3VTTA

High resolution crystal structure of dengue 3 envelope protein domain iii (ed3)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
SYAMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDKALKINWYRKGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title High resolution crystal structure of dengue-3 envelope protein domain III suggests possible molecular mechanisms for serospecific antibody recognition
pubmed doi rcsb
source organism Dengue virus type 3
molecule tags Viral protein, structural protein
molecule keywords Envelope protein E
total genus 12
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vttA00
1SVBA 5IZ7A 4UTCA 5AAWC 3N42F 2R29A 5LBSA 3MUUA 2JQMA 5IREA 1S6NA 5KVEE 3UZEC 1OK8A 1Z3RA 3IRCA 3UYPB 4UT6A 4AM0Q 2GG1A 4FFYA 2JV6A 4X42A 5KVDE 5KVFE 2P5PA 4BZ2A 3C5XA 2R69A 4GSXA 5KVGE 3N41F 5AAMC 4BZ1A 4AL8C 2H0PA 3UAJA 4UTAA 4GT0A 1URZA 3J27A 5H37A 1RERA 4UTBA 5GZNA 5JHLA 5LBVA 3N44F 3J2PA 3VTTA 1ZTXE 1OKEA 1UZGA 2JSFA 1PJWA 3N43F 4FG0A 5B1CA 4ALAC 3P54A 3UZQB 5GZOA 3UZVA 3N40F 2ALAA 4FFZA 5JHMA 3G7TA 4UT9A 1OANA 2HG0A 3C6EA 2I69A 5LCVA 2V33A 1Z66A 4L5FE 1TG8A 3WE1A
chains in the Genus database with same CATH superfamily
1ZTMA 3MRBB 3T1FA 2B1AH 4Q52A 1OAJA 3EOAB 4ZZKA 3S6CA 5K59E 2F5BL 3IDNB 3KYKL 4FQ1L 4XNAA 5FUOL 1ZT4A 4DERA 1YY8B 3QR2A 1XO8A 4OW6A 1IC5H 1OGSA 4YUEH 2FR4B 1USQA 1UXSA 5JW4M 3BQUA 3H9HB 3NJJA 4YHYC 2I9TB 3IDJB 4HUUA 3S35L 1QTSA 4PH8A 2FX9L 2VLKE 3SPHA 2NTFA 5L2KA 1TZHA 1UWXH 1J1PH 1RPKA 1E28B 1KACB 3UEQA 3RVTC 5J6SA 3LDBB 4U1GC 1BZ9A 5LG1A 1IKNC 4Y89A 3TEUA 4K7FA 4PI2A 2XN9B 4WW2A 3GHPA 5M7QA 3BIKA 4GW1A 5GS2H 1QNZL 3BLPX 5I5MA 2ITDA 4N0YH 2DI7A 5IQ7L 3BUYA 3QI9B 1KIUB 2ZSWA 1E30A 4NQTA 1T7VA 3K74B 2EP6A 5FAAA 3EHBD 2HFGH 3PABB 5B7FA 5IJKC 4LVHB 5F1OB 2KPNA 3TO4D 4G7SB 3I6KA 5KVEH 1AO7A 4H8VA 1OM3L 4CC0A 1P4IL 5I8EB 4U49A 3F7YA 1UWXK 4HS6A 3MYJB 5D96B 3HC0B 1AGBB 4G6KL 5IK3B 4AQ1B 5F88A 4Z7OB 5DVOA 1SYVA 4XO9A 5DJZB 1GAFL 4NOBA 1NGYA 1UT1A 2BY1A 3AU0A 4N3TA 5ENWB 5TK4A 1NBYA 3EDKA 4GMSH 4MLIA 2D2CC 3VXUB 2YLHA 4I88A 1FC1A 4JPWL 1B88A 1NC4A 2YA1A 3C5JB 3FT9A 3HB3B 3TBCA 3RWGB 3SKOA 5CJXC 3K6DA 3V7MA 4WUUA 1YEDA 5J7CC 1LL1A 4MCZB 4M8UA 1C16A 5SWQB 1KGXA 1KCRH 1DBMH 2QPSA 2VE6B 5EOCH 3U25A 3W9DA 2IQ9L 5JHDD 2HJFB 2ZTBA 2OA9A 1BBDH 2XZCH 3IS0X 4CKVX 3KPOA 4RX4D 3QFJB 2A83B 2FEEI 2J1KA 4JQIH 1UVQB 4NZUH 3UPCA 5CEYB 3CH1A 5F7MC 4AUUA 2DQDL 3CSFA 2AC0A 2JIXB 2G30A 2VQUA 2IH1B 3ZUCA 2PP7A 1S2EA 3AB0C 4PRIB 4I77H 5TFSL 3W0WE 1T5WA 1U8MA 1A5FL 2BC4B 4QGYA 2ARJQ 1L9OA 4N0UB 1NFDA 4AI7A 5CU9A 2BCMA 5KSBB 4GPVA 3FMGL 2JJTC 1WZKA 3IRCA 2YPVA 3NCJH 3ESOA 4W68A 2Z0UA 3QH3B 4HWUA 3WOVA 3X14A 3X12B 2BSCA 1T1XA 5E95B 5AAMC 4B5EA 3ARUA 5HDRA 2ZCZA 1LD9B 3HG2A 1IAII 2EDQA 2DD8H 3HZVA 1L9NA 1AZVA 2CNYA 4N26A 2A6KB 4Z77A 1ZVYA 3EJZD 1VFBA 4LOEA 3VNYA 3OAZK 2YEZB 1SLXA 3NJVA 1A0QL 1A9VA 2XA3A 3BGMB 4KROC 2M2DA 2ZWNA 3CSGA 3DVNB 4PJFE 4HKZB 4Y4KB 4AEFA 5HYQA 5IMOB 4O51B 2XQYA 3T0BA 4PB0L 4BZ1A 3MMEB 4GAAA 3O9WC 4OZIF 1CPUA 1T4KA 1SLUA 4IK6A 5C6WH 2PPEA 2DJSA 4H8QA 4XVSL 3UBFA 1LK3H 3ESUF 4QT5B 2WWMD 3KM2A 2AHIA 2XFXA 3RIFK 5SWZB 3ZIMA 3AQXA 2CRIA 2VR3A 3FUIA 5SWSA 35C8H 4CAGA 3G6AB 3ZDZF 2EICA 1A21A 3DHPA 3J07A 3B6SB 3SHSA 4HK0B 4MNGB 4NS0A 3BZEB 4ANVA 1BF2A 2XTJC 3V0VA 5AVXB 4QXUH 2MCMA 1NCAL 3EH4B 5K9JH 1SXNA 2JK5B 4K94H 4NRXA 3NABL 4U4BA 4ZW7A 1H0DB 1NLBL 1SDAB 3D3VA 3VI4B 5D5ME 2CHWA 4FFZL 5DMGC 3DOIA 2YSSB 4H20L 1JK9A 3QJHB 2NSXA 2EO1A 3CU7A 3VQ2C 1X9UA 3MRKA 4ES9A 2RD0A 2ATKA 5J9PA 4Y5VB 2WN3A 3POCA 4AENB 1YMMA 5IW3A 2IBZX 2GEEA 2C9SA 3FB5A 3Q01A 4I48A 4QXGL 4KH9A 3FU3A 4YBQD 2N59A 3S5YA 2C3GA 1WIUA 2ZWSA 1IC0A 5D2LF 2Y23A 5EZIL 4PJGF 1CN4A 3BP4A 5AVZB 5LLIC 1NWOA 1PIFA 2P24A 4X5XB 2OYLA 1I8UA 3ZO0A 3O11A 1ZHLA 1II4E 3LKPB 3U7WH 4O58H 4LLWB 4J7RA 3UMTA 4FI7A 4MJ5A 3HG0A 4N8CL 5I8KL 1RJCA 4UM9B 3QR1A 4W9EC 1YEWA 1U92A 1HHGB 2NY5L 4WJ5B 1ZY9A 4DK5A 3ZL1A 1I1CA 1URIA 2X2IA 1XMEB 3WIAA 4HGMA 43CAA 1M1XB 1NGPL 1S46A 2IC2A 3HS0A 3TCLA 1R3LB 3N1PC 4QRRB 2LQRA 2H0JA 3WIFB 4QRPE 4XNQA 3O2DH 2CDGB 2FX9H 1DJSA 3MOQA 4P57B 2F08A 4L5FL 4Y4FD 4MMZB 4XMZA 3BP5A 1VGEL 1HC1A 2OYKA 2FR4A 3NQKA 5BRPA 4XCYB 5FM5M 2APXA 1OCOB 4M7LH 3U2SA 4W70A 2GBTA 4Y7MA 1BF8A 1U95A 3QDMD 2R0ZL 1P7QD 1Y6MR 4TYUA 4MYPA 1VJSA 5DI8A 4JM2C 1V05A 4ELDA 4XR8C 3UTSB 5DD5L 1S3RA 2NR6C 2OMXB 2YD7A 2D4DA 4YHKH 3AG3B 5HHMD 5E00B 4OAWB 1T0MB 2CPCA 2WB7A 5KVEL 3H7BB 3TBYA 1P4IH 3LOWA 5F1KC 2ZXQA 4JO4L 2X4NB 3MGTA 1MRFL 1OCWL 2FLBT 5EH1A 3H4HA 5AW3B 2O30A 4XI5D 4M1CD 4WI5A 1OPOA 5BS0D 1RZ8B 1WA0X 3EKCA 4NQDA 5EU7E 1CLYL 2OJZL 1BOGB 1ODUA 1UQSA 4KAQH 2PW2B 1RI8A 1T6WA 3FUFA 2Q7NA 4AGLA 1KG0A 3CN2A 4GKLA 3DX8B 2Z4QB 3ATFA 7PAZA 4HS6B 3OJMB 3QPQC 1KJ3L 1ECZA 3WEXA 1ASQA 3GB7B 4FMVA 1IGTB 5GS0C 1J8HE 4HAFA 1MIEL 2DQGL 3CDGA 4N86A 1DBML 5EOCL 3R8BB 2QMJA 1C5DA 4ZFFB 1OP3K 2XZCL 4JG0L 4TRPL 4BXSV 3A4EA 3U7YH 4F1ZA 4B9JA 2XN0A 3D5OF 3II3A 4X50A 4D0DA 4NZUL 1G4RA 1N68A 2P80D 3GSQA 2APTA 4BK4A 3L3GA 4MXVF 3Q2WA 3NH7L 4LLWA 2MEJB 5KVGE 1TQBC 3LRMA 4HALA 2WBWB 3NG5A 3KWTA 2ERJB 3MJ8A 1U8HA 