2DWSA

Cu-containing nitrite reductase at ph 8.4 with bound nitrite
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
328
structure length
328
Chain Sequence
LPRVKHTLVPPPFAHAHEQVAASGPVINEFEMRIIEKEVQLDEDAYLQAMTFDGSIPGPLMIVHEGDYVELTLINPPENTMPHNIDFHAATGALGGGGLTLINPGEKVVLRFKATRAGAFVYHCAPGGPMIPWHVVSGMAGCIMVLPRDGLKDHEGKPVRYDTVYYIGESDHYIPKDEDGTYMRFSDPSEGYEDMVAVMDTLIPSHIVFNGAVGALTGEGALKAKVGDNVLFVHSQPNRDSRPHLIGGHGDLVWETGKFHNAPERDLETWFIRGGSAGAALYKFLQPGVYAYVNHNLIEAVHKGATAHVLVEGEWDNDLMEQVVAPVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title pH Dependence of Copper Geometry, Reduction Potential, and Nitrite Affinity in Nitrite Reductase
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Oxidoreductase
molecule keywords Copper-containing nitrite reductase
total genus 93
structure length 328
sequence length 328
ec nomenclature ec 1.7.2.1: Nitrite reductase (NO-forming).
pdb deposition date 2006-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00394 Cu-oxidase Multicopper oxidase
A PF07732 Cu-oxidase_3 Multicopper oxidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwsA01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2dwsA02
1J9RA 4UANA 1W6WA 1JZEA 1J5DA 5EHFA 3S3BB 3NJFA 3EH4B 4G7SB 3OMNB 3EHBB 1QHQA 3AG4B 1NIAA 3ASOB 2XVBA 3NJHA 2FT7A 1PF3A 1RKRA 5F7BA 2B3IA 2YAMA 4W9ZA 1JZHA 1FA4A 4YSCA 2H5UA 3T9WA 3H56A 1AZUA 4ZK8A 1KDIA 2EIJB 1E5ZA 5PAZA 4N4YB 3RYMA 2BP8A 2BO0A 1AG6A 2JXMA 3CVDA 2PPCA 3TASA 1AG0A 2HLEB 3NSFA 1M56B 5B1BB 1NINA 5B7FA 1SF3A 3CVCA 1SJMA 1AS8A 1ZDQA 4NERA 1PNDA 1WA2X 2XUWA 3ABLB 1WA1X 2HXAA 1GR7A 2VMJA 2WO2B 2UXVA 3PXLA 4JHUA 3FSVA 3TU6A 2BZCA 4KO7A 2XWZA 3EH3B 1NDTA 5B1KA 3HB3B 2FQGA 3X1EA 2UXFA 1NIFA 3QJRB 3AG3B 2I7SA 4YSSA 2PP9A 2P80A 2H47C 2IH9A 2PCFA 2EIKB 1OE3A 4HHWA 1NWOA 3OMAB 2FQFA 4YVNA 2E86A 2ZWNA 1WAEA 4E9WA 2UXTA 1JVLA 1KGYE 4A67A 1M57B 3ABGA 1PAZA 1SFDA 1N70A 1ET5A 1E67A 1ET7A 1GW0A 1V54B 5I5MA 1OCZB 3WKQA 1V10A 7PAZA 3UAAA 1HAUA 1XB3A 3NJIA 1A4AA 3IE9A 2BP8B 1CUOA 2PP8A 3NSCA 3GXUB 3HEIB 1KYAA 3WKPA 1BYPA 2VN3A 1GSKA 3ABMB 1AQ8A 2DY2A 1SHXA 4G71B 2AZUA 2UX7A 1GY1A 2LLNA 2QPEB 4P5RA 1DYZA 4AX3A 3X2QB 3N55A 3QJVB 3AZUA 1NPNA 1JZGA 2HX8A 4YSAA 3SBPA 4K9JA 1L9TA 2PPDA 3X1BA 2XX0A 2QDWA 4WTQA 4BK5C 3N2JA 4DPCX 2YAPA 2BW4A 3G5WA 3NJJA 4HZ1A 3FSZA 1T5KA 4Q8BA 4E9RA 2IDTA 1IBZA 4RH4A 1NWPA 3ERXA 2MTAA 2XV3A 3NP4A 2TSAA 2CUAA 3S8GB 1A8ZA 2QDVA 3QJUB 8PAZA 2IDQA 1GS7A 2YQBA 4HAKA 2HZHA 2ZXWB 4A2HA 1A4BA 4G70B 4DP1X 1J5CA 4AKPA 3UACA 2GSMB 2AVFA 1AOZA 1NIEA 2VM4A 1QNIA 3FPXA 1KCWA 3SBQA 3JT2A 2OCCB 3NJLA 5PCYA 2AFNA 1QLEB 4E9VA 4DP2X 3C75A 3X1NA 1OCCB 3OMIB 1FWXA 3SBRA 5E9NA 2IDFA 4M3HA 2BHFA 2YAEA 2Q5BA 1OF0A 2YXWA 2P80D 2W88A 2X87A 4W1TA 4YSDA 5LDUA 3IN0A 1ZDSA 4HALA 2BP0B 3D12B 4GP4B 3NJMA 5I6MA 1JZJA 1KCBA 2GHZA 3CG8A 2HRHA 1UATA 4E9QA 1NTDA 2CBPA 3H4FA 5AFAA 2YAOA 2WSDA 3CDZB 4KO5A 3V9EA 2YAQA 5D4HA 2CALA 3L45A 2ZONA 1PCSA 3CZUB 4A68A 2VW6A 2IAAC 4DP4X 5AKRA 3KW7A 4E9YA 2JFCA 4DP0X 3ABKB 3IBOA 4YSUA 1M9WA 3TBCA 3JTBA 1OCRB 4L0PB 4BWWA 3OQRA 2Y1AA 4GY4A 1BAWA 3AW5A 3FU9A 1AIZA 4JKNA 1PZBA 3NT0A 3WIAA 3ZBMA 2XX1A 1JXFA 1HAWA 3PAUA 4GYBA 1RZPA 1AZBA 2MRYA 1L9OA 4YSQA 5IY5B 2VM3A 3QPKA 2I85A 1GYCA 1ID2A 2BZ7A 2PCYA 4KNSA 1GS6X 3FSWA 1SDDA 1KDJA 4HCFA 1JOIA 2FQEA 2PLTA 4CSZA 2PPEA 1ASOA 1BYOA 3FQ1A 1YLBB 2IH8A 3AG2B 3X1GA 1JZIA 1RZQA 2TSBA 4MFHA 3SQRA 4HCIA 1ADWA 3FQYA 1A65A 1V55B 2IDSA 2QT6A 2R7EB 3FU7B 1PZAA 1N68A 2B08A 5AZUA 4E9XA 3S8FB 4P5SA 5TK2A 3FSAA 4E9SA 2BWIA 2PPAA 1JXDA 1PLAA 4FA7B 1AR1B 2DWTA 4BDVA 2BP0A 1KBVA 4DPBX 1W6LA 2UX6A 1OCOB 1X9UA 3QQXA 2I7OA 5I5IA 1OV8A 1SF5A 1ZIBA 1AZCA 2FNWA 1PY0A 3NP3A 2J56A 2FJSA 9PCYA 3H4HA 4YSOA 3PPSA 2H3XC 1SNRA 2HRGA 5D4JA 5F7AA 4A2FA 4KNTA 3FYEB 1SDDB 1CURA 4NAJA 1MZYA 3UAEA 5I6KA 5ANHA 3UGEA 4BWTA 4A66A 1OOWA 2EIMB 5B1JA 2GBAA 4AKQA 3NJKA 2Y69B 3DIVA 5B1JC 2A3TA 3NJGA 5A7EA 1ETJA 4M4RB 2AANA 1BEXA 1ILUA 3CDZA 3WNJA 3FQ2A 3X1FA 4G72B 2CAKA 2VSKB 4JHVA 4KO9A 5I6LA 3BQVA 2DYRB 4A2EA 6PCYA 4DP8X 1NZRA 3DKHA 1A3ZA 5I26A 3S3CB 1L9QA 2IWFA 3NSDA 4YSTA 3BVDB 3FPYA 2XXFA 3DTUB 1NICA 4KNUA 4AI7A 3NSYA 1A4CA 1OE1A 3U25A 1FFTB 1CC3A 2OJ1A 4GXFA 3T6ZA 1NIBA 2IDUA 1ZIAA 2FTAA 4DPAX 1PNCA 1VLXA 1IC0A 2PP7A 4BXVA 4GP5B 3WG7B 3NYKA 2IWEA 4KOBA 3EH5B 2HX9A 3EF4A 3KW8A 1SHWA 1AS6A 3S3DB 3TA4D 1XB6A 4BXSV 1HFUA 4F2EA 3GYRA 1NIDA 1BQRA 2YARA 1I53A 4BDVB 3T71A 3FYIB 4QLWA 1XMEB 4FAAB 3MX0B 4UF7C 2JKWA 4N8UA 3ZDWA 2DYSB 4YL4A 2IWKA 2X88A 2PPFA 4DP5X 1KV7A 3NJNA 1MDAA 1PMYA 4DP6X 1CYXA 7PCYA 2GC7C 2N0MA 3T6XA 3V9CA 4AZUA 4AKOA 3T6VA 1BXVA 1KBWA 3QJTB 3WI9A 2NRDA 3FT0A 2CJ3A 4Q89A 3OM3B 2FQDA 2XLLA 4GP8B 1GS8A 2WO3B 1AANA 1AZNA 2AZAA 1IUZA 1R1CA 4DP7X 4F7KA 1AZRA 2OV0A 1CYWA 1TU2A 3PAVA 3AG1B 3MBWB 2GI0A 5I5JA 5D4IA 1X9RA 3CVBA 1AAJA 3T6WA 1JVOA 3QJQB 4HHGA 5B7MA 2YAFA 1PLCA 3ZIYA 1XB8A 4YSEA 4ENZA 1BXAA 3UABA 4G7RB 4EF3A 4BWUA 1JZFA 3QJSB 3ZX1A 5B3SB 5I6OA 2UXGA 2R7EA 2YAHA 2HX7A 2CCWA 1L9SA 5B1AB 5I6NA 3ASNB 1AS7A 5I6PA 2XU9A 4X4KA 5B7EA 1JXGA 4E9TA 1PLBA 1B3IA 2W8CA 3FU8A 1WS8A 3PLYA 4YSRA 1NPJA 2ZOOA 5TK4A 1W8EA 1SFHA 3GDCA 1BXUA 2EILB 3IEAA 1F56A 4YSPA 4NB7A 2FT8A 1OE2A 4A2GA 1MG2C 4HIPA 2J5WA 1ILSA 1GY2A 1ASQA 4CSPA 1BQ5A 1J9QA 1IKOP 1EHKB 1ZPUA 1WS7A 1MG3C 2XXGA 1J9SA 1TKWA 1PZCA 2VW7A 1RCYA 1E65A 2J55A 1DZ0A 2GB2A 2RACA 4A2DA 4WKXA 1IBYA 1ASPA 1TEGA 1L9PA 2VSMB 1E30A 3OD3A 4YVUA 4UAHA 4F2FA 1L9RA 2VW4A 3AY2A 2FWLB 3FS9A 2DWSA 4QKTA 1ZV2A 2BW5A 2GC4C 2QPDB 2XV0A 2BWDA 4TXVB 4DP9X 5I28A 3WNIA 1J9TA 1MZZA 1WA0X 1URIA 1EZLA 2FT6A 4HCGA 2Q9OA 2GIMA 4KOCA 3TBBA 2XYBA 2XV2A 3PAZA 1E5YA 1AACA 1JERA 3PCYA 1BQKA 4G7QB 3UADA 1TEFA 2DV6A 2EINB 3FU7A 1ET8A 4PAZA 2YXVA 2J57A 4KO6A 3IN2A 5FC9A 4PCYA 6PAZA
