3GHEH

Crystal structure of anti-hiv-1 fab 537-10d in complex with v3 peptide mn
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
222
Chain Sequence
QVQLVQSGGGLVQPGGSLRLSCVASGFTFNNYWMSWVRQAPGKGLEWVANIKQDGNDKYYVDSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYFCAREFSSYTDHLEYYYDYYYMDVWGKGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Fab 537-10D, light chain
publication title Structural basis of the cross-reactivity of genetically related human anti-HIV-1 mAbs: implications for design of V3-based immunogens
pubmed doi rcsb
total genus 42
structure length 222
sequence length 229
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheH01
4FQXC 4QWWD 5TF0A 4IBLT 4OGYH 2F8OA 3REVA 1UJ3C 2J4WL 1NJ9A 3D69A 2VNCA 4TSCH 2QV2A 1ZEAL 3N1MC 5GISL 1EZVY 1LO2H 2WWMD 3KPSA 3EO1A 4PJXF 3TT1L 4K23H 5T1LA 1Q1JL 2JB5L 2YBRA 5K9KA 3IDNA 1G9NL 4FP8H 1H5BB 5DT1H 1F58H 1FO0A 2P1YA 5B39G 5D4QA 4XX1G 4CW1A 3NIDE 2AQ3A 1V3JA 1FLRH 5D7SH 3P30L 5B4MD 2J6EL 5C0ND 3MV9D 5JIPA 4I2XA 1BGXH 3R1GH 5TDOA 5CD5C 4HUUA 2XXCB 2FX7L 1R5VA 4JPWH 5F89A 1YEKH 5E8PA 4NO2A 4CJ0A 4H20L 2QTEA 3IXTB 2P44B 3QQNA 2OZ4A 2Z35A 1BBDL 3QUKA 4WGVB 5IBTH 3RAJH 12E8H 5SWSD 1KCSL 5LWYH 3P3YA 3VXOB 1ZGLM 2GITB 2GTZA 1FG9C 4XBPB 1F3DH 5DC9B 4G80A 3TVMB 1A21A 3OAYH 3MV8B 5LGHH 3UZEA 1QSZA 5FM5O 1WBZB 3GB7A 3E0GA 5TF1L 2D31A 2WIMA 1JPFB 4QNPF 1JZ5A 3WUWG 1MCKA 2ZCHH 1UWGH 2E8YA 2BVOB 3UPAA 1OM3L 4XI5D 3NIFE 3PWJA 3U83A 4MAYC 3GMQA 4EN3C 4XH2A 1LEKB 5JW3H 3U4AA 4L1HA 3OR7A 1AP2B 1LK2A 1WC7A 4OB5L 2R56H 4X4ZA 1I8MB 1F5WA 3EJJX 2LVEA 2AV1A 2EECA 3WS3B 4EI5A 1BP3B 3ZKXC 1DTUA 3KLAB 4YXHH 2C3WA 1CDCA 4LAQL 3SE8H 5EC2A 3H0TA 1G9ML 4KUZH 3VD3A 3AB0C 5JA8B 5JMRA 3DO7A 3S4SA 1HH6A 5LGJA 4L29B 3GSRB 4M7ZB 3BYYA 3KXFA 4JRXD 1MJ7L 1RJYA 5KSVA 4WFEE 5FO7A 4JAMB 4MAUL 5I1JL 4PJ5B 5E9DB 2DRUA 5KSBE 1ORSB 3UTPD 4G3YL 3WL9B 3O8XC 1DANU 2H8PB 1GSMA 5J06A 1T4KA 1QG3A 