3O41A

Crystal structure of 101f fab bound to 15-mer peptide epitope
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
217
Chain Sequence
b'QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARLYGFTYGFAYWGQGTLVTVSAAKTTPPSVYPLAPGSANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mouse monoclonal antibody 101F Fab light chain
publication title Structure of a Major Antigenic Site on the Respiratory Syncytial Virus Fusion Glycoprotein in Complex with Neutralizing Antibody 101F.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/viral protein
total genus 39
structure length 217
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o41A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o41A01
5H2BB 3QA3B 4TSAL 2NY1B 2DQUH 1EFXB 1RZGA 2FB4H 2ZP0T 3I6KA 2D7NA 3EOBA 4QGYA 3WUWA 1XGQB 2X4SA 3U0PA 4Z8FL 4ZYKB 5FUCE 2ICEA 5E7FA 4MA7L 5HDLA 4PUBL 4NO2A 1AGDB 3IFNH 4KJQD 4JKPL 3MYZA 2J8UB 4JN1L 5E2WH 3B9KD 2F5AH 4NQCE 2GSGA 1CFQA 1BZ7B 4X6EB 1A6WL 4JPVH 2PO6B 2DL9A 2GJ6D 5BOZG 1TLKA 5IKCB 3JWDH 4EI5D 1KLGA 2NNAB 4BFEA 4ZXBB 1C08A 4N0YL 5T1LB 3UAJD 4FFZL 3OPZL 4D0CB 4CVXB 1N8ZB 3AGVA 4ALAH 5F72S 1CK0H 4WNQB 4Z78A 3FFCD 1INDH 1F3RB 2ORBH 1I8KB 4LPVA 5HPMA 2X4UB 25C8L 3D3VE 3UPCA 3B8SA 3O9WA 3TNNA 4XXDA 4XAWH 5IB3B 1WBXB 3BPNB 3TV3L 1OP5H 1XF2A 2SEBA 1BQSA 2FJFA 3DJ9A 8CGTA 1NL0L 5T33H 4WHTA 1ZMYA 1YQVH 1IJ9A 1I85C 3QQ4B 4AQOA 4LBEB 3RFZC 1F42A 2DBLH 1N4XH 2FL5B 4QXUL 4NKQB 1WIUA 1UB6B 1CT8B 1BVLA 1YEKH 1L7TL 2EYSA 1F90H 5SX5K 4R4BA 4HWBL 4P4RA 2C4FU 3U0TA 4YHYB 1T66D 3CSYB 4M62H 4K55A 1XH3B 3VGHA 2R56L 2YC1A 3AROA 4HAFA 2O93L 4OF8A 3H3PL 5DVKA 1DLFL 4FFWC 1WTGT 1NGWA 1TJIL 1MIMH 2EIZA 3WCYA 4V2CB 4B0MM 3QZWA 5E08L 2EC8A 3MRRB 2Z31D 2OLDA 1SEQL 2KL6A 4HMCA 4HF5H 4ZO9A 5J12C 1F6AB 1SJHB 3F58L 3C5ZB 2GUOA 1DSFH 3FOMB 5I8OH 4OD1H 3MZGB 5T3ZE 1L7IL 1AR1C 2UWEA 4U6HB 4OSUL 5T1MB 1JYWA 2CD0A 1G7MA 3CK0L 5DD5H 1U3ZA 4CU6A 4JJHA 1IQDB 1ES0B 3GSUB 4MWFB 5I19L 4RFEA 3V9FA 3OAYH 4MDIA 2J8HA 4YJZL 1A7PL 4XCNA 3QUKB 1LD9B 2HRLA 3AVEA 5HYJA 5FYLE 4OCSL 4DTGH 5JOPD 5CINL 4KK6C 5CJBA 4KHTL 4MZ3A 4BSVA 2AJXH 1CBVH 4XBGA 4FFYL 2XQBL 1S7WA 1R0AL 1Q9OB 1JPGB 1A9EA 4R3SA 4OF7A 3N0PB 5JW4N 4RX4A 4RGOH 3NN8B 5GRJL 2IFGA 3BKYL 3U1SH 2DWDA 4LF3A 1FNGB 2EDKA 4CDHA 3VFRB 5A2KH 1HKLH 4U1SA 1PBYA 2OR8A 3UTSB 1D5ZB 3FQTB 2CDEA 4L1DA 1VEPA 2XTJC 3U4BL 1AI1L 2DB8A 5GS1C 1Q9WA 4RFOL 1F4YH 3C8HA 1M7DA 5DO2C 1QRND 2AK4B 1GZPA 1DBKH 4HFUL 4MA3B 2CLVB 4CMHC 5IVZB 3MV8A 1SY6A 2D7TH 4P9HC 1ZHLA 1I9RL 3SGEH 4BUHA 3PQYE 4JZJC 1DVFA 1FYTB 3MACL 3QH3B 4FNLL 2VXTL 4MAYC 3KPMA 1S5IL 4JRYA 1HXMA 4QRPE 5E9DA 4YDKL 5DUMH 5JIPA 4H1LA 4YPGA 3HNVL 2VDQH 5DDHA 3DRQA 4LHUG 4LLVB 1A1NA 4Z7VE 3NCMA 3QFJE 5CKGA 3TM6A 4K71C 4ZODA 3AU1B 3F8UB 3ARBB 5HVHB 3C08L 1IKFL 2F53E 3RWJB 1CF8L 4KVNH 4JO2L 3CXHJ 2W38A 4U4BA 4WU5B 2LVCA 4O02L 5KSAD 4LLDB 3BWAB 5C08A 3TZVC 2DQHH 4GG6B 2NY7L 3OJDA 4LAJH 1TZIB 1LNUA 3IDMB 2I07B 5I1CH 5I8CB 1N3NA 5DC4B 4G9DA 1NFDB 2FJGB 2DOCA 1J0HA 1FNHA 1IGCH 3GMLA 3IS0X 5MP6H 4JO1L 2X4OB 1SBSL 2H6PB 3VCLB 1X5ZA 1DANU 4IHOB 4R0LB 5GJSH 4U6YB 1UYWL 4HEPG 5FA3B 3HE6A 4CJ0A 1J0YA 2K3TA 4K94H 2YMXL 3D39A 4RSVA 1OAUH 4MNGE 3GUTB 1B2WL 3V79C 1F4AA 5C6TH 2PTTA 4ZDHA 1S7RB 5DRWB 2UWEF 3MRLA 4CRPA 4N8CL 2HA1A 4ODBD 3LDBC 5F8QC 3SDCD 3QFDB 4HX1A 4ETQB 4R4FL 1OOAA 4PJGA 4ZUUB 4LNVA 2OI9B 5DYOA 4W6XB 1ZEAL 2WQRA 4KWUA 4OCXL 4HUNB 5B21A 5F7UA 1FRGH 1S7UA 2WWMD 4D3CL 4D9QE 1IKNC 3EYVA 3JV6B 1MJ8H 1XF5A 4NKDB 4G6FB 4G5ZL 2X89A 2EDJA 3QR2A 3MCKA 1MCOH 3EDFA 2Y7QB 1ZHBB 4YIQA 1BEYL 3VXTB 4EJ1C 2CH8A 3IU4L 4QF1B 1W0YT 5JHDB 2BSRB 3IGAA 1CD0A 5FCUH 2A9MH 1F13A 1OARH 5DRNB 3P73A 1FNEA 2XKNA 3AM8C 3EO0B 2GITB 1MFCH 1FL5A 4J6RH 5C71A 3KYNA 5J6GA 2JELL 4PGCB 1KBGL 3DVIA 4EDXB 5SV4A 2EYRB 3D69B 2VABA 2R29H 5IMMB 1EEQA 4NRZB 4CAGA 3BKJH 4ZTPL 1DR9A 2HJKA 3HPLB 2W65B 1UXSB 4NBXB 4P9HL 4LEOB 4JY4A 3RWEB 3GJFA 3S8WA 1KB9J 1PQZB 4QRQB 1JZ8A 3WE6B 3T1WA 2OXGA 1KENH 2IPKA 4JFYA 1I1AC 1OAZH 2I9LA 1DQQA 3L3OB 3KLDA 5I2IB 3D3VA 4CNIA 3WNMA 4YDIH 2ZUWA 3PWPE 1HCVA 1KN4H 4KRPB 2DDQL 5EC1A 4I3SL 3OMZA 4LHUD 1A7QL 4QEGA 3IAQA 2W60A 4W70A 2F19H 5IBTL 1N6UA 4YHPA 4W4OC 2HRPH 3QUZA 4KZDL 5ICZA 3EGSA 2OK0H 1A5FH 2J12B 3W0WB 5D1ZA 4RFNC 5JQHC 2KQNA 4KTEL 4Y4KC 5A3IC 3MXVL 4I77L 1K5NA 4TSCL 3W39B 3KPSD 3MROB 4DVRL 1A6UL 1HYSC 2VKWA 5I30H 4OCWL 2PCPB 5FO7A 1HEZB 3D2UA 5A16B 4HFWB 1V7NH 1ZT4B 1A3RH 1YNLL 4BYHA 2G5BB 2J8UE 2J3SA 4BFBD 5EOCH 4JRXD 3INUH 5CHNA 3B6SA 5ENWA 3DSFL 4NN7B 2AJUL 3MGTA 3V6OA 1FNSH 5CBAB 3WNOA 4UIKH 2A74B 1MVUA 1J1XL 3MV11 1KNOB 2JK5A 3ARSA 1YUHB 1FV1B 4J3TA 5F7YC 1RUPH 3HR5A 5L7XH 2R0ZL 4RDQF 4LU5L 3S35X 3ZE1E 3M8OL 5BRZD 3F5WB 5A2LH 2AI0L 1IT9L 3S98A 3E6FB 3FOLB 4WW2B 4XPTL 2B1AH 2YPLE 5JLZB 4OD3L 3THMH 4GG8A 1DQDH 3L3IA 3LS5H 1CXEA 3C2AL 3JXAA 5C86A 4XB8A 4M5ZH 1YY8B 3HC4H 5C0CD 4GAJH 1NJ9A 1TQBB 5DD1L 5EDXA 4PLOB 2ZKHL 5F71A 3SE3C 1D6VL 5DMJB 4PGDB 5BZWB 3VWJD 3MNZA 4UI2A 1OF2B 5KZCB 1LEGA 2B5IC 3FFDB 5GIRA 4LAQL 5HVWA 4FQHB 4XCEB 2DN7A 5L6YH 3I02A 5FYKH 3JBG7 4XBEL 5A2IH 5CIPA 4R90H 2X7LB 4K3HA 4JFFB 