3VTTA

High resolution crystal structure of dengue 3 envelope protein domain iii (ed3)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
100
structure length
100
Chain Sequence
SYAMCLNTFVLKKEVSETQHGTILIKVEYKGEDAPCKIPFSTEDGQGKAHNGRLITANPVVTKKEEPVNIEAEPPFGESNIVIGIGDKALKINWYRKGSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein, structural protein
molecule keywords Envelope protein E
publication title High resolution crystal structure of dengue-3 envelope protein domain III suggests possible molecular mechanisms for serospecific antibody recognition
pubmed doi rcsb
source organism Dengue virus type 3
total genus 12
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature ec 2.1.1.56: mRNA (guanine-N(7)-)-methyltransferase.
pdb deposition date 2012-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02832 Flavi_glycop_C Flavivirus glycoprotein, immunoglobulin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.350 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3vttA00
1SVBA 5LBSA 3UZEC 4FG0A 1RERA 5KVEE 5KVGE 4BZ2A 4AL8C 4UTAA 5LBVA 3C6EA 3N43F 3MUUA 5GZOA 4L5FE 2H0PA 1PJWA 3G7TA 5IREA 4ALAC 3N42F 3C5XA 5LCVA 4UTCA 3UZVA 3J2PA 1Z66A 4GSXA 4BZ1A 1ZTXE 3UAJA 4UT9A 2R29A 3IRCA 1UZGA 2HG0A 4UT6A 3J27A 1OANA 4FFZA 2GG1A 4GT0A 1URZA 5JHMA 5AAMC 2JQMA 3N44F 5AAWC 5KVFE 4X42A 4FFYA 3P54A 4UTBA 5KVDE 1S6NA 3N41F 1TG8A 2ALAA 2V33A 3UYPB 2R69A 2I69A 1OK8A 2JSFA 4AM0Q 1Z3RA 5GZNA 2P5PA 2JV6A 3VTTA 1OKEA 3WE1A 3UZQB 3N40F 5H37A 5B1CA 5JHLA 5IZ7A
chains in the Genus database with same CATH superfamily
2D7OA 4XP6L 4LPCA 3WLWC 3OMNB 1KXHA 1PFCA 3E0GA 2ZXBA 5DJZA 4IKKA 4JO1H 1BQLH 1KTJA 1A5FH 4JG0L 5IHBA 5SWZD 4BWWA 1KJVA 4UQCA 2YBGA 4BRJA 2DEWX 2VLJB 2XLLA 4PIBA 1DQKA 1UWGH 2W38A 3NSJA 4J6RL 3V9CA 1VA9A 2C26A 4TRPH 3AQDA 4N8PA 4R2GB 2CDGB 2R0LL 2V2WB 2BSTA 2Z8VC 5CF3A 1I85A 4YDNA 2BH0A 3K1DA 5BJTB 4FZ8L 3HBPA 4JFFB 1BM7A 1KN4L 2Y1ZA 5GRJH 2ZWYA 3HLAB 5FV1L 4K3EL 2LAAA 5I6OA 3LRLA 4HJTA 3ALWA 2HTKC 2XTLA 3ZTNH 4RX4A 2I60L 4NC1E 4DQOL 4Z7NE 5KANI 5BRZB 4EMZA 4AQ1A 4OIAA 1EFXB 2IPKB 4Z7OF 4LFHD 5IQ7L 1ORSB 1KB9K 1PD0A 1RZ7H 3MJ9H 3QJQB 3HNVH 3FQTB 4LCWE 2EH7H 3FOMB 2BS71 2XKUA 3GHBL 3L3IA 3S9DB 4L3FA 4RGNE 1CJYA 5FKAA 3CMOH 5E6ID 1I8MA 5ANMB 3QHTC 3VXRD 3SDCB 2ZPKH 4DN4L 1URIA 3EF7A 5IQLA 3E1F1 5C1MB 3UP1A 5E95B 3HBZA 2YSSA 2EVJA 4KX8A 3ECVA 1E40A 5E8DH 4PJXF 2HPTA 2ZUXA 4AQAA 5DR5L 3FRPG 5DWUL 5IB1A 1D9KB 4ZMLA 5IB2B 2ATPB 2JB5L 3QIUA 1VKXB 1JPGA 1SQ2N 4OCXH 5B39B 1OSEA 2WLLA 4X9FA 5J12C 4AEIH 1BD2D 1XSOA 3M7FB 2QQLL 4QPEA 5JHLH 4MNQB 3EGXA 1T21A 1GGUA 3LEYH 3P4OA 4L4VE 3CPLA 4HWEL 4FHKA 3QE5A 4Z6AT 4JB9L 4X6CF 1AY1H 5EZLA 2GVYA 3LVEA 2WLYA 4UAHA 4R7XA 3QNZB 5I23A 5GJSH 3QNYA 5I1JL 1P5UA 4FKHA 1QSEE 2QGCA 2GTWA 4C47A 5MENA 1J8HA 2GFBB 1TYJA 5IM7A 3X3FH 5DDHB 5JHDA 3PL6C 4F2EA 3ZT6A 1ROCA 4TNFA 4JQXA 4PWFA 3W39A 4X4XA 1RZGA 4GKNB 4YEEA 2VUKA 4N68A 1OT4A 1IC7H 4M1DH 1HQRB 3O3AA 4IU3A 4NP9A 1E6OH 4NQEA 5GIRA 5BRQA 3WIFA 1FFQA 2IH3A 5LGJB 1IGTA 1T6VN 1H3UA 4H8WH 1DEEB 2EE0A 2I07B 2OMBA 3AGWA 1BXUA 1BZ8A 3L5HA 1CI3M 1RURL 3FSWA 1F4YL 3GUFA 4IS6B 4MDIA 1YSOA 5LXGL 4X4YA 2ITCA 1ZJAA 2HTLC 5E70A 1JZEA 1RFDL 4XI5D 1A22B 1TEFA 1IKNA 1KENL 2ZSVA 2Q7AA 4F27A 5L88L 2XNAB 3DMMB 4U3SA 4KAQH 2HH0L 2BWIA 2QHRL 4CNIB 3SE3A 4Y4HB 3FQWB 2HLAB 4AYGA 2ICEC 1U8IA 2CK0H 1JGUH 1XCTB 3H9SD 2E7CA 4M8UA 4HBCH 2DIJA 2VSDA 2Y1VA 3S5LG 3ZYOA 4E0RA 3W56A 4QEGA 1LO5B 1ZTXL 1SXBA 4HUMB 3BUDA 4WV1B 1RUMH 4XVSH 3LPPA 5DUBB 3FUKA 3ZKSD 4HMCA 1BXAA 2WLKA 2OTWB 5DUJA 3QUKA 3QUYB 3BXNB 1NCBH 1NGWB 4NO0D 4QXGL 1JRHI 3RY5A 4Z3TA 1FL6A 3GKZA 2E47A 3KPLB 3EBIA 2W8CA 4G3YH 1EIBA 1T04A 1UXMA 3TWCL 1BX2B 1DFXA 4MMXA 4XN7A 3WGVB 3DYPA 1QLEL 4L2YA 4NQSA 3ZY7A 2PABA 3G6JB 1VADA 2DQTL 2UY6A 2ZX6A 3BPLC 4P3CL 5SWSA 2W88A 2YWZA 1GHFL 4GG6A 4QJ5B 1OCWL 2DDQH 3IN2A 1I31A 4KGLA 3ZDXF 3TO4B 5BUPA 1E28A 4PJ8C 1N64H 1WDAA 5IBTL 4EQ3A 9PCYA 4EQ2A 1OW0C 1G43A 2K8MA 4X0KA 3RUGB 4Y2NA 3DO3A 1BFOA 5C0GA 1GZQA 3D6GA 4W6XB 4WFGE 3PAZA 4KJPC 3QCUH 4BSVA 3QXDA 3IXAB 5LGYA 3RY4A 1OT2A 1S9XB 4PGBB 5E08L 1DLFH 5IHLB 3D5OF 1AGEA 4FZEL 4WI6A 3WSQH 1QFPA 1RUPL 1UZ8B 4DIXA 4Z7OE 2PTTA 1IAIH 5KN5A 2G60L 1L0PA 1E8YA 3QZOA 1UT1A 5JYMA 2X6BA 1FN4A 4XWGL 4GW1B 4AX3A 5DZJA 3MJWA 2WXPA 1K5NA 1QFWL 4XVTL 4AQ8C 5IB3B 1K6QH 3GTTA 1YNTB 1OK0A 2PYFB 5IHWA 5AOZA 2CNZA 3VW3L 2YS4A 5F96H 2V8MA 2YGQA 3L3JA 4PJXE 3L95A 1CIUA 4OLWH 1N6VA 2F7PA 3BCFA 3MBWA 5I9QB 4PJ7F 4R8WH 4C4BA 1SBSL 4OI9A 2DBLL 3K2UL 5HXMA 3FU3A 2DWXA 4XN4A 1JZ8A 5GHWL 4O02A 3QDME 4QRAA 3RWFA 5SWZA 3CHRA 1TZIA 2WQUA 4GP8B 4YAQA 5I1EH 4Q9BA 2L7JA 2NZ9C 2LTQB 1SLVA 4R0LB 1KJMA 4F7PB 1F8TH 2CKBH 4R83A 1HILB 1ZHKA 3P02A 2BW4A 4X6CE 4FNSA 4KTDH 3MV8E 1FGNH 1NL0L 1X5IA 1NLDH 5JPNB 5ESAB 3WTVA 1CK0L 3IB4A 4ACPA 2MFNA 4XN5A 5JIKA 1INQA 1RZ8B 4F8LA 2W65B 3NVQA 1I8IB 1WBZA 5DSCA 4ZFOB 4NXKA 1X3DA 5E7FA 5FYLD 4XE5B 4TL4A 4MB5A 2FJHB 3TONA 1KGXA 3IDGB 4FA7B 1TTAA 2NX5D 3S34L 2ADJA 2FD6L 4QT5A 5D6DC 5E6IA 5DZOA 1QATA 3VXRA 3V4PA 3O0RL 2YA0A 1OEZW 1G7LB 3OPUA 3PG2A 4B95C 3H8NA 2R23B 4HKJB 4NCC2 2J55A 1M05B 4V1DE 4KZEH 4MQTB 3R19A 