1VEPA 2WJ5A 3P11H 3ZTCC 5HGHA 3N50A 1AIFA 4MKMA 4AIZA 4AQAB 5E1AA 2EABA 3NCJL 1SHSA 5DD1L 4ZMQA 3NJLA 3SO5A 1UA7A 4X7EC 3I2CL 3PWNB 3V0DA 4EN3D 3FF7A 3PDOB 4FQPA 3V4VL 3MRMA 3PJNA 2BWDA 2HPOA 4E9XA 4ZFGL 4JVUA 3BSZH 1G43A 1XH0A 1AOHA 1TJHL 2AAAA 2J8UF 4YSAA 3ECVA 3HZMA 4ODWA 1X6LA 1F8TL 3CVHL 4OGQC 5DFTA 5SX5K 3NTCH 4BHUA 5D93C 2HSIA 1D5ZB 2GAZB 4KUCD 3VACA 3RPIA 4F20A 1AGFB 1IC4L 1KCKA 1XGQB 3E6HA 2X10A 2JKWA 1WA1X 1CMOA 2WQWA 2IGLA 3UTSA 3QXUA 2BP8A 3AT8A 4D3CL 1OGAD 4LPVA 1DQQA 1WQVT 3TVMD 5HJDA 2VJ0A 3OLGA 4GYBA 4M8QA 4GRMB 3QHFH 4DVBB 4YQXL 3A24A 1XDTT 3RUGA 5I71C 1IFRA 3RVXD 2F19H 4UTAA 3V0HA 1M7IA 5F3BA 2E7LA 5DJXB 2WBJD 1HI6A 2X28A 4CVWA 1KLUB 1VAHA 1H3TA 3MODH 1RSYA 3FO0L 4FZ8H 4L4VD 5IB4B 1AQ8A 3DJZA 4XNMB 5ETUB 4KY2A 2YD1A 3REWB 4B9GA 5K9JL 1F3JB 4XX1G 1KCSH 3EUDA 4IRSB 4KMTH 2J71A 3V7AE 3AXLA 2VH5L 3GPEA 4YE4H 4PCTA 3FO2A 3LQAL 3W38A 2R4SH 1PZCA 1WZ1H 3SDDC 5EWIL 5C0BE 2AAVA 2V2WB 3BEWB 3LRGA 3RIAF 1IIKA 2FHBA 3X3GL 2OSXA 5LVEA 4WHCA 4XP6H 1T2QH 4R7VA 4QXGH 4X7CC 1TU2B 5DHDA 1YY9C 2BVQB 3BVNB 4U1SB 3V4PA 3TFKC 3OKYA 3L48A 1WZAA 4U6HB 4YX2L 1CICC 4JLRA 3ELQA 4X7TB 4D0DB 2DM2A 4NN7C 5EZIH 2ADYA 4HT1L 2C1OB 1G1KA 2P8LA 3V8OA 2VDML 2ADJB 3Q5TA 5AAWC 3W3BA 1J10A 4DUXA 2GTWB 4HSAC 4NUPA 1ZGLA 3QUML 1E4JA 1KLGB 1F1GA 2WXQA 1FZOA 4NO3B 4UT6A 4WFFD 1U8OB 2XZQH 1JSYA 3UBHA 1EXUA 2WNKA 2P4AB 5KSAA 2OXGB 3BI9X 1H8NA 3CUPA 3F7RA 3GYRA 3M8OH 5GSVA 3ZL4L 2VL5A 3FFDB 1NAMH 4O51A 5FYLE 4GI6A 2QLYA 4JM0A 3NFSL 1NIEA 2EKSA 5I6NA 3T3MF 5AOJA 2XWRA 1I9JL 4Z7UB 3VFMA 3MLVL 4AZ8A 4P4KC 4AE0A 5C7XL 1EFXD 4L5FH 4JRLA 4LQFL 4D7BA 2X0WA 5KVGH 2VDKL 4X5PA 4V11A 1SJHB 3MGAA 2XTJB 3QJFA 3G5WA 4O02A 2Y1AA 4GT0A 1I7RA 3DTXA 1BG9A 3WU1A 3D39B 3WDJA 4ECNA 1JNHA 4JFHE 4QTHB 3O2DA 1OSPL 1FFNB 4UYQA 3KXFA 5DD5H 3PGFL 1E0OB 1VCBC 4WTWA 2PCPB 2D7NA 4MMZC 3DROA 5D1XD 3V4VB 3TIEA 1FNSH 2WQXA 3JWDC 5CJ5A 1QRKA 3WTXA 2MPAL 1N0XH 4N5EC 5DUML 3C08L 4W9LC 3DBXA 3TA3D 2H3KA 4HJGA 1H15B 3FUHA 2NYYD 4H26B 1GMEA 4MASA 4WWID 3NPZB 3GSOB 1T20B 2F1EA 4ZMZA 4AEHL 5K59F 3OF6D 4IBLT 4XPAL 1JFQL 1G0YR 5AALA 2ZWKA 4N2FA 5D6DA 2FX7L 4ETQB 1QR1B 4L4VE 3NAAH 3T8XA 2XCMC 3KR3H 1TQUA 1KTLA 1JNNL 1UM4L 1KJ3H 3MNWB 3B34A 1M7UA 4G1MA 4LAQL 4N0CC 2FLMA 1UD4A 4KK5D 5FB8A 3N41F 1JUFA 1GZHA 4F8PA 4MJID 2FX8H 5JIDA 2Y4SA 3HI5L 4TRPH 5T8IA 5JZ7D 3HBZA 1E9QA 5EC1B 3RX7A 1MCSA 3FC8A 3EXJA 4IJ3B 3VFOA 2QGDA 3QYNA 1YMHB 4GP5B 5D2LB 3ZUNC 3DJRA 3NSDA 1JDAA 1HHKA 5ECJE 1YEJL 5MENE 1BVNP 2NY2D 4F3FA 4JFOA 5HD8C 3LZQA 2KDYA 1I3GL 1S9XB 3UGEA 1S7VA 4G8EA 3IF1B 2ZG2A 1IGYB 1QBBA 3FSZA 4GO6B 1SEBB 4IBQA 1Q8MA 1IAKA 4ZW5A 1D7DA 1U9KA 1XF3A 4MZIA 4QDGA 3PFQA 4GSDH 3G6JB 3U46B 3WEMA 5ES4B 4KTEH 4POZD 1ADWA 2VN6A 3ALPA 4JMXA 5I66A 1BZOA 4JO5A 4BGLA 4ZRGA 3D87B 2D7OA 5KN5A 4L9LA 2M8XA 1QASA 4HJJL 4QRRD 1R5WB 3EFOA 5F9OH 4WDIA 5FYJD 5B3JE 3HLKA 5KG9A 4XVUD 3MLRH 3AS3A 4UOW1 5CEXA 3JWNC 1G7JB 1KBPA 2LAAA 5MEPB 3P0GB 1KPVA 1BZQK 1DANU 2X87A 1WGOA 1C8QA 1VFUA 2TRYA 5ADPL 4PV8B 4PBDA 3K80A 5EEZA 1EJ6A 4R26H 2BNQD 2IBGA 2A6KA 3IK2A 4IMLB 1FCCA 1HNYA 3SYQA 1OW0C 1RIHH 5DK3A 1JZDC 4GS7B 3QHFL 5JHAA 1MLBB 4NKOB 2BVUA 1A6AB 1T83A 5D4QA 4A7VA 2B4CC 4JANB 1EQWA 1GOGA 1NJ9A 1VADA 3EDDA 3UTPE 2XWCA 3BZFB 1AZRA 3MV7B 5HGDB 2CH8A 1WCQA 1X5YA 4P49A 5DWUL 3T4AA 3V0FA 3P4LA 3O3BA 7PCYA 3AT9A 3KPSE 4XCCH 2YEVB 4O02L 3DSNB 1FYHB 3C5ZA 1XXDC 1CD0A 1F45A 1NL0L 1WAAE 3LRSA 1JF5A 4QHNA 4KROB 2PXYD 1HZHH 4NO2A 1BJMA 1OB0A 3MCG1 3T65A 4XCNB 4NQVA 3LB6C 2R4SL 3EGDB 4I18C 3WLWD 3GZPA 1QBLH 5E8NA 3EBAA 2YD5A 3GXNA 4XZ4A 5E8OB 4B3VA 5JLZB 4Q58C 2XX0A 3QJUB 1MI5E 4ZOEA 1I9RL 3N43B 2H32A 3K46A 4POUB 3D07A 4XB8A 3BH9A 4JN2A 3EG9B 5DZLA 1FBIL 4KITB 1RIVH 2WM0A 3I9IA 1IEBB 3G5YA 2MWCA 3UAJC 4M6ML 5HY9A 4P46B 2P49B 5BVJB 1TIUA 3B5GA 4M8RA 3OSVA 5D71H 2QBWA 5FKPB 1L4IA 4OLXL 5DDHB 3ZR5A 1L5GA 2RQEA 1SEBA 3D18B 1GHFL 2EDWA 3D3VE 3TPUB 1VF5C 5JXAH 2ZWYA 5GXBB 3FCBA 4XP1H 3GRWL 4G42B 1XCWA 4OFDA 4RMVA 4EXPX 1RUKH 1BYOA 1LMKA 5C7XH 4PJ7E 1X7SA 3FB8B 4XBGB 1SJEB 5GSRB 2O61A 5KVGL 5HSFA 1RMFH 3WKML 3HS8A 2FYYB 4NQDD 2FB4H 1HT6A 4X5RA 1RZIB 3GTNA 4KI5E 4RGNC 1MWAL 1OP3H 5IVZB 4AZ8B 1EMTL 4Y1TA 2VDOH 2C3VA 4YIQB 1CFBA 2VDOB 1PX8A 3SDYH 1JZ5A 4JKKA 4DP2X 4LRNH 2ZX9A 2DIJA 3PGFH 4LPUA 4NENA 4PJBB 1I9IH 4MJ4A 4NNPH 5AOIA 5CP7B 3ZDYF 3ARDA 1IKOP 4IEFA 1C08B 1HIMH 1MCPL 1TZHB 2WHVA 4RESB 5D1QE 1HCYA 1MF2H 5DUMH 3D0LA 4UU9B 3AXIA 3TH2T 1KWKA 4IGBD 2QSCL 4PR5A 4N87A 1FO0L 3P30L 3S36H 4S1SL 5IM7B 1SZNA 4UM9D 2CGZA 1JFQH 4LDLB 2FL5B 1BA9A 1TJIH 1P6AB 3V0EA 5BXFB 4MCZA 3OSKA 3L95B 3I50L 3ZXAC 4XODA 4WO4A 3H7BA 3TBYB 4JM2B 1TZIB 1R24B 2EDDA 5EU6D 2NY0B 4MA7L 3LN5A 1KEMH 3TGXA 4LLYA 1RK0B 2NDGA 3CZUB 5HHNA 1J0HA 4AVHA 1MPAH 2A73A 4QY8A 1IM9A 4DEPC 1T5XA 4OV5A 5L2JB 2CQVA 3QJTB 1MRCL 5D4HA 5MEQA 3HE6C 3CHXA 2APFA 5D7JA 3Q8EA 5K69A 2HVJB 1IAMA 3SPJA 2EVFA 3FB7B 5B38G 3BSHA 4BH7B 1BQSA 3QJZA 3L3HB 5INCB 4PVLA 4Z7IA 4R4BA 4GMTL 2BWQA 1FSKB 5ICUA 3ARDC 4R8WH 1CFQA 4KO7A 3V6BR 5BVJA 1V3LA 2Y5EA 1ORQB 1OAUL 1I3GH 1R6VA 3A6CL 4N2DA 1BQHG 3OAUH 2Y2TA 2RCSH 4F8TA 2XJLA 2DBLH 2VT0A 2YQ2A 