2C7UA 5E4EC 5DHVA 4FQIH 1QYGL 5IQ7H 1UXWB 1WIOA 4NUJB 1CIUA 2QQLH 4LCUB 3GSVB 3S37L 1ZS8A 2DI9A 1CS6A 5F9DC 3VFSA 5L88L 3MLZH 2ZOKA 1HOCA 1AQKH 3HZMB 3NFPB 3PQYA 5DMKB 1QSEB 2YOCA 1MJUL 4WI7A 4HAGA 2AJVL 2DM4A 4WFGD 1X7QA 3V0WL 2BRQA 4P2YA 4QRPA 3RWHB 1F00I 3DX9B 3BP5B 5E2TL 1F11B 4OLEA 4CW1B 3UBXI 1GRWA 3L7EB 3E2HB 3X17A 1D5MA 3QPQC 4DGVH 3IFOB 9CGTA 1IL1B 4Z7VA 2RGSA 3QFJA 4L29A 4MJIB 1X6LA 4KRLB 3I9GH 5EN2A 4Z77B 1MRCL 2GT9B 5CEXA 1XAUA 1WEJH 3QYCA 1A22B 3TVMA 2X70A 2F53A 1INEL 3I84A 4DKFL 1HDMA 4GJTB 4U7KA 3VGBA 5TH2B 4GAFB 5F7DA 2MQCA 3UTSE 1SM3H 4D9LH 5DFWH 1NEZB 3ARGA 4YFLI 3LKOA 3DX8B 4NZUH 1XCTA 2BRRH 3ZE0E 3UAJC 3UBXG 3HRPA 3O3EA 3HAEA 3N1GC 2V17L 1A6PA 4XP4H 5DZOA 1YEJL 1KIRB 5F1NB 5D7JC 4DQOL 3WN5C 2VOTA 2QKIB 4PGZA 4Z0BL 4KAQH 4MNGA 5HJ3B 3PWUB 4I0PB 3CC5B 1FGVH 4HWNA 5CMAA 4TVPD 3DMMA 2APXA 1XGRA 5ACMA 4WI4A 4RMRA 1GGYA 1AKJD 4X6BA 1FYTE 1MCKA 1X5KA 4L9DA 3VFGH 1BOGB 1TCRA 3OKKA 4RMSA 5E5UB 4HBCL 3RNQB 1T66C 5HHME 2GSIA 2VYRE 3T2NL 1AGFB 4HC1L 4LPCA 3S36X 1S8DA 4LRIC 4YDLC 3D1MC 5H35A 2VLRB 1LDPL 2A1WL 4LLUB 1MAMH 2I60L 3IDNB 3KPOB 4RISL 3VXQA 3QIWA 1IGFL 2KBGA 3MLVL 3VD3A 1PD6A 3OAZH 3CMOH 3DV6B 2ZUSA 1SVCP 4GG6E 4P99A 4FABL 5EBMB 1XF4B 4F7PB 3T0XA 3MRMA 2FX7H 4DGYL 1D6EB 2Q6WA 3QEHB 2Y5EA 3O8XA 4JKMA 4YE4L 4YGVB 2P8LA 4G3YH 4QRRB 12E8H 4ZUWA 1R3LA 1WLHA 2VE6A 1E6JH 4DK6A 4Z7NE 4JQIL 5JUEH 3OSKA 1I1FA 4JPIB 4KRMB 3VFNB 2VWEE 2DYPD 1CE6A 5C0IA 1LO4H 4XPAH 2VDRL 2I9TB 3MCLH 2MQ0A 4HUUA 4DGIH 3MC0A 2EDEA 4JZOA 5I75C 3PP3H 4ERSL 1IARB 3L3DA 1ZTXH 5TF1L 1CDGA 1AXTL 4PRNA 4MQSB 3SDDD 3PWPA 2AQ1A 5E5RB 1KLUA 1VFBB 1BQHB 3B8YA 2AEPH 2W92A 3A67H 1KTDA 4FQ1L 4Z7VF 2DS4A 4OD2B 2B39A 5SWSD 1ZE3C 2ZWLT 2NY6D 1KYOJ 2C3VA 3O2VL 1HSBA 2WINA 4B7LA 1U8JB 2N7AA 1RZ7H 4XVSL 5J12B 3RPIB 2BXYA 5H2BA 5C2BL 2B2XH 5KVEL 3QA3A 2FHBA 4PB9H 1EFXA 1YEEL 3LV3B 3ZO0A 5JHDE 1XGQA 4GKNB 3MTRA 4LOUD 3OKYA 1LO3L 3N1FC 4UTAL 4ZYKA 4IRZL 1A47A 3GBNL 2GIYA 4RMTA 5IR1B 1KCVL 1CLYH 1UH3A 5DMYA 4Y4FC 1AGDA 3ESUF 2D7QA 2J8UA 3LKRB 1TFHA 2VZOA 5D9SA 1A14H 1BZ7A 1KCRL 4X6EA 3EAKA 1KG0B 3CU1A 5IKCA 4FTVB 5EZIL 2NNAA 4ZXBA 1NAML 2VTFA 3ULVC 4JG1L 5T1LA 3DHJA 4D0CA 4N9GB 4CVXA 1N8ZA 3CVHH 1R3IH 2YWZA 4N90E 4P46C 4WNQA 4OV5A 4QGTA 1V8HA 4KZEL 1I8KA 3SJVE 1I4FB 1UCTA 3F7QA 3FO0H 2X4UA 5KOMC 3QWQB 4TTDD 1KJMB 3T1FA 3G6AB 3UTZB 2UYLB 5EPMB 5IB3A 1WBXA 2XNAB 2NCMA 2IJ0C 43CAB 3OZ9L 5D2NC 2XTJB 4NQDD 5D8JH 4K2UH 5F7WC 5GS1B 2GFBB 4XP5H 4JM4H 4LBEA 1BGXL 2FL5A 3SQBA 1EPFA 4QHKJ 1BJMA 1UB6A 1CT8A 3TH4T 3VFUB 4NZDA 2ARWA 3B43A 3D9AL 5TE7L 1NBVH 4CMHB 4Z7WB 5IBUB 3OL2A 3CSYA 5FOJA 3FRUA 1XH3A 4R9HA 5J3HD 5FM5M 3D85B 4NO3B 4UU9B 2P24B 4PLJC 4LIQL 2NXYC 4S2SB 4MA8L 4JZJB 4R4ND 1KJ3H 2FX8H 3FN3A 1MCWW 1KCLA 2VLME 4KJWD 4M5YH 2EEBA 4MAYB 2W9DH 5T3XH 4U1GC 4Y1AD 1E27B 2Z9TA 4WO4D 2ESVB 4CN6A 4F33B 1CL7H 2ZUQC 3MRRA 4FXLA 5CEZE 5F6HI 3B2VL 1PX4A 1IEAB 4K71B 3FMGH 5L9DH 4ZO8A 2VDLH 5HI3D 1SJHA 3C5ZA 3V4UL 2YUZA 2ZG1A 3FOMA 4NWTL 1I3GL 2FDBP 4U6HA 2GYSA 4XNXH 1J8HD 5CP3A 5T1MA 3TZVB 1U8PB 1JPFB 1OPGL 3CX5K 1AR2A 1IQDA 1ES0A 3GSUA 3GEWB 4MWFA 4F15C 4RBPH 1EAPB 1BJ8A 2BMKA 3CFDB 2H26B 4LCCC 5E6ZA 2VXVH 2Y1VA 4DZ8B 1WWWX 2Z35B 3I6LE 4KC3B 5DA0B 1ZKAA 1IGJB 3NMEA 5F9AC 1BFOB 2QHRH 3BKMH 4KK5D 5EOTB 5FUOL 1M7IB 3OGCB 1Q9OA 2V5SA 5HGDB 3FO1B 5H37G 5IROA 3NN8A 1MCPL 5I18L 1R3HB 1ORQA 1FNGA 3LDBB 2DD8L 3ROLB 2R0KH 3UTSA 3IF1B 1D5ZA 3HUJB 3FQTA 1X4ZA 4DVBB 2K7PA 5HGAB 4F7TB 1KELH 3H0TB 3QG7L 2VDKH 2J8UF 4MJ5B 5SWZD 4G42A 1Q72H 1LWRA 2FR4B 5HYIA 1RIUH 3LQAC 3ULVL 3KS0H 4Z5RB 4JFFE 3WUWG 4E42B 3BQUC 1K6QL 2PR4L 2VN4A 1HHKB 4G8GD 4MA3A 1KJ2L 2AEIT 2CLVA 2EE9A 5IVZA 2XG4A 4HPOL 5HDOA 3TYGL 4IRJC 3EIFA 4GXVH 1NCAL 3ZYJA 4FFVC 3EDJA 1MELA 4PJEB 1SHMA 2WMPA 3C9NB 4ZOBA 1YQ2A 3Q0HA 1QSEE 5J9PB 1FYTA 3V7MA 2ERJC 2P1YA 3QH3A 5EOQL 5J8OA 5DT1H 3BXNB 3MRCA 3ZE1F 4KTDH 4OFPA 2XWBB 4TOYL 3BE1H 2R2HB 4M93C 5FFLA 2GK2A 4TNVF 4NUGH 4LLVA 3RBGA 3BEWA 4PB0L 4MJIE 3QIUD 5ID0B 4F57H 3AU1A 1KEGH 3ARBA 1QNZL 3RWJA 5EORH 4IBLT 4LSUH 1F2QA 4WU5A 3MRHB 4LLDA 3BWAA 5A43C 4LP5A 4JPWL 3BMWA 3VFTB 4GG6A 2YR3A 3IDMA 3CFIC 2I07A 1I1AB 1JF5A 5KJRL 2NW2B 5I6XC 5I8CA 5LBSH 1NFDA 2FJGA 4NJAH 5JXEC 4GKOA 4KJPC 2X4OA 3BSZL 3DRTB 1RU9L 1HSAB 2H6PA 2CK0H 4OFKA 3VCLA 1OWWA 4G7YH 4IHOA 1RZJH 4U6YA 1VA9A 5EA0L 2BSED 5FA3A 2FBOJ 4LGSB 2R1YB 3V6ZB 1MHEB 4UT7L 4YHOL 3MLWH 1YC8A 3BRDA 3GUTA 3BRGC 1AHWC 1YN6B 5DRWA 1EGJH 1XIWD 1IQWH 1N0LA 4Y4KB 3EO1A 3QFDA 4ETQA 2R4SL 3TCLB 4UV4H 3CAFA 1T2QL 4ZUUA 1Z0NA 3C60D 4WUUB 3QZWG 2YZ8A 3FT3B 1EEUA 1MCSA 3B2UD 3TNMB 3H9HB 2NXZC 5E4IA 3SGEI 2YPVL 3GJEA 2VMFA 3JV6A 2WUBH 5DI8B 4FZ8H 2A2QT 4NKDA 2VLRE 5CJQL 3VXUE 3MOAH 5DF0A 5ESAB 1F58L 4NM8H 3F7PC 4G6MH 4JFED 2Q20A 4XBPA 5C6WH 2Y7QA 5F21B 1ZHBA 3VXTA 1NUFA 1NCBL 1FO0H 4QF1A 4NZRL 3T4YB 1IC4H 5JHDA 2BSRA 4EIGB 4KHXL 2BK8A 4OQ1A 5GSVB 4ZFOL 3QUYD 1AQDA 2HH0H 2XWTB 4YXHH 4X7FC 4DUXA 5DRNA 1BBJB 4F7MB 3EO0A 3LQAL 2GITA 2XG5A 4NCC2 4M7ZC 3ZE0F 4D94A 3K80A 5ACZB 4QRRE 4PGCA 3PGDB 2X40A 2EYRA 3D69A 5I8EB 4UUJB 1NLBH 5IMMA 2V2TA 5C07B 3HFML 3GI9L 2W65A 1V7MH 5CP7B 1UXSA 