1A3RH

Fab fragment (antibody 8f5) complexed with peptide from human rhinovirus (serotype 2) viral capsid protein vp2 (residues 156-170)
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
217
structure length
212
Chain Sequence
VQLQQSGAELVRPGASVKLSCTTSGFNIKDIYIHWVKQRPEQGLEWIGRLDPANGYTKYDPKFQGKATITVDTSSNTAYLHLSSLTSEDTAVYYCDGYYSYYDMDYWGPGTSVTVSSAKTTAPSVYPLAPVCSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a human rhinovirus neutralizing antibody complexed with a peptide derived from viral capsid protein VP2.
pubmed rcsb
molecule tags Viral protein/immune system
molecule keywords IGG2A 8F5 FAB (LIGHT CHAIN)
total genus 43
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 1998-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF07654 C1-set Immunoglobulin C1-set domain
H PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3rH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1a3rH02
4W68A 1MI5A 1NANI 5DEFB 4F9PA 5D2LF 3S4SB 3RVTC 3LB6C 1RIUH 2WQ8A 1EAPA 2NTSP 3HPLB 1Y6NR 3AY4C 2XZAL 3MA7A 4YHML 4A2LA 3ZDZE 1CS6A 4LIQL 4CN4A 5IHBA 4X4XB 1QLEL 1FFRA 4ZTPH 4IRSC 1MWAH 2A83B 2D0GA 4X5WA 4GUPA 4XB8A 1AGCB 1XIWB 2PO6A 3HFMH 4PBXA 1GSMA 1OD7A 4P5KA 1UACL 3VH8B 4HUNB 3WE6B 1NGPH 2VERN 1RZ8A 4NNPH 3ES6B 3OKKA 3GIZH 2QADB 3T0DA 5BVPH 4OKVB 2EXWD 4X7CC 4ZUSB 2ESVB 5BRZA 4XHJC 3MREB 4S0TD 4P9HL 5TQ0H 1RJZB 1NLDL 5F9WB 3DX9A 1U8NA 3O9WB 4KRLB 4Z0BL 5FO9B 1JWUA 1P7QA 2XY2A 4ZO8A 5C07B 5IKCA 1S7SB 2VMFA 1IC4H 1BBJB 1ACYH 3QXDB 1LO4H 3EFFA 3GMNB 5JXAH 5LQBH 4HIIB 2J6EH 3STZA 1AR2A 1MIEL 1J1PH 4NN7B 1NJ9B 5CEZD 3KJ4C 3MRHA 3QG6B 1E27B 4CMHC 5CINL 1WWBX 2CDEB 1MCIA 2EEBA 1JMZA 3AS2A 1FORH 2CJUL 2PXYC 4X4MA 4R7NA 3QEHB 3KPSB 1S7XA 1HIML 2YSSB 4M1GH 4UIKH 5IB2B 3NGBC 4UV7H 4BSJA 5BW7A 3CXDL 5CGTA 1WZLA 1TJHL 1IBGL 3BKCL 3RU8H 1W0VB 2W07A 3BO8B 1VFUA 2HN7B 4OT1L 2DTMH 4MD4A 4FOMA 3VH8G 1XCTA 5FA3A 1RZJL 2ESVE 3VFRA 3S3PA 1OVZA 3PG2A 2VDPL 4PYGA 4I2XA 1J7VR 1KJMB 3TN0B 2FO4A 5C3TA 1E6JL 5DURD 4FRWA 4LRNL 4HD9A 1LO2H 1IGYA 2X9XA 1TCRB 1G6RA 2DL9A 2NXZC 1I1AA 2Z8WC 4S2SA 5CWSA 2Z93B 1UWEL 4JY4A 1EXUB 4OLZH 3NFPB 4Y2DD 1N5AA 1VGEH 4MS8C 4EIZC 1MFEH 4EUPA 2APXA 4MJIA 5DMYA 3NIFF 4KRNA 4APQA 3GMPB 3WNPA 1S5IL 2PCPB 4D2NA 3RKPA 5F9OH 1G9NC 4D9LL 5BMFH 1KENL 4LSTL 4J3XA 2HKHH 5ICXB 1I9EA 2C4XA 4AY0A 4P2QA 3MBEB 1DQDL 4QRPA 2YN3A 1HXYA 3LDBB 3V6FB 4YIQA 3NPSB 4LL9A 4NWUL 5D7JC 1BGXH 4UT6L 2NXYB 1AGEA 1G1CA 4JQIH 2CKBA 4D3CL 4KK8D 2C9AA 1V7NH 2AABL 3NFSL 1IEHA 4XXCA 2OQJB 5HYJA 1KSRA 5A2KH 5GS3A 5IM7B 4LIQE 4U6YA 5F9JB 2YK1L 4F37F 1XF2A 1IGTB 1PKQA 1PQZB 4C55A 3WKMH 3HR6A 3QWOB 3U7YL 4RGNB 5F1OB 2HTLC 3ROOA 1F4XH 1PDKA 4PPTA 1JNNL 2YD7A 4U2ZA 2ATKA 1HKLH 2FX9L 3FQTA 5DJAB 4ORZC 5HGHB 3N9GL 3UC0H 3O4OC 4FS0A 2DQTH 3OB0K 3BX7C 3CMGA 5HJ3B 3C60C 5INDA 1OAQL 5T5NG 4PRHB 3MXVH 4UQ2B 4UTAL 3BPCA 4YR6A 5EZOH 3UO1H 5C2UB 3VXTA 1VGKB 3TZVC 4G7YL 3QJFB 3QDMD 1YEKH 2YUZA 4OI8A 5IEHB 4QXTB 3C5ZA 5D71H 2NPLX 5JXEA 5CGYC 3SDCD 3WYRA 5HGDA 1LWRA 1JTPA 1IGIH 4ZFOA 2FRGP 2QADD 5IG7B 4ZFOL 5I19L 5C92A 3U30B 1SJVA 5M7QA 3JWOL 4CMMB 4UIMA 1WIPA 4OFYD 2PO6C 12E8H 4K7PH 3S35L 3KPPA 4CNIA 4TULH 4ZUUB 5JQHC 3FO1A 4UNTA 3LPFA 4M00A 4WHCA 3IJYB 4QRRE 3L5WB 4XVUD 3RQ3A 3ULUE 1UVQB 4M7JH 5DRXA 2LTQB 1YJDH 1Y18B 1YECL 1X5YA 4QWWD 4GAYA 4ZFFB 1QEWA 5CEXB 3C60B 3QJHB 4XTRC 1YC7A 4HFUH 1W8OA 2FLBT 5D9SB 4BELD 1QA9A 3QUMB 3U0PA 2AJ3A 4X7SH 3TC9A 4EBQH 4U1KB 1BQHG 1TDQA 1LNUA 3PWLB 4U1JB 4KRPB 3C9NA 5EWIH 2YA1A 3ZHLA 3I50L 1XGRA 4IJ3C 1YC8A 3BSZH 5E00B 1N5YL 1MIEH 2VOTA 4Z7QE 3UTTB 1KXTB 3DBXA 3QJFA 1EEYA 1X5XA 1RZFH 2PXYA 3JTTA 2X41A 2AK1H 5DRZA 3SKNB 5JIIA 4OF8A 3BQUC 1CLZH 1NGZA 2BY2A 1N7MH 3JUYA 1EAPB 2YUVA 1CL7H 4Z0BH 3EJYC 3ULVF 2C4FT 5JOPE 1MOEA 5JOFB 5IV2A 1KTKE 1MFAH 4OZFB 4H26B 1GGUA 1Y0LA 2VZVA 5KS9E 4U6VH 4HJJH 3UTPD 4D9QD 2H32H 3W0WE 1EZVX 4LCWE 5E8PB 3T0VA 5B8CC 1PKQB 5C0AE 4PJ7A 5IW1B 2Y36H 3I2CL 3ZSSA 4TRPH 1IKFH 1IEAA 5F7KC 4U6XB 5EIIB 1Q94B 2OL3H 4FNLL 4HJGB 3TNMB 4DOHE 1FPTH 2XFXA 4Q6IA 3EYOA 4P5TA 4LRNH 1ND0B 3S97C 4OSUH 5JDJA 3UEZA 2OR8A 3OXRA 4F7MA 3L3HB 1MRDH 1CQYA 5CFHA 1BWMA 1G7MA 1GGCH 1G9ML 5JZ7C 5B22A 3LQAH 2PYFA 4NDMB 4YGVA 3TWCL 2WANA 5D7LD 4QY8A 2IFGA 4ZO6A 2GFBA 2JCCA 3WN5B 2ZCHL 2EIBA 4JPKH 3UBXA 3K8MA 4PRPA 5FYKU 3UDWC 5FUZH 4K2UH 3U6RA 1NMCB 2CKNA 3GO1H 1DTUA 1AI1L 2NLJA 4X6DB 5FGBC 1F00I 5IB4A 3VXSB 4M7LH 3RVTD 1PSKH 5FOJA 2KPNA 4V1DE 4JFPB 5J12C 1FAKT 5MP6L 1DN2A 5DUPH 2EYSA 2MQ0A 3TT3L 4BKLB 4GAGL 2V2XB 5D8JL 2DB8A 3TO2B 3KPQA 4FXGA 4I13B 5ICZA 3KWWA 5I1IH 4O2CB 2C7UA 1A5FH 3VE0B 3T1FA 1CICB 5L2KB 3TNNA 3VXNA 5I6XB 1NFIB 4QXWA 4LVHC 3MJ7B 4P2RA 1YQVH 3FO0H 3QPXH 3ZKXB 3VFMA 3F62A 2DTML 1JGUL 5FYLH 1YMHB 1CU4H 4KK8C 3Q6FA 3HC3H 3UJIL 4PLJD 5GGSY 1JWSA 1EFXA 1D9KB 4ZXBA 1FCCA 3FOMA 5I16A 2HH0L 1CVRA 4OTXL 5EU7C 3FT3A 1FE8H 3E2HC 1AGCA 1NANH 1EJ6A 1WC7A 1CWVA 3TVMB 2YRLA 4G6AC 4QCIB 3QEGL 4HCRH 1L6ZA 3MV7B 3K1KC 1IARB 2Z8VC 5ISZB 1VFBA 1GAFH 2OI9B 4YNYB 4N1CA 3BIKB 5D96B 4RQQB 1XGUA 4ZNEE 2BOBA 5KANI 5J6HA 3KPMB 1T21B 4FP8H 3VD4A 4PY7A 4DVBA 1T1ZB 5I8OH 4JO2L 4MHHG 4L8SC 1P5UA 3WSQL 