB 3MROB 3T0XA 1J48A 1P7HL 4I0PD 4L4TA 5D96C 1V7NL 3HKFA 3GPEA 2WKOA 3S8WA 3IMBA 1JVLA 1KGIA 2EH7H 1T1XA 4WEMB 4P2YA 2G5BA 4LP4A 4TM9A 4NKOA 4ZMOA 3WHXA 3L4CA 1ZEAL 5H35A 2KUTA 5K9OA 1D5MB 3U9UB 2ITDB 5DFWH 4A37A 2Y5EA 3O3EB 1CTNA 1U8KA 4J3OC 1P5UC 4Y5XC 4A6YH 2FO8A 3PWNB 3BW9A 4IMKC 4MX7A 1GS8A 4PGBA 2ED8A 1KPUA 2B2XL 1F2XK 4JKNA 3TV8A 4GKNB 1D5XA 3EOTL 3RL1A 4C56D 4Z3GA 2LU7A 2AJYH 5D72L 4BD4A 2AQTA 4NKIH 2HFEB 1CIUA 4WEUD 3U7WH 4JRWA 1RMFL 2EEDA 1K6QH 1EXHA 5JIKA 1GS6X 2DIJA 2YD9A 3KPRE 4OZFA 1VDGA 4F7KA 2J8UE 4KGJA 3QJFA 3BOVA 8PAZA 1ECYA 4U1NA 3SD2A 7PAZA 2NY5H 1JZ7A 2HPOA 4D3CH 2JTDA 4IBWA 1I1CA 2XSKA 1EO5A 4MKTA 3UTQA 3CJJA 4GEIA 3LKQA 4BRJA 1VERA 4KX8A 5CAYB 2EDXA 2FT6A 2AW2A 2G9HB 2UV3A 1P9MC 3RGVB 2XHNA 3OX8B 1J11A 4YSRA 4Y1AA 5CGMA 4HIHA 2Z4TA 4UTBL 1TZGH 5I6NA 1GS7A 5E1AB 4UMSA 1QR1B 5BRPA 1G9ML 2OMVB 4LOUD 4ODHL 5E56A 4E0RB 1UWXH 3OHMB 5F7EH 5H37H 3F83A 4GAFB 1HQRB 3L3DB 2DH3A 2WMPA 3F01A 3GYRA 5JW5B 5ISZB 4N25A 2ZKHL 5EU4B 5L4FA 3UGXA 5J13C 4WLCA 2HT4C 3U1QA 3ZKXB 2VDOB 1G7LA 1EEZB 2F5BL 3MCKB 5HDBB 1BFTA 2R1XA 5F7FA 4GO9A 3GJFK 4AM0A 2H47C 1MZYA 2ZWLT 1CS6A 4M8QB 1NKRA 1IL1A 1RZQA 2YPKB 3ARFB 4FFTA 5DEGA 3R06B 5KOVC 4ODUB 2Q3AA 3CPLA 3ARGB 4LLUB 3N5AA 2FJGA 1O6SA 4GW5A 4E9QA 4Y2DA 4U1GC 3D39B 1T5XA 1EHXA 4XVUC 5F71A 2AXHA 1KACB 1M42A 2GCYB 4NQEA 1WS8A 3DSNA 5GGSA 3AACA 4JMNA 1L9QA 4N0UA 3Q9PA 1WFJA 3FPYA 2V5MA 4AUYA 3NVQA 2D03H 2OMUA 4A7QA 1UD2A 2WKGA 3UIZA 1NGPL 2IC2A 2YKKA 3RIAF 1TVHA 1PMYA 1ASPA 2HLEB 3A67L 4JANA 3SN6N 1MNNA 3RP1A 4JY4A 5MENA 4RRPM 3PGFH 3SDDC 1W0YT 4XP5L 1M7UA 3CXDL 1I82A 1B3IA 1JZJA 3MX0B 1A6PA 2NY4B 4FG4A 4KKCC 5IUSA 4CA4A 2DIBA 3NIFB 1UCBH 2ZCKH 4DP4X 3NFPA 1NLBH 2ODHA 1ZIBA 5FC9A 5D55A 3UGEA 1JGUL 3HG0A 3V8OA 3QBTB 2W1NA 2IV8A 3TEZA 5EFIA 4TN9A 2M1KA 4DZBA 1VADB 1B6UA 4RBPH 3MRCA 3ZRFC 1CLZH 4YHNA 1KYDA 1M6OA 1MCSA 1A9BA 1MWAA 3ZUNC 1XIWA 2X1WL 4HJIA 4N0UB 2DQIH 2DL2A 3T3PE 1FL5A 5I6XC 1XB6A 2HG5B 3WE1A 1QRNB 4OQTL 3KWWB 1R5WB 5HHQA 1DBML 2OX5B 2Z8SA 3G08B 4AJ0A 5ICZA 2CR3A 2Z7ZA 4OQTA 5IUCA 5HI5D 4R4FH 1EMTL 3LEVH 5F1SA 2C3VB 4JPKH 4LB8A 3OKDB 4Y89A 1MCDA 5B1JC 4J3OH 1T0MA 15C8L 4CN4A 3ILQC 1FH5H 4XZ4A 1NWPA 3GSUA 4C47A 1CDHA 4WFED 3T0ED 2PWHA 1BMGA 1MVUA 1REIA 4PG9B 2IANB 3F85A 3VFSB 2R0WH 1F6FB 1GGUA 1TDQA 2V33A 1F4AA 1T66C 1Q72L 4P46D 2B14A 4ABQA 3RGHA 3FCUB 1AGFA 1L7TL 2YQBA 2H3KA 3EJQA 1BVLA 4X9IA 1FAKT 3S4SB 1IMHC 1WAAE 5DK0A 1PVHA 1LE5B 1VZIA 3GTNA 4HWZA 5C0RL 2WYIA 3W9DB 3L5HA 2Z6FA 4HDIB 3V4PA 3CUPA 3WEBA 4BWTA 1WFMA 1V27A 2VB5A 2EIBA 1MCHA 3QUYA 3QJXA 3VFOB 5HVHB 4PJBA 2OMWA 3BMVA 2IGFH 5FYJU 2PABA 3V4PH 3WFCL 2PKDA 2O6DA 3ULAB 1UYWL 1KPRB 4DZ8A 3BQUA 5JO5B 1Q0XL 4J2XA 1PZ5B 2FAUA 4B6ZA 