4ISVA 2X41A 1XEDA 3CZJA 2FWLB 1MQKL 3MRIB 3ATFA 4PB0H 5FYJL 4E41D 4IJ3C 2VXTL 1T0NA 3SE9H 2E9BA 4P05A 3OC5A 5DQDH 3FQRB 5AB9A 3UC2A 3FT3A 4FQ2H 4RIRA 3BUYA 4G7YH 3L4UA 3K7UA 3M07A 1PLAA 3QUXD 2ZXGA 3MLXH 5A6IA 1O7DC 4ZFQA 2FSEA 1PLBA 2JLLA 2EUZA 4QHMA 1YHPA 2DM7A 2FL5B 4FLOA 2XFGB 1K8DB 3LKNA 3EYSH 3BSGA 3FB8A 3EW3B 5C7XL 2J4WL 4JKWA 2PCFB 3QPXH 4OGXL 1T3FB 5I19L 7PCYA 1QRNE 4GMSL 3JWDC 5BV7L 3GMMA 4NRYB 4OIFA 4ODSL 2G3MA 2ZNWA 1CS6A 1TF4A 5K1JA 1NAMB 2R69A 1AHWA 3M1BB 3IM1A 3I3EA 3WIHL 3PV6A 5ID0B 2R2CA 4YDJB 4ODUB 4J27A 3SDAC 4LVNC 3Q6GH 1SJVA 3ZDXE 1HQ4B 3ZZQA 3O6KL 4Y19E 2GY5A 3C6LB 3VI4A 1AKJB 5FECA 2XXFA 4QNPE 4LLUA 3TZVC 4LEXL 4FQXC 3OZ9H 3FT4B 5IFJB 3LVTA 2X0VA 1GZPB 3PNRB 4Z77A 1CG9A 4R7NB 1TCMA 1WV7T 3CU1A 4F2ME 1S7TA 4KROB 5I1GL 2ESVB 1S9WA 3DBXB 3HEIB 3AW5A 3KCPB 3KLLA 4O00A 2XJLA 4MD4A 2G5UA 1YN6B 4RZKA 4GRWH 3U1QA 4B3VA 3ARYA 2NYKA 2ICWA 2VL5A 2VUYA 1EEZB 3MO1A 4ILDA 3GSNB 4PJIF 3MLRH 3H9SA 4H88H 4PY8J 4XNUL 3BPOB 4WU5B 3MLSL 4LEEA 4M5YL 4ZMPA 2XWJA 4R90L 2LGNA 4NI3A 25C8L 2F8IA 3DJZA 4AKOA 3TASA 5IFAH 3STZB 4HHGA 1HWGB 4MYPA 5CNHA 4KWUA 4ES8A 2XTJE 1VFAB 5LHDA 2HX9A 1LILA 4NO0A 4HLEA 1KG0B 1KXVA 5IJVB 5J9PA 1SHWA 2APVA 5I0YA 1LMKA 4PJ7E 2A77L 1L6XA 1UWXK 1N2RB 4FABH 1OE1A 2EIEA 2EE3A 4LAJH 5INDA 3QXWA 1IGFH 1ZGLB 2G4EA 4AK2A 4GRLD 1KC5L 2MNUA 5HBBA 3OX8A 4XXDA 3ESOA 2VN6A 4U6XB 1IC5H 2KLTA 1LGVA 2WSKA 3N0AA 1L7TH 3MKKA 1R34A 1VCAA 1U8KA 2Y6TE 1TQUA 5HGAB 2FZ3B 1R3LA 2QKIA 1F00I 2Z35A 3FTZA 5F93C 5JXAH 3BT2L 4MCMA 2NW2A 3V10A 4D3CH 3IVKB 4QGYA 3N5AA 1AI1L 3BWAA 2X9WA 3KWXA 2J5LB 4PJHE 1EZSA 3HB3C 3AT0A 4FI8A 2OCCB 4HWBH 1L5GB 3C60B 3SE4C 3TPUB 3ML8A 1FHNA 4IU2B 4A39A 5I1IL 3ZKMD 1YUKB 2DEXX 2PO6B 5D1ZI 3JYBA 4AGLA 2QDWA 4J4PC 2H26B 4JMNA 5KVGH 1QHPA 1NZRA 3HG2A 5KSBF 1BM3H 3EGDA 3L7FB 4UMGA 3WKPA 3IKKA 2AJSH 5J06A 3VB8A 3PXHA 1UVQA 2HN7B 4UQEA 4NP4L 3ZN6A 3I50L 4F7CB 4IJTA 1PG7L 3TLRA 5F44A 1IAIM 2BXZA 2JELL 2Y22A 3IPFA 5IK3A 3GRBA 4B53A 5H37H 4H4NA 3UAAA 4X5RA 5FB8B 4X9BA 4O58L 2GT9B 2KZKA 3K6FA 3FUFA 3UTTE 5MEOB 2G2NA 4HWNA 3V79C 2WIMA 3RP1A 4L1TA 5GGQH 2DQJL 5AD0A 5DVKA 1MJ7L 1KLUB 5GRUL 5E5LA 12E8L 2Z8SA 2DKUA 3DKHA 3US0A 3EYQC 3ARGB 5AALA 4G8GB 3QORB 2WWMD 4MMYA 1OD7A 3MXVH 2WUCH 4BDVB 2P5WD 4WUKL 5DK3A 1A6AA 1OLLA 4WTQA 2FH8A 3I02A 5DU7A 4L29B 2P8MA 2AI0L 4TNWF 2QKSA 2FO4B 1IJNA 2Q86B 3V4VL 1VSCA 4QTIL 2WO4A 2E8YA 3DJTA 5D1ZD 1E5CA 4FFYL 3WELA 4G7QB 1N6UA 1T83C 2GYSA 2NX5A 2W5PA 3JYCA 2OJZH 3KGRA 3BC9A 5B3NA 5L2KB 3D7PA 3DHMA 4KJYA 2XWDA 4WI4A 3FZUD 3LIZL 4ZPVB 1Z66A 3G08A 1DBAL 4ODWA 1BFSA 4N2EA 4GSXA 5FUCE 3HI6L 5EOTB 1F18A 4HC1A 2D2OA 4B9PA 4Z8FH 1WA0X 3DV4B 2AJXL 5HDBE 5I1DA 3EGSB 3QJFA 1AXTH 2ILLA 4JPWH 2DQEH 2VDMB 3DECA 4PJ9D 1T1YA 4TVSa 5C0IB 5KEZA 2EDKA 2X4SA 1OP3H 4WVRA 4N9OB 5T5NG 2H41A 4G5AA 3QUXA 3D1MC 1JWUB 4OB5L 2EE6A 2WQWA 4LRNH 2R7EB 1ETB1 2ZX5A 4EDWL 4G6AD 4MCNA 2LV4A 4OM1L 1G9NC 5T33L 3IDJB 5IHHA 4BXSV 2A4CA 3F12A 3PP3H 4ZX4A 1J5HA 4FDWA 4HAFA 1NCAH 3RZWA 3FO0L 1N6QL 1NFKA 1Y0LA 4CMHB 4HH8A 4DGIL 2FX7H 3PWUB 1U8NA 4HGKC 2R2EB 3G5XB 3PF2A 4N1CA 3Q2NA 2NY1D 5D6CA 5T3XE 1GOFA 2FQFA 1XGRB 4MS8D 3ARDD 1NBYB 3Q0HA 4NO5A 4Y2DB 2H45A 2X7LA 3OKLB 1Q9WB 4TNWK 2Z7UA 5LQBL 1ZT4A 4EOWH 3WFCH 2LVCA 1W2KT 2ALAA 2GK0A 4F15B 2GI0A 3TO2A 1JNNL 3DX1A 2X87A 3KNBB 1ZPUA 1YY9D 4XPFH 4YGVB 2X4PB 3HNSH 1BQRA 4Y4FD 5IKCB 2ZYSA 2OL3H 1WIPA 4ABQA 4XNZC 2WWKO 3TA3C 2OK0L 1PD1A 4HJGB 2H32A 5ECGA 4BINA 4HG4K 5KVDL 3UO1H 4OLVL 1F4WL 3L1GA 1A1MB 3T65B 1DQIA 1IBZA 3MLYL 4WHDA 3AG4B 5GRYA 2F0CA 5I6PA 2Q2LA 2XV0A 5DI8A 3MLTB 4UU9B 3DXAE 3IFOB 5HHOD 4X6EA 4BELD 5GISH 3I75B 2KBGA 4EBQH 1YY8B 4BA8A 4NDMB 3FSZA 5ITFA 1MWAH 4HJ0C 1TTCA 1AMXA 2ZCHL 3QRFM 1OAQL 3BIKA 5FX3A 4I2XB 2L7UA 4D8PB 1G1KA 4Y7OC 1RZJL 1ZMYA 3Q3GB 5KSBE 1PDKB 3L5IA 5F9OH 2GSIB 3VXNA 4G6FB 4IHOB 4PTUB 4X6FA 3GMLB 3RDTB 3WHXB 2OXHB 2WM0A 2AABL 3UPAA 2BOCA 3R1GH 5C0FA 4GO9A 3KYMB 4FG6C 4Y7MA 2R39A 3LJ3A 1U8CB 4TF4A 3IT8D 2F7OA 4GRLA 3P1VA 1NC4A 1FO0B 5CZVL 2AHIA 2VJ0A 5E4AA 5HYSA 3CLWA 5FYJD 2DM4A 1ADQH 3N85L 4FERA 5IVXA 3OAZH 1CICD 1DQQA 1WE5A 1Q0YH 4AIOA 2JJTC 5HHXH 2WHVA 4U1JA 5ESVB 5DVMA 1MW1A 3IU3B 1A6TA 3OJVC 1LE9B 2VZOA 1JOIA 5K9KA 1EAOA 4K7PH 5I18H 3HKFA 1I7UA 4EIZC 3A3YB 1OSPH 3P9WB 2F53E 3LIUA 3QIBB 5IB4B 2BVYA 2YD9A 3DK2A 5FLUA 3NFPA 3ZDZF 4BFRA 2F8VA 3GJFA 3GHEH 5HDQL 3FO2A 3HG1D 4ICXA 4X98A 1WG3A 3RU8H 4XCCL 4JO2L 1H9DA 3X3GL 4UM9B 4A55A 1Q0EA 4BFOA 5DJ2B 2YPKA 2P48B 1PS3A 1RIUH 1S78D 4B96A 5ICZA 1MJUL 1XXDC 1OAYL 2H6PA 4WTWA 4Q9QH 1OAXL 5AVQB 2DTSA 1Q4NX 3FXIC 3BP5A 2F68X 4PV9B 1E5BA 1EEQA 2Q76A 3NSFA 4OSUL 4YH6A 1YLBB 5FYKH 4DW2L 4GUPA 4LLAA 4MQ7A 4OZHB 3CFCL 2HSIA 2XWBB 2I5YH 4I5BA 1CGSL 3UZQB 2W07A 3W9DB 2CLRA 2XVKA 4YHOH 3MLZH 2P5WA 2Z93B 4QI3A 4HCFA 3K8KA 4LSTH 1ACCA 1DUYB 2B1OA 4J3OD 4Z18A 3QUHA 3PWJA 4M7KL 3GS4A 4OGYL 3UXFA 5C0AE 3UJJL 1T80A 3HI5H 4ZX6A 1FLRH 1U58A 2F6AA 3L2NA 5D1ZA 1WHOA 4FCAA 4X99B 4XPBH 4HHWA 1NPUA 3UG4A 3QEQB 1D5ZB 2Q0ZX 3OKYA 4NT6B 4BXVA 4YSOA 4QKTA 3ROLA 1CR9H 2WAQA 3MRJB 1PLGL 3RJQB 1NPNA 2XG4B 4KHXH 2CLZB 4OR1A 5J1TC 4U6YB 2D0FA 2IAMD 4ERSH 1RUQL 4X9HA 2FT6A 1FWXA 3DX8A 4TSBL 2A6IA 