chains in the Genus database with same CATH superfamily
5FUZH 1G7LB 2WXHA 3ARDD 3EYSH 4Y5YA 1A1OB 4IS6A 3DGGA 2F74B 4O58L 5HJBA 1GGTA 4H5SB 4JPIA 1S9VB 2V3EA 5I15L 3L4WA 1U8NB 3VFSA 3MLZL 5IMKA 1VPOL 2YPKA 4O00A 3I6KA 2BS71 2B3RA 1KUMA 2QMKA 4ZK8A 2DQCH 2BX5A 3PGDB 3RVXD 4ABQA 2GJ6D 3KJ6H 1FV1A 2I07B 4ICXA 5HYSB 1XAUA 3WIHA 2HLEB 3NSFA 1C1EL 4P5TA 3IGFA 4ZD3L 5C9JB 4KFZC 2H0PA 4NHUA 4UQ2A 5BO1L 2NY2B 5L2JB 1XR9B 2WANA 3ARZA 3EJTA 1EXHA 2YGPA 4MAYB 4J1UA 4NN5C 1HDMA 2CK2A 3QZWG 4DGIL 2QVMA 4JR9L 2HKFH 3MJ7B 3VI4F 4K7FB 1Z9NA 2ADIA 3US0A 2YSSB 2BVTA 3IKCA 3TJPA 3NQKA 1HEJC 3V0FA 3VSTA 4ZXBD 4M1CD 4LLDB 3O2WH 4NPYB 5C8JB 5IMMB 3WEAA 5FIEA 1ED3A 3FT9A 1FL5A 2RD0A 2Y7OA 5DC2A 4X8XA 1WFMA 4FE9A 3G3LA 1TO4A 1TQVA 1SMAA 3CVIH 3JXAA 2H6PB 1MJ7H 3BGMA 3PV6A 4PJGE 5JHBA 1FIGL 1SHXA 2AEWA 1XF2B 3WS3A 4ZXBB 1C08B 4PRNB 1BIIA 2MJWA 2XCMC 3FXIC 1S7XB 4FMFA 1OAKL 1Z66A 5JHLA 4OIBA 4L5FL 1WWAX 2BDNL 4GRWB 4NGHL 4FXGB 4ELKA 1UM4L 3B2XA 4D9QE 5K9OB 3ZR5A 1JZDC 2R2BB 3T0EE 4LU5H 1E3XA 2JB6B 1CD8A 1LP9B 3FQNA 4FYTA 5AD0B 1JTTA 2A77L 2CO6A 3IDIB 4DSYA 5KANG 3RI5F 4IJTA 3MRCA 1G0XA 1IBZA 3PWNA 2BOCA 1CFSA 2FX9L 1II4E 32C2B 1GPOH 3VNYA 2FBRA 3IMRA 5D2NC 4B97A 4FTVE 4MS8C 2CPCA 4HCRH 4JZJB 1GZQB 4AE1A 4DP1X 4NCC1 1KXTA 2XPZA 3FHQA 5AALA 2BVPB 1YAZA 1VFAB 2YOAA 2A74C 4HWBH 4G6ML 3QCUH 4UU9A 1LE5A 1IBFA 4Y88A 3QAQA 2CR3A 4KVPA 1KPVA 1DQDL 2E9WA 1KT2A 4WI9A 4ETYA 3CC5B 3UJTH 4Z7QB 1R3JA 2LGNA 1YEGH 2WINB 5GGTA 2Y5QA 5DD0H 5TD4A 5DRZA 4K3EH 2DD8H 5HYJB 4JFSA 5AOMA 2QZ5A 1UB5B 2JQMA 2FZ3B 5FYJD 1Q0XH 2HT4D 3L9BA 5F97E 3B9KD 1RY7B 1OF0A 2ZWYA 2ZXDA 2F53D 4HXAL 4YBHA 3S88L 4H8HA 2X10A 3LYRA 1XL6A 4QGTA 5LDUA 2CKBH 5GGRB 3TOPA 4MD0B 4ANUA 4F9LC 2YUVA 4YDJB 3CFCH 3LPWA 3HR5A 3LEYL 4KXBA 5D6CB 2W95A 5DYOB 3JZ7A 3K2IA 3QR1A 5GGSY 3RL2B 1C1EH 1UATA 1BX2B 3ZKMC 3SKUD 3MRGB 1FSKC 2CBPA 2L3BA 1WSST 3AS3A 3NSXA 3FTXA 4Z5RA 5KS9F 3V9EA 3P4MA 1TSHA 2QR0B 4KKRA 4PRPA 3TN0A 5DHVH 3ULVL 2IAAC 3OKLB 1LEKA 1Y18A 1GYWA 5T3XE 4C56B 2FO1A 4E9YA 3OC8A 1JF1A 3SJVE 3ABKB 2WMPB 3PQYD 4KVCH 3IBOA 4R7LA 3U4BL 3DGDA 1FCCA 4KJYA 3MCKB 1IBGH 1JF5A 4E5XB 5FYJU 5ITFA 1QPPA 3MNWB 4U4IA 4IK6A 4RRPG 2EEBA 2XX1A 2E59A 3BKJL 1ZS2A 1ZXKA 4GYBA 3UZQA 5BQDA 3W2DH 1CPUA 2XQBH 4O2EB 2O6PA 3MLYL 3MHZA 2GUOA 3ISRA 4N0YL 3IDGA 1N8ZB 3HAEG 1G0DA 2IAMA 4WU5B 4JO1H 1YQVH 4RISL 3H9SE 3E9TA 1XZ0B 1MNUL 1S9XA 3FQ1A 5TF1L 1P9MC 1N6UA 3SY0B 1RVFH 3VM7A 5GZND 5F6HJ 5DS2A 1JN6B 3QDGA 1T0PB 2V3FA 2TSBA 2WIIA 2GBUA 3D07A 4M61B 4KI1A 4QUOA 4HCRL 4F7EB 3SYAA 3THML 4UTAL 3LMJL 4X83A 4KROC 4ZPTA 3RNKB 4C83A 3FTVA 1NAMH 4R4BA 1PZAA 1RU9H 3M07A 3WN5A 2F8IA 1I9JL 3QXAA 2BRQA 4JQIL 2FEEI 2JIXA 5E2UH 5DURD 3EO9H 2JLPA 4P5SA 1RURH 5EG6C 2PCFB 5CLYA 5IMLA 3BD3A 3CFEA 4A7GF 3NN8B 3QUYC 4FERA 2P8MA 5T33H 1DVTA 3BWAB 2BWIA 5CILL 2YGQA 2NY0D 4GLRH 4XBPA 3VCLA 1OK0A 3VQMA 3ULUE 5KS9A 4P9MH 3GTVA 3EYOA 4P4KA 2C7FA 4G8IA 4G8GA 5I5IA 1TQSA 1IVLA 1QLEL 4NFCA 1JGVL 1SEBB 5J57B 4ZUVA 4Z7UA 2HMIC 4TULH 3BAEL 4KMTH 4WHDA 1TJMA 1IX2A 3C9NA 1RZIA 5D9SA 4DN3H 3C2AL 5JTWA 1SDDB 1OAUH 4WW1A 1MCLA 3GS7A 2VWEC 1CD1A 1OOWA 2MCAA 4HIHB 2BSSB 1A5FH 1E9QB 3DIVA 4BQ9A 5EZIH 4NC1C 1BOYA 3VU2A 2P8LA 3RILA 1PD1A 4AUUA 1HINH 4KO9A 4FYRA 4PWHA 4OM0H 4I2XB 4WY7H 4NSKA 1BM3H 3PS6A 4ADIA 1VEMA 4Z7QE 1BD2E 1U8MA 4AXWB 4X98A 3B2VH 1OAKH 3GSWB 3CFUA 5HDBE 3VGGA 4DK6A 1CI5A 1UD2A 1L9QA 3TJEL 1BD2B 2ZUTA 4WFFD 5F7DB 4YSTA 2NY5C 5HDBB 3TVMD 2IANA 1IAOA 1OK8A 2XXFA 5JIDA 4KPHH 1NICA 1FBIL 3FONA 3CHSA 5HDBF 2VRKA 2X9YA 5CJBA 1MH5B 2OJ1A 2YMXH 4GXFA 4M8UA 1PNCA 4U1HA 3OJMB 1KB5L 4ZUTA 4XWGH 5EU6B 5DR5L 3TL5A 4UOW1 1JI2A 3L4UA 3R8BB 3KLKA 4PVNA 4FFYH 3S3DB 4EPSA 3P4OA 2VDQB 4WWKB 4ETQA 2IC2A 1OSYA 2UVFA 3VXRE 5A6LA 3ZO0A 1OVZA 1VSCA 2YS4A 4CAGA 1NLDL 4N2IA 3OF6A 5C0CE 5T5NF 2B2XL 5H94A 3CLEH 2JKWA 2EUZA 1KXQE 1IBHA 3MCKA 2DYSB 5FV1L 1DSWA 2VMFA 3TF7C 4KK6D 4HD5A 4H1LB 5D1XD 4MB5A 3ZKXC 3HJ0A 3ARED 2JJUA 1QRNB 1AGBB 2VQTA 3D05A 4LK4A 3FB5B 4OZGF 4LNVA 3ZKQD 3ULUL 3D0LB 2B9AA 3WLWC 3DMMB 3U7YL 4Y16B 1PX8A 1QQDB 1D6EB 1VJSA 1ZTXH 1A47A 3ARYA 4GP8B 4QRBA 5IBTH 1NCWL 4Q58C 3OZLA 3LEVL 4DP7X 1ADQA 3MBWA 3DXAD 5CKGA 1WRFA 3L3HB 3BP5B 4N26A 4U1KA 4JX0A 4GSXA 2QV4A 4HXBH 1N5AA 1SBBA 2GI0A 2WUCH 4XBPB 3VCLB 5A3IC 3VRLE 1FYHB 4GRLA 2Y5TB 5CGBA 4RMTA 2OJEB 2MPVA 3ILPB 4HKJA 2RBLA 4A1RA 1QSFE 3LMJH 1A9VA 3GZOA 2NY1D 4GAAA 4L8DA 4PJEB 2YRBA 4PW4A 2EJ1A 3FUKA 3NPSB 4GO6B 4GMTL 4OCXH 1KCRH 5IK3A 2HJLB 5JIHA 4PJEF 1QZ1A 5FGCB 3KPRA 1MHCA 5I6NA 1GZPA 1UJTA 2P7TB 4MKTA 5LGYA 3VMPA 1X7QB 4WHYH 1JPFB 