3SGEH 1WC7B 2FJFB 3ZHLA 1VKXA 5E8DH 2XA8L 1BEYL 2GTQA 3TJEH 3PNWB 3CVHA 4GSDL 1TVHB 2AI0L 2EDTA 3NFNA 4CBZA 3NRQA 3ZKND 1GTFA 5F8RC 5DVLA 3IJSB 3JQOB 5E56A 4KQ4L 1A6WH 1H15A 4HAKA 3EO1B 4NGHH 4FABH 3RVWD 4X7FC 4AYGA 1FQ9C 5HVHC 5ANMB 1CO1A 1JD7A 2W07A 1ET8A 2D73A 2ENYA 3JVFC 4DP6X 4AYSA 3QCUH 1YN6B 3TV3H 4EIBA 4Z8FH 3E8VA 2VRAA 3O3DB 3NIFE 4HIEB 2AEQL 2IFFH 3K2UL 1NGQL 4LSVH 4HIJA 1RZFL 4K3JL 2O5YH 2H2SD 3QJOA 4PJ7A 4PRHB 4I3GA 4XE5B 5C9JB 3LIUA 3BD3A 4L18A 1XGPA 3KPSD 3BKJH 4W4NA 1TOXA 3SDAA 1NMAH 4K7PH 1TZAA 1E8YA 4PV8A 2E56A 3U48A 3OXSB 3B2DC 3BAXA 5C92A 5CLWA 4XNBA 3UO1L 4U6YB 3KPQB 3PAYA 4LAJH 3QS2A 4ZPTA 1MWAB 5DWUH 1SUJA 5L2KE 1OP4A 2WIIB 4QTIL 4WW1B 4YSEA 4PFEA 4QPEA 6FABL 1PLGH 3AREB 3SO3C 3D69B 5IFAL 2CALA 1JN6B 3MFFA 2ITDB 2PWEA 3K6OA 1Q0YL 4P5KB 5DEFA 3EJSA 2AEIT 4ZMWA 3CIQA 4P0DA 2XV6B 3ARED 4BA8A 5I26A 4K8RD 5D7KD 3QVAA 3I3BA 1QBLL 1XF3B 3V7AG 1CT8B 1EO8L 3X1GA 4LB8A 1NGWB 1ZHLB 3BZ4B 3LRSB 2UWEF 2VDRB 2LLLA 5F2FA 1CL7H 2NUTB 2MCPL 1GVIA 4TQIA 4NN5C 1XTLA 4LIQL 4M6MH 4XXWA 2EINB 3ARBA 3LD8C 4LOUC 4K5NA 4N8VB 3FFCB 1EANA 4IHBA 1IB5A 4AYBA 4XCEA 4OIIH 1Z5LA 2XVKA 4UTBA 4LF3A 2I60H 3MRKB 1H6FA 1B0WA 4XH2B 1PQZB 5I1JL 2EEBA 4DPAX 4CVZB 4JAMA 3MU3A 5JA8B 5I9QC 4KKLD 1TT6A 1EEUA 3MV01 1EHNA 5HGAA 1DJWA 3EOTH 3JYCA 2Z31B 5HY9B 3HS0C 3MTRA 4FXGC 3SGEI 4XP1L 3CZGA 2QADD 4FFYH 2P5EB 1ZWIB 4YDIH 5IVXF 4XC1L 5LAPA 1DR9A 3GDCA 1HZLA 3T04D 2CO7B 4DESA 4GKSA 3LMJL 3VWKB 2WTOA 4IKKA 4TM9A 2M1KA 4L1HA 5E8EB 2VYRE 4KTDH 2JJWA 1MCCA 4PRIA 1CIDA 3F5WA 4FG6D 2B1AL 4MD4A 4HHAA 1TLKA 4JHUA 4OQTA 3DPBB 4MDIB 5DRXA 5C1MB 3GMLA 3WNPA 3FHQA 4TQEH 2IDFA 5FUOH 3X13B 4G8GD 3BAJA 4D9RD 5BW7C 5JOPD 2APSA 4BFGA 5IROD 3FH7A 2AEPH 1R3LA 2OAAA 5E24E 1CICD 4X98A 2CK0H 1MNUH 3QRGL 4NBXB 3W9EA 4ONGH 1CI5A 1I9IL 2AGJL 3MREB 3H9SB 5AZEL 1DFXA 1MVYA 1KXTA 1KYDA 4M7JL 1LQSR 2AQ3A 3U1SL 3TX4A 4MSWB 5LGJB 1AQMA 2ICEA 1J1PL 3ZT6A 3AWGA 1HHJA 2PCPA 1HL9A 3H3PL 1NGZB 1CVRA 2WYIA 4B9CA 5FYJU 1QI3A 3W82A 1DUYA 1NEUA 2IMNA 2GFBA 4WGVB 2DDQH 5MENA 4KXAA 1NLDL 4P4KD 3UTOA 1CICB 4BEIA 2JKSA 2RMNA 4MA7H 1WFTA 3V4UH 3G04B 1K5NB 3QEQD 1MZYA 3R1GL 5A2AA 3W0WB 4PGBA 1BM3H 1YPZB 5DJ0B 1BMGA 1CD9B 1OGTB 1Y1UA 1MCQA 3DRTB 3KVDD 3RY6A 1G9EA 5I0XA 3L1EA 4J5VA 1ZTXL 4N85A 3W11C 3L95A 5HJ3B 1PZAA 4X6BA 2XWEA 1P6FA 4B41A 4A38A 4BFBD 4LSTH 2IAMC 2HYMA 1NA8A 3VDBA 3KCPB 2R56L 1TETL 5KSVA 2IF7A 4EAEA 2WWNA 3NA9L 1G9MC 2G5UA 4P04A 1SY6L 4YZWA 3TFBA 1J9CT 4KZDH 2BSSA 2DQEH 2J12B 3AROA 4DEPB 4UINH 4QAWA 2YMXL 3MCLH 1JRHH 2D0HA 4N3UA 4ZMPA 3A6CH 1JD9A 4XMLH 2X7LA 2HVJA 3BEVA 1E9QB 2FJGB 5FYJE 1FFRA 5ECGA 3UZQA 3RFZC 4TSCL 2GUYA 2AQPA 4DO6A 2GI7A 4N2MA 4OLUL 4XNDA 5JW5A 2NNCA 4DAGL 3D09A 3FONB 4IBVA 3QZOA 5TF1L 2LABA 1TFHA 3HJ0A 4J6RL 1IM3A 3GXIA 1BBDL 1X4XA 4UT6H 3L3JA 3IF1A 3L4VA 4YGVB 4HIHB 5HPOA 3II1A 4JQIL 3S3BB 3BP4B 3TZVC 3Q6FA 4X9YA 2EZ0D 2CBOA 1OTSD 4Q0XH 3SDXE 4XPBL 1H8OA 1IL1A 5D7LD 5B8CC 2C9PA 2KS0A 1KB9K 3HEIB 3R06B 1LMIA 4AJVA 4N2IA 1MN4A 1Q9LA 1YYLL 5KW9H 3MUZ1 4FQHA 4E9SA 4Q89A 4IU2B 1X7TA 1XB3A 1YJDH 1YUKB 2OCCB 3EHBB 4PG2A 4P8QA 3UJIL 3GM8A 4KY1H 1NC2D 3SE6A 1WDAA 3RGVB 4M1GL 4P3CH 3KPRD 1B6UA 3DX6A 2Q6WB 3TONA 3KEDA 5EUOE 3ESNA 5B21A 3BKJL 2RTTA 5BQ7B 4JFWA 2IIJA 3AS1A 1B0IA 3QIBA 2J88H 3VXQA 4BKTC 1BSIA 5GRVL 1XX9C 3UO1H 5F89A 1M7DA 2YPLA 3KLHC 1A65A 1Q9KB 2AXFB 5GGVY 4FQLH 5EU5B 2YKLH 3L4UA 3DK0A 4PS3A 1N59B 3ATBA 1S7UA 3REVB 3L54A 2BP5M 5CLZA 1SXSA 2EDBA 3EGSB 5I8OL 2N0KA 3QQDB 1BQLH 2YGPA 4PJFB 3K6SB 1HL4A 2PPCA 1HYRC 5EZOH 1CFTA 1AHWA 5D7IF 3CVCA 2B3RA 3OHMB 4OGZA 1M7IB 2B3IA 2VKXA 4M61A 3D2TA 1E50A 4XVTH 5HYSB 3G08A 5JHLA 4BZ2H 4X6CF 3QDJD 4ONFL 5DS2A 35C8L 3NJFA 2CIIB 1DO6A 3C6SA 3KLQA 5EIIB 4JY5L 4N5UA 3I6KB 4OFVA 5A2JH 5E9DE 2H1LM 3PWPD 4H1LB 3MJ9L 2PYED 1DFBL 1LK2A 3Q1SH 4FYRA 1FP5A 3GRGA 4TULH 1NCAH 3WE1A 1R34A 2DWTA 3BLKA 4LFHG 3OGCB 4OIIL 1KBKA 2E8ZA 2PYFB 3DARA 3WNNA 4PJ9D 2YEQA 1HAUA 1DEDA 1UGNA 2ZJSH 3GEWB 1SVZA 2DRUA 1XSIA 1AR2A 1HYSC 2BVQA 1W0WB 2HAZA 2ZX7A 3VFPA 4FTVB 1TJMA 3PNRB 5LBSL 2IANA 4JLRB 2QHRL 5C09A 3C60B 1CTMA 1IC7L 1MJ8H 3BH8B 3AFLA 3WE6B 2FEEL 1C16B 4MRBA 5SWQA 3OXSA 3LMJH 4MQTB 1WWCA 2XBTA 4I0PD 3O6FC 4D9LL 2J20A 1J9TA 3ASWA 2EDMA 2F9BT 3VYNA 3B7UX 3GJFK 4EE2A 4M4PA 2ZOLA 4LCWD 4TVPH 5GS1A 4Y4KA 3VI3A 3GUFA 5E1AB 1JV5B 1BQ5A 1OB1A 2W9DH 1E6OL 4ICWA 1BQUA 4P2AA 4X0NA 5KVDH 3O2WH 3D85D 4UWQB 1JZFA 3ZKNC 1NIAA 4QRRE 2R0KH 2BVPB 3UTTA 2BY0A 2Z7YA 4RIRB 4IMKA 1B4JL 3X13A 1KENH 1AC6A 2EVGA 2MPVA 1WFJA 5A3ID 2VITB 3ZTDC 3T5WA 4GG8A 2HLEB 1KYOJ 1R46A 2IH3A 1CGYA 1P5UC 3GBEA 1U8JA 5T3XD 1FFPB 5HHME 1PFOA 2VUYA 1MAKA 2Z0BA 4KHXL 1NLDH 2DH2A 3RWJA 2FCBA 3Q48A 1KNOA 5EBLA 4NUJA 3IFNH 3IMSA 4B9ZA 3IJYB 3L6FB 4MCNA 3R1GH 4QJ4B 1DVFC 4GRMA 2P5ED 4MJJA 4PRPE 1HHIA 3N42F 3HPLB 3MRDB 3HG4A 4DN3H 4NZDA 1GZPA 1TKWA 3L08A 1IILE 4H1LH 4RMQA 4Y2DD 1I4FB 1CURA 2IDSA 2R69A 5FHAL 4G8GE 1OCWH 3IDGB 4PRHD 3CFBB 3SJVB 2LAGB 4YHOH 3EYOB 4YDJB 2ZYSA 2KLTA 4FKEA 5FM8A 5B1JC 3LQAC 3GSWB 2XVBA 1U3HB 3FT4B 3NA9H 4GW4A 3B8YA 4BKSC 2G3XA 1SY6H 1TPXB 4DKAA 3U46A 5CLXA 2CO6B 4LKCB 3K2KA 4I9WE 