1A4KB 3E2HB 1NCDL 4HX1B 2YXMA 1AGFA 5J6HB 4PJCE 1FFPB 5FOBB 5J6GB 2Q9OA 4MTMA 4A68A 5FF6A 1LO4L 4PJ9A 3BDBA 4X6DF 4XZUB 2O72A 1EO5A 3EOBA 2HG5A 1ZEAH 2RR3A 4LIQH 4P23B 2F1BA 1OTUC 3SCMB 2D73A 3NFNB 2X6AA 3KPSD 3N9GH 2A9ML 2VW6A 2O5XH 5IR1A 1EVUA 1N0XH 1EANA 1Q0XH 2X1WL 4MSWB 5IESL 1ETZA 4PJ5D 3SZ6A 4WGVB 2C1PB 1AO7D 4LAQL 1MLBA 3JUYA 4L4TE 5ACZB 4QF1B 1H5BA 5FO9B 5CD5C 1ASQA 1RUAH 1NDMA 1M2VB 4R97B 4CL7A 3WTTA 4KK9D 5E2WH 4HS3B 1OCOB 1CDHA 4XNQB 5TE7L 4XC3L 3E6FA 5G4MA 2E9IA 2WWNA 1VDGA 4UI2A 2F08A 4LLVB 4BZ1L 5F0MB 3GDCA 4WO4C 3ARDA 2YEQA 4YX2H 3QULA 4FNQA 4LLQA 5LGHL 2XRAH 3N44F 3HS0C 4MVBD 5DQJA 1AP2B 5CEZE 4WJG3 4NUGL 2HKFH 2AXGA 4UT6L 3K4AA 4EI0A 3PXLA 4Y4FA 2FLMA 1IEBA 4OUUA 2GITA 1DN0A 3JT2A 4FXGA 2VAJA 3EAKA 4B27A 2E9GA 5EEWA 1N8ZA 1QO3B 4YBLC 4LARH 4U1HA 1VCBC 2GTZB 1QSFD 3V5KB 4OLEA 4PBWD 3MXWL 1FG2A 5HHOA 4NRZA 4YHPA 1CXLA 1UG9A 5FDYA 3B2UD 3U4BH 1GW0A 3P9MB 4NN5B 1BLIA 4N8CH 3QI9C 1OE3A 1CXKA 3BSZL 1IX2A 4J12A 2PW1B 3VM7A 4WO4A 4HLJA 3ZDZE 3BUTA 3EYFB 3U4KA 1MQ8A 1RPKA 4L37A 3DOSA 3P0VH 1CDBA 2VMJA 4G5ZH 5DRNB 5F7DB 4NZDA 1UT2A 1KGCE 2MPVA 3GRWL 3JWOC 1M9WA 2DI7A 3MLPA 3OMIB 5C09E 1DBKH 4ALAL 4RAVB 4DEWA 2EEXA 4OGZA 5DZPA 4P4KB 1UCBL 1NM9A 1OOWA 4NQCD 4AV5A 3VG9C 2FATH 1TEGA 3IMWA 2DL2A 3B3BA 4FAAB 1TIUA 4KUCD 2EXWC 1I3GH 2DQUH 2IQ9H 3FB7A 3AT9A 3TEUA 3E6HB 3L4ZA 2DLHA 3IU4L 3CDCA 4XPGL 3V6ZA 2NLJA 3KLAA 4ENZA 1CICA 3EYOA 3N1FC 2NY5C 3VFOB 1MDAA 4Z7VE 1AE6L 4NQDB 3S8WA 1J86A 3ROOB 1MFCH 2AEOA 3UROR 4NENA 1QQDB 4JFDB 4RETB 1TITA 4MYWB 1XZ0B 3INUL 1PY0A 1FVDB 1SDAB 3VGEA 2ZOOA 3Q1SL 2CCWA 2MCPL 4TKWA 4YSUA 3EFDH 3UAEA 3GINA 1FH5H 3RPKA 3VFMA 4PJAF 1GR7A 4UNUA 5TDNA 4K8RH 3FHEA 2Q7YA 1Z9NA 3HG1A 3OWRA 2A74A 4WHTA 4XWOC 4FFWC 2BC4A 3NEOA 4UV7H 3GSXB 3II3A 1GCYA 3WIHA 4OJEH 3DGDA 2OR9L 4WW2B 3DURB 1IB5A 1NJ9A 2Y2YA 4XN2A 3SYCA 5JXEC 3IFNH 4LQ1A 2ZAHA 3P0YH 3PHSA 3ILDA 2EYSB 2Y23A 5LN4A 5DEGA 3BGFC 4QTHA 3NCJL 3QJRB 3A6BL 3PGFL 1MF2L 5CSZA 5DJ8B 2FX8H 4I9WD 3VNYA 2B3RA 2HKAA 3NOIA 5TK4A 1OGAB 4FEMA 2Y7QB 3I6GA 4K0OA 5KYYA 3DO7A 4PVNA 4RH4A 1KBWA 5AWNL 2DQHL 2E76C 2XKNB 2ZTBA 5CHNA 1Q1JH 3HKZA 3RNKA 5CBAB 1F3JB 1A66A 3FRUA 4RQQB 1M53A 4F5CE 3H6AA 1OKEA 2ZAGA 3QUGA 3WXWH 2YN3A 4PJBE 1CTNA 2DMGA 2AEWA 1HXMB 5BQ7A 4PYGA 2WVVB 2Z91A 5CKGA 1S5IL 2C8NA 3B5TA 1LJMA 3QDGD 2IH9A 2VLLB 2Y5QA 1NFIB 3PJSB 4X5XB 3NJFA 2DQDL 4QO1B 1IL1B 3QPQD 3PNWB 3EJQA 2IAMA 3PQYD 5BMFL 3FCSA 4GBXD 4DP7X 1MW0A 3V2AR 1PKQB 4MAYC 3WNMA 4YDLB 1NGQL 1KNOA 4JRYB 1A7RH 3EH2A 5L6YH 4G42A 4Q58C 3X1BA 2HMIC 2EIZB 5CCGE 4C56D 5IMKA 1T1ZA 1BOGB 2NXZD 2A9AA 2GQHA 3FQUA 1NBZA 3KPSA 1A21A 1KTLA 2MKWA 1HOCB 4N28A 5E6RB 1U4FA 1NGPL 1ZA6B 4JCWA 3WUZA 2I9LA 5A2KH 3P11L 4NPYA 1UTDA 3NCEB 1W0VB 2VL4A 3M1CA 4JDVB 5DHXB 4ETQB 1JF1A 5GGTL 1AO7A 2H0JA 3SKJL 2MNWA 1SNRA 2NY4C 5JDSA 1H3TA 4TV3A 3BKYL 3QDJB 5ICXA 4QY8B 3MA9L 1JPFA 2CRMA 1AD0B 3MMEB 1E5AA 1D5BB 4OZ4A 3U9UA 4YJZL 2NT0A 1JF5A 1TFHA 2VLJD 1NFAA 3ZHFA 1N3NA 4OBSA 2IBGA 1AQKL 4OGQC 2GEQA 1HCZA 1O0VA 2WXOA 3IPEA 5L8JB 4R2GD 4YXKL 1P4IH 4TMPA 4L8DB 5HHMD 3GSNL 3FKUS 3B6SA 3L3KB 4JFFD 2YXFA 4WHYG 5C08E 3WGUB 4PGCB 2Z8WC 4MHHG 2C1OB 4J1UB 3O6MH 3B2VH 4TOYL 1C5DA 2JXMB 4G8IB 4M6NL 2FWOA 3MJ8A 3MRHA 3FB5B 3ZE0B 5IGXL 1H6FA 4B5EA 4JL2A 1NEUA 2Q7NA 1ODUA 1EFXD 4JN1L 4G43B 2IADB 2XTSA 1PQZB 2H3KA 4CVZA 3CH8A 3UDWA 5BZDB 4M6OH 1GZHC 4KZCA 2ITDB 2XN2A 5HJBA 3T77B 3W11C 4A1RA 5LXVA 4W4OA 3KR3H 3SDCD 2R0WH 4GKLA 3QT2A 3CVHB 3EOAB 4BKSC 5FFLA 1K85A 4FJ6A 3HFFA 4PJDA 1BHGA 3JWDL 2VLRD 3D08A 3G6DL 4H13C 4Z3JA 1D9KD 4P5TB 1NCWH 4JJHA 4LPYA 2DQFA 1FE8L 2NQ3A 4XBGA 2GSGA 2V9RA 2VERA 4ZFGL 2JCWA 2JMRA 2L7EA 4YN3A 3CVBA 3BKMH 3MFFB 4CMMB 2A83B 3V4VA 3UBXA 4MNQD 4U0RC 4WHCA 1BBDL 3WFHA 2CUHA 3CD4A 2XV6B 3K6SA 3D12B 4LLYA 3HE6B 3A24A 5D93B 4DGYH 2NUPB 4LU5L 35C8L 5F9WC 5IEKB 2DLIA 2HFFA 3GXPA 3NESA 1JXDA 2APXA 3BQUD 4GRWF 4YC2B 2NNRA 1W0WA 3LIZA 4KO7A 5JZ7D 1WT5C 4NQCA 4ZDHB 2YWYA 5IG7B 5E8NB 1VFBB 1HI6B 4IBYA 5HHNA 5E2UL 1XL6A 4YQXH 1J05A 3GMOA 3SKNA 1RK1B 4D0CB 4GFXA 2ZWNA 4Q2ZB 3UERA 1QTPA 3EHBC 4XXCA 4XP5L 4JDTL 2LU3A 1Z9LA 4PP1C 1KELL 4JFYA 4R4BA 3TU6A 1MKFA 4WEBH 5KZCD 1ONQA 2KPWA 2F5BH 4TUJA 1LD9A 5CN3A 1XCXA 2VUOA 2I9TB 4BK5C 2HUHA 2ZP0T 1YEDB 5FUOL 1FF5A 1NCCH 2Y6SC 5E8PB 1RU9H 4IIQB 4ODTL 1A7NH 4WEMB 4Y2OB 1E4XL 3DMMD 3U30B 1ASOA 2A5UA 5B8CB 3KWUA 5MEQA 3MA7B 4EDXA 3PWLB 3D34A 4PRAA 5EU6B 3ZQWA 5C0DA 5ALCL 1V27A 2AQPA 4AQOA 3EO1B 4OV6F 4WJ5A 1EVTC 2AEQH 4ZODA 1DQLL 1XGQB 3RQ3A 3ALPA 1S46A 4CRPA 1A7PL 1F45A 3CGTA 1E27B 5CEXB 2ED9A 3IBEA 1CGTA 3HZYB 4JM2F 5ANHA 1K4DB 3CZUB 3SOBH 3UG5A 3QUYD 3GXTA 1S7WA 1U42A 3GGWB 3NQIA 3ILPB 2NYZA 2OJEA 3U9PL 4ZNEE 1O6TA 1B4RA 2BZDA 1X5JA 1P4BH 4PW3A 4YK4C 5I82A 2JLPA 5C07E 1FYTE 3O6FB 1FVEA 4KI5D 1GIGL 1BCIA 1I1YA 3MDJA 1L7IL 3ASNB 5J57B 5D71L 3MACH 3ME0A 3ERXA 3NJIA 5ESQB 1CGXA 3VVWA 2DWDB 4H8UA 1X5KA 1PX4A 1MFUA 3MX0A 2R1XB 3NA4A 1GAFL 3D39E 5IBUG 1EZLA 3RTQB 2A9DA 5BS0D 3A47A 2K4WA 3HA0A 4HIJA 4DKTA 2OI9C 3KHQA 3BAWA 3HTLX 1ZE3C 5DJCA 4ZQTA 3RWEB 1I4FA 3QDGA 2HT4C 3IMTA 3E1ZA 4OQ1A 5JR1H 3CSYB 3U4AA 1WBYA 2ZUTA 3PQYA 3CZKA 5AVUB 1TNNA 4GBXA 4NPKA 4YGAB 1B0WA 