4FQXD 3TVMC 5TH2A 5K39B 2PWHA 2Q20A 2FB4L 4AJ0A 1CS6A 1SEQH 4KXDA 5A2JH 4G6FD 3PDGA 2JE8A 3MRMA 2CXGA 4AZ8B 2DEYX 5GRJH 3TWYA 4B96A 2WHVA 2Z4TA 2M1KA 5E8EB 2DMBA 2QFRA 1XV8A 3CZJA 3FN3A 3FQRA 4RQQB 4XPTL 4XXWA 1KJ3L 5DZNA 4ZS7H 3PWNB 1AI1L 4G8EB 1OP9A 3EO1A 2EXTA 4L8BB 2ZUQB 2AV7A 1GJWA 3ILQC 4OV6F 1BQ5A 1J9QA 4QRSB 5EEUA 1NC4B 3QUML 2X1WL 1OP4A 4HKBA 3FU5A 1MFUA 5D7JA 3Q43A 3TZVA 2J55A 2VSCA 1I75A 4GW4A 4G1EA 5MERA 3TCLB 5HHQB 4H4NA 2Z92A 1QNZL 3V4PA 5T5FA 4N0CC 1F00I 3D51A 2K3TA 5HHVL 4B3EA 4FFTA 3HZ3A 4R8WH 5IBLC 2YPLB 4JO4L 4X4ZA 4PV8A 4F5CE 3HI5L 4JFWA 3D33A 5C0IA 1WEJH 43CAA 3D3VE 4HUWB 4X6CB 4OJCA 3HI6L 2Q9OA 1DDTA 3V5HB 2C9VA 3C5ZB 3MU3A 3F7YB 2Z9TA 1JYNA 3NUKA 3PAZA 2ICEC 2WLYA 4UB0L 1BBJA 5EO0B 2R9HD 2WYZA 1BLIA 3GSVB 3MBXL 3AXLB 4JRXE 5CCGE 4XB3A 4MJ6B 3GXMA 2G30A 4OB5L 4S1DC 3LXAA 3V0VB 1XSJA 5HGHB 3UTZA 3BKMH 4BUGA 3UTSD 1BVLA 2JWYA 4PJ8D 2ZSWA 1LQSR 4JG1L 4OJFL 3ZKSD 4OD2A 3QNXB 1ES0B 3F58L 3NIDB 4I0PD 4P9HC 2GBTA 2IOOA 5E6IC 5H2BB 1SJEA 5BV7L 1ORSB 2BJMH 1HSAA 4UAOB 4DW2H 4P46A 1QHQA 2V17H 3CFIC 2HWZH 3U46A 4WFGE 5EUOF 2YHGA 1GGCL 4AV5A 3DJ9A 2EH8H 3DJRA 1IZJA 4TVPL 1T6WA 1EERB 2B5IB 3QDMD 4GQZA 1KJ2H 1NCDL 4KI5D 3U30C 2X2IA 3T9WA 3UZEC 3IF1B 2IH3A 4FNRA 4XVUC 4E42A 4F20A 5IB4B 2VDOB 4B9KC 1TKWB 4I0PB 4GMTH 4RSYA 3S37X 2P5WA 3DOSB 5FFOA 4QF1B 2BOLA 3PXHA 2HUEA 1RL1A 2L7JA 3GINA 3E8UL 3MACL 4ELME 3QIBD 4X42A 1MWAH 4S1RL 1ZLSL 4OCSL 5AAMC 3D08A 4GJTB 1FFRA 2P8PB 5HTSA 3T5WA 3X3GL 4Z18A 1KBGL 3BWAA 1QUNA 3OSVA 4LVHC 3P73B 3T3PF 1ZVHA 2KLRA 2VUYA 3PP3K 4NPKA 4GXUM 3PG2A 5KVGE 1AI1H 4HKXB 3V4UH 2ZYHA 5FGBA 4YO0B 2DQ6A 3EFFA 4J3XA 2IH9A 3NRPA 4QJ5B 2YJLA 3DURB 3D1MC 1CK0L 5IM7B 4F7EA 1P6AB 2DS4A 2X6CA 4KVNH 3KPPA 2CLZB 2BCKB 2KQMA 4YGVB 4P2YA 4XWGL 2JTYA 2AXWA 3QEQE 5ABDE 2HH0H 3LX9A 2H8PA 4L4TD 2AJXH 1DJZA 1MQKL 1XB3A 3O0RH 5ACZB 3FCTB 4Y7MA 4S2SA 1CUOA 4YUEH 2EZ0C 1AHWA 4UZSA 1FGNH 5T3ZE 4HIQA 5IUSA 3MBEA 1V3MA 4K23H 5I71C 1RZKC 1H3PL 2JLLA 2UX7A 3TFKD 4OLXH 4HFWB 1Z32X 5HHVH 1ZGLA 1L9TA 4NQCA 3HVNA 4L23A 4IRZH 3QDJE 2C5DC 3OLEA 2Q7YA 3IU4H 3AAZA 4HSAC 3BH8A 1RH8A 3SDYL 3SJVA 3ZSTA 3R06B 3WKYA 5HVHB 1TITA 2EEDA 3APMA 3NJJA 3QUMH 3IETB 2FR4B 1LNUB 3OKKB 3WENA 1F90L 1Q9OA 4ODWA 4U1LB 4OF5A 2Z31C 4MJ2A 2XV3A 3RVWD 2VZVA 3BZ4B 4UCFA 3VH8A 4KZCA 3KWVA 4DOHB 1M7XA 3BP6B 4IU2A 1FG2B 4K3GA 4W6WB 5CINL 5DUBA 1UCTA 3TONA 1EO8L 1VZHA 3PGDA 5EU7C 4X7FC 2C26A 3MGAA 3MJ8A 3ARGD 3D3VD 4EZLA 1OANA 1QLEB 4JL2A 3OX8B 2IH1B 4NI6A 5DLML 3SDDA 4YDVB 1ZT7A 4PJCF 2CO2A 3UTSA 2JCCE 4YDKL 5T3ZH 3LNGA 4H8VA 1G9EA 1KIUB 2BP5M 1Q0EA 1UA6H 1ONQB 1AD9A 2OTUA 3GLAA 4G3YH 5CZKA 5CJXA 3FTZA 4J3OD 2OL3L 4Q6IC 2JKIS 4NKOB 5F3HB 2H26A 1HH9A 2OXGA 1D7BA 2UWEF 3O6MH 4GG8A 5IGXH 4M93C 3WFDH 5KJRH 1KELL 4PTTB 1FH5L 3B2PA 3D12B 3QWRA 5E03A 5BRZD 3VXUD 5T3XL 4QJ4B 3N9GH 1S5IL 3AT9A 4N8VB 2WNGA 4FZ8H 2H6UA 2J6EH 3ISWA 4HKZA 4JE4B 4WTXA 1X5HA 3CJJA 1BZ7A 3UG5A 2X70A 3TYFB 2NY3D 3CFQA 5EF0A 4XOBA 3BD5A 1QABA 4PWKA 1RZKH 2CUHA 4LLAA 5C08A 5KS9E 2YAQA 2Y1VA 2ZONA 1FVEA 2Q76A 3GF8A 1KFAH 4NKDA 3RJQB 3UPAA 4X5PA 4Y4KA 1JNJA 3V2AR 2YRPA 5CFAA 3MLVL 3BAIA 3F84A 1C12A 1M05B 1KTRL 1N6VA 3ORJA 1NM4A 3DRTB 4OFQA 5ISZA 1B4RA 1X4YA 2EIBA 4TRPH 1TTFA 4XP1L 1TQBB 1I1FA 3GFUA 3RJDA 2B9BA 4GG6A 5FHAH 2CIIB 3LQAC 3GI9H 3RTQB 3NT0A 3HG0A 1U2HA 4PBDA 4HEME 1JMZA 3FBQA 5JXED 1JPEA 1R3IH 5J4MA 1G9NC 4XT1C 3QI9C 1MFNA 5GS0L 1CFTA 1RZPA 2DLFL 3MJ8B 3Q2LA 5E4EC 4CMHB 1BVNP 5JHDB 2EVJA 1KBPA 1KWGA 3CGTA 1JXKA 1GYCA 2CRIA 3GHEH 4YHLL 4WGWB 3TWCL 4GO8A 2VDPH 5AUMA 4AENA 5I9QC 4MJ5A 3NIDF 2WCSA 5JMRA 1ONQA 3VGBA 3HUJF 5JOFB 4N9OB 2OKMA 5E9DE 1VKXB 4TM9A 2E27L 5GS1A 1FP5A 5D8JH 3HE7D 2GSIA 3UTPD 1CGSL 1U4FA 2NCMA 3Q8EA 3U1SL 5I75B 3V4VB 3G6DL 3H42L 5F9OH 5FHBL 3WGUB 1ERNA 3GMLB 3W9EA 1OHQA 4DW2L 3RIFF 4OZ4B 2VJXA 3MRKA 4QRRE 2EAEA 1HOCB 3ESOA 1NFDB 4V1DA 3U9WA 1C7TA 2QQQA 5DQJB 4UDUB 4B5EA 1EEQA 4XXDA 4W4NA 4ALAC 1DVXA 4PCSA 1YNTA 4QY8A 1NAKL 4EMZA 5E2VL 3MREA 1NGWA 3VYPA 1F8TL 2BP0A 4U0RC 2IF7A 3QDJB 1Q90A 4XB8A 1WFUA 1PZ3A 5TJWK 4AK1A 3CFTA 2V2TB 2OMXB 1N3NA 2A1WH 4WUUE 4R26H 1YNLL 2ESVD 4JM4L 2GAZA 1AZCA 5I0ZA 3O6ML 3SJVB 1CK0H 3MUGB 4UV7L 2SODB 4WJKB 4K9EC 2B39A 4KK9D 4OFIA 2B0SH 2ESVE 3L95B 1EFXB 5D1XA 5C09D 5CGYC 2CLZA 4N2NA 5IMKB 4G9FB 1IE5A 1ZA6B 4D9LH 1G7MA 3FFDB 3OF6D 1Z5LA 5A7EA 4ODUA 4B60A 5F7DA 2EDFA 3V0JA 4RIRA 1MVUA 5GIRB 2BVQB 4Y2OA 2JMRA 3OJDA 1IC4H 4O02L 4OGXL 4U6VH 3KVDD 4YPGB 3PJNA 3VWKD 5JIQA 1NANI 3VD5A 4Q6KA 8FABA 1MRFH 2F61A 5KEZA 5CF3A 5EIIB 5K9KB 1T66D 4WQOA 4EOWH 3HZYA 5E08H 3FFOA 2IXQA 3H9SB 4NUGH 4NNXA 5DRWB 4QRUB 2A9AA 2AMUA 3BAYA 8CGTA 3QXUA 3HC3H 3AU1B 1FI8C 1A7PL 1SXAA 1ZE3C 4MMYB 1OE1A 4FXLA 2ZX9A 4QHMB 5IFAH 2RA1A 2BC4A 2R4RH 1FRGL 1NM9A 4QXGH 4KZEL 2FX8L 3DDGA 2BFVL 1UOKA 4MZIA 2FO4B 4QXWA 4ZSOA 4FEIA 1OW0A 3QI9D 4PFEA 3IRZA 1O5PA 4DAGL 2R59A 1ZLWK 2YARA 1I7UB 4OGYH 5JHLL 2N1KA 5KS9B 1KB3A 3H1ZA 3ULVF 1LO3L 3FBKA 1RUMH 1T89C 3D8MA 3IDNA 4N8UA 3BO8A 5E94A 2IWKA 2PW2A 2ICEA 2N1TE 2BNQB 3TBVB 4Y16A 3UZVB 1SJVA 4KK5D 1I8IB 3SGKC 1B4JL 4UV4L 5AVUB 1I9JH 2AQPA 1P5UB 4PRAA 4NRYA 3QORA 1P7KA 1GAFL 3C2AH 4K94H 1T1WA 3WJMA 4OZHB 4RMVA 