4MA8H 5F21B 3C2SA 1S7UA 3WLWD 3T2QA 1OAUL 3WDHA 3MRKA 4QOKE 3WIHL 3KDMB 4L4VB 4KU1A 4JQIL 4JO3L 2Y6SD 4UAOB 1H3PL 5A3IC 4RA0C 2W60A 5E2UL 1WTLA 2WW8A 3HTLX 4HWNA 3BPNC 2R8SL 2I26N 3WIFB 3QZWA 1HHIB 4P59H 2NY5C 1QA9B 1B0GB 3QEUB 4OZHE 4NZJA 3OXSB 4AENA 4DOHE 4PIRF 3P4OB 5SX5K 1F97A 1X5LA 1B2WL 3MNWA 4X0KA 1LK3H 1QEWB 5F7MC 5KVGH 1I7ZA 5D8JH 1MJJA 3GSWB 3CSYB 3FTGA 1YEFH 5HYJD 5C2BH 4W4OA 4F9PA 5E94B 2GTWA 4X80H 3T0XA 3MBXL 4GRLA 2D7QA 5B39A 4GS7B 2F15A 4NRXB 2NY3B 5GGRB 3DJ9A 2E9BA 3PQYD 1AD9B 4DKFH 3DVNA 4MA3B 1YMMA 3DROB 4P4KC 4XCFH 3V5HA 3GJFA 1ITBB 2CXGA 5D1XA 4P99A 4EI6A 4KXZI 3O2VL 4GXVL 2DLGA 1DQQB 4OV6F 2YXFA 1V8HA 1VPOH 3NFPA 5T1MB 4GLRI 1HSAA 4JO2L 3DLQR 2VLRB 1ETZA 2A9NL 1F3JA 2OTPA 2YA1A 1U8PA 4Y2DB 5T1DH 2EYRB 4BJLA 5D7KD 4ZFZB 5CINL 2YN3A 4BZ2H 3WUWA 4R7DA 1T7VA 5I1HH 3OKDA 3V5DB 5EPMB 1NCAH 4Z95H 5EU6D 5D1QA 4Y1AB 3GO1H 1MFDH 3BD3A 3IDUA 5JOEA 4LCWD 1OD9A 1WTGT 1HHGB 1KTDA 2NLJB 1X7QA 4CU7A 5DJCA 1S7RA 4GAYA 4ZDHB 4OLVL 1U92A 4BSWA 4NQDE 1NFIA 5A16A 1QFUL 5FM5M 3T2OA 3FOLB 5DMKB 4I4WA 2J8UA 4EQ3A 43CAB 3EJZD 3V6OC 2NCMA 3SBWA 4DZBB 1FQ9C 3QULB 1IM9B 3NZHL 2ZUUA 2Q76A 4ENED 1OSPH 1HKFA 5D5MA 2AJSH 3PGFL 5H37G 3F5WB 2K3TA 3SN6N 1DQDH 1LP9B 3QNZA 5MERA 3WLBB 1DBAH 2HFFA 4NHUA 5C09A 2AW2A 3HZKA 1VESA 4I77L 1N6QH 5DLML 4HQQH 2CDFB 4JG0L 1QFPA 3V6BR 3GI8L 5EBWA 2NY7L 4P46D 3DGGB 4JN1H 1CDBA 4RNRA 3SQOH 5F96H 1U3HC 3MLSL 1UH3A 5IHBA 3U0TB 5ISZD 2JKXA 4XNZB 2G5BA 1MJUH 3ARGD 4K07A 3KVQA 4JLRA 3O4LD 3G6AB 4P48A 4QRTA 3NTCH 1J05A 4YE4H 2EEBA 43C9B 3ZKQD 3MCLH 4KK8D 1D6EB 4OBRA 3HZMB 2A1WH 4PJDA 5IVXE 3TO2A 3VXUE 2NTFA 3O3BA 1LGVA 1CXIA 2I5YH 2NX5D 4MNQE 3WE6A 3NN8B 5LXGH 1DLFH 4L9DA 3MXWH 3S3PA 1MREL 1TJHL 3L3JB 3O9WB 4OCRH 2BSTB 4TTDC 1DUZB 2CKNA 1MCQA 1JE6A 2IMMA 2F19L 3MRPA 1U8LB 5BS0B 4PR5A 5EU4B 5JXAH 1OGAB 5DK3A 2UUDK 1UEMA 1JNLH 4U1NA 1KT2B 2IAND 4M6OH 5IVOA 3KGRA 3U2SB 5F7HA 4UTAL 1YEHL 2H2PD 3GFUA 