1O6VA 4JPVL 3FB6B 4DAGL 3ZVVA 4OFIA 3P4LA 1YYLL 4OZGE 2DICA 2QVMA 5T1KD 3TT3L 4OCNC 1JTTA 2C4FU 1FVCA 5HY9A 1VACB 2XA3A 2QLVB 3MZTA 4XMXA 5JQHC 3TYFA 5EZJA 2CKNA 5F7YC 3SPVA 2YK1L 1QD0A 3LHPH 3FT2A 1W8NA 2FLRT 2VABB 2FO8A 1MIEH 4I8DA 1YECL 2QBWA 1N59B 5KTEH 5LDUA 1GYUA 2P42B 4OJDH 3GQFA 5DURB 2ZUQB 4NGHL 1TZAA 2BK8A 4ZTOH 3W37A 3ARXA 1OGPA 2VLJA 3V4PH 3N1QC 4N22A 3SBWC 2XG5B 3VXUE 3U9WA 1G9MC 1GS6X 3EH4B 1T03H 5I8CB 2CRYA 4AEHH 1COBA 1Z3GH 4UTAL 4Z7QB 2CDGA 2DJMA 2V2WA 4M1GL 3NBNA 2H1XA 3QS3A 3P3SA 2NYYD 1FI8C 3ESMA 4GRWE 4JFFA 4D7BA 5BJTA 3ZTCC 3RWDA 2DQGH 2BP3A 3UTSE 3HLAA 2BIHA 1VF5C 1U3HD 5HJ3A 2PP7A 2RJMA 3MRBA 4P2OC 3SKMB 1A6UH 2APFA 5B22A 1JTOA 4XAWH 3V4UL 4KTEH 1JPEA 2WNKA 1EERB 4PG9B 3KJ4B 5C0NC 5L7XH 1EFXA 3HUJE 2IPKA 4GAYB 4ZQKB 1XB3A 3HW7A 1WLHA 3V0FA 1HJBC 3FQTA 2PUQT 1CXIA 3FOMA 1NKGA 1UB5B 2OTPA 3VRLE 1ZVHA 3O6LH 3H7BA 3U6RA 1HL4A 1T4KA 5TF0A 3SDCA 3KGTA 3MGAA 3ULSB 4PJGB 2EDRA 4BUHA 4DZBB 4MHHI 1FO0L 1VRSA 1XX9C 4JKLA 4M5TA 3T1WA 4RA0C 5EOCH 1P6WA 5D4QA 5IB2A 1D9KA 3KBHE 4JPQA 2ATPA 4LCYB 4KY1L 1OP5H 3S98A 2BNQE 1VKXA 3WE6B 5B39A 5FS5A 1JXFA 4JFSA 3QEHB 4YDKH 3WENA 3VACA 4MNQA 3BRDA 2QQNL 1WFTA 4TS6A 4YL4A 1S9VA 1AXIB 2H0FA 2HFEB 4P04A 1YEEL 4OCYL 3FN0L 4JFQA 1EGJL 4DHLA 3FTUA 3BQUA 4CC4A 3QNZA 5AKRA 2YMOA 1TETH 2WZ5A 2YOCA 3NJXA 4QRRE 4U6VH 1RJZB 2GFBA 3BAXA 4JFEB 4Y4HC 5DDHA 2NSMA 4LSSL 1YPZF 2D7TH 4LCUB 1OP3K 2J57A 4OQTL 2FTAA 1MRFL 1WUNT 3LNFA 4GKNA 5E1IA 4KO5A 2CA4A 1ED3B 5KVGE 1HQRA 1OQOA 3NACH 3ARWA 5EIIB 3BEWB 1SM3L 1DBJL 4KH9A 1YNKH 3N04A 5EO1B 4W81A 3PP3K 5A7EA 4B9GA 2PTUA 1AKJD 2I07A 4L1LA 1LYQA 3FFCE 3GSVB 1HEZB 4A66A 4A7UA 1NANI 2B4CC 5I5RA 4PI0A 4IS6A 2HCZX 4ONHB 4KROD 1TYRA 2ESVD 2WMPA 1A4JB 4P2CG 4UTCA 5DFTA 3WYRA 5ADPL 1MREL 1BP3B 2XNAA 5DHEA 1S7SB 3TNNB 4Y8DC 3DMMA 3BP7B 3TO4C 1DDTA 4BZ1A 2CPCA 4IIZA 3ULUL 4CNIA 5E8EB 2HLAA 1KCVH 1XCTA 3APDA 4P9HL 2A4EA 4APQB 2J6EL 3V5HB 5CJ5A 1Z6JT 3OSKA 1MDTA 1O5DT 2XPZA 1TQCB 1LO5A 4UT6A 4GQZA 4WV1A 1OANA 5DUBA 1BF5A 1LO3L 2Y25A 1P1ZB 1EZVX 2KQMA 4OCLC 2OTWA 4JN2B 2VDKH 3BXNA 3QUYA 4PJFF 2XV3A 1OB0A 3HG0A 5D1QB 2FBRA 5DUPL 2PYEE 4LHQB 2W9DL 2XIDA 3HJ0A 5BOPA 4GI8A 1I8KA 1BX2A 4NZJA 2WSPA 4Q89A 7CGTA 4G8AC 1ZS8B 3V7AE 1Q1PA 3G6JA 2MRYA 2OMVB 1VIWA 4X4ME 5F89A 5I30H 3RY6C 3EBAA 3BSZA 3L9YA 2DWSA 2GBAA 4UZUA 4FMKA 1NGZB 4NAJA 5FO7A 2B16A 4XNYH 5I9QC 3RUGA 1F3RB 4PLOB 5AYUH 2E0PA 1L9NA 2XICA 2PR4L 3UYPB 1TJMA 2PP9A 2VDNL 2CGZA 4AI7A 3GRWA 2YPLE 1DCLA 2UVEA 4MBOA 1HH6B 3V0WH 3IXAA 3QXVA 3OXSB 1E4XI 1S9XA 1YEGH 3VI3B 3SN6N 1AZBA 2ZG2A 3T0EB 5LG6A 3RJDA 3KYKL 4WWID 3UBHA 2B08A 4C58B 2XWZA 1NMBH 1UZ8A 3C60D 4MASA 2WKLA 2D4DA 4M4PA 5B1CA 4QYAA 5T1KA 3OAZK 4YUEL 2PO6D 1WA1X 4GW1A 1GXEA 5EMYA 1IUZA 1O9ZA 1UA7A 3B7RL 5LWYH 2W94A 4PVBA 3QZMA 5IB3A 2UZXA 2VITB 4N2GA 2AQQA 1YNTA 2DOCA 4LK4A 5LBGA 5I73C 1X4ZA 5FYLH 4PUBL 2YPVH 1MN4A 3X17A 2F58H 2XC8A 4L48A 1CDGA 1UKTA 3BCDA 4PP2B 4XPHH 2I27N 4RMRA 1SUJA 2YQ2A 4V11A 4TTGA 3ILEA 1AXSB 4JRXB 4TXVB 4R0LA 3WOVA 2W91A 2XYCA 4F7PA 1DCEA 1HILA 4RGNB 1A0QH 4NWUH 4ORZC 5MHSE 1E4WH 3FU0A 3II1A 3THMH 2BSED 1DJXA 4HC1H 3WY2A 4ONGH 2X0UA 5JPNA 4I87A 5ESAA 4L23A 3L5WB 4R4FL 3ARGD 4O51A 3T71A 5FGBC 3B2PA 3DHUA 4G8GD 1S7QB 5DT1L 5C0EB 1U3HA 1RZ8A 2W65A 1CZ8L 2CUAA 5FA3B 1I8IA 4LVHC 5C2UB 1YPZE 2QSCH 4EO5A 4ZFOA 1VZGA 4M3KB 1WZLA 1RPQA 4S1SL 2FJHA 1D6VL 4KKCD 3NCYS 3MI6A 2BJML 5GS3A 3ZO0A 3IDGA 3R7QA 2N3JA 3RFZB 1CFVL 2VQTA 1C5BL 3ZMRA 3PDGA 3HVNA 4F57H 4KV5E 3LPOA 1ND0B 2HJLB 5E00B 1G7LA 4IBLT 2VAAB 2R23A 2DD8L 2BPBA 1M05A 5A1AA 4LCCC 1NEZB 4U1NB 4UDUB 1QSEB 4H1LB 4J3XA 5F7LB 3UH8A 3TIEB 3JZ7A 3ARFC 1HXKA 4P46B 3HPLA 3MRIA 1EJOH 2IDFA 3CK0H 3QO0A 4MQXC 2DS4A 2P5ED 3LCYA 5FGBA 4OD3H 4R7DB 5JMRA 1N5YH 3VWJD 3FQRA 2ZNXA 3C6LC 4IOFD 1BVKB 3N41F 4XP6H 3MZGB 3WIIL 4QRTB 2E75C 1J88A 1Z7JA 2FHBA 2JJWA 1BQHB 3FTSA 2YUXA 5D1XE 1GSMA 4JG0H 1QI4A 2EDQA 2FL5A 2PWGA 3C9NA 4YHNB 1ZOXA 4P5MB 5DVOA 4FJYA 2PCFA 1T3FA 4J6RH 3K8LA 1YJDC 5DHYB 1I75A 4PLJD 3ZIYA 1CE1L 4IRZL 3JV0A 3VD2A 5FGRA 4PJFE 1HCYA 2CBMA 3TC9A 2R0LH 3MV9B 5CLXA 2WCGA 1WEJH 4MA1B 4N0YH 3BPOC 1Y7VA 4APXB 4FZ8H 4AUYA 1NAMA 3M1BA 4ZO6A 1TZGL 2J8UB 4Y2DD 5ID0A 1KEML 3HCVB 4YDJA 1ACZA 4ODUA 5HHPB 1A3RL 3QQNA 1J9RA 2N4IA 2YMXL 4FQCH 3N43B 4PRBB 1HQ4A 3QJUB 2Q5BA 1AKJA 3CDGB 3V6OE 5GGTA 5IQ7H 3FT4A 5IFJA 3R18A 2CBTA 2JI2A 3GHBH 4R7NA 1HL9A 2NXYB 4YFDB 2XXGA 2ESVA 3DBXA 2UV3A 2AEIT 3KCPA 1MRDH 1EAJA 2J1ZA 5TE6H 2CQVA 5FYKE 1YN6A 1DVTA 5TQ2L 3T2OA 3EH1A 4HEPA 5D2NE 5D7KE 1EEZA 3QJXA 5D5ME 4YHYC 3MR9B 5GRXG 1WFJA 3GSNA 5DR5H 5SX5H 1KTKE 1Q9LB 3S5ZA 4Z0BL 3DTXB 4WU5A 1OARL 3RX5A 4JHUA 3P3TA 3VB9A 1MCSA 2EDDA 2BRRH 4FHBD 1GTFA 4BD4A 1BVZA 3STZA 4LLMB 1PSKL 3ECBB 2JCCF 1I7ZA 2NY5L 4HWEH 5DUML 4NNPH 1KG0A 4G6FD 3RDTD 4OCSL 4TN9A 1UD6A 4J7RA 2Y07H 2B1HH 4LPVA 3O2VL 5AVZB 5I1JH 1SJEB 1N2RA 1VGKB 1IEAB 2PCPB 2ZYHA 3IPBA 4NUPA 3KAAA 4A63A 4FMVA 2VRKA 3GJFH 3OZKA 1VGEL 1CXHA 2MH4A 4HISA 3OB0H 3UJTL 1ZGLA 3UFIA 4P2AA 3TWYA 3DNKA 1U3ZA 3H1ZA 1LMIA 4U6XA 2ZP8A 3GXUB 1OB1B 3F62A 4LO9A 5M95B 1JI2A 3K3QA 5IHUH 5CCJA 4QAWA 5GGSB 5I26A 4N5UA 1AIFB 3HRZB 3B34A 5HGAA 2FZ3A 5C9JB 1BVLA 