2FIKB 2FH8A 5EF2A 2L4OA 1MCOL 1DBAH 3CZFA 3NDZE 3P40A 3EJYC 5FYLE 5CD3A 1HXYA 1AANA 2WO3B 2L04A 1A7OL 4MKMA 4Q2ZA 4EI6B 5I66A 4HH9A 3M1BB 3IMBA 2V6HA 3L9RA 4OLUH 3RY6C 25C8L 3EJZC 5G5DA 4PTUA 1VFOA 1NGWB 2QADB 2BNRD 5GS0C 1HHJB 3BIKB 3HOGA 1X5MA 4U6YB 1HX0A 4PGEB 4YDIL 3IU3B 1XB8A 1G7IA 3BX7C 2NYZA 3GSUA 2QQNL 4KK6C 3KJ4B 3F8UB 1XCQA 1X4XA 3B9DA 3MROB 4EVNB 2EUXA 4AH2A 3LKQB 1P4LB 3S3SA 2ZXQA 5I5RA 3CAFA 5J6HB 1U21A 3SZKC 3QEUA 3NA9H 2WK2A 4ACPA 4F9PC 4DJMA 5IBLD 4XE0A 4BV1A 2ZJSH 4U1SA 3CHRA 4JRXA 3LKNA 1WFTA 3S98A 4DPRA 4K9EH 4UT7L 3EH2A 3P02A 3TF4A 5CJXC 3GJFA 4ISVA 4FA8A 5I30H 3BKCL 5IJCC 4N2CA 3A21A 4EQ2A 3L4VA 1B3IA 2W8CA 3VDAA 4ADGA 1FJ1A 3HG1A 4LBEB 4ZMPA 1ROWA 2WO4A 3EZJB 4FNTA 2JKSA 4UNUA 4K8RC 2YJQA 2OW6A 2XN9B 5KSBA 1RUPL 4KPHL 3REWA 2JI2A 4RIRB 5FF6B 5IG7B 4A2GA 1MIEL 4HIPA 3WGVB 3FN0L 1DCLA 4FXKB 4PJEA 4BK4A 5KVDH 1WGVA 2Z3FA 2WD0A 4R4FH 5I6XC 5GGVY 4L8CB 4YZWA 2BSCA 2OX5B 4HLZG 4WUKL 3DO3A 4ZD3H 1R0AH 1D5XA 2BLFA 3CFNA 4OU3A 2XXCB 4IEFA 1DJGA 1UXLA 4JHWL 4M43H 1C16A 2BNUB 4RGOH 4LCIL 2ERJC 2VTFA 3KWWA 2JSFA 4OIIL 2P5WE 3AADB 3O45B 3E8VA 5G55A 4AQ1B 4MD5B 4RNRA 2PUQT 2APVA 4PS3A 1G6RH 3V6ZA 5T3ZD 1G1YA 2R0ZL 4F27A 5GGVH 5EU4A 4OFPA 2OJZH 2D7NA 3GIZH 4M5YL 5I28A 5HHOA 7TAAA 1FVEB 1NBYB 1URIA 2FT6A 1MLCB 4OY9A 3F7VA 3S9DB 3DGCR 2E6PA 5AQ0A 3RHWF 3L4ZA 5D7KD 2ZKHL 2OJEA 1J1PL 1E5YA 4D0CA 5ICYB 1S6NA 4MA1B 2X9ZA 4OLWH 3ZE0F 2W80C 2AITA 1PD6A 3MGOA 1H5BC 3QIBC 5ISZB 4PJCE 4I5BB 4HUXB 3M1CA 3GZQA 4Q6IA 3VQLA 3BVTA 1TMCB 4F7MB 4AUJA 4XNYL 5HGBB 2X0WA 1FE8H 5LBSL 1ACYH 4HV8B 4PY7B 3WYRA 2P24B 2QL1A 3KHOA 1R24A 3OMNB 5I23A 2APFA 2JB5H 1A6WH 3ASOB 3BZFA 5J9PA 4ELMA 2UY7A 4UQBA 2XN1A 2Y1YA 1M3JA 4YQXH 3ZSSA 1RHHB 1CQKA 4WUUA 3WUZA 5DD3L 4Z3IA 3QE5A 5B3NA 3I6GA 3FCBA 4KX7A 1H5BA 1TZAA 4MASA 4N4YB 4L8CA 3E38A 4LFHG 4U0QB 1Y6MR 2E74C 4GG6B 3NFSH 4KRLB 2ZUYA 1A7NH 1INQB 2YUXA 3QH3A 5KWYC 1SF3A 3TT3H 5AB9A 1QRKA 3B5GA 1D6VL 5AB0A 5I66B 1JNLH 1NPUA 4I89A 1TIUA 4FFZL 1CFVL 4UOZA 3ZE0E 1GR7A 5E5UB 4DGYL 1PY4A 3IKCB 4NSKB 4RWHA 4I18C 1BQHG 2DWDA 4XNMA 5FKPA 1V7NH 2EUVA 4LCCA 4XAWL 3X1EA 3QJRB 4R5VA 1Z7JA 2PP9A 1PLGH 4X6CE 2YKLL 3EJSA 4M5ZL 3GMMA 1R6VA 3EO0A 1QFUH 4HHWA 4CC1A 4LSRH 4TQ8A 2UXTA 2CNZA 5D71H 2XOTA 4FFWC 3MQIA 4I3RL 4KMLB 4A67A 3TBVA 4FCAA 3O2VL 4HLEA 5EU6E 1ET5A 2Y72A 3HUJE 4LARL 1OQOA 4N0UB 3CU7A 3FN0H 3CH1A 3K8MA 3MV9A 5EUKA 3RWCB 3MLPA 1UXSA 1AHMA 4BFIB 2OMYB 1E6OL 3WMQA 2FX7H 4HUVB 1J5IA 2BP8B 1AP2A 4FN0A 4FS0A 4PUBH 4OFDA 4RRPM 3GXUB 1BYPA 2Q8AH 3RVUD 4A7GA 4UM9B 1AIFA 5HJ3B 4P5RA 4FHJA 4LSPH 4XC3L 3SDCC 1OEZW 4F8TA 2PPDA 3BESR 3DPDA 2XJKA 4ZI8A 1LWHA 4I87A 4MD4B 5AAWA 4Q6YA 5EZLB 1PJWA 2H2PC 1GGBL 3N2JA 1RUQH 1GHFH 3AU1A 3QISA 2JI3A 5I1LA 3UJIH 5EA0L 5L2KD 4LE8A 3T2PA 1SJHA 4NQCD 3RWDB 2IVFC 3MRLA 3RZWA 3IPBA 3P30L 4H44C 5HPOA 1LP9F 4Y2LA 1IFRA 3BO8B 5IFHL 1CD9B 2ZYIA 3LXUX 4G11A 4XCEA 2J1XA 3D87B 5EIQA 2Z8WC 1GGCH 3EF7A 1DQVA 4QO1B 1JAEA 1VRSA 1XTMA 2DLEA 4BKSC 4N2HA 5I1GH 3EYFA 2QELA 1VAHA 3EFOB 3MRQB 5INDA 2X9WA 1M7DA 2GW5A 4PRHE 4RBPH 3W38A 3EJRA 1X7TA 1A7RL 1HTYA 3RVTD 5J3HC 4BCZA 1FFOA 3CVHB 4M3HA 1UM6L 3VQ1C 2BHFA 4H20H 3T0WA 1CFMA 4BA0A 5FOBB 3E8UH 5KN5A 3SGKA 3V0WL 5EUKB 2ALWA 3Q1SL 3GGWB 5FX3A 2F8OA 2XVLA 1CFBA 4X5WB 1TCRB 1JFQH 5CBAA 3EDDA 2ZKYA 1OCWH 5E0QA 4IM8A 5C0DB 1FL3B 4MXQC 5GGSA 3UP6A 2YQ3A 3FC8A 4PRPB 4XAWH 3TN0B 5DC9B 2X89A 4W6YB 3QQ4B 4FYQA 4M7KL 4QMEA 4W9HC 2V37A 2DBLH 4OZIA 3RGVB 4LNRA 1BBJB 1OW0C 2LU3A 3PHAA 1S5IH 3EFFB 4P9ML 1GJUA 2J1YA 1KBGH 2VLMD 3T65A 4L1SA 4UQIM 1KOAA 2H6OA 4GKSA 4XNMB 5KVDL 5F7NC 4R3SB 4NAMA 4DFIA 4LAQH 5E4OA 3HE7C 1SHSA 3KYMA 4P8QA 3GSNA 3MPCA 4F3FB 2O5YH 2XICA 2FR4A 3K6DA 3NRFA 3OXRA 5IKCA 1BWWA 3T2NH 1AKJB 2EKSA 3RY6A 4J12A 4I9XA 3FB7A 3U2JA 5D5MA 2KZBA 1HJCA 2FEDD 4QF1A 4DOHE 5HYJA 3QUZD 3GUFA 1KN4H 1P5UC 4NQEB 3SBWC 3SD2A 4M6NH 2FECI 3ZUCA 4G6KH 4R97B 3DX1A 3KCWA 2BMKA 3ZE0B 4QRTA 3F05A 4XX1E 2FBJH 2WB7A 4E42B 1U8JB 1OGAB 2OTWA 3EOTL 3BSZA 1TZ8A 4HS3B 3D7PA 1JS4A 2OZ4H 4Y19D 3BKJH 5CD5D 2V9QA 2VR9A 3BZFB 1KTLA 1E0OB 4LIQE 4MWFB 5ERWA 1S46A 4RDQF 5F2FA 5KAQG 2FQEA 3MLXH 5FA3A 3W9EB 3NIFE 2G3NA 5FOBA 2MKWA 3T0EC 1BYOA 1A6AB 2ADYA 1C12B 4TSCL 3CCHA 5DFTA 4JGJA 1IV8A 3PE9A 3G5VB 5H37A 5JHDD 4UT6L 2WLLA 1WAPA 1BBDH 3BAKA 5TE4L 1BZ9A 1E40A 1BOGA 3GSOA 1NCBL 1CVSC 2GYSA 2WYTA 4IU3A 4OLWL 4XAKD 1JV5A 3LH9A 4Y19B 1INQA 2UY6B 3V5KA 2UZPA 4PJ6A 2Q8AL 1FNHA 4D0CB 5ICYA 1ITBB 2ISDA 2X44D 3MSPA 3GI8L 1UYWH 2JJWA 1HE8A 4PJXE 3L9EA 3KDMB 2CIKB 2EXWD 5E6YA 3GMQB 2HRPL 2ITDA 2WTRA 3F62A 1T03H 5MHSE 1KF9B 3TZVD 2O5ZL 2X4OB 4N87A 3SE9L 3NVQA 1FFQA 4H8PA 5ADPH 3ULVD 1YJDH 4I4WA 3QXTA 1UJ3C 1ZIBA 4FL4C 5T1LA 3T3PB 2O26U 3D9AL 4K5OA 3BH4A 2F68X 4XMKH 1NEUA 4O5LL 3EFDL 1G9MH 1NLBL 3IT8D 5DO8A 5C1MB 1XXDC 2I9TB 4K5MA 1MZYA 3WNMA 4OQTL 1SLXA 4LHUG 5ANHA 4AEHH 3BJLA 2VDKH 3KLAB 3B7UX 1C08A 1QVOA 4PRNA 2A3TA 1BAFH 4WAFA 2BRRH 1CGVA 4FQXA 1H9VA 1UD8A 4JM0A 4JB9H 5C08B 4G80A 1AP2B 1D6VH 3L54A 4TLTA 3QR0A 5CSBA 4JHVA 3ESMA 1J1XL 1T5WA 2ZCKH 2VLKA 2VRQA 4L1BA 2JK5B 4LCWA 4TN9A 1AO7B 1ZHKB 1K4CA 1QEXA 3GIVB 1OGTA 3JV6B 2QSTA 3TCTA 1R3LB 3PIQB 3VTAA 3RFZC 3BCFA 1BXXA 