3O41A

Crystal structure of 101f fab bound to 15-mer peptide epitope
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
220
structure length
217
Chain Sequence
b'QVTLKESGPGILQPSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARLYGFTYGFAYWGQGTLVTVSAAKTTPPSVYPLAPGSANSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mouse monoclonal antibody 101F Fab light chain
publication title Structure of a Major Antigenic Site on the Respiratory Syncytial Virus Fusion Glycoprotein in Complex with Neutralizing Antibody 101F.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/viral protein
total genus 39
structure length 217
sequence length 220
chains with identical sequence H
ec nomenclature
pdb deposition date 2010-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o41A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3o41A01
3WUWG 4OLUH 4DKEH 2H8PB 2FZ3B 5FF6B 3U0TA 3LMJL 3U6RA 1E4XL 1BMGA 3I84A 1TCMA 3RIFK 1HZHH 5IMMB 4DVBA 5E2VL 3MRKA 3B2UD 5D7JA 1XF3B 3DSFL 4NPYA 1NFIB 3RNQB 4FTVA 2AK4D 4XMLH 3R06B 3RA7H 4Z7OF 3BH8B 1HKFA 1K4CB 5E08H 25C8H 1IJ9A 1A3RH 2GITB 5GS2D 4GKNA 4HIEB 2AJXL 3UYOD 3HUJF 3TIEB 4M9OA 1ED3B 1FIGH 4RZCA 2PR4H 3ZO0A 4NUGH 1CFQA 4P9MH 3V8OA 4UIMB 2D7TL 3NZHH 1J1OL 3BD4A 4WV1C 4YDLB 4H8WC 2BVQB 2J8OA 4R7DB 5E24E 3QDGD 4OFDA 1AHWA 5L2JA 4KAQH 3OJMB 1LVEA 5IFJB 3KJ6H 4CRPA 1N5AA 4V1DA 1CF8L 3PWJB 1MCRA 4AIXA 2CKBA 1PX4A 4XCEB 4UT6H 4X8JA 3H42L 2XQBH 3WIFB 1I1RA 3RUGA 5FO8A 1S3KH 2FBJL 1KJ2B 4LVHB 4O2FB 5HDBF 1IAIL 2WWKO 1G9EA 4RBPH 2HTLD 5F7FA 4OZGF 3ARGD 3DJ9A 1UKTA 4ZYKA 1N59B 2XWTB 5CD5C 2LAGB 2IPTL 5F70A 1IGFL 4UTAL 5I1LA 1SY6L 1P5VA 2YXMA 1MCWW 2DN7A 4U6HA 4X6BA 5ICYB 3FB8B 4WWKD 1HWHB 4NKOB 1KBGH 5BV7H 1RIVH 3WE6B 5GGTH 1J87A 4HWBL 4PJIE 4AMKH 5ID1A 1EJ6A 1GPOH 4K8RC 4P57B 4XWOC 2WNGA 4U6YA 5D7LB 5BZDA 1JNLL 6FABH 3JWOL 1KTLA 3O3EA 4BUGA 1C5BH 2PW2B 5TDNB 3GK8H 3O11B 3ECBA 1TZHA 3VD3A 2ZCLL 2BRQA 5BVPH 43C9B 4LMQI 2HVKA 2JJWA 4MNQD 2HA1A 1JHKH 4JZOB 4L3CA 3S98A 1AGCA 3OHXA 4KKCD 3WN5B 1CD1B 4ZS7H 1YEFL 3ZSSA 1IQDA 4JQXA 4CN6A 5EO9A 3QA3A 2HKHH 1SJEB 3MGTA 2NY5H 2YA1A 3EDKA 1EEQA 4QHLB 3VMPA 2B1HL 4EN3C 4YR6A 1NGQH 4JN2A 3MSPA 1S9YB 1AC0A 4J3TA 4HXBL 5JO5B 4HV8B 2FX9L 4KK8C 3MCKB 3SKOA 1F5WA 2XICA 3ARFC 5B22A 1QLEH 3ZKXB 2EYTA 3MLWH 1CK0L 1YNKL 1IFHL 5MEPB 3LKOB 2D0FA 2GJ6B 2X1WL 1QFHA 2CUMA 4N0UA 5ALBL 3P0VL 4HIIA 4XVTL 4ZOEA 5E1HB 4IOIB 5FECA 3OKMB 1MHPH 1RPQA 5J11B 4TSCH 4DUXA 2UVEA 5DURB 3TIDB 3V0VA 2E7LC 2PTUA 1MLCB 5LQBL 1G0XA 4R96B 4KK6D 3PG2A 1PSKH 1S7TA 4O4YH 4HF5L 3O4LE 2DIBA 1JL8A 2ZG3A 2VXQL 2DM3A 3GSNA 4NM8H 4HC1H 5EUOF 3HUJA 5F7EH 3L95A 2VDKH 4L8BA 4WY7H 5BS0B 1R0AL 1LK2B 3DXAD 5IEHA 5JOPD 4HDIA 4DVRL 1CFBA 1H5BA 2JCCB 1DP0A 5DRZB 2HTLC 4NQVA 4PRPA 3SY0B 4QRUB 1V7ML 2XNAA 2HFFA 4QRPA 1U58A 1QNZL 4Z6AT 4Z0XA 4GKOA 2ERJC 1U8MB 2C26A 4OQTA 4ZUTA 4QHUB 4DGVL 1X5ZA 5L2KB 5TE7H 5JHLH 1MREL 5EZLA 4Z18A 1KT2B 5D7KE 2R4SL 3AY4C 4Y4KA 1EH9A 4PJ8A 4FQXB 1ADQL 3RWFB 4C4KT 4P2YA 3KPPA 1XGTA 3WXVH 1TDQA 2PTTA 4G8GB 5FYKU 3VE0A 4FABH 4JR9L 2WIIA 3HZVA 5CEZD 5TDOB 2DBLL 3QULB 1XIWB 3UBXG 2AJVL 1A4JB 4Y1AD 4ELMF 5SX5H 3QO1A 4KKCC 1XR8A 1PD6A 1K3IA 1PLGL 3CFEA 3KYMA 5EFIB 3FQWB 4P2OB 3UC0L 5DUBB 1I7TB 3FQUA 3VFPA 4HD9A 5CJQL 3QNXA 2HLFC 3WNOA 4KQ3L 3PV6A 4LVNB 4OGAD 5JIKA 1RULH 1Y6KR 2BNUA 3BEVA 1EDQA 5C09E 3TJHD 1ZKAA 3L3KB 4WTXA 1G7IB 5F6HI 3SBWC 3DI3B 2O93L 1KELH 4AEHH 3DETD 2HJFB 1YYML 4QCIA 5CD3A 5ERWB 5HHOB 1FO0H 1XAUA 1IGIL 4L9LB 4PUBH 3WS6C 1NC2D 3CX2A 5E6IA 4GRLC 2V5TA 4MQSB 5I1KL 2J1KA 3QO0B 1N8ZA 3T04D 3GSXB 3QXAA 2R0KH 3GNML 2BZDA 1JNHB 2Y6SD 3BMWA 4DTGH 3LZFH 4K94C 4IOFC 2W91A 1Z9MA 2GTWB 1T20B 3RJDA 5DJAA 2FO4A 3SGEH 5HPMA 4NN5B 3O0RH 2OX5A 4RGND 1Y0LB 1TVBB 5AWNL 5EO0B 3EZJB 1OTSD 2AJYH 1OP5H 1YEJH 4YNYB 3QSKB 3VRIA 3MLVH 4GLRH 4MX7A 5L8KB 3VXQA 4NFDA 4S10A 5FB8B 3G6AB 3SDAA 4NZTL 1I1AC 3SDXB 1TENA 3BPLB 2EH8H 1MAMH 5DHVA 1JV5A 5C92A 3PABB 4XP9H 3ARBD 4OD1L 5EUOA 1RHFA 3W39B 5DD0H 5GJSH 2R23A 2YXFA 4FQHA 1A0QH 4S2SB 5TPWH 5HD8D 3DGCR 1QBLL 1B2WH 4QXTA 4I4WB 3UTQA 4XCCH 4KWUA 5EU6E 3MJ7A 5E9DE 2KZ1B 3WLWD 4AH2A 2BNQD 3HI1B 3MFFA 5CMAB 3VFVA 5DJXB 2VTFA 4FZEH 3MGAA 1JN6B 4KJWD 4X6CB 3LH2L 3TCXA 5IVNA 1PEWA 1G6RL 3PXJA 4WI5A 3JTTA 1FL5A 5I1GL 4JFZH 3TJEH 2Q76A 1SQ2N 2GY7B 3C6LB 4PLOB 2JB5H 3LPWA 15C8H 5EZOH 2J88H 4FFYH 3MRJA 1D5MA 1U9KA 3RWDA 4OIIH 5TFSH 4XXDA 4X6EB 1BVKA 2DM2A 4UUJA 5I1EH 1FZOA 1OTUD 1EERB 1G7PA 4UAOB 2ORBH 3GMRB 4GG6B 5I17B 2FSEA 2CRZA 3GBNH 2CKNA 3QXTA 3C6SB 2GK0A 4OZ4A 4XC3H 5TQ0H 5MHSD 1DLHA 1AXIB 3OAZK 4KDTC 2VMFA 5TDPA 2LV4A 1E4WH 3GMQA 4KI5F 4ZPTA 5E5RB 4N8CH 5J9PB 4Y5VA 4ELMA 4ONGH 2DQGH 4OM1L 5JPMA 2VAAA 1ZT7B 2D7OA 2WBWB 3NAAH 5DO2C 3I6GA 1KLGB 2NY1D 4P59L 1T04B 2FB4L 3DETC 5DK0A 5GGSB 2ZUWA 1JVKA 5T1DL 3VD5A 3UJJH 5FKAB 5KJRL 3IDXH 1T2QH 4DN4L 5ICXA 3IFOA 1EEYB 4MJ6B 1FN4A 3IKCB 3QDMB 1U8NB 3V5KA 3GB7B 2XTJE 3CDGB 2Y6SC 1GH7A 4N1EA 1V7NH 1QFWH 3EOAB 5CBAA 1QO3A 1PZ5B 2RB8A 2DLGA 4OQTL 3O3DA 3TNMB 5MI0B 5AG8A 1I8IB 3VXUE 2F53D 4P46B 4X6DB 1BZ7A 3P9MA 2WIMA 3RU8H 1RZJC 5EH1A 3VGDA 4ZXBA 3C60A 4F8QA 