4LIQE 3I9PA 3D3VE 2D2CC 4DK6A 4F91B 1ZV5A 3IVKA 1L9RA 4EI6B 1F4YH 4A37A 4KHTL 3VFPA 2AKRB 1FP5A 4W93A 4N1EA 3K2MC 3TPUA 1L5GA 4ZS6D 3C60A 4TTDD 1IC1A 2X4RB 3QIBD 4IU2A 2XN9B 3CXDH 4KK8C 3VMOA 4DCQA 1ZVYA 1RVFL 2PO6A 3QORC 4L8BB 2HH0H 1A14L 2P5PA 4J28A 2H26A 3IJ8A 3BX7C 5CBEB 2AXWA 1ESOA 2X2UA 1ZTXH 4NBZB 1UEMA 2HN7A 4WF7A 3U1SL 4F7CA 1CD1B 4FXKB 1QEXA 1YMME 4I18C 4KUZL 1UCTA 2JTYA 2WXMA 3CZFB 5CS7A 4ZMAT 2CAKA 4HK3J 3Q5OA 4K23L 5FB8A 1IGMH 5GS1B 2GT9A 4KK5C 5MEOA 5J89A 4K5LA 3TWCH 5F6IC 1QLEH 4F7MB 2EDJA 4QAMB 3WNPA 3UEZA 1KLUA 2BSEA 2DQTH 4KKNA 4V1DB 2YEZA 3CVHL 1SF3A 1CLZL 1OCWH 4PI2A 3OWEA 3ULUD 3ARGA 3AVEA 2QFPA 4G8GA 4PGZA 3QORA 1PAZA 2H2SC 2YRPA 5K39B 5CGTA 4BDVA 4A7GA 1XFPA 5IBTH 2FJSA 5CKAA 1ZHBB 1BYNA 4L29A 1HSAB 4DUWA 1J1PL 3EOTL 2FO4A 2Q86A 3LD8C 4YS4A 4JFHE 1I8LA 5CCHE 1GPOL 4F7TB 3QEQD 4L9LB 4E9XA 1AZRA 4FZEH 4CMHC 1RUPH 4HMEA 4KMTL 4U1MB 2NR6C 2G60H 2HVJB 1KYOJ 2BX5A 3LQZB 1IQWL 5E9AA 2K4AA 5EOTA 4CJ0A 3QRGH 1O6SB 5EZOL 4YHIB 3DV4A 1QFWH 2V7HA 3EBHA 2P5EA 4BRVA 3EGSA 5C0IA 4GSRA 4C54A 2R4RL 3RVVC 1P6FA 3DUUB 4MLIA 2APWA 3VWJA 1UD2A 4P23D 3L08A 5ITBL 2NPLX 2ZWLT 3KPMB 3IDUA 4W70A 2RCSL 3D0VB 4MNGB 4ODHH 1A3ZA 2VC2L 4LMQI 3VXSE 2P80D 1SBSH 5I15L 2DBLH 2R7EA 3K2UH 3LKSB 4UINL 4Y19B 1ZWIB 3B83A 1M7DB 2KZ1B 4YDIL 1UEYA 5GHWH 2H1LM 3IDJA 1JZDC 1I9IL 3CV5A 4XO5A 1KGWA 4N8VB 2BCMA 1PMYA 3BFOA 3EFFB 4L2LA 1Q72H 4NJAL 1VERA 3LH9A 3QSKB 3NEXA 3BKJH 5AVXB 3PWUA 1JV5B 4GAGL 2AAAA 2O26U 1A1OB 2TAAA 2R2EA 3G5XA 3MQIA 4N86A 4X7SL 3WNJA 1NL0H 4NOBA 4F33A 4JEGB 4K7PX 2H4EA 1XGRA 3O11B 1NBYA 2LAGB 4Y2DA 3RWHA 1BJ1J 1Q9WA 3OKLA 1XCWA 5JOEA 5DYOB 4FQHB 1SJXA 4U05A 3SO3C 3KNBA 4WNQB 4I0PD 2K7PA 3HS9A 3BUPA 4NNXB 2YBRB 4YGVA 2X4PA 4GINA 2HPOA 3E3QE 5IKCA 3CZEA 3N55A 2ERJC 3S34H 2XTJB 4LF3B 5I76A 4Y0GA 3ET9F 3QC6X 4S1RL 2FD6H 4HJGA 2AEPL 2IEPA 3O0RH 1SFHA 2WNWA 3OKEA 3GBEA 4JQIH 1A1MA 4ZO9A 3T65A 3B5HA 3SQBB 4UTAA 4AIZB 3DPBB 5B1KA 3MLTA 4HUXB 1XAUA 3IFOA 1BG9A 1SRDA 3HC0B 4UU9A 5JO5B 1NDTA 4UIMB 3SJVB 4HP5A 1K8IB 1YY8A 4ZUTB 1MQKH 4K3DL 1LWRA 1CIDA 2LLNA 4NDMA 5FYJH 3MRMB 4I2XA 4D8PA 4F8QA 4UBDC 3Q3GA 3B9KB 1CYGA 2ZXQA 3NCXA 1PDKA 3BMWA 2GSIA 1QFUL 2VMFA 5FYKU 5HVHB 4PTUA 4IHOA 3RDTA 3GMLA 5EU4B 2OXHA 2YRLA 1B4JH 3QO1B 3S5YA 1D5MB 3BJLA 4E5XB 5I19H 4OGXH 4PJHB 1C5CH 1J9QA 3KYMA 1GS7A 4GG6F 4GMSH 4O4YL 1U8CA 1SDDB 5BV7H 2CZNA 4P4KD 2VOTA 3S97C 1BZ9A 3GM8A 1FO0A 1JN6B 3KXFB 5F7MC 2QPSA 3C08H 3WIHH 3FK3A 3QQ9D 3X1NA 1BAWA 1IGYB 3IMUA 1X6LA 1AYRA 2X4UB 5ESVA 1XR9B 5HGGS 3UPRB 3IU3A 1LE9A 4JFDD 4HUWB 4ZOBA 1IAMA 3S6CA 3RIKA 1EAPB 4G7SB 1B4LA 4I48B 4G1EB 2JQAA 3H6JA 5EC2A 2CMRL 3T6WA 3NIDB 1G7JB 5DD6B 2JI1A 3GUTB 1EGJA 2EDLA 4JG1L 5CJXC 4KNUA 5LB1A 4JM4H 3VU1A 2NDFA 1S6NA 1BIIB 4XMLL 3QIBA 5IB4A 1FL3B 4KKLD 1RD6A 5CUSH 1NCJA 3ELAT 3OMAB 1BXVA 3PWNB 4Q6YA 3CHPA 5HJGA 1P7KB 4HKBB 3FF8A 3BEVB 4XN9A 1X7TA 3H4HA 4XB7A 3RHWF 4NBXB 2A99A 2NY0B 2X2YA 3B8SA 4UM9A 5DJ2A 1OV8A 2A73B 4J3OH 3MLSH 2J43A 4FJZA 1HNGA 4M5YH 5FFGA 3ABZA 3SYPA 5IBLD 2ADFH 1V55B 4P3DB 5DMYA 5ENWB 2FJGB 1RV6X 2APSA 3CQFA 2X89D 4HSQA 5ICUA 1NMCB 4MQSB 4ZMXA 1D7DA 3HI1B 2ADIB 2QTVA 3RGVB 2QADD 4NZRH 3ML9A 2AJYL 2QTEA 1CO1A 8FABB 2LFEA 5DJ0B 3E2HC 3MJ7A 4U4IA 5H4YA 2Z9TA 2XWBA 2Z65C 4H2CA 3SPHA 2DYPB 1OGAD 2P3YA 3ARUA 5T1JA 4J2XA 1FSKC 3UZQA 3W9DA 3GKWL 3MKGA 2VM9A 2J2ZB 4Y5VB 2ATAA 3AM8C 2AJUL 1XR8B 1KC5H 4FFZH 3VXOB 2WD0A 3SCMC 3ZGHA 5HDBB 2XWXA 4F20A 1J9TA 1DUYA 4W9EC 4HZAA 3FCUB 1S7XA 4X4KA 3S4SB 1I8UA 1E6JL 3HHRB 3IMBA 1TSHA 3X1GA 3QQ4B 5FDWB 1W8EA 4NQEE 3HMXA 3N42F 4X99A 4DFHA 1F58L 1D5ZA 2ZOLB 3QEQA 4R97C 5KVEL 3OM3B 1AI1H 4DKEL 4NT6A 3DGGA 2R8SL 1GGBH 3CFUA 3MRJA 2DKMA 2XG4A 3VA2C 1JGVL 2CLZA 3HJEA 4URKA 4U6YA 5BW7A 2WN3A 3VWKD 5I1IH 1A4KA 5B4MC 2SODB 2H8PB 3TA4D 1MCDA 1E9QA 1JAEA 5J6HA 4WFEE 3RHWK 4JRYD 1FFPA 2WYHA 5FOBA 2HT3D 4NZUH 3K6IA 5J6GA 1DANU 3BVVA 3V0IA 5BZXA 4JE0A 5A2BA 5C0BD 4DPBX 4P23A 4NCDA 1J5IA 1SN2A 3SCMA 3NFNA 3FU6A 2C9UA 3MODH 4B50A 2FB4L 3EF4A 2FSDA 3WMSA 4NP4H 2C7UB 2P80A 1SXCA 3HPJB 1PG7H 4OLUL 3ZQ9A 2E46A 2RB8A 4MSWA 4M7JL 5ISZE 2K78A 2C1PA 4C57C 4QF1A 1NMAH 5FO9A 3SGEI 3QDJD 1OSZB 1M2VA 4AKPA 1GY1A 4YXLL 4HS3A 2ZUSA 1Z9PA 4Y4KB 4XNQA 2DQJH 5B3JF 4NZTL 4AYEC 4NN5C 3G9AB 4LLVA 1MOEA 1J1XH 3QQXA 5EIIG 2BSTB 5SWSE 3L45A 3WUWG 4WUKH 4LRIC 3S8GB 2AF2A 1AP2A 5I74B 2OLDA 3F85A 3BH4A 3KW8A 3VI4F 3BGMB 4I0PA 1BMGA 2YMTA 4I77L 4QTIH 1IAKB 4X9IA 2IDSA 1JXGA 2N0MA 1T1XA 4ZOEA 4XTRC 5I6XC 4TVPL 3KL5A 4GQQA 2P9RA 4L1BA 1WTGT 2MPAH 3LH2H 4NN7B 2GTZA 3V5KA 1DBAH 5FKAB 3F83A 1YVLA 4RWYL 3P9MA 4HEME 3JQOB 3RDJA 2AJXH 4PRIE 3L4WA 2QV2A 2PW1A 2ICES 1IV8A 2XBZA 3WO4B 2YSSB 1DJSA 4G7RB 3VH8B 3EYFA 3WN5C 4P5TD 5IB1B 2IGFL 1RIVL 4D8OA 5DRNA 5F7DA 4LKXB 5T1DL 4OB5H 5T8IA 4DTGH 4PREB 4EDWH 4EUPB 1FNGB 1VLXA 3RB7A 1SEQL 1P4UA 2XFXA 3N91A 4HA1A 5HI5D 3GSQA 5T33H 3LSOB 3HE6D 2EC9T 4BGLA 3C75A 5CIPB 2OSWA 3FO0H 3KWWB 4RAVA 4JHBA 3HAEH 1N6QH 3IJ7A 4Z23A 2F53B 4DGIH 4P4KA 1DSFL 4L1DA 2J56A 1LXMA 3RKDC 4JFWA 2LW3A 3TEWA 4M7LT 1PZDA 4HIIA 5FHAH 1MCPL 4TQEH 1RUKL 4WW2C 2JKLA 3E6HA 1MFVA 1FNFA 1RZGB 3EH3B 1JZ3A 3VFOA 4NI6A 5AW2B 4FTVD 1IARB 4G59C 