3O41A

Crystal structure of 101f fab bound to 15-mer peptide epitope
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
217
Chain Sequence
QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARLYGFTYGFAYWGQGTLVTVSAAKTTPPSVYPLAPGSANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/viral protein
molecule keywords Mouse monoclonal antibody 101F Fab light chain
publication title Structure of a Major Antigenic Site on the Respiratory Syncytial Virus Fusion Glycoprotein in Complex with Neutralizing Antibody 101F.
pubmed doi rcsb
source organism Mus musculus
total genus 39
structure length 217
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o41A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o41A01
4EUPG 5TDOA 1IQWL 4ORGA 4PJ9B 5H94A 4E41D 5D2NB 2FLBT 1FDLL 2ZP0T 2NY1B 1FVEB 1IAKB 3FB7B 3KNBA 3TN0C 5MP6H 2XNAB 2BNQE 4CDGC 3ARFB 4NBYB 3ZYIA 3L7EA 3SCMA 3DYMA 1N5YL 1RZ7H 4X6CF 4I3SH 1Z9MA 3HNSH 3MTRA 1OTTC 5DJ2B 25C8H 2Z91B 2HP4A 1UQSA 1NGQL 2DLGA 3I3BA 1AP2B 3S34H 2VLKE 4OIAA 2ZKHH 4OLUL 2AEIT 2K9UA 4IHOB 1INDL 2DYPD 4F7MB 5IGXH 1JCKA 3HZVB 4ACPA 5F7UA 43CAA 1QSEA 32C2A 4L8CA 3PP3K 4XXDB 2P24A 4F8QA 1RK0B 4Y5XC 2GAZB 5D9SA 2I9TA 4JFZH 4R7NA 5ESAB 3N1PC 4HT1L 5BVPL 2NZ9D 4JN1H 2VR4A 5FO9B 2AJ3A 5JHDA 1U95B 4ZODA 2NXZC 4G8GE 2UWEE 4LVHC 4MD4B 3SOBH 3TZVD 1BWWA 3EYQD 3PQYB 5JQHC 1AGEB 4RCAA 4F15C 4OB5H 2XN9D 2QADD 4NQCA 1QBML 3INUL 3PWJA 1S5HA 4YHLH 1FNFA 4HH9B 4N8PA 3G5YB 2IH1B 4LSVH 1LEKA 3NCCB 3CU1A 5C0IB 3WHE1 4MXWL 4DVBB 4JO2H 4UIKL 4FFZH 2CGRH 1FC1A 4WTWA 4D0CA 1JPGA 3DX8A 4I0PC 4Z7UF 4Y5YA 5L8KB 3NZHH 2VIRA 5FGSA 1YEIL 3MLYL 5EWIH 2B8OT 2VISB 2EDWA 3M45A 4R4BB 1JHKL 2W9LA 1MCEA 2CPCA 3NIFF 2NW3B 4P23B 4L9DA 3RU8H 3U0PA 3MRBA 4G6JH 1U8NA 3IU4L 5ICZB 1DSFH 5EUKA 2WBJC 4L3AA 4P3DA 5IVXE 4KK5C 2CO6B 4PYHA 1W0VB 4JFHE 1ZA3A 3MJ9A 5ITBL 1SEBB 2OR9H 4ZOBA 4LPTA 2Q76B 2F8XC 3O3DA 4CL7A 4NN5C 1PSKL 1DFBL 4JQVC 4KZEL 1WBYA 3QJHB 5JNYA 1NCWL 1CYGA 1KCVL 4I48B 3IKCB 4X98A 3FB5B 5DUPL 1CE1L 3DVNB 3LKPB 5LBSL 4PS4H 3T8XB 1YMME 2I9LA 4HIXL 5J9PB 4Y2DB 1MI5E 4XVJL 2XY1A 5IWLA 2EDJA 3IRPX 1VADA 5D2LA 3TBVA 3WNMA 2Z31A 4NFCA 5TFSH 4HS6B 5DZOA 3PWNA 3H0TA 3QXDA 1CZ8H 2KDGA 1MHPH 4X4ME 5DD3L 5E6IC 5IKCA 1XIWB 2QQNL 3S36H 3DIFA 3BUTA 4N0CD 1IBGH 2ZOKA 1TNNA 3BE1H 1S5IH 1F58L 1M7XA 2UVFA 1UWGL 4UT7L 3QUXA 2CDEB 1U6AL 1RU9H 3FN0L 4LCWE 1A7NL 4XGZB 4D3CL 3HMXL 4PB9H 1JNLL 2LFGA 2DN7A 3IDNB 3ILQD 5IBUG 5I71B 2CKBH 3DMMB 1TVHB 3OKMB 3V5DB 3C5SB 2OTPA 5HDQL 1R3JB 1IILE 3T2QA 2CIKB 3QH3B 2VITA 3QNXB 2R0ZL 4LCUB 2YWZA 3OG6B 3GKWH 3GMNA 2LAAA 3BKYL 5J3HD 4Q9QL 2NY4B 1CLZH 4BH7B 1LEGA 5E95B 4JRYD 5BVJA 3IFLH 3ULVL 3EGSA 4PRPD 5D7JD 5IMKA 1VSCA 3PNWB 5KSUB 5ACLA 5DJZB 2QV2A 5J0BA 4L8SC 4EOWH 3MJ8B 4J1UB 4YXHH 1PGRB 5DQDL 3ARBB 4LEOB 2IALB 4WUUE 3RWCB 5DJCB 3T2PA 4KKNA 1E4WL 1BD2B 1ZHNA 2VWEE 5TF0A 3SDDC 4YGAB 1IC1A 3FZUC 1ZLSH 3RVTD 5SWZD 1DCLA 5FKPB 4I9WE 3RIFK 3V95A 1KTKE 1IC7H 2QQLL 1X4XA 3S4SA 1DVFB 4LLMA 3BKJH 2H2PC 3VXUB 4EN3D 4EUPH 4B7LA 3QEQB 4X0KA 1E4KA 1A6TB 4CDHA 4FFVD 1DTUA 5CJBA 3U82B 1TDQA 5CZKA 4OD3H 4F7CA 2HJKB 4MVBC 1MIMH 1GGBH 1RURL 4OF6A 5GISL 1AKJB 3GMMA 4ALAL 1X44A 1RZIA 3P2TA 4DGVH 4R8WL 5D1QA 2VABA 3CFCH 4JJ5A 2OJZH 4GW1A 1MCLA 1M7IA 2VDQL 1MJUL 2GSGA 3CD4A 3PWUB 4D94A 2Z93B 5ETUA 4JPKH 3DVFA 1TZHA 2X4NB 3UBXB 5T3ZE 2YPLE 3WNPA 5FYKU 4RGMB 2NY5L 5KVGH 3SDAB 1BFVL 3WSQL 1RJCA 4U7MA 1IFHH 2G2RA 4EDWL 3GJEA 4Y19B 3V79C 4JR9L 2EH8L 1ZT7B 2YZ1A 5FHAL 3VRIB 3H9SB 3TIDB 2WINB 2EECA 5DXWA 3V6ZB 2FO4A 3IDJA 3MBEA 4QRPE 2DBLH 4PJHF 4NM4L 4GBXC 3RBSA 3VGGA 3WEXB 4OZ4A 4PGBA 3X17A 3QUML 4S0TD 2NXZB 5CGYC 4LVHB 4K94C 3HAEG 4Z78B 4LPXA 4PRDB 5EZLA 1KTDB 4HIIB 1N64L 4DUXA 4X7SH 4ZTOH 4PJIE 2B7DT 3CPLA 4ZD3L 1MJ7H 3MV8E 4S2SB 2P5EE 5D8JL 4Z0BL 3CAFA 1BQLL 2OM5A 4MNHA 4ONGH 3L5XL 4LRNH 3PHQA 4LHUB 1Z5LA 1JFQL 4U6YA 3TF7C 4I0PB 2H6PB 5CD3B 2E7MA 1QFHA 3DYPA 3DGGA 3GI8H 3RGVD 1CXLA 4NQXB 5DF0A 2EDRA 3IF1A 3EYVB 2DBJA 3B6SA 1IAII 4I18B 3H9ZA 2OSLA 1DQJA 2FX9H 3C60C 5INDA 2HN7A 4JFDE 5KSAB 3RWIA 5I30H 2HRPL 2EC8A 3WV0A 4LAQH 1QFUL 1XH3A 4XNZB 3MLVL 4LPWA 5DTFB 1T2QH 4PJFE 4XP4L 3SJVE 2A1WH 3ZE1E 2OZ4A 4KGLA 4NN5B 3MRMB 2YPKB 4OSUH 5DRXA 5L2KB 2CDFA 4QRRA 2R2EB 1ZT4A 3MACL 2J8UE 1WCQA 4Q74A 5CAYB 3FONA 2W0FB 4FQLH 4E0RA 5F1NB 3REVA 2APBA 4R26H 3MLUH 5HYJE 2F54D 4IIQC 1QSZA 4E41A 5I1GH 3EOBA 2BJMH 2JJUA 3MGAA 4HKXA 2Q1EA 1I9EA 1UB5B 3B5TA 5C6TL 1U8PB 3OAUH 3RVWC 1EPFA 3KYKL 3RUGA 2A9MH 1NLDL 1WC7B 2ESVB 2GK0B 3WFBH 3X14B 5GJTH 3V6BR 1JZ6A 1FE8H 2XZCH 4FQXB 1D6EB 1EXUA 2GJ6D 3K0WA 5E6IB 4XI5D 3ZE0E 1FG2A 2EYSB 3UPCA 2WIMA 5ISZD 5GGRA 4O2FA 3T4AB 5IMLB 1AFVL 1R3IH 3HCVB 3QB7C 3VFUB 5JZ7C 1CDYA 1SYSB 4LSQL 4PJXA 3VMPA 1IGIL 2ADGB 7CGTA 1K6QH 4YAQB 5F88B 3KLHD 3RA7L 3MOAL 3K80A 1KJ2A 1GGIH 5HHNA 1LVEA 4HWBA 4KI5E 4EIGB 4OQTL 3VXSD 3CXHK 4HBQA 3LN4B 1A3QA 5IBLD 2OQJA 1XGYH 1PG7X 3GSXB 2NY7H 4P5MA 4PP1C 4CKVX 3TBTA 4WWKD 2YEZA 4UUJA 3V4VL 1MWAA 1A22B 3WIHH 4PRAA 2PW2A 5T1LD 4V1DB 5L88H 5MEOB 3NPZB 4P46D 4X6EB 4KJWC 4CU7A 4XMPH 5F21B 4XP5H 3UZQA 5C0AB 4MHHG 3QDJE 1J9CT 