4QRSA 3QI9B 3IU3B 15C8H 1AGFB 5BV7C 3Q2CA 4YHLH 3R1GH 3SHSA 1UC6A 3ARFA 4HFWA 4PY8J 1YYLH 2AJSL 4L4TA 1RJYA 4QYOB 3EO0A 5HHOA 1P2CB 4YDJB 3F7YB 4OZHB 4BH8A 5CJ8A 5C3LD 1UQSA 1GYAA 4GW5B 2G60H 2GTWA 2FJFB 5DUML 3M07A 5AWNH 2R39A 4JFDE 5CHNA 4JY5H 1H5BB 3RY6C 2O5XL 4JREC 5E6IA 1CLCA 1FNHA 4FXLA 4X6EB 4H5SB 1KTRL 2ED7A 4OFKA 4LPVA 3X3FH 3BJ91 1S8DA 3O3EA 2L7JA 3NIDF 3UTQA 4KUZH 2NX5D 4NZRH 1QFWL 2FD6H 3ET9F 1QA9B 4XCNB 2WBWB 2OJZH 2BZDA 1ONQB 1TVBB 4NP4L 4OFVA 5DD3L 4HMDA 4R90L 5GRVK 4FG6C 2QQKH 4QHUA 3IFOB 4X98A 1H3PL 1VEMA 5HPMA 2HTKC 2OZ4L 4ONHA 1CF8L 1EEZB 5CP3H 5F7DA 3BUYB 1TZGL 4FNLH 1N64L 5HGAA 3ZKMD 4IRJB 5CCKL 3MXWH 3RWGA 5CKGA 1FL6B 1YEFL 3IFOA 4J7RA 2XA8L 4WV1A 2WINA 1JPFB 2ZUXA 3OB0H 2W59A 2VKXA 3E1F1 4JFPA 1J8HE 1FHGA 1K8DB 4HGWB 3AAZB 3NCFB 4GG6A 4N0FB 3NPSC 3GK8H 3QIWA 1R24A 1KJ3L 3LD8B 1PG7W 2EICA 5EBMB 5IROA 1ERNA 3ZYIA 1FC2D 3CFEA 3MBEC 2DTSA 2ICEA 5ITFB 4ZPTA 1MJJB 5HGBB 4Y1AD 43CAA 3AM8A 4JO1L 2IFFH 4MDIA 3VD7A 2IPUG 3KGRA 2BJML 1IGMH 2WQRA 3W2DL 3VE0A 5L2KA 1H5BA 3WUWG 2PNDA 5BJTA 2ATPA 4KROC 3WIFA 2FHCA 4AH2A 3BGFC 3UTTE 3QWOA 1WT5A 3BQUD 2NY3D 5JXEC 3BXNA 3DWTA 4PGJA 3MX0A 1OGAA 1CFQA 2Y5TA 4CADA 4PLOB 3SKOB 4MNHB 2X6MA 3MJ9H 3O0RL 4J3TA 4LAQL 3RWEA 5IW1A 5F9AC 2A73A 5EBWA 2WP3O 2BVYA 4NJ9L 5E8PA 2FGWH 3KS0J 4TSBH 3MGOA 4HMEA 4HHAB 3VXME 1FC1A 3H9SE 1J8KA 1MJUL 1GGIH 5A2IH 2JELH 2GJ6E 4LDLB 1ZTXL 2F53E 5JW4N 4JKKA 3VFSB 2P7TA 1LDPL 3WHE1 5CZKA 2IGFL 1HNFA 3PL6A 2V2WA 3BKML 3HUJB 4M6NH 1NH6A 1FZOA 4Y16A 1RK0B 2XA3A 3QUYC 1FPTL 2YA2A 4GQ9H 5D5MA 1JVKA 3DX6B 3QUZA 1I1YA 4DUXA 5FECB 1FRGH 4LU5L 4F58H 2DDQL 2MKLC 2EXYD 3HI5H 1I8KA 1ZT4B 2EE6A 6FABH 1JZ5A 1FGVH 3C2AL 3B6SA 3AMLA 1Z3GH 3CFBA 5EWIL 4GLRI 3KDMB 4ODHL 2GK0A 5F97E 2MKWA 1JHLH 3MOQA 1FLRH 3OF6A 3D85B 4Q0XH 5J6GB 3VG0L 3L7EA 1RJCA 2V5MA 5IIEA 1WAAA 4Z7OE 1ZEAL 3GSUB 5DVOA 2NY7H 7CGTA 1PX3A 2ORBH 3CXHK 2QSTA 1E6OL 2GT9A 3VXMB 1SY6A 2WIIB 1P4IH 4N0UB 2D4DA 5K59E 5IHLB 5EO0B 1IAOB 3UBXI 3FFCB 4OUOA 4LFHG 5GIRA 3ARGD 3O4LE 2ARJA 3DYOA 3AB0C 3IAPA 3WNMA 3P30H 3CC5A 3FO9A 1C7TA 1OAKL 5EULV 3VGBA 5GJTL 3GEWB 5TJWK 3BW9A 3L3GB 3BEVB 2QQLH 3V9FA 2JK5B 1A64A 4YEEA 4NYLB 5AWNL 4RZCA 1HSBA 4KKCC 4YUEH 5AZEH 5DD1L 3HE6C 4GRLA 5L2KE 3MV8B 5D9SA 3VFVB 1U3HA 3VGFA 5TE7L 1I1CA 2DI9A 1KTDB 1CN4A 2H32B 3DLQR 2DYPA 3KXFB 2CJUH 1X4ZA 3CUPB 1SBSH 3P4MA 3V7AE 4O58H 4QRTA 1NGWB 3LSOA 4O2FB 1B2WL 3GJFH 5EZLB 1WEJL 1B0RA 1IGJA 4M8QA 4RIRB 3U82B 4CDGC 2P43B 1H9VA 4KJYB 4B7LA 1K85A 4ALAL 4WHDA 1F6LL 2FR4A 1P4LA 4F7MB 5EUKA 5DJCB 5C0JA 4OZ4A 1T1WA 1U8KA 1PZ5B 1NCBH 1HI6A 2FATL 3BQUA 3TPUA 4S10A 1JUFB 1XF4B 4QHKI 2ZOKB 3CLEL 4RNRB 4M5ZL 4OZGE 4OZGF 1G6VK 3C6LD 3HS0B 5GRJH 3FRPG 2IJ0C 2JJTA 1I4FB 2XTJE 4WI3A 4BFIB 5GRVL 5JXAL 5SWQB 4N5EC 1TJIL 3BGMB 3FB7B 4MD0B 4WENB 1FZMA 5INDB 3MBXH 2NY0B 2X70B 3V6FA 4KDTC 1R5VB 3W0WA 2BRRH 5CSZB 3PWPE 3KNBA 4JVPA 2O61B 1A6VL 2BNQA 3IFLL 1I4FA 3QUMH 4JFDD 4BQ9A 3QQ4A 4PRBB 1DVFA 4PGEB 4W4NA 4B53A 1CK0H 4Y89A 1ND0A 5L8LB 2VDKL 4U6YB 5F9JA 5FHAL 5CJXA 4Y2DB 1F5WA 4FQJL 2MMXA 3MLYH 3QXWA 5IFJB 1UA6H 5EORL 2G2RA 4GS7B 1MRCH 2ARWA 3KYMB 1FYTB 2KQMA 4Z7QF 3VXQA 5FF6A 1OARL 1OP9A 5EUOE 4OZIE 3L5JA 1YEHL 1QEWB 2BVOB 3D0LA 2BDNH 4UOW1 5DD3H 3RVVD 5BCAA 2W0FB 4L4TE 2JELL 4HS3B 1EEQA 1W72B 1K6QL 3N9GH 3RZCB 1MCCA 1U92B 4Q6YA 4FP8L 1CZ8H 3WNOA 4Z7WF 1J0KA 4AL8L 2H2SC 3JV4A 4GRLB 5D1XC 1IE5A 3RNKA 5BVJB 3LN4A 1P69B 1U8QB 1JK8A 1R3HA 4G7VL 1G6RB 5IG7A 1QSFB 2K3TA 4LNVA 3HZVB 1CE1L 3M8OH 2V2TB 1G7HA 3JV6B 2IPKA 3ZDYF 3CH1B 3EHBD 3IGAB 4M1DH 1EERB 4MQXC 2DQHH 5F7FA 4OFIA 1QBLL 5SWZB 3M45A 4FTVE 4OLUL 4PJ7E 4D3CH 1IGJB 4IS6A 4RIRA 4Z7NE 5JW4Q 3FFCA 3K2MC 1A6ZB 4M6NL 3D2UA 3V6OC 3B2VH 3PIQB 5J11C 5DQJB 4X4YA 3QEQA 3BO8A 4GRWE 5AUMB 4U1GB 3UTZA 3X14A 2R2BA 1S9YB 2DYPD 4EI6A 2NQCA 4YHNB 5C2BH 3HB3C 4G8FA 3LH2L 4HPOH 5ETUA 2DQEH 4O9HL 3S35X 1GGBL 4WWKC 1MEXL 2PO6D 3O9WD 4NM8L 3E8UL 1RPQA 3QDJA 3VA6A 2J5LC 4UV4H 3HNSH 5EN2B 1J0HA 1DEEA 1RK1A 2CGRH 4RSVA 3MV8D 3S5LG 3S98A 1J1OH 2CXKA 2PF6A 4LDEB 2HLAA 5D2LB 1NBZA 1XGPB 1MCWM 5T3XH 5IFAL 5FDWA 3J8F7 5DTFB 4BFEA 1BOGB 5I1LA 3E6HB 4I0PD 1MF2L 3G9AB 3FRUA 4KZEL 2VZOA 1S7QA 1TFHA 4LASL 4Y16B 4DN4L 4GW4B 3TYGH 2WIIA 4CU8A 3PWVA 5JUEH 4WTZA 4G9FB 4LCUA 2DJUA 3MLTB 3JWDL 4OZGB 1HXYB 2AQ2A 1VFAB 5HHMD 1P7HL 2VLLB 1UM6H 1S9XB 4Z78B 5IHUH 5IBLC 4FQ2H 3ISWA 1DBBL 2G2RB 3GK8L 5C7XL 3ZKQD 3NBNA 5L2JB 3GJFB 1NDMA 3M1BB 2QADC 1UB5A 4NO0A 4GG6F 5HYJB 3RPIB 5I17A 4OD3L 1BQSA 1M1SA 5ID0B 1Q9KB 1UCBL 1FNGB 1QBAA 5DDHB 4QT5A 4WW2A 1F4HA 2R2HA 2ZUQC 1IKFL 2CDGA 2Z31B 3PWUA 4D9QE 3BFOA 1T7VA 4O2EB 5IGXL 2CO6B 1SBSL 2J8UE 4F3FA 5H35A 5I2IB 3Q3GA 4NIKB 3QBTB 3FOLB 3QDAA 1D5XB 4OCNC 2JIXA 1KNOB 3L3DA 5C0DA 4AENB 4MA3B 4P2QB 4QRPB 43CAB 5ALCH 4M62H 2AI0H 4LSTH 5EOCL 1KLUA 1FIEA 1T3FB 4X7SL 2XWTA 5CBAB 3UPCA 4HWBH 5LWYH 3HG1B 5CIPH 4NRYB 1OAYL 2VZ3A 2FGWL 3VD3A 1N7ML 3WMSA 3BP6A 5MEPB 1OCWL 5ID1A 2MCPH 5GS0C 5DEGA 5GZOD 3B3IB 4K3JL 3SDAD 5F6HI 5FCUH 1PFCA 3DRTB 4Z7WB 1IM3B 3TNNB 1H3UA 4UQ3A 1I9IH 4NN7C 4GJTB 3MROB 3DVGA 4X4ME 4HUVA 3I6GB 3S35H 5EBGA 4NQXB 3K4AA 5IESH 4Q9RH 2AS5M 3W39A 