1G6RB 1J18A 2WLLB 3CBKB 1I3RA 1X7SA 2DWEA 2WSPA 3FPYA 5AW3B 4C58B 3FT4B 4Q97A 4KU1A 2B7DT 2R4SL 4L5FE 2X4TA 1JGIA 3B1TA 4N20A 3BUTA 2QBWA 3OVUB 4PLJC 3A24A 2BIQA 1L4IA 2HFEB 3J8F7 2VR5A 4KK5C 2MQ0A 4OCMC 3K2UH 3UOAB 5IHZA 1E9PA 35C8H 4M9PA 1E4XL 1FE8L 1NGQL 1SXCA 4KJWD 5LBSH 3CLEL 4FMKA 1E6OH 1QACA 3E3QC 3V55A 4BXSV 1P4UA 5LWYL 2PWEA 1I1AB 2IO5A 1I53A 4L8SA 5I9QB 5ACZA 3RAJL 3GSWA 2NOYA 3G04B 5D5MB 3CN4A 1C5CH 4MMZA 5EV7A 2OR7A 2Y1ZA 1JWUB 1Q72H 2DLIA 3ARXA 4WI4A 3U36A 3QI9B 2BIOA 4NS0A 2V2XB 7PCYA 1TT6A 3WN5C 4U6XB 1KGIA 2FWUA 2Q2LA 1O9VA 5HYJE 3WDJA 3TBYA 1CFQB 7FABH 1MFCH 4NRXA 1CL7H 2OULB 5DHYA 5DUJA 1KPUA 4LRNL 1ULVA 3KCPB 4UYQA 4F57L 4XVUD 2E8YA 1L5GA 4JFPB 4Z7NF 4POZD 2DEXX 2VDOL 3KYNA 5SX4H 1YEHH 4X7EC 3AXHA 2K45A 5D70H 5EOTA 3PWJA 5L7XL 1EJOH 4PS4L 5T5FH 3SCMD 3A67H 3NTCL 3EDEA 1MAMH 1ZEAH 4LAJH 2VWEE 1VCBC 2VN7A 2D7PA 4HIEA 4NO3B 5HI3D 5FYLH 1MCPL 1AAJA 2VZ3A 4U1SB 2F53E 5IW6B 4L1TA 3WO3B 1ZS8B 3QIWA 2YIHA 1I7ZA 3T2OA 2XTJD 3NN8A 3HG1E 2V5YA 3IF1A 1MHHA 4HW6A 4XMLL 5SWZA 5TDNB 2C7UA 2D31A 4P99A 1D5MB 4F15C 5JPMB 5E2WL 3U9PH 3ZX1A 5TDPA 4FL4B 3F5WA 4U31A 4DKDC 2IBZY 4WUUB 2UZIH 1IGYA 1RJLA 3CE1A 3LS4H 3MR9A 4JDVB 3GI9L 5IQ9A 4WV1A 3QUXC 5HYQB 3M6DA 5A3ID 3PJSB 4IGBD 1F6AA 1IGFH 4MB4A 5HHNB 4EOWL 4HH9B 2NNFA 2XTJC 3FFCA 4JRFA 3EJYD 2MPAH 3JVGC 2P8MB 1IAMA 1U93A 4ZPVA 2EILB 4QTIH 2J3SA 2WVVA 4XOEA 1AHKA 4FZEL 3MRIA 3D9AH 1X5GA 2FT8A 1OE2A 2ZKWA 1MG2C 1Y1UA 4MX7A 4MSWA 1WWBX 4QCIA 1I8KA 2DQGH 2ZAHA 3T0EA 3M86A 1NLBH 3BH9A 5MHSD 1AY1L 4Q9RL 2H9GA 2FO4A 4G8GD 1U8OB 5JR1H 4NRYB 3RRQA 4TS6A 3TNNB 5FYKU 3NZHL 5SWSE 1RCYA 1XGUA 4CU6A 2X6MA 3ZRCC 3F00A 1NBYA 5JIKA 1GXEA 5KVDE 4ISVB 3CUPB 2I5YH 2RALA 3HZVB 4FTVA 3MRJA 3SO3C 2D2OA 4G6AD 1J12A 1FZKB 3CXDH 3CVIL 3RUGF 1DBBL 4JFFE 4LMQE 4P4RA 5DRXB 3E6HB 3Q8BA 4XPHH 4AG4H 2DJSA 4NUQA 1P5VA 3UDWA 8FABB 5D7KE 1EA9C 5AW8B 5MEQB 3SPJA 4R96B 4IRZA 3KWTA 5EIVA 5IMLB 3PQYB 1BQKA 4PP2A 1J7VR 3P4NB 1I7RA 2DICA 3QAZB 2DV6A 4NQUA 4OD1H 4I3SL 4X4XA 3OQ3B 4N2LA 2J57A 4TNWF 5ABAA 3BN9C 4PCYA 1Z3GH 5EPMA 3QDHA 4UANA 3FO0H 5DS1A 1WIPA 3U36B 5CD3B 1CB4A 1T04A 5KYUB 4CL7A 1UT9A 1FNEB 2WKGA 3HC4H 2D2CC 4FLRA 4X5RA 1RK1A 5IF0A 5LDSA 1NIAA 2GAZB 3PFQA 2FJHB 4DVBA 4L8SB 2DYPD 1QSZA 4I1PA 4K3JL 1CD1B 3TEXA 5F96H 1FA4A 4JUSA 2Y22A 4G6JL 4IYKA 2VZSA 4WO0A 3ZHLA 1XCQB 3MROA 4EVNA 3NTCH 4LVHB 5CP7A 1W15A 4C4KO 1QI5A 2FX9H 3I74A 3QQ3B 1C9SA 1TTRA 2FIRT 3CVDA 3CX5J 4G9FE 4LLVA 3KXFA 4YE4L 1E8YA 1NCNA 4XNXL 3AITA 3PAYA 3FMGH 1F4XL 1ZDQA 1U58A 2VR7A 5K33A 4XMTA 2EXYD 2XUWA 1WA1X 2BXYA 3JUZA 2FJGB 3I9PA 4GOSA 4XO4A 1E27B 5TE7L 1Y18B 3U4EB 1FO0H 1N8OE 4IMKC 3T8XB 4Y9CA 4ZX3A 1MOEA 5HGGS 3EGXB 4O51A 5DS8B 1KPVB 4LGSB 3QWOB 4PJIF 1UZGA 4M9OA 1IGYB 1L0YA 2F53A 2UZXA 4GH7B 4QHUA 2XYCA 2QHRH 2QMJA 3D0LA 4Z7OB 3MV01 3FUIA 3LS5L 5JQ6H 1GOGA 3ABGA 1UENA 3QEGH 4PJCB 5BRPA 2O6EA 1U93B 2JKRM 1MIEH 3V6OC 1EDQA 1OWWA 4ONGL 3V6OA 4J8QA 5D2LF 2F1EA 2XN9E 4QRPB 4BZ2L 1I8LA 2EH7H 2IAMB 4JFHE 1E4WH 4C56E 3IJSB 4TSAH 5J1AB 2NX5E 3EOBA 4G42B 3KPSB 4XNUH 3MR9B 1GSKA 4D0DA 1AQ8A 3RB7A 4NQDB 3MRNA 3MLRH 2HG5B 4CGUB 1OGSA 3IB4A 3CFKB 5CFHA 4K9JA 4XCFL 5BQ7A 3DUSA 4JFQA 4PIBA 4HIIB 5IBUG 1M71A 4P2QA 3U0PA 5HJDA 2NY6B 3FCGA 5JW4M 3O3EA 4RMWA 4K5PA 2J8HA 5SWQA 1GZHA 4Y9EA 3S3JA 3ZK0A 1T5KA 2ENSA 4B9JA 5C0BB 2EE9A 1NWPA 2J88H 5CCHE 4KTDH 2QDVA 4JFDA 4XH2A 3IE4A 4XP4L 2QR0A 2W0FA 4O2FB 2FL5B 4DQAA 3GXIA 4MTMA 4NM8L 3ZW3A 1EJOL 3OJDB 4OLXL 4PS4H 3OB0K 3POCA 2VM4A 3IJEA 3P0GB 4RCAA 2OCCB 4GIPD 2A99A 4JFFB 4L1DA 5BZDA 4BCXA 5F3FA 4DGVL 5DRXA 2G3MA 3P0VH 1VZIA 4DVRH 4AH2B 4P23D 4XVSL 2VN5A 3O8XA 1RZIB 2E9BA 5D9SB 5DJ6A 3GSUB 1U8KB 4P48A 4ZDHB 4NQEA 4U6YA 2COQA 4FNPA 4Y5YB 4BSVA 4I3RH 5G2NA 3K0YA 2C34A 2FDBP 1E4XI 3HUJB 4YSDA 5G5DB 2C9UA 5D7LA 5DRZB 3VWJC 4F8NA 4JRWA 4J3BA 4Z6AT 4NENB 1JPSH 1UQSB 1U8IA 5HHME 4HPOH 4E9LA 1CVRA 1YQ2A 4LCIH 5DZPA 4F33B 5I1GL 3DTXB 1HCVA 3FFCE 3PNWB 4UINL 4X6BA 5A1AA 4X9HA 2OS7A 2O61B 2OMTA 1T6VN 1WIOA 2R15A 5H37G 4NZTL 2JTDA 3QDMB 5IOKA 4HK0A 2CALA 1T5XA 3L45A 3G6AA 4LKXB 15C8L 4KTYA 3DC0A 3HI1B 2XZAH 4NCDA 4AG4L 5F1KC 2YQ2A 2CA3A 3LZPA 3MNDA 5DQDL 3KNBA 1U36A 3K91A 4LQFH 3V6FA 3LPPA 1UWEL 4RFEB 1F0LA 5CLWA 3BPNB 3KBPA 3QIBB 1WAAA 1A4KB 5I2IB 1D5IH 3L7FB 4MJIE 1NC2B 2PF6A 2P5WB 1W72A 1UJ3B 2DLFH 4XHJD 4JDTH 3WIIL 3O9WD 4E41A 3ZBMA 2HKHL 2APTA 1KSRA 2O1AA 1HK6A 1IC4L 1JNNL 1Q9LB 4JREC 3SDAB 1AZBA 1UEYA 1IILE 3VACA 3D5OF 5IY5B 4AMXA 3H3BC 1R5IB 2WSKA 3FSWA 4OLYL 1JOIA 1FL5B 1JV5B 4Y19A 1RP9A 3QUXA 1BVKA 3LPGA 4K3JH 4XO8A 4HLZH 5AYUL 5IB1B 4R4BB 2OA9A 1CDIA 2VSDA 4JRYE 1RZQA 4B9PA 3QZOA 5E56A 4HZAA 5I6XB 4L4VD 2O4EA 3DBSA 4PRID 1AGDB 5CSGA 2BCKA 1U95B 2KL6A 1F86A 2Z0UA 3OV6A 4P59L 1S9XB 1TZGH 4Z7UF 5DZ9A 3POHA 1R5VA 1HYRC 1G7QB 3WE6B 4KH9A 3H7LA 3SCMA 4PGJA 3WJLA 3QUGA 4PJFA 1RIHH 3KPSE 3MRGA 3N9GL 5DMKB 3DLQR 3SKMA 2BHZA 4OSUH 4BFNA 4TQIA 2W0LA 1WBYA 5AZEL 4GQ9L 4E9SA 1WEJL 1ODAA 5BPPA 3U7YH 4HAFA 2F5BL 3DHUA 3K3QA 2N01B 3DK2A 4EDWL 1P7QB 3BAXA 2R0KL 4OKVB 3RFZA 1IM3D 4DPBX 4KTGA 4NNPL 1U8LB 3BXNB 3Q2CA 1UFGA 1O6VA 2BIHA 2Z0BA 1UWXH 1H3XA 5I19H 3VXTA 4GG6E 1XF3A 2R83A 5D8JL 2J56A 1QEWB 2FJSA 4NQXB 