4W4OA 5F93C 3DXAE 4M1DH 3HUJE 2HG5B 1I8MB 3ALPA 4QXUL 3M17A 4X8JA 3QWRD 2R1WB 3MLSH 2EEDA 1F8TL 4J4PC 4H1LA 4PGJA 4HGWA 1SVCP 4PG2A 4X6FB 4ZO8A 5IVZA 5F97E 3VD3A 3QPXH 3OGOE 4HC1L 1KCRL 1JTTA 2ADIA 3SKMB 1MRDL 3VFMA 5EU6B 4MXQD 4YWGL 1K85A 2ILLA 1F02I 1YEDB 4PB0L 4JFYB 1TJHL 2X4SA 4NJ9H 4X9IA 3U7AA 2F74B 1QQDA 1Q9WB 2LU4A 1IAIL 2JCCB 4JFEE 4LARL 3LKSB 1NFDF 4ODVL 2R9HC 3L9RB 1JF1A 1T2XA 1A21A 3T0ED 3SHSA 1OAYL 3QO1B 1FNEA 3AM8A 1MUJA 1V7NL 3BZ4B 4MAYB 1FO0H 3OZ9H 1T2JA 1OOAA 2BNQD 4OF8A 4ZSOE 3QUZC 4KVCL 4LNVA 5I2IA 1I3RA 4ODHH 1YN7B 3VFNB 2F53E 2PYFA 3IJSB 1E6OL 3F58L 4PJHB 3TO4D 2J6EA 3HI5H 4XX1E 3LB6D 4PJ7A 3PHOB 1LE9B 2FZ3A 2QQQA 4FQIL 1FZJB 3GRWL 5B22A 1S7QB 1HN1A 2VLKD 2HMIC 1A14L 3FQXB 3NCMA 4WU5A 2GJJA 1J0YA 4JHZA 3U2SA 4YFDB 1RZ8A 5DHYA 4DOHE 3L95A 1B0WA 4UV7L 2X05A 1G7LB 1BX2B 1VFAA 5D1ZC 4XAWL 2WP3T 3RTQD 1AGDB 3LQAH 5KVDH 2VXQL 5B3JF 3OHXA 4AT6B 9CGTA 2X9YA 3PWVB 5DYOA 2E9IA 4HIJB 3MSPA 2A6JB 1NCAH 4G8GD 4ZO9A 1ODAA 2W60A 5EFIB 3VWJD 4AIZB 2P7TB 4AK1A 5I1LB 4JO1H 4WI9A 4TRPH 3IDYB 4IRZL 3PWPB 3X13A 5D5ME 1XEDA 4X5WB 5DURD 3BPLC 5CZXC 3K4AA 4WUKH 5CEXB 1P2CB 4HK3N 3NFSH 4PBVC 3EO1B 5AD0B 3ULUH 2AJYH 4JZJC 4CNIA 5I8KL 5EOCL 3K2UH 5BJTB 3QSKB 2ZUWA 2MPAH 4G9FA 2ZOLB 2AABH 3OKKA 3TCLB 4LRIC 2AGJL 3C60B 1I1CA 5F9JA 4AEFA 1NGXB 4PRPA 2APFA 3GSVB 3QNYA 1CD1A 5FYKD 4PIRF 4OCXH 4LLVB 2PNDA 1IGTB 1FNLA 1MREH 4P2OB 4ONOA 5IIEA 3OF6A 2YHGA 5FYJH 5IEHA 1SJHB 2X1QA 5I18H 3QULB 3HFMH 4JFHD 1MCFA 4QY8B 1T4KA 1BQHA 4PTTA 4QNPF 2W92A 1YECL 1IAOB 5SWZA 3MRFB 2DTML 2WNGA 4DAGL 3BKML 4O4YH 1H5BC 1MFAH 1S7TA 5C0BB 3GSWA 1HILA 1X3DA 4IIQB 3SBWA 1T1XB 2OXHA 3IJYB 3JTSB 4HWZA 2AXFB 5B38B 4M43L 3VFTB 3HNTL 1YMMD 4HFWB 4HF5L 4FS0A 5DK2A 3QEUA 4IBLT 4LSTL 1U92A 1MI5D 2EH7L 3BPNC 2VDLL 4GAGH 4BFEA 5HGHA 4LHJB 3KYOA 1V3LA 5GS2H 1INEH 3FHAA 3LSOA 3RP1A 1BMGA 4ZAKC 3TVMD 3U48A 2V2XB 2R2CA 3MBXL 3WS6A 1OCWL 5FB8B 4R97C 3FO0H 1CFNB 3BKCH 4X5XB 4QTIH 5BMFH 4XVUD 4Z5RA 5JW5A 1DLHB 4L4VE 4EQ3A 4CJ1A 3VGBA 5J56B 3P0YL 2X44D 2XXMB 4JZOA 4N8VG 5CHNB 3BQUB 5KJRH 4R96B 1FP5A 4LCWD 2R1XA 4K71B 1WBZA 3FO9B 4NN7C 3RWJA 1HHJB 5CS7A 1UWEH 2R15A 3BP4A 3SPVB 4F7TA 4HKJA 4M1GH 4YE4L 2VERN 1PAMA 2D3VA 3MYJA 1GRWA 3CMGA 4TUJB 2UUDK 3G6DH 3UPAA 1UKSA 1JI2A 3BPCA 3IDMB 1FORL 1YUHB 3QZWB 1YY9D 4R9HA 1E0OB 3LZFL 3D39E 4X9FA 1IC5L 3OR6B 5C0JB 4FFWC 4P2YA 1R3LB 1SYVB 1YYLL 2F5AH 2CDGA 3LQAC 4GAFB 4GRMA 4URTB 4XCCL 3CH1A 3EYUH 4PJAF 3ZO0A 4UTBH 2Y72A 3UCRA 3ARDB 4LCYB 4NWUL 1M7DB 1T0PB 1ADQL 3RGVA 2DQDH 4P57B 2V7NB 1QLFB 3VXOB 1OAZL 4WUUD 1WT5A 4ZOEA 1MQ8A 3EYFA 3KJ6L 3QO0B 1Q8MA 1SHMA 3DROA 2Y6SD 2W9DL 1IKNC 1WEJL 4YC2B 3WHXB 4ODWA 1MRCL 3LCYA 3PV7A 3GSRB 4PJEF 3X12A 4O02L 3WFCH 5DD6A 1NGPL 5E5MA 3AMLA 5JXEC 3QIWC 4K7PX 3B5GA 2A6DA 4I9WD 3ULUC 4H0IA 1JYWA 2GI7A 1T1WA 1G0XA 3C8HA 3PXHA 4H0GA 4YDKL 2PYEE 3A6CL 3OJDB 4UILL 1Q0YL 1BFSA 3VFRB 4XCYB 3T1FA 4C56A 2R8SH 3MC0A 5CILL 5HGDB 4XBGB 2X4PA 1B6UA 3MREB 4PRBA 4TSBL 5HJ3B 2DM4A 2P8LB 4U1MB 1K4DB 2P4AB 3G6JA 1RMFH 4OGYL 2B0SL 1HDMA 3C9NB 4YEFA 3SCMC 3UJIL 3UTQB 4ZDHA 4ELKA 4KHXH 2X4QB 3ULUF 3FT4B 1XGPA 1OP9A 4OIBA 3TT1L 2M2DA 2VXUH 5T3ZD 2YPLD 2PXYD 4ZFGL 3GI9H 1OGAB 4JDVA 2FATH 2B4CL 1FGNH 3MNVB 5J13B 1T1ZA 2AI0H 4H88L 3WDHA 2H32A 5D1ZB 2YRPA 2GUOB 1A4KA 1EGJH 3FHQA 4AQ1B 2R1YA 5ISZA 2BY3A 2FIKB 5DD5L 4CU6A 4JQIL 4AIXA 4LKXB 4YHPA 5FUZH 3C6LD 1PYWB 1A7PL 3BVNB 1X7QA 3FO1B 4NCDA 4FQJL 4LLQA 1XGQA 3LMJH 3RY6A 4JHBA 4HXAH 3J8F7 4MA3B 4TNVF 1OSZA 3U4EA 2NTFB 1PBYA 4ZUSB 3VXSA 1A7OH 1JGVL 2QHRL 3MV8D 3STZB 2P5ED 4H8WL 5ERWB 3ULVE 4I2XE 3PABA 3RZWA 5IK3B 3PJSB 4WWKA 3OX8B 2E9BA 2A0LC 3ZKXB 3TYGL 2VH5H 5T1LA 3ARZA 4NZRH 4P46A 1T6WA 2XKNA 5CP3H 1EUUA 1A3LL 4GW4A 5FO8A 4GSDL 4Y5YC 2A2QT 3V4PL 5AZ2H 2DMCA 3D18B 1BVKA 3QWRA 3ARGB 4YR6B 1GIGH 3DURA 4BUGA 3FT2A 4CJ0A 2ZCLL 3DUSA 5ALBL 1T22B 4KKCC 1ZLUH 5SV4A 4QRUA 1L6ZA 3SJVD 2D9CA 3RWFA 1BZ7A 3OJMB 1RJZA 5SWSA 4IRJC 5EO1B 1HXYB 4GRLC 4WJ5B 5I1DB 3L1OH 4Z7QF 1NGYA 2AEPH 2CRIA 4PLJD 2HKFH 1E28B 5HYJD 1P6FA 1MOEA 1MHEB 4BA8A 4QRQB 5I73C 1PLGH 3O41A 3EOTH 4J7RA 4HCRH 2O61A 2NLJA 2BNQA 1S9YA 4R3SA 3S5LG 1JWSB 1Z0NA 3HPJA 4AEIL 4ZAKB 1C1EH 1B0GA 3B8YA 4OIIH 4PJ8B 2D7MA 5IWLC 1FZOA 3TO4A 3BO8A 3O3AA 4MJIB 3GHEH 4NKIH 2VL5A 4R0LA 2Z31C 2WBKA 3KPOB 5JIIA 2VKWA 1AXSA 1A2YB 1DQMH 3U7YL 2AK4D 3OJ2C 3C6SA 2VLKA 4U0RB 2UY7A 3E2HB 5IFJA 1N8ZA 3O4LD 4YK4C 5T3XD 1UZ8B 1S7XA 3QFDB 3HE7C 1OTSD 2IG2L 5FEBA 5HHXL 5BO1H 4KI5D 3SE8H 5E4EC 4OZGB 3RTQA 4AIOA 5E6YA 5E99H 3UO1H 3CH8A 2LV4A 5GS0D 1CFTA 3AS1A 1ZT1B 5JO5B 1C5CH 4NCC1 2HA1A 3ARED 4EDXA 4G8GA 2UWEA 4J3OC 4UV4L 2RCSL 1FG9C 2DKUA 4JPVH 3VWJA 2DLIA 3KPQA 4KY1H 5DEGB 1WAAF 4U2ZA 5HI3D 3NN8B 4L5FL 1O7VA 4IDJL 4P2RB 4NP4H 1N5YH 4KTDH 3VXTB 3EJJX 4IRSB 4JFOA 1TMCB 1YYML 5TPWH 4EVNA 5IM7B 1I7TB 4OKVA 4KROB 3H7BB 2HLAB 1KPVA 1MHCA 3V0VB 3G04A 1LO4L 3BT2H 4TTDC 4S11A 3H7LA 1I85A 35C8L 4ZYKB 1AGFB 3QUYD 2D7TL 5DEFB 5ABDE 5F3HB 1NAMA 3ZT7A 1X5IA 2GT9A 3DV6A 3GHBL 4Q6IC 3WMSA 1GZQA 3W2DL 1CFSA 4N0FB 4BK5A 1KELL 3DETC 4KK6D 3VXME 4AL8L 1NC4D 2VLRE 5EBLB 5EU7E 1EDQA 1KCSH 3CSYB 2DB8A 