4WI7A 3MYJA 2ATKB 2CH8A 1EEQA 3S98A 3CXHJ 4XHJC 1IKFL 3UEZA 4I3GA 4X6EA 5C8JA 3KPNB 1NGQL 3TA3B 2LU3A 2V7HB 3WFHA 1KJVA 4FOMA 2R69H 4DGYL 5K9QI 3DETD 5T3XD 1REIA 2DICA 2EIZA 1R6VA 1YUHB 4NWUH 1IM3A 3FO9B 5ENWA 4OFVA 2EC9T 1U58A 4HIXL 4RAVB 3T0AA 4P2OC 3HMXH 4R0LA 4FFZH 1MPAH 2YD8A 1CT8B 1AI1L 1U8MB 2D9CA 2PXYD 4QT5A 5H35B 1JP5A 2CJUL 1JK8B 4M61B 4Y4FB 1JRHL 1RVFH 4PG9B 1B0RB 1FYTA 4PJCE 3O3AA 4G8FB 1JN6A 5GXBB 4D0BB 4HC1H 5KANG 1PYWB 4MXQD 2DLHA 2ZUYA 3MUGB 4KRMB 3G08A 4P4RA 4M62L 4JPIA 2ZSVA 1FBIH 3MO1B 2R9HD 4GKZB 1MH5B 1QD0A 4P5TC 2DWEA 1BFTA 2BZDA 4HMCA 5F7EH 2NY2D 5AZ2L 1M4KA 3LY6A 5KSAD 1PG7L 4N5EC 2BRRH 3AREC 3KLHC 1BX2B 2ZNWA 4G8GE 2D9QB 1CFTA 3ALWA 3QQ4A 8FABA 4GAJH 4N0UE 5DSCA 5CJQH 1ADQH 4JFEE 1BVKA 1J7VR 3NVQA 4J3UA 3L3GA 2DQGL 1B0WA 1FLTX 4MNHA 1KB9K 1AKJD 2EDQA 4OCYH 5D6DC 3V6OE 4APQC 2WWKO 1EEYA 2GW5A 3U79A 4LHUA 2CKBH 4U0RB 5ECJE 3I6KB 5ADPL 5GS1A 4PV8A 3WDIA 1NC4A 5DWUL 2YC1B 1K2DB 5IROA 3SGJC 1MWAH 1N4XL 2J1KA 1HHHA 2L7UA 1NAKL 3ARFC 3ELAT 2PUQT 4QTIL 3PWUA 4QHUB 4HLZG 3L9RB 4U1HB 4HJ0C 5INCA 1P7HL 4CN6A 5EN2A 5GRVL 3S97C 1E4WL 3HI6H 4AQ1B 3DOSA 1JHKH 5I66A 2ZOLA 5AWNH 2XTJC 1RMFH 5JIHA 5BRZE 4Y19E 4XVTL 4CVXA 4PJIF 1A6VH 1TZGL 4O2EA 5BQ7B 2EDFA 2AK1H 3NCYS 4XAKD 4EDXA 2APFA 3W0WE 4OGAC 3H6JA 5I8KH 1LQSR 2NW3B 4E41E 3KHOA 2FD6H 3TBWA 1VEMA 6CGTA 5JORA 3S88H 3ULVL 3OGCB 3WFZA 4LF3A 4JE4B 5CBEA 3QCTL 1WT5C 2ED9A 3H9HA 3VD9A 2G9HA 4PPTA 5CEYB 1CK0H 1U3ZA 4OT1L 4MCZB 1UWEH 3KR3L 2IALB 4KVCL 4XP5H 4YO0A 2HKFH 3MRIA 3MUJA 1BQHG 1LE5B 1Q94B 5B3NA 3ZT5A 3M17A 4N0CC 4ZUUB 1ZT1A 3DMMB 3EDKA 1OF2B 2X70B 4NNYA 1S5IL 2E7CA 4BFBD 4FQJL 4XNYL 2BC4B 1A7OH 4KQ3L 4MHHG 1QBLL 3T0WA 4K9EL 1WBYB 3MLZH 5EA0L 1T1YB 4HPOH 4RFEB 5KN5B 2AJUH 2CLZB 2ZG3A 4TSAL 3EFFB 2WP3T 4HHAB 4S1DD 1T1WB 4ODXB 4ZUSA 3CX2A 1PZ5B 5D7LE 2FBJH 4TQEH 3T0ED 4X9FA 5ESQB 5ACZB 2AJZB 4PRIB 4WWKD 5KS9A 2B5IC 3WFBH 4HZAA 5L6YH 4X6DE 2GK0A 