5D4QA 4LEOA 4LDEB 1UM5H 3HRZB 4KUCF 1TJGL 1WCBB 1RZIB 5K9QI 1PG7X 1CE1H 1EH9A 1PQZA 4G6JH 1WTLA 3SJVA 2D31B 5I2IA 4R26H 1MHCB 4OQTH 2AEWA 6FABH 1FVCA 5DHXB 1T7VA 2BOCB 2VXQH 3JWOC 3WIHH 3I6GA 1BWMA 3G5YB 2B5IB 4Y7MA 3M07A 5D2LB 5IF0B 4OJFH 5JHLL 5IWLC 2YXMA 5FYKU 4R2GD 3P9LB 4KXZI 2X1OA 3Q6GL 3WXWH 2Y4SA 5B3NA 3F7VB 1M1SA 1XGPB 3MV9E 1XGYL 3C2SA 4I9WE 4M6OL 5E4EB 1D5IL 2BVOA 3O9WD 3VD9A 2JJUA 2IADB 5ALBL 4DN4H 1KB5H 5DJYB 2I26N 4GG6F 3W39A 4H1LG 3MROA 1DN0B 1QA9B 5E8OB 1FAIH 4A6YH 3VJ6A 1MNUL 2PCPA 1HEZA 5A16A 4HFWA 3QCUH 1ZT4A 5FHAH 3BX7C 1D9KC 4ONHB 1L6ZA 4J3UA 1QOKA 2G5BA 3L5HA 1AH1A 2PTUA 4S11A 1YY9D 1KXVC 3P9WB 1RY7B 4XP1L 1GZQB 4Z7NF 5CBAA 5TDNB 3LN4B 1JJUA 2A74A 3MBEC 4XPHL 3MRFA 5FV2A 4RWHA 5EU3B 2IGFL 4GMSL 2C26A 3HCVA 5LCVL 4JFPB 1FV1A 4FG6D 4QYOB 5DWUL 1VFUA 2CKNA 3BRFA 4YBQD 4HHAB 1D5BB 2JB5H 3QDGB 5CZKA 1HK6A 2XTJE 3F5WA 2FO4B 1Z0MA 3E6FA 3FOLA 1FFRA 1MRFH 4WW2A 3ARPA 3MFGB 3FFCB 2X41A 3NPZB 1KCKA 1X5JA 4AY0A 1LK2B 2VLJB 4OGYL 1JHKH 5D7JB 3WN5B 4M1DL 3TT1L 4RDQG 4Z7WE 5IK3B 5LAXA 5I73C 3MLRL 4PLKD 3K4AA 4PGDA 5BZWA 3VRLE 1P5UA 5HYJD 1CQKA 5KVMC 1NAMB 4XVTL 1OF2A 4KMTL 5GGTL 1Q0YL 2UUDK 1LHZA 3FFDA 4FQHA 3GKWL 4XCEA 3EDDA 2ESVE 2X5PA 4RX4D 4L4VB 2Z8SA 2X7LA 1DE4B 4JFFA 4YDLB 5L2KB 3SDDC 1UXWA 4F8QA 1RK1B 2X4NA 4NUJA 4E0RB 2FECI 1PSKH 4LCUA 3GSVA 3JWOL 1MIEH 2O61B 2V5TA 3NFPA 3HZMA 2CIIB 2NY6C 5DMKA 1QSEA 5FYJE 4HWBA 1VPOL 4C4KT 5EUOB 1A7RH 2AJSL 2OBGA 3ISWA 3RWHA 2YRLA 4LPWA 4XC3L 3DX9A 1OT2A 2GQHA 3BP5A 3SHSA 2HT3D 4YQXL 1F11A 4CW1A 2R8SL 5TPWH 1J88A 4P57B 2P4AB 3IFOA 2O5ZH 1IL1A 4LRNH 4OV6F 4MJIA 2VLLB 4P23C 1CR9L 4X7TA 1Z9MA 5MERB 2UZXB 4Z77A 1DVFD 2YKLL 3HMXH 1OW0A 4AEIH 1JRHH 4HXBL 1Z9LA 2VDPL 3PNWA 1RZ8B 2YK1H 5GSRB 1X5AA 3ZKSD 4JRYD 4XCFH 5FGCE 5E9DD 1ZGLB 4OM1H 5IT2L 3BYTA 3GFUA 3RHWF 5TH2A 1UC6A 3MJ9L 5I75B 4ODTH 4TVPL 1NEZA 1EJOH 1CVRA 5LGHL 5J13C 3DX8A 2XZAH 3LIZH 4O9HH 1DBMH 2HKFH 2J4WL 5AZ2L 5KTEL 2WW8A 1U8HB 2AW2A 2E9WA 3RVVD 3WDHA 1KIRA 4NKIH 5C08D 3HTLX 3SQOL 3ZL4H 4TTDC 2DQJH 2ADJB 5F1NA 1BPVA 4LSRH 1P9MA 3X14A 4QRTB 1U8QB 5DRZA 3AREC 2QKIA 3L9RB 4GQPH 2VQ1B 2BVEA 1QUNA 2BDNH 3D87B 4Q58C 3PWUA 4I0PA 5HJ3A 1NSNH 3CC5A 4NGHH 4OLVL 4NHCH 4PJEE 2X1QA 1HCFX 3UEZA 1JTOA 3I50L 3UX9B 4PY8I 1QHPA 3O41B 1G6RH 5IVXB 4OGAD 1BOGA 4JZNB 1P4BL 4NRXB 1YYMH 2YRZA 3RNQA 1TXKA 1WBZB 1IM3B 1MCNA 2O5XL 1AGFA 2IBGA 4OIIH 2VLRA 4LLUA 3MQIA 1RMFL 3RJDA 2YUVA 3IDNA 3KPOA 1SJVA 3EYQC 2RJMA 4YX2L 2K9UA 3QXUA 2EKSA 3EZJB 3LZFL 3DV6A 3V4PH 1CN4A 4I18C 5BS0B 4WO4C 1S3KL 1A7OL 5DJ2B 4QHMB 5D7KE 4LPXA 1VGEH 5EBMA 4TRPL 2H2PD 1XF4A 3JWNC 4F7PA 1KJ2B 3I2CH 2OS7A 1D6EA 2BXZA 1JGUL 3QUXC 4EZMA 2X89D 3QEHA 2WLYA 3U48A 2GKIA 5D2NB 4YGVA 1N7MH 4HUMB 4QRRA 3QQ9D 4XP9L 1BJ1H 1EHLL 1N64L 3O11B 4PRHB 1I85A 4LLWA 5BCAA 5TDOB 4S1SL 3I3BA 3VFNA 3IT8D 4XCCL 1GIGH 2EXYD 2I9TA 3ES6B 3QAZC 5J6HB 4P5TC 4JFZH 5IOPB 3MBXH 3MA9L 3ARYA 2NXYB 3PWLB 2R23B 4NQCD 4WUUE 1HQRA 1VB9A 1OQXA 2XY1A 4ODVH 1UM4H 3ULUC 1VFBA 2NY4D 1BQHA 4NQEB 1EXUB 1VERA 1WUNT 4ZD3L 4U1GB 4V1DB 5GXBB 5HHXL 4OD2A 2XYCA 3LOWA 2LAGB 2ZUQB 3MV9A 2BHZA 1KOAA 2QLVB 3AAZB 4GRWH 1IILE 2VL5B 5CGYD 3D3VD 5FUZH 1U8JA 5CZVH 5HHOB 3GI8L 3QJHB 1NMBH 4M7LH 3RPIA 3BT2L 1K2DB 5C0AE 1JGLL 3WSQL 3NIFE 3LV3A 5EWIL 4GKNA 2B0SH 1OB1B 4I2XB 2NY0D 3MLUL 3K1DA 3LSOB 3WFHB 1G0DA 5TFSH 5IR1A 1MQKL 2DLEA 4XC1L 3L1OH 4F15B 3JV5A 4M6NL 1RFDH 5I1EL 3QUZD 4IDLA 1WZKA 4LCCB 1JNJA 2NW3B 4ZOEA 3S35L 5TE6L 3FN9A 5FM8A 4OTXH 3UYRH 4UDUA 4ZMAT 5KVDL 1JNHB 1KG0A 1OAKH 1UWXH 2A6JA 4QXGH 3QNYB 4FTVA 5ITBL 4BFIA 4XHJC 4P49A 1DBAH 3D2UD 4ONGH 3LKSB 4N9GA 1CLOH 3LD8C 1A7NL 3QQ3A 5BQ7B 4HIXH 5IW3A 4JFXB 1I4FA 1MY7A 4ZFFB 1WWBX 4JFQB 3K7UA 4MCZB 2CJUH 3G6AA 3UTZA 3HAEG 2UYLA 4UAOC 4DK3A 3O2DL 3NFNB 1F5WA 2XNAA 3RWDB 2ZPKL 43CAA 4LKCB 1EO8L 1N59B 5GS1A 4K8RC 3NCYS 1YPZB 4ZFOB 2GFBA 3N1QC 2Q8BL 1P84K 1JFQL 5T3ZD 4LHQB 3B5HA 3VFUA 3UDWC 4HCRA 3UO1L 4XP6H 5JO5B 4Z7WA 4YWGL 2X4RB 4IRJB 4ZUVB 3GSNH 3D85A 3VA6A 3LPWA 4NO3A 4UU9A 4S2SA 5FYLD 4JZJA 4B50A 5KVGH 5KOVC 4TYUA 4XRCB 2ERJB 4MAYA 2IPUK 5JA8B 1S7SB 1V3LA 3VW3L 5ALCH 2DJSA 1OAXL 3QWOA 1TDQA 4PJCB 1E27A 2ESVA 5ESQB 4NNPH 4M93B 4F33A 3K8LA 1JN6B 2FZ3B 1IEAA 2IH3B 3CZJA 1RUAH 2AXFB 4I4WB 3ARDD 1LEKB 2CIKB 5HBBA 1KGCE 1NCCL 3LRHA 4LMQI 5DUPL 5J1AA 4L3AA 3WXVH 3WO3B 1RUKL 4MNHB 3TZVA 4GT7A 1INQB 3V5HB 3ULUL 1U8PA 1JPFA 4G7VH 4JQVC 4LASH 1I9EA 1EAPA 5I6XB 3CFDA 2H26A 3QDGE 3CX5J 5IG7B 4QWWC 5ADOL 3P11H 4DZ8A 1HHGB 3U7AA 1QRKA 2Z35A 4HXAL 4K23L 5DMIH 4YH6A 2OJZL 1X44A 1ODAA 2C9AA 2OMBA 5C7XH 2ZZUT 1IGJA 3FAWA 5KSBB 2IALB 3RUGB 5A1AA 1LEIB 2MSPA 4JAMB 2VLJE 5EOTA 3PQYD 3TLRA 2LU7A 1M7IA 5DJ8B 2V5RA 3NGBC 1W72L 5HGDA 1JNNH 2MMXA 3FO1A 5C09B 3OAUL 3CDGB 4QRPD 1AHWB 5GS0D 3V8OA 1R3HA 3QG6B 1DEEB 3NA4A 1X4XA 1OD7A 3TBSB 5IB1B 4FQJL 3ROLA 3IF1A 1WFTA 3QFJD 3HUJA 1AJ7L 2HJFB 3ZDYE 4Y4HC 1HZHL 2XKSA 3MRGB 4F7TA 3H0TA 5ISZB 2QV2A 4I8DA 3TVMD 3NA9H 1QSFE 3HR6A 4MJ5A 2NXZB 2F53D 3TT3L 2I24N 4Q9RL 2P44B 3Q5OA 2FR4A 1OAQH 1IKNA 3RKPA 4L4VE 4Z5RA 5EZOL 1W2KT 5L2KE 1U8OB 4E42A 1UZ8B 4BQ9A 3S36L 1HHKA 5TE4L 4MXVE 