2FGWH 1T7VA 1YJDH 2SEBA 2YD4A 4XHQA 4MQ7B 3JTSA 1MNUH 1V3JA 2V9RA 1LP9B 1CI5A 3QUZB 4UBDD 3RVUC 2A9NH 2ZCKH 2X4UA 1F00I 1WGOA 2DTMH 3LKQB 1RZIB 4MNGA 5C9JB 1A3QA 5HHPA 4PGCA 5DS8A 3OKNB 3QQ9D 3D6GA 4I3GA 2VXSL 3NOIA 2NLJB 4HT1L 3VXSE 2WBJC 4IRJB 5C09A 1CZ8H 1KF9B 4LDOB 5TJWK 1ZT1A 1CFSB 3DV6B 1IAKB 5I1IH 5C0BD 1QSED 4G6KL 1T7YA 1EEZB 4R0LA 2V17H 4L3ED 3MXWH 4OKVA 2BNRD 4KJWC 3T65A 1JNJA 3MOAH 1JZ7A 1JP5A 2OJEB 2OJZH 1S9XB 1QYGL 3BQUD 2VN4A 1I9IL 3W2DH 2ID5A 4PB9L 1OP3K 3MNZB 2ZCHL 4U1NA 5GGSY 2BY2A 2CIKB 4PJ5B 2ZUUA 1OTUC 3V6OC 4K71B 4I5BA 1TETL 3N0PB 3O3BA 3GM8A 2VLMD 4PFEA 3ARZA 2XZCL 4OBRA 3RNKA 5FHAH 1KPVB 3HG1D 1C5DB 1EFXB 3CVIL 1E4KA 5JXAH 3BW9A 2XRAL 4XH2B 4C83B 1T5XA 3CD4A 1RV6X 1JHTB 1MFCH 5IQ9A 5I8KL 3HZYB 3R8BB 4C56E 3ULUL 1ZSDA 1U3JA 1N64L 5J6GB 3UPCA 4NNXB 1T0MA 4YUEH 5EOTB 1DBJH 5DK2B 3ROOB 4AEEA 4V1DD 2DJSA 2BSSB 4WFFE 2V7NA 3HPJB 1JUFB 4NP4L 35C8L 3FO0H 1ZHLA 4X9HA 1X5KA 2VZSA 3E0GA 2DKUA 4MA7L 4S0TD 1HI6A 5TF1L 3VXPB 2Z92B 3P73A 1MY5A 5E9DA 5FKPA 4F33B 1DL7L 3BKJH 2P46B 2YPVH 1Q72L 1AP2A 2D3VA 2XTLA 2V9TA 1M71B 1OCWL 1NCUA 5IW3A 3WIIH 1UB6A 1JI1A 2EXWC 1EZVY 3O41B 3RWCA 4F37F 2NXYD 5FYLH 1KTDB 1IKNA 4BFBD 3GMMA 4QXWA 1QOKA 2IQ9L 3HC3L 4D2NA 2O5XL 1HNFA 1VB9A 5HGDB 5GISH 5JW3L 1KULA 2LTQB 3OG6B 5F97E 4MHHI 5FGBC 5D8JL 1RZGA 3DLQR 1NEZG 5FIEA 2NY4D 1EA9C 1YMMD 3UTZA 1LO4H 5GRVL 1F6LL 4PJFE 4JKPH 4HJJH 1DDHA 1SEQL 2VDRL 3QUXD 5ABDE 5KVGH 2VXVL 4JRYD 1YNTB 1FNHA 3S5LG 2CLRB 2CRIA 3ARPA 1QLFB 4M6MH 4YDIL 3IAGC 2CSPA 4IDJL 2IALB 1UQSB 2EDWA 3AGVA 3MLRL 3OSKA 4PRHB 1DQJB 5ALCH 3BKMH 1QG3A 4Y16C 3RVXD 4GQ9H 4YZFF 5GRVK 3KDMA 4JZJB 4NSKB 5IWLA 1OAXL 1XGRB 3QUML 2IEPA 4Y4FC 2BHUA 4E41E 3U2SA 1KLFA 1WIPA 1MVFA 4WO4C 2XN9B 5IG7A 4WU5A 4GSDL 1U8JA 3NIFE 1JGUH 1LO5B 5BVJA 1DANT 4P4RA 3OJ2C 1U3HA 4OLVL 4CVWA 1W72B 4KZDL 3FB6B 2AQ3A 5M94B 4A6YB 1A6TA 1NDGB 4PJFF 5E56A 5HGHA 4ZQKA 5MENB 3LRSA 2DLIA 5KSAD 4OCRL 5JUEH 5D7SH 2Q7NA 2W9EL 3KGRA 3EFDL 1WFOA 1N4XL 4OGXH 5D6DC 3VMOA 3O6LH 3MBED 4G43A 4WHTA 2OR8A 4IHOA 3RKDC 4JO3H 3QIBA 3SE4C 1KCKA 3RBGA 3FKUS 2IC2A 2DMKA 3QFDB 5I6XB 3VXSA 3TH3T 3DROA 2OZ4H 2FX7H 1PY9A 2H32B 2DQJH 2VL4A 2NTFA 1CE1L 5GGRB 5BRZB 2J3SA 4OZFG 2AI0L 2R4RH 5DZOA 4GXVH 4NWUL 4ZFOB 3NIFF 3A6CH 3BZ4A 1GL4B 3D2UD 1IQWL 3KPRB 3HNVL 1OTTD 2BJML 5DC4B 1CL7L 3QYCA 4LIQH 4PJXE 3U7WH 3KPOA 2HT4D 1S7UB 3RL1A 4OAWB 2XQYG 5KZCB 3N9GL 4I48A 3ARTA 1KEGL 1XGQB 1IC7H 1MWAH 1BWMA 5C0RH 3BPOB 1MRDL 3LQZB 4AYFA 4LFHG 3MC0A 2GCYB 1E27A 1AE6L 4PJ9B 2GFBB 4Z77A 2IANB 4MD5A 1NMAL 4WGVB 1IGCH 4QO1A 2R56L 4HJGA 5I1HL 1D6EB 1OGTA 4ZO8A 1OB1B 3CLEH 4YH6A 2CR3A 1NMBL 1U2HA 4TN9A 1EMTL 4MCZB 2OSLA 3SJVB 5DJ6B 2VR5A 2EIDA 5T33L 1LE9B 4Y19D 3IJHB 3V4UL 3SE9L 2JK5B 5SWZB 1A6ZA 2J4WH 2IPKA 5DJYB 2WWMD 4L4VE 1BD2E 2CO6B 1UJ3A 2FD6L 5AD0A 4H1LA 2F74A 2D31B 1NCWH 3LKPB 3S37X 4WW1B 1ZV5A 4LRIA 2AXFB 5B3JE 2F54E 3HI6L 5E6ID 3V79C 1UM5L 2BRRL 4FP8H 1R5VA 2I5YL 3E3QC 4XNMB 1HYSD 4Z7WE 2CJUH 1CGSH 5I66A 4U7SA 2P5EB 2DYPD 5DJ8A 5IHUL 5GGRY 2F5AL 3T0EB 1EK3A 4Q0XL 3X12B 5KSAC 4H25B 3CVHB 2HH0H 3K1KC 4HH9A 3OKOA 1N0XH 2ICWI 5I2IB 5CP3A 3VWJC 3UEZA 3DX9B 3HAEH 3ELAT 4HX1B 4PY7B 5F3BA 4N0YH 4WEBL 2Y9RT 4F9LC 2GIYA 1MF2H 5ESQB 4MD4B 5GSRB 1FJ1B 1FYTA 2I9LB 3HE6D 4HIJA 4PJFA 3OKLB 2FHCA 3SDAD 3EIFA 3OB0H 4P9HC 2Z35A 1D9KD 4OTXH 2HT3C 5LGJA 1OAYH 3IDUA 2Y06H 4JDZB 4M62H 2IFFL 2NY3B 2PXYA 2DQUH 1M7DA 5DHYB 2JIXA 5B3JF 2G5RA 4BSVB 4YHNB 1B3JA 4AK1A 1V05A 5FO7B 4YXKH 1UEMA 4NQEE 4UIKH 4Z7WF 1X5LA 3IU4H 3BXNA 5EIIB 4V2CB 4ELKA 4JM2C 3B43A 5F96H 4XBEL 4JPWH 4OIBA 4E41A 3E1F1 3LSOA 5FFLA 3KLAB 1MVUA 2L4OA 4U6VL 2V2WA 1Q1JL 4JG0L 1OAZH 5LGHH 5I73C 3QFJB 4G6JH 4EXPX 3VCLB 3MRIB 3ULSA 2AXGA 5HHNA 3OWEA 4YX2H 2VLJE 2VLRD 3K46A 1CLCA 5E94B 4LSSL 2AJSL 1KJMB 1KV3A 2JB6B 3V0WH 2AKRB 4WI6A 1MRCH 4JHZA 3IGAB 4G7YL 3N1QC 4XNQB 3L1OL 3O4LD 4M1CD 1T0NB 1CLOL 4BH7B 5IW1B 4UILL 1MFDH 4GAYB 3TNNA 4UU9A 3G5ZA 5C70A 4YDJA 4ETQB 5J1TC 1FVEB 3WIHL 4FFWD 2M2DA 3MRMB 5IIEB 3FMGH 4PLKD 5E2WH 4I0PB 3DHMA 1UKSA 5C0FA 4M6NL 3IDMB 4ZTOH 4X7SL 5F88B 1P4IL 5HGAA 1KYOJ 1BAFL 5D2NE 3FTGA 5F8QC 4P23B 4LPYA 3NIDF 2E7HA 3RZCB 3HPLA 4PJXA 1RUKH 4FXKA 1R3LA 1FNGB 3RVTC 1NFKA 1QRNB 1KPUA 2XPGA 3BT2L 4JANB 3KPSE 5GXBB 1U42A 4FQQA 2JF1A 3C8DA 5KW9L 4L1HA 2NY6C 2HT2D 2J6EL 2Q7YA 4J6RH 1CXLA 3GBML 4O2EA 5T3XL 2FECI 4G9FE 4J3UA 2BDNH 4PV8B 4CVXB 1LK3H 1KJVA 4GS7B 2MHAB 3FO2B 4DFHA 4LAQL 2GI7A 4YHIA 4Z5RB 3C60D 5IB2B 3MRGA 2DD8L 3PQYA 3QEQE 4LHUG 3UJTH 1BVLA 4P5KA 2V5SA 3HE6C 1DQLH 2W9DH 3MV9B 3INUL 2DDQH 3B5HA 1JPTL 2FLBT 3WFEH 4LEXH 3DURA 3HZKB 3U36B 3VFNB 2Q86B 4FFZH 1IM3B 3UTTE 1JF5A 1S7VB 4UNTA 3MUZ1 3MRLB 1YECH 4JRXE 1TTUA 3ZDYE 1NSNH 4QRRE 4HWZA 3SO5A 3RDTA 4WFGE 1OF2A 3JWDL 1ES0B 1BD2A 2OCFD 5IBUB 3V6ZA 2FYYB 3QI9A 4F37K 1HEZA 1WV7T 3UTOA 4GH7B 1QZ1A 2VKXA 4I3RH 3CXDH 1NLBH 4M7LL 5IT2H 1LE5A 5DVLA 3ESVF 4XXCC 5CSZB 2F54A 1T89A 4JY5H 2R0LH 3O6MH 1T22B 2ESVA 4GW4A 3QQ4B 4Z7WA 3WFDH 3PWUA 1PYWB 2N7BA 1Q9LB 3OKEA 3BN3B 4NDMB 3BRDA 4H26B 3G08A 4LPCA 3WKNA 5J1AB 1JPFA 3PP4H 4D3CH 4G8EB 5D70H 5KVDH 3TBVB 2AEQL 1SYVA 4XCYB 3RVWC 1EO8H 