4IU3B 4WI2A 3WIFB 5IROC 1QQDA 2A7BA 1T22A 4JFDA 3GI8H 3GLAA 1XZ0A 3VI4E 4TULL 3OKDB 1SY6L 4RNRB 1FVDA 4N2NA 2OK0H 1SEBB 2O5YH 4HPYL 4YWGL 2ORBL 5KVDH 4OLVH 1F4WH 2ITCB 3MLYH 3L13A 2WYZA 2Y36L 2DYSB 3P9LB 4YSRA 4XOEA 4LPXA 4ZAKC 2MKLC 2M1KA 3P30L 2ZXAA 3S96B 1EEYB 1HYRC 1T89C 1GL4B 2AERT 3GSXA 3IE9A 4HJ1A 3UAJC 1CUOA 2EKJA 4KKAC 5EU6D 3MOBL 2F15A 1FORL 1OAQH 2WXNA 5DFWH 2GHZA 1HHIB 3M46A 4WW2A 3TH4T 4JY6B 2IWKA 4GW5B 3DURA 4E0RB 2IDQA 1RZJH 2X89A 3ZZSA 2EYSA 3RVUD 3BOVA 2AQ3A 3QW9A 1QUNB 3U7YL 1MPAL 1XB8A 4NM4H 1DFBH 4Z7UE 1KGUA 4GS7B 3Q9PA 5DJ8A 2Y3AA 5ERWB 5GGSY 1OGAA 2Y7QA 1RZKC 3QFJE 4G6ML 1E90A 1MW2A 1B9ZA 3UZEC 1VEPA 2H9GA 2XKNA 3MNVB 5CZVH 4PJCB 5CBAA 3CVDA 1BWWA 3P2TA 5B3JE 4PJEA 4RQQA 3NN8B 2R29H 3SY6A 4BFGA 4CN1A 2XQYG 4OTXL 5F0LB 4ELME 3D4GA 1KFAL 3H3BC 3FT1A 1HXMA 2FT8A 5BZWB 2WVVA 2ZKWA 3D07A 2G5BB 4XMKL 4WSJA 5JNYA 2XPYA 2CE6A 1KULA 4UWQB 4HIEB 4BSVB 1ZE3H 4M7ZB 4NUJB 2VLLA 3PJSA 1NFIA 2XHNA 3KJ6L 3H7LA 3QXDB 4PWGA 4QOKB 1OT1A 4R5VA 4ZXBB 4QO1A 1IL1A 4L4TB 3WJJC 5CJXA 3PNWA 1ORQA 2E6QA 3V4LA 4F1ZA 4FYSA 2CXGA 1O7DE 4IKLA 2JJVA 4RMSA 1PKQA 3DX6B 4CU7A 2FH6A 2PTTB 1CBVL 4JRYA 2EINB 5HDQH 1UZ6E 3OVUB 3ISWA 2EIZA 2D3NA 4S1QL 3X3GH 1HYSC 1U95B 1KJ2L 1BOGA 3BIBX 1IIIA 3G3LA 1UA6L 2NY3C 2R27A 3OKNA 2F74B 2FQDA 4TM9A 4ADJA 3H9SE 2VZ1A 3NTCH 3WMPA 5CU5A 1HOCA 1YNLL 1DQML 2PLTA 2HG0A 1KCUL 4BBWA 1ZA6A 5B38G 3QDHA 1KIUB 1W0VA 3ZZLA 4JDVA 1MFBL 3LZPA 4ETQA 2FK9A 4WGWB 1SXNA 4Y1SA 2OTUB 3RAJH 2B0SL 4FNLL 1CVSC 4ENED 3QDJA 2AXFB 3WI9A 4QY8A 4YE4L 5SWZB 5I5IA 2O5NA 3L48A 2BIPA 3CFCH 1AGCB 3K6DA 5EOCJ 1CGSH 1G9MH 3LZNA 4R7VA 4L8DA 5KSVB 3L3KA 4NKQB 4LEOA 1P7BA 5HDRA 4PGCA 4XOAA 2C1OA 4Q6IC 4OFQA 4M7KH 1PEWA 4J1UA 2G9KA 4RGMB 4WK4B 5E2VL 2JXMA 4CUCA 3BJ91 4G8IA 3MBXL 1A9BA 3FB5A 2WV3A 3WKML 5BNXD 5DLMH 5I75C 3TPKA 4G43A 2IADA 1DL7L 2EO1A 1PQZA 2VZ3A 3PHOB 2VM3A 1P84J 1FZJB 5BZDA 1PLGH 1XMWA 3B7SA 5C09B 3AG3B 1NH6A 1RUQH 4RVBA 3T77A 2GC7C 2FVNA 1NCHA 1XF2B 1F90L 1NCDH 3QCVL 4KRPC 2WQSA 3CVHA 4D9RE 4JGMA 1KCSH 3OJDB 4HT1H 1T5XB 4CSZA 2Y72A 4P5TA 4ANKA 2X1QA 2Z64C 4N4YB 2Z6FA 2AGJL 4NN6B 4AKQA 5CLZA 3MNMA 4LGRB 4HKZB 4TUKL 3SYAA 3GLDA 3RE0A 4Z7VB 3SHSA 3T3PB 1BD2B 1RULL 2A83A 4CMMA 5H94B 2UX7A 1SOXA 1ZY9A 3FT3B 5IESH 4LAQH 5FEBA 3HE6A 4Z3FA 3T3MF 1DBML 1X4YA 3SY0B 3WXVH 5GS2D 4QHMB 1OY3B 2O1AA 3DK0A 1DE4B 1BQUA 1T66D 4PRPB 1M42A 2GAZA 3LKNB 5TE7H 4XC3H 4AC4A 4G83A 3CLEH 3AG1B 4ZDHA 5IG7A 3WS6A 1MUJB 4P2QD 5E8NA 4ANWA 1WZKA 1BSIA 4BZ1H 1VFBA 2AVGA 4QD2E 4F9PC 1SLWA 4FMFA 1HI6A 3MTRA 5IVXF 1L9QA 2V17H 3AJ7A 2LOEA 3NSCA 4WRLA 5F7HA 1QR1B 3WAKA 1RK1A 3BKCL 4AMKH 4BFKA 4D0CA 1NC2B 4UNVA 4Q2ZA 1AC0A 2AANA 3RVTD 3FS9A 5AEAA 3OHXA 4OKVB 4NUGH 4F9LA 4NQUA 4UT6H 1G7PB 2R15A 1OGTB 4F1SA 5FYLE 1KJ3L 1UWYA 4TNEA 4OGAD 5FECB 2FX9L 4GY4A 3SGJC 3KBEA 3BZEA 1T6WA 2WLNA 3VCLB 5LCVL 1CLYL 3MGOB 2I9TA 2X70B 2NX5E 1CG9B 4PG2A 2B4CH 5GS0C 4K5NA 1AQHA 3T0WA 1P6AB 3RZCB 3O6FC 5E8PA 5C6PB 3OL2A 4IIQA 4Y2OA 1P5VB 1IKFH 3AU0A 3IGLA 5B8CA 4QHKI 3HNTL 3MA7A 4GUCA 3PWLA 3RTQC 5EU6A 4WENB 3EO1A 4MXVF 2GI7A 3O41A 1JPTH 2V9TA 4AT6A 1NLBH 4JFZL 2BO0A 1E30A 1UB6B 2XWJB 1UOLA 5I8OH 2OMTB 3K46A 2V5MA 1E27A 3GRWH 4GH7B 5EN3A 1S7VB 5HI3D 5CEXA 2I85A 3EYUL 3NJKA 4AVIA 4DNLA 3HZYA 1Y1UA 2LFGA 1K4DA 2YLKA 2CH8A 2IDTA 1QR4A 2VN4A 4G9FD 4TVPD 3GGWA 1NQBA 4NO0B 2NNFA 5HYJD 3ILPA 4YR6B 4E42B 3R06B 4WKZB 2BIIA 5J9PB 1T4WA 4J3UA 3CC1A 5EEYA 3PRZA 4IBTA 3UCQA 2P4AB 3QJOA 4XX1G 1F02I 2JJSC 2EDEA 4E9YA 3N40F 3VA6A 3GK8L 5ESQA 1G6VK 3IJEB 2DWDA 3C2AH 4XPGH 3C5ZC 2R1XA 2GJ6E 3BH9B 4YOKA 4PWEA 2PF6A 3G5VB 1I9RH 3F7YB 5EN2B 5DC2A 1MCEA 4Z7WE 4UMSA 1MHEB 4BUGA 5C0CB 2YD7A 1R3LB 2QKIB 3RWEA 2O93L 2XI9A 3INUH 4LP4A 4ZO7A 4Z1PA 3Q1SH 1G6RB 2GJJA 2APTA 4ORGB 2MCPH 4ESKA 3GJFK 4QXVA 4I88A 4L3AA 4FQ1L 3FB6A 3RBSA 3TBYB 2QGBA 2IWFA 2J8OA 3CN3A 2DQCL 3MCG1 4DKFL 3BPCB 2Q6WB 3QUML 4PGJA 4JO8A 1B3JA 3I9GH 1AS6A 1MSPA 4JO4L 4NZ8A 5HDOA 1VACA 1YYML 2NCEA 3QXUA 2JIXB 4YHMH 3BO8B 2OR9H 2HT2D 1IVLA 3D05A 2X9YA 1CL7L 3KJ4C 1WJ3A 1GOHA 1XB6A 2VABA 3II2A 3CFQA 4K15A 4ANUA 2AK1H 1OPGH 3JWNH 4I3RH 3MRCA 3PIQB 4WFHE 5TK2A 5J6SA 5F88B 2A6JA 1IAOA 3B43A 3NCJH 1HSBA 4UUJA 1HINH 1MF2H 3ABMB 1WVZA 4LCWD 4UYPA 1RKRA 2JVUA 1MEXL 3FU5A 4G6KH 1L0QA 4RGND 5I8CA 3IRZA 3T3ME 2L7QA 4Z3EA 5GZOC 3K91A 5CMAB 5ICYB 3TF4A 1MCWM 2R0KL 3S35L 1UWEL 2WSDA 2ZQKA 4MMYB 4EN3C 3CHSA 4H44C 4JVWA 3SKMA 3MRGB 4KQ3L 1EXUB 5I28A 4AYDC 1KTRL 2JNZA 4PG9A 1MXDA 3QXAA 2LU7A 3RVWC 3KPRE 4GAYA 4ZQKA 5PAZA 1KY7A 4FFVC 4M8QB 2DQDH 1UB5A 1UURA 3B7TA 2C3HA 3F7RA 1A9EB 1WICA 1XAKA 3B2XA 5BMFH 1MFDL 3H9YA 4AITA 1A8ZA 3WCYA 3PWPE 2HLFC 4KJYB 1BQSA 4DZBA 4UCFA 1QSED 4KXDA 1DVFC 2ENQA 1J87A 2PETA 5DJYB 1GS8A 1NAMH 4NHCL 1NSNL 2XPGB 3BYTA 2B7DT 4LCYA 5TE4L 4E41B 2HAZA 3WE6A 3QEHA 5IV2B 5SX4I 1OCCB 3FSOA 1PX8A 1T1YB 1NGPH 5LJYH 3EDFA 3EUDA 3P11H 2DTML 1T7ZA 2J3SA 4MMZB 4RZCB 3SGDI 3GBLA 4MXVE 1QSVA 3QUXB 4PBVC 3AABA 3ASWA 3BPNB 4A7QA 1SOSA 3BKYH 1YEFL 4M1CD 5J3HC 4YPGB 1A6ZB 3MA9H 2XN1A 2D7NA 1FCCA 1XDTT 3F12B 3VAEA 1FUNA 3T2NL 3LXCA 1AQKH 4P2QA 1RJZA 1UHVA 2OPCA 4JFEA 4YXKH 1XT5A 4QRFA 3ILQC 1UENA 1HS6A 2KC0A 3GSNH 4APQC 