2I5YH 4XPAH 5IVXA 1R3HB 5EG6C 4M9OA 4WU7B 2AJUL 5EBWA 2SEBA 4NBZB 5TDOB 2CXKA 5H94B 4ORGB 4HX1A 3FQRA 4FABL 1UG9A 3KNBB 1VACA 5L6YH 1RUQL 1UZ6E 1KEMH 3LKRA 3L7EB 1MHHA 2F53D 3SCMB 5DC9B 3V52L 2MOVA 3GNMH 1YMMA 1RVFH 3AROA 1UQSB 2V17H 1MI5A 4TOYH 3C8KA 4HFUH 1YN6B 1S78C 3TVMA 2PW1A 4OLWL 4X4MA 43CAB 2Q7NA 1QSEB 32C2B 2CUHA 2P24B 2FB4L 5D9SB 3ES6A 3RPKA 3IU4H 2I9TB 2O26U 5IUSA 4R7NB 4HXBH 3RDTD 1Z3GL 2K7PA 3SGJC 4XNXH 5JHDB 2AJ3B 4DQOL 2XG5A 1CL7I 4LCWA 4AMKL 1U3ZA 4N0UE 4XPHL 4XNYL 1C5BL 1YC7A 2R56H 2ZJSH 4NZDA 5C8JB 4K7FA 1GC1L 4Q9BA 4WFGE 1NLBL 5IV2A 2FH6A 4NQCB 3PWJB 1CBVH 1S5HB 4MJ5A 3DSFL 1NMCC 2CMRH 1I9IL 3P11H 4MA1C 1LEKB 3W0WD 2O5XL 4U1IA 1P84J 4XMKL 3P4MA 3L3HA 1AHWC 5C92A 1YPZF 1XGUA 1V3JA 3K8MA 4D0CB 4M02A 1JPGB 3DX8B 3MA9H 1A9EA 3DUHA 4MX7A 4K3GA 4Y5YB 5K59F 2VIRB 4P59L 1NANI 5C2UB 1HQ4A 3CUPA 4OM1L 5F1KC 4NO3B 1X5GA 5DD3H 3V6OC 4Y4FD 1KB5H 1U3HA 3O11B 3U0PB 3MRBB 1T03H 1FIGH 1U8NB 5TQ0L 2EIZA 1EHXA 1I1AA 4ZOAA 4O5LL 4WUUA 4P3DB 4YBQD 3CSPA 3BXNA 1SBSH 2J6EH 5AEAA 4X9BA 4FZ8H 4F2MA 5D72H 1U6AH 2IPTL 1ZA3B 2BVEA 2AQ3A 2NNAA 4KK8C 4YIQA 4JGUA 2Q8AL 3ZTJG 4GG6F 1KCUL 4TPRH 3VG0H 5C7XH 5CJXC 3O3DB 3P9LA 3PIQA 5EZOL 2B20A 5DWUL 5AZEL 3X3FL 5GZND 5IB3A 5JNYB 2R2BA 3SEPA 4X98B 2ED8A 1L7IL 2APWA 1RQ5A 2R0ZH 3SGKA 3VWKD 1CGSL 5GRXG 1PD6A 3G9VA 2HH0L 4QO1A 2HFGH 4U1JA 1TLKA 1VADB 5D2LB 1Q9OA 3TBVB 1BVZA 2Z31B 2QKIA 2P44B 2KBGA 4WIQA 2QSQA 3ZE2F 2L7JA 5C0RH 3PWNB 3WLBA 3H0TB 2LTQC 3QXDB 1NBYA 2EO1A 1EFXA 2EE2A 2OL3L 2XZAL 3OXSA 4UI2A 5IKCB 2YPLA 4L4VD 3DIFB 3MRRA 4I77L 2PXYA 4Y1AE 3W39A 1ZAGA 1P7HL 2ZOKB 1HE7A 3VG9C 4YHOL 3BZFA 2GSIA 2C9AA 4LFHD 3QUXB 1J05A 2BSSA 4GMSH 3F65A 5IFAL 5IQ7L 5ILTL 2WK2A 5F72S 4OBRA 3EYSL 4QRPA 4WCYL 2MWCA 3JWDH 2COQA 4PLNC 3I75A 4MB5A 5I74C 1FYTE 2NZ9C 5M94B 3P4OA 1KXQE 1YC8A 1IGML 3QNZA 2VITB 4PJIA 2EC9T 3CVHH 5TDPA 1KJVA 1QFWH 3MV8A 2P5EA 1A4JA 3TZVC 3MGTA 3CX5J 3EYQC 3GMNB 1CL7L 1EO7A 3BZEA 2R4RH 2XICA 1WTLA 5T1MA 1NKOA 4PJGE 2VAJA 2QADC 5BVJB 5H2BA 4YPGA 1YY8A 3GFUA 4W4OC 3EGSB 5IMKB 3NCFB 3O6LL 3JV4A 1NL0L 5CGTA 3L3GA 1NQBA 4KKAD 2W0LA 1JGUH 3VXRE 1HCFX 2NY5H 1XGTA 4K3EL 5FUCC 5K9OA 4PG2C 5CIPA 4JFDA 2AV7A 3PGFL 1ZHNB 4XPGH 1CGXA 3KLSA 1BFTA 4L3ED 5EO0A 1KXVC 1ZV5A 1XGRA 4RGOL 3O9WD 3QUMH 5HYIA 5LJYH 3S4SB 4PJFA 3M8OL 3SJVA 3MFFA 1N64H 4RISH 4XPBL 4X0KB 5A43C 2J8UA 3VI4E 1MAML 1WWCA 5LQBL 4F7CB 3GMMB 5HYJA 1RZIB 2XQBH 4PR5A 5D1QB 2VABB 4GW1B 1M7IB 2GSGB 1U36A 2WIIA 5FGCB 5LGKA 4LBEA 5ETUB 5C08E 5HI5D 1VGKA 1TZHB 3HC0A 1UJ3C 3EJZD 4XB7A 4RDQG 2H2SD 3IFNL 1BM3H 4G7YL 2G2RB 4NJAL 1A6VL 1JRHH 4M6ML 2EXYD 1AD0B 2X2YA 5F7KC 1TPXC 3KXFE 1AGBA 1QFUH 2FRGP 2X1OA 3LEYL 2FO4B 2VR5A 3IDJB 3MBEB 4N0CC 4OZ4B 5C6PB 4PGBB 1YEEH 4F9PC 3RIAK 5EZLB 1VEMA 4HMCA 1G9MH 1FH5L 3GIZH 3UYRH 3CPLB 3K7UA 4XZUA 3FQNA 5IB4B 3ILQC 5MI0C 4YPJA 3I9GL 1HWHB 1P7QD 2BRRH 4Z7NF 1KPRA 5HVFB 1MEXH 1J7VR 4MNHB 4MA1B 2BDNL 4HUWA 3PHQB 3BWAA 4TN9A 1Z5LB 4HAGA 4NRXA 2GQHA 4TUOA 4U6YB 5IB1A 4KHTL 1MCPL 4BKLB 4NO2A 2EYRA 4YHML 3DGGB 1A6UH 5B39A 2XIDA 5J3HC 3IF1B 3JWDC 3HUJA 4CVWA 3RWDA 3B6SB 1KEGH 2OSLB 1DQJB 4JHAL 5EZJA 5INDB 4WW2A 2WWKO 2HN7B 4Y8AA 4LMQI 5D7JC 4KPHH 2ICEB 5E8EA 3RWIB 3WUWG 3QUYA 3V4UH 1IQDA 1XH3B 4LASH 2GY5A 1H8NA 1VEOA 3E0GA 1OAQL 1BGXL 3EFDH 3GMQA 5E0QA 2YWYA 5GS1A 5DRXB 1BREA 2CDFB 5F6HI 4JFEA 3ZTJH 1ZT4B 3AY4C 3RVTC 5D71H 3FONB 3LD8C 4RX4D 4E0RB 2H1PL 3REVB 3OL2A 4XPTL 5HHMB 3SBWC 4E41B 4UTAL 3EOBB 5DGQA 3KPSE 2IAMD 4EN3C 4ZSOA 1MQKH 4OV5A 1LK3L 3RUGB 4FFVC 2F53A 3MQIA 1MLCA 3ZMRA 2LTQB 2J8OA 1G9NC 1EXUB 5HPOA 3P30H 2VRAA 1NMBH 2OCFD 1FG2B 2ZSVA 3FMGH 2ICWI 4Z7OF 5GGRB 5ALCH 4O2FB 4KQ3L 2XQYK 1JWUA 4M6NL 3ARWA 1L0QA 2D7OA 1TETL 3Q5OA 1MRDH 4PJXB 4S1DD 4QXWA 4GRWB 3ZDZF 1N2RB 4XC3H 2J5LC 3TWCL 1KJ2B 4Z7WF 5HHNB 2EO9A 3CMOH 1HK6A 4KZDH 3WLWD 4EBQH 3TBWA 3P77A 1R24A 5I74B 5HVGB 2OQJB 4ODVH 4LCCB 3DV4A 4JM4H 3I6KA 4JFPA 3RDTA 2PF6A 5C0CD 1CXFA 4W4NA 4U0QB 1RIUH 3NAAL 4ERSH 1OAYH 3TBTB 1X5JA 2YEZB 3N1FC 3MRNA 1UM5H 4UUJB 1MWAB 4PRAB 2R0WH 2PW2B 5D5MA 3S37X 3IDGB 4N90D 2FJGA 2W9EH 4PJCF 5INCA 3QR2A 4HSQA 1AD9A 3MLXH 5LXGL 3KS0J 3M17B 4X8JB 1JNNL 3DWTA 4NN6B 1HOCA 5J11C 1LO3L 1G9MC 4H1LB 4N5ED 4QHLA 4HGWB 4DKEH 5DVLA 1Q1JL 4CN4A 5IVZB 4J6RL 3RGVC 1OP3H 4EI6A 2ADIB 3VFMB 3VXMD 1I8LA 5DJAA 5EUOB 4Y4FA 1MRFL 4XAWH 1BBDH 2FBJH 3GK8L 2YN5A 2X4SB 2JB5H 5J4MA 1I9RH 1CTNA 1QQDB 4ENED 2VXQH 3O8XD 1WFUA 3T2NH 2AVGA 3FTGA 3BEVA 5EPMA 1JF1B 3QQ9C 4UOJA 1I3UA 3WDJA 1FNEB 4JO3L 1CG9A 1F2QA 3CCHA 4ZTPL 1RIVH 1F4XH 3CK0L 1QBLL 5I2IB 2GFBA 1I3RB 2O5ZH 2PYFB 4J3VA 5D7LE 3VWKA 5IJKA 2R0LL 2IANE 4KQ4L 4PJ7B 2FZ3B 2AXJA 2FEEI 4KKBD 5KVFL 1FIEA 1SJVA 1DBBH 4RFOL 4U6HA 4WU5B 3S96A 1I1YA 3QXWA 3U2SB 1FZKA 1RZ8B 5HDOA 4KUCD 5DHYB 1T1YA 1ZTXL 1AR1D 4UU9B 2FX8H 3IJHA 1VFAB 2FWOA 1TZGH 4XI5C 4L4VA 1P5UA 3HC3H 2HT3D 3OHXB 5CJOL 3T0VA 3KR3H 1QZ1A 5DYOB 5AG9A 5FECA 3WXWH 1NFKA 3RY6C 3KLHC 2W60B 3CNKA 1JGLL 5IW1A 3LPFA 2CJUH 2XQYG 3AFLA 2X7LA 5BV7L 2DTMH 5MI0B 2O5YL 3X13B 1JK8A 5IBLC 4IJ3C 4Y89A 2DJUA 4GXUM 5FYKH 1U8JA 4WWKC 2C1PA 1HHIA 4CNIB 4P5TD 1J0ZA 4G9FB 4P46C 