1OTSC 4YMPA 4DWHA 5JA8B 4L0YA 1KEML 1EZVX 3GRWA 3MKKA 1G1OA 4Y4HD 4H8PA 3PDOA 4XMVA 3AG2B 5LQBL 4BWUA 1S7RB 2QMKA 3SE3C 4X80L 3U2IA 1QKZL 2GBAA 2F61A 4P2QA 1UC6A 1EBPA 1DVUA 2E7BA 3APFA 3VM7A 2DQUL 1LO0L 2NTFB 4MD5B 3QWQB 4YHOL 4BE6A 1HAUA 5F6IB 3MRQA 1NMCC 4OI9A 4NB7A 1ASQA 1M3JA 1PLGH 1W72H 3QK0A 4NQXA 5B21A 2NTFA 2I9TB 1HE7A 2FBJH 3DURB 5FHAH 1AXSB 1KPUB 3LKOA 4A2FA 2JB5L 4AM0B 1O7SA 2ZXDA 3V7AE 3MRGB 5IIEA 3O3EA 4PJBE 3VX1A 3HPLA 4R0LB 4P2RD 2VQTA 3KPMB 5BO0D 3PWUB 1JCKA 3LQAC 5AW8B 1GH7A 3MLSL 5KEZA 5JIMA 2AZAA 3N40P 4F7PB 1OM3H 1T1WA 4KH9A 3VFGH 2DYPB 2YRPA 1BPLB 2BSBA 4LGRB 2V9UA 4YWGH 3CN1A 1S7XA 1SHSA 4AKPA 2FGWL 2APWA 2BNUB 4D94A 2P5WA 1ZOXA 2BC4A 5DUMH 3H2WA 3SYOA 3UTSE 2NY2B 4QOKB 2CIIB 4ZO9A 4NN5C 4RX4A 1KN2L 2EIJB 2YGNA 4FQQA 4KK9C 5I24A 5D2NE 5B4MC 3L16A 1WZMA 3GS0A 2YAFA 4OD1H 3UTQB 4DP6X 4PI0A 3RTQB 2R8SL 1YMMD 4O4YL 3L9RA 2GEEA 3LRGA 1JGVL 3DUHA 3WFDH 3QJFB 4ODWB 5EULV 3ULVH 3HS0A 3KWTA 4UINL 2X7LB 1AYOA 5KTEH 2NZ9C 3NN8A 2A3TA 2VDLB 5K9KA 1PLBA 1EEYB 3S2CA 5JHLH 2NYYC 3OC8A 4JG9A 2W0FB 1YC8A 4ZFOL 4XVUD 2AMGA 4GMSH 5SX4I 1MCQA 2F54D 5I17B 4YSEA 4G6AD 4F20A 1ILSA 4FYQA 3CV5A 3KS0J 5J12B 1IRAY 4XVTH 1RZKC 3H4HA 4N85A 2OMYA 2ZUSA 1MFNA 1ZLVH 4OFQA 4BELD 1UKTA 1DQJB 5FLUA 3WXWH 4GG6B 4F37K 1V7ML 4NPJA 1QWNA 3QGVA 4OF5A 4YFLI 4DCQB 3WENA 5DYOB 3WHXB 3DARA 4APQB 1MFAH 3PAVA 2YD4A 1NIFA 3KDPB 3HI6L 5CSBA 2CK0H 1YEJL 4ADJA 25C8L 4E9SA 3QZWA 2DMCA 2NZIA 1OALA 4ZW5A 3BH8B 3HUJE 4ZMVA 4U2YA 3TZVA 4GT7A 3Q13A 2X70B 3TONA 3HZKA 1E4XL 4K23L 4RMUA 4KXZH 1E4HA 1UURA 2Z9TA 4GBXD 3RFZA 2VXSL 1SY6L 5B1AB 2W65B 3HI5H 5I71C 4PJEF 1NLDH 2HJKB 3KGUA 4MAYA 2CO6A 4OM0H 5GRJL 4LKXB 4P2OA 5B4MD 2UXVA 1R33A 1HL5A 5DURB 3QFGA 4W70A 3VI4A 4BDVB 2DWDA 4ZOEA 4K55A 1JPGA 4QXWA 1D7CA 4XB7A 5D1QE 3T09A 4ZO8A 4F8LA 1RUKH 3MRDB 4LP8A 3RWGA 5DZOA 2H32B 4XB8A 3ZTDC 3RJOA 3DYMA 3H8NA 2HH0L 5T1KA 3VFMA 3W0WB 4BFJA 2QEJA 3WTSA 3EYOA 2XOTA 4YE4L 3VA6A 2X4TA 3E3QC 4XC3H 1X7QB 4V2CB 3ILQD 2IJ0C 4ZW7A 3BIKB 4OQTH 4OZ4A 1EHLH 3F5WA 3VDCA 5BV7L 4TV3A 1F8TL 3R4DA 2XZCL 5L88L 1TSRA 3T8VA 1ZSHA 2GK2A 4K8RL 3EO0A 4LPWA 2VXVH 4RDBA 3OLDA 5FYKU 3L2LA 4IDLA 5KVGE 4MQTB 5GRYA 5CD3B 2EH8H 1M1XB 3LMJL 1RZIB 5F1IB 2VDOL 4OSUL 1JZ8A 2ZCZA 3QIWA 5ISZA 1J9CT 1XGPA 1BP3B 2AJYL 3KXFB 1DBJL 5D72H 5I19L 3L6FB 4UM8A 1J12A 2AKRB 2CRIA 2CUAA 3NIFE 1MJ8H 3VFUA 4LPCA 4YHPB 1HH6B 4M1DL 5K93A 2CRZA 3B2MA 1RZPA 2TSAA 3ECQA 3QQXA 3VGAB 1J8RA 5IEHB 1MFCL 1JN6A 4XBGA 4HPHA 4LAQH 5FK9B 3VI3A 1L5GA 2ESVD 4JN2B 2NY2D 4DKEH 5HDRA 2V8MA 4FJ6A 2W9EL 4ZS7L 4AC2A 2WWNA 5C0CA 1G87A 3GNMH 3PIQB 1A5FL 3LRSB 2ADFH 4AQEA 1I7UA 1YY8A 3D09A 5L8JB 3P3RA 2F5AH 1DQDH 2VLRE 3DX3A 5BMFL 3PL6D 3LSOA 3B5HA 2Q7NA 4LOUC 