2DWSA

Cu-containing nitrite reductase at ph 8.4 with bound nitrite
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
b'LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper-containing nitrite reductase
publication title pH Dependence of Copper Geometry, Reduction Potential, and Nitrite Affinity in Nitrite Reductase
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwsA02
1FWXA 1SHWA 2HXAA 3V9CA 1RKRA 1PZCA 2PP9A 3ABGA 3MX0B 3NSDA 1RZPA 3TA4D 3WG7B 4PAZA 3S8FB 4WTQA 1ILSA 1KGYE 4GP8B 5I5IA 2PPAA 5LDUA 4P5SA 2IH9A 1AAJA 2YARA 4JHUA 3FPXA 3QJTB 2X88A 1NIDA 2BO0A 2QPDB 3FU7A 1KDIA 3EF4A 3NJNA 2PP7A 2UX6A 5D4IA 1VLXA 1A65A 2VW7A 4CSZA 4E9RA 2CJ3A 2ZONA 2BP8A 1HAWA 2FQEA 1SFHA 4DP1X 3NJJA 4A2FA 1M56B 1AG0A 1N68A 3WKPA 1A4BA 3CG8A 3TU6A 4KNTA 4E9XA 1T5KA 1J5DA 2RACA 3FU7B 3UGEA 4GXFA 3NT0A 1XB6A 4W1TA 3PLYA 4G70B 1OE1A 2BP8B 2VN3A 1BXVA 1X9UA 3NSCA 2VW6A 1GS6X 4WKXA 2QPEB 3DKHA 1YLBB 4AI7A 2FT8A 3QJRB 4DP0X 1SNRA 2CBPA 3EH3B 4EF3A 1JZEA 1MZZA 2FNWA 4KNSA 4BWUA 2PPEA 4A67A 4A2DA 5I6LA 1JERA 4HCIA 1PLAA 1AG6A 1JZIA 4NB7A 1J5CA 4HHGA 2ZXWB 1NTDA 4A66A 4YSUA 4NERA 1PY0A 1ASOA 1PAZA 2B08A 3CVCA 2GSMB 2MTAA 1ADWA 5I5JA 1L9RA 1GS8A 1JXGA 4F2EA 1HFUA 3NSFA 2IWKA 1ZV2A 2FT7A 1GS7A 1OV8A 1URIA 3OMIB 2GBAA 4Q8BA 3FQ2A 1CUOA 3JT2A 4FAAB 1OE2A 1FFTB 5F7BA 1A3ZA 1E67A 1TU2A 1ZPUA 3NJHA 4DPAX 4DP8X 1SDDA 2Y69B 4BDVA 1JOIA 4KOBA 2DYSB 1KCWA 2MRYA 1V54B 2XU9A 2AFNA 3SBPA 1W8EA 3IEAA 5I5MA 2AZAA 3H4HA 1X9RA 3NJGA 2E86A 1TEFA 2PCYA 1AS7A 1B3IA 2EIKB 2XVBA 1RZQA 2VM3A 3NJLA 1ZDSA 4G7RB 2XYBA 2GB2A 3OM3B 3QJUB 2H5UA 4RH4A 2BWDA 2I7SA 2PP8A 4KOCA 2CAKA 1OOWA 3IBOA 2R7EB 3FS9A 1W6LA 1PZBA 1M57B 4YSPA 4YSOA 3MBWB 1ZIAA 1ZDQA 3ZIYA 2HZHA 2J56A 3KW7A 4GP5B 1ET5A 6PCYA 1E5YA 1NPJA 5A7EA 1JZJA 2FWLB 1WS8A 1AQ8A 2UXFA 1BYOA 4MFHA 2XV3A 3WIAA 2FQGA 3X1FA 4L0PB 4UF7C 1AS8A 1AACA 1XB3A 2XXGA 1NINA 1PCSA 2XV0A 3CVBA 3OMNB 2H47C 2YXWA 1KBWA 3T6XA 2QT6A 1QHQA 3FQYA 1ETJA 1N70A 1BQKA 5I6KA 4P5RA 3FSZA 4E9VA 2DV6A 4KO5A 1GSKA 1F56A 1AZBA 4M3HA 1L9TA 3NSYA 3OQRA 5AFAA 3FU8A 4YSQA 4HAKA 4ZK8A 4HZ1A 5D4JA 5B1AB 2PPCA 1NWPA 3L45A 4HIPA 4G71B 2YXVA 2P80D 1BXUA 1GW0A 3AG4B 3U25A 1NIEA 1JXDA 1IUZA 2AVFA 2XXFA 3X1BA 2OJ1A 1TKWA 4DP7X 2HX7A 2ZWNA 4DP6X 6PAZA 4E9TA 3N2JA 2PPDA 3T6VA 2YAFA 1SF5A 4DP4X 2BHFA 4DP5X 4A2EA 3ZX1A 2IWFA 5IY5B 2JKWA 4PCYA 3CDZA 3S3DB 1AZNA 1NICA 2BZCA 2IDQA 3FQ1A 3BQVA 4HCFA 1QLEB 5E9NA 5PCYA 3SBQA 4BK5C 3WKQA 2N0MA 4DPBX 2PLTA 2YQBA 4YSAA 3WI9A 5B7EA 2HRHA 2QDVA 2BP0A 4KO9A 1AANA 1DYZA 3PAVA 1NIAA 5I6PA 1BQRA 2GI0A 3FT0A 1AZUA 4FA7B 1CC3A 4E9YA 1J9RA 2H3XC 5AZUA 1AR1B 2TSAA 3T6ZA 3NP4A 1V10A 4E9QA 1BAWA 3PAUA 1WS7A 2EIJB 3PAZA 3ASOB 3RYMA 3S3BB 3SQRA 2CUAA 2FT6A 5I6OA 2BP0B 2DWTA 2XX1A 4GY4A 5B1KA 2OV0A 2XV2A 1NIFA 5TK2A 3FPYA 1OCRB 1M9WA 2J57A 1CYXA 1JZHA 1PLBA 3BVDB 3NJIA 3FU9A 7PCYA 2J5WA 1OCOB 2W8CA 1NDTA 3FSWA 5AKRA 5EHFA 3NJMA 2PCFA 3NJKA 3TBBA 2J55A 1KBVA 3ZDWA 4YSCA 2A3TA 5D4HA 3X2QB 1AZRA 2W88A 1IBYA 2VSMB 4KNUA 4W9ZA 5F7AA 1E5ZA 4F7KA 3PCYA 3X1EA 1NZRA 4K9JA 1SDDB 1GYCA 7PAZA 1XMEB 2DY2A 3EHBB 4BDVB 2OCCB 1ID2A 1DZ0A 1MG2C 5I6NA 3QQXA 4N8UA 2BZ7A 3GYRA 2UXVA 2VM4A 5I26A 4YSEA 3AW5A 4G72B 3ERXA 1IKOP 4NAJA 2FQDA 5I6MA 1MG3C 2BW5A 3QJVB 1PLCA 2IH8A 4YSDA 3ABMB 3H56A 1BQ5A 1ASPA 1MZYA 2ZOOA 4AX3A 2UX7A 2HX8A 2FJSA 1AS6A 1ILUA 2EIMB 4E9WA 3AG2B 3TBCA 1W6WA 4KO7A 2XX0A 1TEGA 1SHXA 1R1CA 4DP2X 2P80A 1SF3A 3NP3A 1L9QA 3HB3B 4DPCX 3UAEA 2EILB 2QDWA 1SJMA 2WSDA 3G5WA 1L9SA 3OMAB 2AZUA 4CSPA 8PAZA 4TXVB 3DIVA 3IN2A 5B3SB 1PMYA 4YSTA 3UACA 5B1JA 2YAHA 5PAZA 3UABA 4YL4A 2BWIA 4M4RB 3SBRA 3T9WA 3T71A 2PPFA 2I85A 4KO6A 2BW4A 2FQFA 2HRGA 1SFDA 4AKOA 4GP4B 5TK4A 3KW8A 4ENZA 3FYIB 1KCBA 1HAUA 2IDTA 1IC0A 1AIZA 1WAEA 3PPSA 4BWTA 3UAAA 2FTAA 1L9OA 4QKTA 2IDUA 4HCGA 4JHVA 2NRDA 1PZAA 3V9EA 3S8GB 4E9SA 1PNDA 3GDCA 4X4KA 5ANHA 1WA1X 1OCZB 3ASNB 4N4YB 4UAHA 1GY2A 1KYAA 2VMJA 2GC7C 4YSRA 2IWEA 3X1NA 4DP9X 3WNIA 3EH5B 3ABKB 3AG1B 3C75A 2GHZA 3IN0A 1V55B 4AKQA 4YVUA 3CZUB 5I28A 2GIMA 2Q5BA 1ASQA 1XB8A 2HX9A 1NPNA 3PXLA 1FA4A 1KDJA 3QJSB 4A2GA 5B7MA 1JXFA 1BYPA 3CDZB 3FSVA 1PNCA 4YVNA 1IBZA 1E30A 2XLLA 2Q9OA 2IDSA 2YAEA 1OF0A 2WO3B 2Y1AA 3OD3A 5FC9A 3QPKA 4BXVA 3FSAA 1ET8A 1OE3A 3TASA 1A4AA 2LLNA 1WA0X 1WA2X 3DTUB 1BXAA 4F2FA 4BWWA 4A68A 2VSKB 5B1BB 2HLEB 2IAAC 1GY1A 2TSBA 3ZBMA 9PCYA 4BXSV 3IE9A 1RCYA 1KV7A 1MDAA 1JZFA 3FYEB 3AG3B 3HEIB 2CALA 1CURA 2DWSA 1L9PA 4Q89A 3UADA 3D12B 3JTBA 2R7EA 3CVDA 1UATA 2B3IA 2YAMA 1AOZA 2YAOA 1OCCB 2JXMA 2DYRB 1EZLA 5B1JC 4A2HA 4AKPA 4HALA 2XUWA 3QJQB 2UXGA 1NIBA 4G7QB 1JVOA 2GC4C 2JFCA 4HHWA 3T6WA 3WNJA 4UANA 1GR7A 1ET7A 1A4CA 3AY2A 1A8ZA 2CCWA 4QLWA 1EHKB 1I53A 1ZIBA 1QNIA 4YSSA 4AZUA 1E65A 2EINB 1J9QA 3NJFA 3GXUB 1AZCA 4JKNA 1NWOA 2YAQA 3AZUA 3H4FA 3NYKA 2WO2B 3ABLB 2AANA 3EH4B 2UXTA 2VW4A 1JVLA 2XWZA 3S3CB 1J9TA 3X1GA 1BEXA 3N55A 5B7FA 2YAPA 1J9SA 2X87A 2I7OA 4G7SB 2IDFA 1PF3A 1CYWA 1JZGA 4GYBA
chains in the Genus database with same CATH superfamily