4A6YL 4Z77A 4O58L 4KRMB 5EOQH 1HSBA 4E5XB 3DOSA 1CS6A 4PRPB 3DX6A 2FD6H 2WANA 3QNYB 1CD1B 1EBPA 5K93A 3RWEA 2VXTL 5GGUA 1NDMA 3P0YH 5IIEB 4ZO7A 3DGCR 3SGDI 5IEHB 2F5BL 3BPOB 5GGTL 1AR2A 4Q0XH 5D7SL 1T4KB 4MXQC 1BQHB 3C09C 3BN3B 2MCG1 4PTTB 1RZJH 4U6VH 4WHYG 5SWZB 2I60H 1L7TH 2PYEA 1I3GL 3O9WA 2HVJA 1S7TB 3MV9E 3GSWB 1IZJA 1HILB 2LE9A 4KWUA 5TQ2L 3CDFA 4HWZB 3L5HA 1B4JH 2DAVA 2M1KA 3T0EC 5DK2B 3LIZL 1M6OA 3QEUB 2PCPA 3LZFH 1U92B 1F90H 4QHNA 5HGHB 4LVNB 4AJ0A 1BHGA 1YYLH 3KYOB 1OF2A 1JTPA 3LSOB 5I8OH 4JY5L 4F37K 3NPSB 1VB9A 1FYHB 1YNLH 3TO4C 2YD3A 2D7QA 1M71A 4UDTA 1AXTH 1HIML 4JLRA 4R0LC 3LB6C 4OFDA 3WIIH 1CDGA 3WN5A 5L0QB 4YFEA 4Z5RB 5JW5B 4FXGA 4Y2DD 1T6VN 5CSZA 5ELIA 5JOFA 3HMXA 2FEEL 4PJDE 1JTOA 4JZOB 2R2HA 2W9DH 3NBNA 4ZS6D 1LO0H 2R1XB 1WBZB 5HXMA 1NGPH 3RWJB 1RZKL 2QQKL 1F97A 3RTQC 1MFCL 1KJMA 3BP4B 4F7TB 4PD4K 4WNQA 4HKJB 1FNSH 5E7FA 2LVEA 2FO1A 5I6XB 3MYJB 3X11A 3L3IA 4OZHE 2CUMA 4GLRH 2DQIL 4P4KA 3LH2H 4X7EC 3BPCB 5D96C 3S5LA 3VWJC 3VDAA 2EDQA 5GPRA 2WUBH 5EU5A 1CR9H 1IEAA 5E56A 4I2XA 2V5RA 5I1IH 1A0QL 2OLDA 3DECA 2CDGB 4GRMB 1NGZA 3VDBA 4XPFH 4HPYH 1WVZA 4DGYL 1NBVL 5J11B 2DQCH 1QUNA 1NCCL 3RGVB 3VXRD 4NQTA 5C09E 5C2BH 2UWEF 1OHQA 4BK4A 5F96H 2NY4D 4Y2OA 3KPNA 5D7IF 3EYFB 4NIKB 3DROB 5DO2D 4X83A 4ODWB 3QXVA 4JQIH 3MO1A 4LQ1A 4WI5A 3X12B 4UINL 3NCEB 1A7PH 4K3DL 5DD6B 5E5MB 2A6DB 2A9NL 1T1WB 1V5JA 4BQ6A 3ILPA 1BJ8A 3ARBD 3RY5A 4KKLD 2Z4QA 5KW9H 3L5WA 4I5BA 3T1FB 1OB1A 4C56B 1QNZL 1PQZA 3TNNA 1TVBA 4J2XA 2X4PB 1UCBL 2QHRH 4PRBB 4FZEH 3QHFL 2BX5A 1JZ4A 4RX4A 1J1OL 4BUHA 3G6JB 3MZTA 1HDMB 3TIEA 3T65A 3SDYH 1K3ZA 4ZDHB 1KN4H 4ELKB 2ZWLT 5GRVK 1KENL 1XGPB 1DVFD 5C08D 3VXUD 2EDBA 4DW2L 4G5ZL 3TYFA 4IOIA 1RZJC 4JDVB 1A3LH 3RI5K 1T1ZB 4OF3A 2H32B 2VDOH 1KLFA 1B90A 3ALWA 3W11D 1A4KB 2R1YB 5ISZB 2ZCLH 4NOFA 4M6OH 5ALBH 1KBGH 4YHPB 2XT1B 4MA8H 3O2DL 2YD2A 1P5VA 3BP6A 2BCKA 1HSAA 4XVUC 1X7QB 2J7LA 4LLQB 1XGQB 2RIKA 4I3RL 5D1XD 4AY0A 5BW7C 1OWWA 5LWYL 3SDAD 4W6WB 1OSZB 1DQDH 3BRFA 1NDGA 3UAJC 1S7UA 3VXSB 3SDXF 3VI3F 3MCLL 5KAQG 2VQUA 3H9SD 3D87B 5AYUH 5E9DE 3PABB 4RAVA 1EMTL 5AWNL 3S88L 4OCSH 1EZVY 3PDOB 5HSFA 5T1LB 2P5WE 4PV9A 1JYVA 2F58H 4P46B 1YY9C 3W9EA 2XKNB 2CRZA 5C0FA 3Q0HA 1OY3B 2YPVH 4GW4B 5FO8B 5JHLL 4WO4C 5IOPA 1WZLA 1LD9A 5E2JA 2Q8BL 1JL8A 1S3KL 1BVKB 2YK1L 4Y4KD 3SQOL 4TVSa 3DURB 5CJQH 3DUSB 3O6KL 2YD9A 1O0VA 3E8UL 2XYCA 3BH8A 4MNQE 4QRUB 1TFHA 1EHNA 5HHXH 3VXMA 4HKZA 3C09B 2VLRA 3RWFB 1BZ7B 2Y6SC 3QAZC 1RJZB 1OAKH 5SWSB 5JUEH 1FC2D 1CTOA 3I6LE 4FRWA 1FNGB 1MFEH 2ICCA 3F7RA 1NGYB 4G8EA 1XFPA 2Y36L 4F58H 1NEZG 2BERA 3O81A 1JGDA 3KPSD 3RHWK 1LP9F 3O41B 3TA3A 2VXVL 2DI9A 5HDLA 4JEGB 4L5FH 5ITFA 2O61B 2NLJB 2X6MA 5L2KD 1S9YB 4R3SB 2ZSWA 2VMFA 1ORSA 4HKBA 2LU3A 3HPJB 3MNWA 4UMGA 5C07E 5T3XH 1B0GB 2Y07L 2D31A 3EKCA 5JDSA 3TO4B 3BO8B 2AP2A 3O3AB 3PDGA 2VL5B 3D85D 4R7DA 4R0LB 2B5IC 5JPNA 5FDWA 1EEQA 1AXSB 3FOMA 5JW4M 1YA5A 3C6SB 2VLKB 5I17A 1EIBA 4XP9H 3ARTA 5IFJB 1N8ZB 2PXYC 4HMEA 4OQTA 1J1PL 2ESVD 1S7XB 4HQQL 3TO2A 4S1QH 4FQXD 4M48L 1S9VA 3O4OC 4N8CL 3RTQB 3KPRE 4FXKA 1RJYA 5GHWL 3UJJL 1J0HA 2PTUA 3AVEA 4DTGH 2C4XA 1HYRC 1CFTB 2G75A 3C6LC 2DQTH 4V2BA 1G7HA 3GSUA 4EDXB 4G8GB 2UWEB 5ACZA 4N0UA 1A3RL 1XR8A 5D96B 3RVVC 1GOHA 3EYOA 4MB3A 3KPQB 1UWXK 4M62H 1RUQH 4RRPA 2LAGB 2CXGA 5JDJA 5EN2A 5DURB 1MJJA 1WWWX 5E2VL 4QHMA 4CMHC 4JFOB 2YBRA 4JFXA 4EVNB 3KS0H 4MZ3A 4OKVB 1KPVB 1MHCB 4HC1A 3G04B 1FZMA 4P5TA 5KOMC 5K9KA 2Q86A 4V1DD 2VZTA 3LS4H 1NAMB 5MP6L 2GT9B 1FFPB 3DV6B 1A6PA 1AE6H 1F4YH 1GZQB 5C0AD 1CFSB 1J0KA 1RZ7L 3AU1A 3VXQA 4I3SL 3ZYOA 2XI9A 25C8L 5DFTA 4HJ0D 1YDPA 5GIRA 3MJ7B 1FBIH 5IVXB 4XTRD 1R0AL 3S34L 1RY7B 5DD1H 2ZKHL 5EBWB 3UJTL 2SEBB 3O2VH 2OK0H 4HX1B 3FQRB 5JA8B 1LILA 4CN1A 1VACB 5KSBF 1NKRA 3NCYP 4JFZL 1MHHB 4Y4HA 1EA9C 4CVZA 2PO6B 4JN1L 4PLJC 2IAND 1WZMA 1X5ZA 1YMMB 4B50A 2B39A 4XMKH 4P3CH 1H3TA 1SEBA 1MI5B 1BF8A 2Q76A 3SOBL 3GDBA 4MAYD 2NY3B 3QJHA 3ZE1F 1LWRA 3TVMB 4YLQT 4PV8A 1G6VK 4OB5L 3FB5A 2PW1B 2MHAA 3BP7A 3LKPA 4YHLL 2XTJE 1G7IA 5B4MD 4M5ZH 3MRGA 3PG2A 3ES6B 4IM8A 4J8RA 2IFGA 5KBNC 5E5UB 5M95B 4DEPC 2ZUTA 2EKJA 1MFBH 3NZHL 2WQ8A 5EWIL 1ACYH 1OTSC 2QJDA 4KI5C 1OSPH 4P2CG 3MXVH 1R5IA 4PJ5E 3TBSA 3RU8L 4HG4K 4K7FB 1NBZA 4NDMB 1FYTA 4G6JL 3U6RB 4X7DC 5GS0C 5IV2B 1DSFL 5HYFA 1BIHA 4MJ5B 4WEMB 3SO3B 3AREC 4JPWL 5T33L 1RUAH 3G08A 4U1IB 1NAKH 1JZ8A 3P4MB 3L3HB 4QWWD 1XGUB 1EFQA 2F15A 5I1KH 3PWPD 4PJGA 2YD4A 1A9EB 4MX7B 1CVRA 3EBAA 3CUPB 4Y7MA 5H35A 3AB0C 5JPMB 1F11A 5E4IA 3QNXA 4IS6A 1U3HB 1JMZA 1HI6A 4LMQE 4PS4L 4D0DA 3VXRA 5J89A 2EIZB 3QUYC 4BELD 1WIPA 1I1AB 5FUOL 3EW3B 4WUUB 3HAEB 4BH7A 3BXNB 2EYTA 4F2MB 3QAZB 5EZIL 3NA4A 4YIQB 5TFSL 2NNAB 1X4ZA 2XFXA 4PRHE 5T1KB 3RX7A 4KK6C 1CZ8L 5GZOD 1OM3H 2RFXA 3JV6A 3P9LB 1JZ3A 3PIQB 5DRWA 3S36L 1U8OA 5IB3B 2Q7YA 3IFPA 2R2BB 1GPOH 4P2OD 1IBGL 2DWDA 2DJSA 4NQDE 3BE1L 4QKXB 4CGTA 1S5IL 43C9A 5FV1L 2I25N 4RMWA 4EI5D 4HAFA 1RU9L 2GY7B 2H41A 1SQ2N 4LPCA 1A64A 4UAOC 4PB9L 1TJGH 4U1JB 1EHLH 4YGVA 1FFOA 1Q9OB 3WXVL 4HH8A 2QKIB 5JXAH 1NPUA 2Z8SA 2QLVB 4HIEA 3WLBB 1NBYB 1QRNE 5C08A 3O6LH 3V7AG 5LGJA 1EFXB 