2WSPA 3NIGE 3D69A 4XNQA 2ZE0A 4Z7WE 2ZYIA 2WXIA 3VDBA 1NDGA 3DETC 3ARRA 1OL0A 2G4EA 4ZS6D 3M17B 1G7QB 3V5KA 1CK0L 1KIQB 4LZKA 4ATWA 1JXJA 1Z6JT 1IM3D 1GTNA 4DVBB 1K3IA 1CGUA 2X70A 4FXKC 4AYEC 4L5FH 2R39A 2P5PA 5JW4M 1CXIA 4JKWA 3RZCB 2Y6SD 3CN0A 4N1CA 2DQDH 3IDXL 1A7PH 1I8IB 4XCFL 4OFYA 5SWQB 4D0BB 2GAZA 1IBZA 1C5DB 2UXFA 2BERA 1MH5A 3C5XA 1BJ1J 1V3LA 4DN3L 3VWJB 3MJ6A 1RSFA 5EIIA 3W9EB 2WQSA 1BMZA 1RKRA 2HZHA 4Z7WA 5ETUB 3TJEL 5IM7A 3FQTB 1CG9A 5FGSA 1NCHA 3LCYA 5DD1L 3WO4B 4KH2A 4N8VG 2BOCB 1UWEL 2UY6B 1UOWA 1OF0A 1XTLA 3QIWD 1WCQA 4FP8H 5DD6A 4OIFA 5LCVL 4KMLB 4ZFFB 1KIRB 1XSKA 1J8KA 2E75C 2W0KA 1G7JA 3S8GB 1A6UH 1XCTA 3EYFA 1HHIA 8CGTA 3S88H 2WAQA 6PAZA 2DI7A 3D39D 2CR0A 2W95A 4PTUB 5JUEH 1M9SA 2VDRL 5LUMA 4DGVL 3QUZA 4A7UA 4AZ8A 5JNYB 2DWDB 3RTQA 2V9QA 2JIXA 2XWRA 5LAXB 1FF5A 3WOVA 2UWEA 1S8DA 1Y6NR 4ZSOB 4TMPA 1KLGB 3CHQA 3NK3A 4HU2A 3FQYA 4JKMA 4PRIB 2KL6A 3BISA 2AVFA 2AEOA 2WINA 4L1BA 5DZNA 5ANMA 4M56A 1T22B 2YJQA 4K94L 3H9ZA 4LLWA 4XC1L 5E8OB 2QVMA 3KPNA 3SPJA 3FRPG 4JCLA 1LEIA 1H3GA 2WD0A 1BQHA 3EFOB 3Q3GA 2A77H 2BNRE 3UTPE 4U33A 2C9QA 3KNBA 5EEVA 1ZHKA 2PNDA 3MBEB 3C08L 1G7IA 1EUTA 2AQSA 4B97A 3O0RH 2FX7L 1F4YH 5ALBH 3VYOA 3UBFA 4L23A 5IHZA 2QPUA 1U6AH 4XMTA 2HRPL 2WBJB 1JF1B 4OGAC 1CL7I 3KVPA 2YQGA 1OO2A 3ZDYF 2BHUA 2X09A 4J12A 3VTTA 1K5NA 3QRLA 1G0DA 2A4EA 2AABL 2ICWB 2KZWA 4UQAA 4MXVF 4KROB 4ZFZA 3HNSH 1DL7L 2BXZA 5D7SL 1Z5HA 5TE7L 4R2GD 3T4AC 3V5DB 3P4NA 2KZKA 4YC2C 4XNZB 1IQDB 3BVNA 4CC4A 2CO4A 1TQSA 1I8LA 3D33A 3N41B 4PJIA 4Z78B 2O93L 4YIQB 1DQLL 5JPNA 2Y2WA 3G5XA 3SDXA 1UUNA 3S35H 3O45A 1SN0A 4JZJA 1HU8A 3CC5B 2OTUB 1F1GA 4L1SA 2CBQA 5DYFA 5IW6B 1YAZA 2DWYA 1D3CA 2HTKD 1ADWA 1B4RA 5C0DB 1F41A 2QPFA 2HFGL 1VFUA 5ITBH 4W6XB 2XX1A 2HT4D 3G5ZB 4FNLL 4FYRA 4PRHD 1SF5A 4R3SB 3LRKA 4NZTL 1V8HA 3BAWA 2AC0A 1X5GA 1KBWA 2E74C 3VQLA 1BFVH 1QI4A 3QZMA 3MNDA 5CJ8A 1M7XA 3TBTB 5D7LB 1IO4C 2EDNA 1YQVL 1K4CA 5E9DA 5BRQA 3FTGA 5D7KD 4JDEA 2B5IB 4JLRA 3FRPA 4WKXA 1MNUL 1JWMA 3E9UA 4P46C 1JNNL 1VESA 3AWEA 3ERXA 4N4YB 2VDLH 5D4IA 3V6ZB 2V37A 5IB4A 3H53A 5GS2D 4QT5B 4H8UA 1LQSR 3T8XB 1IARB 3CFKB 2JKRM 3UACA 2VLRA 3ZDZB 4L1DA 4WNQA 5IW6A 3IJSA 1G7MA 1YY9C 1U92B 5EHFA 3QCUH 2E47A 4UV7L 1S7UB 2ZWNA 4HGMA 4F91B 4WCYL 1AXSA 4P9HC 2JI3A 4KUZH 4N5ED 2A6KA 4PJHA 5FKPB 2BIPA 3V2AR 2YXMA 4LIQL 1KBGH 5I66B 3CFBA 3A6CH 2EDQA 4Z7IA 1LXMA 5TDPB 5F8RC 2ZCHL 2ZUQC 3IS0X 3QIBD 2XVBA 1BG1A 1P6WA 3UPAA 3VFWA 1S7WA 3V95A 3ULUH 2O6PA 5CSZA 2C5DC 2X4UB 4XO5A 6TAAA 1I85A 1JERA 3V7MA 3GM0A 4U31A 5EDXA 1INQA 3OMAB 3P4OA 5DGRA 4JPSA 3BVTA 2IAMA 1N8OE 1GTFA 2DZEA 3FJTA 4NKDB 4NN7B 2ERJB 4EZMA 4F8TA 1BF2A 3QWRA 4QO1B 2RALA 5AWNL 3GHBL 3PL6C 3QCVL 1UM5L 1FQ9C 3K6NA 4LP5A 