4JRYE 3H7BB 3JV0A 1E4KA 1GIGL 4RWYH 3B6SB 1TQCB 3V9CA 1C1EH 2BNQA 3LZQA 2VDPB 4R90L 3HN8A 2Z31D 2VQTA 3F6IA 3B9KB 2PPAA 2MOVA 1Y6NR 4JFEE 4Y19B 3ZR5A 1BAFL 4LOFA 4N0CD 1AAJA 4GJTB 1J05B 3BD3A 3MLYH 1A7OL 3CH1A 4FF9A 3REWB 3OAWA 3CPUA 4X5LA 3EF4A 4NP4L 4MA1B 1YEHH 1CBVL 5D4IA 3F5WA 4RFOH 3QFGA 1FC2D 2CJ3A 2YZ1A 4UIKL 1BZ7A 3C6SB 1KGCE 5CLWA 3F8UB 1X7QB 1ZOXA 2R0WH 1EEZB 3KPSD 3QEQA 4XAWL 5HGDB 1ZY9A 4X7FC 3ZE0B 4RMSA 1DL7H 2FJGB 2NOYA 3SE8H 1SY6L 3GXIA 1JZ4A 3DK0A 4YDJA 4IRJA 4PJGF 4QO1B 4OQTL 4I48B 3LPPA 4HJUA 1S5IH 4NQXA 3KBFA 3WD5L 25C8L 3DSFL 3AROA 1QR1A 4QRRB 4RAVA 3CGTA 4JUTA 1KLGA 2W07A 1F6AA 1G1KA 5FW7A 4AM0A 3RFZB 3IVKB 2YRLA 1ZPLA 4WSJA 3GIZH 3NSCA 2R2BA 3PV6B 2VDOH 4GSQA 3MXWL 4JDZA 1AO7A 4JO4H 3H85A 4H5SB 4LLVA 1IIIA 5I23A 4MX7B 2KPWA 3LQZB 2FNWA 1L5GB 4J6RH 2ZUSA 5JIHA 5F3HB 5LXGL 3S5ZA 3JV5A 3GT6A 1HWGB 5EO9B 4MDJA 4EI5C 3KPTA 3MR9B 5BVJB 4KH2A 1ZHBA 1C5DB 3HCVA 3VA6A 1M3JA 4QGYA 4C56E 5GJTL 5I8OL 4NNXB 1ZANH 3U1SH 4YDLC 2XQBH 5JHAA 4NDMB 5CHNB 5ILTL 4JVWA 4LCYA 3J07A 3VNYA 1YQVL 4G6KL 1G7IA 1IAKB 3QZMA 3U4EB 2GW5A 3AM8C 3ZKXC 1QOKA 3OMIB 3CV5A 3ULVC 1X7TA 2GTZA 4LDCA 2ZUUA 1CFQA 4P2CG 5FM5M 5J0BA 1EHLL 2PW1A 2QZ5A 3QRFM 1JF1A 1HL5A 1GGBH 1PPIA 3L4ZA 1KPRA 4Z3GA 2KDYA 4MDRA 2CKBA 4B9GA 3UYOD 5JNYB 4P2OB 2MTPA 3SGEH 1E6OL 3BFQG 4JB9H 4AUYA 2P3YA 3H4HA 1NCNA 3RZCB 3UZQA 5KJRH 4UT9A 1NLDH 3J7HA 1B6DA 1ZDSA 3TTYA 4EIZC 2ADJA 4FD0A 1NEUA 4HCRA 2H3NB 4TQEL 2DB8A 5TE7H 2VO8A 4ETQB 3TZVA 4KFZC 4M03A 3FXIC 2R7EB 5E7BA 2OMVA 3C87A 3BRFA 5IREA 3IGAB 1A3LH 1H6TA 2BVOB 3IFNL 5D2NE 3LNFA 3CN0A 4YSPA 3KLSA 5DZ9A 3HPJA 4GP5B 1QKZL 2AQ1A 5D2LA 4NO2B 3P3UA 1Q9WB 4H13C 2OMTA 3IE4A 3PG2A 4P2QB 1YECL 2ZP0T 4UBDC 2C9QA 3DGGB 2VDPH 3NFSH 4W6WB 3IJ9A 1XZWA 3IDMA 4OD2B 3FCSA 3IF1B 5ACLA 3MDJA 1P4LA 5E8NB 4PJIF 4L0PB 2YPLA 3VU1A 2N3JA 2BFVH 3G6JA 4XPBL 1T7ZA 2NQCA 3E1ZA 4ZTOH 1R17A 5IEHA 1LO5A 1UA7A 4CU6A 1DUZA 3E8UH 4MD4B 3WGVB 4CJ1A 3FQYA 1DQVA 3BVNB 4EI5D 3E6HA 4TPRL 2X09A 4JRLA 4HIQA 4CN4A 4KO5A 2CDGA 4OLUH 4HW6A 1RUKL 2IGFL 5CEYB 5F6IC 3QO0B 2FJFB 5EPMA 3MUUA 4CVXA 2V2XB 3DTXA 1CK0L 5J06A 5D4JA 4GUOA 1PGRB 1CF8L 1ZT4A 2ZOLA 3C2AL 5GGSY 3H3PL 1VCBC 2DWXA 3BKML 1FLTX 1I3RB 2ICEA 1ZVYA 5F7DB 1QABA 1WD8A 4GI9A 5ID0A 5BW7C 5CO1A 2GTQA 1SJEA 2VLJD 1NDGA 3D25A 4L5FH 3S96B 3A23A 2XY2A 3MLXH 2ARJB 1MREL 2R2EB 5DJYA 3VFGL 2X4OB 4M6NL 2RCSL 3QIUB 2A6JB 1OAXL 3GMOB 3UPRA 4BFEA 1JCVA 3LKPA 3GBEA 3ZX1A 3BUBA 4L9DA 5IY5B 5DJ6B 2EQDA 1UA6H 1FC1A 2VXSL 3IB4A 4HCFA 4ZNCD 5DFAA 1V3JA 4ERSH 4J3WA 4DPBX 3O6FB 4I3RL 1ZAGA 3GRWH 2VDLB 3REVA 4AMKL 3L9BA 4G5ZL 2EDOA 3PWJB 1W2KT 2BPBA 4LVNC 2DYPA 3LNGA 4G1MA 2FDBP 2LFGA 3FQUA 4N28A 5F0PB 4CDHA 4U6VL 4O4YH 1Y07A 4WJG3 2P28B 2V9QA 4HS6A 3SKJL 3WUWA 4QRTA 2EIZB 4RRPM 2O5YH 2Z9TA 4XPHH 3WMQA 1G1OA 2RD0A 3CVHL 3VI3E 5F7KC 1QQDB 3BOVA 4ZZKA 1TCRA 1XBDA 3MGTB 4JUSA 1AE6H 1J86A 2ZZUT 4AUJA 2YA2A 4LSVH 4L8DA 3L2MA 1OCOB 5L8JB 1VEPA 5IBLC 4PJBA 1MCDA 4ZFFB 1X9LA 3I6LE 2D9CA 4ZPVB 3CPLB 2CO7B 2Q7YA 3LRGA 5GGRA 1SGKA 4ORGA 3ARDA 1PDKA 4R96B 5F1IB 2HVKA 1AGDA 1E5ZA 1FFOB 8FABA 1NEPA 4PJDF 4S1QH 5LGJB 2WBWB 2AKRA 4GBXA 4GIOA 3FB7A 4K9JA 4OD3H 3TNMA 2XWBB 4E41A 1SVCP 3AS3A 4ZW8A 4P3WA 1OGTA 1Q1JL 4HPOL 2VDMB 1TMQA 1NCWH 2IPKA 4JY6B 1Q9OA 3GPSA 1CU4L 3Q9QA 1IKOP 4NAJA 1KENL 4U7MA 5DR5H 5I6MA 1PKQA 5LGYA 4FQJH 1VFUA 3DX7A 1R33A 3JWOH 3MBXL 4KXZI 5CSGA 3IS0X 4G3YH 4R3SA 4UINL 1KCRL 2AK4E 2XV6B 3MUHL 5INDA 3NIFB 1HT6A 1DJZA 1C7SA 2NLJB 4ODTH 4BCXA 3QGVA 5EOQH 4YHKL 1K2DA 1FAKT 5DF0A 2BDNH 3JQOB 1CTMA 1ZTXE 4AM0Q 3TONA 4CU7A 1B9ZA 2VAAA 3QHFH 1MCSA 4MD5B 4DP2X 1CGXA 1HOCA 1PEZA 4R2GC 1E8ZA 2ZUXA 4IKJA 4LEBA 2BIMA 4M48L 2WSDA 3D0LB 3C08L 1REIA 5C0EA 2J25A 4TXVB 4YR6B 3I2CL 3HZMA 3ZDYE 5KUKA 1KTJA 3FFCD 1EMTH 2A74A 3RILA 3Q8EA 1B4JH 2FB4L 1G9NC 1YC8A 1JN6A 4M4RB 5GGUA 3P3RA 4ZT1A 2NY2C 3RWGA 3CFKB 4NM8L 4KO6A 5F93C 4F8PA 5JORA 3QI9D 2WLLA 4WW2C 3V95A 1E50A 3T0EC 4GRLC 1EBAA 3FO2A 3S36L 4KUZL 4L1HA 3VU2A 2WXLA 3W9EB 1JHKL 5D1QE 4EZLA 5IBLD 2VRKA 1AHKA 5HVHB 4Y1SA 3RIAF 3IMUA 1ND0B 4KTEH 2JIXA 3X14A 1TFHA 2PXYC 2VDLH 5DDHB 3TGXA 3V9EA 4I2XB 4D9LH 2IQAB 4J3OG 1BJ8A 4O51B 1OP3K 2YR3A 4UAHA 5CBEB 5ITBH 5E2UH 2IWEA 1KIQB 4MCZB 1XH3B 1N64H 2ZXQA 4XPAH 2OULB 2O5NA 3BMVA 4JAMA 1CR9H 1RZFL 2H32A 1FNLA 2D7OA 4N22A 1V55B 1I9IH 5C08B 2CCVA 1A66A 4AJWA 5DZPA 1HQRA 5I1KH 5KYWA 1NMBH 1ASQA 1KGXA 4DO4A 1Y18B 4FFZA 4KMTL 4MA8H 2X4PA 4OKDA 3PWNB 5LBSA 3CDZB 4XCCH 3GXFA 1QR4A 3PNRB 1H15B 3FN3A 2IIJA 4NNYA 2UY7B 2F54E 4PWIA 1MXDA 2JQZA 3QUGA 2G0LA 4XTRD 1PQZB 1ODAA 4BXVA 2VUKA 2P8PB 4O5LH 4R0LB 4X4XB 3UX9B 1A4AA 3D3VE 1HQ4A 5I8EB 3RVWC 4XCNB 1FFNA 1VADA 1HVXA 4MCYA 4Z0BH 3VFNB 2QKIA 4ZYKA 5BS0E 1K85A 1TZOA 5I2IA 4IS6B 4OF8A 1TETL 1P7QB 1GY1A 4R2GD 4BFIB 3AAZA 2BNRB 5C2UB 1BG1A 1TO4A 5F8QC 3SOBL 2VDMH 1MDAA 3MCG1 3LN4B 4AJYV 5JW4M 2J21A 1XBRA 5FHAL 1LEGB 1INDH 3V5HA 4DT2A 4YUEH 5EULV 1GCYA 3R0NA 3FUEA 1T0PB 3QIBB 2FECL 3HNVL 2YAOA 4Z7AA 2FSDA 4FQ2L 3ULUC 4KQ3L 2NY2D 1BQHA 1QAWA 4HKJA 2Q8BH 4AQEB 3DYMA 1BQSA 2ZQKA 2ZCHH 4GRLD 4NQEB 2GC4C 4HHWA 5FW6A 3HAEA 3T0ED 2WUBL 3DBXB 5ICZB 