4UINL 5C0GA 5FUZL 1UUNA 3B2VH 4URKA 5F0MB 2QL1A 3RZCA 4BFIA 2CDEB 5E6ID 3HUJF 2UWEA 3X2QB 3S96B 2FQDA 3CPUA 5IB5B 1AQKL 4FHBD 4OGAC 4IKIA 5FB8B 1ACXA 4GKZB 2K9UA 1OT1A 3MRLA 1INDL 4K8RC 2XWJA 4DTGL 2DJ4A 2YLKA 1MIEH 4JFQA 1MFVA 1WCBA 3SDAD 1XEDA 2OXHA 3V95A 4NZJA 3IFPB 3KWWB 1BQRA 1I3VA 3TN0A 1T0PB 4JG0H 1U0QA 2ATKB 5J9PB 3U7YL 2TSAA 5L4JA 1KEGL 1VKXB 1YSOA 3LNGA 3GMNA 5IB1B 1NUFA 3MPCA 3UTPD 3RA7H 5IVXB 1K6QL 3T77A 3UYRH 2DYPA 4U1KA 3U2IA 3U9PH 5E94B 3OKEA 4HU2A 4Z7QE 2HT4C 1GW6A 4NO3A 4Q97A 1YYLH 4PN6A 1AKPA 4GAYB 4KQ3H 3WENA 2UUDK 4ODTL 4GI8A 4I3SH 1INQB 2XACC 2V7HA 3O11B 4GKNA 2ZQKA 2VL5B 3FFDA 3CXFA 2WCSA 3IJ8A 1A1OA 1BHGA 4KY1L 4LLUB 5AL0A 4XO5A 3FHAA 5DD1H 4R3SA 1WRFA 4M1GH 2DV6A 2OSYA 2P9RA 4P3CL 3PY9A 4NKDB 3ZDZB 5IOPB 2YUZA 4OAWA 4WJKB 4FFVD 5DZVA 2WLMA 4D9RE 1CU4L 3S3JA 3APFA 4J3OD 4ZUSB 4HOXA 1JCVA 4OF6A 1MDAA 2NY3D 3UJTH 1ZVNA 4PWFA 4DP0X 3K71A 5E0FA 1WBXB 1JGDA 4JY6A 1JNJA 4FQLL 2E9GA 1O5PA 4MDJA 3PV7A 2CMRL 2LVCA 5JDSB 5F1IA 3TH4T 4PJFF 3WIHA 3QWRD 1DDTA 1HH6B 3L81A 1X5ZA 4AQ1A 3SDXF 1BQLL 2X1PA 3OG6B 3MV8E 1N7MH 3ZYZA 3WEAA 3TBVB 4UNIA 3MOAL 5KSUA 3U79A 1FH5H 1CLZH 5JIHA 4BZ1H 5IBLD 4U3HA 4NYLA 2D3NA 3UL4A 4AEIH 1DSYA 3HPLA 3JV5A 1QSEB 4W6WB 4WIQA 3SN6N 5EZJA 3W56A 2B0SH 3U1PA 2EYRA 4AOFA 1NFKA 4PD4J 3MFFB 4U1HB 5F9DC 2ZXCA 4OZHF 3ILPA 5JNYB 1GZPB 1T0OA 1TKWB 2F19L 4MAUL 4LU5L 1C5BL 1MJJA 2XWTA 1PEWA 2VDQL 4PGEB 2V3DA 3OC5A 1HYSD 1KGJA 3EOBB 4GKOA 1SY6A 4WSKA 4K3HA 3MODL 4LHJB 5AFAA 5JA9A 4OFYA 4W9CC 3E8UH 1SN5A 5I30L 4XWGL 4JFYA 3VU1A 1H6UA 1BXXA 1RU9H 1OL0A 2Y72A 4TXVB 1RIUL 3AY4C 1YN7A 4WI9A 1IV8A 4NQDB 3VRLE 4HCRH 1PX3A 2ZJSL 1HNFA 3L3OC 2CSPA 1F2XK 2VC2B 4CBPA 1NAMB 2NR6D 1L0XA 1EZSA 2LT9A 5HI4C 3LPOA 3JV0A 3TCTA 4Y19E 4IS6A 5D9SA 4ZT1A 2H6PA 4WAFA 3UBXB 4BELD 4ORGB 3AG4B 1WWBX 2AQNA 4P9HC 1MJ8L 1M57B 2R8SH 4X6FB 3GI9L 1UJ3C 3N42B 3VFOB 5IVNA 1A6TB 4PRPA 1U3NA 1JYVA 1LO0L 1O7DE 3TH3T 3QSKB 2IDCA 2CHNA 1E5UI 4UMSA 3OAYK 1CLCA 2DMCA 1HZKA 1L5GB 1MCIA 3GTTA 2BSBA 4R5TA 4AXWA 1NEPA 1EAPA 1SOXA 4U6XB 4X99B 3D0LB 2YQBA 4W9FC 3S7GA 3M8OL 4CU6A 1NAML 3IJ7A 1HAWA 1BZ9B 3US1A 1DCLA 3UO8B 4ZXBD 1E6OH 1FL6A 4MA8H 3OR6A 4ZO7A 1P7HL 1UHVA 1HXKA 3ULUE 1BAFH 2L0DA 2J73A 2VLRB 4HAGA 5CZXD 3ROOB 2X4SA 2WYTA 3QNYA 2OJEA 4JFUA 3UTTE 2BIOA 1B4JH 1R5WA 3W81A 5CU5A 4EQ2A 1XGTA 4S0TD 1HH9B 1RZIA 4PYHA 1E2WA 1ICTA 3KS0J 3NEOA 3C2AL 1DYZA 1NPNA 1F11A 2DM7A 4M3KB 5F6HJ 3T2PA 1EDYA 5AVTB 3PCYA 2PO6C 4ZOBA 1G4MA 1S6NA 2ICEC 5DK0A 2QZQA 4KHXH 1WZLA 3BPNB 5A16A 1OSPH 2DYRB 4LLDA 2FBJL 3VRIB 1AXTH 5KYYA 2X89A 1FL3B 1OSEA 5IQ7H 3IMTA 3S34L 4JFFA 1AGFA 1TEGA 2W65A 5F88B 4Z76B 5T1JA 4P9HL 4ZMLA 2ZOOA 3B3BA 3Q8FA 3H8NA 1D7FA 3ERXA 3WFCH 5GGRY 4W93A 2OW7A 5JXED 1OM3H 4DCQA 2K7PA 1JCKA 3MYZA 1WFMA 3F3HA 2EXYD 3A22A 3QCTL 3VG0L 3DRQA 1BFSA 2WLIA 2YFNA 1NPJA 1AMYA 5GZOC 5HJ3A 3VD2A 3GXUB 4OFPA 2WYHA 3VXUE 2VDMB 4V1DD 4L4VB 4PRDA 3L7EA 2IAND 2ZUUA 5C09D 3BPOB 1ANUA 1ZAGA 3KR3L 4LZKA 3NSXA 1N5AA 3VXNB 3IDGA 4A7GF 1QLEL 1SMAA 5KJRH 5AW9B 3DXAD 3RWEB 4P2QD 1NAMA 4JRYE 2FDBP 5DVMA 4Z0BH 1ZHBA 3BO8B 5E6ZA 3TESA 2C4FU 2PW1B 4N0FA 4Q4EA 6PAZA 3T6XA 2JI1A 3KCWA 2K0RA 1YYCA 2IQ9H 4C83B 4DKTA 1MHCA 4HOMA 1U8MB 3HTLX 2QVFB 2OX5B 2OV0A 3S96A 3PGDA 2ZKMX 5DFWH 2HFFA 5EORH 4N6RA 4OJFH 2F53A 1GKOA 4ISVB 1I9EA 1C7TA 4XNQB 4NZTL 4GIPD 5I1LA 4P48A 4P3WA 1FFPA 4FS0A 3WMPA 5K9QI 3O41B 2G4EA 4I77L 1KIQA 2XVLA 4K23H 5C0DA 2X05A 2G5BA 3TJPA 1A5FH 3KM1A 3TC9A 4TVUA 1KGCE 4DT2A 3EYUH 4U1MB 3TO4C 1ORSA 5KJ4A 4EIGB 3R06A 2KBGA 4MKTA 4QHPA 2JB6A 1LWRA 2YPVL 3OZ9H 1U95B 5DJCA 1I1FA 2XIIA 1AD0B 5L7XL 3J7HA 2C4FT 5KBLA 2E9IA 1J88A 3DX3A 1UH4A 3CX5K 1TNMA 3LZFL 1CU4H 1INQA 2WZ5A 3RY4A 3F6IA 1A3ZA 2F58H 2VXUL 2W07B 1HSAA 1HH9A 3QDHA 3RWCA 5F7KC 3PWPA 1N3NA 4ZS6D 4QKXB 3SQRA 3MLRL 2CBPA 2FQEA 1CG9A 3QIWD 1F11B 4JHAL 5DJ8B 3RPKA 5DRWA 4XN7A 4KC3B 4YDMA 3VWJA 1FVDA 5EU3A 2ZF9A 2J1WA 1A0QH 1CT8A 3HC0A 4HF5H 1HDMA 2YD8A 3WY1A 2OK0L 4L8SB 4PJDE 3QK0A 5E5LA 3H55A 3LTVA 2XZAH 2BHYA 1N7ML 1XGPB 1SQMA 2TSBA 3CVBA 5AG8A 2AXFA 1A6ZB 2HJLA 3MRJA 2VZTA 5DMIL 1G7LB 4Y1AB 2PW2A 1RIHL 1CLZL 1G7MA 1YQVL 3CFJB 1MG3C 3JVGA 3QUZC 5FYKD 3VRLF 5CKAA 1ITCA 4J4PD 4XPHH 1YECH 3L7FA 3DHJA 2Z4QA 3K1KC 1NC4B 2CCVA 5AAPA 1M7XA 3K5RA 3T6WA 1E5YA 2OMYA 5J89A 3X3FL 4GUOA 2VDQH 1V54B 4IKJA 5E6IA 3KDMB 2UXTA 5CGMA 2X2YA 5SWSD 3HBQA 2A6IB 1NMCB 3PWLA 1OE3A 3CFTA 1GKEA 1U36A 4QTFA 2ZYRA 4KVNL 3NFPA 1HZHL 1NANI 1A3LL 1T4KB 2F54B 4U6TA 3LN5B 3C5XA 5HHVL 4OIFA 2HRPL 3C6SB 3BRFA 5H4ZA 3WXVL 2DEXX 2GUOB 5DTFA 1M56B 4XNZC 4XPFH 1SVCP 4WVRA 1CXIA 1S7RA 3POHA 3RX9A 2C9VA 1UJTA 1GXEA 5DR5L 2WTRA 3VD1A 1MI5B 1J11A 2QVMA 3A0OA 3RG1C 4D8PA 1RJZB 1I9RH 4JFZL 2D3JA 2YMOA 1E6JL 2XSKA 3EJZC 1E8ZA 3GI9H 4M00A 4NCDA 2FE0A 2NT1A 4UDTA 4N28A 1EGJA 4ZUVA 4CVXB 1LO0H 4GXUM 4J6IA 4ZUUB 1GR7A 1G7IB 2XN2A 5IMKB 4JFDD 1JWUB 5I82A 4GQRA 2A74B 1ZT1B 5CKGA 1J8HA 1UFUA 3H3KA 4H13C 3C5SA 3BUQA 3DNKA 4OFKA 2I5YH 4KH2A 3O0LA 4NWTH 3NSJA 5E2UL 3V6OE 2P5EA 1DQDL 5H35B 3PV6A 5D7SH 4HYTB 2VW7A 1BAFL 1GS6X 1RUKL 2A9NL 4ZQTA 5CHNA 1KV3A 2DM3A 2ZE0A 4FDWA 1AIZA 3T0EA 2R7EA 3Q2CA 