2B59A 4CVXB 4KZEH 5EU3B 4DN4L 3QNXB 5CZVL 3NP3A 4YFLF 2ED9A 2YD5A 1UD6A 4LE8A 4PJ6A 3REVA 4X99B 1CFMA 2A6JB 1SPDA 3ZU8A 4HD9A 2JF1A 2AJSL 4AQAA 5CN1A 1YO4A 3MLWH 1CK0H 2WQXA 3PDDA 4KY1L 1Z66A 1TQBB 4C56E 5E9DD 1NCUA 3BUDA 4KKRA 1GGBH 3M8OH 3BFOA 2HKFL 3BHBB 2BDNL 1KLUA 5LDUA 1YYLL 2EYSB 2J21A 5HGAA 1EXGA 4V1DE 3A5VA 5I6LA 4WK2B 1MWAL 4K2UL 3VXUE 3ZDWA 4JFYA 3VFWB 1UD5A 5EZLA 4R0LC 2F8XC 1W15A 3QPQD 5EBMA 3U6XA 4BHUA 4JM2F 1O6SB 2BNRB 1AZZC 4WSKA 2HT3D 1Q94A 3IAPA 4ZFFA 2F53E 1GHFL 2WB7A 1WUZA 5FYKD 3K8KA 1UXWB 3CFUA 2ZUYA 3UBGA 2ZAGA 4MMZB 4AK2A 3FQTA 3RJQB 5KVDL 1MHPL 5H37A 4J23A 2QSCL 2N7SA 1G7MB 2FL5B 4HGWA 4BCYA 3EH4B 2WPGA 1VLXA 3MCKA 1ZK9A 2AI0H 2A6IA 4HJ0C 5IQ9B 3FN0L 2J72A 1T7WA 4MA8H 4MAYC 1ZGLB 3O4LA 4RGOH 5JW5A 1EANA 1NCJA 5KSUA 3GLAA 3ROLA 3HC0B 4Z77B 1SLVA 1F13A 5F1NA 3T4YB 4XP4L 3GZKA 1OSZB 2VDKL 4RLDA 3ULUC 5T5FA 4U6VH 4JLRB 4EAEA 3M7FB 5KS9A 2AEPH 3KW8A 1OKEA 3H0TB 4PCSA 4WI3A 2X5PA 2OK0H 2MQ0A 3CVDA 3GJFA 4UTAA 5KN5A 2J73A 3BKMH 5D8JH 2QT6A 3TEXA 4MD0A 4JRYE 1EDQA 1HKLL 3ZKMC 4MQ7A 1TETL 2IF7A 4XMPH 4IGBD 4FQIH 3D48R 4O2FA 1UA7A 1JK9A 1FZKB 4PB0H 1HCVA 5I76B 1NEPA 1I9RL 1X3DA 4PHZA 3ZYZA 2OMUB 4X4XB 3SQBB 4NEHB 4AEFA 4JUTA 2WNGA 1KB5A 1PQZA 3B9KC 3ILPA 3UABA 5KSBE 3G6DH 4GPVA 3QIUC 1R5IB 1KIPA 2VDQH 2APFA 3D06A 4NHCH 4LSRL 5T3ZD 3LXBA 4OUUA 5C3IA 3GRWL 5ADPL 4I77H 4O51B 2Y1YA 1JXKA 3OKLB 1OWWA 4X9BA 2BZCA 5SWSA 3TO4B 1NCCL 3GSWA 2QZQA 4Y16C 1SUJA 5JW4R 3P2DA 3KM2A 1I9JL 4J3OD 1K5NB 4Y8AA 4TNGA 3QR1A 1XXFC 1M05A 4FQXB 3QDGB 2N7AA 1CGSL 4ODSL 1DDHB 4UM8B 3EOAA 3KJ6L 3NGBC 4OCMC 4XPFH 5HYQB 4F7MA 4LBEB 1E9QB 2WBJA 1ED3B 1FH5L 4X6BB 2F8VA 3H42L 5HYEA 1YEHH 4ICWA 4KK5D 4PJEA 1CCZA 2BP0A 1OGAA 3EJYC 1T6BX 3MREB 3OKKB 3VFPB 5MENE 4JFEE 3OSKA 4IBSA 4GG6F 3VMPA 1KNOA 2ORBL 2AS5M 4F8PA 3KL3A 1YA5A 4GFTB 4RFOL 4YZFE 4M43H 4OFIA 1KJ2H 4OB5H 4I5BA 2HKHL 3WS3A 3EFOA 5KZCB 3INOA 1XH3B 4G80B 1JMZA 1E4WL 2Y36H 3BXNA 1HXYA 4BGLA 4OU3A 2JJSA 1I9IL 2PO6D 5CLTA 4EKXA 2MHAA 5LXGL 5FGBA 1A4JA 1U4EA 1KN4L 5DWUL 5GZNC 3DROA 2H32A 2V7NA 2DQCH 3LKQB 4ABVA 3SGDI 1LP9F 1U8MB 3QZOA 4P9ML 5FM8A 4XODA 4J1UB 1JPFB 1QLRB 2AV7A 1XL4A 1A6VL 4N8UA 3B2VL 1IBDA 4PJ7E 1W91A 4UBDD 4FULA 2RH0A 2XFXA 4JKPH 2HVJB 4PUBL 1PEZA 2O5YL 3RVTC 4PCKA 4Q2ZB 2D7QA 2BSTA 1UADC 3WIFB 2YKLL 1V10A 1A14H 2P24A 3RL1B 5C86A 3T6WA 2J25A 5F9WC 1J1XL 3MV8B 4FXGC 2BOCA 3BVWA 4P5TB 5TQ2L 3BUYB 2R2HA 3GSNB 2OS7A 4HKJB 1OGSA 4MX7B 5GSVB 4EUPH 2CIKA 5DD3L 3W9EA 5C07A 4DPAX 1AMYA 3T77A 4Y2DC 1XH2A 4HH8A 4QI3A 4LHUA 4ZUTB 4DEUA 2EXYC 4IMKA 2LU5A 3HKZA 2VJ0A 3QA3A 1KTDB 2Q5BA 5K9OB 4KJYA 3VFVA 5JXED 3HE7A 4DP7X 2AV1B 1X5XA 1F4XL 4V2BA 4Q7DA 5CJBA 3ZKXC 1UGNA 5HHPA 4FQ1L 1PSKH 2XXFA 3O6MH 