4QIRA 4HWEH 1BLIA 3K7UA 4R97B 1KBGH 3WU1A 4XNQB 2NY4C 1KIPB 1NAKL 1N12A 1AOHA 2HJFB 3A4EA 4B96A 4EDXB 1NGQH 2B15A 4TUOA 1ZRUA 3QARA 1EJOH 3GXUB 2FBJL 3RPKA 4BFJA 1DLHA 2X12A 1J1PH 1IM3A 2X4RB 2OJZL 3H7BA 4M6OL 1A2YA 5LCVL 2AANA 5AKVA 5FW8A 2ZXBA 3B9KA 3TPUA 4ZZFA 2K45A 1X4YA 1E7VA 2KH2B 4ZTPH 1QRND 2DI7A 1J05A 2YAPA 4ODWB 4PWJA 2ZP8A 1S7TA 3W0WD 4LB8A 3EGSB 3REWA 1U6AL 3ZL4L 5EZOH 4EJ1C 1HKFA 3F05A 4BV1A 2NTSP 5EU4B 2VDRL 5EC1B 2J5LB 2R1WB 4P5KB 2WQVA 3MO1B 3C6SA 3TYGH 2R56H 1IGIL 2HXAA 2J88L 3GSWB 1EEZA 5D8JH 1HXKA 3EBGA 1M71B 4KHTL 4QHKJ 3TA4D 2DICA 4GKOA 4LDLB 3ULVL 2C9PA 4ZFGL 3W5MA 1HHKB 2WW8A 3U7YL 2ZKMX 3B43A 3Q6GL 4GI6A 4I48A 2NW3B 2P5PA 2AAVA 3STZA 1EERB 2PP7A 3DXAE 3FUKA 4ABWA 4QRRA 4Z3EA 4E5XG 3RFZA 3IVKA 3TV8A 3QUZD 2ZPKH 4Y9EA 3NJJA 3EO9L 3PV6A 1MJ8H 2XIBA 1P6FA 2CIKB 1NUNB 1A4BA 2DIAA 3OKOB 3PRZA 4MNHB 1A02N 2QSCH 4B95C 1ZGLP 1L5GA 3QWOB 2BMKB 2G60H 4M61B 2N1TE 5TFSL 2W0FB 1XGPA 2DM3A 2VERN 4FNPA 4PBDA 3WOVA 2ID5A 1OE1A 3NZHL 3SDAB 2K3HA 2X0WA 4A7TA 3WJJA 4ICWA 2RH0A 1KPVB 1GS6X 3O6KL 4I8DA 3ULUD 1S9XA 3W1ZA 4KTDH 4NNXA 3QJRB 2ILLA 3AXLB 4NDMA 4XXWC 4NKQB 2E9WA 2DWDB 5CHNA 2ICWI 3C8DA 5CSBA 5B1CA 3T5WA 2NUTB 2VZ3A 3VXQA 4I0CC 1IAKA 2PPEA 5D7IE 5IB4B 3U4EA 4MMXC 5AZ2H 2AV1A 2V7NB 1T4KA 3TO4A 4GSDH 5DJ2B 4PBVC 2JI3A 5JYMA 2NY4D 2P7TA 3J27A 4ZFOA 3K2MC 4TUKH 4LBEB 1HESA 5GRUL 4YSUA 3L1EA 2WVVB 4ZFQA 4R4BB 2QQLH 2ZUWA 5KS9E 2QR0B 2CGZA 4JZOA 3NN8B 4K94H 2BCKB 5LWYL 1VFBA 3B5TA 4ODVL 1FHGA 5ESQA 4UT6A 3QPQC 4A7VA 4D8PA 3BDXA 3CBKB 3M1CA 4JFZH 3OKNB 1GSMA 1EAJA 2WCGA 1I8KA 3B2UC 4P0DA 4XCYB 4KC3B 5T5NG 1JF6A 4ALAH 3VGDA 2H3NA 1I7RA 3HE6B 5F7BA 1OAYH 4M8QA 2OZ4A 1AFVH 2EE9A 2VLRB 2VN7A 2ATPB 1KCVH 2XHNA 3JT0A 4C59B 4NSKA 4E0RB 2OTPA 3WXVH 3P73A 2H1LM 2OP4H 3ZE2B 2XU9A 1HH9B 1OSZB 3KYKL 4HEPA 4H4NA 4K9EC 4LRIA 4J3VA 1Q9WA 1M7IB 2Z91B 3OM3B 1OK0A 2X05A 3VWKA 1TU2B 1BM3L 2H5UA 2I27N 2X2UA 4TN9A 3VGFA 1DJHA 1E4HA 1I3GL 4L4TD 1AGEA 3DGGA 5E6SB 4ZD3H 2NYYC 4HK0B 2A9NH 4KVNH 3RWFA 1EFXB 3HG0A 1M57B 3IDNB 4EN2A 1J8RA 3ASWA 5CZXC 4X5QA 5E8NA 1IGFH 1U91B 1X5YA 1IM9D 3ALWA 2B0SL 2DIBA 5I75C 1EGJA 2HZHA 1XHHA 3CLFL 4WWID 5BV7C 1KWKA 2Y07H 3GIVB 4XBGB 4W81A 3EYQD 4GRWE 4FFYH 1IB5A 5I1HH 4C4KT 4YK4B 4ONFH 4IBYA 4XMKH 4YJZL 4DN3L 2C3WA 3F7VB 5HGHA 5EOTA 4U1IB 2E75C 4X6DB 5FUOH 4J3TA 1EEQA 4JREC 2XV3A 5CEYA 4UF7C 4S1SH 2FJFA 1RUML 1UD5A 4PV8B 2V2XA 3EJUA 2Y5TA 4L05A 3EGXA 1S46A 4PJFE 3VFUB 3BT2H 1A1MA 4IMKC 4QYOA 2G3XA 2WTRB 2IPUG 3LZRA 3T6XA 4ICXA 1R0AL 3HS0C 2COVD 4NEHB 1HX0A 3HRZB 1NCBH 1I3RA 5IMKA 2BCMA 2FIKB 3QXWA 3N44B 2Z0BA 3Q1EA 5GGTH 3LEYL 1X5GA 1IT9L 4GFTB 2R2EA 5C0IA 3P02A 3RU8L 2DEYX 1SQMA 5JDJA 3QIUA 3DUSA 4JPIA 4P4KA 5T3XD 3OKDB 1OANA 3NSXA 3P30H 3QPQD 5F96L 1F4HA 3VQ2C 3BVVA 5DJ6A 1G0YR 1NSNH 2XN9D 5FAAA 2WSKA 3B2UD 3NFNB 4KGJA 3GJFB 2WIIB 1KEGL 2X3BA 3MJ6A 4PRAB 2FO8A 1JXDA 2E6JA 2Y36H 1N18A 3ZDYF 2EXYC 4OZIB 2IMMA 2MEJB 3FZUC 3WIIL 4Z7NB 2QZQA 5GRVK 4G82A 4GIPD 4ZW6A 3WIFA 3JUYA 2HX7A 4HU2A 4MJ6B 3RWJA 4OGQC 4N86A 3WJMB 5L4JA 2QPFA 1Z5HA 2H8PB 4OSUH 1XDTT 5D1ZB 4L9LB 1T1YB 3X13A 2PTTA 5F89A 4LSTH 4ZJ9A 1AIFB 1KCLA 2F53D 1A21A 3UTTD 2C9XA 4NX0A 2YUVA 5HJ3B 4OJFH 1MIMH 4PEEA 3RVTD 5F88B 1A14L 1E8WA 5CCHE 1QQDA 1ORQB 3B3IB 3MGTA 1TZ8A 4PREB 2EDQA 4R9HA 2F5AL 2ITDA 2R0KH 5DFTA 4JG1L 4KJQD 1Z66A 3TNNA 2IH3A 4Z7OB 3W39B 3QA3B 4ZFFA 3NP4A 4BA0A 4RDQG 2BS8A 2H1PH 4AIEA 4ZPVA 5C0CD 4NKMA 3CPLA 1TQWA 1VENA 1KIRB 1LLAA 2QLYA 4R96A 2ENQA 2FAUA 5FCUH 1NIFA 1UZGA 3BVDB 2QELA 2GIYA 1E4XH 1KJVA 1MRDH 1S7SB 1IE4A 2FRGP 4PJEB 4XWOD 5GIRA 3RUGE 2HMIC 1A64A 1G9NL 4PRIA 1EX0A 2HB0A 5D7JB 5EA0L 2COQA 5ABAA 4H1LG 3RWCB 3MROB 4PG9A 4J2QA 3EJJX 2ERJB 5E4AA 3NRFA 4UQIM 1ZLUH 1MRCL 2MH4A 3BPNC 1FPTL 1RLWA 5TTRA 2IQ9H 3RLSA 2X89D 5GZNA 4PRBB 3QDJD 3EHBB 4MBRA 5IM7B 4BDVB 4WEUD 2HJLB 3MODL 1MG2C 2VR9A 3EBAA 2HYMA 2RIKA 3K0WA 4PSRA 4UU9B 3GSVA 2BZ7A 1FLRL 1JYWA 3DIDA 1XF4B 2ZYHA 5I15H 1VFMA 3I9AA 5IB2B 5BRZD 4MD5A 1HNFA 1UFUA 4MQXC 4NQCB 4WO4B 1A6PA 2EXYD 3FZUD 1R24B 3WBDA 4F15B 4BJLA 4EQ2A 4NC2B 1WEJH 3OZKA 4X80H 3V9FA 3VSUA 2VR7A 4YR6A 4K5OA 2UX7A 2NY5C 4LCCB 4QHNA 4E9WA 2CHWA 1O9ZA 2FYVA 3L4XA 1V7ML 4QXUL 5FKPB 3ROOB 3INUL 4LEXL 4M4RA 1THAA 3BGMA 3CHSA 5ACMA 4DKDC 3SKOB 1U8KA 1IFGA 1RHFA 3QULA 1R3HB 4F9PC 3SZ6A 2QDWA 1RZGB 3ULVE 3RJDA 3BUYB 3CCHB 4LVEA 3B5GA 4KAQH 3ENEA 2QPSA 5D9SB 3RGVA 2HVBA 3GJFH 3Q9PA 4Z3JA 4KJYA 3OB0K 4N2FA 1JSYA 2YSSB 1ND0A 3FQRB 4Y1AB 3SBRA 5ECJE 1WWAX 2PPFA 2ENYA 2X0UA 1NM9A 4QHLB 2X38A 2XPGA 1DJWA 4K7PL 1JYVA 2GJJA 4UNIA 4YC2C 3KW8A 3GMRB 1KCBA 1KIQA 4MCZA 1XH3A 2CGRL 4PB9L 5C0JB 4AGOA 2FTAA 3QG6A 4IGBC 1FNEA 1L9OA 4FQPA 5D55A 5I8KL 1G7MB 2QADD 2R0LH 3ULUL 2D9QB 2NRDA 1Y18A 15C8L 2ZWLT 4J3OC 3U7WH 3ZDZB 5I24A 3FN9A 5HHMD 4TVSa 2EAEA 3CK0H 3GDCA 3FOLB 1H15A 3MV9D 1HNGA 1QLFB 2UY7A 2E9BA 2VMJA 4IU3B 2GC7C 1KYAA 1FH5H 5JZ7C 1T0NB 5DQ9B 2V5RA 3X1NA 1P4BL 5G4MA 4MHHI 2FEDC 1JGDB 4MA3B 5F8RC 3DHPA 1S6NA 3QQ9D 3CZUB 2WLJA 3NTCH 1FL5B 3G3LA 4MAYD 2E7HA 4I77H 5I8EA 1P84K 1P7BA 2HWZL 4LF3B 2NY1C 2KHAA 3MNZB 