2ADIA 2ZOKA 3ZTJH 4LBEA 4NRYB 3ZTNH 1X5AA 1K85A 1A7PL 2AEPH 1TJIH 2QSVA 3RL2A 3ZDYF 1EGJH 3REVB 1OP9A 2KUTA 2YMXH 5I1AB 2XZQH 2X2YA 3EJYD 5GGTA 1RZKL 4TULL 4DGIH 3FRUA 2QQKL 1AR2A 5IROC 3V4VL 5C0DB 2G60L 4RCAA 2DLEA 5FV1L 1JGDA 1RJZB 4PJCE 1IGJA 4KHTH 5IR1A 2BSED 1CU4L 4DJMA 4UV4L 4RFNC 4WGWB 3DO3A 1FFOB 5C0GA 3L9RB 3VI4F 1DFBL 5B4MC 3H3KA 2DIJA 4NQEA 2G75A 2AV1B 6CGTA 4OZFH 5HYIA 5SWSD 2LABA 4ZO7A 4JFDD 3D39D 1ZGLM 4J12A 3MRFA 4JPKL 5FOBA 5JTWA 5KN5B 1QLRA 4LP5A 5EU6D 4CDHA 5E9DD 1VADA 5DZNA 2H1PL 1MAKA 3PWVB 2X4OA 1F3JB 1I8LA 1NCCH 3CZFA 4EN3B 3AM8A 2ENSA 4YEFA 4ZDHB 4OGYL 1L6ZA 1P69B 1AQDB 2E6JA 3B2VH 5E2TH 5L8LB 3CFDA 2EC9U 5CJ5A 3ARFB 3B5TA 3FT4B 4PY8I 4J23A 2VLJA 3CSBA 1NC4B 2DMCA 2VDPL 1BBDL 1CICC 3LQAL 4MXWL 3VFTB 5LBSL 1CDIA 1OW0A 1OOAA 1C16B 3LEXB 3K4ZA 5DI8B 4P99A 4MJ2A 4YIQB 1A9BA 2D2OA 5IJKC 3HHRB 3PJSB 4WI4A 4Y2DC 2B39A 3V5HA 2X4PB 1T03L 2MWCA 4WUUA 3MO1A 3OGOE 1ZVHA 5EOQH 2NYYD 2VH5H 4NQXA 5F44A 1E28B 1U92A 4F80A 2VB5A 5KTEL 4I18A 5D2NA 4LSPL 4ZPVA 5TE6L 4X7EC 4D8PB 4PJEB 3O3AA 1FGNH 1MCDA 4HC1A 2XTJD 2GSGB 4Y0GA 2VITA 4CADA 3HS0B 4LEOB 3B5GA 4HHAA 1X7QA 3S6CA 5IESL 4NKMB 4PRIE 3PIQA 4G9FA 3VXUD 4MZ3A 3SKJL 5GGQL 3JV4A 5CUSH 3ZKSD 1C1EH 2WLYA 1F90L 2HG5A 1LO2L 3ES6A 4PG9B 1IKFL 4OKDA 2ERJB 3L5XH 3QEQA 3GUTA 3VD4A 5I8EA 5LGKA 5HYSG 5EIQA 2C1OB 5EZJB 4JFXA 5DXWA 4HKXA 4JQIH 4MLIA 4HMCA 3EJYC 3CVHL 3ARUA 3G6JB 3WUWB 2Y07H 4NJAL 1ZHNB 3FZUC 4X99A 4HKBB 3UTTA 2YBRB 4QTIH 4DKEL 1KNOB 3PWNA 2ADJB 2LVEA 4OSUH 4YPGA 5E8EB 4HWEH 4JRXA 4PRDB 2A6IB 1NBZA 1TVDA 4QRRA 1HZHL 2BFVH 3L7EA 4CVUA 1Z3GH 5KANI 2OL3H 3NACH 4BH8B 4R26H 3EJJX 1QA9B 3DMMD 3VXSD 4DUWA 3RA7L 3LS5H 2NY2C 1XMWA 3PGDB 4Z7UF 5E08L 4YGVB 1A3RL 4N0FB 3IFLH 4WTZA 1K5NA 5DMGD 3WLBB 3OG4B 1J8HD 2P5WB 4G6AC 1MJJB 1FIGL 1PAMA 2PR4L 4NUGL 5KVEL 4LCCC 2GJ6E 4UOW1 1GJIA 3T0BA 1P7HL 5JOFA 4ORGB 4KAQL 4OV6F 2A9MH 3KJ6L 4EKXA 1B0RB 4UV7H 3GSWA 4APQD 5FDYA 1VEOA 4UT6L 5DD1H 2XQBL 5E8NA 1D5XB 1S3KL 4GRLB 5TF0A 1Y6NR 1F6FB 1FO0A 2XXMB 4NN7C 4R8WL 5D1ZA 5IBLC 4RMRA 3NFNA 4AM0A 1FC2D 5BS0E 5DA4A 3AFLA 2OXGA 3E6FA 4U1LB 5ACZA 3NPZB 5I1JH 2FO1A 1I7UA 4M9PA 4KUCF 3QT2A 2JCCE 4C56D 4P5TC 2DWDA 2ZUXA 3DUUB 5BV7L 5I19H 4PJCA 4G80A 5GGTL 4J4PC 4RBPK 5DEZA 1GPOL 1A7BA 1EUTA 5F7NC 5LWYH 5E8OB 4WFFD 1C5BL 1I1AB 2VLLB 4OLYH 1AXSA 4XNYH 4DKDC 3CH1B 5K59F 5L2KE 1HK6A 5BVPL 2H8PA 2OP4H 1A7OH 1KCLA 4DCQA 2GKIA 2AAVA 3NFSH 1WFNA 2W92A 3U9UB 1Q38A 1XF3A 4ZS7L 4G8GE 1S8DB 3KYNB 5BQ7B 1MIEH 1K4CA 2BY0A 5EB9A 2HKHL 2GITA 5T1MB 3VW3L 4KU1A 3TIEA 3QISA 4JGJA 2DTSA 1NGQL 3CMGA 3SDDD 1UYWH 2F8XC 2BVQA 3P4OA 4JFFB 3F7RA 1QLEL 4HGMA 5CHNB 3MLWL 3ULVE 5IFJA 1A1MB 3TA3C 5F6HJ 3BMVA 2IBBA 1AD9B 4NOBA 3EYVB 2R1YA 3AREC 1WBZB 4F7MB 1OAKH 4U7MA 3EZ8A 3CFCH 4O2FA 1XF5B 1MHPL 3JSSA 5EA0H 4TSCL 4HBCH 4CBPA 1EBPA 3RWGA 1DVFC 5CFHA 1N6QH 2XWTA 5C0AB 1HILA 1MCPH 5F9OH 1DBMH 3DYPA 5I8CB 1E6OH 4HFWB 3CFKB 1CFTB 3MJ8A 3PL6A 1K8IA 1PSKL 3FFCD 1INEL 1ND0B 1U93B 4O4YL 4POUB 2Q6WB 3O6FD 3REWB 4NM8L 4E41D 4HC1L 4NKOA 2AVGA 4OIAA 5F7EL 4APQC 4QT5A 2VDKL 4D9QE 4WY7L 4PRIA 2F58H 1NC2B 3DUSA 1ROWA 2HFEB 3AS3A 2BVTA 5I15H 3SDCC 5IVZB 4YGAB 5JMOC 1ORQB 2XWBA 4XB8A 2PW2A 5TDNA 2B4CC 3O11A 2B7DT 2AK1H 3WMSA 4F9PA 3I6KB 3OV6A 2ITDB 43C9A 2VC2H 1YYLH 2Z9TA 4ODSL 4R97C 5GPRA 1TJGL 3SDXE 4M5YH 3WN5A 4O02H 1CD1A 5JHLL 1JRHH 2DKSA 5IFAH 1OL0A 1SJEA 2DIAA 4ZUWA 1I9EA 5HVGB 1G7MB 2XA3A 4HKZB 3PWPA 2EIBA 4XB7A 4RFEB 3V5DB 3WXVL 2EDTA 4POZD 3O3UN 1S9YA 4K8RL 4FABL 2YWZA 4L8CB 5I0DA 4GT7A 4JB9H 3UBXB 5IMLB 3BZFB 3WJLC 1X5HA 2Y7QB 1YY9D 3PGCB 3QDAA 4FQLH 4IM8A 5MEPA 4R2GC 4NO0B 4DAGH 2V5MA 2GJ6A 4NO3A 4X6CE 1RVFH 4GW5B 4RMQA 5KOMC 1HSBB 1EBAA 2WBJB 3P0GB 4ONHB 3HR5A 3OKMA 4HG4J 3U4BH 3LRHA 2YHGA 4I13B 4UDTB 5H8DA 5CZKA 4NO2B 3MREB 3P40A 4JFQB 5JR1H 1DR9A 1RULL 5DZLA 5HHXL 1KEMH 4GG6E 5C86A 1KELL 4AEHL 1EX0A 3MACH 3ZDZF 1JGEB 5J06A 1FO0L 4PUBL 4FHBD 1XF4B 1AD0A 5BS0A 1ZK9A 3MZGB 3P4MB 4OD2B 2EDXA 1LK2A 5EBLB 2AEIT 2BY1A 2R0KL 4EIZC 2JCCA 4JO4L 1GOFA 1K4DB 3SY0A 3GMPB 3SOBH 2VDNH 2J5LC 4GAGH 3L3DB 3O0RL 2A6KB 4I8DA 1KB5H 3RDTD 3QDME 3FCTB 3NIGF 1UA6H 1VPOH 4L4VD 1BD2D 5GZND 4QHUA 2ITCB 1KN2H 1RSFA 2AJYL 5ID0B 1YEJL 4N68A 5ANMA 5EPMA 3O6FC 5F89B 1KT2A 1KTRL 3MLVL 1NBQA 4U05A 5H37H 3WHE1 1IC4H 1WTGT 3RWFA 4PBXA 4AL8H 5B3NA 2B0SL 4LDEB 4EBQL 1FNEB 3IF1A 4G8GA 1MAML 5ELIA 4MJIA 1HINH 4H20H 4QY8A 2W38A 4YHPB 1DUYB 4XP9L 1OP5K 1LP9E 1AIFB 1U41A 2NQCA 3M1BB 5DD0L 5GJSL 1A4JA 2Z31A 3TH2T 1A0QL 3KNBB 4ODWA 5TPWL 4U1IB 1BECA 2W0PA 4RAVB 1HHIA 1S7WB 3FQWA 4P2OA 3ALWA 3VDBA 1MFEH 3CSPA 4XCCL 5DUBA 4WNQA 1I7TA 1DBBH 3L3IB 3PUCA 1M05B 1AFVH 4IRSC 4FZEL 4LOUD 3S3JA 3S35L 2BVYA 2JE8A 4JFZL 4RMTA 1J05A 1J18A 2GUOB 4M7JH 5DRWA 2EE2A 4ZG1A 5T1LA 2JB5L 15C8L 1P7QA 5EZOL 2HN7B 4HUUB 2E7BA 4FFYL 4PLJD 5GHWH 5TFSL 4L9LA 4D0CA 5I1EL 1YY8B 1ERNA 1NAKH 2ORBL 3P9LB 4NNYA 1FVCA 1B6UA 2VYRE 1R24A 3GSXA 1FNLA 3IKKA 2X41A 4ZOBA 2GTWA 1E4WL 4PJGB 2R39A 1CWVA 3QIUB 2VERN 4JFOA 4QTHB 4N8CL 5IVXF 4G5ZH 5IEKA 3H0TB 4WVRA 4Y16B 3NAAL 3LPFA 4X5XA 5EO0A 2XKNB 4P2CG 3GJFB 2G5BA 3QAZB 4Q9BA 1VACA 3FONB 4FXGB 3SCMD 1I7RA 