2ZCKH 5KW9L 3ARGD 2FJHB 1CL7I 2JTDA 1P69B 2ED8A 1CFVH 4PJEA 3C9NA 3ZYOA 4LLYB 5J9PA 4K8RL 5EUOE 2VLKE 3G08B 4J3WA 4MNQB 3QJFB 2DLFH 4K7PH 4MHHI 1I7TB 4TUKH 3AM8A 5ADPL 4Q9CA 2R2HA 4LLAA 4M7ZB 3O0RL 2V5YA 3E8UL 1RHFA 3CLFL 3MOBL 2VDOL 4QOKB 3UJTH 5ID0A 2Z93B 4POUB 7FABL 3PHSA 3QPXL 1TZGH 2C4FT 4RMQA 5FKPB 5I1AB 5INDA 1MFDL 1FL6B 3SDXB 4PJAE 4ZS6D 4MQXD 3MRIB 2JJSC 3KPLB 3S4SB 4Z7WF 2XTLA 2PW1B 3MRHA 1ZLWH 5LQBL 3TA3C 3VRLF 3VFTA 1GCFA 1X3DA 3TO2B 3CU7A 2R0LL 4D9QD 4ODUB 1BQLH 1I1AA 2BP3A 3GJFK 3DI3B 4ZQKB 4HIHB 3QXDB 4AMKH 3DRTA 3G5XB 2FB4L 5CJOH 4XPFH 1HSAA 3QIWD 2XRAH 1F8TH 4AT6B 1UM6L 4TN9A 1N0XL 2R1YA 3V6ZA 1MHEA 3CGTA 3DECA 3GHBL 4JDZB 3IFNL 4W4OA 4PD4K 5CIPH 3EYOB 3WBDA 1Z2KA 4ELME 5DHVH 1MRDL 3WNPA 1YN6A 5EZJB 3H9ZA 2LV4A 1K4DB 5M95B 2DIBA 4Y4KA 3ZTJH 3O8XD 35C8H 3VFPB 4FXKB 4JPVL 1I9IH 3QXTA 1HHJB 4XI5C 4WUUA 4ODXB 1VGKB 3FT3A 2IAMC 2HYMA 3TNMA 4JLRB 2BVYA 3H9HA 1HIML 3TH2T 3F12B 1D9KB 4WHCA 4JDVA 4ALAL 1CK0L 2YBRB 2ORBL 1ZLUH 5DI8A 1XZ0B 3QCVH 2VISB 1D5XB 1PX3A 2JLLA 1S7TB 2C5DC 2EDRA 3HI5H 4OFIA 4UILH 3G6DL 4JREC 3RL1B 5JTWA 3QSKB 5BS0E 3MBEB 3PWPD 5T33L 3ULVE 2VXUH 1QBLH 3RP1A 4X9FA 1FAKT 3T4YA 2UVFA 4OF5A 2HT2D 1JBJA 1N4XL 2CGRL 2NY2D 5GSVA 2XWTA 3PABB 4KVCH 1YEKL 2BNUB 1F90L 3ARFC 3PL6D 3PHOA 4F7MA 5DGRA 4XMPL 1OGTB 5ACZA 3NCBB 3X13B 4MAUH 5I8EA 2NY1D 4PRHE 4UUJA 5AYQA 1EFXD 2ZCLH 3QNXA 4MXWH 1IRAY 3MGAA 5C07A 5HI4D 1NCNA 3O6MH 3HRZA 4GSDH 1JZ5A 1RZIA 1KEMH 1YJDC 1MIML 4UZGA 2HT3C 4HC1A 3WLWD 4ZO6A 3V0VB 2OP4H 2EECA 4MX7B 4PJEF 3SE3A 5I73B 1TCMA 2YD7A 5J56B 2D31A 1B9ZA 3DVFA 4K7FB 3ZKQD 1MHCA 4PRDB 5CZXC 1PW3A 2CKBL 3BUYB 2GI7A 2BOCA 3BDBA 4HF5L 4PG2C 4M4PA 1OHQA 5I8OL 4HD9A 5I1IL 5D2LA 3SBWC 5IF0A 4HUVB 4NQEE 3HMWL 3MV7E 4LDLB 3H7LA 4V1DE 3P9LA 4K94C 4J7RA 5T1LD 4EXPX 2JJWA 3F7VA 5DD5L 1XGPA 2QSCH 5JW5B 1ETZB 1Q0XH 1VHPA 1C12B 3SDDB 5HHOE 4WFEE 2IADA 5KVFL 5KSUB 5DJYA 3JUYA 1LO5B 4I2XE 4DTGL 1DN0A 1QA9A 4N0FB 5CJXC 2NX5B 3TJEH 2AJXL 1OTTC 5SWSB 2NY6B 5CD5C 5D7SH 5CFHA 2MCPH 1KN2H 2YPLD 2E7LC 4ONHA 4BH7B 1DANT 4UB0L 3LB6D 2E27H 2X2YA 1RK0B 3MMEB 2WWKT 2UZIH 1HKLL 1GZQA 3BP6B 4P23B 3OKDB 5TDNA 3T0EC 1W0VB 4YXLH 5EBLB 1BECA 5EU3A 5J57B 3QHFH 4Z7UB 1F4YL 4JFPA 4HULB 4QYOA 5I15L 2B4CH 4YK4C 2PXYC 4HHAA 3CIQA 3BAEH 4NNXA 1P4IL 1D5BA 2YA0A 3BN9D 3QDGA 3SKJH 5J13B 3PDOB 2FO4A 3C5ZD 1QACA 1YPZE 1HH6B 5DVLA 2H2PC 5D1QD 5A40E 4X98B 2IC2A 4BELD 1LK2A 4L8DB 2VLJA 5D7JA 1U58B 1GOHA 4M7JH 3WN5A 4BK5A 3RZCC 3AREB 3C09C 5DUML 2FH6A 2VDQL 5IK3A 2YD4A 4KMQA 3NIFF 1AIFB 5LWYH 3QQ9C 1WC7B 3L5XL 5BJTB 4KI5E 3FO2B 1CDIA 1NAMA 3V6BR 2EXYC 1DP0A 4F80A 4AEHH 2B20A 4KVNL 3JTTB 4PJCE 3L7FB 1YJDL 1IM9B 1NBYB 5I1CL 5J06A 4L4VA 4JY5H 4LRIA 5L2KA 1CDBA 4ZUTA 4OLWH 3AC0A 1IGCL 3TJHD 1RK1A 1KCUL 3UTSD 5GHWH 3K2UH 4E0RA 1M4KA 1VEMA 1HHHA 5A2JH 5E70A 1IE5A 4I18B 4Y1AB 4WO4B 5F70A 3V4VH 2O61A 2EZ0C 2CIIA 1UADC 5EUOA 4K94L 3VU2A 5GZOD 2ATKB 2Y6SD 3NCEB 3IXTB 3QUXB 5C6TL 2DMKA 4KUCD 3DHMA 4ORGB 4LSPH 5CD3B 4P57A 4D9RE 3DROB 1JGVL 4GH7B 5HHNB 5CGTA 2PYEE 5KSBE 2VLLA 4OZFB 2N56A 3U0WH 3ULSB 2R0WL 5MERA 1ZGLP 4YR6B 3S34H 4HK3N 1FYTD 3VG0H 5GSRA 1RZ8A 4LSQL 1FRGL 5C09E 3QAZB 5JIIA 3DYPA 1N5YL 4R96B 5HD8C 3T2OA 4NNYA 4P5TB 2IWGA 3K8KA 5HHMD 1J10A 1OAYH 3VD5A 1TZHB 1CD8A 2H1PH 3OQ3B 3PHQB 4FA8A 1MCOL 1NKRA 3PIQB 1Q1JH 4MS8D 5ISZE 5F6HJ 3Q48A 4PG9A 2OR9L 4ONOA 5DS8B 1U8HA 1KFAL 4YLQT 2BHUA 5FHBH 3NCJH 5FKAB 3BJLA 5FCUL 2Q1EA 3REVB 2A9ML 2ADJA 4Q6IC 3GM0A 1OARL 3ILQD 4QRTA 1U8QA 4XWOD 3L9RA 3BVNA 1H0DB 2VQ1A 4J6RL 1CIDA 2GAZB 4ELMA 4JCMA 4HBQA 4H0IA 1NANI 2R29L 5SWZB 3BKJL 1W72B 3A6BL 4MNQE 2FWOB 2P7TB 4ZUSB 3O41A 4M61B 5IVXA 4QO1A 4JZNA 2UY7A 1A0QL 4Y4FA 4NRXA 2VO5A 1EK3A 1GGIH 4WHDA 4XVUD 1WBZA 5DC9B 5DLML 1KENL 4BZ1L 1ED3B 1IM3A 2UZYB 1OAZL 3UTTB 4QOKE 2VR4A 2OJEB 4RQQB 4XPBH 5E2UH 1LO2H 1MCHA 3T3PE 4YDIL 2YN3A 3H3BC 1U3YA 5FB8B 4BSWB 4MB3A 1KN4L 1PZUB 2R9HD 2FYYB 5BS0A 3P3YA 3DVNB 4KQ4H 2F19L 5DJ2A 4P46A 4QHMA 3LD8B 4HH9B 1VACB 1PG7L 1QLEH 3FJTA 4OI9A 1JRHI 2HRPL 2H41A 5T5NF 2CXGA 5EBGA 3ARDC 1SMAA 4G6FD 1OM3H 2BVPB 4C56B 4YNYB 1KUMA 1UA6H 2CPCA 1HINL 1MFEH 5DUBB 3O11A 4PRHA 4YHZL 4C58B 5TDOA 5JHDD 5E2VH 4S1QH 5FA4B 4U6VH 5C3TA 2X1PA 1V7NL 4MXVF 4TNVK 4QKXB 1A3RL 1YECH 3LAFA 3ES6A 2VNCA 1TVHB 1QO3B 1I1YB 2Z8WC 4TQEH 4GS7B 2FECL 5EOCL 5GS2D 3INUL 5IV2B 5J6HA 3IJHB 1DL7H 4KKCD 5AYUH 2OX5A 1UB5B 3SKUD 5EUOF 2R23A 3P9MB 1P2CB 4UIKL 5F7NC 4NQEA 4V1DA 4UOJA 5T1DH 5D72H 4YBHA 4GW5B 4CVZB 4X6DB 5L7XL 4N90D 1Q9KB 3F6LA 3AAZA 3SJVD 1WZMA 1X9QA 2VZVA 2VL5A 4PJAF 4F7CB 5HHOA 3QJHA 5CJ8A 4KKAC 1K2DA 1TJHH 1WVZA 2HLAA 5JW3H 2G9HB 4KRPD 4OCYH 2VR9A 2B1AL 1OB1A 2HFTA 4I2XA 3THML 4BKLB 3LS5L 3LSOA 3WFHA 4AYFA 4NJ9L 4M5ZL 1REIA 3IFLH 3HC4L 2WUCH 3W2DH 4LCCA 1G9EA 1FFQA 1T6VN 2NW3A 1C1EH 1FGNH 2APWA 1F3DJ 1ONQA 1JNHA 4LCIL 4BJLA 3QNYA 4GOSA 1EZVY 3DNKA 4OUOA 2Q8AH 1MCRA 5EG6C 3NGBB 4F7EB 4ELMF 3DARA 2VLMD 1NEZG 3KWWB 3LKSA 3CFKB 5L6YL 5FYKL 5BQ7A 4JFXA 4ZFFA 5LJYH 1QR1B 4PGBB 2XA8L 4R90L 2V7HB 4MCZA 1QBML 1WZ1L 3GGWB 4FQIL 3CSBA 5IQ7L 3NFNA 3CMGA 5CEZD 3RWDA 2ZUTA 2QQLL 2AABH 1TPXC 4LKCA 3TESA 