4X7TB 2QSCH 5CR8A 3ARDC 5BS0D 2PWGA 4A2FA 5KVGL 4FD0A 3PXJA 2P44B 3TZVB 2AXFA 2N7SA 4NM4L 3ULVE 2X4TB 2EIMB 2FWOA 2MOVA 3E0GA 4W68A 2Y69B 3OX8A 5JQHC 3EFDH 2CR6A 5CLZA 3VGFA 4APXA 4QRTB 3M7FB 4HJ1A 4IGBC 5D1QE 3QUXD 3ZKNC 3BUDA 2VSKB 3PYCA 4L05A 4PG9B 5GS0H 2Q7AA 2QHRL 3BHBB 1FG2A 3RIAK 2GY7B 2Z35B 4OVUA 3RGVC 3D2UD 4JGMA 4LCCB 3FB7B 5MENA 2HAZA 5T1DH 2N7AA 4NO2A 5I26A 5IKCB 1KLUB 2VQ1B 2VJ0A 2CGZA 3MI6A 2EDKA 3CZGA 1GGBH 4U3SA 3DO7A 4K0OA 4MCYA 5IR1A 2GFBA 4NFBA 2AAVA 4IMLB 3V4PB 4B0MB 1S9YA 2ICWA 4M7LH 4N9GB 5TE4H 4KROB 2N4IA 4Y19E 1S7XA 2J21A 4LCWD 3FW6A 4ES8A 4KOBA 1TJXA 2C9XA 2Y6TE 4NQTA 1IGJB 2X6BA 5L2KA 2DQDL 4L5FH 3H2WA 3E1ZA 1CXFA 3I3DA 3P3YA 4W9JC 5EO9A 3K5SA 4UT9A 4PG2A 2C3XA 1RZ7L 2EYSB 1XMEB 3G5ZA 3MX0B 3EW3B 1BF2A 2EVHA 1R5WB 2LTQC 4LSDA 1DBMH 2B1HL 2R27A 1ZA3B 4BRJA 4HOZA 3LRLA 1A2YA 4XN9A 3C6SB 4CMMA 3QJFB 3V52L 3VRJB 5AAMA 1SJHB 2G2NA 2PABA 1JPFA 1AKJD 1CO1A 2EC9T 4DEUA 4Z3JA 4MMXC 4WWNA 1GJIA 2R1WB 5D7LD 5A2AA 5CGMA 2R1XB 1UM5H 3KL3A 3JQOB 1THCA 4I5BA 4OJEH 3K2UL 4NQED 2Q8BH 5D7JC 2D7MA 4TQEL 5GZOC 3FQRB 4K71B 4FG6C 4MVBC 2MMXA 3O8XD 4HWEH 2Y6SC 4OI9A 3ZDXB 1ZPLA 2Y5TA 5B21A 3AC0A 2R0WL 2DQUH 3Q48A 1L9MA 4RFOL 4UMSA 2WWKT 1AO7E 4OSUL 4GW1A 1BP3B 2DQEL 4LMQI 4Z78A 1D7FA 4MDJB 3H9YA 3KDPB 2XWBA 1KTKE 3BPLC 3CVBA 4HWZA 4A7TA 4WHTB 2YGNA 2VXQA 5E1HB 2YAFA 5INCA 2DJUA 1OT4A 3F7YA 4TVPH 3RVXC 2QTEA 2R29H 2YEZB 1WUNT 1NBVL 3M7OA 4JO8A 2XIDA 4WTZA 4JFDD 3FTUA 3BGFB 3D2UA 4MQ7A 4ZQKB 1SM3H 1VEPA 3BEVA 2EIEA 2FUQA 2K1MA 4I9WD 2V8LA 4I77L 2HJFA 3B9AA 3SKJL 4UM9A 1O7DE 3N42F 4YFLI 4XBMA 1C5DA 1YNKL 3HR6A 1S3KH 1T3FA 4J3TA 1S9KC 4N2EA 3U83A 1E4KA 1URZA 3KGTA 3ARGB 1CD0A 3M46A 2JJTC 4YHZH 1XH3B 1BEYH 4RGNC 3QUZA 2DTML 3KGRA 3LOWA 4QEGA 4WUUD 5EOCJ 1KCSL 1Q9WA 3V4LA 1JRHL 2OMNA 1F1AA 1ETZA 1YC8A 3KR3H 3EYQC 4NZRL 5F44A 1HZHH 3IETA 4KUZH 1NBZA 3F6IA 3RHWK 3O2DA 2UVEA 3N91A 1EZVX 4U3CA 1BV8A 1J10A 2WXFA 3C5JA 5J12C 1MJJA 5I76B 5TQ0H 1ZGLB 3OXSB 5FWQA 5CKAA 1G6RL 4LZKA 4FQPA 1BPLB 5C0IB 1KZYA 4JPIB 4WUKH 4RGMB 2UUDH 3K0WA 3V6FB 4EI0A 1BF8A 4PN6A 1N26A 4JKPL 3V5DB 1CDYA 4JHWH 2BW5A 3K72B 1MJ8L 4IS6B 4TXVB 2RJMA 5FKAB 1J9TA 5EH1A 3RBSA 4EDWH 3MNZA 5E00B 4KOCA 1HCZA 1OM9A 5FUOH 3ILPA 5D7IB 1T2XA 1VFBA 1M7IB 4K3EL 4XPHL 1EEUA 2VLJD 4QRQB 3WCYA 2ZOKA 3FO9A 1UB6B 4D2NA 1E90A 3BZ5A 4XBEL 2FSEB 2YBRB 3BFWA 5C7XL 2XWTB 2XQ0A 1SY6A 1U8IB 5DHXB 4B9GA 1SUHA 4Z95L 5JUEL 2YXVA 1INEH 2XZCL 4MA1C 5ANME 5FC9A 2Q6WB 5J9PB 3QDGB 4PJAA 4EEEA 5DRNB 2W81C 1JZEA 1YG9A 4HPHA 4P59H 2DQFA 3HMWL 4AOFA 5EZLA 3O9WA 3ZL1A 4G7SB 5EU4B 3ETTA 4HG4K 5TTRA 4P2AA 3GHBL 4W9DC 5DI8B 2BVEA 4UQ3A 1XGRB 2NY7H 4PJDA 1SY6H 3Q6FA 1FFNB 4R4NC 4RGMC 3UERA 4D0BA 5JOEA 5FGSA 2ZX8A 1Z6JT 1MFVA 4W9ZA 1FGVH 5CJ5A 1JZHA 5C3IA 4YSCA 1IFHL 2G60L 2WM0A 3JUYA 4HIHA 4EO5A 2G5UA 2EICA 1PU0A 1VGEL 5PAZA 4YZFF 1SM3L 3SKNB 3M8OH 4C56D 1D5ZA 1K8DA 4JJ5B 4U1IA 3LKRB 3QK0A 3DVNA 2VDRH 5EC1B 2EDJA 3CVCA 2ZIDA 3NAAL 1OAXH 5HHOE 1OM3H 4P07A 3Q2VA 3A0OA 1DLFL 4ZAKA 2WIIB 4KKZA 1WBYB 4YUEL 3QHFL 2NY0B 3FSVA 4RGNB 3OAZH 5DJ8B 2BZCA 1XO8A 2ADJA 1RFDL 4K3DL 4RMUA 3BOVA 2VAAA 2BNRA 1HHKA 1TFHA 4HZLA 4PG2C 2BWQA 2VAAB 3NCJL 4D8PA 5MP6L 3MV9D 2PCFA 2EIKB 5HP5A 5CJOL 1F4YH 1NWOA 3EHBC 4YHZL 1QUPA 2ZWNA 3BPOC 43C9A 1M57B 1N70A 1WZ1L 1H19A 1XF1A 5TGBB 4KY1L 1B2WH 2JI1A 3SPIA 3SKJH 5HVGB 1NAMA 4G9FD 3C08L 2X6UA 3LZFL 1H5BB 2NR6D 5FDWB 3UGXA 2DY2A 4BK8A 5IJBC 3LCYA 2QPEB 2XKSA 2IADA 3UXFA 2XFGB 1A3RL 4Q4EA 4D0BB 1F18A 5ANMA 3EAKA 3HCVB 5IQLA 2R39A 1BJMA 5C0GA 2QSQA 2WYIA 5D7JB 3QJZA 4IGBA 2V2WA 4OD1L 5DQJA 1DJIA 2YAPA 3GS4A 5DC4B 4OZ4A 5E99L 4HZ1A 4P2QD 4QCIB 3BUQA 3GJEB 5I8KL 2OYMA 4AV4A 1XBRA 2R2CA 2ENYA 1ZMYA 1A8ZA 1W0YT 1W0WB 3L3DB 4A6YA 3MXVL 1L3NA 5DDHA 3X12B 2X42A 4DERA 1XR8A 1RK0A 4PQXA 2J88L 4HDIA 3ULSB 1RZ8A 3CIQA 3VXSD 1A8JH 1NSNH 1NEZA 1F3JB 3FUJA 4L4TE 4S11A 4AM0Q 5G4OA 2AKRA 3WNLA 2GSMB 4QI3A 2IG2L 5EZJA 4TTGA 4F33A 1QNIA 3RPIA 2VDMB 1F45A 3CDCA 2B1AH 3VI4B 2DI7A 3ET9F 5DD5L 2PKDA 4H0IA 4OZGA 3BAEH 5FK9B 3VI4A 1X5ZA 2D31B 3SDCA 1MXGA 2DQUL 5E9NA 5D6CA 1B0RA 2FHCA 4U05A 5B39A 2BNQD 2OYPA 1F8TH 4KDTC 5KBKA 3QHZL 3ARTA 5B22A 1BD2D 1OP5H 1C16B 1HE7A 1KIPA 2FH6A 4M8QA 2C4XA 1PDKA 2ZG2A 4L37A 4PJBE 2WN2A 4JZJA 3T2QA 4U6TA 1S7QB 2Y2YA 4FQ1L 2SEBB 5HHOD 3TV8A 4LFHD 4GP4B 2J25A 2H45A 2KHAA 5C09A 2D3LA 5I6MA 4FQQB 1S9WA 2G0KA 4R7NA 4UIKH 4XMWA 2ESVB 3ZZQA 4LGRB 3DXAB 2ZPKL 3UCQA 4Q52A 2KDGA 2ESVA 2WSDA 3F3HA 1LD9B 4R7DB 1I3UA 4IKLA 4WEBL 2J2ZB 4FJYA 1WP6A 3I3EA 3LS5H 5JQ6L 5JPMC 3TJHC 3UMNA 2QADD 4GEIA 3EH1A 4KDTA 3QIWC 3G7TA 3FRUB 3ABZA 4ONOA 2NNRA 3QUKA 3ML8A 2JELH 4OCLC 2OR9H 3PV6B 4MZ3A 3KPQA 3SY0A 1YUHB 4PHXA 2DYPA 3MUGA 3BLPX 3CZKA 4WI2A 4G82A 1OPGL 3VWKB 5C6TH 3RURA 1AXIB 5HHPA 4W9LC 4FA6A 4FYSA 5BQ7B 3VX1A 2Q3AA 1G7IB 2D03L 3HG1D 4M5TA 4MAUH 1VERA 2WBKA 3GC3A 4EI5A 5K9OA 1U8OA 3M17B 3JWDC 4IDJH 4XMVA 2MRYA 2XKNB 4HAGA 2CDGA 3BWSA 4I1RA 3WAJA 1MIMH 3KYKL 4MDJA 2Z31D 3WFZA 2IH1A 3FQWA 3RVVD 3ESPA 4OJAA 2E4TA 4JRXD 5CWSA 3QZWA 4BSJA 1DJXA 4CVUA 4Q56A 4BKTC 4U1GC 3OAYK 2NX5B 3SSGA 3G6JB 2FZ3A 4OZFA 4U7SA 3V4VA 5FAAA 2HPTA 2B4CH 3LKOA 1QSVA 1I9IL 1W72L 1QYGL 2W1NA 3CSFA 