1GOGA 5CD3A 1CDGA 1UCTA 3DRQA 4P57B 4QRTB 3B3IA 4CRPA 1MWAB 5HYIA 1W0YT 4MWFA 5C0IA 5I15H 3LKSA 4I18A 1H3TA 3FOMB 1HHGA 1KCVH 1TETH 3HI6L 5ALBH 5CEYA 3PV6A 1YEHH 2NLJB 2YEZA 3U7AA 2KH2B 2P5WA 1NMAL 1L7IH 1GGCL 2DBLH 4JG1L 1HE7A 2OR7A 5I30L 4ISVA 2N1KA 1T5XA 5CJOL 3ZTJH 2FSEA 4RBPH 4P57A 5D96C 2APVA 1MHPH 2GTZA 2X4UA 5KZCB 1FVDA 1CICA 3FCTA 5L2KD 5SX5H 3GMNA 3FB6B 4E9LA 1N5YH 1KLGA 3LQAL 1NAMH 3QDME 3V6OE 3SDCB 4RA3A 5FO7A 1CDIA 4YBHA 5C0BD 1H8OA 2VXVH 4L29B 1PSKL 3DUSA 5KVFL 5F7UA 2NY1D 1IGFL 4JRXD 3M1BA 4K7PY 1MFAL 1AI1H 1SYSA 1DBML 1AD0A 5DVKA 5KN5A 1I7ZB 1X4XA 2A77H 1W72H 2ZUWA 3D69B 2F53A 1QFPA 3RAJL 4LCWD 3ZE0E 4L4VD 3V8CA 4WEBL 5LVEA 2W65B 5DYOA 2AV1B 4LDOB 1K8IA 1T0PB 2IC2A 1FO0A 2PYED 2DMKA 2XICA 3V0VB 2X1XR 5C0ND 2DD8H 5HVWA 3FRUB 4JFZH 4PJ5E 5AG9A 3EGSA 3OXRB 3SCMA 1VFBB 1I75A 3BZFA 2D7TH 4OLYH 1CDBA 4NQVA 1U8IB 3FHAA 3HZKB 4ZS7L 5LBSH 1FZJB 2HH0H 5JIKA 3PXHA 1FYTE 1I7UB 5DRWA 4B7IA 2JE8A 3OKEA 3MRBB 4TTDD 3D25B 3UYRH 1AKJD 3I6LD 3QIUD 4KMLB 1GJIA 5L7XH 3T08A 1TVBA 5BW7C 5INCB 3QI9A 3NCMA 4LCIH 1WV7T 3PF2A 5DHVA 3WNLA 3U7WL 4Z8FH 4FQLL 3U0WL 4PJ8C 1EFXB 1FVCB 2IPTL 1T83C 3PE9A 1QFUL 1N26A 1RZGA 3BEWB 3OXSA 1KN2L 2FJHB 5D1XD 1ZMYA 3MRGA 2DMCA 4OBRA 3GB7A 4M6AA 3C8DA 2BNUB 3GNML 4LLQA 2OK0H 1OQOA 4KMTH 4ZUTB 1ZS8A 4U1IA 1OGAB 3G6JF 1F3DJ 2IAMA 5CD3B 1T66D 1B0WA 2W60A 2H2PC 1QUNA 4MNGA 2VDLH 2HFEB 1S5HB 3V6BR 4NZUL 2C7UB 3VFTB 1DSFH 2F54D 4OGXH 3OG6B 4OD3H 1XIWC 4IDLA 3MLRL 5BS0B 1OAXL 1QSFE 4AQ1B 2D2OA 1KCSH 3KYAA 3OJMB 1P1ZB 3TH2T 3L3OB 4DWHA 5J13B 2RHEA 1INDL 1JRHL 1LVEA 5MEPA 1FLTX 2Y4SA 4JFFD 1T0MB 2L7UA 1IGCH 2XN9D 1CIUA 2PW1A 5M95B 4C83A 1L7TH 4ZFFA 4P9ML 3DVNB 1BJMA 2B4CC 1MWAL 3MJ9A 3MJ8A 4NWTL 2KDGA 4DUWA 5J13C 4K07A 2DLTA 4GBXA 4L4JA 4FABH 3W39B 1I9RL 4HEPG 3BVNB 3TA3C 3KPNB 1D5ZA 1AY1L 1DBKL 4KPHL 2FHBA 43C9B 5K9QG 1HHHA 2E3VA 3C6SB 4OCMC 4MB5A 2FX8L 4JRWA 3D3VB 1ADQL 5CP7A 1ADQA 3KPQB 4FXGB 1E4XL 4AEIH 3EHBC 3RPKA 5CZXD 3NCJH 4Y1AE 5DC0A 4Q2ZB 4YE4H 5T1KB 5DJ2A 1B3JA 3LIZL 4ZFGH 4ZFZB 1T1XA 2MFNA 1XMWA 1NDMB 1QBMH 2YUWA 4M6ML 5B38B 5GS1B 4O02L 5IMLB 2KZ1B 3G08A 5E99L 2J8UA 2FJGB 5T1MA 4HX1A 1MFCL 4FQQB 1XR8B 4PUBL 4H26A 4LLYB 2P5WE 1ES0B 1J12A 2DLFL 2GITA 2GQHA 3SKJL 3NZHH 1MCQA 4TSBL 3MBEA 2E6QA 4PFEA 4OGZA 3MRBA 2Y6SD 4BSWB 4F3FB 4LHUG 1HQRB 4P23C 5B4MD 5FYKD 4E0RA 1Q1JH 2BNQD 4JFDA 4ODBD 4C56B 1KB5A 4GW5A 3QFJE 5HHPA 1F58L 1IVLA 2BVEA 1RIUL 1FZKB 3Q1SL 3QDGD 4JM2C 4Y5YC 5IB1A 3N0PB 5HDOA 4X4ZA 2AW2A 1MAKA 3S36X 3ULUH 3Q6GL 1TCRA 3P4OA 4DGIH 2DQCH 3L3IB 1MFNA 4IDJL 5C08B 4NQTA 4K3DH 4OKDA 5D6DC 2GCYB 3WFDH 3FQXA 2J6EA 1X5IA 1S9XA 4WHTB 1NCWH 3QUYD 3WEXA 1XFPA 3CU7A 1MH5A 4MXQD 1T1ZA 3QCUH 3GSVA 1FNFA 1DBMH 4LEXL 4Z76B 1RU9H 3DGGB 2BOCA 3LSOB 1NGWA 4D8PA 4WY7H 2ESVD 4FN0A 4XP4H 2I5YL 1Y18A 1AE6H 4R26H 4Y4HC 2IANB 1A6TB 1DLHB 4JEGB 3HR5A 4JCMA 4FQ1L 2BC4A 1U0QA 5JIHA 4NUGH 2C3XA 3HZYB 1XF4A 3CH1A 3VCLB 1HSBB 2CD0A 1FBIH 3LEVH 4PG9A 1KIQA 5HHXH 3VD9A 4ISVB 4KAQH 5ACZB 3RWDB 3HZYA 4G6FD 4OT1H 4OZHE 5CKAA 3RGVB 2X4OA 3RVXC 4MMXC 1NUDA 3VXMD 4PJBA 4ONGL 3TO4B 4B5EA 4EVNB 4ZQKA 1NEZB 1W72A 2Q87A 4QF1B 1KCRH 2OJZL 2P45B 2VLRB 4X8XA 5E9DA 4U7KA 4O4YH 4ONFL 4UIKL 2GW5A 3P73A 5F96H 2DBJA 1WBZB 5BS0D 4U1GC 2KQNA 2R4RH 4GKZA 3D1MC 1T89C 3EYVA 3GI9L 3MOAL 3TN0D 2IANE 5GGSB 4HSQA 3PHOB 3O6LL 1FGVL 4LBEB 4OZFH 1QSEB 1J1XL 1I7RA 1ZHNA 4J6RL 1PD6A 4LSRL 1S7TB 1M6OA 1QP1A 3C9NB 4PBWD 4U4BA 5HGDB 3HRZB 1TZGH 2HKFL 1AIFA 5GRUL 2MCPL 4KZDL 3U2SA 1PG7X 1LEIA 3EFFB 4MJ4A 4C4KT 3VXOB 2O26U 2YMXL 5T33L 1LP9E 2Y7QA 4UNVA 3PQYB 4UB0L 1N59A 3MNVB 3OBAA 4P9HH 4EI6B 2P42B 3DECA 35C8L 4HS3A 1OWRM 2F5BH 4K71B 5C0RL 4ZUTA 2J88H 3W0WB 3HKFA 2N7AA 1X5JA 3FT2A 1BREA 1RSFA 5HI3D 2VNCA 4NM4H 4K71C 5D2NA 4WUUE 1JRHI 5ICXA 1SVCP 4M5YH 2F5AH 5I1KH 5JHDA 4FFZH 1DR9A 5T3ZL 3BP7A 2R0KL 4G6KL 3TBSA 1MQ8A 2XN9E 3NA9L 1NL0H 1MCLA 3WIHL 4KV5E 3MRCB 4G8IB 2D7TL 4OLYL 4NKQB 4KXZH 3I3DA 3VJ6A 2WBKA 4N5UA 4S1SL 4TOYL 1K9TA 5GQBA 1QZ1A 1ZT4A 5KSVB 3TJHC 3QH3B 1A0QL 4N5ED 4DZBA 4RMQA 3T3PF 2EYTB 4LGSB 1RMFH 1IGYB 4PJ7B 4OV5A 1BFVL 3P2TA 3CFKA 3U9UA 4U1MA 4OQTA 1XF5A 4N1EA 2A1WL 3VMOA 4TYUA 1EO7A 3ABZA 3FAWA 4OBSA 2ORBL 1Q9WA 2R9HC 1NDGA 4LHJB 1G6RH 3HLAB 3VFSA 3O2VH 3P9MA 1QHOA 1NLDH 1CFVL 2V17L 4C54A 5D1QB 4YGAB 3W11C 1IGFH 2UY6A 4YLQT 4LLDB 1CGSL 5CD5C 3RIAF 1BVKA 5FGCB 2DQTL 2AJXH 2J1KA 1MCDA 3ARDC 5KS9F 1JGEA 2VXUL 1HXMA 5DD0L 2R1XA 2V5TA 1P1ZA 4IRZH 3QEUA 1PZ5A 4JFYA 4WEUD 5J4MA 4HS8H 4IJ3B 4Q74A 3C09B 4KVCL 4OZ4B 4U7SA 2YPLE 3SCMC 1SM3H 2VLMD 4NQED 2DD8L 2F58H 1GGTA 1SEQH 1FGNH 1ZVHA 3U1SL 2Q7NA 3C8KB 4PJ7F 2UZYB 4WFFD 2PKDA 4D9RD 4JFHD 2Z35B 3EJYD 4F15B 4EI5C 1HILB 2H2SD 5F7YC 2BFVL 1FFNA 4PRDA 4DKAA 2X44D 3ARED 5SX4I 3I6LE 3WO3B 3IJYA 3X11A 2XXCB 2NY7L 2EZ0D 1TITA 3QNYA 4RAHA 1WBXB 3LQMA 1LEIB 5AG8A 2D0HA 1JPTH 3WE6A 2FEEI 3D48R 3WD5H 2H2PD 3QFJD 4HUUB 3NN8B 5J3HC 1QSFA 1LEGB 3BRFA 1NFDF 5DS8A 1GC1C 3WNKA 4F37K 4NQDD 2FATH 3EOBA 5FYJE 4Z5RA 2JJVA 4R7DA 4OLZL 3BDYH 3ETBF 4ONHB 4KVNL 2DS4A 2GTWB 3DMMC 5D7JD 3V5HA 3HPLA 3G6DH 4R26L 2Z4QB 3MACL 1V3JA 1EGJL 2FECL 1NFDA 1KPRB 3MRGB 2QTEA 1I3VA 3GJEB 