1N59A 3B9EA 4G80B 4Y4HB 3UTPE 1KLFA 4P0DA 1YPZA 3MLZL 4ZFOA 2XXCB 1KT2B 1JE6A 3RVXC 2HWZH 2GJZB 3HHRB 1P84J 1DFBH 2CMRL 3SE9L 3BQUA 4JDTH 4HS3B 5JO5A 1CDCA 5F3BB 3ULVF 2ZUUA 3ZYZA 4IRJA 4DGVL 2H3NB 3I3EA 4ZUVA 4XMLH 4R2GB 3EFDL 2NX5E 2K1MA 3EOTH 3I6LD 3ABZA 3I9GL 4X9HA 3F6IA 2DQCH 4XRCA 1WEJL 3Q6FB 3QB7C 1S7SA 5F9JB 3H9YA 1B88A 4PJCA 5ESQA 2CKBB 1JN6A 2FZ3A 1NQBA 1SM3L 2IH3A 1S78C 1PJ9A 2AXFA 1CXKA 4I4WA 1OTSD 2NZ9D 1BLNB 1LEKA 4D0BB 3GM8A 2WV3A 4NZUL 4J8RB 2Q3ZA 1IEHA 4L3EE 5KZCD 2KDGA 4B7IA 1VCAA 4Z7UE 2EYSB 3PWVB 2CK2A 2BCKB 4MNHA 3B9VA 2N1KA 3V5HA 1INQA 3TA3B 1QPXA 4HWUA 3U0TB 4O4YH 4IM8A 3ZKXC 4DKEH 2FEDD 4JFFD 5IG7A 5JXEA 1HHGA 3FRPA 1FGVL 5KSVB 2BHYA 3QDME 2A9NH 2ZCHH 3HG1E 3NPSC 1CLZH 1I75A 5IW6B 1G7PB 2HT2C 1TETH 5KSBA 2IALA 2E6JA 1LEIA 4JAMA 1WISA 2IQ9H 3CJJA 5EU6E 3PL6C 1QSED 2ZUVA 4NC2B 5I1JH 4JO4L 1OSZB 5C09A 3CDGA 1AHWA 5DMGD 3QG6A 1DEEA 3EDKA 5IB1A 3TBSA 5HI4C 5BVPH 5C9JB 4MJID 3LMJH 5D7IB 2HJFA 2IAMB 3AS0A 2PYFB 3CMOL 5ISZA 3WLWC 3VE0B 5I16B 5SWQB 2CLRB 5FECB 1QG3A 4PFEA 2BFVH 2OTWB 2J6EH 1U8OA 3VA2C 1V5JA 4HJGA 1UZ8A 1IVLA 1BBDH 5L8JB 1ZV5A 4FMKA 2J1KA 1C8PA 1FZOB 2FJHA 4RNRB 3HZKB 1IMHC 4JREB 1XR9B 1P7KB 2E9IA 12E8L 4BSJA 1T80A 1BP3B 4G6AD 4ESKA 3L3GB 1XGUA 4LLYA 5JUEL 3G08A 4MNQA 3QJFA 1LO4L 4XPAL 1I7TA 1IAMA 3ARFB 3REWB 2WIIB 3OB0H 4DN3L 5BO1H 1YPZF 3HC3H 3B4NA 4R8WH 4TSAH 5GGRB 3VD7A 4I0PD 4YFEA 4GKZB 1ZTXL 4QOKA 5GGTA 4K9EH 1YYLH 1JMXA 1SVZA 4MA7H 5I1AA 5FKPA 4KU1A 1T89C 3SDXA 4PUBH 1E4XH 4KROC 5BV7H 2R2BB 3MRIA 3KPLA 3S4SA 2MQ3A 2PW1A 4JKPH 2RQ8A 3LB6C 2AEPL 2DLGA 2FLRT 3A67L 4P2OC 3MR9B 3TO2A 2X4PB 4JB9L 4ODUA 4KI5F 4WGVB 4Y5VC 4RGMC 4XTRC 3IDIB 1C5DB 2VLRD 3F65A 2GEEA 3ECBA 1AY1L 3VXUD 4ZQKA 1U8KB 4NC1C 3QXDA 3EW3B 4PB9L 3MLTB 3G5XA 1DUZB 3ULUE 4PJCF 3OPZH 5H8DA 4QHLB 3V5KB 5EOCJ 1C16B 3OG6B 5IBUG 4OFVA 1YMMB 4EN3C 2R1XB 3P0VH 4H88H 4PLNC 3S37X 5K59E 3W82A 5EZJA 4PD4J 3CXHK 1K4DA 4LCWB 1A14L 2A83A 3VFPA 3BZ4B 4FXKA 4QRRD 5D1QC 5JPNB 4XVJH 1HHJA 4ODXA 4NWUH 4JLRA 4LGRB 4YAQB 1I7UB 3F12A 4GMTH 1D9KA 3RHWK 1T20B 1R3IL 2VZ3A 3CVHL 3MJ9A 2D9QB 4OFDA 2YBRA 2CLZB 3UTTE 4F3FB 1XZ0A 3FO0L 4O00A 5KSBF 4MLSA 3BD3A 2VISA 3NIDE 1D5XA 2XACC 4FXGB 3VXOB 2IMNA 1S7TA 1LILA 1X5LA 4M8VA 1DLFH 2XWJB 3T0EB 4IIQC 2E3VA 4M6ML 4K2UL 3RL1A 1TJIH 3MBEA 3BH8B 4LVEA 3IDXH 4FFWD 4FRWA 1U6AL 1H8OA 4XP5L 5E08H 4EUPB 4HQQH 4ZDHB 1MREH 1RIHL 3QUMA 1V3KA 3PABA 1CDUA 2AVGA 1QLFA 2BNUA 3RY4A 4YK4B 3TJHC 2PXYB 1RJCA 3BGMB 1MJJB 3MV9D 2MPAH 4I9WD 3V5DB 1NBVL 1OGTA 1I3RB 4C56E 3GSRB 1OVZA 4JE4B 1NUNB 2OL3H 1B90A 2LU3A 3KXFE 1AR1D 2FX8L 4FS0A 4CDGC 5DJ6B 4HUWB 1XF5B 4M5YL 1S9WB 4PJFE 2PN5A 4WIQA 2DIAA 2IG2H 1F4WH 3RZCB 3C09B 5EUKB 1A7PH 4PY8J 3V0VA 3GK8L 1CL7L 4YIQB 4K7FA 3ZLQC 4PRDA 3P4NB 1WAAE 5L9DL 3BUYA 4H0HB 4KHTH 1EV2E 4BK4A 5FM5O 1T2JA 1R0AH 3N9GL 5FOBB 4G6KH 1R3JA 1GGUA 4HUVA 3KNBB 1U3HD 3LQMA 4X6DE 1J5OH 5J6GB 5JW5A 1ETZA 1Q8MA 3C6LC 3U82B 1C12A 3T3PF 2R39A 1T5WB 4NQCB 3SDDA 2E7HA 2VXVL 2Y23A 3DURB 4CN4A 3STZB 4HKXB 4HK0B 4HS8L 1T6WA 5HHPB 3LQZA 4JY4B 1KB9K 5KSUA 3O6LH 2XTJD 4GLRI 2V2WB 4RFOH 2X4QA 3GJFB 1UEYA 3DO7B 1QSVA 2WP3T 2YA1A 2NX5A 5E94B 2QHRL 3BKML 5SWSA 2HTKD 4YXKH 4XWOC 2I9LB 3HNTH 4HFUH 3D3VB 3WIIL 4X0KB 5DO2D 3MUY1 2R1WA 4CN1A 4M1CC 4PV8B 4HWEH 1DQML 1I9RH 1JVKA 1VSCA 1RK0A 3WFEH 2HFGH 3MMEA 1T4KB 1U93B 1DLHB 3BP6A 3ALXA 3D85D 4P23A 3OKDA 4LSSH 3MACH 1H5BC 2ZJSH 1T0MB 4FNLH 2VXTH 3GSQB 1W0VA 2F8XC 5EBLA 1KELL 4YHPB 5BVJB 4DUVA 4YDKH 4MAYD 4ZPTB 4Z7UA 3ZMRA 1IGIH 1JI1A 3A6OA 4X83A 3WHXB 2BVTA 2ESVD 3O4OC 5I66B 1JP5A 5BXFB 5GZNC 3C08H 2RFXB 4OLZH 1CF8H 1O5DT 3V0AC 3QDMA 1HH6A 3U7WL 3HG1A 4U6TA 4X98A 3OF6D 3KJ6H 3TZVD 3BEVB 4L8DA 5DT1L 2QSQA 1U58A 4Q6IB 4KTDL 3HLAB 5FYJD 3AREA 3MGTB 3MOQA 2X4TB 4JO1H 4NUGL 2ITDA 1AIFA 4F58H 1WC7A 3U30C 4H0GA 3FB6B 4F57L 5BJTA 3FO2A 4N0UE 3HR5B 2YMXH 3FL7A 4P2CG 4LSUL 3JTTA 5CSBA 4WRLA 4KKCC 5HGBA 4N8CH 3L7FA 1IM9A 3O2DA 4MD4B 1NBYA 5J7CC 5AUMB 3EJZD 3CD4A 1MF2H 3WDIA 1G9MH 1OD9A 3T09A 3L3IB 4OCXH 5F3HB 2QEJA 4HG4J 1MCFA 4L8CB 2CK0L 5K93A 1F02I 4I18A 4D3CH 4YO0A 4Y1AA 4WO4A 4W4NA 3SPVB 2W0KA 1ITBB 4G5ZH 4OLYL 2VH5H 3WJLC 4EVNB 4PBWD 3ARDB 3TH3T 3IXTA 3QUXA 1T22B 1BEYH 4JQXC 1EGJL 4OFYA 1IQWL 4ORGA 4PPTA 5CD3A 1HWGB 1JWSB 3DROA 2XKUA 2ENYA 5HHNA 3QDAA 3NABH 1AD0B 4OZFA 3ULSA 2YD5A 4YR6A 3OJ2C 1CCZA 2JF1A 2BSSB 1V05A 5JXAL 5CEYB 2C7UB 5EC2B 4KKNA 3O6FC 1PY4A 2CUHA 5I8KH 2WUBL 4R96A 1KBGH 4P5TA 4FZ8L 1TZHA 1EO5A 3MOAL 5D7IE 3PHQA 4P9HH 5DJZB 4NM8L 2D7MA 4JFHE 3PIQA 4U7MA 1X6NA 1EVTC 1KV3A 1R3KB 1FO0L 3BI9X 3JSSA 4RWYH 2YWYA 5DS8A 2PETA 1IC4L 2BVUA 5FKAA 1FL3B 1K9TA 5C0EB 3REVA 1EEYB 2YSSB 2HH0L 4PJHB 1UWXK 5D7KD 4MQTB 3RWFA 3K81A 1BOYA 1H0DA 3O3BB 1UT9A 3QFJB 2GAZA 4ZTOH 4Z7UF 4M03A 1NLBL 5ABDE 4Y5XC 1YEGH 1PEWA 5IBTH 1VKXB 1UWGH 1W72A 1II4E 5D7LB 1AO7E 1ZSDA 2NY3D 2FWOA 2P7TA 4ZUSA 1NAKH 5ETUB 4M61A 4YHLH 2FGWH 1ERNA 3LN9A 4F2MB 5F7DB 1CE1L 3ARVA 2C3HA 4N1CA 3ARGB 4KTEH 2Y36L 4L8SC 1KCSL 5J1TC 3DXAB 4WFHE 4I77H 1ED3A 4JHAH 4PTTB 3UTTA 1NGPL 4TSCH 5C0DB 1A2YB 4AH2B 2OJEA 4RQQA 4OQTL 4Y4KD 5A3ID 5DXWA 4DVRH 1WGOA 