3FSVA 2MPVA 4UOW1 2WJ7A 3TEZA 3VFNA 4U1LA 3B7SA 3WY3A 3E2HB 4MQXD 4BFIA 1UH4A 2YMOA 2V0AA 2DF3A 4FZEH 5I0DA 1I9RH 3EYFA 2EKSA 4FTVE 1UZ8A 2IG2L 3LN4A 3MLRL 2Q86A 3QDMB 1VGKB 3VXMB 5ICYB 4CC1A 3PWVB 4P23D 3TV3L 1YEFL 2YD7A 3VFOB 5HYJD 4WK4B 3UXFA 2F58H 1KELH 3QJZA 1OT1A 4AQEA 5CCJA 2HVJB 3O45B 1MFNA 1SEQH 4NQEA 1KGWA 3L8QA 3FYEB 4NWTH 5KS9F 1GA2A 2A4CA 1CN4A 5I0YA 5IWLA 4XNQA 4LPTA 3U30C 3CZJA 2A5UA 5A3ID 2ZWYA 5L9DL 3K5RA 3QH3B 4EDXA 2HPOA 4M5YL 1AGBA 4WEBL 3MRQB 3V4VB 3RTQD 4LSRH 2APBA 1CFVL 2OL3B 2XUWA 2X4RA 4QRUA 5IQ9B 3JWDH 3U82B 5GXBB 3KBEA 4JQIA 3TBTA 1YJDC 1MFBH 2HTKC 3B2VH 1SYVA 4H8WH 4IK7A 4DVBA 3CSPA 2H0FA 1JPTL 4OZGB 2CRYA 4ODWA 3P11H 4LGPB 5FR3A 1BZEA 4QJ3B 3GB7B 4PD4J 1WBZB 4ZMLA 4MZIA 4J3OD 5EU4A 1J9QA 1BSIA 1QBAA 3VJ6A 5EC1A 7FABH 2R1WA 4JKNA 5MHSD 5CP7B 3N6YA 4DSYA 3LKOB 3ZO0A 1GVIA 3GSWA 3A4AA 1IFHH 5JZ7D 5I71B 3WFDH 3EG9B 4UMGA 4GMSL 1VJSA 2X6BA 3QPXL 5KN5B 3Q8AA 4YXKH 1ZLWH 4X9FA 2NW3A 1AQMA 3LXAA 3IXTA 3L3OB 2ZCKL 3WHXB 2PKDA 3VXOA 3K8KA 3MJ7A 2NY1D 3A67L 5HDOA 1YNKH 1S8DB 5T3XL 1D6EA 1H0DA 5HVGB 3S8FB 2CIKA 3OKOA 2XY1A 4GRWF 1UACL 1MFEH 3OF6A 3PUUA 2O93L 1HWWA 3VI4A 1NFDB 2DPKA 4CA4A 4F8OA 3BQUB 5ETUB 5GGTA 3P4OB 3IKCA 1OTUD 1WFMA 4NQDE 5EUOB 4JRYB 4AQ1C 4OCWL 4PRPE 1MUJA 4H26B 1UZ6E 3A3YB 1OP5K 1RY7B 2YQ3A 4NHCH 3W9DB 5IROC 1A65A 1IBHA 1FCGA 3TWCL 1JCKA 3K6DA 4PS8A 4JL1A 3UTSD 4PJFF 4DVRH 2H2SC 4KK5C 4KKAC 4HV8A 2JF1A 4XPGH 4K9EL 1I4FA 2R59A 4IKIA 4JM2D 3QWNA 5HDQL 3PL6B 1F4XH 1I75A 1YEIH 5IGXL 2XG4B 5AUMA 1UT1A 2NUTA 3WJLA 4DNLA 2OMZB 4NRXB 4YHYC 1OAUH 2EDLA 1UXWB 3FOMB 4Y4FA 2QGCA 3FTSA 5DJ2A 5B8CC 1NCCL 3FBQA 4PS4H 4LBEA 4LEEA 4YE0A 5KTEH 4OI7A 4H2CA 3TT1L 2EH7H 4R4BA 4ONHA 1FAIL 3V4PA 1S7XA 2QR0A 3IU4H 3NN8A 2BCKA 4FLHA 1WIPA 2VMFA 5BV7L 4XVSL 3MOAL 4GAFB 5E6IB 3KWXA 3BAXA 3KLLA 2FR4A 1IGML 1H8LA 3GI8L 4RRPA 2HTKD 1NCUA 3OKNA 3SSGA 1N4XH 4OFVA 2NW2B 3PQYE 5DLML 2EABA 4XCYA 4A66A 2AS5M 1J8HA 4P04A 3HR5B 4G8GE 4D9QD 4K3EL 1NBYB 4NC0B 1L9RA 4IOSA 4MJHA 1XF2B 3V10A 3NSFA 4R7LA 1DFBL 1HH9A 3S5LB 1AQDB 5E5RB 1KB5L 5EU6E 4JN2A 5EBGA 1HZHL 3IMWA 1SYSB 3QR2A 3V4VH 2Z91A 4EBQH 3F12A 4JFXB 2OL3H 1TU2A 1XAUA 2APWA 2APFA 2WOBA 4OI9A 4YXHL 3SJVD 2HLAA 3D8MA 3U9PH 4KOBA 4EXKA 2HCZX 1YYMH 2EXSA 2X4UB 3FRUB 3C6LB 4JE4B 2I9LB 4Y4KD 4D8OA 1KXQE 1U91A 3BPOB 1X9RA 4GAJL 1TEFA 5D7SH 3CSYA 2HKHH 3F84A 2JELH 1FL6B 5EU5B 3NCXA 1VCAA 4P46B 5BCAA 2G2PA 3QJUB 3RUGF 1ETZA 2FWOB 1D9KD 2E8YA 3FQXA 4OGXH 5IROD 2VXQL 2I07B 1QRNE 3LIZL 3N3EA 1T7VA 2G75A 4BFBD 5CCGE 3F7VA 4JFSA 3QT2A 4LRNH 5JLZB 1P1ZB 4KK5D 4X6DA 2KLSA 4LK4A 4NZRL 2C3XA 3B8YA 5DQDH 4AIZB 5DRNB 4QLRA 4K15A 2O72A 5E0FA 2NX5D 1MFCH 3LD8C 2OYLA 2NDGA 2BXYA 5L2KB 5F7LB 5GGVL 3VFUA 4BSVA 4JGUA 3TJEH 1PBYA 3LS4L 1A47A 3PF2A 5F0LB 5EU3A 2JJUA 5FGCB 1OTSC 1WS8A 4X4MA 4ECNA 2YUWA 2UXFA 2JE8A 1AXIB 1LWRA 2FIKA 5DEGA 2W9DL 4JG9A 3U6RB 4WNJA 5CNHA 5DS8A 2LV4A 2N01B 4U3SA 2JKSA 2Y0SA 3BN3B 3QNZB 4PJGA 4XZ4A 5A2BA 1LWJA 4HOZA 1ITCA 3VSTA 3KCPA 3RG1C 3UC0L 3M17B 2QT6A 2X2YA 2WLIB 5I6KA 2NXZC 4RDBA 5CLTA 2WIIA 4QRPA 4PRAA 4LHQB 3LKQB 1X5HA 5FA4A 3KS0H 5K9OB 2LTQC 1DQML 1JK9B 2H8PA 3FTWA 2YLHA 4W9JC 5TDPA 3SODB 5FEBA 4DK3A 4L9LA 5JHLL 3ULUE 3ULVF 2R29L 4Z9KB 5DK3A 2G9HB 4L8SB 4TKWA 3NFPA 1AIFA 5BZWB 4PD4K 3UZVB 5FO9A 5KJ7E 4YWGL 1CXEA 1JTOA 1MCPL 1JPSH 3DWTA 4W9IC 4TYUA 2GAZB 2GJPA 3B3IA 3KL5A 4NO0B 2B16A 1E6JH 4JFWA 4DP6X 2VGLM 3L4WA 1BJ1H 4N2IA 4HWNA 4F20A 4OGAC 3KEDA 2OTWB 4ABQA 3KLAA 5B4MD 1G1YA 2JKWA 3M8OH 4PCYA 1AHWC 4YAQB 3QA3A 3R06A 1PL3A 5E9NA 3AQXA 4BK5C 3TJHC 4XP1L 4DKFL 1JWUB 4ZW7A 2A6IA 3RL2B 2VR6A 2N0MA 1KIRA 3TN0B 3V5KA 1PZSA 2HRHA 1J1XH 4H25B 5FM8A 4RMTA 1K4CB 2IGTA 2Q0ZX 2MCPL 2NY5L 1IGYB 1IGTB 3HLAB 1SZNA 2R9HC 3SDCB 1UJTA 5CP3H 4FA7B 1CC3A 4NZDA 3CLEL 4KROD 4E9QA 2OKMA 5D7JA 3GRBA 1XF3B 1FYTD 2YXMA 3IDJB 3RWCA 4FADA 5ISZA 1OSYA 1FUNA 3FT1A 1JIBA 3H9SD 1KCKA 4GY4A 1DBJL 3FMGH 3FPYA 3N06B 2MHAB 4HKBB 3I3DA 4M7KH 1OTSD 5BQ7B 1OGAA 2W8CA 3BZEB 3QUKA 2DJSA 2KBGA 4PRBA 2G4EA 5E99L 3TBYB 5HBBA 4G9FB 3VI3B 4L4TE 1KIUB 5IMLB 1D6VL 4ZBJA 3QUHA 3GS0A 4CGUB 2O6EA 3VXUD 4AWJC 1SN5A 1XF4A 5FYLD 1UD8A 3NPSB 4D7BA 2XZQL 3UL4A 2UZXB 4QOKE 2D8KA 5CN1A 3MJ9A 2GFBB 4NKOB 4OFPA 2FL5B 4NQCA 2PABA 1R24A 1ITBB 5E6UB 5KYXB 3GUTB 5KYUA 5KW9H 4JM4H 4TSAL 4ZXBC 1NMAL 2XOTA 4PJIA 2PWEA 4WF7A 4OZHE 5LN8A 3T8VA 5K1JA 4JK0D 4FJ6A 2P45B 3T1FB 3TC9A 1TUPA 2HFGH 4KJWC 1A6VL 1IGCL 3SKOA 1TTUA 4UAOB 5DZAA 3MTXA 1NGPH 3QJVB 4W4OA 3TH2T 2IH8A 3SPCA 2GJZA 2WXRA 4B6ZA 4YGVB 4MXWH 3A47A 2XZCL 4UM9A 5E2TH 2R4RH 3LPOA 1JWSB 3VXRB 4OGAD 5LG1A 3R8BB 2ZKYA 1HHIB 2RFXB 5KSAB 2LGNA 4A6YB 1SQ2N 1HHGB 3AS1A 4KUCF 3HIZA 3HR6A 2XX0A 3WEBA 2YSSA 3TJHD 3FQRA 5E00B 1QSVA 1QSFA 2FO4B 4HISA 2X6CA 2YKLH 5HD8C 4MD0A 3IDXH 1CVSC 5I18H 1MJJA 1AGFB 5C0AD 1K4DB 2K70A 4QHLA 3OPUA 4PG2C 1MPAL 3TA3D 1XCTA 5G5DB 3GMRA 4I7ZC 3TF7C 1EAQA 4PR5B 4YPGB 1EDHA 4DEPB 2R9HD 2BSDA 2PYFB 2X9ZA 3HC0B 3Q1SL 1TJIL 2Y06H 3D4YA 4WGWB 3P4LA 5DVOA 1FDLL 2K6ZA 4BQ9A 2QHRL 1J9CT 3QC6X 3OBAA 4O2FB 2FECI 1F3DJ 2V3FA 5D6CA 2NZ9C 3U48A 