4F7PB 1ZXQA 3CDYA 3O2DH 1MY7A 1Z9SA 3PQYE 4DKFL 2KBGA 2WUBH 4N8PA 4HIXL 4XNMB 4L8DA 4P5KB 3KXFD 2EC9U 3E6FB 4KC3B 4OV5B 1BX2B 1NMBL 1BJ1H 4LSVL 2C3VA 1OSZB 3QG7L 4NZJA 3M8OL 4WDIB 4GBXC 5I1AB 4Y2DA 4HDIA 3L6FB 4JY6B 4X6FA 2J8OA 1VCAA 4XTRD 4MJ5A 1J1XH 5I1GH 3MV9A 4WI6A 5L6YH 3UCRA 1T0NB 1IAIM 3BMWA 4X7DC 5GRZA 1Z9MA 4AEHH 4EEEA 1CD1A 4YEFA 5HHVH 1V3MA 1JFQL 3P40A 4LLYA 3FMGH 1BJ1J 3AROA 3KR3L 2ADJB 2E7BA 1FL3B 2JJSC 3VFUB 1YMMD 4JPWH 1WZ1H 3VH8A 4FFYL 4P3CL 4QTHA 4MJIB 3MSPA 3BKYL 1T2XA 1JGLL 2UZIH 5FB8A 3LEXB 8FABA 5ALCL 5D7IE 5IMOA 3MRPB 3W81A 5EOCH 3TP4A 3HRZA 1JPSH 3IU4L 3DNKA 4G8EA 1VADA 1U36A 1QR1B 5JHDD 1U8MB 4Y5XA 3PP3H 4D0CB 3U4BL 2DQDL 2P1YA 4JCLA 4PJCB 5DGQA 1J11A 3MLYL 4HUVB 4IOIA 1ZE3C 5T1DH 1I85A 4M1DL 1A9BB 5BZWB 4GAGH 4P49A 5C0EA 5JZ7D 4NCC2 3O3AA 1WC7B 3T2QA 1LK3L 3SJVB 5E94B 3R1GL 3HAEB 5EU6A 4GRWH 2H3NA 1XR8A 4BSVA 4U6VL 2B8OT 5A3ID 4NO3A 5HY9B 1AQKH 4FTVB 1KJ2B 2DM3A 5IBLD 4P3DA 1DBBH 1NAMA 1XGTA 4NJAL 4MQSB 4OCRH 4W6XB 4HV8B 5DA4A 3VWJD 4G8FB 1A6AB 1P9MA 3UMTA 1WFTA 4Y8AA 3QEHA 3O2VL 4JFXA 1F2XK 2P24B 2QR0A 4XCNA 3SEPA 1C8PA 1O5DT 5I15L 4LEOA 5DQDL 4WFGE 3HMXH 3HE7D 5IJVB 3QPQC 4NKMA 2CLVB 4NQEB 5E8OA 1U8LB 5IMMA 3MYJB 4BFBD 4YHMH 2E8YA 1IRAY 1DE4B 2OM5A 1TZIA 3T77B 2A74A 2X4SA 3MV01 3RX7A 2YUXA 1TLKA 3TVMD 3WIFB 4LK4A 1F6AB 2Q1EA 4AJ0A 2EKJA 2ENYA 2ICWJ 1MF2H 3E3QC 3TIEA 1RURH 2WBJB 2A6JB 1P7QB 5D5ME 5GISL 1U8LA 4PJCF 4LCCA 3R4DA 2VABB 1Q94A 4LEOB 1CBVL 2DAVA 2FYYA 4NQSA 1GL4B 3GZKA 3ZO0A 4X6DE 3RFZC 1WICA 4NFCA 3BD4A 4JJ5B 3HRPA 1G7JA 1NCAL 3VFOB 4N0FA 4D94A 5DJYB 4Z7VF 2XPGA 3QDHA 3ULSB 4WVRA 3ELAT 4LQFH 1J18A 3FB8B 5GGTA 3TH4T 1J8HA 4CVUA 3JTSB 2FBOJ 2VSCA 1K4CA 1SJEA 2UUDK 1E4KA 5DDHA 4Q9RL 3QA3A 3OJ2C 1K3ZA 1HHKA 1D6VL 4DK3A 3NIGF 4QHUB 1A6PA 4QYOA 5DGRA 4M9OA 2ZNWA 5TDNA 1PG7L 3O3UN 5KVDL 1MJ8L 2XY1A 2EIZB 3EDFA 1BX2A 2NY4C 2E9BA 1KIPB 3BP7B 1INQB 2QHLA 3MUZ1 3T3PE 3WXWH 1TIUA 3GKWH 5EBWB 1M7DA 2CDFA 3U46B 3G04B 2R2BB 2YD1A 2FD6L 4UU9A 4Z8FL 2I25N 1BQHA 2OBGA 4UI2A 1MRFH 4N0YH 4RFEA 1Q9OB 2NR6C 4E41E 1J86A 2NTFB 3DV6B 3FT4A 4XBPB 3HI1A 3F7YA 5FUCC 2CRMA 3GSOA 4AQOA 4HFWB 3RVUD 4EUPH 2YN5A 1UCBH 5I75B 5DLML 1AJ7L 4JO3L 4X99A 1CYGA 2XPGB 4WTWA 4UBDC 4CDHA 4MJ2A 3OKLA 4PJEE 2ERJC 4J4PC 1CFTB 5JQ6H 4YBLB 2YPKB 4MCYB 4OCWH 2AXHA 4TVPH 5D1XB 3M17A 5J7CC 2GI7A 3I3EA 2VDML 4YHNA 1WBZA 3JVGC 4X0KA 4AG4L 1UH3A 4KDWA 3VWJA 2OR9L 1L7IL 2DBLL 4LNRB 5E03A 5F6IB 1XGUB 3TO4C 3KPSD 5DRXB 3LB6D 1F6FB 2BVOA 3D0LB 1BLNA 5DVMA 3MR9A 3VGHA 3CAFA 1NAKL 2VDRH 3HFML 4JRYB 1A3LL 1A9BA 5BZWA 3GDBA 5EU4A 3VI3F 2ATKB 3ULVH 1CR9L 4NUJA 1NGYB 3O0RH 5EBLA 3VDCA 3IVKB 4RISH 2R0WL 2O5YL 3DRTA 3SDAB 4FXKB 5DJZB 4ZYKA 2DWEB 4U1SA 4MXWH 2IPUK 3B5HA 2EYSB 5BOZG 4R90H 1KBGL 1DQLH 5ADOH 3LKQB 4RMRA 5F71A 4MAUH 5IEHA 2YWZA 2CRYA 4JFXB 2F9BT 3H3BC 2DQIL 4PJ8D 3WJLA 2CKBB 3H9SD 5CEYB 1UWXH 3QP3A 4PB9H 4G6JH 1QYGH 3CLFL 1AQKL 3X13A 4ODTL 1IM9B 2NNAB 3MJ7A 1F3JA 1TTFA 1NFIA 1QRKA 4OJFL 4Y19A 4YHIA 2PYFB 4NDMA 1ZLVH 5I1DB 3GSUA 1T0NA 3BGMA 3ZKMC 1LD9A 2FIRT 4PJHB 4HG4J 2C3HA 1UENA 1JZ3A 3SCMB 5I19H 2R69H 3T0BA 1NC2A 2BVQA 3U36A 1RFDH 3OKOA 1BIIB 1IQWH 4M02A 1MJ7L 1T1WB 1U8KB 1TZHB 5FECA 1WCBA 2IWGA 1X5ZA 2AK4B 1I9RH 3VD5A 1UM5L 4MNQD 1IAII 1HDMA 1C08B 2AJ3B 1ZGLP 2COQA 5D1QA 3D69A 2QBWA 4JRXB 4NP4H 4RMSA 4ZAKD 3FMGL 1OM3L 2YKLL 2E9IA 4JLRB 1FZMB 3N85L 3U9PL 2VR4A 1JNNH 4BQ8A 3QIUA 3S36L 2XACC 1G7MB 3NVQA 5HVGB 1RVFL 4KHXL 3L5XH 4APQB 2Z9TA 5GRJL 5FUOH 1JI2A 1F3RB 4X6FB 3IDGA 3RGVC 4LSSH 2FX7H 3LKQA 2V9RA 3FCTB 3V5KB 3EYUL 3GMMB 5KANG 4JVUA 3RPIA 2W0PA 4YE4L 4HLJA 4MJ6B 3QNXB 2IH1A 1EJOH 5EU3B 4Y2DC 3O41B 4F7EB 3U4BH 4R4BA 4M6OH 5F1IA 3QDJE 1YNKL 4ZS7H 1A1MB 4R2GD 3QQ9C 5I74B 5D71L 5DMIL 3T09A 4OIAA 1MFCH 4GRWF 9CGTA 4JZJA 1ODAA 4J8RB 3SJVE 5D2NB 5TQ2L 5ESQA 5E6YA 2P4AB 1UJ3B 2I9LA 1UH2A 1C16A 2VQ1A 2WAHA 3LKOB 3CXHJ 4G80A 4P9MH 5DR5H 1JHKL 5H94A 3GSRA 3REVB 1WFNA 4NQEE 2FIKB 1NGZB 2ZP0T 4LLUA 3SDXE 3KYKL 5E2JA 3RWFB 1EFXD 1IFHH 3DURB 1RULH 2YWYA 1EEYB 4MVBC 4CVZA 2X4TB 5GSVA 4ZUUA 2FLRT 5I6XC 1F4XL 1AKJA 1OD9A 5IBTH 1MREH 1QR4A 5ERWA 3UC0L 3CVHL 1M7IB 1MUJB 5GS0H 3CVHA 1KT2B 4A6YH 4M5ZH 1J05A 4BK4A 1Q9LB 4JM2A 4LSUL 3RVXD 1YDPA 2R1WB 3UP1A 4ETQB 1WWWX 4HWUA 1BZ9A 1VENA 3O45A 4G6FB 4JG0L 4ZUWB 3WUWB 3QUMA 3U0PB 4EBQL 2XQBH 1R6VA 3VRIB 1CXEA 3ARGB 4FZ8L 3S4SG 5J8OA 4X6DA 2F53D 3FN3A 4PTUB 1EO5A 3QJHA 3FZUD 5D5MB 5ANMA 4JB9L 4NN5C 1LD9B 4JDVB 1LEKA 1P4IL 1U8JB 5A16B 4QF1A 1N6QL 1A21A 6CGTA 3UPRA 4OF7A 4D8PB 1A6ZA 4FFWD 2VDMH 4PJ9C 4KK5D 5D7SL 5A2JH 4XCFL 1F2QA 3DV4B 5HYJE 1CFBA 3KPPB 3UTSA 4CNIB 3TBVA 4R4FH 5C0CD 3QDGE 1A1MA 2ILLA 2VXQH 2JJUA 3GMQB 1KV3A 2HT4D 3GRWL 1D6VH 4JFYB 3EBAA 3TH3T 1FRGL 1EUUA 1JP5A 4LU5H 5HHOD 3KJ4B 4CMHB 1EA9C 3P0VH 3HI5L 3LN4B 2WNGA 5DD1H 1UB5B 3GBNL 3MLXL 1F11A 5DMKB 3LQZA 2PR4H 3GJFA 1IC5H 4NBXB 5DZNA 1PKQE 2NW3B 4CU6A 3S5LB 3H2WA 3WFEH 1OTSD 5HHNA 3BP4B 4XVUC 3SDYH 3ARYA 2FECI 5EZOL 5FYLL 3LV3B 1C12A 3DYMA 3V95A 4QWWC 4MJIE 5F7NC 5E1AA 4LEXH 3ULSA 3PWVB 2GJ6A 3X17A 1JF5A 4OI7A 3Q5YA 4C83B 3JBG7 4DGVH 3GMLA 1I7ZA 2EDTA 1ZHBB 3HE6B 5D1ZA 1CE1H 3OKMA 4PY7B 3BGFB 