4WJ5B 2HVJB 1KC5L 2UY6A 2L0DA 4YFLF 4OCWH 4PTUB 5FB8A 2EH8L 4BSWA 1HYSD 4WUUD 1S7VB 5ACLA 3UJIL 1RUML 1YNLH 2FYYA 3DVNA 1PDKA 3WXWL 4HH9A 1VACA 3QEQE 5JW4R 3P30H 2AJUH 3OKMA 1XGRB 1ZOXA 2F54B 3LH2H 4P9ML 1T04B 4E9LA 2BVPA 4DN4L 3RDTC 4C56A 1TPXB 4YNYA 3LEVH 1J1XH 3CLEH 5C0AD 5DUBA 2XQYK 3X11B 1FAIL 1YMME 4A6YL 1FE8L 3MLYH 1QQDB 3H9SE 5FA4A 4QTHB 1JV5B 3QCUL 5FHAL 2AJYH 4F9LC 3UDWA 3TBYB 1TVHA 5T5NG 2BNQE 1QO3A 1RIVH 1I8IB 1I1YA 2AI0H 1YN7B 2DI8A 5IV2A 3IJHA 4I3RH 4LCWE 1VFOA 4H8WH 4AL8L 5EB9A 7CGTA 1UB5A 3P9MA 1P2CA 4KK9D 3C2AH 1RULH 4OF3A 5DD1H 1WICA 5DMGC 4P2RB 4ZO7A 4GW5A 4CVZA 4X6DA 2X9XA 3H6JA 1Q9KA 1UH4A 2M1KA 3ZT7A 2QTEA 4LARL 4U33A 2JB5L 4F7CA 3T0EE 3AY4C 3R8QA 4KKBC 3VI4E 1PGRB 4NT6B 2RCSH 3V52H 2G9HA 5C0IB 3MNWB 4I13B 4XBEH 2FNBA 4P4KC 4JZOB 4BKLA 4JQVA 2BJMH 1JHKL 4TUJB 4CVUA 3G6JE 2XA3A 3L3DB 5D96C 3ZKXB 1IAIM 4UT9L 3L5IA 5C1MB 1QFWH 1J18A 1L9NA 3ULUF 5CEZL 2BZDA 4NO5A 1NDMA 5L88H 5IMLB 3VFOB 2P48B 3NPSB 4NQUA 3ROOB 1MCDA 3UC0H 3OR6B 4JPKH 4YDVB 2DIJA 2X44D 3KS0J 2D2OA 1CICC 2P5WE 4YHIB 1I9JL 3CVHB 1I8MB 3PL6B 2VXSH 3V0WH 4HH8A 2FIKB 4F7EA 2O5YL 5K59F 3KWWA 1LP9E 1PKOA 5DK0B 1ZT1A 3CFKA 4CUCA 4FQLH 3DETC 1T3FB 3OR7B 1QR1A 4PGBA 1HHIB 2V7HA 1ACYH 4QRUB 3GGWA 3QPQD 3BGFC 2DKMA 1MRCH 4Q9QH 4GAGH 3OKNB 3LEYH 4G80A 1INEH 4Y4HA 3FT4B 4PJ8D 2ICCA 1MIEL 1KGCD 1KT2A 4JKWA 5F7MC 1A6AB 3NIDF 3K8MA 2GJZA 1A7RL 4M3KB 5D9SB 1VADB 4PJXB 5E8DH 1P7QA 4HS3A 4S1RH 5F3BA 2PNDA 1IC1A 4ZFGH 3QDGD 3QEUB 2H3NA 2O5ZL 4LRNL 4I0KA 3T3ME 5GPRA 4OV5B 4DQOH 4N0UA 5GGVL 3HMXL 1A4KB 5JOFA 1JRHL 4CKVX 3Q6FA 3VMPA 2YK1L 2VLJD 5D7JD 5F9JA 3T1FB 4XCFL 3GSXB 2VJXA 3ZT6A 4OM1L 5JIHA 1FIGL 4UBDC 2CKBA 32C2B 4ODTL 3N50A 4NPYB 1EJOL 3KG5A 1BLNA 1FZKB 3OKOA 4D0BA 2XZAL 4PJFF 4J8RA 3LIZL 2YPLB 2C3GA 1DBML 2EDTA 4TULH 2HKFL 4KROB 5F9OH 2NR6D 2JJSA 3PWVA 2BCKA 4PJ7F 1F4HA 1KTLB 1OT1A 4WY7L 3RWGB 4HC1H 1QSFD 3TA3A 3ZL4L 5HYQB 4P2OB 2DQJL 4LSRL 1WAAF 3DYMA 3W5NA 2NTFA 3FRUB 3GB7B 4RGMB 4L4VD 4Y5VB 5L2KD 1JHLH 3LRGA 2BDNL 3U6RB 5IFJA 1NSNL 1IGFH 3MLVH 5KSVA 4NGHL 3PV6B 1U3JA 4NHCL 3JV4B 2EDWA 2BNRB 4X6DF 5IW6A 1G7PA 4FABH 1P4LB 5I1KH 3BPLC 3CXDH 1G6RL 4L8BB 5K9KB 2OYPA 4EN3B 3BN3B 5D93C 2VLKD 4AZ8A 3Q2CA 1BIHA 1OSZA 3UROR 3GMMB 4YE4H 1EIBA 4P3CL 2QSTA 3LY6A 5D1QB 5C9JA 5D7IA 4JQIH 2IAMA 5FYKE 2PYFA 3GMNB 3V4PL 5TDPB 43C9B 1CDYA 3KHOA 2XI9A 2BMKB 3CDYA 2P45B 3VE0A 4OKDA 5I16A 5SWQA 2CUMA 2CLRA 5FECA 3LEXB 2Q3AA 2Q76B 2OTWA 3MRPB 3UTOA 3FN0H 3N06B 2VZ1A 1A21A 3HA0A 4FOMA 1AD9B 2CO7B 5DEZA 1FZOA 3GMQB 4RNRA 3HZKA 4IIQB 1N7ML 2OZ4L 1U3HC 3HI6H 4YHNB 1XR9A 1P7KA 4LFHG 4FQ1H 3L3GA 4BA8A 4DW2H 2OTPA 4X7SH 2D03H 4HJJH 1GIGL 1ORQB 3NTCH 5J11C 5EH1A 3ARFA 5IIEA 3REWA 2WIIA 5C2BH 5L0QC 2JCCB 5GGRA 4GKZA 3CFEB 3MBXL 4WEBH 5C0JB 1IAOA 2EDLA 4G42B 2HTKC 4JKLA 1KCVH 4ODVL 1CXLA 3TIDB 3EHBC 2R2BA 3WMSA 2Z92B 2VR5A 3IETB 3RI5F 2HT4C 4Y4FD 1EDQA 3MR9A 2V9RA 2X4PA 1FBIH 1FIEA 2C1OB 2VITB 4M7KH 1AGBA 1H9VA 2HLFC 3IDIA 4XNZC 1C5DA 5CZVL 1NMBL 4PG2A 3BKCH 3WNNA 2OCFD 1U8KA 5GRZA 1NAMH 3MLTA 1DUZA 2P8MA 4JG1H 3MRCB 3SBWA 4QHLA 3V5KA 2B0SL 3RGVC 5BS0D 2CQVA 1C16A 3ULVD 4PJHE 1YMMA 4P46D 5HHMB 3H9SA 3C6LB 3RJQB 3K46A 3BEWB 3L1OL 3ME0A 1OQOA 1RFDL 2ZG2A 3KYKH 2R1XA 5ESVB 5M94B 2H9GA 3OZ9H 2BNQA 3MSPA 1KTKE 3RA7H 2CRIA 4NM4H 4LCWA 3UYRL 1JZ3A 1EX0A 4WWKC 3BZ4A 5E2JA 5JPNA 1J8KA 4S10A 1OAKL 5D7LE 5CJXA 4QXGL 4PRHD 5F9WC 4XB7A 3IRPX 2Y72A 3RIFF 1JMZA 5JR1L 3D25B 2APFA 4YAQA 2E7LA 1X5FA 2RHEA 1DBAL 4NSKB 1I7UA 4M00A 4ONGL 1T20A 2FCBA 3DXAE 4JRWA 4KQ3H 5DR5H 3RBSA 2FBJH 2CLZA 3DIFB 5GISH 4F3FA 3GBMH 1IGYB 2CJUL 4FXGA 4LIQH 4O5LH 3VXOA 1MCEA 2D7PA 4PLJD 4YPJA 2NXYD 2XWJA 1H5BB 3L3JB 3RY5A 3T0EA 3BH8A 3MNVA 4NQED 3FRPG 5F93C 4EUPA 4EKXA 3MV7D 3EJZC 3O45B 4V1DD 1PEZA 4GXUM 4Q74A 2F54E 3EO1B 5D7IF 3IU3B 5HVGB 2PXYA 3BGMA 3FZUC 1MJJA 4NDMB 3G6JA 1T0PB 3V5DA 3V4UH 4XP6L 1I3RA 4NWTH 3GSRA 5HHOD 4JY6B 4WFED 3H8NA 3GSNL 3MRDB 2EH7H 2HFFB 3GJEB 1UCBL 5KVGL 2I5YL 1OPGH 1Y18B 5DJ6A 4HUWA 1GPOL 1S9WA 5T5FH 5I1GH 3RZCA 5EUKA 4LFHD 3NZ8B 5IW1B 1BF2A 3BIBX 4XBPB 4R7DB 2NPLX 1GGCH 1ND0B 5B38A 2FGZA 3U30B 1VESA 1GAFL 1DJSA 3TPUB 3P4NA 3SCMC 5FUOH 5FOBA 1AQDB 3KNBA 1HH9B 1E28A 3UJJH 4P2RE 2I27N 2JB6A 3QI9C 4MCYB 1SJEA 5I18H 4G7VL 3RIAF 4HCRL 4HJ0C 4LVNC 4U1NB 1T5WA 4NQCA 3IYLW 2V2TB 3DURA 3P11L 4P5MB 3STZA 4HKXA 4HK0A 5HHPA 3QO1B 4AK1A 3GRWH 1MFAL 2B1HH 5DMIL 5C7XL 2V2WA 4A6YB 3DO7A 5HGGS 4J2XA 5E94A 1SBBA 4IEFB 3SJVB 1ADQH 1QBAA 4NP4H 2PR4H 4UNUA 1JNNL 4LMQE 4X0KA 1FVCB 1KJ2H 3IDJB 3BQUD 2I25N 3I6GB 2UV3A 3AUVA 4PV8A 1UKQA 2X6MA 5FDWB 1U8IB 3S3PA 3S4SG 1V3MA 4IRJD 4OLXH 3IKCB 3FCTA 3V6FB 1T4KA 1U93A 1DLHA 4FFVD 5GJTH 3U7YH 2NY3C 1OTUC 3X3FL 5EOQH 1T0MA 3GSQA 4KI5D 1S9XB 4XNQA 2HFEB 2ED9A 5SX4I 5BVJA 2MKWA 4X7EC 4TOYH 3NA9L 2J7LA 4ZPTA 4NKOB 3O4LB 5FYJL 2BVOB 2VZUA 3O6FB 2BY0A 3WHXA 5I66A 4AENB 3JTSB 1UENA 4L5FH 2ZCKL 5BXFA 3SKOB 3OHXB 2W91A 4G8EA 2RFXA 4JFOB 3VJ6B 4BH8B 4JPWH 1EVUA 3ELAT 4HKBA 3BEVA 5LG1A 3EJYD 4K7PL 1IFHL 4Q6IA 1KXQE 3HLAA 5JDJA 4PJXE 2X4TA 1RZKC 3VI4F 1RU9H 5JXED 4JO3H 3DPBA 1OP3K 3MRFB 3FB6A 4KJPD 5EA0H 