3WO3B 4YNYA 1BOGB 3CZJA 1NGPH 5HVWA 3IDXL 4Y4FB 1T2QL 4JO2H 4WO4B 1JFQL 3THMH 1IZKA 1R5IB 1CD9B 3SDXA 3KR3H 3RWEB 5BW7A 4R4ND 1QFWL 2XG5A 3OF6A 2VISB 3PV7A 4OZHF 4F2MA 5I76B 4D0DB 2R29H 1I1FB 3W39A 1CGUA 1H15B 3C5ZA 5DUPH 3JVGC 5GZNC 5GSVB 2HTKD 5E8PB 1H0DB 2FGWL 1YJDL 3AROA 2RJMA 4FG6C 4LLWA 3TZVC 4I4WA 2IBZX 1I1YB 1FFQA 1NANI 2A9NL 1H3UA 4U1SA 2ZCKL 3HI1A 4NRXB 5CMAA 5H35B 1BFVL 1JF6A 5DJXA 4U6TA 2DTML 1U36A 3JWOC 3NCJH 5B38G 4IMKA 4QRSA 2YZ1A 4EQ2A 3KPSD 1BJ1J 5DRNA 4CL7A 2YN3A 1PKOA 3MRDA 4KMLB 4KMTL 3QUKA 1BQHG 4X6EA 1FG2A 4J2XA 4P2RB 4O58H 3GMRA 1CZ8L 4GG6A 2YN5A 4GRWH 3D85A 3EYUH 2MQ3A 1PG7W 3C6SA 5I1IL 3QEQD 4JZNB 4X9BA 5D72H 5JPNB 4YHLH 4YBLC 2V17L 2I24N 3MXWL 1HIMH 3MOAL 2OJZL 2Q1EA 4OGZA 5AYUH 2H2PD 4CJ0A 3W2DL 4N1HB 1WFUA 1MWAA 5SWQB 2ADFH 1CTNA 5GGVH 4CVZB 1WC7B 5FKAA 5GS3A 4WW2C 1K6QL 2ARJQ 1KB9J 2ZUVA 4NOFA 1EEYA 3MRHA 1BREA 3QDMA 3QEUB 5E95B 3TCLA 2CPCA 3MV8A 3STLB 2BMKA 4HCRL 5FHAL 5E1AB 4TVPE 3RY6A 3IDNB 2ICCA 1PZ5A 1S7RB 1U8QA 1RMFH 3MRPB 2XN9E 2GTZB 3MGOA 5JXAL 1I8IA 2ZPKH 3TPKA 1LHZA 3DVIA 4EIGB 4P46A 2OI9C 3X13A 1OARH 4ZOCA 5FGRA 2NW2A 5FGCB 5E7BA 3SCMC 4Y5XC 3UCRA 1UENA 2DLHA 3DVNB 4MQ7A 2W07A 1I3GH 3ARDC 4AIOA 4YUEL 4BK4A 1DBJL 4HGWB 2IH3B 2Q87A 3VGFA 4YQXH 1V3MA 2CLZB 3LKQA 4DEPC 4YBHA 5HI3C 2UY6A 1OAUH 4MAYD 2JJTC 2C3WA 4OF0A 2P8MB 1VGEH 4U31A 4P3CH 3OKNA 5JW4Q 3PWLB 2H41A 3OJDB 3BKJL 2NLJA 2YPVL 3LB6C 2HTKC 4ENED 3P0YH 5HVFB 5JZ7C 1AGDA 3QHZL 3WIIL 2XYCA 3QWRA 3VWJB 5BRZE 1JPGB 1IAKA 5FYLL 1MCOH 3GBLA 4OZHA 4N90D 2EZ0D 1EEZA 1RFDH 1CDBA 5EG6C 3HFML 4BUHA 3KPRE 2YD5A 3ZLQC 1UXSB 4ZFZA 5SV4A 3U0PB 3T2OA 2ZWLT 5GISL 5D7JC 3QG7H 3S97C 5IOPA 4N5UA 3MNZA 1L9MA 3M17B 4XPTH 1KIRA 1HE7A 3MNVA 4MB3A 2WZPD 2V2TB 3ZYOA 4JKPL 1CDYA 3S5LB 2VZ3A 3MV7D 4XTRC 3D87B 4JGUA 3LN9A 4JG1L 4WIQA 5KVGL 3SGKA 4TRPL 2Y36L 4M6ML 3FQXB 2IANE 1KPVA 5A43C 1C5DA 4JM2B 1M4KA 1NCAL 3BKML 5ALCL 1XCQB 1EFXA 4GG8B 3X17A 2FATH 1IE5A 1DBKH 4GQ9L 2D4FA 4XH2A 1H8NA 4ODVH 2H2PC 4C83A 1J8KA 5MERA 4PGEA 4U1JB 1ZLUH 3RP1A 2IADA 3HZYA 5DVOA 3DVFA 3SJVE 3MA7B 1JF1B 3EW3B 3WDHA 5J6GA 5I73B 1IGYB 4LLDB 1NGYB 1A6VH 1X5JA 3DV4A 3AU1A 5SWZE 3CH8A 2LFGA 2XZZA 2BSSA 3C5JB 5CJBA 4G6MH 2EH7H 4LASH 4ZS6D 4KTYA 1MELA 5CP7B 3OXSB 2I25N 1OVZA 3QQ3B 3VXPA 1EAPB 4OF8A 1YZZA 4M5ZH 4CKVX 5JUEL 5D7SL 3VXNB 3O6LL 4JO3L 2FJFB 2ICWJ 1T21A 5LVEA 3O41A 2P5EE 4X5WA 3VRJB 3BSZH 2BVOA 4HJ0C 4AZ8A 3FN0L 4M61B 1D5IL 1IC1A 3ZKNC 4P2QD 2OZ4L 2UV3A 4ESKA 4GLRI 5IFHH 2DQJL 3W9EB 5D7LD 1A64A 5HGDA 4PV9B 4JDTH 1ZHBB 2R4RL 1CD0A 2WQ8A 2OTUB 5C0CB 4JFEE 3Q6GH 1LD9A 4LNRB 5JORA 4HMDA 5CIPB 4GXVL 5DRXA 4JQXC 4EI5A 3A6CL 2NY6B 4HZLA 3D18B 3I85A 3DX8B 2BOCB 5D2LB 2D7NA 4NYLB 4LIQL 3U7WL 3TP4A 3EYFB 3HE7D 1BLNA 1QLFA 2ZUYA 3O2DA 1G9MH 2EZ0C 1RJLB 3LDBC 1UQSA 3WKML 1ITBB 1DQJA 1IC7L 1MWAL 5C0RL 4Z7VF 1BJ1H 4CUCA 1Y6MR 3GSQB 3VA2C 4IMLA 4XBPA 3G5VA 3SO3C 1NUFA 3CAFA 4JZJA 3QPQC 3B9EA 1J0IA 5I1DB 1IGCL 4TNWF 1JHLH 1O7SA 3QPXH 3T4AA 1RUMH 4MAUL 4EUPG 3CLEL 3OR6A 4MNHB 5ESVA 3T3MF 5D5MF 5HDQH 2M1KA 4C58B 3F7VB 1NUNB 5HI4C 3C8KB 1RZ8B 2MMXA 1A3LH 4MDIA 3FB6A 2JJSC 3QFJE 5J4MA 4NQSB 2P8LB 4A6YA 2R2HB 4KHXL 3VXOB 3QB7C 3W0WB 5JLZB 5DURD 2B8OT 3OJVC 2CO7B 4JVPA 5SV3A 1UACH 1VFAB 1A5FH 3ULUD 3RHWF 2X4TA 2CKBH 2DLFH 1II4E 2P4AB 1TVHB 3QIWD 3BFOA 1LO0H 1CFNB 4L8SA 1EHLH 2ED9A 5FYKL 1Q94A 5EU5B 4KJPD 5DVKA 2CJUL 2H32A 4Y89A 3P2TA 4QXGH 1CGSL 1NGZA 5BRZA 4TVSa 1ZWIB 2ADGA 4U6XB 1QUNA 4X80H 4Y4KC 2HH0L 3KPRA 4UDUA 1PJ9A 4PJ8C 1N0XL 1WAAF 1VGKA 5C0EB 4XMKL 4HBQA 1EGJA 1QRNE 1S7UA 4N0YL 1YA5A 3FB5A 3BRGC 1AKJB 4N0RA 1INQB 3WL9A 4YHZL 1MF2L 1NFDB 4XRCA 4BFGA 5L2KD 3BO8A 4TTGA 3VDCA 1CT8A 2E8YA 2VUYA 4TYUA 3HC0B 4F15C 4QYOB 4L29B 5JQ6H 4FQXD 1F02I 4RNRB 1U8PB 3LEVL 4EOWH 4UMGA 1EAJA 2UZYB 4MD0B 4OTXL 4DWHA 4RFNB 2GCYA 1OAYL 2BX5A 2Y06L 4G8GD 4M62L 3U1SH 4PJ9A 2DQUL 5MP6H 3LKSB 4KY1H 1B4JH 4Q6YA 4Y5YA 4HULB 5K9JH 3EUUA 3MV9E 1OB1A 1BQUA 5I18H 3ZT6A 1XIWD 4YXKL 1LNUB 4UIKL 4NHCH 3OB0K 4HUMB 3HE7C 1PBYA 4JPWL 5C08B 4M1GL 3BDXA 3T2QA 5GJTH 3VDAA 4P2OD 4XCFH 3ULVD 2JK5A 3UAJD 1TNMA 5CCKH 1UWXH 2XY2A 5DJYA 1NDMA 3BAEH 1X5YA 3L3JB 3P30H 3MYZA 1CICB 1OAZL 4OI9A 2AGJH 5LGHL 2UWEB 2Z91B 2P24B 2XOTA 2ZNWA 3C87A 3CMOH 1CGTA 4G6JL 5DMJB 3MRQA 4OJFH 5FYJE 5GS0D 4YX2L 2AXFA 5HHOD 4Z7VA 1RURH 2IPUK 1T2JA 5EU3B 2A6DA 4Y2DB 3V0WL 4HS3B 1HHKA 1MRCL 3S34L 4HIHA 4MA8L 3QCVH 2LU4A 3G5YB 2P5EA 5ENWB 4CN1A 3KPMB 3X12A 2EDNA 1MFDL 5F9JB 3B3IA 4H25A 1IBGH 1F3RB 4LLAA 4UINH 5JHDB 5D5MA 1A47A 3DX9A 3EYSH 1HQ4B 2KL6A 4HX1A 5FHBL 5HJ3B 3ULUC 3GSNH 3FMGL 1HHJB 4JFEA 4J1UA 2ZSWA 1F2QA 5ESQA 1TTGA 3QIWC 1A6WH 1T5WB 4ZTOL 3VG0H 2I9LA 1J9CT 2XV6B 3OX8A 3OKLA 4XBGB 1RUKL 4KKLD 1KN4H 4KK9C 2QR0B 4GKSA 4QGTA 5IB1B 3AB0C 3BKCL 1UJTA 1ONQB 3O9WA 5DDHA 1JZ3A 5IF0B 3OPZL 2Q8BH 3MR9B 1IAOB 4WI8A 2VRAA 4BSVA 1UM6L 2BDNL 4XNUH 2FH8A 1LK3L 4LHUB 1BP3B 4N8VA 1JMXA 2EKSB 1ZGLP 4DKAA 3UJTL 2WV3A 5CILH 1B0WA 1DQLL 2W9DL 4FQJH 4FQXC 3EO1B 2DDQL 3KLAA 1WCBB 2APBA 4JVUA 5KANG 3WFEL 4LEXL 4IBLT 3C08L 4RRPA 4PG2A 4FFZL 4PY8J 1VKXB 3EGSB 2B2XH 1OGAA 1I9JL 1YQVH 1U8KB 2OL3A 12E8H 3QFJA 4P9HL 