3GM0A 2HFTA 3OXSB 2UZIH 2YPLB 3MRKA 3MRRB 1W72H 3R0MA 2PXYB 4B5EA 3W39B 4JGJA 4POZC 2HJKA 3GKWL 3WFEL 3E6HA 4NKQB 4K8RH 1HHKB 3BZFB 2GSIB 4KAQH 2WWKT 5EOCJ 5F9AC 1KIPA 1J05B 2BSSB 5CMAA 5CZVH 3KXFA 3IFLL 3WNKA 4QRPB 4FQQA 1HKLH 5GGRY 3I75B 2ZG2A 4EOWL 4EQ2A 4YBHA 5D1XA 4U1GB 4YXHL 3QDAA 2PN5A 3RDTC 3P4OB 3GEWB 3BQUD 3QNZB 4PJIB 1FL3A 4NFBA 5TDPB 1KJVB 2WINA 3MV8B 4OV6F 2P5EB 5LQBH 1A4JB 3MGTB 5JIPA 3QWOA 5FIEA 1ZLSL 3BZEB 2BOCA 3IDXH 5T1MB 1XF5A 2VE6A 1ADQA 1IC7L 4HMDA 5H2BB 4YPGB 1YY8B 2E5EA 3ORJA 3BKJL 3JV4B 4PRIE 2CK2A 5C09D 1MAJA 2FH8A 2WM0A 1XGTB 1ZEAH 5K9OB 4G7YH 2W07A 4OD3L 1GGBL 1MIML 5IR1A 4J3UA 5CIPB 3U36A 4JFDB 4DGVL 2AV7B 4AZ8A 4CADA 3CFCL 2D03L 2X09A 2OJZL 4Y4KA 3OPZH 1BLNA 3ARDD 3OSKA 4Y4FC 1TZIA 4OCLC 4LGPB 5EOTB 5EO0B 2H6PA 1XGRB 5I8CA 4HS3A 3GSNA 4PJFB 2WV3A 4YBQC 3SJVB 4Y16A 5KVGL 2XXCB 2OMBA 1R5WA 1CDBA 1IFHL 2X4TA 2FL5A 1URLA 3BP5A 5K33A 3P9WB 2J8UB 3DI2B 4W6YB 4OJFH 5KAQF 3FQTA 5JIHA 3X3GH 5LCVH 4KH2A 4I3GA 2DBLL 2FR4A 5GZNC 2IF7A 5HYJB 3CVIH 4PR5B 3RGHA 5DVMA 5BS0E 3KPSA 2B1AH 2WIIB 2J1KA 3LVEA 2EICA 1MCPH 3VWKC 4LBEB 1QYGH 1VGKB 1ZLVK 4X7SL 4ZTOL 4E42A 3HC0B 3CZFA 1MJ7L 2JELH 3D85A 2W65A 3BDXA 4JHAH 3GSOA 4PY8J 2E7LC 1C5DA 4ONGL 1F4HA 4LRNL 1AGBB 4LP5A 1VERA 3HRZA 3GI8L 3FRPG 3FN9A 1VCAA 2IQAA 3H9HA 3NIDF 4LDLB 4A2LA 1MY7A 4IOFD 5GSRA 1EVTC 2FX9L 2J4WH 4LSDA 4NHUA 2IPUK 2ENSA 5T1DH 1NCUA 5E9DD 1XZ0A 3FQNB 4LAQL 4U1LA 5EIIA 4DN3H 1KPRB 1P69B 4XPTH 3UX9B 3SGEH 1GJIA 2XWTA 4HUWB 3BWAB 2P46B 3QEGH 2CLVA 1OPGH 1T2QL 4NRXB 5IB1B 3C8DA 2L0DA 4NO2B 1N6UA 4OSUL 2EYRB 2ZG1A 5B39B 3QDJB 4DUVA 3JVGC 3DXAB 1JYXA 3HUJB 4FQLL 3RWDB 4R26L 5EZJB 3MLUL 4WW2B 1ZLWK 3HE6A 1UWXH 1JPTH 5I1GL 2BJML 2JJSC 5F7NC 1OD7A 5E8EB 3QUYB 1IQDB 3OAUL 4X6EA 4MNQD 4KKAC 2A9ML 3WFBL 5GJTL 1XR9A 4IDLA 1Q38A 1FE8L 3N9GH 3GMQB 1W2KT 5CBEA 4PJBF 5GS1B 1G6RA 3BDYH 4JFEB 5HHVH 4Q7DA 4Q2ZA 1PX3A 3P0VH 5GRYA 5HYSA 1L4IA 4JVWA 1K6QL 2P42B 5KZCB 1GGIL 1TJIH 3CLEH 4JFYA 4LCIH 5K9QG 3B3IA 1C16A 2IFFH 4ZSOB 5GS3A 1BJ1J 5C07D 4OV5B 2VZVA 2Y4SA 3I50H 2F53B 3WIFA 4X6CE 1MLCB 1XGYL 5D93B 2IANA 2NY7L 2XTLA 3BFOA 5I19H 2A6KB 2ZSVB 3QHTC 5F7FA 5C70A 2X1WL 1U93A 5FV2A 1PKOA 4O00A 5HI5C 2DMBA 3WIHL 1JWUB 5L88L 3EJZC 4DOHB 4PJ8D 7FABH 4XMPL 3ZYJA 1CLOH 2H2SC 3B9KD 4MJID 3LKOA 4LVOC 3CXDH 4M1DL 3MNZA 3SY0A 1DL7H 3TBWB 3P77B 3S97C 1U8LA 1R24B 1EAJA 1IT9L 2RGSA 3G5VA 3DV4B 3RDTB 3I6KB 4JFPB 1T66D 3ALXA 3QPXL 1TTGA 3BD4A 1OTUD 2RB8A 3MRNB 4G3YL 4I1NB 5D5MB 2XZQH 4NJ9L 2IBZY 5DZNA 3NH7H 2FJGB 1QLEH 1T3FA 2DRUA 5INCB 3TLRA 1AD9B 2IPUG 4LQFL 2DD8H 4DWHA 1HOCB 1F6FB 5IMOA 3UROR 4QHLB 1FO0L 3OZ9L 4Z7UE 4NKMA 2E6JA 3O6FD 4EI6B 4ODHL 4IRSD 4D2NA 4JM2D 1ZTXH 3HI5L 3WL9A 2NPLX 4Y4FB 3NIFE 4KROD 1A7RH 5AD0A 1CGUA 4S1RH 4YNYB 2W91A 3FTGB 4HW6A 3BEVB 5EPMB 3GJFK 3G5ZA 2I24N 4QEGA 1BAFL 1RHHA 3LPGA 1CG9B 3CCHB 5EUOE 3D69A 2MFNA 1FAIH 1EAPA 3L3DA 4EEEA 3LQAL 5KVDL 2ED9A 3WUZA 3VW3H 1I7RA 2D0GA 4OCWL 1CDJA 3IRZA 3VWKB 4M7KL 2C5DC 1NCAL 4EI5A 4K55A 3UBXG 2X40A 1RI8A 2IAMC 3UEZA 4JO1L 5DSCA 4TRPL 2HYMA 4U6HB 2Y7QA 4MHHI 3S96B 1I1YB 2UY6A 1FZKB 1YEJH 2XTJD 3JTSA 1T1YB 2AXFA 3PP4H 4JY6A 3IJHB 3VFTA 2FWOB 5DQ9A 3F7PC 3NFSL 4MD5A 5DMJB 4LGSB 1QRKA 4L4VB 1EVUA 2VXTH 2FHBA 3ULUL 2AJYL 3QXUA 4GJTB 1SY6A 3FRUA 1CFVH 2WWMD 3K4ZA 3VGEA 1VFOA 2MPAL 3GBMH 4PJDA 3ARPA 1F3RB 1JPFA 5FECB 1LO2L 3FCTA 4JPIA 4S1DC 2AABL 3BUYA 5JMOC 2Q20A 5IW1B 2KL6A 1KYOJ 3QA3A 4PJ5D 1QSED 3PWLA 2X7LB 3WLWC 4F3FA 5BRZE 4OCXL 1M4KA 3D3VE 4OTXH 4QGYA 5I1HL 4XAKD 1JK8B 5F1SA 1CWVA 1MREL 4OZHA 4LHUG 4ELMF 5ANME 5FYJL 1RUKH 2EIEA 5I18L 5JHDD 3HFML 1MCCA 1U8JB 2C1PB 3D39B 1HHIB 4OCRL 3B2VH 3FO9A 4OQ1A 5TF1H 12E8L 2CKNA 4O51A 1XAUA 4QCIA 4O4YL 4Z77B 1MFAL 1HSBB 1N6QH 4NSKA 3DX6B 4PYGA 1MNUL 1G7QA 5C09A 1FNHA 1ZHBA 1DBKH 3RWEB 5GGUB 4HUVA 1NDMB 4GAGL 4N5EC 4S1SH 4F33A 3G5XA 1QP1A 3NFPA 3Q6GH 1INEL 3EOAA 1QHOA 3NGBB 4NZTL 5FGRA 4F8TA 5DHVA 4OZFA 1MFDH 1WZKA 3I3EA 1A6WH 3FO0L 3BKCL 1IGFH 3O8XC 2PYEB 3O9WB 4IMLA 4QTIL 2HVJB 4ZUWA 2C3XA 4NQDD 1AQKH 1ITCA 2P8PA 5KJRL 3MRLA 3U9PH 1M6OB 2PCPB 3MRJA 3TFKD 3PHSA 1HQRA 4HBCH 3VXNA 4QHNB 2DQJL 1A0QH 2D9QB 2CLZA 1UWEL 4Q97A 1OF2B 2OL3A 4M1GL 3ZKQD 4DGYH 3BD3A 1ES0A 4LLDA 4DGIH 4UDTB 1M71B 4OI7A 4JLRB 1BQUA 1QEWA 2Z8RA 1NCCH 3G6DL 3OBAA 2NQCA 5HGDA 3WN5B 4KKBC 4FXGB 5CSZB 4U1MA 3QCTH 2AAVA 5JOFB 2VKXA 1CDIA 2F5AL 4LVOB 2R2HB 3UTQA 2C3GA 1UZ6F 3EYUL 4OZIF 4UTBL 5LG1A 4BZ2L 1AR1C 3ARSA 4WTZG 5J1SC 3THMH 4W68A 1KJMB 2KKQA 4XNUH 2EIDA 4WNQB 2DQDL 3L7FA 2HT3C 3MNVA 3X11B 3L3IB 1Z2KA 2BVOA 1HXMA 5GGQH 2GUOA 3QUXD 4P4KB 3LHPH 3S5LB 5E8OA 5EU5B 2GJZA 3MLZH 1IEAB 3WFCL 4I2XB 5E9DA 1KNOA 3NA9H 4KUCF 2FIRT 1DLFH 5KVEH 1K9TA 1NGZB 3IB4A 3DO7A 1Y0LA 2AJSH 3DJ9A 4ZUUA 4P9HH 2FECI 2DM2A 1QBBA 1W8OA 4MXVF 2P5WA 4KXZH 4ZUSA 4H25A 2MKWA 3I2CH 4ISVA 2R8SL 3E6FA 3MLRH 2WQRA 4P5TC 1MCKA 4P2QE 5SV3A 3KPNB 4NNYA 1KFAH 2KUTA 4QRSA 3Q48A 4Z0XA 1JPSH 3OX8A 3SE4A 4KHXL 3MO1B 4PD4J 1U8KB 2VXUL 5SX5K 4N5UA 4MNQA 5TDNB 3JTTA 3GI9L 3ILPB 2FATL 3VJ6A 1FGNL 1HKFA 2OI9C 3FFCE 2AI0L 4HJGA 3DYOA 2Z4QB 4TTGA 4ZXBD 1NBQA 3L5WB 4I5BB 1F6LL 1OB1B 