3BZFA 2AV1A 4L3ED 4F2FA 1OB1B 5SX4I 2JJUA 4JFEB 1CTOA 1W0YT 3N44F 3C2AH 4MZ2A 4ODBD 4M7LL 3AMLA 1EMTH 2BMKB 3S3PA 2X4QA 4TVPE 3P77A 5KVMC 3ULVF 3QUYC 1TUPA 1KBVA 1I53A 3SDYL 1IZKA 3SYPA 4KO9A 3OJDA 3S34H 3S97C 1ZJBA 5AW7B 4YHKL 2W60A 2PPDA 5ERWB 5DK2A 3PJSA 2R0LH 1CJYA 5BUAA 1JXGA 3S36X 1NUDA 2BSSB 4FG6C 4RGNB 4UOJA 3KH3A 2BVTA 4L4JA 1JTPA 4V2BA 4HC1H 3O9WB 3TN0D 4ANXA 4JFPA 5DJYA 5DEGB 4AQEA 4XCYA 3D33A 4ZYKA 2AK4D 3L6FA 4S1QL 4DSYA 1G1CA 2VO5A 3ZTJG 4H0GA 2G2RA 2CLRA 1ZV9A 3RP1A 1IEBA 3G5YB 1B3JA 3MLUH 5AW4B 3VG0H 2CJUL 4OKVA 1CLYH 2OJZH 3CE1A 4TN9A 1NDGA 1QUNA 1SVBA 4MD5B 3TWYA 3PLYA 4OCXH 1ZS2A 3FQXA 1L9QA 4OVVA 4OLZH 4C47A 3RZCC 3SKOB 4TSBL 1SYSB 5C8JA 4P99A 1MFUA 2ADJA 1O9VA 1XXFC 3BWUC 2IH8A 1F18A 1PAZA 2Y7QB 4YPGA 5E6YA 4DZ8B 4P2RD 4X6BB 2AQRA 1S7RB 5F0PB 1IL1B 1ERNA 4NQVB 4CDGC 4QHUA 1NGXB 3RNKB 2DQGH 3VH8B 5I23A 3BAKA 4FC3E 4TLTA 3A47A 4U2YA 2HTKC 1R9FA 3P54A 4NT6B 2YBGA 3EFDH 2CDEA 1JK8B 4OZGB 5HGHB 2BOBB 5CJQL 3LQZB 1BFVH 1F86A 5GSRA 1Q4NX 5FV2A 3UDWC 5IG7A 5I75C 1RP9A 4X4XB 2CM5A 3TA4D 3MRHA 4OJFL 4UT9H 3IFOA 2W5PA 3IXAA 2Q2LA 4R8WL 3IPBA 4WHYG 1Z5LB 3U30C 1RLWA 4I1RA 2EDJA 2FRGP 5KSBA 1S8DA 3OAUL 4AYEC 5C0CA 3P11L 2VDNB 1GGCL 2WB1A 4FLHA 5IMMA 2GSIA 1DBJH 3K4ZA 3MLYL 3PP4L 3AQYA 3OQ3B 1BEYH 2NW3A 4OZHB 1M3IA 5GGSY 2F53B 4ISVA 1VEOA 4R7NA 3ROLA 3I2CH 2DICA 5BS0A 4GO9A 2K8QA 5L7XH 2LOEA 4PRNB 5TGBB 3WN5A 2VWEE 1IJNA 2IPUK 4LASL 2NNAA 1ZXQA 2QPFA 4NSKA 4AKQA 2GJ6B 2XWBB 3LZFH 3VXOA 3CBRA 5F6IB 3RWDA 1A6WL 2F58L 7TAAA 5F1NB 3LKQB 2MCAA 3TYFA 3IJHA 4CU7A 2ESVB 4PM1A 5DURD 4ABVA 1DO5A 1NEZA 4D0CA 2P5PA 5FW6A 3A5VA 3RTQC 4HKBA 4FQXB 3NTCL 4N9GA 1B0GB 4HHAB 4JHAH 3O8XA 3GMMB 1OP9A 5SWSE 2H4EA 3HG1A 2DIEA 1FVEB 4Z8FL 5MP6H 2JJSA 4KV5F 3DETD 4R2GC 3DKHA 2D7PA 4JN1L 1BOGA 1UQSB 3FCUB 1TEYA 3HAEB 4YWGH 3WO3B 4MDJB 2XQ0A 3VFVB 4UTCA 1H3PL 3X1NA 1MCKA 3OM3B 2YAMA 4PJXB 3H6AA 5F97E 2DQTL 3UPRB 2P7TA 2W92A 3ET9F 2UXGA 2XV0A 3IDMA 2DN7A 4MSWA 5JPMB 1U2CA 4XTRC 1X5MA 2EXSA 4GT7A 4Z5RB 4APQC 3TS8A 2KPWA 5L0QC 4HS8H 2ETWA 1W72H 4CSZA 4F7EA 5HGBB 2BRRL 4O2FB 4YXLH 3LNHA 1RY7B 3QZLA 3NGBB 5E1GA 3PWUA 5EFIA 4FZ8L 4X5QA 2GCYA 3V5DA 3DO7B 1X5LA 3HG5A 4FD0A 3ARGD 1A3LH 1Q0YH 2BZ7A 2X2UA 5JQHC 5ALCL 5AOKA 2DKMA 4JHWL 5CUSL 3TNNA 2HRPH 3MRNA 2XWZA 1IKNA 1PCXA 5C0AE 3WXVH 1FA4A 4ELMA 4E0RB 3ARFA 1CUOA 1PKQA 2CXKA 4XPFL 3BAEL 3U4EA 2R2CA 5DR5H 1EO8H 1KLGA 4AJ0A 3GC3A 1T2QL 1DBAL 2J8OA 2XG5B 4X7SL 1E6JH 1H3UA 1QW9A 4UZSA 4A7SA 4YX2H 5IHLB 2MQGA 4RFEB 3LNFA 3QWQB 1T0NB 3TF4A 2AKRA 5L8LB 3JV6A 3IDYB 4LLQB 3VD9A 5D2NB 1KIPA 3DMMA 1J86A 4MJ6A 3T3PB 1IGJB 3QUMH 1BLNB 2LV4A 2V2XB 4JPSA 4PV1C 2BVPA 1DQLH 4HKXA 2AMUA 4JG5A 4YSDA 2MTAA 2GJRA 3H9HA 4EUPG 1T2JA 4WNQB 3IXTA 2C3HA 5DC2A 3KPRE 3QXWA 4NWTL 5B39G 3TXAA 4UF7C 1HEJC 3NFSH 1IIIA 3MUGA 4ZFZA 1DQDH 3DDFA 3GLEA 3MX0B 2OR7A 3KWUA 1FZJB 2EDRA 3VGAC 3MLVH 3VE0A 2QTVA 4OCWH 3CDZB 1MFAH 1J8HB 4WW2F 2DWDA 2UY6A 3QPKA 3B9KB 4WI3A 4V1DE 5ISZD 1Z1WA 3MSPA 1MW1A 3GIZH 4C54A 4NKOA 2VUKA 1KXQA 5H35A 5AW8B 1J5OL 1NUGA 1SPDA 3FCGA 3HG1B 4DF9A 4Y5XA 1N70A 1M9WA 5ICYA 5CHNB 4WSGA 2JQAA 1ZD6A 2MQ3A 2OMUA 4E5XB 2AEPL 5G4MA 5KWYC 3JZYA 4LT7A 1IQDA 1MNUL 3QRGH 4P2QA 2VR5A 4ONGL 5FR3A 2AGJH 1L7TL 2BLFA 2X9WA 3SKJH 3A4AA 4GW5A 5M94B 3MXVL 2X4UA 3QO0B 2X3CA 1FDLL 4ETQA 2MPAH 3GD1C 5DFAA 3U1SH 2H32H 4LDEB 4JDVA 4YZFE 3ASOB 1FAKT 4OJYA 2TAAA 2LU4A 3Q1EA 4FLRA 1XIWC 3H3PH 1JXKA 5KVFE 1IGCH 4LRIC 5DZAA 5F7YC 2G9KA 4A63A 4MJIA 3MLUL 1DVXA 4UDTB 5EFIB 2A3TA 2WXMA 1XCQA 3IGAB 4PTUA 2OKMA 1NBQA 3EH3B 4I4WB 4OLZL 4JX0A 5DUBA 3DVGB 1CE6B 1LDPL 2DLIA 2CUHA 1C12A 3WGUB 1RZKH 2AV7A 4QR7A 5I6MA 3ULUD 3WL9A 3KLLA 4M4RA 5FA3A 1T22A 1ZTXH 5DXWA 1UA3A 1ZLVH 4DZBB 2OXGA 4X6CE 3T08A 2ZOKB 5KYUA 4FRWA 4HH9A 4UIMB 4AV5A 1TQSA 5EU4A 4GKNB 1AZCA 3PWVA 2F18A 2FBRA 3NZSA 3ZGHA 3CC5B 4KKAD 5E8PA 4KOBA 5AAWA 2MKWA 3QIWA 3ML9A 4KZDL 4Z7OF 2WBKA 5G2NA 1JPGA 2JCCB 1COBA 1AJ7L 4AMKH 3FF8A 1S7SA 1JRHL 2OTPA 3FOMA 1KGUA 3H54A 1AXIB 5J6HA 4FHKA 2Y25A 3PF2A 2WO4A 1PY4A 2EXYC 4ZS7H 4M6NH 3G6JE 3T09A 5CEXB 3I02A 2PXYC 4P2CG 4XH2A 2NYYC 5A7EA 3VXRA 3A67L 5TF0A 1YMHA 4LASH 3FT1A 5EUOF 2DI9A 3VXSE 5DFVC 1A66A 4ZFQA 5F1SA 5F9OL 4Q0XL 1GGIL 3IDJA 5C07B 3SODB 1TTUA 3GSRA 5DJCB 4MMYB 2OZ4A 4H2AA 4OI8A 2ZP0T 5C0EB 1DEEB 1R3JB 4F2MA 4D94A 4C56A 4RA0C 4FP8L 5KW9L 4B6ZA 2DPKA 1JXJA 2FQFA 4JVWA 3UJIH 3G5XA 4H0HB 2YUXA 4WEBL 2V2TB 1EZVY 5EEXA 4KKLC 5BXFA 2FATH 5FKAB 2L7UA 4XMTA 3AB0B 4MZ3A 2FGWL 2YS4A 1H3PH 1XV8A 2BPBA 5AUMB 5IQ9A 3N1GC 1E9OA 3SY0A 4HG4K 5IV2B 1O0VA 5DJXA 4JJ5B 4OZGE 3ZT7A 1FVEA 4ODXB 4JFYB 1BW8A 2VLLB 2OMWA 3F85A 4J3OG 2EJ1A 4JDVB 4P5MB 2A9AA 1L6XA 1SXBA 4R96A 1KLUA 2EEXA 4CMHC 1MW3A 2HT4D 3RWHB 8FABB 2Y7NA 1W72L 2Y7OA 1G7MB 5E0QA 1TQCB 4JO3H 4WF7A 3B3IB 3B7YA 4POZC 1E3FA 3WS3B 2OSLA 1YEHL 4KNUA 4WU7B 4JPKH 4OV6F 1KNOB 4MXVE 2ZWLT 5I1IH 3SPIA 5ALCH 1VFAA 4UQ9A 3VM5A 4F27A 4JHWH 2VB5A 2Y5TA 1C7SA 4R84A 4OZFG 1W72A 1ADQL 4NM4L 1S3KL 1YYML 3PHAA 4CNIB 5HGBA 5MEOB 1I8KA 1YEFH 1A47A 2YD3A 3HZ3A 1LE9B 1S7VB 2ERJC 4G8EB 2GCYB 4L05A 3UZEA 4YS4A 5I0WA 3WIHL 1ZA6A 4XVTL 3O3BB 1ONQB 