3WUWA 2XKNA 4UDTA 5ACMA 2WBJC 3REWB 2OMNA 3IDJB 5I1CH 4X6CB 1XGQA 4JZOA 4RWYL 1MRFL 4N0YL 1FBIL 4LBEA 4JFED 2WP3T 2ZJSL 1KF9B 3NIDE 3SDCA 4Z95H 5DI8A 3ECBA 2DN7A 1R3KB 4QHNA 4CVZB 3VW3L 3MBXL 3I75A 4IMLA 1F3JB 2GY5A 2OR9H 2R29L 4UU9B 2HFTA 4F9PC 4LARH 3PHQB 5T1MB 1MCOH 4OCWL 5GZND 4IMKC 5A2LH 3VXRD 4IHOA 4HPYH 4TVPE 4PGBA 2HFFB 1R24B 1LO3H 5T3XL 3LKSB 4I18B 5GPRA 1U2CA 3OSKA 4OFPA 5KOMC 5MEND 5EU6E 4LLWB 4R4BB 4HS6B 1XIWA 2PO6B 1M6OB 3KG5A 4OLWL 5TDOA 1I7RB 3NOIA 3O3AB 4RGNE 1U8QA 2FX7L 4P59L 4QOKA 4L9DA 1M05B 4KJYA 1U8IA 4K94L 5IT2L 1P6FA 1A7NL 3U83A 1I1FB 2X4NB 3DPBA 3V5DA 2AJXL 5DJ8A 4LLUB 4OV6F 5D70H 2RQ8A 2FL5A 1OAZH 2BXYA 3GMRA 3REVA 1I3GH 4QOKE 1N3NA 4L4TB 1HN1A 4PS4H 4DQOL 4Z7OF 4NO5A 2ZG3A 3MRPA 2IQ9H 2DLEA 2BERA 1CZ8L 3RGVD 3MLUL 1EHXA 2R1YB 4EKXA 3LVEA 1E28A 1QG3A 4G5ZH 3TO4D 3KYMA 2VAAB 3VA2C 5SWZD 3QXTA 4F7CA 4PLKC 5J6GA 3R0MA 4HBCL 4KV5F 2AK4A 3B9AA 4DVBB 5JW5B 5EG6C 2D7QA 4FMFA 5IGXH 4JANA 1JZ8A 3QPXL 3SDAC 1FZKA 2AGJH 4XH2A 4A6YL 3HB3D 3MXWL 1JWMB 1YEFH 2VDRL 1A3LH 3RUGF 4LVEA 3BH8A 1XF3B 2RFXB 3D39E 2P5WD 5HSFA 2IG2L 2A6DA 5L8KB 4YIQB 1E4XI 4JLRA 1DANT 5KG9A 4MB4A 3VU2A 1ZAGA 3WNNA 3QZWG 1M7DB 1XR9B 3OZ9L 3LH2H 4WHTA 3TEUA 3LEYH 4WWKD 5C0RH 4XVTL 2P24A 2QR0B 2YPLA 2OCFD 2YD5A 2WLZA 3KPRB 4HK3J 1P53A 5KN5B 4L8CA 3SDDA 1SYSB 2DQIH 4XRCA 3HG1D 3ZHKA 3MLTA 3RTQD 2XWBA 1WQVT 4KJPC 4X5WB 2APWA 1EXUA 1DFBH 1JNJA 2A6DB 1MCNA 3WJJC 3B4NA 3ULVE 4P2RB 3GMRB 5F7WC 1EJOL 4WFFE 1ZOXA 5C9JB 1MCHA 4JN1L 1A1NA 3BPNC 2Z92A 3GRWH 1LO5B 4WUKL 1BVLA 4S1SH 4TOYH 1R3LA 3B8SA 4IOIB 4NRXA 4Y4FC 4NSKB 4Z5RB 5B3JF 2A9NL 4X6CF 4HGKC 2X4UB 2NX5A 2HLFD 4LSVH 4G43A 4JFOB 3FB5A 3O3DB 3QDJB 1IILE 4O5LH 5TGBA 4UILH 1W0VA 2VLKB 2YD2A 4LPXA 1OPGH 2LVEA 3VFOA 2EYRB 1YEGL 1AO7D 3VDBA 3ARDD 3QNYB 1JYNA 3OJVC 1UM5H 2VISA 5EOCJ 1A6WL 3K8LA 4MWFB 1JHKH 3OTTA 5TGBB 1ZHKA 1ZVSB 1T20B 4XP5H 4UDUB 3P4LA 4P2QD 4QRPD 4RMTA 5DT1H 2AJYL 3SGEH 3EIFA 1GRWA 5KZCD 2V9QA 5E08L 1MREL 4F8TA 1S5HA 1SJXA 1FG2A 4HS8L 2QEJA 4KKLC 3T3ME 3V8OA 4UUJB 3QQ9D 3L3KB 3VXRB 5D6CA 5K93A 2NY5L 5I17B 5I73C 4V1DA 2UY7A 3VWJB 4HWNA 4AIZB 4FFYH 3O6MH 3T8XA 4XCFH 5FKAB 3RL1B 5I9QC 3BD3A 3VFPA 3MJ9L 1MWAA 3KDMA 2Z31C 4PJ8A 1CD0A 4M1GL 4JFOA 3ZKNC 2G75A 1CE6B 3B6SB 3X3GL 3CX5J 4QHKJ 2AEPL 4Z7WE 5DJ0A 3VI4E 5JR1L 2MPAL 1V5JA 5FF6B 3VXQB 3T0WA 4JY5L 2ZZUT 2V7HB 4Z7UA 4OCXH 4S1RL 2Q8BL 4JN2B 1JL8A 1EDQA 3C5ZD 1DUZB 5T3XD 3B2UC 1FN4B 3U4AA 1L0QA 3A6OA 3SGJA 1BAFH 3MNWB 4NZDA 1FSKC 5LGJA 5F72S 4PGDA 4M7ZC 3B9VA 4ELKB 2NY2D 1TJGH 2NY3C 5JXED 3DX8A 3OL2A 1NBVL 2A0LC 1DN0A 2R0LH 3CXDH 4U05A 1AGFA 2OP4H 5IVXA 5DJYA 1HOCA 1NMAH 1M71A 2K9UA 4HXBH 1UG9A 3ZL4H 5D2NC 4PJ9B 1FL3A 1WISA 4LRIC 5HGGS 4W6YB 5I74C 1FV1A 4POZD 4LSPL 5GRWA 1KNOA 2H1PL 3DX8B 1QSZA 3KYOB 1NGPL 3OQ3B 3OR7A 1AGBA 3D2UB 2YRZA 4BFIA 3CFDB 1Y6KR 3SKNA 3S5LA 4M7LT 2ZJSH 4AZ8A 2VZSA 1UB6A 4HUKB 3GMOB 3FO2B 5DC4B 4EOWH 2AGJL 3QAZC 4O51B 4P2RE 3Q5OA 3BYYA 2VDQL 2JIXD 1J88A 1G0YR 2VDLL 5FK9B 3QI9C 3RJQB 4OLEA 4PLKD 2VQUA 5IVOA 4LARL 5T5NF 5B8CB 3AXLB 2W9EL 3IRPX 3IF1B 2J6EL 1EZVY 4XVJL 3UTSB 3QHFL 4GXUN 4WTZG 1D9KA 5J11B 4WEBH 1OTTC 2V7NA 1A6AA 5MENE 2CIIB 4NJAH 2XYCA 3VXTB 1YQ2A 2FYYB 4NQSB 3VI4F 4RDQF 3MOBH 4M7JL 4ENED 1HYSD 4PJEF 3IJSB 2E7CA 2GSIA 2XZZA 4XVTH 3WN5C 4P4RB 4P46C 4LHQB 3MCKA 1JV5A 3LCYA 1P5VA 1KCKA 1MCEA 4UBDD 1YEDB 2B5IC 3CDGB 4PP2A 4IIQB 4TPRH 1FSKB 4GS7C 1IQDB 5F1IB 4GW1A 1N6VA 3HZMB 4JZNB 5AEAA 1IKNA 4J1UB 1NJ9A 5IW6B 1OT1A 4Y5VB 4JVWA 2J5LB 2ARJQ 4H25A 4XZUA 3JUZA 1GZQA 1BIHA 2JKXA 4Y19E 1FNAA 1R5WA 3SJVD 1NCAH 2DLHA 5FCSH 1HSAB 1UXSB 3C6LB 5D7KE 3RP1A 1NMCC 3FOLA 1ED3B 1ETZB 3VWJC 5H35B 5I2IA 3ARDA 4M93B 3GM8A 3RVVC 2XV6B 4NRXB 1B90A 3L7EB 1AXTL 5FV1L 3L3HA 4DGIL 5C0BA 4AT6B 4XC3H 1OAXH 1PQZA 4MJ5B 1BD2A 2QSCL 5SWSA 4C56D 1TZHA 1A3RL 3RIFK 2B20A 3L6FA 5I1EH 2A83A 12E8L 3A6BL 5DMJB 2BY3A 5E08H 4YDKL 4PJEA 4HH9B 1EEUA 2NY6B 4NO0B 3VJ6B 1WUNT 2XQYG 1TQCC 4ZUVA 1MI5D 3JV4B 4XRCB 4L4VE 4PP1D 2H8PB 4XWGH 1RIVL 3CMOH 5ICYA 2Q7YA 2VDKH 4LLVB 4AG4H 2AKRB 2ADJA 3ZZ1A 1U3HD 3S96A 2VE6A 5I76B 2J4WH 2IPTH 4FQ1H 2B4CH 4FQHB 1QFUH 5EU7E 5FA3B 4KKCD 5EO1B 4W6WB 2NY2C 1D5XA 2DJSA 3TBTB 2F8OA 1C1EH 1NGXA 1HCFX 4ZXBD 1UADC 1S7QB 1KIUA 3LIZH 2CDGB 2VITB 3QCUL 3HS0A 3PGDB 1S78D 1A4KB 1EFQA 3LKNB 4AEIL 3WLWD 3BSZL 1KC5H 4QHMB 4HIEA 4MAYA 3C09C 1DQLL 4Y5XC 3T0EB 3OKOB 1BZ9B 2A9NH 3C08H 2ADIA 4MAUL 3DYPA 4L5FL 3HCVB 5FUOL 4NBZB 2VL5B 1QTYT 5MI0B 4LVOB 5GGSA 5TPWL 2R23A 1KFAH 4RCAA 2GSGB 4R96A 2BNQB 2OL3L 3WJLC 1NCCL 2R0ZL 2YD4A 5TE6L 1XAUA 1JWSB 2R1YA 4ZDHB 2DIJA 1B0RB 1CXFA 1H0DB 4JDTL 4MDIB 4FQXD 1L9NA 1UM6L 3ZDZF 4NKOA 1L7TL 1IM9A 5DMIH 1MPAL 1YA5A 2V6HA 1ACZA 3MLSL 2Z35A 3BD5A 3H9SA 1DVFC 4I77L 3UTPE 3B9KC 4ZQKB 5F9WC 1N59B 1NSNH 2XRAH 3MNVA 3T2OA 1A9EA 1AHWB 4M7KH 4Z0XA 1X6LA 1NCBL 4N9OB 2F54A 4NRZB 5DFWH 4UINL 4PJIB 3Q1SH 1H3GA 2CMRL 2IAMC 3SDXF 5DJZA 4ZYKB 3CNKA 2JF1A 2ZUUA 2X5PA 4E42A 3EDKA 4XMLL 1G84A 3NZ8B 1MHHA 4HUMB 2Z91B 3BIBX 1RUMH 4CN6A 1S7VB 3DHMA 2BVUA 2HLFC 5HPOA 2B1HH 3EYFB 4U3CA 4Z0XB 1URLA 4QNPE 4NM4L 3RUGE 4LMQI 1AGDB 3F58L 3QFDA 4OFYA 5EO0A 2BNQE 5JQ6L 2CSPA 