4KQ3L 1KJVA 4FX5A 2HA1A 1JV2B 5DXWA 5F3BB 4G6KL 1I1AC 4LSUL 5L8JB 5C0GB 3E6FA 2YSSA 2DIAA 1NCBH 1HKLH 1NGXA 4UNTA 5AL8A 5D4QA 3FFCB 2PPAA 4M8RA 4MA3A 4AYID 2IADB 3C60A 1W0WA 2P5EB 3L3DA 4R9HA 4S1QH 5FKAA 1UACH 2VDMH 1MI5E 4PV9B 2EECA 3EUUA 5JORA 2YFNA 1CF1A 3UO1H 2FD6H 3RPKA 3U0TB 4M62L 1PY0A 4NZ8A 2FCBA 1T22A 1ZT4A 1S4IA 3EGSA 3KYOA 1HHGA 3H4HA 3OR6B 5HGAB 1WK0A 1D5RA 43C9B 1N4XH 1BZOA 3FFCD 3FQUA 1B0IA 1FN4A 1H3WM 4IMLA 1BIIB 4IBWA 3WTWA 1IKFH 2EYTA 2P43B 3BZDA 2R69L 3HJEA 1E4HA 1SEQL 4Q9QL 1VFUA 2VERA 4G6MH 2NPLX 4LLUB 1CT8A 1EJ8A 2PR4L 1ETJA 2F7IA 3HFML 3KDMA 1XGYL 3N1PC 3NA9L 5GRJL 2V17L 3DURA 3RA7L 2H3NA 2P28B 4NNXB 1W9XA 3TIEA 1QSFD 3H0TA 2PO6A 5KSAB 1I1FB 1TYEB 1MRCL 2DYRB 1N9PA 3TEWA 5SWZD 4U1MB 1AOHA 2VH5L 5D2NE 2EADA 5JW4Q 2NY4C 3B34A 3RZCC 1L6PA 1UEMA 1MVUB 5GIRA 1IT9L 1P6FA 2IWFA 3NSDA 2BVOB 3P4NA 1PD0A 4XMKL 1JN6A 3ZDYB 2V9TA 2XG5B 1GA2A 1R46A 2IQAB 4IBTA 4X7SL 1JYVA 2EEAA 3GM0A 4N3TA 2XBTA 3T1FA 4K2UL 1CZ8H 1CC3A 3L3KB 1FQ9C 2FTAA 4K7PY 3GBDA 4FG6D 4JQXA 1IC0A 1MCCA 5D1XC 4UBDD 2HVKB 5BZZA 2CGYA 1QRNE 4G83A 3UTTA 3UP1A 1A6VH 4I13B 3GI8H 3SE4C 3DK0A 1WZAA 1DN2A 2AABL 4PREA 4OLZL 1CDCA 1WPCA 5HI3C 3I3BA 1QLRA 4OKVA 3GRWA 3DARA 4XC1H 2QPUA 4XNQA 1NAMB 1TG8A 4NFDA 4UF7C 2RMNA 1UZ8A 2Z93A 2X88A 4NJAH 2XWDA 3VGDA 4L0YA 5GJTL 1AD0A 4FC3E 4BQBA 1JDCA 3VD4A 4B95C 1C5DB 1RJCA 1UUNA 3KYMB 1XZWA 5E2JA 5KBDA 1H0DA 2VITB 4WFEE 1OO2A 1YCSA 1QI4A 5E8NB 4DETA 2BVYA 5DO2C 1U91B 3P4MB 1YC7A 1I85C 4OUUB 4P2RB 5CM1A 1LDSA 4LKCA 1Z9SB 1E4KC 3S34H 1E2WA 4HUUB 2PXYC 2VDML 3VFRA 1W91A 3SE3C 5INCB 5CZXD 4OI8A 3MX0A 2NR6C 5CXPA 2VZOA 1N6QH 3D18B 3QWQB 3DV6A 5K5YA 3AM8A 4ZNEE 3QEHB 3FO1B 3EGDA 3PAVA 4CU8A 4X5WA 5CBAB 2WXRA 3ME0A 2FHFA 2ATKA 1I1YA 4JZOA 1X9RA 5JPMA 1KG0A 5KYYA 4ZYKB 1UD4A 4KBPA 4BKLA 3AMKA 3QJQB 3HE7A 4AMWA 5F89B 1Z2KA 3ZRFC 1EQWA 3DX7B 4F7PA 3LN5B 1OB1B 1INDH 4JO2L 1J0ZA 1HHGB 1T66C 1FL6A 4HKBB 3TPKA 3W5MA 1NKGA 1FFNA 3PF2A 2VR8A 1E9OA 4JPKH 3QUYA 5HGDA 2ZCHL 3ASNB 2CUMA 3OKEA 4AEIL 3KYNB 2ZXGA 3L3OC 4NQSA 4FHBD 3VFUB 1A5FL 4NLAA 1E8ZA 5EU3A 1FIGH 4X4KA 2P9RA 2HT4C 4X6CF 3VA6A 1FO0B 5BS0E 3QZLA 5DLMH 3CVHH 3WFBL 1XGYH 1P7QD 1FO0A 3G5YB 1IM3B 4D9RE 3O6FA 3TYFA 3UYOD 4TV3A 2AXHA 2NQ3A 2D3JA 3ECQA 1NUNB 5E1QA 1IVTA 5SWSA 4BD4A 3VYOA 2X2YA 3WNKA 5A2CA 4ONFL 4LLUA 4CSPA 2FECL 3CQPA 3QXDA 3OGOE 4KRNA 5IHBA 5J3HD 4MHHI 4PTTA 3ZLQC 4KVNL 4I0PC 1E65A 2GB2A 2R1YB 2CLRA 1IBYA 1IAKB 1F13A 2LABA 4NP9A 5C08D 3GZPA 3TJHD 5KTEH 3QNZB 3NA4A 4PCKA 3AY2A 3WIHH 3FS9A 1K85A 3GXDA 4HOMA 4ZUUB 2ZXAA 3QNZA 1BFVL 4LXFA 3ARQA 4UYPA 1ORSA 2NSXA 3OHXC 3MNVB 4DO4A 2Y7QB 3QFJD 3LDBB 1X44A 3GD1C 4AE0A 1IAIM 5I0WA 1OD7A 4GG6F 2EDHA 3DMMA 5FO8A 1G7QA 1YQVL 4O02A 4RISH 3WE6A 1SVCP 3OG6B 2BHYA 2J4WH 4Z0XB 5T5NG 1G6RA 3VO0A 4WIQA 2CBTA 3QJHA 4AM0B 3CDFA 4ZW8A 3U1PA 2F0CA 6PAZA 2YPVL 3BQUC 4WW2B 1FORL 4FFYA 1AD0B 5GHWL 4ZODA 1BLNB 4MVBD 5EU3B 3CDGA 3U1SH 3BDYL 3LAFA 3H3PH 3ZRSA 1J11A 1P1VA 2ZUWA 3AXIA 5SWSD 1LHZA 1AZVA 2QTVA 3RKDC 1BVLB 3TEZA 5C0CB 3RE0A 1QLRB 1DBKH 5T3XD 2Z1PA 1AXSB 3B3IB 1P7QA 1TQCB 3FN9A 3SOTA 2OMWA 4JBSA 2A73B 1RUAH 5ES4B 3W0WD 2CO7B 1FNSL 5JIPA 1BAGA 1TUPA 2V7NB 2XFXA 1PL3A 3CN2A 2WUCL 2A1WL 2VXTH 3V5HA 1L0XA 4JFOA 4PS7A 3L7FA 4BKLB 2YPKB 1Z9LA 3CH8A 2EABA 5IVNA 4L0ZA 4WI0B 2H1LM 5FUCC 5LQBH 3OKMB 4KTEL 2BIPA 1SXNA 4U6HA 1U8PB 3L5WA 3ASWA 4D8OA 4CJ0A 1XSOA 5DUPL 4NZFA 2HXAA 5I0YA 1MFAL 2X89D 1CMOA 4B0MM 3WFBH 5BOJA 2WO2B 4HJGA 4XR8C 5F7MC 4A2MA 2XTJB 4M5SA 3U30B 4X4YA 5JPNB 4GRLD 1XXFC 2WVTA 4YJZL 2XTJE 4F2MA 3QS3A 3FT2A 1MJ8H 4Z77A 4U3HA 1CXHA 4XX1G 5DMYA 5I1KH 2AI0H 3NH7H 3FB8A 3OMAB 4UAOC 3MGOB 5E2TH 2FLBT 1JVLA 2VQ1A 3BT0A 1KGYE 1UQSA 3JSSA 3OB0H 1IO4C 2AQRA 1SFDA 3VFPB 1H3TA 2DMKA 3I75A 4F7PB 5MENB 3G5YA 1FN4B 3MOAH 5ID1A 1OCWL 4HUVA 1H6FA 1OP5K 4AYFB 3GRBA 2JJSA 3S5LB 1MF2L 2NTFA 5FGCE 1A4JA 1QG3A 1TU2B 1E8WA 3HBGA 4HS3A 3S35H 3Q7JA 3AABA 2CKBA 4OLVL 3S2CA 4V1DE 2LLNA 4L2YA 1FVCA 3SDCB 2MNUA 4GMSL 3IDYC 4HQQL 4ZXBC 3AROA 4GKLA 2W60A 4EBQH 1BF5A 4BE6A 3SBPA 4NRZB 4JVWA 2F8XC 1A6TA 4BQCA 3WEXB 4AVJA 3SEPA 3NZUA 2WWNA 3S36X 3QW9A 4KFMA 1QEWA 2DM4A 1USZA 1WVZA 1N59B 1NANH 1ZHLB 3P4LA 4NQXA 4X7TA 2NY5H 1ACCA 2K8MA 1NEZB 1FAIL 4RAVB 3Q13A 5TGBA 3UYRL 3GSNB 4RH4A 4Q74A 1TDQA 3MOQA 3GZKA 3M8OL 3OHXA 3QQDB 1OGAD 1CLOH 3SKOB 3RQ3A 1P4IH 1WUZA 5F7HA 3DHMA 5GGTH 1DBAL 4UT6H 2FX8H 4ORGA 5B8CA 3T65B 4PW3A 4OCRH 2NY3C 5EFIA 5LGHL 2PO6B 3KS0H 4KTDL 3C8KB 5JYLA 4AGOA 5DGRA 1EZVY 1JCKA 3HB3C 4KRMB 3C5XA 5DJ6B 3GBMH 2K6ZA 1LO0H 3DX0A 4Y9GA 4LVNB 3BDBA 5EN2B 5E8NA 3QFJE 1EXUB 3TA3C 2B4CC 2YLHA 5J12B 2GUOB 3PWLB 4D0DB 2DLGA 5A2KH 3EYUH 3NFNA 2XQYG 4PJXB 5LGJB 3SGJA 2HMID 4ZMWA 4DQOL 4LDCA 3WIFA 1MFBL 1ZHNA 5C6PB 3PPEA 3S4SA 3L3IA 5JA8B 3MRBA 4JGNA 3LSOA 1KTJA 2DYPB 5ITBH 1WFIA 2PW1A 4HJJH 1GGUA 3D25A 4F7TA 2JKTM 3RFZB 3UYPB 2CCLA 4JRYA 1RJZB 2VL5B 2P5PA 4MX7B 1U30A 5GQBA 5C70A 3SE3A 3OKLA 4GS7B 1QASA 3RX8A 2HVBA 3QXVA 3HS9A 1HQ4B 1Q0YH 3AUWB 4JKPH 2YWZA 5C0AB 1YEWA 4OF3A 2D9QB 5F6HI 2DZEA 2ZG1A 1LXMA 2ZSVA 3ARSA 4XO9A 3VFNB 1KYUA 3LRGA 5FYKE 2P46B 4LPXA 4A68A 2W9EH 3QRFM 2D0FA 1LEIA 3RIAF 1PS3A 5AKRA 5IIEA 3MYJA 4PWGA 4DP0X 