1J0IA 4O2EB 3GNML 3VCLB 2BS8A 3MA9L 4X7SH 2ZCKH 1YEDB 3G6JA 3MRNB 2EYTB 5DDHA 2ADIA 1FBIH 2EDFA 4TOYH 1CBJA 3KPLB 4NO2B 1S9VA 3FRUB 4CADB 4QRUA 1BVOA 2YGNA 1MWOA 2VWEC 1OHZA 3ILQD 5I76B 1CFSB 1BAGA 3QUXB 4U6VH 1WP6A 4GRWB 1KJVA 3NEXA 4N8VG 2B8OT 2B77A 1VB9A 5MEPA 4DPBX 3B9KC 3NJGA 3KPPA 1OD9A 1Y6KR 1GHFH 4J23A 2ZICA 2X7LB 2IV8A 3LN4A 3DJSA 5BO0D 1IE5A 1AGDA 2BC4A 5LBSH 3GRWH 3QZWA 3CPLA 3O8XD 4WRLA 5CIPB 5DK0B 1G5AA 4HPHA 3LPPA 4OCWL 2AJXH 2NX5E 32C2A 3SZ6A 3VXQB 1UCTA 2DYPB 1VENA 2AJZB 2UZIH 5E6UB 4XX1E 3JYBA 3GIZL 2V9RA 4NO0A 2D7QA 2P45B 1AH1A 1GZQB 4QHMA 4OI9A 3JTSB 3LDBC 4KV5E 3KXFB 1FFOA 2ZSVA 1MWAH 4GRLA 3KPQA 3KYKH 4FQ1H 1TXKA 1XCXA 3DTUB 2VDOL 3TEWA 3OR6B 4ZPVA 3F58H 5AYQA 3UXFA 3OKMB 3C5ZB 2DTML 1VEMA 3I75B 5IBUB 2W9DL 1WBZA 4L1BA 1AACA 1O6VA 3ATAA 4XB7A 1M6UA 4XZUB 2ADGA 3EH5B 5I1EH 2OR8A 1HIML 1MCPH 1NCUA 2IXQB 2R0KL 3SJVD 5IHHA 2H0FA 1IE4A 1ESOA 2B59B 4HUXB 4JM2A 1GMIA 1RHHB 1X5GA 5DS8A 2D4FA 1Z6JT 3K6FA 2HG0A 2VZ3A 4MBOA 5T1KB 4NN7B 1NCJA 1IGCL 5HYJB 3GMPB 2SODB 5BZWA 4JZOA 1Z5HA 5F9WB 1CI3M 1IAOB 5FXCH 2DW5A 4JRWA 5EU5A 3MNWA 3U9WA 4N0YL 2PP9A 5T5NF 2APWA 1ZHKB 1RVFH 1CDJA 3C12A 3FN0L 4A1RA 3PGDB 4JUSA 5MEOA 1F42A 1OPGH 4J3TA 2H26A 2D9QB 1QSEA 1W0WA 3KGSA 4YSPA 5DSCA 5K9KB 1QFWL 3RVXC 1XSOA 1ACZA 4M1DH 5CJOH 2WSDA 2X53A 1J9SA 4HKJB 4U0QB 3LZNA 4KRNA 1JF1A 2A38A 4TQHA 3B1TA 5H4YA 1V27A 1CQYA 2F74B 2ZUVA 4X9BA 3LVEA 1ILSA 5EC2A 4HZAA 1AGEB 1ZMYA 3BZ5A 3TO2B 1AJ7H 5EIIA 1BAWA 4J12A 4WWKA 4BK5C 2VR4A 2PN5A 4PIBA 3VSQA 5J3HD 1TQVA 4FCHA 2Y9RT 3ZMEA 1PSKH 3V5KB 1E2ZA 4OVUA 1GJUA 1INDH 4PJGB 2V7NA 3K4AA 2OMBA 1LYQA 2AI0H 2B1OA 3MAWA 4KROD 1UT2A 4TUUA 4F7KA 2MNWA 2P8MA 2H2PD 1AC0A 1BWWA 1KLFB 1PY9A 1X9RA 1QWUA 4XN9A 1XQ4A 4Y2OB 3CFIC 4NQSA 3MREA 3RA7L 2Z3FA 1PKQE 4UM8A 3V0VB 3QFDA 1HQRB 1GGIH 4ANUA 4U7KA 2XLLA 3PQYE 4FABL 4WV1C 4Y1AA 4HPOL 2HFEB 1BBJB 3K2IA 1G5GA 1H0DA 5ITFB 1KT2A 4FP8H 1RJYB 2YZ8A 4L48A 4ODTH 4WU5B 3TV3L 4PY8I 4N2BA 1FNFA 1AKJD 2QFRA 3HNTL 2PR4L 1KTJA 4FNUA 4IGBA 2E59A 3FMGH 4Y88A 5F7AA 2FATL 3BWSA 4GSRA 3TTSA 2O5ZL 2JWYA 1M71B 2FUQA 2VLRA 1TCRB 4YHPA 5FYKL 1HSAB 2XYCA 3V5HB 4F2EA 1A1NA 4K07A 2Q20A 1L3WA 4JK0D 1QACA 4PGBB 1CXHA 2WXJA 2N0MA 4F33B 4URTB 3QT2A 1D9KB 1BLIA 1H8SA 1L9TA 4PJ8C 1BD2E 1G87A 2BIHA 2H41A 1AO7E 2EUXA 2B2XH 2XQYK 2L7EA 4JO3L 1XAUA 2OTWB 3BMVA 4MJ5B 2DYSB 4DPRA 1K4DB 4E2OA 1J05B 4WEEA 4YC2B 4S0HA 4WJ5A 3TJHD 4PB0H 1OO2A 1FH5L 4MWFB 4WHYH 3VXUA 2A9CA 1S3KH 1YYMH 2NY0D 3SOTA 4RWYL 1CGVA 3RTQD 4OIAA 4WTQA 1AZZC 4KU1A 3INOA 4IKLA 5ILTL 4Z78A 1FZMA 4OD1L 4UBDC 4AQ8C 5GS2D 3MZGB 2FJGA 4JKWA 1XCTB 4PI0A 1BIIA 3GM0A 4MAUH 2P28B 3KDMA 3SKUD 3HC3H 3AREC 4L0ZA 2Y0SA 5DJAB 1IVTA 3MA9H 3VNZA 2C7UA 3CFKB 3LKSA 4Z3JA 4KX7A 4ZZFA 3MLWL 2VRQA 3B9DA 4ZJ9A 3E0GA 1P9MA 2A83A 3B9EA 1T20A 4MTMA 5HVWA 5J1AA 2PPFA 1TTFA 2BJMH 1NLBH 3TEXA 4FFZH 3U36A 2JIXA 4H20H 1NINA 5GS0D 2UXFA 3NZUA 3P9LA 1JHTB 5L8KB 1X9LA 2NY2B 3V6FB 5IMLB 3KMDA 3K4DA 3DX4A 2F8IA 1T5WB 1S7XA 3RX8A 1HXYB 3EOTL 4PGDA 3KVPA 3UC0L 4FGMA 3IJEB 1T4WA 1V7NL 4FFYL 5I19H 3R0NA 2EILB 5C0FA 1WBYA 1K4CB 3OWEA 5I18L 3MBWA 4Y19D 3Q44A 3VTAA 5B3JF 4RMRA 3HZYA 4L9DA 4DVRH 2UZIL 3MLZL 1LD9A 3A23A 2VKWA 3ZIYA 3I85A 3HUJB 1OWWA 5CSGA 4K3DH 1M3JA 1FHGA 4R9HA 4M1CC 1GGTA 3HZMB 3MFGB 4TQEL 5B39B 2JLPA 3PFUA 2A9BA 1LWJA 2NY5H 1N18A 5AW6B 2NY7L 4H5SB 1GRWA 1HOCA 3B56A 5K39B 1UOWA 3M6DA 4LNVA 2X9YA 3KZ8A 2DTMH 2QVKA 4HWBA 4L4TE 1NGPH 4QYAA 3FK3A 5AZEH 1AD0A 4NEHB 1XF1A 1Y0LA 1S9WB 1I7UA 5F9WC 3WMSA 3O2DL 2OS7A 3NSFA 2ZT9C 4MNQD 4O2CB 2Z8WC 3N06B 5D55A 3TWCH 2LE9A 3DPBA 5DFVD 1VGEH 1DLFL 3I75A 1HILB 3UGUA 5I0ZA 5CO1A 2IDUA 2OTWA 4OFIA 5TH2A 1N0LA 3V10A 5DRNB 3O4OC 5SWZD 2CK2A 5KJ7E 1RZPA 3CFDB 3U0TA 1M05B 3LXCA 3VRJB 1ES0B 2R0ZH 3GSUA 3C6EA 4XOBA 4HEPA 4DGYL 4PGCA 3FUDA 1YDPA 4KFZC 1RVFL 4W9GC 2C1PB 3BQUC 2X4PA 1HH6A 3T0EE 5DJYB 3ECWA 2FIKA 3P0VH 3VXSD 2XZZA 4B9FA 1QFWH 4ELKB 3MR9B 1ZT4B 4X9IA 2ZWZA 4AGNA 4GEJA 5CWSA 3OAYH 2GIMA 3DC0A 1QYGH 2IQAA 3E6FA 1G9NH 2IWEA 4LSTL 5IQMA 4B7LA 1ASPA 3QCTH 4DJMA 2R56H 1CICA 1TETH 1KFGA 5DQ9B 5ITBH 2BHUA 3S3SA 2Y1YA 3T0DA 2VSCA 5B4MC 2DQEL 3AITA 3G6DH 3HVDA 4G5AA 2UX7A 1XFPA 3WGVB 1HJCA 3IRPX 2BOCA 5B1BB 4DP5X 1AFVH 2DBJA 5KJRL 2PCXA 4YDLC 4QOKB 4Z0BL 4NWUH 5D6DC 2NDFA 1A2YB 1Y18B 3PXJA 3WUWG 1HN1A 4FQXA 4KI1A 1KY6A 4N9GB 4XZUA 1P0SE 3ENEA 4J6RH 2BM3A 5D4JA 3CHSA 3QPQD 3WKQA 3CH1B 4M56A 4PCSA 1BCIA 1XVSA 4RFOH 3K2MC 5KVFL 1NCTA 1M1XA 2Q2EB 3W5MA 2QADB 3HZYB 2NY4B 2WO2B 4ZUVB 4CVXA 1CLVA 1JHKH 3OJ2C 1WFUA 4B95C 1B4LA 4NZTH 1G7HA 4WKZA 1FNAA 4J8RB 3BN3B 4OZHA 1DQJB 1YPZE 2A6DA 3K81A 2IH3B 5EA0L 1QX1A 5D1ZI 2PR4H 3ESPA 3ROLB 1YNTF 3EYUL 3OB0H 5GGSB 1JI2A 1SDDA 4TNFA 1JNHB 2YAOA 4LMQE 4CC4C 1TU2A 1ZVSB 1YEIL 2PWGA 4HJTA 4BXVA 1N8ZA 3V4VH 5DA4A 1RJYA 4WU5A 2OMXA 2BCKA 3CZJA 3BC9A 3PHOA 3V9CA 5I28A 5C3TA 4O2CA 1JPTL 2N3JA 1Q9LB 2JKLA 4WFFE 3RTLA 3BQVA 3EZ8A 4A55A 5DD3H 1F8TH 3CVHH 1UUSA 4GSXA 2B2XL 4M02A 4RAVB 3PL6C 2GSMB 1WSST 4HF5L 4BCYA 3MLSL 4U1LB 4BHUI 2OK0H 4UDUB 1I1YA 4G8FA 4GP8B 5KAQG 2JQZA 3NP3A 7FABL 4R5XA 4Z6AT 3V4LA 4OZIA 4L4TD 2VQTA 4X5WA 