4AKOA 2GTWB 5AW2B 1QLFA 3VGBA 1EZVY 1IE5A 4IU3A 3WS3B 3UTTE 5DQ9A 1IC0A 3AXIA 4OUUA 3VDAA 3BH8B 3K46A 2WWNA 2Y5EA 1JGDA 3DOHA 4QKTA 3ARZA 3QBTB 3ILDA 5KVDH 3MLVL 2V8LA 2FWSA 1W0VB 1ZGLB 3S8GB 1IZJA 4LF3A 1UH2A 3FO9B 5HSFA 4MQ7A 4X4KA 3LN9A 5K9JL 5H37H 3FHAA 1DDHA 1UZ6F 1YJDL 3E6FB 3IDUA 5C0CE 2VMDA 3ARDC 5LO7A 3QUYD 4KDTA 1BD2B 3UBHA 2YN3A 4Y5YC 4FKKA 4ZXBD 4QXGL 4MMYA 3QDMA 3VXMA 3IETB 2FEEI 3F7YB 3BP4B 3KYOB 5HHPA 1PTZA 4Z3TA 3V79C 4Q52A 3VH8A 2DBJA 2NUPB 2R2CA 1EA9C 3PWVA 3S4SA 2L7QA 3V0WH 2A73B 1OAKL 2QSVA 3OJDB 2Z8RA 2W65B 3ETBF 3GMPB 4PJDA 2V5SA 2BOBB 3DV4B 3QCUH 2HVJA 3O45A 1E4WH 2MQCA 5FO7A 2Q7NA 4LESA 1P2CB 5GISH 4JRXB 4A1RA 3HB3C 1RZ8A 1MFUA 4M93C 2AXFB 2B5IC 2BM3A 5JXEA 3ARBA 4WI0B 1U36A 1L3WA 1U3HB 3BAIA 3QH3A 4TNWK 3WL9B 9CGTA 5K5YA 4W9FC 4GLRI 1FVCB 3IU3B 5HD8D 1OO2A 5B3NA 3PWUA 1I9EA 3T2PA 5C3IA 1KV7A 4WUUB 3C09B 3DIFA 5M95B 1GC1C 4S0TD 3MLPA 2IFGA 2IAMB 4OZGA 1ZK9A 3V55A 4AGMA 1MDTA 3SYCA 2YAMA 3P3TA 1WBZA 3K72B 1WAAF 5FGBC 3KNBB 4Y16C 3WMPA 4A2HA 1MNNA 2A74C 4WW2F 5D7LD 3LKOA 4M1GL 3QJQB 4NZFA 2NZ9D 1QA9A 2OI9C 4NCC1 1CQYA 1KN4H 3D2TA 4Y88A 1QBML 2H45A 3BFOA 5J3HD 4XPFL 4DZ8A 3DMMC 4F7TA 2F1BA 5KN5A 3WTWA 5LNEA 1XF5B 4YSSA 5CZVL 3WHXA 3L3OA 4PJHE 3K1DA 2GABA 5I82A 5AEAA 1XQ4A 4HIIB 3U2SB 3RVVC 3QUXB 4LAQL 4FNTA 2FO1A 2XZZA 3ABLB 4Q6IB 5ANMA 4ZOCA 1FNGA 1JVLA 1S2EA 5I1IL 3PNWB 3S3CB 3MCYA 1NFDA 1RD6A 3BQUA 3HN3A 3D18B 4JRYA 4PJAB 4H26A 5D70L 4PU2A 3VD7A 4RX4D 1DSWA 4ZS7H 5I1JL 4GYBA 4HETA 3WEAA 2J4WL 4JFEA 3V4LA 5C2BH 4Y5XB 2BS71 5DMIH 3U0TA 4OIIH 4EI6B 4NOFA 1D5IL 2ZCZA 2N0KA 4XCFL 4XAWH 4P5SA 1K6QH 2IPUK 1OD9A 3PL6A 3JSSA 5F9OH 1AZZC 1MI5D 1BF5A 2GJRA 2OMZA 4PGDB 3HB3D 3CD4A 4OM0L 1E0OB 1V8HA 3UYPA 5EIIB 1UXWA 3VRIB 5HJDA 4XMXA 2B59B 1A6UH 4XMLL 3GHPA 5LGKA 1H3PH 4PV9A 2QKIC 1IAIL 4KNTA 4OCYL 1TZAA 1I7TA 2YHGA 4NJ9H 3LKNB 1M1SA 3QIWA 4N90D 4XPTH 3B9DA 1OW0A 2QFPA 3ATDA 2NW2A 3GBLA 2VN3A 2YGQA 3VVVA 3H9YA 1R3LA 2JTYA 1KULA 4U1GC 4TSBL 5I5RA 3P4NB 4NKDB 3ES6B 4G43B 3FTVA 2X70B 1IILE 4IHOB 5GSRB 1YLBB 1MF2H 1KTBA 2QQKH 4EF3A 1F18A 5AYUH 1MZZA 1F11B 1J88A 1ULVA 4N2GA 5AL8A 1PKOA 5I8OH 1XF2A 1EHXA 5HYJE 4Y9CA 3MSPA 3S5LA 1YQVH 3FK3A 3B7RL 3IPBA 4C56A 1X5LA 1YEEH 2A9BA 4GO9A 2YFOA 3M07A 2J8OA 4X6FA 2IBZX 5D7IB 2VIRB 4G1EB 1KFAH 2EUWA 3RVVD 3KPMB 2AJUL 4WO0A 4C4KO 3FRUA 4IOIB 3C6LA 3CVHB 1NGWB 2JLLA 3LH2L 4IBZA 1E28B 2NY3C 4JPVH 5FYLL 4TQPA 1TQCC 2QPUA 3QWRA 5EU5A 1O6SB 4M8RA 2LAAA 1FFTB 2XTJC 4LNRB 4BZ1L 3BVXA 2YGOA 3ULSB 2ATAA 4M9PA 2I07A 2WVSA 1TJGH 5BZZA 5DRWB 3U36B 5HHOE 1JOIA 5MHSE 4WV1A 4DJMA 1IGJB 3MRPB 1FG2B 1FSKB 4AIZA 2XRAH 3NJGA 3D52A 1HCZA 5FECB 4IRZL 1PYWA 4UIMA 4LCVA 2B77A 1DSFL 5JR1L 1J5OH 2QQQA 3AGVA 1IKFL 5I73B 2I7SA 1N3NA 1NGXB 3RVUD 1X9QA 1UT2A 3LQAH 3MRLB 3VXSD 1KJMB 2ZF9A 3WE1A 2JXMB 3TOPA 1WAPA 4HLEA 1L3NA 4YSOA 2J8HA 2IFFH 1NAMB 2B1AL 3PHOB 4UV7L 3MV8E 2WAHA 3BCFA 6PCYA 3F7PC 1CL7L 1N7MH 4U1NB 3M17A 4X6CB 1E9QB 2WLIA 3UBXI 4FQQB 1HK6A 4LVHC 4XVTL 4F57H 4M1CC 4K4KA 3RIFK 4OZHF 3VFSA 2K7PA 2E7LC 3LKQA 1BYOA 4XO5A 3FTGA 1U8MA 5J12B 5K9OA 2FQGA 2OR9H 2Z31B 3WJJC 3QZBA 2X44D 1BFOA 3OL2A 1JK9A 3BE1L 3UTSE 1GPOL 4O9HH 4YDIL 2H47C 2YXWA 5SWSE 3MXVL 4HOMA 2G9HA 4L8SA 4OT1L 3EYOB 1N70A 5ELIA 2A9ML 3PU7A 2QSQA 4HF5H 3HHRB 4HK3N 3QYCA 1XR8B 2XTLA 3BKMH 4A2LA 3KPSB 2GAZA 3PJSB 3T8MA 1JXJA 2RA1A 1LEKB 3CMOH 5B1AB 4KKCC 4QT5A 2EACA 3VXPB 2XVKA 1Z6JT 2RCSH 4R8WH 1BMWA 3ZMNA 4P2OC 4YLBA 5AVQB 4LHUG 4OB5L 4YAQA 2R83A 5EEXA 1P9MA 2D73A 2YIHA 4GQZA 4XVJH 2ESVE 1JWUA 2A6KB 3ZW3A 5BVPL 1GXEA 3K8MA 3RL2A 3SDYL 3L4CA 1M7UA 3RZCC 2XTJD 3WKML 4H25A 1ZCRA 2Y7NA 4F8LA 4I3RH 1SN0A 2WSPA 1K4CA 3FO1B 2AGJH 4HMCA 3SO3B 4JGNA 4E9TA 3S35H 3HLAA 1N10A 7CGTA 3SDCA 3HZVA 4D9QE 2PCPB 4QEGA 4DP5X 1F8TH 4HXBH 4GXUN 4WLCA 3R4RA 3EGDA 1I1FB 3BQVA 4RISH 3IDJA 1TVBB 3N42F 5DT1H 3VD9A 3NZSA 2R4SL 5DSCB 1MAMH 1SEBA 2I32A 1HHJA 1OAQH 3HE7C 4OLZH 1N8ZB 2WUCH 1TJXA 5B22A 1CXLA 4MVBC 5BQ7A 2LW3A 3L17A 5DWUH 1F4WH 3RY4A 1DVFD 5I6PA 1KCSH 2P5EE 3BZEA 1T1WB 4PJ8C 1AXTH 4UB0L 4G9FA 3VI3A 4Z3IA 1OPOA 3BAYA 3KR3L 4N68A 2UWEE 1MIEL 3LV3B 3PAUA 1E9OB 4FJYA 3GO1L 4R5XA 5H94A 2J12B 2NTFB 3JWOC 4HOXA 4F1SA 1F2XK 2D7MA 2XBTA 2AJ3B 2UZXA 4LARH 1D5BA 5F3BA 4LCIL 3GBNL 1PLGL 2GFBA 4NKOA 2DQDL 4JY5H 3FU9A 2FL5A 3QXTA 4X6EB 3DYPA 4OCSH 4R4FH 4X5PA 5DK2B 1YN7B 2H26A 4FEMA 1FFPB 3T2NL 1I8IB 3DJSA 1BZ8A 5MEQB 4Z7UE 1P5VB 2OQJA 4PB0L 3QXAA 1AZRA 1B0GB 4RFNB 3U4BL 3IRPX 2NX5E 1A8JH 5DA0B 1HN1A 2A9AA 5AD0A 5KSBF 3DOSA 1WVZA 4HGKC 1NAMH 1XMEB 3AITA 4UQAA 2AK1L 2FJHB 4LPWA 3HC3H 4UINH 2VDQL 4HDIA 1KYFA 4WVRA 2JI2A 3LRKA 2RFXA 3SZKC 5KSAA 1UADC 2VM4A 4A6YA 3ZK0A 3EFFB 3KYMA 3BP5B 3FQWB 5E00A 2G2NA 3ORJA 1K8DB 4JRFA 2AK4A 2FO4A 4OBRA 1EHNA 2EDEA 3S0PA 5IJKA 2DQIL 1AGFA 3SKNA 2OJEA 2DWEB 5G5DA 4GXVH 3QUML 4Y4HD 4W9CC 4F8QA 3O6FC 4RCAA 5CGYD 4EE2A 5ABZA 4QTFA 3GEWB 1BQLH 1U58B 2YBGA 4YPGA 4CC4A 5IUCA 2F18A 2F7OA 2NR6A 4M5ZL 1Z9MA 2TRYA 2G3ZA 2CA4A 2ZAHA 5D6DC 1CBJA 3MMEA 4N1EA 3AU1A 4Z7QE 4DFIA 1KB9K 4G9DB 4WFHD 2ITEA 4DPCX 4IEFB 1X4ZA 3HE7D 4YHZL 