4MXQD 1G7JB 3LNEA 4Y16C 1B9KA 2A77H 3K7UA 3OQRA 1QSEE 4MNQB 3Q05A 1ODUA 1E2VA 1T22B 3DPBA 1MWAA 3GSXB 4FJ6A 4GY4A 4NXKA 5E6SB 3RWFA 2ENJA 3FULA 2HSIA 3Q5TA 5AOZA 3HHRB 1BFOB 5IROC 2AJUH 3RWHA 3MXVH 5DEGB 5IB5A 4HIXH 4PV9A 3ZUNC 1MLCA 2KI6A 5BZDB 5EZOL 3QWNA 4K71C 5IHHA 2VM3A 4B3VA 2B16A 1RPQA 3BP5A 5C2BH 3CN0A 4E41B 2DLHA 3BYTA 3WOVA 3KMDA 5HGAA 3FT2B 4QHMA 4DO6A 5CS7A 2EDTA 2IAMD 1YHPA 2ZCLL 1BMZA 4MNHB 2MCMA 4O51B 4N6RA 3SE9H 4EBQL 1URLA 1U41A 4MS6A 1B6UA 2E7HA 3GNMH 5KYUA 3LN9A 2B59A 4RFEA 5DJAA 4PJAB 4WTZG 4RA3A 3A6BH 5DHYB 3SQRA 5MENE 2Q6WA 5B4MC 5ESVB 5DO2D 1ZVSB 5EU5A 4ZTPL 5EEVA 1N68A 2VC2B 4WFED 3WJJA 4JFYA 4AEHL 3QG6B 2MCPL 2A6DB 2NY6D 1R3KA 1TTGA 1FUNA 4PB9H 3BRFA 4MA8L 5DZJA 5AW2B 2UYLA 3V6OE 2ZKXA 1EBPA 1ZEAL 3U7WH 1DQJA 1JXDA 1PLAA 5HPMB 4EKJA 2HTLD 2AXJA 1NMAH 1HKLL 4BELD 2K70A 1I1AA 1TQWA 3VXMB 5KJ4A 2ZKHH 1A9BB 3B1UA 3MRFA 1DQKA 1LO0L 3LQZA 2G4EA 3Q5YA 4BRVA 5CEZH 4ELDA 3AREA 2NNAA 4M00A 1WWWX 4P06A 3D39B 3U0PB 3CZFB 1DSYA 1YUHA 3IGAA 4JFZH 3AQYA 2WLHA 4PJXA 1CURA 1XGUB 2JXMB 2NY1C 2J6EL 4N28A 2I25N 1GTFA 4DN3L 2A73A 4DO5A 5HY9B 4XE5B 1I8KB 4PBWD 1I7RB 4QXUL 1ACXA 4PI0A 4Z7VA 3X1FA 4FG0A 1BD2A 2YKLH 4M5ZH 4NZUL 1F3JA 2VC2H 4K8RL 2BNQA 5J6GA 3MRRB 1MPAH 3D39D 4A2EA 2GSGB 2MQGA 3QA3A 1XEDA 1NZRA 3B8YA 1A3ZA 3KGSA 1FFPA 4QHNA 5D6DA 4ATWA 2JJTA 3QUKB 4YDJA 1Q94A 4NP4L 4AGLA 2A4CA 3IU4L 3VMOA 3O4LE 3BVDB 4LU5L 2Q7NA 2IBBA 2IAND 3MRJB 3CXFA 5HI5D 1BVZA 1IKFL 3T6ZA 5ISZD 4PWFA 4U7KA 2YUWA 4DPAX 1GL4B 2WOBA 4Y0GA 1MFMA 3VJ6A 3CSYA 4GP5B 3Q8FA 3U4EA 1TZHB 2CJUL 3ZHFA 5I1AA 4B27A 1I8MB 4Y4KD 5DYOA 5IW6A 2AJXL 4IBQA 1P6WA 4YWGL 2XWEA 1U8NA 2ZYRA 1KXQA 3JYCA 1LMKA 1F41A 2GHWB 3FYIB 1WBXB 4L37B 3V4VH 2XY2A 1WD8A 2A74B 4ZFOB 2XY1A 1CDHA 4PJ7B 3GEFA 4ZW3A 1FAKT 4PPTA 5CP7B 3TLRA 2JCWA 2PPFA 4HBCH 5AVXB 3BEWA 4FQIH 3TP4A 2ADFL 1VADB 3K6IA 1B88A 3O6LH 1CFQA 1QWHA 3B2UC 2H2SD 2J73A 5K93A 2PTVA 2RFXA 1IM9B 3HZKB 2YZ8A 4PR5A 4R4ND 4G9FA 5L4MA 2FSEA 4P49A 1KXVA 2JQAA 2ZKMX 5IWLA 3QI9A 3FCSB 3I9AA 2AKRB 4UNIA 4TLSA 3RI5K 2QQLH 2XLLA 4BFKA 2EACA 4MXWL 4EZKA 3CSGA 4Z7NB 5BXFA 3RVUC 1TQBC 1N8ZA 2X6AA 1A6UH 3AY4A 1MCJA 2WGXA 5F7EH 3W37A 4NKOA 1FSKB 4NT6B 3ZQWA 1EGJH 1JVOA 1AMYA 1ZA6A 4NYLB 1ED3B 5GZNA 3DJZA 3TBTA 4FXGA 4I77H 1S7RB 1UZ6E 1A1MA 3NCYS 2YXFA 4AQEA 5FO9B 5JOPD 3QJSB 1SBSL 2QQKH 3OWEA 1WZKA 4Z0BH 3ILDA 2X7LB 2ARJQ 1T2JA 1NBVH 1ZV9A 3ZIMA 1NCUA 2DWEB 1KB5H 3C6EA 4F93B 1A7NL 2F6AA 4LL4A 2C1PB 1ZTXL 1YY8A 2VDQH 3FQ4A 2E46A 2H41A 3K4DA 4KAQH 1EDYA 3KWUA 3WLWD 4JY4B 4GKOA 3ES6B 3FUNA 1DZBA 1XGZA 3VWJB 1SFHA 1RJLB 3IEAA 4GI8A 4MAZA 1MCIA 1JD9A 3RGVA 1J5OH 4NB7A 4IBVA 3T4AC 4ZMLA 4DHLA 1U2CA 3DA0A 3HPLA 2XPGB 2VYRE 3BN3B 1YMMA 3H7BB 3MMEB 3QSKB 3SDDC 4G9DA 2NW3A 5BRZE 4WI6A 4ZQKA 4F9PA 4GAGL 4OCXL 4R90L 5D2NB 4YX2L 2FRGP 4I3SH 4P2CG 4S0HA 2CBOA 4P2OC 2ZXBA 4PRPD 3TN0D 1M2VA 3ZDXF 2FLMA 5ECGA 4P4RB 4KKAD 2F54A 4LEBA 1S7SB 5JO5A 1M05A 4V1DD 4AENB 4TSBH 4RWYH 2QHLA 2VLJA 1KLGB 1GZHC 3DHJA 2QVFB 5I1IL 2HVJB 4QLRA 1KB5B 1V27A 3GBML 5IVZA 4AQ8C 3P77B 1V05A 4MS8D 2WVUA 2JK5A 4LCWB 3O41A 4H0LC 2VLLB 4N0FA 1FNGA 1U92B 1QO3B 3QPXL 4FOMA 4RAHA 1WYJA 5LGKA 2H2PD 2XV2A 3PWPB 4HUCA 4G5ZL 3PCYA 4XNBA 1DEDA 2D0HA 3GSQB 4UQDA 5KYXB 3B9KA 2KLTA 1A4KA 4Z7AA 4RETB 1N18A 3FB8B 4Y5XB 2DWXA 2K7PA 3US1A 3SCMC 1Z5YD 3GNML 3D4CA 4G3YL 2MOQA 4PGBB 1C8PA 4YHNA 1VADA 5FM4A 4IBLT 1EHLL 2P5WD 3JT0A 1J9RA 3HA0A 3FMGL 4P5KB 3BEWB 3W0WA 5I71B 2P5EE 3HN5A 1WJ3A 2BSBA 3N50A 3K72A 1HOEA 4DUVA 4D3CH 3IWVA 3GLZA 1X6LA 2P4AB 2CHNA 3VRLF 3W57A 3VUAA 5KVFH 1HL8A 1YMHA 4M7LT 1EEZB 3HMWH 3INUH 3JV4A 5BW7C 4LCUA 2B3IA 4FFWD 1T1ZA 3GHBH 3TO2A 5KG9A 4QRQA 2ITDB 3SGJC 3CPUA 3II1A 3C5JB 2J4WL 5MEOB 2BP8A 4GT7A 4ZZKA 5DK3A 3TYGH 2YD4A 5EBWB 4BYHA 1DR9A 2I32A 3MLUH 5KJ7E 1J9CT 4UIMA 5CEZL 3I02A 4MYWB 1A7PH 2V2TA 4Z7WB 3U0TA 1PCXA 4OT1H 4NERA 1HS6A 3WKMH 3GLDA 5I18L 2R0LL 4AL8C 1K4CB 2EYRB 4JVPA 1QKZL 1UT1A 5MEPB 4O4YH 5D2LA 3VXUA 3QWRD 4AMKL 1O5DT 1NJ9A 4CRPA 1Z5HA 3IRCA 5I15H 2F9BT 3AB0B 1P69B 2OYLA 1GGYA 4J3UA 1GKOA 4JEGB 2AJ3A 4XHJC 4GUPA 3K6FA 2JCCA 1MDTA 4UDTA 3NIGE 2BNRE 4MNGE 5L2JA 3HPJB 2WXPA 2XSKA 1WAEA 3O3BB 3IMUA 4NUMA 4ZW6A 3NGBC 2A9NL 5BS0B 3P69A 2W38A 4JQXC 5KVFE 3SDDD 3FKUS 4L1HA 1IGML 4JKWA 3NAAH 3QQ9D 5IREA 1MY5A 3GGWA 5DSCA 3ARGA 2AGJH 3DYOA 4XO3A 4F37K 3UAAA 1HAUA 3APDA 3MNVA 1MCQA 4XZUA 3ISYA 4X99B 2PP8A 4LOEA 1N10A 3WKPA 3GMOA 1AKJA 2VN3A 3B43A 3CZLA 3D69B 1A64A 1HHIA 2HJFB 3JWNG 3O6FD 4S1SH 5HJGA 3UTTB 1YYML 3WEOA 4AX3A 1HU8A 3HRZA 1JK9B 3WTTA 4BIKA 4LCUB 2G5RA 1E4XH 1NGQH 3LXBA 2AQQA 2XX0A 1SOQA 3EYFB 4IMKA 5GSVB 1L3WA 2A83A 1XL4A 3NBNA 5KSUA 2OZ4L 3SKMB 4DPCX 1R24B 4KVCL 3QFDB 5IR1B 1LK2B 1IC5H 2AXGB 2BDNH 3G5WA 3QUYD 4GKNB 4NDMB 1CIUA 3KPRD 4WEUD 4XHQA 4F7CB 5C9KA 2VDNB 4TNVK 2CM5A 3SGEI 1QR1B 1I85A 3D3VB 3S8GB 3FB6A 2X6VA 1OGTB 3WL9B 2IDQA 5E99H 1FYTA 3LIZL 2MOGA 5L9DH 1LILA 3ZE1E 2QVIA 1UZ6F 4LLYA 5KYXA 1AE6H 1C7SA 2FSDA 2A6JA 2WTOA 5KN5B 1AOZA 1KCWA 5DS8A 5F9WB 4NCC2 2VDRB 2AEQH 4CVWA 3BLKA 4L4TA 1BOGB 1BFSA 3GSOB 1IM9A 4PR5B 2AFNA 2HTLC 4U6VL 3L16A 5IVOA 1EH9A 3P3RA 3C75A 2BJML 3CPLB 1R5IA 3SYCA 4DP2X 4WEBH 4AVIA 1AIFB 5HJ3A