1O9ZA 3OR7B 3QXAA 4Y9BA 5CD5D 4OCLC 4E9RA 2YAQA 1YECL 4OD3L 4ORZC 5JMOC 2VERA 1V10A 4AM0Q 4OF3A 4HUKB 2ESVD 1NBVH 3RGBA 1A6VL 1KCVH 3RTQA 3DTDA 3AU1A 3MCKB 1NIBA 3HC3L 4ONFH 1RZJC 2PO6A 2G4GA 4NRXB 3MLTB 4YVNA 3QFDB 4NHUB 1DFBH 3Q1SL 2FNWA 2MQCA 3O9WD 3TN0B 1WPCA 4FA7B 3MROA 5IJVA 4LP5A 2XIDA 4I0PA 2CIKB 4GBXC 1KT2B 3QZMA 3CX5J 2Z1KA 2W0FA 2VISA 3MGOB 1CYGA 4U1KB 2DWDB 2UY6B 1F4YH 1D5RA 3I3EA 2CBQA 3ISWA 4QOKA 5DLMH 2F1BA 3X3GH 2FTAA 5FYKE 3F84A 1BX2A 1ZK9A 4UNTA 4XP6L 4DQOH 2ZKHL 4HLZH 1NMBL 4APQD 3CFMA 1NCDH 4G82A 2QHRH 3QNXA 4LESA 1PY0A 2ZOLB 3H2QA 5BRZE 4R3SB 2EIMB 4Y4HC 4X6DB 4LLVB 5AW2B 4LCUA 3HNVH 3FO1A 2VC2H 2VDMH 5AQ0A 2F5AL 3E3QC 4M29A 1ZJAA 4D9LH 3BKMH 1VDGA 2OX5A 2WSKA 4B9YA 3QDAA 2AJYL 5L9DL 1EEZB 2DLTA 3CXDL 1QD0A 2BRQA 4KZ0A 3K71B 3FBKA 1FFTB 3ZL4H 5J06A 4UI2A 5CCKL 2PP8A 4G1EB 1AQDB 2G2NA 4EIUA 4UV4H 2XOTA 3FOLB 1GZQA 3KD4A 5D7SL 5KVDL 1FG2A 1A4AA 1QA9B 3ELAT 3QG7L 2HKHH 4NX0A 1AANA 5A6IA 3NIDB 3AY4A 1GGYA 4IRZL 1KENL 4XVUC 3H0TA 4IOSD 4LQFH 1X7QB 4G8IA 4HKZA 1CTNA 3I9PA 1JOIA 5HYQB 5H94A 3MO1A 4KUCF 1RKRA 4G6JH 4NKIL 3QZBA 3T9WA 1KN4H 4A66A 2ITEA 1PLAA 1GH7A 1EGJL 4XXWC 2NY4D 4G6AD 4WWKD 4OT1H 3HAEH 3SGJC 1JHLL 5SWZA 3MKGA 1CFVL 4K5MA 4H8WC 2VM3A 3CZEA 2NY2C 3D4YA 3ZKSD 1I7ZA 5AYTA 4JCLA 1VGKB 4GNKB 1OF0A 3F7YB 2VMDA 4NHCH 4W4OA 2XBZA 2FH6A 1N0XL 4ZUTB 5BRZA 3B2UC 3C08H 4TTDC 5FOJA 4YHZH 3GBDA 4BSVA 1QYGL 1WT5A 5HJGA 1T03L 2W1NA 2UWEB 1AY1L 3B2XA 4S1QH 4DP7X 1TYJA 2GI0A 1QO3A 4XNZB 5FA4B 4R0LC 2D03L 2GC7C 3R0MA 4S10A 2C4XA 1RUML 3MRFA 2XY2A 2YRBA 3SBRA 4XRCA 5ID0B 2VNCA 4OCXL 2MNJB 5FUZH 3NAAL 2DYPD 4HIQA 3B2VL 3UZQB 3OX8B 1FC2D 1R0AL 3LXUX 4XAKE 3E6FB 4GQPH 4FJ6A 3VGEA 2YN3A 3RJOA 1EDQA 3S48A 4A37A 1WAAF 1N5YL 4Y5VC 2WVTA 3QUZD 4WFGE 3KPRA 4QF1A 5HJBA 3RWFA 3OKEB 4UUJB 2C8NA 2AP2A 1LO3L 2K9FB 2GEQA 2KZWA 4G6FB 2VJ8A 5D70L 4AGPA 2AMGA 3HBPA 1QHOA 3EFDL 3OF6A 4PJXE 4GG6B 4RFOL 2ZXEB 4ZSOE 5KVFH 2NUPB 5C0CE 4FYQA 3RDTA 4DO5A 1KEGH 2E27L 2UY7B 2DEYX 3SE4C 3BUPA 3UYRL 1OE1A 4N9OB 1YEJH 2ED7A 5LAXA 3ARFC 3UG5A 3D85A 4L5FE 3GRWA 3VWKD 2WKOF 4I3SL 1GGCH 4Z7WE 3S8WA 4N0UE 1DBJL 3PP4H 4P5RA 4F7PA 2VMFA 5EA0H 2QT6A 3I6GA 2IOIA 2VXQA 1JPST 1ZV2A 3DGGA 2XN9E 1WBXA 3D39A 4IQHA 3TOPA 3LVTA 3BOVA 2OMZB 3B2MA 2GK0A 4IHOB 1MJ7H 3SBWC 1YEIH 2Q7YB 3QG6A 3K72B 5C0JA 1A1MB 1XWVA 1BOYA 2I9LB 2NXZD 3N43F 1ZANH 2CKBB 4QRPD 4HJJH 5CBEB 3MRPA 3BVTA 3UJTL 1I31A 3WG7B 4JGNA 1IVLA 2VRKA 3ZQWA 5B1AB 4NQEA 1QFHA 4LVOB 1ITBB 4MAYC 5IKCB 3CFBA 4PG9B 5IW1B 5ADPH 3BESR 3I74A 4PJIA 2WZAA 4I2XE 3NZ8A 3F64A 4WV1B 3ZKXC 4EZJA 4S0SD 4PAZA 4PJCF 5IQ9B 3UG3A 1Z9MA 4MB5A 4MXQC 4TQPA 3HHMA 4K5OA 2X4UB 2ICWB 5D5MF 1NIDA 4HLZG 3BDXA 4WI0B 5EU7C 3U7AA 5TQ2H 2DQTH 2V37A 3F7VA 1CFSA 5IB5A 4G43A 1DVFB 2B39A 4PU2A 2YD6A 3FSWA 3B3IA 4EBQL 4EOWL 2DZEA 2CG9X 3AMKA 3MV7E 4YXLL 2X1WL 3D2UB 4WI2A 4WO4C 5CN3A 4DGIL 1JYWA 3KG5A 4XCCL 4QKTA 5JHDB 3AXLB 3MNMA 4FQJH 1HHJB 1NL0H 3UEZA 2HVKB 4PJAA 3E8UL 5I30H 3MV9D 1A14L 1RU9L 3UTZB 5CD3B 4G70B 4JO1L 3SE8H 4KK6D 3HG3A 3HRZC 3VI4E 3CFKA 4NNYA 3EHBC 5HHOD 4Q4IA 1F4YL 1ZSHA 3P3YA 4K5PA 3WL9B 4JFXA 2UZPA 1C08A 4JQXA 3SIKA 3GSQB 5GGTL 1X5IA 1KPRB 2GC4C 2LR4A 5DYFA 2V7HB 5C0DB 2ZKHH 3PWJB 5IJVB 3U30B 3CMOL 1NCDL 4RISL 4GG6A 2PF6A 5KSBE 4KXCA 4P2YA 2YQ3A 2NY5C 1FN4A 2VISB 3MGOA 3BUBA 5I75B 3P3SA 4GEIA 1FJ1B 3GT6A 5L6YL 3Q2VA 4AMXA 2WV3A 3QB7C 4BQBA 2EXWD 1NKGA 1HXYA 2QV2A 5D1ZA 4Z1PA 3NJMA 2WOBA 2P52A 1V7MH 3GIVA 4M93C 5L9DH 5GSVB 4LCCB 3BGFC 3CXDH 1U8QA 4AVJA 3QNYB 4EI5B 1OF2B 2X44D 3CZSA 2AABH 5SV4A 5JHMA 1BZ7A 1ZLDA 3D25B 5F21B 4UV4L 3QIUC 2AEWA 1OK8A 4XN4A 4F7MA 3EJJX 4F7CA 1VACB 4BUHA 5C0JB 3FQNB 5AVWB 3CFUA 3N0PB 2BSEA 1AG0A 4JFED 1CZ8L 4JGMA 4TLUA 2CNZA 4WW2C 5CJBA 3FONA 2OYMA 3FTZA 4PJ7B 4PRHA 5LBVA 4R4BB 3RNQA 5GS0H 4LLMB 5JXEA 1RMFL 3L3JB 4B27A 3SDAB 4L4TA 3W39A 2HTKD 1W91A 5C0EA 1YVLA 4MQ7B 5DYOA 5KAQF 3QDJB 3S0PA 1EGJH 3OZLA 1ROWA 4ZPVB 3AAZB 1KELL 1R4XA 1YMMD 3H4FA 2Q8AL 1VLXA 3VWKC 4BRJA 5E6IB 4OM1L 3G5XB 4HS3B 2FBJH 4HXAL 1S5IH 1AXSA 1BJ1J 1I1AB 1CD1B 3BHBB 4PJBE 1L7TH 1QBAA 2PO6D 4NNPL 4AV4A 3SKJL 1D5BA 1RK1B 2KH2B 2XVGA 3T6ZA 4ZI8A 3SD5A 1XGTB 2CKBL 3FUEA 4NHCL 4RA3A 3DXAA 5DHYB 5E1QA 4WK4B 2LW3A 4ZW6A 1H5BA 4W9KC 3HAEG 3RWHA 5DA0B 4N90E 3S36L 4LEOB 1P7KA 2JJVA 1FPTH 1TFPA 1IGFL 3IM1A 3RWEA 4UANA 1TTBA 1T0NA 2ZKYA 2B15A 3F2LA 3T8XB 1IT9H 2GVYA 4IU3B 3EG9A 5IFJA 2BS9A 2VSDA 3VAEA 4F7EB 4PJCA 3GB7A 3RUGE 3TVMC 2IGFH 3GF8A 2O5XL 1R0AH 5B38B 1SN0A 4LMQI 3V4PB 2B9BA 1CVSC 3DV4B 4JDZB 3QIWC 1QLEH 2AXHA 2JTDA 4Y2OA 3CH8A 3BPNC 5K1NA 2J7LA 4Y8DC 1N5YH 4MD0B 3WHXB 4G9FA 5CGBA 4M5ZH 2C9UA 5ACMA 4WUUB 4DETA 5JMRA 4DGUA 4J2XA 4MHHG 3QEQB 3Q6FB 5IB3B 4O2EA 4KO6A 3RU8L 4MA1B 5GRZA 2PCYA 1E7VA 4YHIB 4AL8L 4XXDB 2B08A 2E27H 3EDFA 4LOUD 4JMNA 3GUTA 4GMTH 3BAIA 3MJ8B 4I7ZC 5LXVA 1JZHA 1XGZA 3LXBA 4QRPB 1S5HA 3RDTD 3SKNB 1UKQA 3RE0A 4KNQA 2VLMD 3V5KA 3T0AA 1KJ2L 4M03A 3GLDA 2JNZA 1A1OB 5KTEH 1MCDA 1XMWA 5FECA 2RCSL 3JTTA 3ZQ9A 1LEKB 1SOKA 1ET5A 3D08A 4FJYA 3RDTB 3SYCA 2KYIA 4A7QA 5F9JB 5E9DA 4IOSA 4ZS7L 4C57C 3BAYA 3GMLB 3NA4A 4ZTEA 1QR1A 3OZ9L 1DQTA 3L1GA 