1J5OH 3C6LD 2NY2B 1YECL 1NSNL 5GIRA 3MRIA 1XIWC 1J86A 1HQRB 4U1HB 5IQ7H 5E94A 3U48A 4FZ8L 1GGBH 5I9QC 1KJMA 2WP3T 3QDHA 2CDFA 4LCCB 4W4OC 1GGIH 5E5UB 3RGVB 1DN2A 4I3RL 4WEUD 1UVQB 4K7FB 4OCLC 1DQMH 1T0NA 3EYOA 4BH7A 1DQTA 3NMEA 2R0LL 3O6ML 3MQIA 2YD7A 4QOKA 4MS8D 2H6PB 1FVEA 2RCSL 4M4RA 5C0ND 2XY1A 3WFDL 1D5BB 4KI5D 4Q6IA 2QADC 3MRMA 3QDGE 5IIEA 4PGDA 3ZDXF 4HXAH 4HUVB 4NN7B 3PP4L 5H2BB 3WYRA 4K7PH 4OLZH 5D70L 3VFMA 5KVDL 4NHUB 3WXWH 4P23A 4PJEE 1IILE 3T77A 4JGMA 4QHNB 1RK1A 3ZTNL 1QRNA 5C0JA 2XWJA 3OQ3B 4GKZB 2AEPL 3P11H 1NCNA 1TJIL 2JTDA 3UPRB 1U91B 3FQRB 3MFGB 1GAFH 1JPSH 4P5TB 4Y7MA 5DC0A 1EGJL 4YC2C 1OLLA 4NN5C 3DO7B 4PRAB 2YMXL 2VWEC 2XZQL 4IEFB 4P46D 2V5RA 2MHAA 4DGIL 4Z5RA 5IB2A 3DRTB 3UROR 1U6AH 1Q0YH 5BXFB 1YEDA 3MJ9H 4KHTL 3MV9A 3VXRB 1I8KB 3O2VH 5E99H 4ISVA 3QUZD 1I9RH 7CGTA 4MCYB 2VDML 5DHVH 4JAMB 4JN1H 3BDYH 3VFNA 2R2EB 2Q86A 3KYAA 1IM3A 4LF3B 4E5XA 2ICEA 1YUHB 4RISH 4KROC 1YDPB 2HFTA 4EVNA 3T1FB 4X4XB 3V7AG 1SHMA 4RX4A 1KIQB 3HMWH 4DZBB 4XP1H 4R0LC 1NCCL 2FYYA 3I02B 4IRJD 5ETUB 4WV1A 5DQ9B 3B2VL 5ITFB 5E2TL 1CR9H 2PN5A 3KPQB 1GGTA 1DUZA 3BD5A 3ZKMC 3WFCH 1X4YA 3TA3B 3TN0A 5DQJB 1CDHA 3RQ3A 4FMKA 1T22A 1OQOA 1W2KT 3AREB 4X9FA 1DQQA 2X4RA 4HS6A 3F58H 7FABH 1GYAA 1U3YA 4FA8A 4M43H 5J1AA 4LGRB 3HZMA 2NR6D 1DVFB 4PJ5D 1JWUA 1E4KC 3BPCB 1YPZB 4QRTA 4NRYA 4YBQD 2J2ZA 3X14B 1IEBB 4KXZI 2OMNA 3EO0B 4PYGA 4GW1A 3FJTA 2DWEB 5D1QD 3GMOB 2R2CA 3REVA 4RAUB 3F7YA 4KI5C 4H1LG 4Q74A 4TNWK 4D0BB 3WNMA 5A2IH 3SDCB 5C0DA 3Q1SL 3FO1A 1JIBA 3CNKA 3KG5A 3VGAC 3VWKC 2WAHA 3WS3A 4N9GB 3W82A 3BP4A 5CUSL 1C1EL 4HZAA 1FFOA 3L9RA 5HYSB 4Z7QE 4R97B 3LCYA 5C9KA 4NT6A 2A6JA 3L5XL 4LLQA 1OWWA 2A0LD 1JTOA 4ODHL 1EXUB 5EC1A 5KN5A 4JQIL 3DYMA 2WANA 2BCKA 3U4EB 1IKNC 4JFHD 3PWVA 2UZIH 1JZ2A 4PREB 2Y07L 4JPIA 5EO1B 1RIHH 1CTOA 3QXDB 4ZDHA 4QTIL 3RHWK 3I75A 3U79A 2XI9A 2IH1B 4OSUL 1QFOA 4JREC 4HWEL 3NA9H 2IQAB 3ARFA 3BP5A 3OR7A 2BFVL 3JV5A 4LCYB 4FQIH 3NACL 1NC4A 4R26L 3U0WH 3SE8H 5J3HD 3TC9A 4R2GB 5TE4H 3VFTA 3LS5L 4TTDC 4F3FB 4PJHF 1P4LB 1KYOK 3LEXA 2X4NA 1NAMB 2ATPB 2P44B 5CEZE 4K3DH 1H3WM 4E42B 1QPPA 5EULV 3HNTH 4NKIH 2X70B 5C07D 3TYGL 3ZMRA 2X7LB 3PNWB 3EFFA 1DEEA 1XCTA 3QDGA 4M48H 4KPHH 1A7NH 4ZFFB 5IWLC 1E28A 4UV7L 4CMMB 5DSCB 2R1WB 1MFBH 1T4KB 4PRHD 4TUKH 1AGBB 2XA8H 4D8PA 5DD1L 1KJ3L 3BH9B 5L7XH 5ICZB 2ZOLB 5EBMB 2MKWA 1PZUB 4PRNA 4TVPD 1U3HC 2VZOA 4LEOA 2FLRT 4LVOC 2AV7B 2APVA 4GMTH 2NR6C 3GIZH 2IWGA 2XN9D 3FT2B 4PTTA 5I1JL 3C5SA 1XGUB 4YBQC 3WNLA 4PG9A 4MXQC 1E4JA 1FE8H 4KH2A 4FNLH 1KB5A 2F15A 3GSVA 5I19L 1G0DA 1PX3A 3WEXA 2C1OA 5EZJA 4BSWB 2EIZA 5D1QC 2W1NA 2C3XA 3JUYA 4E0RB 3OGCA 3SHSA 3QIBC 5FAAA 2OR7A 4XX1G 1W0VA 5LWYL 5MEND 3WUWA 2NY0C 4C55A 1ZHNA 2DL9A 4OLYL 4R90H 4XNYL 2Z8VC 1KNOA 2YWYA 1WJ3A 2OP4L 3GM0A 1A7OL 4GRWF 1MRFH 4PRDA 1ZS8B 2A6IA 4KTEL 3CJJA 3R0NA 3NFSL 2APXA 3GJEA 3OZ9H 2Y5EA 4F7PB 3PGDA 1JWSB 5E6ZA 3GI8L 5HHVH 3WLBA 3FB7B 3EOYG 1MJJA 3VI3E 4NFBA 5FM5O 3T0WA 5AZEH 1A4KB 4UT7H 1UYWL 3KPRD 4IRSB 4YWGH 4FFVC 3QCTH 3RIAK 5DJ0A 4X7TB 2CMRH 4WI2A 4X6FB 3IDGB 1GGYA 1RUPL 3MMEA 3I50H 3OKDB 3SBWA 5CSBA 4XNZC 3DVGB 5K93A 1IM9B 3WS6A 2NX5B 1OAKL 5J6HB 2C5DC 3CFCL 3DX6B 2ZUSA 4PJ9D 5EA0L 4HBCL 1FORH 3O6KH 3LY6A 2IAND 1N6QL 3D69B 1MCPL 3Q48A 3S88H 4ONFH 1E6OL 3V6OE 2VXUH 4PJHA 4PJAE 5ACMA 3SJVD 1UJ3C 3DUUA 5E0QA 5DC9B 2OTWB 5MHSE 2IFGA 2CRMA 1NPUA 2F58L 3IXTB 5SWZD 1AQKH 4HPOH 1FDLH 4LRIC 1TCRB 43CAB 5I15L 4KVCH 4O2CA 3C9NB 3B9KB 2RHEA 4GXUN 3CH1A 1QQDA 2AK1L 2WM0A 1UCBL 4NCC1 1FH5H 4Z0BL 3LN5B 1N3NB 4YO0A 3VJ6B 2VC2L 4NKDA 1C8PA 4ZFGL 1FNFA 4M5YL 2XZAH 4O02L 3HC4H 3MLZH 1L7IH 1A6PA 5IFAL 1CE6B 4HWUA 4X8XA 4OFVA 3IFPB 4L4TB 4ZUSB 2J8UB 1MCQA 3TZVB 3OKYA 1MCSA 1DE4B 4XZUA 5EUKA 4LPUA 3BEWA 3T0ED 2BSRB 2F53E 3TBSB 2OLDA 1RZKC 4X98A 3GSUB 5GRWA 4PJAF 4JB9L 4TSAH 2ARJA 4EDWH 2YC1B 2FJGA 3NZ8B 2PXYC 4FQLL 3ALPA 5LJYH 1FV1B 1MIMH 4DAGL 1S7QB 1G1YA 3EYVA 1KCUH 2PO6C 2BVPB 3K80A 2KKQA 1RVFL 1CLZH 1G7LA 4JE4B 1XF5A 2NY3D 2H26B 4Y2OA 4JPVH 3U4BL 4YHKH 3W11C 5I16A 3NGBB 4YAQB 3QH3A 2PYFB 2IGFL 4KDTA 4YBLB 5JR1L 3L5WB 1T1XA 4G9DA 2DBJA 1DZBA 3EHBD 4LHQB 1KEML 2YD8A 5F3HA 5B21A 5I8CA 1L9NA 1P6FA 4XPGH 3CFKA 1CFTA 4M8VA 1ND0A 1U93A 4G8IB 2LAAA 2Q6WA 3MACL 5C0BE 1WWBX 4XPAH 4FQCH 2AJUH 3LQAC 4WW2B 4DKFH 2COQA 1NC2A 3MYJB 1T7XA 4LCUA 5IVZA 3D0VA 1ORQA 2WUBH 1C12B 2ATKA 2PNDA 3P4NB 4N5ED 1MFAH 3QFJD 2VDNL 4WI3A 4KRMB 1KB5L 2W65A 1UA6L 4JRWA 1NCBH 5IHZA 1VPOL 2VZUA 3UXFA 1KN2L 1BGXL 5IKCA 1MY7A 5EBWB 2QKIB 5GRJH 2YRPA 1RI8A 4BK5A 3SCMB 4Y5XB 5DJ2A 4WCYH 3HG1E 3ZE2F 3KLHD 1EO5A 3ARDB 4AL8L 1G7MA 1YMHA 4RFEA 3KWWA 5INCA 3S9DB 4XAKE 4OUUA 1CGWA 4H20L 1MFNA 3GHBH 4PGZA 2W60A 5AAWA 5CEXB 4DEPB 3ARVA 1OY3B 2Y7QA 1MHEB 3PGCA 4ZODA 4I0PD 4Y4HC 4NO0A 4ZO6A 1M7IA 4P23D 3RZCD 4GW5A 2KBGA 1HSBA 1B4RA 1QRND 4OZIB 5DYOA 5JIPA 1AY1H 1B6DA 3QWOB 1VFBA 3JV6B 1MJ8H 2R9HD 4YDKH 4PGBB 3TBYA 1DBBL 3T0EC 1ZVSB 1ZT4A 4G3YH 1AFVL 5DFVC 2YKLH 1T1WB 4NO2A 1FQ9C 2BNQA 4P2RE 4HAFA 1MCHA 1NKOA 4K2UH 3U0TB 1EUUA 5D71L 2X4QB 4M7JL 2X1XR 3X3GH 3HLAB 3MRKB 5D7JB 5A2JH 4NPYB 3WHE0 5GHWL 4EEEA 2FEEI 3MV9D 1XF4A 2MKLC 3D3VB 