1QFUH 3P3YA 1OP4A 3GXUB 4LSQH 2OMXB 3PGCB 4YO0B 4XP9H 5IQOA 3EJJX 4A2HA 5DCCA 2NXYB 1JZ2A 4CL7A 2WINB 1VZHA 3ULSB 3ZL4H 2VDNH 3R7QA 2BVPA 3F65A 2NYYD 5AOKA 3HS0B 5G4OA 4DOHE 5DT1H 2Q8BL 4PGEA 1K8DB 3QAZC 4XGZA 4M1CD 4D9RD 1HCZA 2H2SD 2WXLA 5FA4B 4NUGL 4AVIA 2IALA 5K59F 3VD2A 1O6VA 1MHCB 2QTEA 1KLFA 1W9XA 4FHKA 1BXVA 3WCYA 4UTBH 4ANXA 3G9VA 4PJAF 5C0BD 5T33H 4OI8A 3BAIA 3KLHD 4ECNA 2ZWSA 5EU5B 4MKMA 2YPVH 5F89A 5E9AA 3ARUA 5DVMA 4HJTA 5LNGA 3HI1A 1KC5L 2IOOA 3BKJH 3IN2A 1G1YA 2EDBA 2D31A 5HVFB 1NBQA 4HU8A 4UT9L 4ZFGL 1XF1A 9PCYA 3JXAA 4LCWB 2DJ4A 4UQ3A 1H9DA 2HTLD 3GSRB 2X3AA 3WS6A 4NNYA 4Z7UA 3TVMC 3AS1A 4HUWA 2Z4QA 4HJJL 2P43B 4NZFA 1KTCA 3W2DL 3PWUA 2OXGA 3VMNA 3ZL4L 4HVBA 5HHOE 5JPNC 1SXNA 1HILA 4NJ9H 2VXQL 4G8FB 4Y5XB 2IDSA 3V0VB 3KEHA 5C07D 3BE1L 1C08B 1FG2A 1A1NB 3WUWG 4EO5A 2W5PA 3E1ZA 4KI5D 4YSPA 3RZCA 4Y1AE 4RESB 2ZZUT 4NOFA 2FWOB 2QQKL 3HE7D 4JRYB 2A0LD 1S5IH 1KOAA 5IV2B 3LAFA 4TULH 1HESA 1SYVA 3WY4A 1PNCA 3P40A 2D3JA 5I8KH 4TLUA 5C0BE 4P2AA 1A7NH 4DFHA 3WFHA 4KGLA 3CXHJ 1AD0B 5KBDA 2NNRA 3DX0A 3QUMB 1OSEA 2PCYA 3O3AA 3UCQA 5GS0H 3QUYC 4ENZA 2JKNA 4ONGL 4RBPK 3M46A 5T1DL 1A5FH 4GRMB 2VMFA 3SDCB 2IWKA 1BAFL 3MFFB 3DXAB 1DZBA 5ID0A 4LVHC 1DBAH 1NKOA 2VN3A 1DQQA 4N2DA 4NQCE 4B96A 5GGQH 1ZT1B 5DVNA 4DKDC 4ZZFA 2K3TA 3ABZA 3U48A 2TRYA 1U58A 4XZUB 1SM3L 2JCCE 1KTLB 2WLHA 3B2VH 3FFCB 3FULA 1SJHA 3GMNB 2MKWA 3UX9B 1F02I 1RIHL 3FUDA 4MXWH 3DECA 3E6HA 2DQEL 2VDPH 4JFSA 4XNXH 5GRUL 4O2CB 4RWYH 4FN0A 4XNUH 4EI5A 3QT2A 4EOWH 4UOW0 1T83A 1IM9A 2DQUH 4FLQA 3THMH 1FIEA 3ZYOA 3X1EA 4G8IA 2A9NL 4Z7OE 1X9UA 5I8EA 1I1RA 2BVOB 3LEXA 4NQTA 3DTUB 4X4ZA 3U4EA 2DJSA 3L3KA 5KUKA 5EA0H 1LEKB 4QXVA 2X38A 2XA8L 5HDOA 1UXWA 4ONHA 3DIDA 4JFDE 2B39A 2BNQB 1G4MA 1K2DA 4A2GA 4IRJB 4Y5VA 5ABAA 3DHUA 2VSDA 4ZO6A 2HLFD 4GRWF 2HVJA 1U8JA 1NCAL 2YARA 3IGAB 1BVKA 2NY0D 2RFXA 4UWQB 1IFGA 4N6QA 5FFOA 1E42A 1I7RB 4HIIA 4NHUA 5KBPA 1RUPH 4KXCA 3QRBA 3ZT6A 2L0DA 2P8LB 3QJTB 3L3JB 3MRCB 4OZFG 4YGAB 2LV4A 1T0NA 1MFUA 4ETYA 4IBYA 2WP3O 4YOKA 3AQDA 1A7NL 2MHAB 3C2AL 3P4LA 2F74A 1E4XH 4LSVH 5LJYH 2JCWA 3MQIA 4DFIA 1SLUA 5DC4B 3Q43A 5IY5B 3NSDA 3S97C 1J0YA 1NFDA 1TVBA 1YVLA 4HWBL 3VTAA 1KCBA 1ZHNB 4B9GA 4NO2A 1BOGA 4OGYH 2F53B 5AUMB 4KKCD 3RWFB 3ESVF 4IHOA 4Y19E 3QNXA 4YGVA 3RVXC 4R7NB 3HNVL 4WIQA 4LCCB 2XUWA 5MENB 3IDNA 4LQFL 2CNYA 2R23B 3CZGA 4XMWA 2G0KA 3R7RA 4ZTOH 1WJ3A 3WGUB 3OKKA 4GAJL 4FQ2H 5C0ND 2IBBA 3DMMD 5I75B 4K3DH 4C56A 1J9RA 4QRPD 1NEUA 1TTGA 3UEZA 1X5ZA 4MCMA 5FOBA 1F90H 5GGSB 3ZL1A 4YDIH 3QQ4A 3BAKA 3C6LD 1S7WB 5ILTH 5ISZD 3VXPA 3HNTH 4HJ0D 4JRYD 5I17A 2CZNA 4H1LB 2AK1H 4YHZL 1M56B 3LJ3A 5HJDA 3KDMB 1USQA 1P4BH 2EKSA 1GZHC 4FD0A 1OD9A 1OARL 4IRSC 4RFNB 4ZAKB 3NJLA 