4K8RL 4PJHF 2YBRB 2J5WA 4U4IA 2BW4A 3EDJA 4L1DA 1DQJA 4RRPA 3RFZB 5CP7A 4DK3A 1RSFA 4OZ4A 2G9HA 4DO4A 4Z7AA 2V9QA 4LCVA 2BNUB 3T6QC 1F2QA 3MRJB 4KDTA 5FO9B 2Z91B 4RSYA 3B5TA 5MERA 4FKHA 1SUHA 3QCUL 3A6OA 4JW3A 5CSZA 4RCAA 5EC1A 4DOHE 4JAMB 4LSVL 2XZAL 4OZFH 7CGTA 3ARRA 2A5UA 3HMXH 3SD2A 1XIWB 3WJJC 2GFBB 5ICYB 4Y1AE 1XR8A 4RAVA 2FGWH 3KBFA 4LPYA 1SQ2N 5K93A 2IXQA 2VMCA 4LLYB 3U6XS 1BDYA 1CDHA 5A3IC 1NMAL 3G04A 1E2VA 2WBJB 3NFPB 4YFLF 4PJDA 4NC2B 3RHWF 4NQCD 3QQ3A 2ED8A 4YLQT 4HJUA 1GC1L 4JREB 4J4PC 1L6ZA 3E9UA 3OC8A 2EIEA 3QWNA 1X6NA 4MDIA 5C0BD 3ARZA 4F57H 2JLLA 3SE3C 4FQJL 1XH3B 1YEHH 1KGYE 4L9LB 3PQYD 4KVNH 4JPKL 4OH2A 1EAQA 5LAXB 1ETB1 1K4CA 1UENA 1XCQB 3IGAA 1CFQB 4KWUA 2BERA 2EXWC 5I15L 1EHXA 2IANB 4OB5L 5C09B 5CLYA 5D2NC 3C8KB 2IWGA 2HCZX 2H32B 2IPKB 1KF9B 2JH2A 3FTWA 3WIHH 1J12A 1E5BA 4AUYA 4BK5A 4MMZA 2KQNA 1UM6L 4KJYB 4YSSA 2O6CA 4JFZH 1N67A 5AVVB 1ZT1A 1TVHA 2H9GB 4L37B 1BJ8A 3V9EA 3DX7A 1UG9A 2AVGA 4GAGH 5J56B 5FLUA 5DJDB 4M48L 4WK0B 5T1LD 5INDB 1U58B 3UMNA 4J39A 1WFIA 4R7XA 2NNAB 2AZAA 3EYQC 2J8UE 3PWJA 4NQEB 5HDBF 1JV5A 2UZYA 4QO1A 5GZND 3LPWA 4ZTOL 1Q0XL 5IBLC 4B97A 2Z31D 5MI0B 5I6LA 1YO4A 1T0MA 2R59A 3P4MA 5E2UH 1TTCA 2Z9TA 1J48A 5FC9A 1J8HD 5I1KH 2EC9U 3MBEB 5IFHL 1QI5A 5KYXA 2D8KA 2P8MB 5F7DA 4Z7UE 5AUMA 1JZ4A 4UQ3B 4NDMB 4XC1H 2A9NH 5KANG 1WH0A 1A9EB 2EZ0C 3FQWB 2GT9A 5LO7A 1G7LA 3C09C 5IWLC 3S5LA 3BKYH 2AK4E 1Z3GH 3HUJA 3LEYH 5FO8A 3TA3A 1Q9OB 3MKKA 2E5EA 3M17A 1UURA 5KYYB 1B90A 4XOEA 4YL9A 3N91A 1YEGL 5T5FL 1JIBA 4HFUL 3F58L 1TMCB 3QI9C 3V52H 5JQ6H 4RNRB 3HN8A 4TSAH 4W6YB 5LXGH 2CLRB 1HU8A 4RGND 4RDQF 3OXRA 4KTYA 1U3JA 5I1EL 2CKBH 1NDGB 3SDDA 2HX9A 3IE9A 4M7JH 4ESKA 1U30A 4U1NA 3J8F7 3QQ3B 2WLIB 2AW2A 1IBGH 1F97A 2CZNA 1IGFH 1MI5A 4D8PB 4JE4B 1T80A 1J1OL 1GGBL 2BNQE 2BIPA 3KL0A 4CADA 1JGIA 1P2CB 3ORJA 4JKMA 2AFNA 3DXAB 4CKQA 2DDQL 3DLQR 4NUGH 4WFHD 2LU7A 3HMWL 1NZRA 5D1QC 2O5XH 1RUAL 2NX5D 5GHWL 4S1DC 3FN0H 4UAHA 4UT7L 2CR3A 4GOSA 4N4YB 3DMMB 4MJ6B 3WNLA 4H44C 3IDNA 1B2YA 3O2VL 2NY4C 4G6AC 4W9ZA 5AKSA 3ZE0F 1VACA 4N2KA 2QMKA 4NFBA 1ID5I 2PPAA 1SBBA 3QQNA 5HHOE 1LE9A 2G3MA 2DQIL 2ENSA 2VLKD 4LHUG 5CJQH 3A6BL 3JUYA 1BFVL 2YHGA 1ZLUK 3FSAA 3FQXB 4M43L 4TNVF 4BIKA 5D2LE 2OULB 4C58B 3BWZA 4IBYA 5GGSA 3L3GB 4PJ9C 1BVKB 1DN0A 4WTZA 4F9PA 4WCYL 1Q9WA 2QR0B 3OB8A 1JVKA 1MREH 1U8KB 5E8EA 1MFNA 2FUTA 3ZY7A 1HESA 5IM7A 1EZLA 4KGJA 3C6LD 3MLYH 2E8YA 1Q94B 3ETSA 4TSCH 2VDRH 2AJVL 4OLVL 3OKKB 2HWZH 2QZ5A 4FQIL 1FLTX 4DAGH 1AYOA 2KI6A 2CUAA 3EFOB 1MCEA 2BNQA 8PAZA 5IG7B 4BCXA 4UT6L 3RVVC 3TEYA 1UATA 3QDME 5HHNB 4JQVC 4TLKA 2H6PB 4U3SB 3TLRA 3ZVVA 5C2UB 1WWWX 3OKDB 3QZWG 3ZSSA 4X5WB 1A3QA 4KK8C 1EEQA 3AZUA 5IR1B 4JDEB 3BQUB 4PGZA 1FI8C 2YJLA 2Z7WA 4ATTA 3MV9A 1W8EA 4FF9A 4P2OA 1DVSA 4FCAA 1NCBH 2I9LA 1OOWA 1QEWB 1PU0A 1I8AA 3BDBA 2V2WA 3BEWA 3HNTH 4UV7H 1NCWL 1XGRB 4AQ1C 5AB0A 2E0PA 4AEEA 3HMXL 4PR5B 4JN1H 4WUUE 5HDBB 2WVUA 1N2RB 3QUKB 4RQQB 3QEQE 2O5ZH 1VADB 4N24A 5CZVL 4Y4HA 5FYKH 3IJHB 1ACCA 3A4DA 3ARFD 3OKMA 4N1CA 3BD4A 4HCIA 1MKFA 1B0GA 2P8LB 1JF1B 2WIIA 4WW1A 2BP0A 4LL4A 2Z8VC 4ONHA 5F7LB 3FQUA 5T3ZH 1SNRA 2W0LA 1GC1H 1HI6B 1FNEA 3F8UB 2UVFA 2BRRH 1IGIH 1QG3A 2FD6L 2FIRT 2Y6SD 3KE0A 4EO5A 4Z7VB 5IOKA 1CXLA 4JFHD 4WHDA 2X6UA 5E9AA 1K8IB 3KYAA 3FB6A 5E5MB 4FLQA 3AGWA 4YLCA 2WLHA 1CYXA 4BFEA 1SMDA 1CDUA 4U31A 2WXLA 4RWYH 2CRZA 4NI3A 1J9QA 3KHQA 5ILTH 3ARGC 12E8H 2H3NA 5TE6L 3VTMA 4HHWA 4YC2C 1UM6H 4BZ2L 5TK2A 4XBEL 2PABA 4LSRL 2XWJB 5C0CD 4X5LA 4JY5H 1IAIM 3MLWH 2X4RB 4GAGL 4XCEB 5GZOD 4JGUA 5A2KH 5CP3A 3R8QA 1IRAY 3MNDA 1XZ0A 4HX1A 4DOHB 3D18A 5ISZA 3PREA 5T1LA 4JM2F 3FQTA 4ETYA 1DQLL 4ZTOH 3TYGH 3Q5OA 4FYSA 4UQCA 4JZJC 3S98A 3TO2A 2WXNA 4KRPB 3QC5X 1PL3A 3HJEA 5BMFH 3S35X 4MS8D 4S2SB 4PWJA 2WD0A 3KLDA 3UC0H 3TIDB 4ACTA 3ZDXE 4RFEA 3T0EB 4DGVH 1JVLA 5HTSA 1UZGA 1OF2A 3HAEA 5I18H 4ZW3A 2OMUB 4E5XA 1AE6L 2R9HD 2FK9A 4OR1A 1O7DC 4DVRL 3ZE0B 3GSNA 3DK2A 3KNBB 2FO4B 3FRPG 5E4EB 2V5RA 2XFXB 4IOFC 3EO0B 5AVUB 3SJVE 2C3VB 2NXYC 4WKZB 2Y5QA 1DQMH 1URLA 2PMZA 3GSXA 3HI6L 1MVUB 4TVPL 8FABA 3BRDA 2KDGA 1AP2B 1KYAA 5BNXD 4JY6B 5CIPH 2NXYB 3FULA 5FWQA 1BXVA 5T5FH 3W0WD 2NY7H 4HFUH 3R4RA 5ERWA 2DIAA 4C4UA 4UOZA 4OBSA 4P5TC 1AGCB 1KB5H 3TA3B 4TSAL 2HTLD 2V5YA 2IADA 4U3CA 3B9KA 4ALAC 4AQEB 2J4WL 2W81C 4IIZA 3DMMD 5HDLA 1UOLA 2YSSA 4JFSA 5KUKA 3VD5A 3L5XH 1DUYB 4K3EH 4BA0A 3F7PC 2D7MA 3U6XA 1T89C 4Q74A 1IBGL 3FB5B 1ED3A 2WQ8A 3KPMA 1E5AA 3KDPB 4GAYA 1KB9J 4AGMA 4Y4KD 4PY8J 2XNAB 2YXVA 3K8MA 4AQZA 3HPJA 3U2JA 1DN2A 2CJSA 5E4IA 4YHLH 2IALA 4DEUA 3HMWH 3KYOB 1VGKA 3BWAB 5SWSB 5DMJB 5A2FA 1LDPH 2Y7MA 2KLSA 4UT7H 5DZOA 3FPYA 2AVFA 4C83A 5IOPA 3AG2B 1OW0A 3P0VL 2WXIA 4FNRA 2SEBB 1U92B 4XT1C 3S88L 5E2VH 2HFFB 3ZDZE 3WTYA 2WMPA 1LP9B 4PBVC 1SJMA 2QQLH 4FTVA 1G7QA 2HJKA 1CYWA 3TCLB 3IBOA 3A6BH 3UYPA 3MLTA 1MXDA 1ZRUA 5FO8B 1FE8L 1SJVA 4YDVA 2VLKA 3RWIB 3OG4B 4HFWA 2F7QA 2OCJA 3M17B 4TNVK 4M7LT 2NZ1A 4XI5C 3G7TA 1MREL 2F7OA 3FKUS 3OLEA 3TEZA 5C6TH 2ENPA 3WMQA 1GYAA 3CFCL 4YMPA 1OGPA 4QRSA 4M6NL 3AQZA 1ZLEA 4PHXA 4PJDF 4BH8B 4FQIH 1EAPB 1MSPA 5DI8B 2JXMA 3SGDH 1YNTA