2GTWA 4AVIA 1QI3A 4PJHF 2VDRB 4MVBD 4YDLB 1FRGH 2I5YL 3O0RL 3BH8A 2VXVL 1OTTD 4TL4A 4PJ8D 1PMYA 1TIUA 4MDIB 3Q5OA 3RBSA 3OTTA 1CCZA 1KY7A 1VACB 1F6FB 5PAZA 3AREC 4X9GA 2ALWA 4GW1A 1T03L 3HG1E 1SY6A 3KEHA 3LNDA 3U0PB 4U1KB 1UB6B 4UOQA 5IBTL 4OQTA 4BHUI 3IDGB 1TVHB 4PVLA 2HRGA 2XYCA 5B39B 2VLJB 1R19A 2Q1EA 4GP4B 3WO3B 3HI1A 1GC1L 5E94B 4W93A 5SX4I 2VLLB 1GRWA 1BD2A 4BK8A 4RWYL 4PI2A 1QLRB 1C1EL 1FIGH 2W0KA 2N4IA 5INCB 4X9BA 1W0WA 3GQFA 3RNQB 1YNTF 3IETA 3F7YA 2DQFB 4S1DD 3KYOA 5EBWB 3VXNA 3MLYL 3EYUH 2VCOA 1HKLH 4P49A 3HHSA 2XNAB 3NH7H 2X10A 5EZJA 5C07D 3QEQE 4KXCA 5F71A 5GZOA 1YEHL 4GMTH 2DKUA 3RX9A 4HUNB 4RFOL 5KSVA 3GMPA 4E42B 2BOBA 3DV4A 1INEH 2Y72A 1S5HB 2R0WL 4P2AA 4XMVA 2BVPA 3ECBB 4NFBA 4N2CA 3W56A 1G7LB 4JRXA 1DL7L 3HOGA 3SE8L 1ADQH 1Q8MA 4M5SA 2ETWA 1BYPA 2AXFA 4PW3A 1S5IL 2DMGA 1MCNA 1U3HA 2FX9H 1D7CA 1IBZA 3WL9A 2NY0C 2IAND 4KBPA 2WQ8A 1AO7E 3PXHA 5J6GA 3WV0A 4N5UA 1XR9B 1TSRA 3VXUE 3GIZL 2C3GA 1RLBA 2VDOL 4Z7VB 5CJOH 4JO4L 3O6FD 1V3MA 5E2VH 3O8XA 2W59A 1JZ5A 1Z2KA 4Q9QL 1JDCA 1P6AB 2ZUYA 4JFVA 4J6RL 1TTGA 3I50H 3LHPH 3MV01 1VZHA 3W2DL 2IO5A 4G8FB 2A4EA 2MOGA 3KNBA 4PTUA 3GTVA 3HNVH 4XP4H 1R5VB 4K5LA 5E8PA 4M56A 4I89A 4B7IA 1XXDC 1E9PB 3AY4A 3EJRA 3U1SL 3CUPB 2XQBL 1DCLA 3HJEA 4FABH 1L9PA 2CA3A 3CXHK 4J4PC 4R84A 3FQTB 4PJ5D 1JNHB 1VZIA 1XF5A 2WXGA 2F08A 2ZXEB 1UATA 2YD0A 3ARED 3IFOB 3NCEB 4XODA 5FDWA 2HKAA 1Z3GH 1NOAA 5TE6H 5AAMC 2R1YB 5HVHC 2EE6A 5I66B 1F3RB 3U2SA 3COOA 5J11B 1N6VA 3T8XA 4NN6B 4Q6IA 1GGBL 3F58H 4J23A 3WNJA 2JV6A 5L88H 3TCLA 2WPGA 3PNWA 1QSZA 5DI8A 5C0AE 5EEUA 3ILQC 5I16B 3FC8A 4JB9L 1A1OA 4GSXA 1DDTA 5KJRL 1NLDL 3G5VB 2P9RA 1TYEB 2CUIA 4WJ5A 1O9VA 4Y5XA 2CJTA 4P2YA 5CUSH 3EH4B 1MCEA 2N7BA 2UXTA 5TE7L 4EI6A 2DQUH 2JKIS 4U7SA 4LVNB 3POHA 1KUMA 1BEXA 4C83A 2ITFA 2F19H 3FFCB 4GUPB 2VXUH 3WXWH 3DV6A 4FQIH 5EIIA 2ADYA 4KRPB 1NM4A 3JZ7A 4R0LC 2B59A 3CC1A 4NZUH 4WWOA 2BVEA 1PG7H 3QI9B 3CZGA 2NY0D 2WBJD 1NFIB 2B20A 4G80A 1AJ7H 2WLHA 4FI6A 3DOIA 2Z8VC 4ZSOE 4N2NA 5LDUA 1H3TA 2YPLE 2WKOF 3NFSL 2VDPL 3DXAA 3O3BB 5HY9A 2BSEA 3FPXA 3G6JE 3T0VA 1QATA 5AG8A 4EUPB 5D4QA 3H53A 4FLQA 5DJZB 4K94C 4PJ9D 1YY9D 5F21B 2BFVL 1IKNC 4ZTOL 3GKWH 3FU0A 3APNA 4FLSA 2DI8A 4FG0A 1IEHA 4NKDA 3QXVA 3E8UL 1DBMH 3O2WH 4GFXA 1YEGH 4IHOA 3UAJD 2O5ZH 4ZX4A 1F6LL 1N0XH 3QIBC 2Y1ZA 4BE5A 1F11A 5J13C 2R1XB 4CKQA 4ALAC 5LQBH 2CRMA 4XN5A 1YUHA 3K81A 4OQ1A 5CEZH 4NS0A 2BSSB 4IBWA 4HC1H 3GMQB 1JF5A 3LXBA 3MRRB 1JHTA 4R97C 3WDHA 3O9WC 4LKXB 5IWLC 1VEOA 5D7IA 3BN9C 3T3MB 4OLVH 2IH1A 1ZA3A 3KPMA 1TZIB 4XHJD 4N2MA 1OSPH 3SE3A 5C9JA 4IOIA 1AD9B 3CVHA 4N5ED 4GAAA 1E28A 4L5FL 2E7LA 3MGOB 3MLXL 4RA3A 5DGRA 3VD1A 1J5CA 4LSQH 3QAQA 5KS9A 2GIXA 3ILQD 1NGZB 1VB9A 5CXPA 3LPFA 1KCUH 4TM9A 1ZV9A 1E8YA 1WSST 2MTAA 3WELA 1UA6L 3UCQA 4R2GB 5ALBL 3X3GH 4PCTA 4ERSL 1T21A 3O6LH 1EVUA 1IQDB 3GRWL 5HI3C 2J5LC 5I74B 4LP8A 4XO8A 4U6HA 1AR1D 1R4XA 3MRPA 3VQ1C 2J6EH 5D7LE 2APXA 5FECA 3D0AA 3JT2A 1V7NH 3TBSB 4PH8A 4BFOA 3EOYG 3T4AB 4O4YL 2FVNA 4MZRA 1SDDA 2OYPA 2H6PA 3ZSTA 5K93A 1R75A 2O5YL 1NGXA 2UWEF 4KK9C 4DGUA 5DYOB 2EUXA 3I02B 3MRLA 3PFUA 4XPHL 1KJMA 3K6NA 3JTTB 3T0EB 4GRLB 1DJIA 3IEAA 2R39A 2B1OA 5DRXA 4GG6A 1AE6L 1IC4L 1WV7T 3PHOA 4N0UB 4BGDA 4LSVL 4JN1H 2EIKB 3CSTA 2A2QT 3SQOH 2BNRD 2GB2A 2EE2A 1PZ5B 2C9SA 4U1NA 4Z3HA 3QC5X 5CD3A 2BWDA 2Z35B 4F8TA 2J1WA 1RQ5A 1MAJA 2I24N 3DJ9A 3S3PA 3N40F 3VYPA 1S3KH 2P24B 3SDAC 4YH6A 5KG9A 4MLSA 5DVKA 2Z31A 2EDNA 4S1QL 5ESVB 2J2ZB 2EUVA 1QRNB 2FH8A 3F3HA 4OD3L 3W0WB 3ZHNA 5A7EA 3CQQA 1DSYA 1WDAA 1YPZE 4N3UA 1I85A 5KBLA 4I18B 3EYOA 1PG7W 2CO2A 1MI5E 4CW1A 2QVTA 3NIDE 3A4DA 1NBZB 2YEZA 1XR8A 3O9WD 4Q56A 4UTBH 4F33B 5JQIB 4PJFA 2CJUH 1T6WA 3PJSA 1T1XA 1AS8A 3D9AH 4XRCB 1LEKA 1HXMA 4P3DB 1AP2B 4FQJL 4KDVA 4EUPH 1ZT1B 3DVIA 4QYAA 3JWOL 1DQJB 3OZ9L 4G3YL 3MRKA 5DHEA 5ACZB 3TVMC 4Y2NA 1BQKA 4P5RA 4ODTL 2A6KA 1DQDH 5EOQL 2DV6A 1A0QH 1EANA 3QUZB 2Q8AH 1SBBA 2BDNL 5TDNB 4N90E 3ARFB 2MJWA 4L4JA 5E51A 4TNWF 2YS4A 4QI3A 3QHFL 3FO1A 1VSCA 2KZKA 3HE6C 4Z7QF 4N3TA 4ISVA 1K9TA 2EYSA 4K3HA 1OZTG 2EYRB 1A7NH 4XP6H 3QFJE 5GGQH 4ZMPA 4N2OA 1BXUA 1QBLH 3VWJC 4UYPA 5FYJU 1TVBA 4KXZH 1P6WA 2YD2A 3WN5B 5JPNB 1EMTL 4UDUB 5C6PB 5GQBA 1EPFA 5FUZH 1B4JL 1Z9NA 2VLMD 4IMLA 4NRYA 4KK9D 2FLRT 3HHMA 3N5AA 2GUYA 1T1WA 3CN2A 5J6HB 4DP4X 4A2EA 5CD5C 1CDIA 4IIQA 3T2LA 1BG9A 1LK2B 4F58H 3BT0A 1E9OA 1EO7A 2NY4B 1BVNT 2VZTA 3E80A 2HH0H 1WBXB 2LQRA 4OCRH 5B3JF 3WI9A 5E4EB 2AJ3A 5HHXH 1NCTA 4W4NA 4MYWB 4KTEL 2VDLL 3O0LA 4N9GA 1KGUA 2JSFA 2V9TA 2GBVA 4X6EA 4D9LL 5EEWA 4GG6F 1LD9A 1PD1A 4HULB 4XMTA 3UTPE 3ZYJA 4YK4C 1YN7A 2GSIA 4KITB 4B5ZA 5ITBL 3T6ZA 2WQWA 1AQHA 1BAWA 1FFPA 4XPAL 1EEUA 1I8IA 3G9VA 5DQJB 5LBVA 1P5VA 1CR9L 2WXOA 3QNYB 3ARVA 1I9IL 1DO6A 4FGMA 1U3NA 5I1KL 1NMBL 1UKQA 3S35X 5DUMH 1T6BX 1N9PA 1IC7H 1ES0A 4OLEA 2E3VA 1ZHKB 4HWZB 4MA8L 1UWGH 3ZYOA 4XCCL 3HRZC 4HVBA 3QZWB 1SBSL 3B7UX 2PO6C 2VN6A 1XGQB 5JA9A 1S9KC 3D4CA 3HTLX 3VXSE 5C0BB 5HYIA 1QWNA 4HFWA 1YMHB 1FZMA 4O5LL 4H88H 5FYJD 2LFEA 3TVMD 3PCYA 3L1OH 2WHVA 5JW3L 1K8DA 5IFJA 1P53A 3GSXB 