3UJTL 4EDWL 2UWEF 1UVQA 3S36H 4L9LA 1A47A 4YZFE 3UDWA 4D0DA 3RL2A 3H7BB 4X7TB 3WDJA 3WXVH 1CT8A 3JWOH 1UKTA 3QR2A 4GG6E 2DLIA 3RKDC 5HVFB 1TQBB 5E2VH 5F70A 3HC3L 4X6CA 2JLLA 1QLRA 5E2TL 2VWEC 4QTIH 2PYEE 4YDIH 4R4FL 1E4KC 4PJHE 3FT4B 1MJ7H 4JDZA 4Y4FB 3GUTA 3MA7B 4ENEC 3O3BB 1CFVH 2V17H 1NGXB 3VFGH 4Q97A 4N0CC 1GGBH 4OAWA 3V0VA 2HT2C 4GOSA 4OZFA 1EX0A 4PGCA 2EO1A 1Q72H 7FABL 3O9WC 3IDNA 4JHAL 1FH5H 4I3RH 3UROR 5JOFA 2NNAA 4PJ8B 1TVDA 3CFKB 4ODTH 2EZ0C 5EOTA 1KEML 4XNXL 1F02I 2YMXH 2NY6D 3PQYD 4NO0D 4XXDA 3F8UB 1EHLH 2BHUA 35C8H 3BAEL 1RJLB 4EJ1C 3BH9B 3SKOA 2R4SH 4Y5VA 1EGJH 5J3HD 1I1AB 4S2SB 1GAFL 1YEIH 3EOAB 3IXTB 1WWCA 3QA3B 5FA4A 3IVKA 1I1AC 4L1DA 1GC1L 3HNVL 2AQ3A 5F7HA 4PRIB 3UTSE 1HQRA 4S1RH 4GKZB 5I1CL 2F54E 4C56E 1EAJA 3P11L 2G75B 1HQ4A 4I8DA 2P7TB 5GGTL 2EDBA 3MRQB 3N06B 5JLZA 3H9HA 3HA0A 3DUUA 3T0ED 3AREB 3NCYP 1NKRA 4P3DB 3U4EB 2Z91A 4LHUA 4DUVA 4OQTH 2KL6A 2BVPB 1CDCA 3L3KA 3QIWD 3CSYB 1GHFH 4P23A 2ZUVA 3ARXA 4LQ1A 3QRGL 4IRJA 5EBLB 4WHYH 4XBPA 4KZDH 3D3VE 2R15A 1RV6X 4MA7L 4WI8A 3MODL 3QUKB 2OZ4H 1OAYH 1TQBC 2G5BB 1T6VN 4WJ5A 3CUPA 1UM4H 1DP0A 3X12A 1MJJA 3A67L 2BVTA 4R2GC 3CZFA 3NAAH 3QHZH 4I9WD 5TQ2H 5ESQB 2OX5A 4Z7NF 4GG8A 1G7IB 2YSSA 4YHOH 5IB2A 1U58B 3IU3A 4WNQB 3GHEH 3KPLB 5D7SH 3ES6A 3OKKB 3MACH 4NO3B 3QHFH 4JHWL 3ALXA 5KSAC 3W9EA 1T03H 2IF7A 3H42L 4LKXB 1BHGA 3UZEA 5BXFB 1F4YH 2EXWC 2D9QB 4NQUA 4S0SD 3S3SA 1XT5A 3N1MC 5HXMA 4ELKA 1I8LA 2J8UF 4MSWA 1OOAA 4K9EH 2FWOB 5GRYA 2NTFA 1SEQL 3U1SH 4HLZH 1A22B 4XC3L 5LGKA 1OTUD 2LE9A 3RIFF 1DBAH 3PWPD 4A6YB 3W2DH 2H6PA 3RKDD 2IANA 4GAFB 2GKIA 5I30H 2F74A 1U3HC 4YX2H 3AREC 1YUHB 4XP1H 2BSTA 3V7MA 4YHKH 1G1YA 1GIGL 1WZ1L 3PL6B 4KK5C 5FM4A 1K2DB 4M7KL 3W9EB 2W65A 2DQFA 3WS3A 3UAJD 5BV7H 1ZEAH 1BVZA 4JJ5A 5LAXB 2BCKA 4R3SA 5F8QC 1T1XB 1K4DB 1O7SA 1KPRA 5IMKB 4JFEE 1DQQA 4Y4KD 1ZLUK 3W5MA 1YY9C 2EDOA 4PGZA 5KVFH 3A6CL 2BSTB 5HBBA 1S7RB 1RUML 1RZJC 2ZPKL 3VXRA 1I9JL 5DHYA 5JDSA 1I1YB 1QPPA 5IT2H 4NGHL 1Z2KA 2X89A 1TVHB 4XI5C 1ACYL 4Z95L 2O5ZL 4PTTA 3P0VL 3PNWA 5GGUB 5CSGA 2FO4B 4QOKB 4GQ9L 4WDIA 1DE4A 4M43L 3T65B 2ITCA 5D1QC 4OFDA 2UV3A 1Z6JT 4WWKB 5C0AA 2FSEB 4OM0L 4OF5A 4JG1H 4JJHA 3MLSH 3E0GA 3O8XA 4I77H 2VISB 1PVHA 1ZTXH 3HMXL 4H0GA 4TUJA 4PG2A 1MCOL 1JF1A 1I1AD 5BS0E 2W38A 4FTVD 4JDTH 3ARPA 1O0VA 1CGWA 4UILL 3BKCH 1WTGT 3OKYA 5J9PB 2Q20A 3SQOL 3DUSB 4WGVB 3H3PH 1KB5H 5BS0A 1RURL 4GW1B 1TTUA 3T4YA 1TQCB 5EOQL 4QGYA 4GKNB 1ZHLB 2ZSWB 4RGMC 1EEZA 1CVSC 5C09B 1TZIB 2HJFA 5IVXF 5AAMA 2BHZA 3DSFL 4YQXH 4JPVH 4D0CA 4KI5C 32C2B 3UZQA 1YPZF 3MYJA 1NCDL 3IAQA 4OGAC 2EIEA 1IGML 1RZKL 1DFBL 1ZS8B 3F12A 5HI5D 4RGND 2BNUA 1HXMB 4LHUB 3HPJB 5MERA 5KS9A 1A6UH 3WFHB 4Q7DA 1MLCB 1E6OH 2W0LA 1AR1C 2NX5E 2F19H 4WY7L 2UZIL 3QIWB 2YPLB 2EDEA 1J0YA 2HKHL 1TMCB 1OP5H 4HWZB 1Y0LB 2EDDA 5EC2B 2FBJL 2ZUQB 4LCYB 2VZTA 5EUOF 4OZIF 1WZKA 2DQDH 3B83A 4R9HA 1TJHH 3O11B 1I7UA 5DRWB 2AJUH 4HKXB 1AFVL 4RX4A 4O2EA 3GMOA 1WT5C 2FJFA 3RA7L 3PGFL 4RFEB 5C9JA 1SBBA 4D0BB 5B39B 2X42A 1QFWM 3SGJC 4Z7UE 5EC1A 1YMME 4XNUL 5HVHB 4NWTH 1X5HA 1VKXA 3IDXL 1IEBA 4GQPH 1JZ6A 4P46B 1CG9B 2EXYC 3LOWA 3QQ4B 1Q0XH 4PJ9A 4APQC 2IQAA 3MFFB 3UXFA 4PJHF 3UZVB 4GT7A 1HNGA 1R5VA 3HG1E 1MFBH 2E7LA 1EVTC 4EN3A 3U0TB 3WHE0 2I07A 2XWJA 1DLFH 1KENH 2F74B 4PR5B 5CZXC 5E5RB 3L5HA 4G9FE 5IVNA 2Z31A 3PWUB 1F4AA 1NCWL 4PIRF 3VXUA 4M6MH 1EH9A 1I8LC 1FN4A 3PL6D 5F88B 1A1NB 5MHSD 2X4PB 2VLJA 3SBWA 4PJFA 5FYJH 4PREB 1HH9B 1JUFA 3E3QE 3KYNA 5T1DL 3SKMA 3MRMA 2HFGH 4OLVH 4MNGE 2DLFH 2X9YA 5BOPA 5DYOB 1OWWA 4O00A 5KSBF 4DZ8B 3SKJH 3B5TA 3TBYA 4I3GA 4G8IA 4AIXA 3PHOA 5C6WH 3PWPA 4MDJB 2P5WB 4F15C 4GRLC 1CT8B 4M8QB 4OM1L 1A9EB 4X9GA 4C57C 3F7QA 3OZ9H 3ZKND 3B2VL 5A16A 3D18B 4TUOA 4HIHB 5HYEA 2BY1A 2DQCL 3V4PL 3OHXA 5EIVA 4MCZA 4DN3H 3ZDXF 4FQJH 3ZDXE 3GBLA 5FDWB 3RTQB 2W91A 1B88A 4AEFA 3KWWB 1LMKA 5HYSB 3RVUC 4J2XA 4Y5VC 1YDPB 2V2XA 1Z9LA 3FQRB 3VWKB 1JHTA 3FN0L 2ID5A 5D5MF 1KT2A 5JW4M 3BJLA 3ULVL 3GBMH 4XT1C 4ACPA 2PTTA 4ALAH 2ICCA 2DKSA 5D93C 1QFWI 2YEZB 3BZEB 1G9MC 2EYRA 3DUUB 4YPJA 3FTGA 2ZCKL 4X7FC 3H9SB 3TF7C 3KNBB 3A6CH 1PEWA 3LZFH 4DW2H 1KPVB 3VRJB 1T7YA 3KLDA 2BXZA 2XZCH 1IT9L 2GJ6B 4JHWH 5K9OB 2DF3A 5E94A 5GRXG 3HC0B 4U33A 4PRNA 1UJ3A 2I9LB 5HHXL 4YFEA 4PJ5A 3GHEL 4OKVA 4ORGB 3I6GA 1A7PH 4MDJA 4PTTB 3ARQA 3SQBA 3MZTA 3MROA 2R23B 4DZ8A 5FYJU 1KJ2H 5GGVH 1D5IH 2VUOA 2F5AL 2DQHL 2P8LB 3AFLA 5EO9A 3BYTA 5I1KL 1TJGL 5F93C 5IMOB 3E8UH 2QV2A 4QXTA 4HJ0D 4P3WA 4I2XE 1MAJA 2VYRE 4ZMAT 1B2WH 4F57H 1A8JH 1GHFL 2AK4E 5D6DA 3CX2A 1L0XA 3GSNA 5C70A 1D5MA 4H88L 5CBAA 3N85H 8CGTA 4PR5A 5A43C 1CXLA 3O6FA 3SQOH 3H7BA 1DEDA 3BI9X 2VLLA 1ED3A 1ETZA 2WWKT 1U8PA 1P84J 4X7TA 3TN0C 3WXWL 5E1AB 2JCCB 3HHRB 4ODVH 5EO1A 2NZ9D 4Y4KC 5IWLA 3J7HA 5IV2B 4KI1A 1SY6L 2DKUA 4JPIA 1D9KD 1R3IH 4N0UE 1BPVA 3SDDC 4Q9BA 4TSAL 1D5MB 4XC1H 4RISL 4JO4L 4HKZB 1Q9KA 2HRLA 4UB0H 3R8BB 5EA0L 1UXWB 1U6AH 3WLBB 4NNYB 3BN9D 2Q8BH 4JANB 4K3EH 4E42B 3PGCB 1IEAB 1CFQB 5C7XH 4J1UA 1CL7I 4M61A 3GHBH 2OS7A 4KROB 1RUAL 4AK1A 3E6FA 1J9CT 3OGOE 3TBWA 5AYUH 1KC5L 2VXUH 1AO7A 3MLPA 5T3ZH 2C3GA 5IROC 5T3XE 3IETB 5I1JH 4PLJC 4G8GE 