2B16A 4Q6YA 3NTCL 1R3JB 3VGFA 1YPZF 4LGSB 1K3ZA 1ZANL 5DHYB 3FTXA 4TNWF 4LNRB 3KEDA 2X4SB 4KROD 3RAJL 3PS6A 1MI5D 3L4YA 4IBQA 5I1LA 1OK0A 3KLDA 5DT1L 5ICXB 3ZE0E 1XCQB 1NMBL 3O3UN 2EDJA 4JZNB 3T0DA 3G3LA 1A47A 3BLBA 5I30L 1GXEA 5F7LB 2MH4A 3ZMEA 1TQUA 3FUEA 4IJ3B 3QAZB 4FLOA 4MZRA 4KTDH 1ZRUA 4YPGB 3QDAA 3KLHC 4U1SB 4E41A 2WIIB 3P54A 4JM4H 1D9KA 5GGRA 4PRHE 2WUCH 2GITB 2O61A 5HXMA 1NCDL 3OX8A 3M8OL 2YA1A 2AJ3A 2PPDA 1J5CA 1OCWL 1F4XH 2W0PA 3FQWB 1H15B 3CZSA 4KJPD 4QRRA 2YBRB 4PSRA 2AK4B 1CDCA 3BZFA 5C8JB 4M7LH 2BPBA 4FCAA 5ANHA 3OQ3B 5FO7B 3WIAA 4R0LA 5BVJA 1KJVB 1NBVL 1BJ8A 1WBXB 3NH7H 4LASH 1E0OB 1E28B 4N2GA 2PWFA 4LCIL 1VFBA 1C5CH 4MMZA 1WFIA 2MNUA 4IQHA 3RIFF 4MA3B 2QBWA 3NCYS 4YLBA 5DVLA 3PHOA 1NMBH 3EYVA 4ENED 2XBTA 1D5XB 5EOCL 3TURA 2F9BT 4XN7A 2OX5A 4Y88A 5EORH 4F8QA 2AQRA 4Z7UE 4LLQB 2YUXA 4AXWB 1AE6L 4LSDA 4W81A 4XMKH 2UZIH 4S1SH 1S3KL 3C5ZA 3FS9A 4U1JA 5HGAB 1BEYL 2WLYA 3HMWL 4WVRA 5EN2A 3UC2A 1ZTMA 1AQKL 2HP4A 5D7LD 2B77A 5KWYC 5L8LB 4I4WA 5ESQB 5AW6B 1S7VB 3D18B 2E6QA 2MKLC 2C4FT 4OJAA 1S9YB 4B9JA 3TEYA 3VMOA 2XN9E 3N50A 5DZPA 2QGCA 2CLVA 3WLWD 4N0RA 4JFUA 2FUQA 5HPMB 3UO8B 1MI5A 2YUWA 4L05A 1BOGB 1WE5A 4KHXH 5EU6E 4EEEA 2BVTA 1T7YA 5A2FA 1GR7A 3L3OC 4X0KA 2GHZA 2VDRB 4H8QA 4JAMB 5C2BH 1WVZA 1KGCD 4I18C 4M4RA 3LIZH 2AQNA 3PWVA 4GRWH 2HH0H 5LO7A 4GS7C 1T1ZB 4J3OG 3ZDYB 3U1PA 1BZDA 1D9KD 5CCKH 4B7LA 2X40A 4FFYA 3DGDA 3WY3A 2FIRT 2DJMA 5CEZL 4JM4L 1WWCA 5DRNA 4FFYL 3OJDB 5DJ2B 2X44D 3EDFA 5KJ4A 4M8UA 5DC0A 3D2UD 1TZIA 5IJVB 1I9JH 2GG1A 1T5WA 2ZUVA 2D73A 1QO3B 1AMXA 3DNKA 3HE7C 2NNCA 5TDPA 4BFEA 1SJMA 3W5NA 3MKGA 4PJIE 2Y7MA 1IAIL 4XBEL 3VCLA 4LLUA 5IJKA 1KWKA 3SQOH 1CMOA 2WBJC 4QKTA 5DD0L 1OQOA 2HYMA 5A1AA 5BZDB 2EUZA 2B9BA 3MV9B 1S7UA 3UYRH 1WZ1H 3OLIA 1CFTA 1XIWC 4PGJA 5L2JB 3OD3A 3DXAE 3F7VB 4NSKA 1PAZA 2V5RA 2CDFA 2NY7L 5C09D 3ALPA 5JPMB 3MOBH 1C5DA 2XPZA 5LBGA 1KB9K 3FUMA 4WKZB 4Y4FA 2Y3AA 3RUGA 4OGAD 1HQRA 2DLIA 2VXVL 1EXUA 2IVFC 4PLJD 2Z31C 5HPOA 2V17H 4HS3B 4PJXE 4GQQA 3EH5B 2LHAA 1MFDH 2J56A 4WQOA 4XXWA 2VIRA 2Z1PA 4IIZA 5INCA 3SPVA 4ATTA 4DVBA 4UNUA 3LZNA 4ZX4A 1IT9H 1WO2A 3S8FB 3UDWA 1E9OA 2X4OA 5DUPH 3VB9A 4BZ2H 2F0CA 1NDGB 3RPIB 2FECL 4ODVH 3QUMH 4GRMA 4X50A 4KVCL 1NC2B 1BX2B 1H8SA 4DW2H 4NQDB 4YDVA 3FO1A 3IFLL 3IXAA 3ZE0F 1JAEA 2BW4A 5HYJB 4B5EA 4N6RB 1BX2A 1HN1A 2BIMA 4K7PH 5FYJD 3RRQA 4B3VA 1HXKA 2Z93A 1ETZA 3LRSA 5FYKL 2M8XA 4K5LA 3GLDA 3HB3D 3KLKA 1MREL 2JI2A 1CT8A 4IKNA 2PR4H 1KN2H 2J1WA 1SYVB 4YXHL 4AYSA 1NQBA 3OHXC 1R46A 3C75A 4XPAH 1U30A 4LVEA 1M7DB 2A1WH 1UZGA 3NCMA 5CO1A 4ELKA 1SQ2N 2HLFC 2ICWA 4XI5D 4NNXB 1UM4L 1JHLH 1IFHL 3MUJA 4KUCF 3RLSA 1J5DA 1SF3A 2Y1AA 2CCVA 3IFOA 2WANA 3QIBA 2R4RL 3NEXA 4RFOH 1XIWD 