1PQZB 1H3GA 1ZLWH 3TNNB 1TVBB 4UOW0 1EGJL 3SDCD 4P23C 2ATKA 3DUUA 2GITA 1JV5A 4YUEH 3QCUH 4LF3A 3TIEB 3T65B 2VN4A 4GS7B 4HXAL 5FA4A 4OLYH 4WV1A 4RWYL 5CEZD 4AM0A 3BGFB 5C07A 3T1WA 3TYFB 1A7OL 4NOBA 4IOIB 4WJ5A 4YQXH 3NCBB 5I1DA 5JHLH 4RFEA 5D1QD 2R0KH 1KF9B 5IROC 3RX5A 1OVZA 2X4OA 2V7HB 2VH5L 3QIBB 4BZ1H 3MODH 5TE4H 4NZRL 2BCKB 1HSAB 1IMHC 4Y2DC 3JUZA 3B9KA 3QEHA 1NDGB 3KPRA 5AZ2L 1S7UB 1GIGL 5F7LB 3IETA 3MBED 3ZZ1A 5E2TL 3SE9H 4OF5A 3PL6D 3ZKMD 4RAVB 3LKNA 1N4XH 1EBAA 4MCZA 5FYLL 5I1AA 4LK4A 4OZGA 4PV9B 3UTPE 2UZXB 3W9EB 4UBDD 1D5XA 1H8SA 1T83C 5C0FB 3MLPA 1HINH 5I71C 4GKOA 4TVPD 2EDKA 3L1OL 1SJEB 2AEPL 5IOPB 1LD9B 2HKFL 2VC2L 5I1CH 5CSGA 3ZL4H 1IL1A 1KB9K 1PLGL 5DEGA 3EOTL 3NZ8A 4HCRL 3QXAA 3SQBA 4KMTH 1NEUA 5DA0B 3O6FA 5ADPL 1REIA 1C1EL 4OIIL 4JM2A 4UOW1 2FX7H 4HKZB 2NY4C 3TBYA 3VXMB 5ADOH 2VLRB 1RIHH 3GHEL 4DFHA 5EA0H 4N8CH 3H7BA 3D0LA 1A6ZA 2VLME 5DO2C 4NUGH 1D9KD 2F19H 4P9HC 4TQEH 1CD0A 1D5MB 1DQML 1CF8H 3ETBF 1NFDE 3QDGE 3OMZA 1JHLH 1RPQA 5B38G 4G8EB 3WHE0 5CKGA 2WW8A 1JGDB 3ARBC 2BSED 4KKLC 2BVUA 2VR9A 4YEEA 4WW1A 4GMTH 3TA3B 1BJ1H 1OT2A 2X70A 5ITFB 1EV2E 3SE8L 2ZSWB 4HKBB 1ORSB 3B9VA 1ZS8A 2YD6A 2ZPKH 3MNWB 3B9AA 5E99L 4D9RE 5E2VH 3UO1L 2D31B 3JXAA 5JDSB 3GSQA 1C5CL 4R7DB 2NY0D 3FB6A 2XOTA 5HHMD 1ZVSA 5JPNB 5FDWB 1QFPA 4JPVL 4ETYA 1DVFC 3FOMB 3RVXD 5IHZA 4KY1L 2E27H 1QKZH 5I17B 4DZ8A 4JQXC 3VD9A 4NP4L 4KTDL 3TO2B 1PDKA 5TPWL 1U8QA 4NPYA 4XBEH 1S9VB 4OCNC 3W11C 2IQ9H 1RJYB 4FXKB 3MPCA 4LSSH 2QTEA 3BT2L 1V8HA 3N1MC 4JHWL 4PGZA 1R0AH 1YN6A 2G75B 1H15B 2EKSA 1G7HB 1F42A 3R8QA 3UJTH 3GSUB 5A3ID 5D1XC 4RGMC 5ACZB 4N0UB 1XR8B 1JUFA 3QCVH 3QZWG 3SDAC 2QR0A 3EYOB 4PJ5A 5E8PA 4M1CD 1ULVA 1KCSL 2ATPA 5EN2B 3ARXA 1MJJB 2I5YL 4QHMB 2A6IA 4XPAL 4CUCA 2VZUA 2YBRB 4JFXB 2NX5E 4MQ7A 3ISWA 3QFJE 4XVSH 2EDYA 5FM5O 2ARJQ 3U7WH 3SKOA 4CN6A 1FZMB 4P5TB 2D7NA 4P4RA 5C8JA 5K9KB 2Q86B 3Q1SH 4MDIA 1AGCA 5L6YL 3OKLA 2L7UA 3OAZH 5EDXA 1KEML 4Z6AT 2A73A 4BYHA 1WITA 1QBAA 3AU1B 4NC1C 3RJQB 3VXQB 6FABH 4KVNH 1S7WA 5FGBA 3GNML 2X1PA 1IAMA 1RVFL 3WFHA 2V17L 4Y4KC 4BFIA 4Z18A 4TOYL 1YDPB 5GIRB 2M8XA 1N0XH 1OQOA 2OI9B 4HFUL 4M7JH 4NQEE 1A1NA 3PV6A 5D7KE 1XF2A 4PRHA 4NO3A 2ERJB 2EZ0C 1JYNA 4ZNEE 1HEZA 1MF2H 4I18C 3MLWH 3O11A 4S10A 5KSAC 4W81A 3HHRB 4NQDA 4Y4HB 4CVZB 2XY2A 5DC4B 4HXBL 4XNZC 4JPWH 1J86A 5T33H 1QFWI 4HWUA 4XNXL 2NW2A 2B4CC 3QI9D 4APQA 1XF4A 3CLFH 4YBLB 3TH4T 2R56L 2ZJSL 1NGWA 3HMWH 3MRDA 4YO0A 5EO9A 4PV8B 2AJXH 2MHAB 1QRNA 3BP7B 3MRPA 1CBVL 1TXKA 3Q3GA 2HKHH 1BJMA 1G7IB 1NFIA 3B8SA 2JF1A 2CMRL 4Y1AB 2ICWA 3V2AR 3MRGB 3P11L 4UT9H 2X41A 4J8RB 5DJXA 2LABA 5FUOH 1MELA 3IAPA 4K94H 4N68A 1CXEA 4G8FA 3MA9L 5EZIH 2R23B 3P0GB 4WHCA 2IBGA 2MSPA 3H8NA 4HULB 1S7SA 4FQXC 4H8WC 4LP4A 3PGCA 5J6HB 1R5IB 1RJLA 1KB5L 3TBSB 4JKPH 2HJFA 4WVRA 1NBZB 4M4PA 4BJLA 1T03L 1FYTB 3DO3A 1PY9A 3WFZA 1FIGL 5HHOE 1B4RA 4OM0H 5IMMA 3PF2A 5EIVA 5F6IC 1SBSL 2J6EL 2FLRT 3EDKA 4FZ8L 4A6YA 5D72L 4YXKH 3G08B 5JOPE 3MRCA 4TPRL 3VG0L 3N06B 2BFVH 4DK3A 5C7XL 4R2GD 3WXVH 4PJGB 4HD9A 1SM3H 1LHZA 1FVCA 2CRYA 1IGCH 5H35B 4PJAE 1F11B 4IS6B 1C12A 4PRIA 2BY2A 1HI6B 2IEPA 4UB0H 4D0DB 3VXRB 1ZKAA 1FV1A 3WFEH 4G9FD 1JRHI 2HFGL 1A8JH 4M8QA 2EYTB 1AC0A 2XFXB 5B8CA 1N0LA 5C0RL 4K23H 1JBJA 2ED7A 4PJEE 4TNVK 3BIBX 4WI3A 2BP3A 2RFXB 3JV6B 3RWGA 4JN2A 4X7TA 3LV3A 5DRWB 4HJ0C 1U8OB 2Q7YB 3IFPB 3HPLB 4UIMA 4WI4A 3T4YA 3LEVL 2DWDB 4XTRC 3OF6D 1BECA 3HC4H 2XWBA 4ZXBA 4N1EA 43C9B 3SDCA 1MCSA 4GMSL 1T89C 4XC1H 3GMLA 5SX5H 3GO1H 4FMFA 4WFED 3JWDL 4YGVB 1FFOB 5DA4A 1GZPA 2NY2D 5BS0A 4HIEB 3V9FA 5EU3A 3ULUE 5HHQA 5C08B 3GBLA 5LGJB 3UTSB 4FQHA 1HH9A 3CVHL 1U3YA 2BK8A 3MRKB 4C57C 2F8VA 1QFWL 4MAYC 3E6HB 3B43A 2R4RL 1YQVH 5CP7A 2D03H 1KIPB 3BSZH 4DZBA 5CMAB 3KXFB 3VFVA 2JCCF 1MJ8H 5B4MC 5FOBA 3MUZ1 4FQQB 1JF6A 3QDHA 5D1XB 5B21A 1JGUL 5BCAA 5FO7A 4NQSA 1IC4H 4ZMAT 5IB5A 5HYQA 4NNPH 1AD0A 1FL3B 2QBWA 4XPGL 4POYA 1WCBA 3QWOB 4GO6B 3B2UD 4UNVA 3PL6A 2BOCB 5DEZA 1XF5B 2VE6B 3FKUS 1G9NL 4MZ2A 2ZNWA 5TE7H 3E1F1 4RISL 1KCLA 4YDIL 4QWWC 4ODSL 4P2QD 4XWGH 4Q9RL 5IB4A 4WFHE 3IDYC 2EDTA 4FNLH 5IR1B 4XCEA 3U36B 1DBML 2XQBL 4CADB 3V6FA 3TH3T 3LDBB 4Y4KB 1BLNB 2BHYA 1TZIB 5AUMA 4BKLA 3O45A 5I8CB 4HS3B 5F70A 1XF3A 3FFCD 3GSNB 4NNXB 3JWOH 1BM3L 3KVQA 3DARA 3FOLA 4Y16B 1R5WB 1D9KA 2X4TB 2FL5B 3BP5B 1JRHL 4JKWA 2ICEA 5GZOC 3FQTB 5D6DA 1AY1H 4Z7QE 5C9JA 1KG0A 2FR4B 4PY7A 1ORQA 3LKQA 4P2OC 3KPLB 2OS7A 5I75B 1YEEL 3KPSB 3P73A 3HI6H 3TJEH 4JRXE 4HHAA 4C56D 5F8RC 3TV3L 1G9ML 3U4BL 2CK0H 4JDTH 4EI5C 5E2WH 3GIZL 4HEME 4E42B 3UYRL 1HNGA 4X6CA 5F7EH 3UZVB 3CZFB 4D8PA 2AEQL 2BRRL 2W65B 3D85B 3O2DA 3IVKA 3GSOB 1D5BA 1MEXL 3JUYA 4P48A 2RBLA 4RSVA 1C5DB 3WFDH 2HWZH 2Y06H 2YOCA 3CFDA 3Q6FA 4I13B 3HRZB 4PBXA 1A02N 3NTCH 3AGVA 1A6UL 2IQAB 3H9HB 3SKJL 5GSRB 1KEGL 2VDML 2E8ZA 4NHUB 1AI1H 2YD1A 3MOQA 1H3VA 4JVUA 2D4FA 4KPHL 1VESA 1XZ0B 1ERNA 4U1LB 3V4UL 5EIIB 4LASL 1B0RA 1AC6A 5F6IB 1IEHA 1U3JA 1N2RA 2XWTB 5CGMA 4QLRA 3EFDL 2CLVB 4HZLA 4XHJD 2YR3A 3BQUC 1WAAE 5KS9E 3UTPD 1HNFA 3QG6A 3GIVA 4K71C 4RBPH 4Y5XA 4LCCA 5F71A 5D71L 4MWFB 1RUPH 3MOBH 1BZQK 1QPPA 4X7CC 4TYUA 