1IQWL 4POYA 2DWEA 5FLUA 3V7MA 2VE6A 4FULA 1IM9B 5CAYB 3WLBB 2VLRD 5IHZA 4MNGE 4LHUD 5LCVA 2VDML 1MCWM 2BSRB 4N8VA 3VWJD 35C8L 4EI5A 2CM6A 3P69A 4L9LC 5D1ZC 1INDL 4W9EC 1AD0B 3DHMA 4YUEL 2OSWA 1TJMA 3OAZH 1HL8A 2ICWB 2VXTH 4IEFA 3ABMB 2EEBA 2QSTA 2X7LB 5JYLA 1BWMA 1FORH 2Q8BL 1YN6A 2HX8A 3MLUH 4GO8A 2LU5A 1KMGA 1YMMD 3MREB 2ZCHL 3AM8A 1VACA 4X7EC 1KYOJ 4HWEL 1EFXD 3B1TA 1KBGL 5CZRA 3UYRH 5H37G 4PTTB 2DQGH 3U0PA 4G7VH 2HT2C 2ZICA 3N50A 3IDGA 1C12A 2DL9A 1NGQL 5K69A 5JHDB 3MRNA 5E94A 1WFNA 1EJOL 1Y0LB 3N1FC 4AGNA 2AQ2A 6TAAA 3QP3A 4PRHD 3A21A 2VLLA 4Y19E 1B4LA 1J1PL 2XTJE 4IBTA 5TH2B 3PGFH 5ITFA 2BHYA 2VSDA 1G9MH 3CWGA 4FXGB 2XN9B 5INCA 3V6BR 4UDTA 4DK6A 5E03A 4KKBD 2DQFA 5EBWA 4ZTPL 1WIUA 4XXDB 2UUDK 1X5IA 5EZOL 2O6PA 4YFDB 3ZE0E 2IDTA 1PJ9A 2Y7OA 3TYGL 2R56L 2WINB 3U9WA 1S5HA 2DBLH 3ECBA 4J3SA 5C09D 1OT2A 2PO6D 5E56A 4WI3A 4QRRE 3ATFA 2F53B 3EHBC 2X4QB 2GT9B 4AH2A 5HYSG 2ZUQC 3ASNB 3G6JF 3RB7A 2D0FA 3B4NA 4TUUA 1CQKA 5DZOA 5H8DA 3S36X 1SOSA 4ZW3A 1XR9A 1ZD6A 2ZPKL 4L5FE 3GXPA 2XWJB 1E2WA 1ZVSA 3TEYA 1MJ8L 3KPQB 1DQIA 2GIMA 4WO4C 3EUUA 1PFOA 5IJVB 4F15C 2N59A 2QSCL 3GKZA 4DGIH 1JXFA 1WBYB 2G60L 3GM8A 3JWDC 1E30A 1O7DC 3CFMA 4LCCC 5D1ZD 3HKFA 4FTVA 3G08B 1RVFH 3TV3H 4H8WC 3RIFF 1OF0A 5IVZB 4AUUA 4AY0A 2GYSA 1W72B 1L9MA 4Q74A 4B5EA 2E7DA 2HUHA 4KTDL 3MV7D 2QFRA 2V2WA 3CUPA 4W4OC 5AVUB 3WY2A 1BXAA 3FQTA 3IFOA 2ALAA 1V3LA 5C0GA 2D7QA 2Z4TA 5J1SC 4UTAH 1V3KA 4JGJA 43C9B 5L9DH 4GSDL 5ABDE 4Z77B 1T6VN 1U8NB 9PCYA 3RPBA 4OZFA 1RJYB 2HT2D 5I66A 4HKXB 2HLFD 4TUKL 3L81A 1FGNH 4HUCA 5TQ2H 2P5WD 1M4KA 4APXA 3QDJB 1CFVH 5DFVC 2QQLL 5J7CC 2H9GB 4NN7C 1M7DA 4K94L 5AOKA 2CALA 2DM4A 2FHBA 1Q0XH 1QSED 3ARUA 1CE6B 1IEBA 4WK2B 1MJ7H 1VDGA 3VE0B 2B9AA 1ECYA 4JFZL 4JPSA 2VKWA 5F2FA 5BRZB 5MI0C 3S7GA 4JGMA 4OKVB 4LDEB 3LYRA 4HALA 3G5VA 2ZOTA 3QZLA 3QJXA 4WI9A 4ALAL 2HSIA 2V5TA 4D7PA 1OAYL 4CNIA 1AFVL 4UANA 1R3IH 4AG4H 5C6WH 1KCVL 1KJ2B 1RSYA 4OJYA 4WFHE 4KU1A 1TYRA 3PREA 2F7PA 1Q90A 3WXVL 2OP4L 1BVKB 4UQ9A 2YZ8A 4ATWA 4P2QE 3QZOA 4V2BA 4LPVA 2LLLA 3EHBD 1AZCA 4G6FD 4P2RD 3FHEA 1ODUA 4YDVB 3DI2B 2VDNB 5SWQA 4FG2A 5D1XC 3DURB 4ZD3L 5CJ8A 3D1MC 4J1UB 2A9NL 1SXCA 4KVNL 3IBEA 3STBA 4KDTC 1UD2A 3N91A 4YZFE 4WO4D 3TIDB 4KZDH 2IDFA 4NXSA 5JW5B 1IGFL 5DJZA 1SJHB 4AL8H 3B2DC 5DHMC 2Y07L 1XL4A 4X0KB 1ZA6B 3V2AR 5KVEH 1I7UB 4L37B 4NQDA 1M1XB 3OXSB 4FFYL 4Q58C 1KZYA 4PRPA 4WNQB 3TEWA 1KGYE 4DQOH 5I1HL 4ONFL 4PGCA 4XMKL 2YARA 3JXAA 5DUJA 2D3LA 3NIDF 5C07E 2R1XA 4RLDA 2OX5A 3O2DH 4DQAA 2EVGA 5FUOL 5DHDA 2QADB 3AABA 2C4FT 3FH7A 4S1SL 1M05A 1QLEH 2BIQA 4LCWD 1HCFX 1BIIB 3GMQA 4RAUB 5HHMB 3V5DB 3U6XA 1IAIM 3BT2L 3MV9B 3C8KB 3LPGA 4X7TB 3CZFB 1IEAB 2O1AA 1TZIA 2OYKA 1FV1A 1NCBL 2CZNA 2YPVH 3P0YH 4TQIA 2VJ8A 4HSCX 1O5PA 1AD9A 4RQQB 5DFVD 3Q8CA 3WTSA 5GGTL 1WFJA 1XB6A 2E76C 4IJTA 4MAYB 1NEZA 1K72A 3P30L 3FRPG 1NSNL 3BSGA 3L2NA 1W72H 2W9EH 3O4LD 1I1YB 1LDPL 2Y36L 3PQYA 1ZLUK 1T1ZB 4IRJD 1FVEA 1S9WA 4EIGB 1JZIA 2X4SA 1JMXA 3Q2CA 4G8GA 3TBSA 5I71C 4KKLC 1N59A 4OFYD 4P23B 2MIZA 5HYJB 4FC3E 1XSKA 2Z92A 1X5XA 4D94A 3L3OC 4HZLB 1F86A 1MIML 4OJFL 4WW2A 5CIPH 5D5MB 3JTTA 2VDKB 2A77H 4GRLA 3T0EA 3OKLA 2FT7A 4TSCH 5D1XD 3LRMA 1KPUA 3G9AB 3P4MB 3V0EA 4AEEA 2KS0A 2R0KL 4JVPA 1PZ5A 3R7RA 1Y7VA 2DIJA 1TVDA 4FFTA 3A6CH 3P40A 2PXYA 2Z35A 3BI9X 3GXTA 4HBCH 2H1PL 1KXQA 3RTQB 4LLMB 1KJ2H 3AB0B 5AWNH 2DTML 3D85A 1FGVH 2YUZA 4YC2B 1U2HA 2PYED 4G59C 5FCUL 3JZYA 3MKGA 4BFNA 3LKSA 4B9YA 3GEFA 5DJDB 1A9BB 1Q72H 2YD6A 1E4XL 1B3IA 1MRDL 1QRNA 1RZQA 3PJLA 4MZ2A 1JI2A 2G5RA 4PJCB 3FN0H 2DQEH 2WK2A 3DUHA 3GJFK 1UD4A 2VDNH 4RMWA 2A83B 3EADA 2IWGA 5TF0A 1NBZA 3RGBA 3VFMB 2Q3ZA 4TL5A 4F33A 3UBGA 3MRGA 3NIFE 4P3DA 1AP2A 3KW7A 1ZT1A 2IQ9L 4HWBH 3WLWD 3K3QA 5E6IC 3TXAA 3VRJB 5I17B 4P05A 4I4WA 2F7IA 4JANA 4FE9A 2NY1B 3BKYH 1KTLA 4EZMA 3DSNB 4XN8A 5DUPH 3D07A 4Z5RB 2EIEA 3BPCA 5I15L 3FH8A 1TTBA 1Z9LA 5LAPA 4B9FA 3ME0A 4U7KA 3OQ3B 3SGJA 2J43A 4GKZA 4MYPA 4GT0A 1EO5A 4JFQB 1SVBA 1HE8A 2EE3A 3O11A 3RWHB 5EV7A 2X1PA 3L5WA 1WEJL 3OMNB 4X80L 2H41A 3MPCA 3UTOA 3EZ8A 3U46A 2G4GA 2YK1L 3AXHA 3TEUA 4M3HA 1URZA 4QD2E 4BIKA 5EFIB 4ZK8A 3US0A 2ZTBA 1MCPH 4JM2B 3R0MA 1C16A 2E47A 4Y2OA 1U8JB 1DO5A 3C5SB 5J6HA 4URKA 3S9DB 5FXCH 3GNMH 2JLPA 2PWDA 5FUCC 3T3PB 2P80D 4KAQL 1OLZA 1A5FH 1PAMA 1LK2A 2AABL 3AG4B 3LN5B 2GCYB 4F5CE 5BJTA 1T3FB 4I2XE 1WBXA 5F6HI 1RPUA 2YBRB 3VVWA 1MEXH 2APVA 4YHNB 3JWNH 4ZTEA 2XFXB 5I0XA 4P46C 2EKJA 1LE9B 2PR9A 1CE1H 5C08E 1AZNA 2BZCA 3FU6A 4E9VA 2H0JA 3ZE0F 5DQJA 3LNHA 3WKQA 3BVTA 5F1SA 3O2VL 2PLTA 2ROXA 2YQBA 5AW4B 2QDVA 3TBVB 5EF2A 2R0LL 1U92B 1DLFH 2NNCA 2VUOA 5T1KB 4G6JH 2BSTB 2VDKH 3U7WL 4HWZA 1A6AA 3THMH 3SO5A 2KDGA 3EOBB 2DS4A 3CK0L 3TCXA 4OF0A 4M00A 4BK4A 3S2CA 3KS0J 1UVQB 1FH5L 1XGQA 1NMCB 2NXYD 1WS7A 3D48R 5HXMA 1YMHA 4X7DC 1LO4H 2NNAB 3DDGA 5I6OA 2F6AA 3NTCL 3LS5H 5FIEA 3RGHA 3I75B 1J10A 1F1DA 1UWEH 1CYXA 4HT1H 1DCEA 4I77L 4JO8A 1LMKA 4L4TA 3SJVB 3WNKA 2K4AA 1OSEA 2BNRE 2KLRA 4WDIA 3MFGB 4LOVA 5MERB 2WO4A 3GSOB 4Y4KB 1BP3B 2AJVL 3FCTA 4MS8D 1IM9A 3E7JA 1LP9B 3SE6A 2HUEA 