3TFBA 5E2VL 1S7QB 4YSOA 4OR1A 5F1IA 2ITDA 4JFOB 2ZXWB 4YX2H 2F54B 4N2NA 2E8YA 4XBPB 4AM0Q 1V55B 5DHDA 4Z7QB 3K71A 4TULL 5CEYA 2BO0A 1J5IA 1G9MH 4RX4D 4Z7AA 4KO5A 3ET9F 3LN5A 3DGGA 2ARJB 3U6RA 3A0OA 3PFUA 4KQ4H 5E1AA 2JJVA 2J55A 1E90A 1HL4A 1RP8A 1UVQA 2DQHL 3MOBL 1KXHA 3WNLA 3GIZH 5D2LA 4GXVH 4DPRA 1EA9C 5J57B 1FORH 5K1JA 1DQVA 1PTZA 2RJMA 3WL9A 4XAKD 1CUOA 3FB5B 5I74C 4Z8FL 3AW5A 1ZTXE 2ZXCA 2YQ2A 1E40A 1PF3A 4P5KB 2N3JA 4PI2A 2QDVA 3FT3B 1RY7B 4FTVA 5DRZB 5HHNA 1S3KH 1JSYA 2XWBB 1IX2A 3C09C 1A7RL 5KBKA 4TNEA 1K6QL 3ZQXA 1UJ3B 4JDTL 3DLQR 3K1KC 4O5LH 2VITB 2BVPB 1N3NA 3LXCA 5EUKB 1U2CA 2YWYA 2J6WA 2EIKB 3RBGA 5D7IA 2XVKA 1J5HA 4N22A 1WIOA 1OHZA 1XF3A 4JFED 1FYTB 4LESA 4NDMA 5F9AC 2WYTA 3UADA 3WHE0 4LCIH 3TTYA 4IBZA 4WO4B 1EHAA 4MHHI 4FJZA 3SKMA 5LGJB 5J11B 2PWGA 4BQ9A 5CEZD 5E6ID 3PXJA 5KSAB 1AI1L 1UQSA 3TWYA 3T0EA 4NT6A 3G7TA 4PGCA 2FIKB 4M7KL 5FFLA 5JIPA 4GG6A 1MNUH 1MSPA 2JK5A 1G84A 4D0CA 1N10A 3KYAA 1QLEB 1FV1B 1U3NA 2WVUA 1U8HB 3PQYD 4HHAA 3MR9B 3PWPB 5E2UH 5HJBA 2A6DB 4OFVA 1FL3A 5L6YL 3FMGL 4L1LA 3MTXA 4NZTH 4X4YB 4K71B 4K3JH 4KK6C 2D2CC 4MQXD 1BWMA 4IKJA 1BM3L 4GSQA 3EZJB 2VMCA 3P3UA 4F2MB 4F9PC 3ATFA 4PCTA 1Q1PA 3MSPA 5DI8A 1NIAA 1RZ8A 4QEGA 4G5ZL 1XGZA 4U0RB 2VJXA 1RVFL 3O2VH 3LS4L 3QNYA 1U21A 5IJBC 4G7VH 4KY1H 1KJMA 1P6FA 5ELIA 4IOFC 2B08A 5GGRB 1KCSL 3GMQA 3JWDC 3TC9A 1S7XB 2R69A 5JXAH 3MCG1 4M6NH 1FLRL 4QRTB 5SWSD 3OB0K 3NMEA 4ZBJA 3GUFA 2LTQC 1VFAA 5TGBA 4AGLA 3EADA 1OAZH 1GGTA 3X3GH 2VGLM 4PJFF 2BP0B 2UZXA 3BUTA 4WFGE 4WUUB 5I1EL 4KI5F 3GIZL 2XWXA 3G6JF 1N7MH 5GPRA 3AUVA 3NFSL 1ORSA 4YBHA 3JT2A 3VU1A 1ORQB 1ZA6B 3PWLB 5LGKA 3F7KA 4BINA 3L8QA 1NGXA 5DMGC 3HS8A 3K6FA 5DZVA 3ULUL 1FFTB 2WKLA 3QJVB 4CW1B 4OD2B 3D0VB 1VKXB 1JD9A 4U1MA 4XN1A 3AXHA 3CFDB 1SMOA 4YXKL 4U3SA 1IBGH 5I1CH 4IMLB 1EMTH 3LEVL 5F72S 1K85A 4X7CC 5F7UA 1EO7A 4G1EB 5I0WA 4ZW3A 4WDIB 1MDAA 3U36B 3SGJC 3OG4B 1R5IA 4OI7A 1DQTA 3FU7B 4L37B 5DJCA 2YA0A 2HPTA 5JXEA 1QRNE 4GAYA 4KHXL 5CSGA 1JHLL 2AJXH 1IM3A 1J1XH 5F7BA 3QUKA 4G8EB 4DGYH 3O41A 1BZQK 3MRFA 4P5MA 1E27A 1K4DA 2J8UB 4R90H 1FBIL 4XN2A 1ITCA 3VO0A 3JWDH 1XBDA 3O6FD 3RBSA 4TOYL 2GC4C 3ETTA 3H85A 3HE6A 4HEPG 4Y1SA 4UOJA 4GMTL 4PJ5B 3HC4H 1NCGA 1NLBL 3GSQB 3S98A 4N28A 5KN5B 3HTLX 4TQIA 1DN2A 2P5WE 3DTXA 4MAYD 1TYEB 3JV4A 4K73A 1PDKA 3HHSB 4GSXA 3FW6A 2IV9A 3QZWB 1A6TA 4U1LB 3NRPA 3D52A 4WTZA 4Z7UF 3BSZA 2VUOA 1FA4A 4G7VL 3VGHA 3NZHH 3TBWB 1LO4L 4NO0B 3MBWB 4ZNEE 2DEWX 1PX3A 1E3ZA 1DFBL 4OQ1A 5IQ9A 1PPIA 1ZXQA 3K80A 5D8JL 4IBTA 4LARH 2G0LA 2R9HD 5HHXH 2OK0L 1WSST 4MMXC 3P02A 3TBCA 4JQIH 1HOCA 1KV7A 3D25A 3FB7B 2VDKB 4J5VA 5BZDA 2YPVA 4OJDH 1BVZA 4TXVB 5D93C 1UEMA 2VISB 3FUIA 4ZFOB 4DKAA 4PY7B 4WTQA 2A4ZA 