3F7YA 3GMOA 3HE6B 5FCUH 4Z7UA 5IESH 4FQ1H 3B9DA 3IDGA 1MQKL 3IDIA 2A77H 3NOIA 1ZLUK 5EU4A 2JKXA 1K3IA 1XR9B 1CLYH 3EZ8A 3U1SH 1CFBA 4PTUA 5CBEB 3FB8A 4ODXA 3P30L 1NMBL 1G6RB 3BMVA 2YSSA 5FK9A 1IT9H 2XV6B 3ARDC 3FMGL 3KJ4C 4LU5H 1ND0A 3F62A 5ALCL 4Q2ZB 5I15H 4OD2A 4G42A 4U6XA 5HYSB 3BEWA 1X9QA 2XRAL 3O0RH 4XC3L 3HNVH 4G3YH 5EUOA 3CMOL 2P49B 3B3IB 1C16B 2G5RA 4KZDL 4EBQL 3QUKA 3VFPB 5SWSD 4YC2C 4YX2H 4D9RD 1OQXA 1P6AB 3GMRB 1JWMA 3WIFB 5D7LB 4JM4L 4LQFH 2IANB 1Q94A 2AV1A 5I66B 3QWQB 2WBJA 1RIUL 3C5ZD 4ERSL 3BMWA 3JWOC 4LOUC 3QI9A 3I85A 1U93B 1UM5L 1FFQA 2R0WL 4E9LA 1ZXQA 2W9EL 1GL4B 3T3PF 3VH8G 2B2XH 4JQVA 4CVUA 2EIBA 5E08H 3LKOB 3MLXL 3MNZB 3SY0B 3AC0A 3S9DB 4Y8DC 1U8LB 1MCWW 4PP2A 2VN7A 2FJFB 1WTGT 3G5VB 1N5AA 4HDIA 1TTFA 4DKEL 5C1MB 3NABH 1BAFH 3EHBD 3CZJA 1DANT 5J13C 3OAYK 3OG4B 4IOFC 4UU9A 5BRZA 4ONFH 4L9LA 3GJFA 1BBDL 2DF3A 2FBJL 3D3VA 4QGTA 2JB5L 1I9RL 1ZA6A 3S35X 3U83A 4EZMA 1T3FB 5ANMA 4FQ2L 5GGVY 3T2NL 4OCWH 1N7MH 4M7KH 3QFJD 3H3PH 1V05A 4DKFL 3KHQA 2GCYA 2Y25A 1YPZE 5IMOB 1TNMA 5C0DA 1RIVL 4NRZA 1F4XL 3HTLX 5K59E 4NKMB 4P5KA 1KCKA 3RKDD 2O5ZL 3BWUC 3O3EA 4UDUA 4WTZA 3WL9B 1HCVA 5MHSE 2H26A 3ZKXC 3UDWC 1K2DA 3S4SG 4XMLH 1DBBL 1LO2H 5D7KD 3G5ZB 3IXAA 1RHHB 4E5XA 4GG6E 1V7MH 4N9OB 5BQ7B 4OCYH 5L2JA 1FCGA 4Y88A 2FX8L 5ACMA 3D69B 1TZGL 5I1HH 3ARGC 4R4FH 3MV9B 3RKPA 4QT5A 1EAPB 3L3DB 1AO7E 4GLRI 3V6OE 1EJOH 3DI3B 3HC3L 1I7RB 4L8SA 2VDPH 2EEBA 2Z35A 3KR3L 2VUYA 1PG7W 2K1MA 3WXWL 1G7MB 4XP6H 4EI5B 4OCRH 3T3ME 12E8H 2X89A 2CJUL 2P48B 2RJMA 4KJYA 3T08A 1HZHH 5H37H 5IFHH 2APVA 2BNRE 5DSCB 3SDDA 3QDME 2Y7QB 2HT2D 3ZE2E 3Q5YA 2PO6D 4QRRE 2YKLH 1MNUH 1VPOH 4JY6B 5DQ9B 2HFFA 4L8BA 4MD5B 5FYKL 4LSRH 1DEDA 3U30B 2DQFA 3MV7E 15C8H 2NY3D 3FRUB 1VKXA 4LIQH 4PREB 4PJDB 1KLGA 2OTUA 1JPFB 3FCTB 1UB6A 4JPIB 4NZTH 3BUYB 4PJ8C 3B9KC 5EOQL 1CXHA 1BOGA 3QA3B 2FD6L 3PWLB 4RAHA 4F3FB 4FA8A 1ZGLM 2J8HA 2LU7A 1QR1A 4OZHB 3BZDA 4U0RC 1QR4A 1T66C 3DHMA 1MY5A 3E2HC 5KVMC 1NCBL 3MJ6A 4Q0XL 4NM8L 3LRHA 1P4BL 5JOPD 1OTUC 4JG1H 5IVOA 5A2IH 2DQJH 2IGFH 1RZJL 4O51B 4U6VL 1UYWH 1OWRM 2I60L 1L7TL 4QCIB 1HWGB 4JFFE 3MRQA 4GBXA 2AK1H 5DK3A 4NSKB 2P47B 1RZFH 1B4JL 4WY7H 1DBAH 1G7QB 4LLAA 5C09B 1ZHBB 4P2QA 4HUVB 1F90L 3D25B 4F33B 3MMEA 4HS8L 3G5XB 3KHOA 2FBOJ 3NFPB 2E8YA 2I27N 3O6FC 3EOAB 5I8OL 4IRSC 4OZGF 4X5LA 4JM2C 4RFNC 1DEEA 3MJ9H 5DHVB 3BHBA 3CC5A 3F7VA 4OZFB 1YNLL 4BZ2H 1AXTL 3KJ4B 4KROC 2XZZA 2XN9E 1U3HD 4JB9H 3WIIL 3TPKA 4IMLB 4Z7VE 5L7XH 4ZUWB 1BP3B 1H3UA 3FFCA 1I1AD 3RRQA 2W0PA 1G84A 2CKBA 2P8PB 3MRLB 5T1KD 3MRJB 3UPRB 3ZTNL 1LO0L 1HQRB 3VXNB 1K8IA 4IMKC 4JM2F 4NRYA 2CLZB 2OL3B 5JLZA 5A2KH 2NMSA 3PGDA 1FNSL 1ES0B 3EDJA 4LLDB 2BSRA 1A5FH 1QEWB 4HUNB 2P1YA 4RIRA 3LH2L 1U8HA 4NQVA 2WUBL 1CR9L 4GT7A 1EHAA 1X5HA 3QJFA 5I1IL 1D5ZA 3S36X 4POUB 4HPYL 4XPFL 2XTJC 3OQ3B 2BVTA 2X5PA 1T20B 1EFXD 2DQCL 2Y5EA 5A2LH 5I8EA 2WSKA 2FHFA 2J2ZA 1EO8H 5IW6B 1I1RA 3L7FB 2WWMC 5C2BL 1IGJA 5F96L 1KN2H 2BVOB 1HXMB 3V0WH 3QQ3A 5E8OB 5LGHH 2GJZB 4D9LH 4QRPD 5JORA 5E9DB 1KNOB 4GAJH 4Z7NE 1J0JA 1WLHA 4EUPA 3DO7B 1Y0LB 3REWA 3OKEA 3BESR 2EE6A 4NQUA 2E9JA 4RWYH 4ZUUB 1T21A 4H1LG 1HYSD 4KK9D 2P5WB 5KW9L 4H25B 4CMMA 3P3YA 4ISVB 3E6FB 4ZFZA 5GS2D 2R29H 3VU2A 5DFWH 4FZEL 2KZWA 2BVQA 4DCQA 4NNYB 1U91A 2XPGB 1DUYA 1RHFA 4QRSB 4YHIA 1JF5A 5JR1H 3SDYL 4GAYA 4Z0XB 1KN4L 3U9UA 3PDOA 4MNGE 3ZDYF 4MNQB 3JTTB 1UJTA 3VJ6B 4HJGB 4P3WA 3L6FA 1KJ3H 2N4IA 3ECBA 5CEZH 3F6LA 4JFDD 2VDOL 3DRQA 5J12C 1NFDA 4M6OL 3QDGA 3MRHA 2ATKB 3DUUB 2GITB 1JV5B 4JRYE 5E2TH 1KBGL 4MA8L 4J4PA 4LF3B 4LSPH 2Z0BA 2YD5A 2DL2A 4PGDA 1WIOA 4JRXD 5FYLH 1MSPA 5ID1A 5FA4B 2ZCHL 4PRNA 4WV1B 4U7KA 1J1XL 1DQDL 3KPPA 4ZO6A 4AM0B 5C07B 3LQZA 4KUZH 3TFKC 5JW4Q 1FNGA 3WJJA 4IRJD 2VL4A 2X4RA 5DGRA 2YMXH 5AYUL 2VC2H 2H8PA 3C5ZA 4RFEB 5J06A 1Q9LA 5DUMH 2YUXA 1WBXA 2X4OB 4OCSL 4BFBD 2G5BA 4Z7OE 4FP8H 5JMRA 2BC4A 1AQDA 1NSNH 5ADPH 3A6OA 2F58L 1KUMA 3ZSSA 4RNRA 3ZDZE 3LS5H 3B9KB 3WD5H 3QUZA 2YPVL 4Z7WE 3S6CA 3SKUD 3QEHB 4FHBD 3DVGA 2YC1A 3KPRB 4J3TA 2X4UA 2F9BT 3DRTA 4NT6A 5LAXA 4N0YH 2FEDD 1RD6A 5DT1H 5CJQL 1QPXA 4JDZA 3IETB 5CJ8A 4TVPH 4ZOCA 3WO4B 3LKNB 1F2XK 1MAKA 3F7QA 4MCZB 1QTYT 1VGEH 2A74B 5I1AB 3QUXC 1WFNA 3HRPA 1OAKL 3F8UB 5JUEL 5DJYA 5D2LF 4PJCE 3SGDH 4B0MM 1D5XB 2NX5A 1E6JH 4PG9B 1MFEL 4OFKA 3QFJA 1QLRA 4BSWA 4F58L 3OAYH 3QRGH 3BIKA 1JHTA 1IL1B 1X5XA 1PZUB 1MCHA 4JAMA 3NZ8B 5JIKA 2PTTA 2VLLA 2FHCA 3QXAB 3CFEA 1CU4H 3O6FB 4J3WA 1GAFH 5T3XL 3QDJD 3QHZH 4JM2B 1YQ2A 1BQHG 4RFNB 3DXAD 3VFGH 3TBYB 4OCMC 1JPST 1RFDH 2Q87A 1GGYA 3D0LB 1A6ZB 2OZ4H 5B8CC 5I16A 4JHWH 5MENE 3T2OA 4NQEA 5C0GA 4JZJA 5GS0L 4XP9L 4TTDD 1PG7H 2CLRA 3S3PA 5J8OA 5HBBA 1FFPA 4ZNEA 1YZZA 2LQRA 3NCJH 3VMOA 1WQVT 4S1QL 4LRIA 2VXSH 4WW1B 4ZXBC 2EDHA 2X70B 3WNLA 4LEXH 3IAQA 3SDCC 4JFED 1ZS8B 1QFWM 4R90H 4DTGL 4MQTB 3MJ7A 1Y6MR 5C6WH 2DQTL 3GSQB 3WIHA 2WBWB 3FB6B 2CUIA 4ZS7L 2VZOA 1ZVSB 3S3SA 5KZCD 5IHZB 5TGBA 2IWGA 3D6GA 4M62L 3QISA 3BD5A 4DZ8B 1E4KC 4PUBH 3CSBA 4GRWH 2PO6A 2FDBP 2XTJB 3KYMA 1H5BA 1KJ2H 4HGKC 1U8QB 4NPYB 4HWBH 5D1QC 2VUOA 5GRUH 1VFUA 1XF1A 2F54E 5EBGA 2EKSB 1ZANH 3LS4L 3Q2CA 