4UQ3B 3WLBA 5FDYA 4APQC 4FZEL 1BJ1J 3EO0A 4RZCB 1I9RL 1DANU 4UOJA 4E5XB 3H9HB 2BSRA 4AVHA 4PMFA 1D9KB 1CICB 2PWFA 4D0CA 2QJDA 2WM0A 1ZLWK 2QEJA 3GUFA 3RZWA 1CDCA 4L8SC 4OZHA 3K80A 3EO1A 1QPXA 1YEDB 2OCCB 4NQEE 3UGXA 2F58L 1KELL 5CJQH 4XXWA 5DTFA 2A0LC 1SEQL 4YHYB 3GYRA 5JMRA 3ALXA 1DQQB 4YSEA 3MCKB 2XKNA 1BOGB 2AI0L 4NWTL 3VFPB 3MLTB 2EVIA 4WRLA 3LQMA 3D69B 2N1KA 4HG4K 1P9MC 1O5DT 4JFUA 1HYRC 2CM5A 3H56A 3HG2A 4P46D 2D4FA 3TN0C 1Y0LA 3KM1A 4E41D 1HNYA 1KLFB 3H7LA 1X5KA 4LSRL 4XE0A 3T0DA 1QEXA 3Q44A 5TH2A 2EH8H 1LMIA 3JWDL 2C1PB 3QR1A 4AEHH 2ZXCA 2XN9A 1MFBL 3OGOE 3B2VL 1RU9H 4H8WL 1IJ9A 3LY6A 1SF3A 4IIZA 4ELMB 2PN5A 3IJEB 3Q1SH 4LSUH 3OR7A 4BCYA 2XXCB 4DKEH 3OX8B 4Q7DA 3MUGB 3P11L 5C86A 4JO3H 3EUDA 2WCSA 5L2KD 4TNVK 2Z4QB 7FABL 5TPWH 2ITCA 4NIKB 2E46A 3A5VA 3D0VB 1NQBA 4Z6AT 1GAFH 2DLIA 2YAHA 2VLME 1IFHL 3BD4A 1RFDH 5IG7B 3WFDL 3AQZA 2F53A 3UTTA 2X4QA 5CS7A 5IVXB 4YXKL 2OW7A 2V33A 4IQHA 3FTYA 2FQFA 3GFUA 5E08H 3ZE1B 5GSVA 5GRXG 4AC4A 4YZFF 2GBTA 1WWCA 1EFQA 4F1ZA 3PHSA 3NPSC 1TNMA 3UFIA 1YNKL 4YO0A 4AGPA 2XWJA 1BBDH 4X8CA 4FQXC 4HCGA 4JPKH 1PZAA 5IJVA 1MFEL 5C0CA 4APQD 3SGEI 1WBYA 1DN0A 4WU5B 1DFXA 1XMWA 4N4YB 1A7PH 4DCQA 1Z5LB 3N43B 4K7PX 1GY2A 4JDEB 2J1ZA 3MRBA 3P1VA 4NHCL 1J0IA 3G08A 1HXYA 2ZNWA 4M1DL 3U0WH 3C75A 3HG5A 1CG9B 4DVRL 1OM3H 4KROB 4LSPH 4JO1H 4XPGL 3B7TA 2JI1A 3EOTH 1KDJA 3FW6A 1FYTB 3QJSB 1F4XL 2DI9A 1YEIL 4NO0D 1NCDH 3VFTA 3H9SB 1GZQB 1OAUL 3MLSH 43C9A 4UNUA 4LLUB 4Z77A 1KB5A 5L7XH 1M53A 5DMGC 4EO5A 4PS4L 5KTEL 1FO0H 2BXZA 1IAOA 2EH7L 3FSAA 3QDJA 1BZQK 5HGBB 3TN0D 3IU4L 3GSNB 2N7AA 3CSBA 3IMRA 4JE0A 4XBEH 2X0VA 1ZV5A 4JZNB 4MXVE 2V7HA 3W11C 4LLDB 4Z76B 5AYTA 4JJ5B 3VXUB 3VE0A 1EO8H 4LSDA 4CC4C 4JO2L 5KVFL 1N4XL 3HFMH 1XWVA 2NR6C 3ZBMA 2VLRE 1TDQA 1X6LA 1OALA 1WGOA 1DBAH 3ETSA 2LTQB 3ZE2E 2J6WA 4NPYB 2CR0A 4PFEA 4PGBA 3ZHDA 3LIZA 4X83A 3PP3H 4KI5D 3ZHLA 5A6LA 2DMHA 5B39G 4L3EB 2IEPA 5FO8A 1BVKA 1I9JH 2AAAA 3T77B 1OAZH 4ONGH 1IFRA 3IMTA 4H0HB 1Z9SB 4YDVA 3LXCA 4GKSB 3V4VL 2CK0H 4EBQL 2F1AA 5AB2A 2OL3L 2K4WA 4LAQH 1ET7A 3DURA 4PJHA 5MEPB 1OARH 3GI9H 3OKKB 2CCWA 4I9WD 4J1UA 3KLQA 1YYML 3T08A 2YD3A 4FQXD 1I53A 1CLCA 4YX2H 5ADOH 5I1IH 3BW9B 5T1DH 4AIOA 1X44A 2EINB 5JW5A 3FB8B 4YBLB 5DJCB 2ATKB 3B2MA 3GSRA 3SKUD 2W0PA 1SJHA 1JD7A 5D7SL 5KWYC 1WIOA 4PRNB 2HKHL 2EICA 2JELL 3H4FA 1OXYA 2PNDA 2BRQA 1GJWA 3CFUA 1ZA6A 4X0KA 3DJTA 1I7UA 2J4WH 4L37A 4OGXL 1M1XA 1FQ9C 4WNQA 4X6DE 4Y5VB 3TA3B 5A43C 1E5BA 3NEOA 4CBZA 2WYZA 1UHVA 3N55A 4FLOA 1MW3A 3KD4A 4L1SA 1MW0A 1B4TA 4LRNL 1HHHB 4HIEB 2L3BA 1P7HL 5HTSA 5DQDL 4OLXL 4KZEH 2VJ0A 1JL8A 2KC0A 2KERA 1MFCL 5GHWH 3NIFF 1YNTA 4RAUA 5AQ0A 5C97A 1R3JA 5AOZA 5JHLA 3ABGA 2JJSC 2DAVA 2R29A 4I3SH 3SY0B 4P3CH 3TJEL 3C8KA 1IM3D 4NC1E 3CZFA 1MLCB 1IEAA 5EC2B 1U3HC 4MQTB 4U6TA 5DMGD 2WXPA 1FNHA 5C8JA 4ZUTB 2IH9A 1MH5A 3LZOA 3FT2B 3HNTH 4DZBB 3ZUCA 1CMOA 4EOWH 3NQIA 4RQQA 2BO0A 4KI1A 5HHNB 4PYHA 3NJNA 3TYFB 5AKSA 4MAYA 2FEJA 3VD3A 1M6OB 1FN4A 3PYCA 1MWAB 5JHMA 2IAMC 4OZIE 3OR6B 4Z7NE 1X5MA 3QUYB 3G7TA 4NRZB 1THCA 2DLGA 1YUKB 3PPEA 2AJZB 1UFGA 1T1ZA 3RA7L 1IBFA 4ZXBB 4JCMA 3IJYB 3LRSB 1JTTA 4N6QA 4TNFA 2XN1A 4F92B 2VRQA 4Q97A 3AY4C 3CFJB 2D3VA 1NOLA 2VW6A 4NN5B 2NSXA 5JDSA 5HYJA 5KANI 1KYDA 2BIOA 2MQ0A 4HGWB 5GRZA 3GBMH 5EZLA 4HZLA 3L3IB 3M46A 2WVTA 3GSNH 4NXKA 5ENWA 2WZAA 3SKMB 4OGZA 4V1DB 1JPSL 3QUXC 4FLRA 4MB4A 1Z3RA 4Z7OE 4LDOB 3ZTDC 3IAQA 3B3BA 2DLTA 1E6JL 4WHTB 4Q6IC 5FYKD 3VX0A 3LQAC 4OCNC 3AACA 1A22B 1LL1A 4BQ6A 1ZS8B 3M8OL 3L1FA 4RESB 4DH2A 5I5JA 1JZ2A 1CTOA 1TYJA 3RTQA 2FX8H 2HT3C 1ROWA 2A6DA 2R2HB 1HFUA 4LLMA 4KX7A 3S6CA 3ZQXA 4PJEE 3FU3A 4AQAB 1J1XL 4Q9BA 4X2UA 3L3HB 1AVAA 4RBPK 3WTVA 4WCYH 3OZLA 5HHOA 2WV3A 5L2JB 1Q9LA 3BAEH 1E67A 4FOMA 5F44A 3VD5A 4DPAX 1AI1H 3QVAA 5ESAA 2YD4A 2OTUB 1WC7B 2WNXA 4JKMA 2CO4A 3JV4A 4JBSA 4YS4A 2A83A 4BZYA 3TBWB 1KCWA 4HK3J 4EUPG 5DJ0B 2AEPL 1R5WA 4OAWA 3WYRA 3FMGL 4DF9A 5SX5H 4M7KL 2Z65C 2M26A 2E86A 2ZX8A 1JPGA 4OV6F 1S78C 5SV4A 2CLZA 4GAGH 3AJ7A 1B3JA 4IK6A 2XYBA 3ZMEA 1QVOB 3L3KB 5IQOA 4JCWA 4P9HH 1GW6A 3NG5A 4WUUD 3GSQB 3EBHA 1JPFB 3L9RB 4PY7B 4WI6A 1BVLB 3EZJB 2OR8A 4NQCE 4Z5RA 2IAMD 3QS3A 1MJUH 3MVSA 5MENB 2AXWA 4P5MB 5AOJA 2O61A 1UASA 1F3DH 2NQDA 3E1F1 5I0WA 1UD6A 1ORSB 5EU7C 2WLZA 4F3FA 3BZ4B 1O7DE 4Y5YB 5CLZA 3TO2B 3SQBB 5KW9L 4JM4L 1BREA 1QUNB 2DJ4A 4TQ8A 4AEIH 5LUMA 3OPZH 1J0JA 4LLQB 4ENEC 1BPVA 2HG5B 5T5FH 3K4ZA 3UTSA 2C3VB 1YQ2A 5EFIA 2CDEA 4QMEA 2HFGL 5SWSA 4JM2A 1CDUA 3CHOA 4X7SH 2G2RB 1XB3A 3QHZH 1MI5B 1CXIA 1NGPL 3C5SA 3QUXD 3MYZA 1G7QA 1MWAH 3CFQA 1QHQA 4MXWL 5E2TL 3WTUA 4Y1AE 2R4RL 1C5BH 2PMZA 2GCYA 4TUJB 1T3FA 2DMKA 3IRZA 4ZMQA 4J2XA 4ELKB 2BOCB 5HI4D 5K1NA 4H44C 3ZKQD 3DVGB 4ZNEE 2XFXA 1HJCA 2Y9RT 2VZSA 3F6LA 2HT3D 2YKLL 4GQPH 1LE9A 3IDXL 5I18L 2ESVA 1UA3A 3JTSB 2V3DA 1J8SA 3UTZA 2WIMA 3KL3A 3HN5A 3O4LE 1F45A 5EUKA 4HLJA 3ZDZE 2F74A 3U25A 3QYMA 3H54A 1FSKC 1IUZA 1JFQH 1G7HA 3TBVA 4N0FB 1C5CH 4WU7A 2Y06L 4EN3C 3EJZC 1YZZA 4RFEA 1RUPH 3EOBA 5I8CB 5I73C 3DX1A 5K39A 2BSCA 3IDIA 3BKJH 3F2LA 4JFDD 4MJID 2VOTA 3P9LB </