4A6YH 3L3OB 3WTYA 3VRIB 3LY6A 5A2JH 2WXIA 1ED3A 2AQ1A 2JWYA 4Y9GA 2P52A 3AREB 3LAFA 3Q44A 2X7LB 3BEWA 5EIIA 1ZT4B 4M6NH 2LLGA 5EO1A 2F1EA 2WBWB 4FF9A 4IOSD 1ZTXE 5D1QC 4ZRGA 1DVQA 3GSVA 2A9NH 1L9MA 4TSCH 3BVXA 3NPSB 4I85A 2J88L 3JVGA 3VGBA 2YHGA 3I74A 4X4ZA 5F21B 3LNGA 2KH2B 2Z7ZA 2NXYD 4XMUA 4ONHA 2Z34A 3U36B 2C9QA 2KERA 4AK1A 1A4JA 5FHBL 4R4NC 3HE7B 5I5JA 5TGBB 4FA8A 3TNNA 2KKQA 3VD5A 1S7SA 5EWIL 3ZYIA 1G1OA 2LLLA 3MREB 1HEHC 5E8EA 5FGCE 1NANH 3SE8L 4NNYB 4O2CB 1VZIA 5F1KC 5EBLB 4EIGB 1ZA3B 1AZCA 1T5WA 2AMUA 4PQXA 1NCOA 5EO0B 1QAWA 5EZIL 3CHOA 2VDPH 3B56A 4X5XA 5DS1A 3V5HA 1UYWH 4ZFGH 1QWNA 3QAZB 3VFNB 2OR8A 6FABH 1GVIA 2CHWA 3L16A 4OM0L 1EJ6A 4PSRA 5JOPE 5EF0A 3FRPB 1P1ZA 3T0EC 1UC6A 2DRUA 4WFGD 4JN2A 3TV3H 3GYRA 4L3CB 3CVIL 3AXHA 2OZ4L 35C8H 2VWEC 2B8OT 2QV4A 3LB6D 3KVDD 5IFHL 2VMCA 1LO2L 1ZS8A 4PN6A 3WTUA 1OTSD 1X5LA 1KIPB 2AQ2A 2CJTA 1D7FA 5K5YA 3TNMB 2OMVA 4NO2A 1PZ3A 5DMGD 3ZOAA 1MZZA 4OZGB 1XCQA 3GSRB 4J3OF 4NUMA 5E2UH 3WNIA 3GDBA 3U79A 1NGZA 5T3XL 2ZE0A 3DVNB 3O3EB 5CZXD 5D7SL 1X9UA 4NO3B 5IQMA 2Y3NA 3ZBMA 3KG5A 3KBPA 4P5SA 5HI4C 3DARA 3UYPA 5KWYC 2Y2TA 2BY0A 3CVCA 1HH6A 1TJIH 3QPKA 4AQEB 3OXSA 3BD5A 3T8MA 1A6TB 5C86A 3VI3A 1H6TA 5AZ2L 1K72A 4JM2C 5D4IA 4DVRL 1BW8A 3QDMD 4KVPA 4UOW0 5FUOH 5IT2L 3GRGA 4OZFG 4XMPH 3M6DA 2QHLA 3MV11 3BI9X 3SQOH 5MI0C 4M8RA 3NGBB 1KYDA 2BFVH 2AVFA 4ODTH 2XN9D 5AW7B 5AB1A 4CGUB 2VR8A 5A2CA 1FLTX 5A2FA 1FNSL 2V7NB 4HKXB 5HHOE 1JBJA 3CCHA 1UH4A 5FR3A 2O6DA 4IKNA 1IRAY 1RXLA 1TVHB 4X6DE 5ALCH 1T2QL 2NY2C 2VITA 2BSDA 1H8OA 4JO3L 3AT8A 2EC8A 3FN9A 4LBEB 1B0RA 1DQLH 4WUUE 4QHLA 4Z95L 1X5FA 1A7PH 4P07A 2PMZA 2ZWKA 3RFZC 1CT8A 4M5ZL 1YQ2A 1FCGA 2ZCKL 4PP2A 3S5LB 1QVOB 2MQ3A 1F4AA 1SY6A 2N7BA 3HUJB 2N0KA 4MJ4A 4YSTA 1LDPL 2ZOKB 2ZOTA 4Y5XC 5E8OB 4D9QE 3BP5B 4LCWA 1AXSA 4G71B 2Y5TB 2VNCA 3U9PH 1NUDA 2MHAB 3DA0A 2FR4B 4MQ7B 3RKPA 3RX9A 4P46C 3BRGC 5D7JC 2GJPA 4V1DD 2Q8AL 5D71H 2W07B 3TT1L 2XDHA 3FTGB 2LE9A 1S7QA 2TSAA 4UQDA 5JPMC 4WKXA 2VDMH 3OLEA 5FA3A 3QIWC 1GAFH 1BLNB 4XPAH 3T8XA 5FYJE 4HPHA 3PWVB 5AB0A 4KMQA 3MUGB 1N19A 2X12A 4DOHB 2ROXA 3IGAB 4JUTA 3HOGA 1U58B 5D1ZB 1IT9L 1H15B 4U4BA 5E6UB 3EJZC 4CBZA 3KDMB 3BDYL 4XP4H 2VYRE 3HFMH 1ND0A 2HJLA 3NIFB 5E6YA 3N3EA 5E00A 4HD5A 4HFUL 4JPVH 4KZDL 1I1AC 2VAAA 3CDYA 4HF5L 1DJGA 1AOZA 4U1NA 2WXLA 4UDUA 1QSEA 3M8OH 2CO2A 3DX8B 3OB8A 2A6IB 4MS6A 4PJDF 3TIEA 3ZKXC 4M7LL 4CW1B 1RL1A 4NERA 3UTPE 1KSRA 3HG1E 3EDEA 1AR1B 5HGHB 1MFEH 4HCRL 2ZIDA 4XNMB 3QA3B 2YK1H 4R7DA 4UV4H 1OAZL 3D51A 1QWHA 3LS5H 1BVKA 3LH8A 3X14B 3C8KB 1YUHB 4I3GA 4QRTA 3ARBB 4Y16B 1BQHA 4XVOA 3VUAA 1Q8MA 4Y19D 5I0VA 2C3GA 4ZW3A 3TEXA 4NFBA 2XYBA 3TVMB 1ETZB 4K94L 4P5MA 1E2WA 2WBJC 2AV1B 2ODIA 3O9WC 3BN3B 4JS7A 5DHYA 2MQ0A 4KUCF 2NY6B 5DJXB 4H0GA 4UTAH 3DSFL 2BVEA 5AFAA 4M02A 1CFTB 3PAUA 4DKAA 4HULB 2FRGP 2G75B 3VQLA 1FJ1A 5IJKC 4UIKH 3QULB 4Y89A 5AAMA 1I1RA 1LLAA 1Y18B 4JZJB 5EBMB 2IGTA 1RSYA 1ZIAA 2A6KB 3LQAH 3A67H 4X5LA 2YKLL 4ZFZB 4PRBA 5F9AC 4N0CD 2P47B 1RZQA 4PGDA 3IDYB 2PPCA 2W60B 2APBA 1MCNA 4KVCL 1QABA 2GITB 2XTJD 5CP7B 1FZMB 4HIXH 4PTTB 4CN4A 1U92A 4K3HA 2PYEB 4AVJA 4CDHA 3IKCB 4HOZA 4FTDA 1ILUA 1FG2B 2F5AL 1J1OL 4YHPB 1FO0H 3LS4L 3MR9A 2AMGA 1Q9LA 4YZFE 4XB8A 2WWKT 3DTXA 3EJYD 3HRZC 4RFEB 2X3BA 2P46B 3LX9A 2E74C 3AC0A 1XZWA 3QUZB 4FG2A 4BA0A 1UA3A 3MRQB 1B88A 2QQNH 5BO0D 4LLMA 3ECBA 2JKSA 4XMWA 5KOVC 3U7WL 3O81A 5ADOL 2K6ZA 1HHHA 2YPLB 4NKDB 1ZLUH 4EF3A 4GMTL 1YEEH 4OCYH 5INCB 1ZXQA 1AO7E 3FN0H 3NJHA 4K4KA 3EJPA 2GB2A 3EH5B 3OR6B 2E56A 1HJCA 1SJEA 1VGKA 2PCPA 3O8XC 3RPBA 3BWUF 2P28B 4KQ4L 1UM6L 5DHVA 2QVTA 4CU6A 3LYRA 4L8SB 1MRFH 2DH2A 4HLZH 1AZVA 4L0YA 5LNGA 1OB1A 1XH2A 3S37H 1EPFA 3VG0L 5A6LA 1C1EH 1SM3H 1DBJH 1AIFA 1KBGH 1WH0A 4F8TA 5C9JA 5D1XC 3VO0A 2MWCA 5B7EA 4JKKA 1K3ZA 1QKZL 3LN4B 4HFWB 1EHXA 4EI6A 1FL5B 2AKRA 3ISRA 5CJQH 4OZIB 3LXAA 4NCC1 4IRSB 5D7IE 4U31A 4XN1A 2X4RA 3UTTD 4K9JA 2GBUA 1MREH 2XN9A 3T4YB 1JVKA 2WNXA 3RI5F 2JE8A 3KL3A 4DP2X 1JNHB 4L8BA 1UOKA 3CHXA 3GZPA 3ZRFC 5IOPB 5TDNB 3ULUH 4E9RA 2BINA 1TJGL 2WBKA 3KLKA 1JHKL 3W82A 4PVLA 1C12B 4NOFA 3ABGA 5F0JB 3FNKA 5CWSB 1TMCB 4YE0A 5CBEA 4FL4C 4WZ9A 3V6OC 4LLDB 5CN1A 4ZNCD 4A2FA 1AS8A 4PBDA 3X1FA 2G2PA 4CKVX 1CD1A 4FXKA 4F93B 5L4MA 3S3PA 3HMXH 3VFWA 1PZAA 1M71A 4XZ4A 2H0PA 1KTDB 3MGTB 1WAAE 4PM1A 5C6TL 1T0OA 3CZFA 4JHAL 4DPRA 5DEGB 4P0DA 3JV5A 1UUSA 4IM8A 2V2XB 2UZYB 4GO8A 5DUPH 5LCVA 5GS1A 1RJLB 4QTHB 3TYGL 4F7MA 1USQA 5K59F 2OMYA 1V7ML 4KITB 2DYPD 4V1DA 4JHZA 3U6XA 5E6ZA 1TTUA 4NQCE 3SPCA 5CILL 3V9FA 5JQ6L 5EF3A 3OKMB 1RLBA 1V54B 5K39A 4KI1A 4NWTH 1P7QB 5JMOC 5DGQA 3VGAC 2ITFA 1ZHBA 2CJ3A 1AJ7H 3TS8A 5D7EA 4M93C 4AGOA 4M8VA 4YIQA 1DHKA 2HWZL 2BMKA 1DEDA 2VSKB 5DMIL 3F6JA 4CA4A 4F7TA 4Z78B 4L9LA 4F7EB 2B1AL 4U6TA 4U1MA 2R9HC 3L5XL 4JO1L 3RI5K 2HVJA 1A5FL 2IAMB 3LQZA 3QNXB 5FYJU 4X50A 3IAQA 4AYFB 4TLSA 5GQBA 1O6SA 4HWZB 2PP8A 3IK2A 2ISDA 4C8XA 4YHIA 2A38A 3OGCB 2MCG1 5T3XD 1CGYA 5HD8C 2VQ1B 5A2AA 2AXJA 3V0JA 3WHE1 3DUUA 4PUBH 5FCSH 3KPMA 3VGFA 3WJLC 3D0VA 3QGVA 4MNGA 3S8FB 3WEBA 3LKSA 4Y19A 2X6MA 3GSOB 1ZWIA 1M7DA 4PWIA 1SJHB 4Y5YB 3UYRL 4PJ5B 3F04A 1A3LH 4H20H 3C6SB 4C83B 1E4JA 4N8VA 