1AE6L 1JUFB 1F4YL 2QR0B 4RGNE 4PJ5B 4XBPA 5C0NC 1MWAH 5E8PB 1UT9A 5HHOA 1OP5K 2ATPB 5CKAA 2GJ6E 4WENB 2CD0A 1CDHA 2A6IB 5IHBA 1FBIL 3MBEC 4U49A 4MQ7B 1FO0A 3ZKMC 5DD1L 3ULSA 4U1KA 4J12A 4KRLB 3O2VL 2OK0L 5C0EA 3HLAA 2R4SH 2YXFA 3SKOB 4P4RB 4H1LH 3TT3H 5CFHA 4MDIB 1AGCB 4NDMA 3OKLB 3U6RA 4PJAA 1SVZA 4UBDC 1OP3K 2A73B 4QXTA 3C08L 1S7WB 5MHSD 5EB9A 3WFHB 4K9EC 4P3CL 4XCFH 3ROOA 4JZNA 4BFIB 5T5NG 2W59A 2HLFD 5DJ0A 3RZCD 1A1NB 1LO5B 3PV6B 5K9JL 4HWEH 1XF2B 4PRHB 3MV11 5JPMA 4LSUL 4PJEA 5E03A 1HEZB 3ARRA 5J12B 4RQQA 1UFUA 4GXVH 1RZGA 4M5ZL 3UTZA 3OXRA 1YEHH 1UEMA 5E8DH 1OLLA 4NQDB 3W5NA 5IT2H 2MTPA 3HAEA 5MERA 3A6BH 1D5IH 3EUUA 4XT1C 2PUQT 1MFBL 2NW2B 2ZG3A 4G43A 1HHHA 5T1KA 4HLJA 1ACYL 3TGXA 5C3LD 4LPUA 2JB6B 3HA0A 5CD5D 4APQB 1XF4B 3FQUA 1OSPL 4OUUA 3MXVL 1WIUA 2MJWA 3QDMD 1NGWB 3MRDB 4OF7A 4YO0B 5IG7B 5EO9B 3TH2T 4ODUB 2R69H 5JXEA 3QIWA 1UXSA 2Y5TA 3RNKA 2V5TA 1QRNB 3MRPB 4O9HH 1R6VA 3Q3GB 3VD7A 2MQ3A 1NFIB 2NY0C 1MVFA 1RUAL 2ICWB 1NAKL 3RVXC 3BW9A 5DJXB 2G60H 3T0EE 5I1KL 5BV7B 4G8FB 1QSFE 3SKNA 3TEUA 3WKMH 1S7SB 3IKKA 3PGCB 4KRPB 2OXGA 3CJJA 4ETQA 1RJLB 4ORZC 4NO0D 2HJFB 3UC0H 4XRCB 1BQSA 1G1YA 3LEVH 1F45A 4MDJA 5E2UH 2EDOA 2JIXD 5IMMB 5HI4D 3T0WA 1HHKA 3CDYA 1B2WH 5A3IC 6CGTA 1P84K 4A6YB 2EXWD 2DWEA 4AYFA 4PFEA 3RUGF 4FOMA 1A7QH 2YN3A 3MRCB 1O7SA 4KV5F 4M1CC 3STBA 5DD0H 1OM3L 4JFFD 4C58B 2NZIA 2VDKH 1FVCB 1GPOL 4LCCC 3U79A 5IVNA 1D6VH 5D4QA 4M4RA 1F4AA 1LDPH 1C12B 4PRIB 1Y6KR 4M5YH 3D39D 2BVPA 4HK0A 3UTTE 5ICYA 1I1FA 1P1ZA 1FV1B 4PJXF 3D2UA 3BH9A 2Y9RT 4GRWF 5DJ6A 2C4FT 1TJGL 2DM7A 5D7IE 4M8QB 1EHLL 1M1SA 2ID5A 5JXAL 5B8CB 4N1CA 3R1GH 5EBMA 4RMSA 2VSDA 1QA9A 3RWGB 1IAIM 2UZIL 3LV3B 4JN2B 4OLZL 4X7TB 1T7VA 1W72L 4MD0A 4NN6C 1DDHA 4UIMB 3T4YB 2VOTA 1J88A 2XWBB 4K8RL 4ZXBB 4KAQL 2Z8VC 5J1TC 1PEWA 3SDCB 5GRVL 5CZVL 3ET9F 2AS5M 5EOTA 3SGEI 3KPTA 4HUUA 3GMLB 2EDXA 3V8CA 1HKLL 2PYED 4FN0A 1VENA 1G9NH 1IM9A 3A67H 4HEPG 1GZPB 5FYKE 5BS0B 5GRJH 4JRXA 4XVTH 5EU3B 5JW3H 5HHQB 5EC2A 1DQQA 1M05A 4G6MH 3FFDA 4FQHB 4YDIH 1HH9B 4PPTA 4ODSH 3U0WH 3AM8C 4Z95L 3QI9C 1EZVX 4WEBH 1B88A 2BVYA 4Q9RH 1GGUA 1ONQA 4IRJA 4P99A 4GRLA 1UCTA 1DBMH 5FA3A 1OAUH 5CP7B 5EUOF 3IDXL 4DZBB 4R6UA 4MA7H 4YHZL 4MS8D 3CSGA 5HY9A 3VFVB 5FOBB 1MIEH 1NJ9A 5I1JH 3UTSE 5TH2A 4K7PH 1E4JA 4Z9KB 2KZ1B 1ZEAL 5FO7B 4NQSB 1F3JA 5IB5B 2RAMA 5HYQB 3I02A 3QBTB 1TQCC 3SDXE 3VI3E 3CX5K 3OPZL 3WKNA 3GM8A 4L9LC 1WCBB 1ITBB 1F13A 3PL6B 5CINH 5ESVA 3CFKA 4UT6H 4PJ7F 4QTHA 1WAAA 4ZFOL 5KS9A 3TV3H 3U4BH 3HE7A 4KMLB 2C1OA 4P4KD 3O6ML 2DQEH 1OW0A 2HAZA 2YA1A 4XP1H 4OJFL 3ULVD 3VH8A 3X3GL 2AEQH 3DSNA 4R2GC 2ITDA 2EDLA 5LCVL 3UYPA 5KOVC 2L4OA 3ROLA 4XCEB 2DMKA 2UYLA 3CVIL 1TITA 1ZSDB 3V6FB 1UM4H 1UACH 1UKQA 4FQCH 2B1AL 1T5XA 5AUMB 4KDWA 2VZ1A 1QYGL 1J8HE 3O45B 5DK0A 3V5HA 3WNNA 1GCFA 2GTWA 1KTRL 1EGJA 3QDJA 5GGVL 5I9QB 3N85H 4OGXH 1XF3B 3DXAA 3SKJH 2JELL 3FOLB 1FSKC 1UA6L 3EDFA 4TUKL 2VDMH 1D9KB 4L4TE 2EE3A 2DI8A 4GXUN 5EIQA 2GHWB 5C9JB 1KG0B 3VD4A 1U2CA 3E3QC 4PY7B 1ORQB 3LKQB 2J88H 3P73B 3BPOC 1LP9E 4Q6IA 1RUML 4HHAB 5E00A 3LRGA 4WEUD 3AAZA 2J4WL 5I1EH 1SMAA 2CQVA 4X6CB 5T1DL 1MCQA 4D8PB 1EO5A 1VFBA 4DN3L 3IVKB 2NY0B 2NY2C 2H32H 1D5BB 2D7PA 5CP3A 4OLVH 4GG8A 3P9MA 3QEGL 1OPGL 1H3XA 1DUZA 2CH8A 3CFDB 3Q6FB 3VRJA 1CI5A 1B6DA 1SJXA 4AG4H 1F4WH 1UM6H 4L4JA 4OI9A 3TN0B 1CE6A 2OP4H 4LVNC 3WE6A 4I0CC 4XWOD 3NPSC 2A6KA 3WS6C 3NFNA 3MUJA 1JPTL 3NIGE 5DI8A 1E4XH 4C55A 3QIBD 1RULH 5L0QC 4KDTA 1B0RB 3KLAA 2XRAH 3KWWA 4YDVA 4QF1A 1ZGLA 4NZUH 2XA3A 5DRZA 3TPUA 2C3VA 4YZFF 4ZUTA 3N9GL 4HZLB 3QQ4A 4KJQD 1VEPA 3QG6B 5FHBH 3GIVB 1YNKH 3BDYL 4Y5XB 5HHVL 1A7BA 3B2UC 5KTEH 3D48R 4OD1H 4HCRA 5ID0A 3P0VL 2MCPL 1DBJH 4FG6D 1KC5L 5EULV 3F7YB 3GMOB 2V9TA 5I6XC 3SGJA 1YPZA 1B9ZA 5DFVD 1NMAH 1TJIL 3CLEL 4LCIL 1DQLH 2MQ0A 4Z7UB 2W38A 1OP5H 2IFFL 3IDIB 4X6DE 3RNQA 3I50L 5EU4B 3AUVA 4PGCB 1GVIA 2FGZA 5IBTL 4F15B 3BJ91 4K3HA 4PTUB 2C3WA 3FB8B 4ODXB 4F7PA 1I7UA 5I19L 2YSSB 5FK9B 5MEND 4M61A 5HGAA 1ND0B 3FT3A 1AHWA 4OT1H 3RZCA 4OD2B 4G42B 1MH5A 4U6XB 3H3BC 4N8VA 2QSCH 3BEWB 1TQBC 2N1KA 7FABL 4GG6A 2FSEA 4V2CB 1CLOL 5BZDA 3V5KA 1WT5C 3CXHJ 2VLRD 3HKFA 4EXPX 3CXDL 1FAKT 3QUKB 4OAWA 5DMIH 1DL7L 1AO7A 3V6OA 5KSBE 4YNYA 1OARH 5D6CA 4FQ2H 2VJXA 2HFEA 1JWMB 2BMKA 3RAJH 3IFOA 4GQ9L 4FTVE 3VMNA 4HPOH 3WO3B 1Q94B 2I07A 2AV1B 4DKFH 5L9DH 1K5NA 3TM6A 2WBJB 3V8OA 3QQ9D 4DN4L 3QI9B 4BM7A 3TA3D 5E1HB 1FLTX 2BNRA 3MROA 4KRNA 3QDMA 5KANG 5CCKH 2XZQL 4PGEA 2YD7A 5CJXA 3NH7L 2YUZA 1QLEL 1WV7T 1R3KB 1ACZA 2Y1VA 4JKMA 3O3BB 1FPTH 2N7BA 1BIIA 2DD8L 3MV7A 1MLBA 2WUCH 3DHJA 1H0DA 4PP2B 5T5NF 3ARUA 1N5AB 4HDIB 3O3UN 1CK0H 4MQXD 5EH1A 1TQCB 3CFJA 2W0KA 4RGND 3ZLQC 4U3CA 5BRZB 3TNMA 4L9LB 3VGHA 3GJFB 3D3VB 4NO0A 1A7RL 4W70A 3HZYA 3G6JF 1KT2A 4S1RL 5I0ZA 1ZA6B 3UMTA 3MR9A 5F89B 2JIXA 5ANMB 2IPKA 5F7DA 4CVXA 2AK4E 5K9QI 1X6LA 1DP0A 1F00I 2GCYB 3O4LE 4XHJC 5T3XE 5GQBA 2DYPA 4NFDA 5C0DB 4R2GB 4JFFA 4NRZB 4WFGD 4HUMB 1NAMH 1FAIL 5DQJA 4P5KB 4CW1A 1CQKA 3VW3L 2E7BA 4G6FB 3O3EB 4UDUB 3K46A 5F1IA 4P9MH 3T77A 1VHPA 3D39A 2H26B 2VO5A 1K2DB 2JJWA 2OTWA 5JQ6L 1JGEA 1ZOXA 1WICA 4X9H