2JB5H 1U58A 4WNQA 2MQCA 3AB0B 3ARBB 3MJ6A 4TVPL 3V4UL 4D0DB 5KSBB 1DQTA 3OG4B 3UTZB 3DMMD 3RNQA 3X14B 4DKFH 3NCEB 2GUOB 1N3NB 3HNTL 4EN3C 5CJ5A 4P4KD 3FHQA 3VXMA 3RGHA 2ICEB 1CTNA 5SWZE 3SGEI 4PJ9D 1A2YB 5ANMB 1NBYB 2X4QA 3G5VA 3RX5A 4L4VA 2ZCHH 3M17B 4L3EA 3WFEL 1E4JA 3MRLB 2VZ1A 5IBUG 1BM3H 2W1NA 1AIFB 5GRUH 3CZJA 1BZ7B 2XQBL 3L3OA 2VL5A 3TBYB 2HT4C 1NPUA 3RDTB 3MQIA 5HHQB 2V5YA 2VWEE 4QHLA 4AM0B 1NCDH 4DTGH 4JQVA 4RWHA 1U8HB 4PY8I 4U1KA 2IALA 3DETD 3V5KA 5J56B 4JKLA 2QLVB 3BUYA 2VDQH 1SQ2N 2YXFA 5H37G 1NAML 3CFCL 3QXDA 3TPKA 3VDAA 5BZDA 5GZOC 1BBJA 3HR5B 5B3NA 3ARVA 2BMKA 1WIOA 5DK2A 5DD0H 3ESUF 1Z5LB 3QIBA 3BOVA 1KTDA 2E7HA 1OW0C 1KGCD 4XBEH 5J1AA 4QNPF 4R2GB 1UYWL 2PTVA 2VH5L 4OM0H 1S3KH 5H2BA 1YQVL 2YPKA 1Y6MR 4N0RA 4R7NB 1I8MA 1AO7E 1HDMB 3G6JE 3EW3B 2ZOLA 3CIQA 1JPGB 3RIAK 5C0CB 3HN3A 3EOAA 4YZFF 4EDXA 2YXMA 4H20L 1NGQH 4P9HC 3D25A 3NA4A 1FIGL 4AEEA 5KW9L 2AJUL 3OV6A 4TPRL 4BZ2L 1S9WA 3L9RA 1BQLL 4JM4L 3QWQB 1MLBA 3PDDA 3OAUL 3P77B 5ILTH 3NTCL 1ULVA 5EOQH 5TE4H 1LE5A 5FO9A 3ROLB 1JGVL 4P5MA 1G7PA 2B2XH 1A14H 1JPTL 1DZBA 2VLRE 3GIZL 5BQ7B 1M4KA 5IMKA 5CJQL 5FYKE 1RZJH 1U95B 2A38A 2B4CL 3FONB 4FQCL 1T1YB 1QVOB 5CD5D 3AS3A 5CJBA 5CMAA 1JTTA 4WFED 3ROOB 1OP3H 3CDCA 1J0JA 2VQTA 4ZOAA 4HC1H 3UJJH 3P3YA 4JG0H 1VACA 3F12B 1FNLA 1KCLA 1YY8A 2AV7A 4PS4L 5TDPA 3TYGL 1HI6B 4RA0C 4N0CD 4TNVF 4FG6D 4A6YA 4NQVB 3GMQA 5GGVL 1FFOA 3SDDD 3ULUF 4URTB 4XPFH 2CLZA 1EHAA 5JHDB 1AFVH 3T0EE 4U1NA 4JRYA 4Y88A 1JNLH 1WSST 2CK0L 3TYFA 2H26A 3GSWA 4XAKD 3EYSH 4PRNB 4ERSH 2E8ZA 3IFNH 5J9PA 4ZXBC 3RWCB 3EO9L 1PAMA 4DAGH 1YYMH 3B43A 4QXUL 1U3HB 2A73B 4M4RA 3VRIA 2X4RB 4OB5L 4KROD 1FDLH 2Y23A 2FO1A 2PTTB 3V4VL 1T2QL 2CDEA 2IG2H 3MBED 1J87A 3ARRA 3I85A 3MCG1 4AEHL 3FZUC 3R8QA 3N1QC 3HZMA 4M9PA 3FN9A 1BWWA 3SO3B 4N8VB 1LE9A 2ATPB 3D6GA 2C1PB 5BJTB 1N0LA 4P3CH 5SX5K 3OJDB 4YHIB 4L5FH 4F2MB 2Z92B 3IDIA 3T0EC 1JWUB 1BLNB 3BPOC 1GVIA 3MJ8B 5EC2A 3D18A 3U7WH 4FQIH 4PJAB 1Q0YL 4U49A 1RUPL 4NJ9H 3BEWA 3MODH 3VFVA 3EJZC 3R06A 3HG1A 5EPMB 2OK0L 3VI3E 2L4OA 1K8DA 2DQGL 4HGWA 5IIEB 3ILPA 3GGWA 2ICWA 3QUXA 1NKOA 3FQRA 4P5TD 4RMUA 2EIZA 3QYCA 4R8WH 1F4WL 1CICC 4TQEL 2AXGA 3SKMB 3KJ6L 5DUBB 2OTUA 4RAVA 1VHPA 3K0WA 2H6PB 2YOCA 3WL9B 5ANME 3DX6A 1MCPL 2BJMH 3L7FB 5C07A 3MR9B 2DDQH 5KVEH 1ZGLM 2UYLB 4DGYL 2XG5A 3BUTA 5FOBB 2AXGB 4ZS6D 4TNWF 2BOCB 3D9AH 4Z76A 4K7FA 3CFJB 1N8ZB 3EOTH 4Q0XL 4PRHE 4G42A 1OT2A 1KLUB 4HHAA 1C08A 4LSDA 5KAQF 4Z78A 3T8XB 3QIUC 3UYRL 3UYPA 4XCCH 4UOW0 4XCYA 3L3JB 1YMHA 1YMMA 1UZ6F 2D0FA 2P8MB 5HHME 5J6HB 2WW8A 1TCMA 3EKCA 1QFOA 5HHPB 1BF2A 1ORQA 3FQUB 4RWYH 2QQQA 2EH8H 5GGVY 4YHYC 5I1LB 3CFDA 4JN2A 3MRIB 3QUZC 4QTIL 1PY9A 4TNVK 1AGBB 3VWKC 4JFQA 4HJ0C 3IYLW 2B39A 4OUUB 4X5XB 3S4SA 1F8TH 4JN1H 5TDOB 3X3GH 2ICWB 1T5WB 4G5ZL 4HJJL 3ILPB 5J1TC 2FJGA 4WI4A 4NBYB 2NY4D 3KPLA 5D2NE 1DN0B 5DSCA 2Y9RT 3QCVL 5EBMA 5ABDE 5FYKL 1JHLL 1S9YA 3AAZA 3IDYC 4OCSH 3VFMB 4HW6A 1WLHA 5KSAA 1ZK9A 3VXPB 3PWNB 1MSPA 4LVOC 4QY8B 1CGYA 3IDIB 3TIEB 3TA3D 2BMKB 3OAUH 3DIFA 2EDWA 5C0EB 5E56A 2NY6C 4U1NB 2NYYD 1X5LA 3CDGA 5F6HJ 1RFDL 3K80A 1TNNA 4XP1L 3HC4H 3P4NB 4OCYH 4XP5L 4RGMB 3LS4L 3MCKB 4J6RH 1XH3A 2B1AH 5BO1L 4LSPH 5SV3A 1LDSA 1KB9K 2DIAA 2J12B 3IDJA 4XP6H 4OF6A 1CDUA 2E27H 2SEBB 4MQ7B 3GO1L 3IDYB 8FABB 2NXYD 1UT9A 5JHLH 5IVXE 5C0FB 1JF1B 3MO1B 1G7IA 4KJPD 3GJFK 2MPAH 5GJSL 3OR6B 1FYHB 1TJIH 3MRQA 1I3RB 1YZZA 3KLHD 4LGRB 4CVXB 1K6QH 4QRRA 4WV1B 1A7QH 1TTGA 1UWXK 3T2PA 5JOEA 2XNAB 4NC1C 2X09A 3I75B 4KY1H 4OUUA 4I9WE 1HZHH 4O02H 3LV3A 1JYWA 1X5GA 2BSRA 1PW3A 5JW3H 1AO7B 5D7IA 3DVGB 4XAWH 5ELIA 1TVHA 4M43H 4Z7WA 1IGIL 3GFUA 4JDZB 3GUTB 5TH2A 3DX7B 2ITDA 4XHQA 2XG4A 5JPMB 1OTUC 1VA9A 1P2CA 3NH7H 3T0EA 1A7OH 1AC6A 4ZSOE 1WZMA 1RAMA 2YRPA 1ZGLB 1NUNB 4PRHD 2CDFB 3U46A 3CCHA 4FABL 4XPTL 2ZSVA 3ARUA 3TBSB 2B7DT 25C8H 5I66B 3VFNA 3A67H 3WS3B 1OTTD 5H2BB 5I18H 2AK4D 1PLGH 4L8BA 4O4YL 5F96L 3I84A 2VR5A 3BMVA 4MQXD 3WIIH 4MNQB 3FB5B 4PJDA 1LQSR 4OI9A 4M03A 2BOBB 1BQUA 4HXAH 2HWZL 3TZVA 3WFZA 4X6BA 3VGAC 1O7VA 4Z7VB 3S88L 3D2UD 4CL7A 3HNSL 5BZDB 1HEZA 4GH7B 4YDLC 2EYTA 2V7HA 5TFSH 4RFNC 4X7EC 5D2LA 1LHZA 4G7VH 1KXQE 1IJ9A 1RVFH 1RZKC 5IFHH 2AEPH 2QSVA 3DOSA 4LLWA 4I0PB 3CPLB 1LNUB 4U3HA 5IF0A 3EFDL 3FT3B 4JO2H 1P7KB 4NCDA 4P0DA 3N1FC 3TBVB 3C5ZB 3RWJA 1MY5A 2I24N 4YHZH 1NBYA 2X4QB 4OZGA 4L9LB 3FQWA 4GMSH 4NKDA 3EJJX 1WBYB 3KPMA 1A6WH 1UJTA 3FB7A 3NGBB 2H32A 1ZT1A 1VSCA 5DJXA 1BEYL 3MC0A 4PTUA 1MLBB 3UTTD 4KKBD 3KPSA 5HYSG 4HXBL 3BP5B 3VFWB 4WI5A 3MUGA 2NXZB 3GBNH 3MLXH 1OHQA 3ZYJA 5B39G 1J5OH 2CRIA 3BWAA 1FG9C 3VWKA 3DSFH 4YQXL 4UDUA 5EN2A 2CGRL 5DXWA 4DCQA 1ZWIB 1KEGH 3VGAB 4HIEB 4MAYB 4WUUD 4K3HA 3FO9B 1G0DA 3T04D 4KU1A 3SE8L 5DK3A 2ARJB 3QEQD 1CDJA 4FFVC 3OKDA 1RUKL 3QZWA 4OJFH 5J1AB 1A2YA 4NKIH 3TESA 4PJCE 1AR1D 4NQDA 5HD8D 4LP5A 3MRDB 1QBLH 4OLUH 2YC1B 1Q0YH 2MHAB 4IEFB 2NX5B 4FQHA 1LP9B 1U42A 2V7NB 2NY0C 5LXGL 5KSUB 4PJFF 5HHNB 2CLZB 5LG1A 4XVJH 4R7DB 3HAEG 3PHSA 2IALB 1OF2B 5EZIL 1KB5L 4OGAD 1BD2E 3PGFH 3BRDA 1V3KA 1F4WH 1EBPA 3MRJA 3IS0X 3MRMB 2ICWI 2APFA 5IB1B 3V0WL 2XWBB 3CC5B 5FM5M 2EDKA 3LKNA 1NL0L 4POZC 3V4PH 