3QP3A 3M45A 3P4MA 4OI7A 5EBLA 5JOEA 4GKNB 3GKWL 3V6OA 1WLHA 4NC1C 5IVOA 1X5XA 4NQCD 2Q3AA 1ZEAH 5EWIH 4PJAA 4RZCB 4WTZG 2JJUA 1CFQB 3QI9C 3IDIA 2KH2B 5I8OH 1HHGA 2P7TA 3L3DA 2EXYC 4G5ZL 1AHWB 1KIPA 1YMME 5L2JB 4ZTPH 5DUMH 3U46A 1ZXQA 3FCTA 1DCLA 1F4YH 1ETZA 5JDSA 1N5AB 2ITCA 3B83A 5ID0A 4JRYE 4NZUL 1NGPL 4LSVH 3Q3GB 5I1CH 4I2XB 3QBTB 4WTWA 5SX4I 5FYJD 4OLWH 1TQCC 3MLUH 1F4AA 3RUGB 5FO8B 4RMSA 3KR3L 4CJ1A 1MJ7H 4DN3L 4LDLB 4OV5A 1FNEA 5FGCE 3RWIB 2XFXB 3K2UH 2A77H 4GBXD 5CS7A 3Q5TA 4YHPA 5T5FH 2P49B 1DUYA 4A2MA 2J12B 2DQCH 1AIFA 2R29L 4P5MA 4LLUA 3EJZC 1F11B 3M1BA 3ROLB 4CN4A 5DUPL 2UY7A 2F53A 4X6BB 3KNBA 5DWUH 3RWJB 4NQTA 5GZOC 5K9OA 5CD5D 1UXWB 5ID1B 1S7WA 5BV7C 4U6YB 3SKUD 5BZDB 3L3IA 1KTLB 1M05A 4U2YA 5B38B 5EU7E 3NCJL 2HFGH 4K8RD 5ADPL 2GUOA 1GVIA 2D9CA 1BQHB 5E8DH 4HUUA 4L3CB 1OSPH 3TGXA 3OHXB 2FR4A 3DSFH 1BIIA 5IMKA 5FGBA 1IQDB 1EVUA 5D7IB 1HXYB 2E7MA 5EO9B 4M1DH 3TEUA 1FFNA 3MGTB 3T3PF 5CEYA 5K9KB 3KVQA 2NY5C 1CBVH 5D72L 4JN2B 4YHLL 3QQNA 5C0BA 2HJLA 1JZ5A 1QVOA 3LDBB 3SKOB 4W68A 2BNRA 2VIRA 1V3KA 5AYUL 4Y16A 4D9LH 2EYTB 3UDWC 1G6RB 3GJFA 4EN3D 1FL3A 3SO3B 3FONA 2ADFL 4FXGA 1NGWA 4K3GA 5GGVL 2DAVA 5C0IA 4KK8D 2O26U 4N0UB 3H42H 3ARFD 4HIIB 5BOZG 1R5IA 3MV7B 1K2DB 1NC4D 1R6VA 3BWUC 1BQLH 4XMPH 1G9NH 3V0VB 2F19H 4JKLA 2PETA 2OXHA 3ARSA 3HG1A 4MMZC 5D9SA 4ODUA 5I76A 1YEGH 3PXHA 2ZPKL 2PTVA 3BWAA 4UTAH 1I1FA 4M6OH 1SY6H 1OARL 2B5IC 1S7TB 4IIQC 4AJ0A 1GOHA 4HG4K 5GSVA 3GRWA 3VGEA 1H0DA 4W6WB 3HUJB 3L95B 4L8BB 4OM0H 4R3SB 1I3GL 5D6DA 2VQ1A 3TF7C 3IDJA 1F4WH 1T83C 1I1YA 3ZHLA 4FS0A 4HDIB 5C6TH 4Y19E 3WBDA 1I3RB 5AZ2H 4YQXL 5H35A 3GMLA 4NQVB 5GRUH 3RTQC 4PB0H 3V52H 2GHWB 4GBXC 2XNAB 1OAUL 2HFFB 4QHKI 4QRPB 3RI5F 1U58B 1VGEL 4P3CL 4ZSOB 4Z0XB 2DQIH 2W9LA 5AAMA 3P0YL 5D1XC 5D6CA 4P2RA 4Y4KB 1H3GA 4PJ8B 4OZGB 2KDGA 4XPFH 1NANH 2B1HH 4PP2B 4MGXA 5C0CE 1MCOL 3MLXH 4XP4H 2PTTB 1RFDL 2D7QA 5I30H 1JRHI 2FX9H 5DEGA 5DR5H 2WIIB 3HZVB 3I9GH 4F15B 5D2LE 4U3CA 3HRPA 1A1OB 4NZRL 1S7XB 1SBSH 3ARYA 1ULVA 4P2QB 4P0DA 3CSGA 2R0ZH 5B39A 1IFHH 1XR8B 1P1ZB 4XPTL 3V9FA 4Z8FH 3NPSC 1YMMA 3P0VH 1FAIL 3WJJA 3QEUA 4O5LL 2DI9A 3FQUB 3VFPB 3QUXA 4F7EA 4JLRB 5E1AA 3QNXB 1MEXH 4JRYA 3IDNA 3PV6B 1X5FA 3HE7B 5CZXC 2DQEH 4KJYA 3FOMA 1R3KA 2GTZA 2FATL 3KYOA 1DBKL 1DSFL 2P5WD 5EU4A 3AAZB 4MB4A 4ODVL 3MODH 2C4FT 2HLFD 5CD3B 2VXQH 4XPBH 1I7ZB 3DVNA 1A6VL 4WU7B 1N8ZB 1CGVA 32C2B 4HIXH 4OUOA 4AY0A 1WT5A 5D1ZC 3QXAB 4PJIF 4BQ8A 5DQDH 1FL6B 4HKJA 5FA3B 4G6ML 4PJBE 4G42B 4W4NA 2EH7L 4LASL 5CGYC 4DW2L 3QR2A 5DJAB 4GRLD 3MLSH 2FO4B 5HPMB 3MCLL 1QNZH 1XZ0B 3TBTB 1WBXA 4M5ZL 4DGVH 1BM3H 4IOFD 4OCNC 3BJLA 1FZKB 2MSPA 5KSAA 1MREH 2VLRE 3VRIB 2QHLA 2R4SH 4V2BA 1NCDH 3CFBA 4QNPE 3VXQB 3OTTA 4LSRH 1I85A 3VWJA 4KRLB 2E7CA 3FL7A 3MBEA 4OCYH 2JJVA 3VFUA 1MCEA 3BSZL 3WV0A 4F9LA 5CSGA 5L8JB 3WFHA 1MCIA 1JV5B 1IZJA 3QIWB 4JR9H 4O51B 5IFHL 4OCMC 3U0PA 5EUOB 3D25A 1I1AD 2MQ0A 3Q6GL 1NFDE 5DD3H 3AB0B 2R23B 3M17A 1A7RH 1DANU 4KDVA 4LSTH 1PG7H 1XGPA 1H3TA 3QJHB 3D2UA 3PHQA 5GRZA 1KACB 2YD6A 3BGFC 3UC0H 1XGYH 4WEMB 4HWNA 2V7HB 3VFRB 2ICWA 3MJ7B 4JJHA 5CJQH 2BXYA 3MFFB 3VFVB 1G7JA 2QSCH 3ISWA 4JY4B 1TIUA 1FL5B 3JTTB 4PJ7E 3W81A 2Q76B 1L7TH 1XH3A 2VXTL 5B8CC 4LGPB 5EZIH 1T1ZA 1LO3L 1D5MB 4EUPB 4JFFD 1JHLL 2NNAB 3QPXL 4JQVA 4EI6B 4UUJB 1IGIH 1RUML 5HPOA 1G7PB 1IGYA 4LLDA 2FSEB 1NGYA 2APWA 2DQFA 3VA6A 5T3ZL 5A2FA 2GK0B 3GNMH 4OZ4B 3F65A 1DLHB 4BQ9A 3V8CA 5TDPB 4KRNA 1A3LL 5I9QB 4ZPTB 5CJOH 2UWEE 3WHXB 1MCLA 4Y5VB 3OXSA 3VRLE 4ELMB 3PL6C 5JPMB 2VAAB 4Y19A 2KQMA 3DBXB 3RGHA 5C0AD 3VFSA 3VXNA 2CIIA 4Y8AA 1A5FL 2CGRH 4R7NB 5ICXB 2R69H 3QUMB 2FEDC 4Q9CA 1FN4B 4XGZB 5DO2D 2QADB 4ZUVB 1B0GB 4X83A 2CKBL 2DLFL 4LLMB 3QRGH 2XG4A 5IB4A 3V5KB 1RAMA 4PJ7F 4WFHE 1LO0L 4F9PC 3ABZA 3MOBH 5JHDE 1EHLL 1VA9A 1QO3B 3O3DB 1KB9K 3CK0H 4MQTB 1U8LA 1A6AB 1YNLH 1BZ7B 3P9MB 3DI2B 2ZNXA 4G7VH 2DYPA 1FLRH 1N7MH 3MRBB 4X80L 3T4YA 4PJIA 4YC2B 5D2LA 3S3SA 3H3BC 1YJDC 3JTSB 5D93C 4KVNL 1M1SA 4OLEA 4PR5A 5F7YC 5TQ2H 2WINA 3VRLF 2X4UB 1RJLA 1A8JH 3DYOA 1MCBA 2DMBA 4MNGB 5MEQB 1FBIH 3HE6A 1EZVX 4PGCB 3GSQA 3MJ9A 1RJCA 5FUZH 3RVUD 5F7HA 3BN9C 3U1SL 1D9KA 5MP6L 4PBWD 4KY1L 1P6AB 5IHBA 1B4JL 5K9JL 4BQCA 4KROB 5C09B 4S1DD 5I18L 2CXKA 2F8OA 4NO0D 3T08A 5C6WH 4NHCL 4R0LB 3K1DA 3C8KA 1RZ8A 4OKVB 5GJTL 5SWSE 1FZMB 2WBJD 3T65B 4JFDE 3D39E 4NQSA 4XCFL 1KPRA 3FO9A 5F1OB 4OM1H 3WD5H 5CCKL 5JLZA 3BAEL 3BYYA 4PJBA 5GGUA 5HYQA 2AGJL 2CK0H 1IEAB 1VFAA 4OJFL 1Z0MA 1H3PH 4N0CC 3O3BB 4M93C 4X4ME 3RNKB 3UYRH 1TVHA 1R3IH 1RURL 1UWXK 2VLRA 3OAUH 1X3DA 2BXZA 3CC5A 1KJ2H 4KTDH 2VDQL 1T3FB 5FA4A 3BW9B 4ZMAT 1XF1A 2PW1A 3LKRA 3QCVL 1ZWIA 3O4LA 5IQ9B 1IBGL 4UINL 5FK9B 2XKSA 2PYED 1BVZA 1ZSDB 3EYSL 2NY7H 3GSNL 1BQSA 1AJ7H 4ORZC 4F7TB 1NFDA 2YK1H 5AEAA 2V7NB 1A6WL 1A2YA 3N85H 5IROA 1GIGH 1D5ZB 4I3SL 3VGAB 4X4ZA 1F4HA 3VWKB 5HI5C 1KN4L 2HWZH 1HI6B 3P73B 1U8HB 3BZEA 2Z31C 3BX7C 5FUCC 2FL5A 2DQHH 3T1WA 5CWSB 1AP2B 2Q8BL 1F8TH 2P47B 3VXRE 1I8MA 4PJ7A 4OCWH 4XNUL 4BZ2H 1UB6B 1VHPA 2PF6A 1E6JL 3QJFA 3RWCB 1QHPA 1IRAY 2FGZA 4G6KH 2G2RB 5KOVC 3SN6N 3GMMB 3UTSD 3BYTA 5CILL 1HCVA 1SJHB 2IBGA 4FQJL 