4D9RD 3T0WA 3HCVB 1AXIB 3MRNB 1TZGL 1Z9SA 5T3XE 2PYED 3TC9A 5D6CA 3G6JF 3O2WH 3HB3C 1T7XA 5D1XC 1IAII 1JZ4A 3KLAB 1MAKA 5C09D 1K85A 5LGJB 4MD4A 5AUMA 1BJ1J 1FORL 1U41A 3VDCA 1Z9OA 4KK9C 1T2QH 1TMCB 5LXGL 1MUJB 2AEQH 4AMKL 3PWJB 1LO0L 5F3HA 3ILPB 1LP9F 4L8CA 4XPFL 2XRAL 4N0CD 2YPVH 5ISZD 4PP2B 1F8TL 3SPVA 1T0NA 2NXZD 2UVEA 1RVFL 1B0GB 5LAXB 4R97C 4EVNA 1G7JB 3ARDA 4LQFH 3VH8B 1T22A 3PP4H 1UKTA 2IF7A 4LHJB 4NC1E 1NCBH 2YHGA 1JWSA 3RDTB 4JVPA 35C8L 5HYSB 2BNRE 1AD0A 1Z3GH 2DL2A 3FQNB 2BSSA 2CRYA 4MMZC 1TQCC 1IBGL 2EDYA 1DQLL 5T1KB 4KY1L 5CEYA 4MNQD 2B4CC 4WU7B 1JGDA 5EC2A 4WHYG 3TCXA 2X4NB 1QKZH 3T3MF 3HFMH 4HGMA 5BZDB 4QOKD 5DJZA 3CFBB 3HI5L 4UILL 3ARWA 4J1UA 3X3GH 1R3KA 2E9JA 2VXUL 1QBLL 5E03A 3MJ8B 3IJYB 1FL3A 5C0EA 2AJZB 5AZEH 3HE7C 1EEYA 4WI8A 2YSSA 4KVCL 4PJHA 3ZE2E 1RJLB 1T1YB 4D2NA 4QNPE 3O3BA 1K3ZA 3WD5L 3OXSA 1H15B 4X7TB 2XZQL 1WFNA 3VMNA 5FGSA 2QQKL 4PJ8C 3ARRA 3PNWB 1EBAA 4M1GL 2ZCLL 5EU7E 4MXWL 1G6RB 1VKXA 3MXWH 5D7LA 3O6ML 4P4KB 1A02N 5ETUA 5GGQH 1KEML 5DFVD 4Z7QE 4F2MA 3BESR 2V6HA 5D96B 2JCCE 3KPTA 2H32H 5GGRY 2OP4L 3DXAA 5ALBH 4NC0B 4PTTA 5C0DA 5HXMA 4ENEC 1A2YA 4XMKL 1RZKL 2ADFH 3MUJA 3OXRB 3WIFB 4AH2A 3U46B 4WJ5A 2HVJA 1T7WA 5IHUH 4PTUA 3GNML 3RTQC 1S7VA 4B53A 3C5SB 1CICB 5K9JH 3X14B 5DRZB 1JL8A 1D9KD 2QSCL 4PP1C 1J87A 2F54A 3UCRA 1ZANH 3BGFB 4NN5C 5B8CC 1T04A 2NR6C 4L4TE 2DQEL 2KQMA 2IGFH 4GMSH 3SDAC 5LCVH 1CZ8L 3MBED 3X11A 3T2QA 1FFOB 5DWUH 4HKZB 3D48R 1QQDA 5D7SL 2MCPL 1BZQK 4QTHA 1JV5A 4PJDB 1IGMH 3VXUB 4YHYC 4HS6A 3TBYA 1ZA6A 5DRXA 1I8IA 4XWGH 2G60H 1YN7A 4X4ME 1C5BH 2E27L 4HT1H 2EKSB 1UEMA 5JMOC 2MHAB 2UZIL 4JFDB 1MCQA 3A6CL 4ZSOB 2FD6H 5IFAL 1IZKA 3DO3A 3WS6C 3QHFL 1MI5E 1PY9A 1WQVT 2EDFA 3WKML 4P2RA 2CUIA 3MLRH 1NGQL 5MEQB 2B4CL 3IJSB 4X5XB 3SGDI 3BAEL 4NQXB 1CXHA 5F44A 4KMTH 5DQ9A 4LLWB 3FB7B 3SKJL 5IGXL 4NT6A 3GKWH 3MNWA 1BIIB 5HDQH 3UTPD 5EO0B 4P2QB 3PV7A 4TUJA 3BDXA 2G75B 3BO8B 3GO1L 4OZFG 1A4JB 1UJ3C 1HQRB 5KANI 4U7SA 4LVHC 2ITCB 3ET9F 3DVGB 4OCNC 4I0CC 5IMLA 3VFOA 2WNGA 4G8IB 3ROOA 2E7CA 4PJHF 3WFBL 3OR6A 3L6FB 4YDVA 2WZPD 5E7BA 4M7LT 4O58H 2RIKA 2D4DA 3BPLB 2NX5D 2H45A 2WLZA 4FQPA 4YHIA 3CVHA 1I8MA 3PL6A 2F5BH 3MV9B 2FIKA 5D93B 4YZFE 5DK0A 1BVZA 1B0RB 1T3FA 1T7ZA 3R1GH 5J1SC 2OR7A 3OR7A 1HHIA 3ETBF 1IC7H 4QRUA 4OLWL 1CD9B 3K2UL 4P23D 5HGHB 5HI5C 1FDLH 4HXBH 2VDPH 3OKNA 3VXNB 1FPTL 5KANG 3FT4A 3MYJA 1ACZA 3MJGX 4L3ED 2A77H 3V4VL 5IT2H 2Y25A 1A6AA 4PRAB 4AIXA 3MJ9H 3MLXL 3M17B 2VIRA 4TVPH 4UDUB 1VADA 3ZHLA 4HDIB 4PJXA 2L7JA 2PKDA 3GSNB 5FO9A 4DUWA 2A6JB 3IKKA 4LSPL 2J4WH 4QCIB 4BFIB 3QEUA 1U3HB 3PGFH 3VFVA 3QDMD 3HG1D 2W07A 1CD1B 3QQ3B 3U83A 5I1HH 1A4KA 3Q1SL 1I1RA 3ZHKA 3VG0L 3ZKMC 1JF1B 5J11B 5EU6D 3OGOE 4Y89A 4Y19B 3ZDXE 3GSXA 4MD5A 3ARED 5L0QB 4OLVH 1I7ZB 1YEIH 3QCTH 32C2A 2H1PL 4NPYA 5DJ0B 1QFWI 1MCWM 1FZKA 3T8XB 2YPLA 1T89A 1XFPA 2Z91B 3MUHL 1S7XB 4OLUL 4V2BA 3AS3A 4FQ2H 3O4LE 3OKEB 4HSQA 1KTLA 3NCJL 5FHBL 3RWGA 1GGBH 2O5XH 5KG9A 5HYQA 4P2OA 2LAAA 5FEBA 3KLHD 1EBPA 1IM9D 3UTQB 4AEFA 3GB7A 4Y5VA 3C87A 4XNZB 1HYRC 3AS2A 3U6RA 5B4MC 1H8SA 4YX2H 4WHYH 3LZFH 2NLJB 3PV6A 1ZVSB 3QIBC 4J3OC 4N1EA 3JV4A 4LSVH 4QT5B 5F7LB 5CILH 4R0LC 3EYQD 2OSLB 2BNRA 1A7OH 1DUYB 4BM7A 3QWOB 3MLPA 3RGVB 1P4LA 4XCYA 3ZZ1A 4NKMB 4L8BA 5K9KA 4EN3A 1JGUH 5ICXB 3BMVA 3VXSB 2XXMB 3GSWB 1GGIL 3GMMA 3QUXD 1U36A 4OFYD 4XP9H 2X09A 3VXPB 4XPBL 5E2UL 5J1AB 4CU8A 5AD0B 4WWKB 1ZLSL 5D1QA 5F9WB 2J5LC 3GMNA 3F62A 2EIEA 1GJIA 5TDPA 4HIEA 43C9A 4M02A 1B0WA 5DJDB 5LVEA 2QJDA 1QLEL 3CVIL 1J05B 2Q76A 3LEXA 1UACL 4LSDA 3MRPA 4P5TD 5C6PB 5C0FB 1AD9A 1S7QB 4KH2A 1OM3L 3Q3GA 3GMQA 1PVHA 4CADB 1YNTB 4IIQA 1UA6L 4YHNA 1KTRL 1MFEL 1H8NA 5AAMA 3ULUD 3NCCB 4P48A 5E2VL 4S1QL 2D3VA 2LQRA 5FGCB 4U6VL 5IFHH 1YECL 5CUSL 4WVRA 2JCCA 1EO7A 2LVEA 1DL7L 3SKNB 2QBWA 3CFEA 5EWIH 1NEUA 5C0JA 3WHE0 3KR3L 4ODHH 3HI1B 4PJXF 3TIDA 4M6NH 5I1EH 2Z92A 3IETA 4KFZC 1YEDB 3TBTA 1WZLA 4LLMB 3S35H 5D72L 4A2MA 3SE8H 2IBZX 5E99L 2C1OA 2VITA 3UTTD 5DURB 3SCMB 4KI5C 5HHQB 1TJHL 3P4OB 3M1BB 4L4TA 3S9DB 1F3JA 1JNLH 4XHJD 3QI9B 5I74C 2XOTA 2FH8A 1UQSB 4RAHA 5JORB 4O2FB 3C6LA 3IFLL 1EGJA 1ZAGA 4GRLC 2WUCL 5DK2B 3W2DL 5ESVA 1T21B 4NO0D 1FFNB 1NMCC 4TNWF 3WFDL 5INDB 1C1EL 1FGNL 4Y2DD 2Q8BH 4C56D 1JFQH 3IDYC 4RGNE 4K8RD 3KXFD 4ISVB 4F37F 3EJYC 3TIEB 1T83C 1R5VB 3D25A 2H2SD 4NSKA 5KN5A 1NCWH 1J11A 3R4DA 1TNMA 1ZLVH 4BZYA 3DIFA 5KAQF 4OGXL 5C0GA 4WV1C 1IGYA 1Q9LB 4MMXC 1LK3H 5TQ0H 3U2SB 1FO0A 2EO9A 2NY3B 2AABL 1H5BA 3L3JA 5I76B 1E6OH 4G9FB 4PJ9C 3PXJA 1OAXH 2FATH 1V3JA 1I8LC 1L4IA 1F97A 1CGSH 3KHQA 1MLBB 2HWZL 3O45A 5DJXB 4RFNB 3BPCB 5GRXG 1DQJB 3IU3A 5DZLA 4NDMA 3LCYA 4JDTL 4CMMB 3S3SA 4F8TA 4K9EC 1NCCH 3MREB 5DUPH 1TTFA 4PY7B 4N0CC 3RY6C 4JY6A 4OGZA 3E3QC 8FABB 3MRDA 3MGOB 1RUKH 4HIJA 2HFFA 4XXCC 5EIQA 3EOTL 5BV7C 2J88H 1A3LH 1B4JH 4JDVB 3ZE2F 4UIMB 3RAJL 2DQCL 1Y18A 2BSTB 1G9NH 4W68A 3R06B 4QNPF 4PJDE 1JIBA 3ARTA 5ADOH 4X99A 4X9BA 3F7YB 3NZ8A 5IW1A 3MV8E 1R24B 4OQTA 4QWWD 3EO9H 4R7DA 2OJZH 4PRPB 1ND0A 5C0AB 4YUEH 3TPUA 4JFDE 1JWUB 4ZSOE 4KKLC 5INCB 4Z7QF 5MEOB 2JCCF 1HH9A 5D1XB 5ERWB 4ODSH 1FCCA 2HMID 