1J1OL 1KTLB 1ORSB 5L88H 2CIKB 4YBQD 1OM3H 4KKAD 1ITCA 3AVEA 4XNYH 4X6BB 3IT8D 4WI2A 1WAAE 1WWAX 3BISA 4RRPG 1R5IB 5TF0A 1XZ0B 2GUOA 2Q76A 5E5MB 2FZ3B 5JHLL 2VIRB 3VFRB 5BRZE 3U0TA 3HC0A 3VGEA 3GSVB 1H0DA 2PW2B 2HT3C 4H88H 2AI0L 4GMTH 2D9CA 2YPLD 3O2WL 4QHNB 3V2AR 1PEZA 1KTLA 1ORSA 4BQBA 5BO1H 5GZNC 1MFDL 2QQNH 3KS0H 4KTDL 1MNUL 1CD8A 4ONOA 4M61B 4JB9H 4Y1AB 3QH3A 5I1HH 5E9DD 4M8VA 5HDLA 4EI5D 5FYJL 5DEZA 1JHTB 1F8TL 4WUUA 4JR9H 2GJZA 1BD2B 4M7ZB 1PY4A 3PGDA 5EA0H 2FHFA 5C0BB 4XVSL 3KLHC 3VMNA 4AH2B 4PP2B 2W9LA 1GGIL 2YBRA 1MCJA 5E2VL 4G6KH 4ZPVA 2I27N 3DO7A 1X7QB 4I5BA 1Q9WB 4KY1L 4KH2A 1G9NH 1ES0A 2A77L 4CN1A 1AXIB 4HAFA 2R0ZH 1JGUH 2ZUSA 3SGDH 3DSNA 4LCWB 2AJVH 5EB9A 5I9QB 5T1LD 2NW3A 3UJIH 3ARGA 1BFVH 4CAGA 3EOTL 4HUWA 2PYEB 6FABL 3SDYL 4JY4B 5KSVA 4ZG1A 1J8HD 3STLA 2B1HL 4U1SB 1VPOL 2HMID 5IR1B 1QSEA 1ZHNB 1RIVH 4MZ3A 3IFPA 4PJFB 1T80A 4Z7UF 4E5XA 1HHHB 3IU4H 3VFTA 1YEDA 1G7QB 3L95B 2BNRE 2WWMD 3ZTJG 1CDHA 4X9HA 4LVNC 4TSCH 5DJXB 3OKNB 3WLWC 1EHNA 4X98B 4ZTOH 3QIUB 3IDMB 1ZT1B 3LEYL 1XEDA 1CFNB 4R4ND 1T7WA 4HH8A 1IT9H 2Z8SA 3QIBC 4NC2B 5FEBA 3W82A 3P0YL 4YBLC 3U79A 3JV5A 4L4TD 2OI9C 4LVNB 5I1JL 1HOCB 4CMMA 1D7FA 4DQOH 1VGEL 2GK0B 3PP4H 3VW3H 2IQ9L 5MHSE 4KJWD 3MRHB 2ZG1A 4WW2C 3O4LD 2PETA 4NNYA 5GS2D 4MD5B 3C2AH 2F54B 4NRZA 4UT9H 4JFZL 4D0BA 1NSNL 4L3CA 4MXVF 1A4KA 3BZFB 4KGJA 1YEJL 2W60B 4LCWA 4Y2OA 1P6AB 2EE9A 3ZTNL 4Z7UB 3SN6N 4NWUH 1OPGL 1RJYB 3RU8L 4EN3D 1J10A 1NDGB 4JFFB 3G5ZB 4QRUB 3MREA 3TO4A 4EVNA 4XCYB 5D7JA 2A6IA 4ZOBA 3MLZL 1XCQB 4FQQA 3LKRA 5LGHL 2CUHA 4TVPD 5FXCH 25C8L 1A14L 2J8UB 4XX1E 2WSKA 4HIJB 1NC4A 1M71B 2DI8A 3WIIL 1JMXA 1U2HA 2GJ6D 4FMKA 5M94B 1U91B 1XF2B 4XPHL 3O41A 4M4PA 5CS7A 5TDNB 4MJ6A 1UWEH 4RQQA 1J1PL 2YA0A 1BMGA 2D7OA 4GLRH 3F65A 3LY6A 1S9VA 3TCLA 1ADQH 5J12B 1U3YA 3D3VD 2VUYA 3F6IA 4QRQB 2R4SL 1RK0A 1IKNC 4NC1E 1A4JA 1JPSL 2R2EB 4JFEA 3HTLX 4W70A 1MCWW 4GMSL 3ZLQC 1UYWH 3WUZA 2DM2A 4DKEH 2VO5A 5ESVB 4H0HB 3ZMRA 4PRAA 4JZJC 3FQXB 4EI5B 4P46A 4EQ2A 4WO4C 1WEJH 3OX8B 2X10A 4I48A 3QDJD 5E2WH 2C3WA 3H7LA 4RNRA 4K23H 4BZYA 4GG8B 1NCUA 3ARFC 5A3IC 3CZFB 4N8CH 1LO0L 3VFGL 5CWSB 5KSAD 3O3DA 2DWEA 4YNYA 1E27A 2C1OA 4C59B 1U6AL 3KLAA 4JFDB 4LOUD 4F33A 3CVIL 2HWZH 2APBA 1W8NA 1MFEL 1GOFA 4GKNA 3AMKA 1X3DA 2P5ED 1FVDB 1JV5B 3GSXA 5IP4A 3MLUH 5DT1L 3CSYA 1CE6A 2YC1A 4NCC1 2ZKHL 5AAWA 5DEGB 1ZHKB 1B6DA 3NABH 5E24E 4CKVX 3O2WH 1EGJA 3UO1L 4HBCH 2Y72A 4FZEL 3I6KA 4C4KO 2I9TA 2GJJA 5DQ9A 1QACA 2GAZA 4Y7MA 5B38A 2HRPH 1NAMB 2RBLA 3IJHB 4H1LB 4PB9L 4TUJB 3HMWH 3DMMB 3HPJA 5MERB 3AU1B 5INCA 3S37H 4LVHB 2WINB 4CJ0A 3L1OL 5FHAH 1NCNA 4YGVB 3NMEA 3RZCD 4PRIE 1F13A 1NBQA 4WCYL 4X83A 5ACLA 2YZ1A 5C0CE 4HLZG 5J1SC 4PJXE 4GKOA 3RTQC 3QWRD 4NQCB 1KG0B 1VEPA 1BOYA 2BNRA 4HKJB 5F7EH 4N0UA 1CR9H 3KYOA 4ODSH 3O8XD 2AJVL 4I4WA 5EUOB 2AJYH 4OZIB 4UOJA 3FFCD 4NNXB 4B50A 1DCLA 5J89A 2IQAB 3WDIA 5DHVB 4NHCL 4MB3A 1N4XH 1CLYH 3IDUA 3MGTB 4WFHE 4WW2F 2F8VA 3Q5TA 4AENA 5C0DB 1HINH 3CFBB 3JXAA 4OSUL 4U7MA 1BIIA 2NY5H 4G6JL 3T4AA 1NC2B 1CQKA 2BVQB 3U36B 3RWIB 5MI0C 2ITDB 3L7FA 2VDNH 4S1QH 5DRZB 1QSEE 2NR6D 1YPZB 4PBVC 1RZFL 1MFDH 4LSRH 5CIPB 1S9WB 3L9RB 1CLZL 4J3SA 4YHPA 3RDTC 1ZT7A 5KTEH 1KBGH 1SEBA 4HF5L 5E0QA 2J8HA 4UT9L 4E41A 5GJTH 3MRKA 2HLAB 1YEEH 3O6FC 5EZIH 4V2CB 4Y0GA 4QRRB 5JR1H 3KJ6H 5GHWH 5MP6H 4UT7L 1QYGL 2X1OA 5I16B 3D39A 2F5BL 2EKSB 5E4IA 2P47B 3DV4A 4WU5B 1NEZG 1QRNA 5GS1A 5IEKA 5F1NA 4HFUL 5KOVC 3EYQC 1AJ7H 4JO3H 4NT6A 3X11B 3ARBC 5IOPA 1SJHA 4XNYL 4PRDB 4HAGA 2JB6B 4YHKL 5HYQA 1KCRL 4GW4A 4IMKA 2G5BA 4XNUH 2ZG2A 3LRHA 1MJ8H 5TH2B 3OKNA 1MQKH 4NQCA 3C5ZC 4YK4B 3RHWK 1HH6A 2VTFA 3DROB 4OIIH 3UTTA 2OTPA 4JKMA 5IK3A 3UJJL 1G9MH 2C1PA 4X9FA 4HMCA 1MHEB 43C9A 4RAVB 4BM7A 3SGKC 3BVNA 5LCVH 3T4YB 3H3PL 4HBQA 1LEGA 1AXSA 1MNUH 1U41A 4R97C 5ID1B 1JK8B 3AU1A 1RJLA 5JO5B 2FBJH 3IAGC 4PJDF 1PBYA 4OZFG 1ZHBA 2CKBL 5FV2A 2Z31D 3RWFA 4V1DD 1UZ6E 2AJZA 2BDNL 4X8JB 5HY9A 1KYOJ 4YR6B 5KS9B 2OTWB 1A6UL 1HHIB 5IQ9B 1BP3B 3ULUC 5SV4A 4UNUA 2N56A 1KG0A 5F3BB 4ZDHA 3P4NA 1FYTA 3L95A 4I3SH 4O2CA 4PJCA 2X4SB 2IBZX 2X9WA 1T4KB 2WM0A 1MRDL 1ZLSH 3VG9B 4ZAKC 2JB6A 5I1AA 4MHHI 2FH8A 5JW3L 1C5CH 5IOPB 4XAWL 1A0QH 5GS0L 2DQUL 3RX8A 2HG5A 3NACL 2XTLA 2CO7B 3SE3A 3RZCC 4PGEA 4ODWB 1XGTB 4DN3L 4HUXB 1ZV5A 1AD9B 1YYLL 2AJSH 4GRLD 3HE7A 5BV7L 4BA8A 3BPOB 4FZ8H 4HWBA 4HT1H 4EQ3A 5HJ3A 3GJEA 3C5SB 2FCBA 4JKPH 3MGAA 5KBNC 5GSRA 2HVJB 5JMRA 4NQCD 4LHUD 4F7TB 4NQXA 3TLRA 4EOWL 3O6FB 3EJZD 2NYYC 2AKRA 4HCRL 4F33B 1OQXA 3BH8B 4R0LC 5SWSD 1JWMA 4P99A 4P5TB 5L9DH 1TNMA 3NFPA 1CICD 3EOBB 3MRFA 4IRZL 5D7KD 1UKQA 1S7TA 4PB0L 1L4IA 2OXHA 4U0QB 4WW1B 4PRBA 4F7CB 5FFLA 5JHDE 2BRQA 5KSUA 3WSQH 5IHZB 3F6LA 5FO8B 4G6AD 1DUYA 3QCVH 1IAIH 2FIKA 5F3HA 1YNKH 1A7RL 2HN7A 1FFNB 1ROWA 5JPNB 2A1WH 3LHPL 4J3VA 4XGZA 1FFPB 3DTXA 4NPYA 3F7RA 4PJAF 4Y8DC 2VZUA 4Y5YB 2CR6A 2AEWA 4XWGL 3ZT6A 4BUHA 1BOGA 3TCLB 2IBGA 1F11B 4QRRD 4NOFA 3T0AA 4BZ1H 2O5XH 4N8VA 3TFKC 3RHWF 1B0GB 3SO3C 2G9HA 1QFHA 1JBJA 4DJMA 3LS4H 5DD6A 3NN8A 5L6YL 5E8NB 2YKLH 2APTA 4XP9L 3KPOA 2ZCLL 1U8OB 1LGVA 2OYPA 4PJIA 1N0XL 1QKZL 5ECJE 2UWEE 3IKCB 4JHBA 4PGBB