3X11B 3HAEG 1AO7D 2BSTB 3LQMA 5HYJD 2EXWD 4JREB 2NZ9C 1QYGH 1TZGH 4LVEA 3GIVB 3FOLB 1BFSA 2B2XL 3B8SA 1TTFA 3EAKA 1RZGB 1XFPA 1YQVL 1A14H 3S36H 2UWEA 2E9BA 2P24A 2Z91A 1T6WA 1J5OL 4FOMA 3LAFA 4S1DC 1WIUA 5CINL 3L6FA 5IQ7L 5KSBE 1AGFB 5KSVA 1GGBL 3GGWB 3TT3H 5IJKA 4PS4H 5EU3A 3HNSH 4PJDE 4HS3A 3VGHA 4ALAH 1P53A 1QEWA 4NZJA 1GC1H 2XRAH 3G5YA 1DQML 1T2XA 4NRZA 5DJDB 1J8HE 1HHHA 5F9JA 4YHMH 3QIUD 5JHDA 3L3HA 3ULUH 1N64H 4Y16D 1YPZE 5IG7B 5FO9B 2IPUG 4U0QB 1HQ4A 2HJKA 4WU5B 2DM4A 2NZIA 4HXAL 1G7HA 4KJQD 5BVJB 2IJ0C 4P3WA 4L8DB 5BW7C 1U3HB 1T5WA 1R3JB 4LVOB 2EECA 4Y4FD 4K7PL 2ARWA 4OLZL 3WXWL 3NCYS 4QF1A 2D03H 4WO4D 5FOJA 5FYKD 4XHJC 4H5SA 3MLTA 4JKWA 5IB1A 3P11L 1WCQA 4G8FA 4ZQKB 5J13C 3LRSB 1GAFL 1JPSL 2Y5TA 4R4FH 1F4XH 3MR9A 4WHYH 3ZHKA 4YXHH 5JIIA 3CSYA 4YHYC 5D1QB 4WHTB 3NTCH 4PJDF 3QIBB 1ZVYA 2OYPA 5F1NA 3BHBA 4XAKD 2EKSA 3MXVH 4UB0L 1U6AL 1Q0YL 2NY0B 3K8LA 4YFLI 3S4SG 2VZVA 4KGLA 3MJ9L 4AT6A 5L88L 4WJ5B 4IMKC 2GSIA 4JCLA 3DROB 3O2VL 3QNYA 5E99L 1I9RL 3HC3H 3O8XD 4BKLA 3T0DA 3RKDD 2N1KA 2NTFB 5A3ID 4LRNH 4JN1L 4CW1A 3FFDB 4BM7A 3BDYL 1BBJB 1IGMH 5DMKA 4PIRF 4UT9H 5F7DA 4HUXA 1VKXA 3EGSA 3KPTA 2EEDA 1MUJB 4RISL 5SWSA 1EO7A 3BZ4B 4Q9RH 3CIQA 3D39A 4JFDA 2FECL 3QZWA 1OQXA 1SEQH 2VDRH 3KPOB 3HMWL 1HQRA 4XP1L 5EU6A 3RL1B 3SEPA 2O5ZH 4YDIH 3HRZB 4P2RD 4LCCA 3QXUA 3ULVH 1CR9L 3BP6A 4S1SH 4XP6H 4X4MA 4NJ9H 4OBSA 3WFCL 1E27B 4XWGL 3OMZA 4Z77B 4MD5B 4XNZB 3O81A 3WO4C 4KZEL 4HJGB 2BK8A 1OGTB 2NCMA 5J1SC 1D5BA 2CLVB 3BD3A 1S9WA 4XAWH 5GS0H 3SGDI 7FABL 1F45A 1RK0A 5IW6A 5F7LB 4QHMB 1UWGH 1Q9OA 3RAJH 3MRRB 5C07B 1R3HB 3GDBA 3IDYC 4NHUA 5L0QC 4KZDH 4QHNA 4LNVA 3G04A 1DEDA 1A6ZB 1T7WA 2IPKB 4J3WA 5J8OA 2EYSB 3ZYJA 1ZLSL 3UPRA 1U91A 4TUOB 4YXLH 4OCRH 1UJ3B 5HXMA 1EJOH 5AD0B 3QIUC 4H1LB 2F74B 4UZGA 5C7XL 3X3FH 4PRAA 5J12C 1VFOA 4BA8A 1O0VA 3QAZC 4KJQC 3DRTA 2A74A 2RFXB 3FFCE 4MB5A 2AQ2A 5BXFA 4MWFA 2DJUA 1NJ9A 2BHZA 1ZA3A 1UZ8B 1KLUA 1I8KA 1R5VB 1VFMA 4KQ4L 3VXUA 4MCYA 5DMIH 2AI0H 5DJ8B 4LF3A 5HVHC 5IV2B 5E70A 2CUIA 1YDPA 4XVUC 3NH7H 3PDOB 4HH9B 3T1FA 3ZTJG 1AH1A 1FLTX 3NFPB 5F3BB 3MRCA 1KIQA 2OQJA 2UZIL 3N1GC 5HY9A 1RIHL 3I02A 1FYTB 5ETUA 2GT9A 4HIJB 5DQ9A 5ITFA 4PJFB 3BDBA 2H9GA 3VWJD 1MRDH 3NA9L 4LKCB 1SVZA 3O8XC 4HEPG 5A3IC 4FQIL 1TZIA 1AE6H 4Y8DC 5KSBA 2PXYB 4HFUL 3SE8L 3U0WL 1NMAH 4PJDA 5JQHC 2PO6B 3DMMA 3GSOA 4MSWA 2JIXB 5I1HH 1NBVH 2UYLB 4XVSH 1Y18B 3E6HB 1MCCA 3MNWB 5IB3B 4K3DL 2HT3D 3GO1H 4RFOH 1C08B 4P4KD 1RHHB 4NKIL 1J8HA 3BXNB 4ELKB 2K1MA 1DVFA 4LAJH 3BPCA 3LSOB 2NX5E 1YPZA 5T33H 4Y88A 4KPHL 1CCZA 1FNAA 2UZXB 1A7NL 2B1AH 4BYHA 1MCNA 1IEBA 4Z78B 5AG9A 3JBG7 4JM2D 1CDJA 1MFBL 4TUKL 2XA8L 4APQA 3GMOA 4GRMA 5L7XL 1LDPL 4RAUA 5DHXB 4D0BA 4PBVC 3VGGA 5DJZB 5HHNB 1J1XH 3SDCA 4GMTL 3TO4D 2EO9A 3GIZL 3FAXA 2VDOH 3F12A 4N9GA 1UCTA 2I5YH 1KXVC 1LILA 1IL1A 3AMKA 3QEGH 2K7PA 4LP4A 2YRLA 1FE8L 5FYJU 1LEKA 3DGGA 5IHUH 4KXZH 1PKQB 3TNNB 2NW3B 4UU9B 4C56A 1EXUA 3SKNA 8FABA 1MH5A 1OM3H 3K3QA 3HKFA 4S1RL 3QUYC 1P9MC 4PREA 2VLKD 4R90L 1QBAA 5C0FB 4M7KH 4PJXF 4NGHL 2WQRA 3QXDA 3FTGB 2IH1A 3PP3H 2NXZC 2QQNH 1MRFL 4L4TE 4M4PA 2AW2A 3HPLB 4FXKB 3T0AA 4LCYA 5A2KH 1KPUB 2XPGB 2P8PB 4B7LA 4EI5C 1FIEA 1QRKA 4Y4HB 3OZ9L 2GJZA 5H94A 2W0FB 4LQFL 2Q7YB 2V5YA 5HHVL 4GXUM 4WI7A 1CLYL 3RVTD 1UM4H 1FRGH 1WWWX 5C0CD 3IFNH 2X70A 4YHIB 4LLVB 3PQYB 2NY6D 3K74B 4UT7L 4YWGL 4OFPA 3QCTL 1BVLB 1JGLL 4N8VG 4P5KB 3SDDA 4J3VA 2CMRL 1CQKA 3DURB 3I50L 1SM3H 4CMMA 4LFHD 4JCMA 1UB5A 1T4KA 1AGBA 4NCDA 3SPVA 3BH9A 1KCRH 1HKLH 3K2MC 3MUJA 3Q5OA 5HHMD 1HN1A 4HK3N 4K9EH 1YC7A 1FORL 1OF2B 4P4KC 2AV7A 3V6ZB 3FT3A 3QI9B 4CU6A 2VL5A 1JWMB 3MLYH 3S88L 4M7LT 5I74C 4ONFL 1P7KB 4QLRA 2K9UA 3SE3C 1VESA 4RIRB 2VQTA 1UFUA 5D96B 2VXUL 2EICA 4GJTB 3IU3A 3FFCA 4UILH 2F54B 3O6FA 2ESVB 4MYWB 3HN3A 4LCIH 4RMWA 4Z7WB 3W0WD 3F7QA 3T2NL 1AQKL 4HPOL 1FDLL 1LEIA 1F6AA 1TQCB 3TVMC 4KVCL 1NGXA 4OF3A 2WWKT 4L8SC 4BFEA 4X7SH 1P4IH 3TO4C 1FH5L 1BAFH 1YC8A 1WISA 1CQYA 5M95B 3H2WA 2FRGP 2ADIB 2ZOKB 4LBEB 3LKNA 1YN7A 2XZAL 5HDOA 1OSZB 5ESAB 3RL2B 3MLZL 1JWSA 4KKBC 3RVWD 4LK4A 3S8WA 4MJ4A 1L0QA 4RQQA 5BV7B 3FB7A 4U49A 3FRUB 4WHDA 1A4KA 4IRSA 3KXFB 3CPLA 1IGJB 5IR1B 4TSAL 2EIEA 3INUH 3JV0A 3M07A 4OZIE 3GMNB 2MCPH 3IDGA 4P3DA 1AKJD 3ZHDA 3BPNC 5C0GB 3OKDA 4M8QB 4NQEB 1MJUH 1MIML 3B6SA 1KCUL 5A16A 3DVGA 4Y5YC 4DQOH 1NEUA 3U83A 1IM9A 4XP5L 1CLZL 2NX5A 5J6HA 3NBNA 3DX6A 1QLRB 5B4MD 3ZYIA 3JWDH 2YD3A 1MLBB 2X4OB 2BC4B 3CZFB 4U1MB 2DM7A 3CCHA 3D3VE 4M03A 4XPGL 3CFDB 3O2DH 1L0XA 1MI5D 5HGBA 3MUGA 2VLJB 1QSFB 1YEKH 5C08D 1DQDH 2OTWA 1KTKE 4XPAL 4FQCL 4IJ3C 4UQ3B 2AJUL 3H9SB 1NUDA 3CXHJ 4TVPH 1TCRA 43CAA 5JXEC 3UX9B 1JTPA 4URTB 1A9BB 2WUBL 3C9NA 4RWYH 1CG9B 4NQCB 1CICD 1MFAL 1BFOA 1ZA6B 4IS6B 5MEOB 1QSVA 3V5HB 4I2XE 1LEGA 1FZJA 3VJ6A 1CVSC 4WUUB 3MO1B 5EC2B 5CJXC 3BUYB 1Q0XH 4NQXB 1KG0B 4JM4H 4BFIA 2B5IB 1W72H 4GAFB 5IMOB 4IIQB 1KIUA 5GRJL 4L4VA 3HB3C 1J0YA 4KRPB 4Y2DD 1A7QH 1SY6A 4A6YH 1H3XA 3F7PC 4ZPVB 4MDJB 4WCYL 3O3AB 4ZAKC 2PKDA 3H6JA 3TZVA 1DE4A 2XT1B 4HWBA 1JK8A 4WFHD 1BPVA 1HH9A 2QJDA 2VITB 2BSRA 4UNUA 5JHDD 4NM4H 3V4VH 3LHPL 4HUKB 3GHBL 3GSUA 3RTQB 