5DFVD 5JIDA 3NRPA 1PL3A 1MJ8H 4QCIB 1RZ7L 1TQVA 4OT1L 4Y4KD 3HNVL 3U82B 4J39A 2EH7L 3KPOB 2DW5A 2VDRB 1JV5A 4K3JH 4O2FB 5GZND 1A1OA 1N3NB 4ODVL 4Z7AA 4HAGA 1GGYA 3QUMA 4HK3N 4LSPH 4R4FH 3O11A 3FL7A 3DXAD 3W5NA 3AQYA 2YD0A 4YVUA 5DT1H 1KCRH 1AHKA 2MNJB 3B6SB 2YAFA 1OF2B 3IBOA 3B9KC 4FQHA 1E43A 5DYOA 3BE1L 3OXRB 5CSGA 4WNQA 2WOYA 2CPUA 1NIAA 1XO8A 3KL0A 1D6VH 4NNXA 2YBRA 2BJMH 4AEIL 5KSUA 4ZI8A 1IM9D 1CQYA 1CFVH 3HIZA 1C5BH 5SWQB 3DSNB 4LF3A 5JHLL 3Q6FA 3QDGE 1A65A 4N5EC 3IS0X 4CVZB 3LEYL 2Y9RT 2DD8H 3QZNA 4GNKB 5DD1L 5B3SB 3WG7B 1AY1L 1QSFB 2AZUA 3SQBA 4EI5C 5LDSA 3CTTA 4EPSA 3DPBA 1S3KH 4HUXA 1IVTA 5JO5A 2IDCA 3HC0A 3QWNA 4GAFB 3SJVA 5GJSL 1K8IA 2LT9A 4NSKA 4U1GB 4ZUTA 4QJ3B 2NSXA 1SYVB 3K81A 1A8JH 3MRMA 2CM5A 2L4OA 1CMOA 2V5RA 3DDGA 1UOWA 3LMJH 3HC3H 2BY1A 1KBBA 1LEKB 2QPFA 3WIIH 1KDJA 5I66A 1J9CT 3RBGA 5DRXA 5K9JL 3NK4A 4QMEA 4NS0A 3ZHKA 3D3VB 3HMWL 3H2WA 3V4VB 5EU4A 3Q8EA 2XX0A 1GH7A 2VDOB 3K6SB 1G6RL 3QO1A 4JDEA 4H8WL 1D5MA 2Z31C 4E5XA 3LKPA 3T0AA 1UT9A 4PJHA 3ZUNC 4KI5F 2ZSWB 3G6JF 5FV2A 1KWKA 5D2LE 2HFFB 4HUUB 5E5UB 2F53D 2VLJE 2EEDA 3CSPA 4Y8AA 3SDDD 2CO4A 2XXCB 1EO8L 3CMGA 4MXQD 4KKBD 2NY0C 5BQDA 2ZOUA 3KXFA 1R5WB 3MYJB 4GQ9H 3RUGF 2P8PB 4OAWB 2OMZB 1J05B 5E4OA 1A3RH 1IGYA 2YMXH 1LO0L 2E7LC 2X4UA 4AUUA 2W81C 4IRJD 2CK0L 1JGUL 3UPRA 4U49A 3RGVC 2BY2A 1ZANL 4HBCL 3VD0A 5DS2A 5EF2A 4HUWA 1YMMB 4JFYB 4YBQC 1EAPA 5BRZE 5BUGA 4GIOA 4I48A 3FU7A 4G1EA 4TSAL 4MA7L 1RUML 1G7JA 5DD6A 3GUTA 3P2DA 3CNKA 4RDQF 3SPIA 1BIIA 4YLCA 1FL3A 4E9LA 4Q9RL 3MBEC 3PWNA 4K8RC 5GGRA 4GKOA 5ANME 3TBVB 4DO6A 4G3YL 1PG7X 4KNTA 3WNLA 5TQ2H 1EXHA 2YUVA 4URTB 1QA9B 4HKBA 3BEVA 3KH4A 3TN0C 3NRFA 3K0YA 3VDCA 1YNTF 1XIWB 2WXHA 3BUQA 4JFOB 2K9FB 4WWKB 2R56L 4XBMA 1OARH 2A73A 2IG2H 2IC2A 4PRAB 5JW4Q 4QTFA 2Y7MA 5KG9B 2OSLA 4P3DA 4TNVK 4UT9H 5ENWA 5E4EB 2B5IC 3E3QC 2D8KA 4G9DB 3PLYA 4M6ML 5I2IB 2YGPA 2E7LA 1D7CA 3AWGA 3IFPB 3L1OL 1MAJA 1MVUB 3F58L 2X88A 2ADIA 3HI1A 2V5YA 3HR6A 4LDEB 2GUYA 2IBBA 3S36H 5DJ0A 8FABA 5TFSL 3QCUL 3O2VH 2D9CA 1RHHB 4QWWD 5C7ZA 2EVGA 4JKPH 5C0RL 3ETBJ 3LEXB 1WC7B 2AAVA 2DYPA 3G5ZB 2IPUK 4PJ6A 3ZW3A 4H7VA 3US1A 1IE5A 1VGEH 1D2OA 4Y5VA 2J2ZA 1V7NH 2NW3B 1IAIL 5TH2B 3PCYA 3E8VA 4PAZA 3VXOA 3T4AB 2IANB 3FH7A 2WZ6A 1MW3A 3IDNA 3BVUA 4S2SB 2JF1A 4LL4A 2E6PA 3S4SA 2OAAA 4YDZA 5FDWA 2H1PH 5DZNA 4FG4A 4HIJB 1Z5HA 2ZG1A 4PHXA 3VXSB 4JRFA 1H3VA 2JJUA 2PXYB 2ZOLA 1INDH 2F9BT 4WY7L 5JIMA 4KHTH 3BIAX 4LSRH 4OLWL 4LGSB 2OZ4A 2MSPA 3CC5B 3RVXC 2XSKA 4ZXBD 4L4TD 1EUUA 4Q4IA 5KAQF 3PQYB 5A2IH 1CU4L 3AY4A 4GG8B 4IQHA 4PD4J 3FCTB 3MNWA 1ZVSA 1HU8A 4XNXL 1F8TL 4QRSB 5KYXB 3KLSA 2XX1A 4C56B 3GMPB 1UJ3B 1JE6A 2WGNB 1FGNL 3DV6B 4LQFL 1NLDL 3FBKA 4TLTA 5JUEH 3TYFB 5AW0B 1TMQA 2ICCA 4OFKA 5JW4M 3U1SH 4AQ1C 1MCKA 2C7UA 1GCFA 4KUZH 2MOVA 2O6PA 3HPJA 3SD2A 3VFRA 2HJFB 2X4QB 2D9QB 4GAJH 3B9EA 1E8ZA 2K0RA 1ZKAA 4K23H 1X5YA 1OSZA 4U7MA 2EO7A 4L0ZA 1YEHL 4Y4KA 4NQVB 1E4HA 4GJTB 3JSSA 1U8LB 2DMKA 3AB0B 1ZDSA 5GZNA 2VXQL 3CVHH 3TGXA 1CLZH 4CSTA 3ZTEA 4BFIB 4KI5E 3G6JE 2VKXA 4RSVA 3SGEH 2BVPB 4KZEL 5HHMB 4GXUM 2C3XA 2W1NA 3QIUC 5HYEA 3RWDB 3K0WA 1FZKA 2HRPL 1F97A 1JYNA 3L3GB 4EKJA 5HJ3B 3BGMA 4PB0L 3MRBB 4D9LL 2V8LA 5E99L 1Q90A 4LPTA 3GLEA 4JJOA 1IAKA 5DK2B 1GPOH 1IM9A 1J0YA 3JTSB 1F56A 5DQDL 1U2HA 5HHQB 4P99A 1VZHA 3B3IA 4FQ2L 5F3FA 3MLXL 4RMWA 1IC0A 4ZT1A 3A23A 4KMTH 4N2KA 1P5UC 4JREB 5C09D 3K74B 1YEJH 3ARVA 3H7BB 3U6RB 1T4KB 1MRCH 4B9IA 3KLHC 3UG3A 1MFAL 3FN3A 5BXFB 4JQXC 5EZOH 4UOJA 3CBJB 2ZCLL 4GI9A 4CVXB 4K9EL 1JCVA 3ZR6A 3FQNA 4ZX5A 3VFVB 2VLRB 1SLXA 3VH8A 3KM1A 1G1CA 2P24B 4QHKJ 5KVFH 5EV7A 3NH7L 5HVGB 2IWEA 1KDIA 1R9FA 4HPOH 1DN2A 4QHUB 5B1JA 2RCSH 5F1SA 4LKXA 4PREA 3U0WH 4EUPA 1FNGA 4W9IC 2EICA 1WRFA 2BFGA 3Q6GL 3LSOA 1I9IH 1S9VB 4X7TA 5CIPA 3F8UB 3KWWA 2JI3A 4F92B 4JFQB 4OCWL 5DZ9A 1FYHB 4PRPD 3RA7L 3TBWB 3BQUB 1IKNC 2F53A 4G70B 2E5EA 1OGSA 4GAGH 4X7SH 2ZKMX 5I1LB 5KYUB 3F6IA 1JNJA 3CX5K 5E1GA 4H2AA 3SE3C 1SDYA 2PCXA 3RGBA 3LKQB 2F54E 5JTWA 3X1EA 2ENPA 4HCRA 1NC2D 4B0MM 1BVNP 1QZ1A 3OAYK 1R3KB 4X7EC 4OVVA 4IOIB 3BP6B 1EDYA 4DP0X 3P77B 4HIHB 4L18A 3JWNE 5KZCB 3DTDA 3OKDA 4OF6A 3APFA 1AGBB 4RNRA 4OFPA 4RLDA 5M94B 5L2JA 1N7MH 1SEBA 2VXSL 2WZPD 2AEPH 1QPPA 3JT0A 3LRGA 4MMXC 4QRQB 1UFGA 4S0HA 4FRWA 2WVSA 2W95A 4LLWB 3RZCD 1BVNT 3AS1A 2IXQA 2WMPB 4JVPA 5GS0H 3P9LA 4PLKD 4IBWA 2JSFA 3VYNA 4BZYA 3D52A 2AJ3B 2VISB 3S96A 4KK6C 1EEYA 3TFKD 4ZG1A 1Z9OA 3NCBB 3W57A 4NKMB 4YSEA 5HYFA 1PNDA 4ZTEA 4HDIB 1BZDA 1IGFL 1HHIA 1C16B 2R2HA 4JY6A 4GW5A 2F19L 1FZOB 1JS4A 2ADGB 4KJWD 1S7UB 3SDXB 2FHFA 1QFUH 3ZL4L 5E9NA 1N12A 2XZCH 3Q06A 3VNZA 1QUNA 2K45A 2ZONA 4XVUD 5J12B 4MWFB 3RILA 5JXAL 1HL5A 5ERWA 5DK0A 4D3CL 4O4YH 1R3JB 4LOFA 4DP6X 1I8KB 1JV2A 1D5XB 4YSAA 5AKSA 3IJ9A 3Q8AA 5J8OA 2A0LD 4HWBL 3MNVA 4A7GF 2QMKA 4PJCA 5AB2A 5F89B 2BSRA 4ZO8A 5A3ID 1UD4A 3FQ1A 3E7JA 4XGZB 3NN8A 1JHTB 3MFGB 4LOEA 1CF1A 1QFOA 5FO7B 2Y7NA 2E27L 1DR9A 2E7BA 3PL6B 5BZWA 5BS0B 2EXYD 2G5BA 2B14A 4OIBA 1O7VA 3LDBC 5MERB 4AGNA 4HK0A 4XCYB 2AJSL 3IDMB 5AKTA 3UPCA 5C0CD 5KJRH 4HIEA 4NUJA 2CMRH 3NQKA 5ISZB 2PWFA 4QOKA 3S2AA 3QFGA 4ZXBA 4L4TA 4OLXH 3HHMA 1KB9J 2B9BA 4XMLH 2YD8A