5E5UB 1QR4A 1T21A 3FN0H 3WKMH 2AEWA 4ETQB 4GQRA 5BRZB 1LEKA 3UYPB 4Y16B 2CR6A 2Z34A 3SO3C 4Y4KA 2YD6A 4ZMXA 1WH0A 3R0MA 1EO8L 3BPOC 3L9YA 5E99L 2JI1A 2Q0ZX 4UT6H 1AGDB 1TFPA 4JDZA 3QYCA 2A9AA 3MBWA 4XE0A 1LWRA 1QSFA 3QO1B 4K9EC 4RGND 2I85A 1O75A 5DQJA 2G2RA 4RAUA 4I87A 1FRGL 3P9LA 5IFJB 1SHWA 1TOXA 2IPTL 2J6EH 2L3BA 3GXMA 1AS8A 2BC4B 2PW1B 3BAEH 3GMNA 2BINA 3DRTB 3RVVD 5EB9A 2Q3ZA 3MRIB 5E4AA 1DJGA 3KPLA 1F6LL 4MFHA 3ZHDA 1FYHB 2X4PA 1HCYA 2VDNB 4UYPA 3ULUF 2NY4C 2D0HA 4N9GA 3LV3A 2H8PA 4WRLA 5T8IA 3EG9A 4F9LC 1CU4H 2VABB 5MI0C 3BIBX 3O8XC 1EH9A 1FNAA 3TN0D 2OMNA 4YHZH 2MCAA 4BSWB 3NCYP 1YEEL 1TIUA 1WCBB 3K72B 5C0RH 1INQB 3P4OB 3S5YA 3WN5A 3CFEB 3BP7B 5CMAB 4LLQA 4AL8C 1X5FA 4K94C 1CVSC 1MJUL 4JG1L 4Z7NB 3E80A 3L7EA 1Q9OA 2J8OA 1AKJD 3A4FA 3ARZA 2AGJH 4PD4K 1Z9SA 4ONGH 5EBLA 5MHSD 1M7IB 4OLXH 5T3XH 2FEEI 3I6LE 1UWYA 5D7JB 4FG6C 1RPUA 2ZX7A 2UVFA 3TT1L 3PRZA 4JZOB 2XVLA 5DMKA 4E5XA 4JQXC 4FS0A 1ZT4A 4WNQB 3STLA 3B2PA 3WLBA 4Z3FA 5FO7A 5BVJB 3T6QC 2VLKD 4LLVA 3BWAB 3BJLA 4DK6A 5GJTL 4G8GE 2ALAA 2MIZA 1MCKA 2F53D 4AIOA 1D5BB 2KZBA 3MRPB 5IB4B 3CLWA 5GRZA 1IEAB 2VXSH 4BQCA 5T1MB 3C9NB 2J12B 2XQBL 4ZJ9A 1A7BA 2YZ1A 4MNHA 4Q14A 1ZVHA 4MDRA 4HDIA 4QTIH 1F58H 3QW9A 5E8PA 4I3RH 4M1CC 5B8CA 5CEXA 4P2CG 1H3VA 1HNGA 1LE5A 4OLVH 1ZHLB 4PJXA 4KPHH 3AUWB 3I6GB 3B2DC 2VXQA 1YEJH 2VKXA 3MLSH 1JWSB 3CX2A 5C0CE 3G5ZA 2R0ZL 3F3HA 2NSXA 4UQBA 1DFXA 3O4OC 1LWHA 3LHPH 3KVDD 3NJGA 3VFTB 4CILA 3PABA 4G7SB 1AR1B 5IGXL 3HR5B 2A74A 4Z76B 4L29B 2F5AL 1IGYB 2OMBA 5FHBL 3QIWC 4FNQA 1I4FA 3THML 4ALAC 3D85A 3S3CB 5B1KA 5CKGA 4N68A 2BW5A 1ADQL 4A04A 1A7QH 1FPTL 4M62H 3RX7A 1KBVA 4YDKH 1D5IH 3G9AB 5IW3A 3SPGA 4B9FA 2BFVL 5FOBB 2I69A 3FB6A 1HHGA 2VZTA 3EJRA 4MJ5B 2FBRA 2OJEA 1WBZA 3FO2B 1ZV9A 2YS4A 1CGYA 3QEQD 5C0GB 1CVRA 3N42B 4WGKA 2QL1A 3GI9L 1WF5A 1NUNB 3TF4A 5MEOA 3KNBB 4HD5A 3TYGL 3HRZA 5E5LA 3BP4B 1JV5B 1LMIA 3ALXA 3H3PH 2F53A 4OF0A 3QI9A 4EBQL 4PJDF 1U8NA 2HA1A 2IEPA 4OY9A 4JNXA 2GTZA 4HA1A 4ELMF 5AVYB 4JR9L 3I6KB 3PGDB 3DWTA 3MRRA 1YEGH 1NAKL 4ORGB 2NY3D 4W9LC 1ZE3C 2HFFB 4XX5A 2ZOKA 3WLWC 3GF8A 3W1ZA 4PJ8D 2JIXB 3QDJE 5D2NA 4FC3E 2DV6A 2ILLA 4FZ8L 4Z7QE 3KCWA 1NC4B 5F7MC 1PD0A 1R24B 1U8OA 3ZXAC 2CM5A 2OZ4A 2DLHA 4B0MB 1C12A 5GHWH 1OF2A 1I8AA 3KZ8A 3NJKA 4M5YH 5DRWA 2EVJA 3NIGF 1RIVH 3I6KA 4PS4H 1KJ3L 4PRDA 5ITBL 2NTSP 4LLDB 4MVBD 4S1RH 1WTLA 1DO6A 3NIDE 1E9PB 2XNAA 1MCJA 1JXGA 4IRJC 4KJWC 5CZRA 1T89C 2AEQL 4N2AA 2BVOA 3Q1SH 2YIHA 2C34A 2HVKB 3M88A 3TS8A 4AEHL 2A83A 4WO4D 1NAML 1LHZA 3I3BA 4UDUB 2VM9A 3O2DA 3QR2A 5JQHC 2I07B 1IM9B 2Y36L 5E6RB 1VIWA 4KFZC 1CTMA 3CBJB 1LO5B 5C9JB 5JOPD 4B95C 2O26U 4CADB 1TCRA 3IK2A 2BSRA 5JQ6L 4E2OA 1SYSB 1LK3H 1NGWA 2WN2A 4X6FA 3RPKA