1RJYA 3L5JA 3W5NA 3OKKA 4GBXB 2X6MA 3T0XA 3PIQB 4G9FB 1T66C 3KPNB 4X4YA 1CGXA 2APTA 2HG5B 2OR9H 4JHWL 3S35X 3O9WC 1FV1A 1ZTXH 3VFOA 4AG4H 2XIDA 3GUTB 1S7QA 4S1QH 2H32H 3P3YA 3PE9A 4MA3B 1QFWM 2GY5A 5D1XB 4JPKH 1AY1L 1WUNT 4HKXB 2X1OA 4MZ2A 1MJ8L 3O4OC 2H26A 4YDKL 3P77B 1P2CA 3H7BB 4YAQA 4G3YL 3K8MA 3BJ91 5CGTA 1RU9H 3UTTB 3C09C 5D7IE 1KCVH 4K2UL 1FCGA 4YPGB 2AXJA 4LHUD 4JRXB 4QRRB 3X3GL 4KGJA 1Q9KA 2EDBA 3A6BH 3L7EB 4G8IA 5CBEA 3FZUD 1GSMA 4LKXA 4Z7NE 2QHRH 2VDPH 4J8RB 1BBDH 4R4BB 5HHQA 4N90E 2I60H 2IMNA 2HMIC 2CDEB 4WW2A 4QRQB 4PTUB 1S5HA 1K5NB 3NPSB 2CDGB 1ZEAL 5EWIL 4WWID 1C12A 1CDUA 1KC5H 2YOCA 4XCNB 1SYSB 3V6FB 4Z95L 3ARXA 5KS9E 5I8OL 2NY2D 1F58L 3DWTA 4N0UE 3PDGA 2WSKA 4ZTPL 3DOSA 5DUML 4G6AD 1FHGA 3MV7E 1IT9H 3L7FA 1F4YL 3TPUA 5EBWA 2Z93A 3GSWB 3RWHB 1JNNH 3QDJB 1CD8A 4LSVL 3SCMA 3RGVD 2C7UB 5F9DC 1MAJA 2H2SC 2UUDH 5K33A 4OLWL 4HK3J 3MLUL 3ARDA 1FO0B 4QGYA 1MJ7L 4NUJA 1WZMA 5D1ZB 3C2AH 3NFNB 4LSDA 2A77L 4MA1C 3HUJE 1JGVH 5E4IA 5CEXA 4M00A 5C3LD 2DQCL 2JJTA 3TWCH 3E6FB 2KPNA 4QHKJ 3MRNB 4PJCF 4I0KA 2RGSA 1I7UB 5IBLD 4NBYB 3CGTA 1TQBC 1P5UA 5DWUL 3LN4A 4EDXB 3LIZH 3LV3B 4NC2B 4NBZB 1S9VA 3OB8A 2R2BA 3JV6A 2VZTA 5KS9F 4ZSOE 4PGBA 4LCWD 4DZ8A 3CVHH 3AXLB 3BGMA 5F7WC 1ZVSA 5DMYA 4P5TD 4NJAH 3ZT7A 3R8QA 4J4PD 5H37G 2HFGL 5HDBE 5IUSA 2X4QA 2ZG2A 4OZGE 4DCQB 1MQ8A 2AJZA 5E8DL 3HLAA 3KPSA 1OSPL 2VZ1A 3ARQA 3OXRA 5CGMA 1WBYA 3D3VA 3VXRD 1DTUA 4M1DL 3QEHA 3QXVA 1M6OB 3SGJC 4P2QE 3BGFB 5D7LE 1CBVL 3VFWB 5KVEH 2Q8AH 5HSFA 5C2UB 1JZ6A 3P4OB 2HLAA 2EC8A 3SDYH 2N7AA 4D9LL 1S9KC 1E0OB 4OT1H 3TN0C 1A9EA 5JW4N 1GHFH 5B8CB 3QHFH 2R1YB 3Q3GA 4I2XA 4KDWA 4OLUL 3HTLX 3KHOA 3KLDA 3BIKA 2VOTA 2F8VA 3TA3D 4HH8A 3BVNB 3L3OA 1BQLL 1ZOXA 4R8WH 4J3SA 4XMPL 1G9NL 4HPYH 3CUPB 2VQUA 3RWIA 3RWGB 2XFXA 2F19L 3QG6A 4XMLL 1XF2B 3RKPA 2DLTA 3ARED 1HILB 1PQZA 25C8L 1YEGL 1BHGA 1NBYA 4PD4J 3FN9A 3SKMA 4AEIH 4OFYA 3MJ8B 3PL6B 4M6OL 1F11A 3ROLA 1K8IB 4U0RB 4Z7UB 4NQDB 5C8JA 1DVFD 3RWJA 4P9ML 3NZHL 4QT5B 3RVVC 4OM0L 5SX4H 1UXWA 4JFPB 4PRIB 3RGVC 3RPIB 1ACZA 1F4WL 2MCG1 3DUSB 3W9DB 5E5MB 5C6TL 3DX7B 3QNZA 5AZ2L 2XWBB 3VG9C 5B38A 2D7MA 5GRUL 1HOCB 4PB0L 3V52L 4N8PA 1FFPA 1U8OB 2IAMC 4F7CA 1UWEH 4MAYA 1BQHA 3MLPA 3C2SA 2DQIL 3SDCD 3ULUE 3TFKD 4RDQG 1HNGA 4CMHC 4KK5C 1S78C 5D7IA 1HXYA 2BVUA 3HMXH 4JFYB 3VW3H 4ZUWB 2QSTA 5D93B 1U2CA 4XPFL 1IGTA 5EUOE 2FIKB 5K9KA 3PWPB 1GZQB 1A21A 1Q9WA 3MLXL 4XP4L 3VH8G 5I30L 1KBGL 3S37H 1D3CA 1RIVL 5DR5L 3I9GL 4Q2ZA 4AMKL 1SBSL 2R0ZL 6FABL 1G6RA 4N1CA 3IETB 4JDVA 3K0WA 3B2UC 1IC5H 5FDWB 3GK8L 4Z8FL 3FRPA 3GI9H 4NO3B 1T6VN 5KS9A 2YPLB 5FF6A 2FZ3A 5EORH 3HR5B 5IMMA 3MV7A 1K2DA 4WI9A 1ZGLB 1JHKL 1EEUA 4NQUA 4R2GD 1MEXL 1NFIA 3RNQA 3OL2A 2LQRA 3R06A 2I9TB 2HKFH 3ULUF 2DQEL 3BH8A 1PEZA 2JJSA 3V7MA 2NY5L 4HIEA 3VXMB 3MODL 4Z76B 3VD9A 2EDLA 1INEH 3V4PH 1ED3A 4BSJA 1FVDB 4EQ3A 5LCVH 4H8WH 3VFGH 4XPBL 2X44D 4UIMA 2JLLA 3F6IA 5FYJH 4BZ1H 3Q6FB 1AD0B 1G0YR 4R3SA 2JCCF 4R7DA 3IS0X 4ELME 3F5WB 5J56B 5TH2B 4HIXL 4OFIA 4M93B 1I3RA 5DQDL 4FMFA 1T0PB 3PWJA 3ARGC 3GEWB 3F8UB 4XCEA 3H7LA 3MLSL 2E9WA 3UP1A 3WIFA 2DQTH 4ODSH 5JNYB 3PDDA 4ZSOA 1KJ2A 2ED8A 1TJGH 3KLSA 4AEFA 2BP3A 4GFTB 2X10A 2R1XB 1BM3L 5ANMB 5EPMB 5HDLA 1N59A 4WWKC 5HHOE 3WNPA 4P48A 1NCDL 2YRZA 2OK0H 4OZGA 3G9AB 4LSRL 5KVMC 4OCYL 4PP2A 2C3GA 2EDFA 5ICYA 3IF1B 1ORSB 3FB8A 4MJIB 3N1FC 4K8RH 3BRFA 4FQ1H 4QY8B 3WE6A 4DK6A 1A1OA 4HAGA 1S7XA 4UNVA 4P57A 4P2QA 3HI5H 2VWEE 5D7LA 4L1DA 5DD3L 3G9VA 3TFKC 3PHSA 1A7RL 1P1ZA 2Z31B 1KCSH 3ULVF 1FP5A 4ODWB 4LSTL 1RZ7H 1PG7L 2WLZA 4CGTA 1H3VA 4MNGE 1HHIB 2D0GA 4U3HA 1XGYL 4WNQB 1A6UH 4JZOA 4JHAH 4JLRA 2QSCL 5TE7L 3HE7A 3CX5K 4OCSH 5HHXH 4FQ2H 4ONOA 1J05B 5DRWB 1PVHA 3AAZA 5T1LB 1NLDH 4QHLA 1L7TL 1P7QB 3LRGA 4AIZB 4X7DC 5EZIL 1CN4A 4IRSD 1KUMA 5LKNA 2VDLH 3QCUH 3H9HB 4D0CB 5JO5A 1I7ZA 4HV8A 3MCKA 4NNYB 4WU7A 1FVCB 32C2A 4HQQH 1R24B 4IOSD 4UQ2B 1FL6A 4JO4H 4A2LA 5FA3A 4G42A 1IM9D 3LKOA 5CJOL 2NX5D 4WHCA 4JFOB 5GS2H 1CIUA 2YUZA 5IEKB 1XZ0A 3HR6A 4OB5H 1N5YH 2YR3A 4IOIA 2V2XB 4X5XB 4KK6C 3TBTA 2AP2A 2G5BB 1VACB 3TIDA 1I7RB 4GOSA 1FZKA 1ZANH 2EDJA 1MLCA 3BP7B 5F7MC 3SDXF 2BHYA 4R96A 5SX5K 2CGRL 2R69L 1EV2E 2B0SH 4K3EH 3QRGL 4HLZH 5ILTH 4RA3A 4TUJB 4EBQH 2EEBA 3MOBL 1DLFH 3QIWA 4B0MM 4O51A 5JIHA 2W0LA 3K81A 3L3GB 4F2MB 5FV2A 3CK0L 2PCPB 1YNLL 4KI5E 3B9KD 3C5ZB 3AC0A 4G7VL 5DRZA 1FLRL 1N7ML 3LZFL 4DTGL 4JJ5B 5BZWB 5J13B 2KZWA 1LDSA 2CK2A 4QRUA 2BOBB 3QJHA 4ODTH 4LLWB 3EDFA 2PYEB 4U1GC 3WUZA 4YHYB 5TQ2L 4X6CF 1HSAB 2V7HA 3VFRA 4C54A 1U8MA 4U1SB 4K23H 5L2KA 4L4TD 4FG6D 2QQLH 3S35H 4JY4A 1FBIL 3TZVD 4FQXA 4QRSB 5E03A 5FUZL 2X42A 5DRNB 1HCFX 4X6DE 2FX8H 3DRQB 1X6LA 4GG6F 3G5XB 4EUPA 2EH8L 3MRDB 5KSUB 3QUKB 2NNAA 4EI6A 1FG2B 5TDOA 3CDFA 3D85B 1E4XI 5INDB 3RX5A 4TPRH 3QULA 1XIWA 4ERSH 2C1PB 4OGAC 3UTSB 3WHXA 4W4OA 4B50A 5ADOH 1B2WL 5EFIA 3TJHC 3WD5L 1AO7B 5HYJB 1MWAB 3DBXA 2F9BT 3DUHA 5GS1C 1J88A 1VEPA 4GQPH 2CK0L 4QWWD 3WO4B 1TFHA 1H3PL 4R7NA 3QUMA 3MRHB 3TJEL 1JFQH 4XGZA 3ZL4H 4ZUVA 1AGEB 1B0GA 1G7IA 3L3KA 3TCLB 4LLMA 3MV8B 3UYRL 2J88L 4MHHG 2BMKB 1R3IL 2HJFA 2EDOA 5ERWA 5HHOA 4EXKA 3OAUL 4OIIL 1KJ2L