3PHOB 3DUSB 4GRWE 4MCYA 4JHZA 1GHFH 4P5KB 4TTGA 1X5YA 1FQ9C 4HPYH 5TF0A 4U1NA 3QNXB 4P5MA 2OTUB 2CRZA 1HZHH 5F7EL 4FP8L 3QO1A 3TFKD 5F96L 1CGVA 1BD2B 2HTLC 3TN0C 2A9NL 2ZCHL 4A6YA 4Q9RH 4Y4HD 1TETL 1CGTA 4P2QE 4YEEA 2D4FA 2IQ9L 1RJZB 3GMPB 5I1JL 4R97B 5ANME 3WJLA 3S36H 2X05A 5TE4H 2UUDH 1UVQA 3IDJA 4PRBB 2N4IA 4JQXA 2J8OA 1P7QD 2F58L 3VRIB 5FDWA 1U8IA 1FLRH 5BVPL 3IKCA 3V6FA 4K3EH 3QNZB 4IRSC 1G7IB 4H26B 3LMJL 1TTUA 1FHGA 4K8RH 3TO4C 3H3KA 3D39E 1S9XA 5DFVC 1TQCB 2HFEA 3HKFA 1X5GA 2IPUG 4JEGB 4NKOA 3O4LA 3O0RH 4C4KO 3CH1A 3O6FA 5K9QG 2GY7B 3CLFH 4PJGE 2J6EL 4AENA 3GDBA 3JTSA 1NMAH 3QPXH 5EU4A 4NCDA 3V7AE 1MFDH 3SKOA 3OHXA 3D0LB 2JJTC 4OBRA 4JFOA 4L1HA 1BF8A 1M7XA 1EFQA 4BH8A 5CBEB 1GC1H 3FB5A 3WUZA 4WWID 5LQBH 1CFSB 1G7QB 4FQXC 4WW1B 3HE7B 4KMLB 3TA3D 2CXKA 3K3QA 4Z95H 1IC5H 2BX5A 3BZDA 3DOSA 5BO1L 1TTGA 4IOIB 3HC3L 2CR3A 4R8WL 3CUPB 4APQA 1JHTB 1ROWA 4PJ8B 1A64A 3D18B 5K9OB 4M8QA 4K9EL 1UM6H 1YYLL 5IJKC 4Y5XA 1N0XH 1QD0A 3MRNA 2D0HA 2VDML 2A73B 4Q9BA 4XNYH 3JVGC 1E4WH 1E4XL 1IAKB 3GHBH 5BV7L 4Y19E 1N6QH 1R5WA 3TWCH 2QHLA 1MRDH 4NNXB 2Z0BA 3KLAA 5IB4B 4UDTB 4L8SA 3VG9C 5LGJA 3CZFB 1HXYA 5H37H 3WKNA 1MWAH 1GXEA 4EUPG 1MUJA 4NZTH 4XI5D 3RTQB 3PWJA 1HIMH 3ILPA 4YZFF 4JFHD 2IAMD 1QFUL 4EXKA 3O3UN 4PP2A 4J4PD 1B0GA 3DGGB 3RKDC 1T1WB 1G7JA 3P0YL 4JM2F 3P0VL 4H88L 1M6OB 3VH8A 3G6DH 4NN5B 5B8CB 4ORZC 3RDTA 5HYSA 1EUTA 3HMXA 3SDAB 4XVJL 2AXHA 3FAXA 1QSFB 2CGRH 2QL1A 3FQNA 4KK8C 1MVFA 1N5AB 5D6DC 4NWUL 4X6CB 5B38G 4GQ9H 1P7HL 4GKSB 5T1KA 3VXSE 1AO7D 4WU7A 4GMTL 4XMPH 4F9LA 4ZUTB 5C0NC 3ARFD 1QSZA 1DBJH 3S5LG 3FT2B 1JWMB 4WFHD 1WK0A 1HHHB 4RRPG 2M2DA 3TBVB 5BZDA 3DBXB 5J0BA 1AP2B 4X80L 3CFBA 4MZ2A 1NPUA 5JMRA 1WFUA 3ZDXF 3R0NA 1DBBL 2VLKB 3IDXL 5AWNH 1H3PL 3IJYA 3MJ8A 4HQQL 2AJZA 4GBXC 1MREL 3RZWA 3VXRB 3V6OE 5MENE 4JN2B 4YHMH 1RJLA 1T1YA 3BHBB 2CKBH 3QEQD 2MKLC 2MPAL 1H15A 4OKVB 3JV0A 5CZXD 5I1IH 3QRGL 3AY4A 2L7UA 2NTSP 2R2EB 2ICWA 2OL3L 3HMWH 4PJAB 4QY8B 1Q38A 3CFJA 5DA4A 1G6RA 4PJIB 3EYUL 4P4KA 1RD6A 4NNYB 1YMMD 4WGWB 2IG2L 1F4WL 3H9SD 4J3SA 4OZGE 3GHEH 2WK2A 4FZEH 4JGJA 3T2PA 5KVFH 1UJ3B 4FMFA 4LVHB 2BNQD 1G9MC 5CLTA 3OXRA 4PG9B 3WIFA 4DEPC 2A6IB 3U46A 4LCWD 2C3XA 1BFVH 1EERB 3VGFA 3L3KB 3BP7A 4G6KL 2Y06H 3C5SA 1CICA 1OTTD 1JPSH 4U3CA 5CD5D 3BVNB 4UB0H 3QUML 2FSEB 1I7RB 2A0LC 2BC4B 1J5OL 4ELMB 3QEGL 3E6HA 1CLCA 2OZ4A 4N8VB 4U1HB 4U1IB 4DZBB 3H42L 3O6LL 4K3JH 1OP5K 3T0ED 4WUKL 1F3DH 3VFMB 4Y4FB 1IAIL 1CGXA 1FFOA 1P1ZB 1KPVB 1S5HB 3P2TA 5I15H 4HKZA 1A7BA 3KLHC 3CNKA 4YXKL 3SO5A 4Q0XH 4U2ZA 3HNTL 4PJDA 1P4IH 3VXUA 1A9BB 2PXYD 5F7KC 3FQRB 4HUXA 4OM0L 4HWEL 3S88H 4L3CB 4YHKH 3WFEL 2HFGL 2MHAA 1EMTL 1FZJB 4JFDA 1Y6MR 4LSSL 4ZSOA 3RI5K 2ZJSL 4P46B 2AKRB 5FCSH 4TSBH 3CPLB 4G43B 4NYLB 4N0RA 4W81A 1JF6A 1SMOA 2P5WD 5C0RL 1IGIL 2XPGB 3RZCD 4GO6B 5MEQA 3L5XH 15C8L 5EIVA 3IJSA 4X5XA 1NDGB 4NQXA 3T0BA 2R69H 3T4AB 3FB7A 3VI3E 1WWAX 3VWKC 4G9FE 5E1HB 4OLZL 3RL2B 1FSKC 4OZ4B 2ZUXA 3QQNA 5IHBA 3CSGA 3PWNB 2G5RA 1BIIA 5EO0A 1YJDH 4P2QA 1XF3B 3KJ6L 3DUHA 3CFCL 4OCRH 4PGEB 4ZPVB 4G8FB 3FQUB 4PR5B 2G75A 3BO8A 5AAWA 2EKJA 5ANMA 1KCUH 1SY6H 3QHZH 1A4JA 1MH5B 5E6IC 3OAYK 4F58L 2ITCA 1L0QA 4MJ2A 3L95A 2X9YA 3DVGA 3QIBB 2LTQC 4G8IA 3RIFK 2OXHA 1WIPA 3L6FA 2YPKB 3MV7B 4YGAB 5HHVH 4H1LH 4K07A 2EZ0D 4X9GA 5JZ7D 3VFWB 4NQSB 4MYWB 4QHUA 3BWUC 1AE6H 1B0RA 4PRPE 1JGVH 1H3GA 4XGZB 3P40A 2HLAB 4KXZH 1MF2L 4ONFH 2XZCH 3MRBB 4KDWA 2R0WH 2HG5B 4M3JA 2XICA 1DDHB 1G9ML 5F7FA 4OBSA 5HGHA 1AGEB 2J5LB 4LSQH 3BZFB 3VXNA 1UKSA 4J23A 4HKJB 3STBA 4X7CC 4BZ2H 1N5YH 1CTNA 4S1DD 4J3VA 4PRAA 2IH1B 1CVSC 4DAGL 2AAVA 2VH5L 4NFDA 3M17A 1SQ2N 5HD8D 3EOYG 3AMLA 3BDYH 1ONQB 3UYPA 4HDIA 4RCAA 1U42A 3GSNA 4H8WC 3ZTNH 1BD2E 4QCIA 3LS4L 2OR9H 2GTZB 1U3HA 4ZS7H 1U0QA 3NABL 1KFAH 3LN5B 5HYSG 3QXVA 2IPTH 3CDCA 1CD1A 5DSCB 1MFBH 4EUPH 1JF1A 2WIMA 4Y19A 3NFSL 3EKCA 4Y16C 4Y2DC 5I8KL 4WTXA 1I7ZA 4PJBB 1ZHKB 3QDHA 2ATPB 5DJ0A 3A6BH 3RVUD 3T8XA 4PJDF 5MEPB 4OUUB 2H2SC 3RWIB 4X6FB 2Z91A 1OGAB 1A0QH 1S7XA 2YD6A 4RWYL 3EFFB 2BY1A 5FYKD 1TIUA 5DLMH 3RIAK 3OKEA 2MTPA 3BQUB 3D5OF 4BZ1H 3MCG1 5DQDL 1NGXB 2WM0A 5B3JE 2BOBB 3VXMB 1F4XL 3UTQA 3ALPA 4GXUN 3GIZH 4ZTOL 1NGZB 5IESH 5DVOA 2BVQB 2DQTL 4ZAKC 4QT5A 2NLJA 1ZVSA 4GRWF 2OSLA 1YEGL 1DUYA 1PG7H 1UWGL 3RGVA 4N5EC 4X4ZA 5I0ZA 1AFVL 5I74B 1NAKL 4NKMA 1QFPA 4YHLL 2FGWL 5ICXA 4I1NB 1G7HB 3VXSA 3J8F7 3GSWA 2VUYA 4GRLB 4IDJH 1M71B 2O26U 4JHAL 1NMCB 4P3DB 1HINH 3VXPA 4TPRL 4YHZH 3CDFA 5AD0A 4WWKA 3IDYB 4UINH 1MPAL 3GJFH 3OF6A 5FK9B 1UH2A 5EIIA 3PF2A 1NBQA 2EE2A 2H8PB 2ZUYA 1U8NA 3K4DA 5DJDA 1BM3H 1WSST 1D3CA 1U92B 4N5UA 4IOSD 4HWZA 4MSWB 4M43H 1J05A 1QBBA 3P30L 2W0FB 2YD9A 4WV1B 5MENA 3JWDC 5IBLC 4NOBA 1BWWA 3LH2L 5C0FA 1S7QA 4JGUA 2PYEB 2DLIA 1MEXL 2DTSA 4CADA 1YNTA 5EBWB 3LEVL 4ZOCA 3CLEL 3KPPB 4K3DH 3GKZA 2HMIC 1E4KC 4PJ9B 4LEXL 1MAJA 4PJGF 3MLYL 3ZHDA 1CU4H 2AJYL 4OB5L 4OZGA 1RIVL 3TFKC 4I3RL 1RJYA 3SKNA 4AEEA 4KKAD 5GGVY 3NAAL 3NZHL 3N1PC 3PDGA 4H8WL 5BV7B 3OWEA 1RULL 4X6CE 3HI1A 4NJ9H 3WHE1 1X5HA 5D7LD 4YBLC 4EBQH 1YEDA 4HJGB 4LLMA 1HI6B 3DXAD 3C5JB 2VDNL 3K0WA 3VGGA 2EDXA 4LCIH