2ICWB 4KVNH 4OZIB 3IFLL 1XH3A 2RB8A 1FL3A 1A64A 3BWAB 3VFTA 2XV6B 1CIDA 3CFBA 3WJLA 2VDLL 1VFAA 5CEZH 1QO3A 1RIUL 5DD0H 4O58H 4PRAB 3KNBB 5BW7A 1O7VA 2D0HA 3DNKA 4HH9A 2F58H 4DCQB 1FNGA 2JIXA 4ZOBA 2A9MH 3Q1SL 5J12C 1K6QH 1TNNA 4F58H 5HHOD 3OB0H 2VDPL 1NFDE 1N0XL 1GZQB 2G2RB 2D0GA 4BQBA 3TCXA 4DZ8A 3UJJL 4JFOB 1KJ3L 4CN1A 5GS0L 3ZHLA 3C6LD 5JO5B 3FQTB 3K1KC 5C0DA 5JW4N 4OGXH 4LHQB 1A4JB 1ONQB 5TE6L 4HWBH 2B1HH 3QFJD 1CE1H 5F1IB 3GRWH 4WW1B 3BE1L 5JNYB 3LPGA 3WO4C 4EI5C 1AD0B 5L2KD 4O2CB 3WN5A 4D9QE 4JM2B 4QTHA 3HPLA 4DN3H 4CVZB 2ADFH 4GMSH 4U1SB 1NCUA 1AH1A 3FFCD 4OAWA 1EFXD 1CS6A 4OSUH 2XTJE 3EO0A 3BQUB 1QZ1A 2C26A 1AY1H 3KPPB 1DVFA 3RPIB 2ARWA 3RWGB 3TJHC 5EUOE 3GSNH 4EXKA 1DUYB 3P9MA 1MFAH 2GHWB 5CGYD 1BQHA 1MNUL 2DLFH 1YECL 3X14A 2CGRH 5IEKA 1AJ7H 3VG0L 5JOFB 1A6AB 1MLBA 1QVOB 4ZXBD 1FCCA 3HUJB 1OL0A 5IM7B 3WBDA 3QB7C 2KKQA 2XKUA 5IBLC 4PS4L 1BQUA 3OMZA 4KKLD 1CLZL 5GQBA 1SY6H 1VFMA 1GJIA 4N9OB 1NBZB 3HS0A 1I1RA 2E27H 1XEDA 4R90H 5DJ0B 3MV11 5HY9B 2D7TH 3DARA 3VXSD 5EDXA 3ZDYF 1JRHI 3HE7B 2XWJA 4X98B 4QRRA 4W4OC 2JCCF 4B0MM 1IAOB 4F9PC 4GRLC 4PGDB 1D5BB 3U0PB 2UYLB 1T1ZA 4LOUD 3FQXB 4K7PL 4FFVC 3KPSE 2CRZA 4NO0D 4P2QA 2C3VA 4N90D 1JPTH 2HKHH 1WWCA 4U1IB 5C0AB 1ZLWK 4X5LA 3K81A 1GH7A 3WHXB 4Z18A 3KPTA 5C0FB 5DC0A 2UV3A 4FFWC 1M05B 5D2NB 2R4RH 5GSVA 2FSEB 2X4RA 3KYKL 2PR4H 4XPAH 5CEXB 5IEHB 4OF5A 4U1JB 1F4HA 1IGTA 2GY5A 4K3GA 4MXWL 2C1PA 4I2XE 5CJ8A 1MCRA 1U91B 3IRZA 2F53B 1Q9OA 3MMEA 2NY4D 4MS8D 1AR1C 1CD1B 3R8BB 3A67L 2ADGB 2GJ6D 5EZLB 5DZOA 2P45B 3F7PC 4N1HB 4UDTB 5DHYA 4LKCA 1TIUA 1JHLH 2FR4A 1IGCL 1X5HA 1CFNB 4JFFB 1RZKC 2R2EB 1W72L 5B8CB 4XCNA 2X4QB 4HMEA 4I0KA 4NQXA 3L5XL 2F74B 5I8CB 1DBJH 2FHCA 4PJGA 3T1FB 1FDLH 3GGWB 4GRWF 4CAGA 2DQTH 1KENH 1FNEA 4KI1A 4YDKH 1WQVT 1SEBB 4FQ1H 4L5FL 5F9WC 1MVUB 3V4UH 4IRJA 3TT3H 1A02N 1Q9KA 3N0PB 4GKSB 3KYMB 4IHOA 4ERSL 3KAAA 2VLKB 3DTXA 5T33L 3DGCR 3EYVB 5C0BA 3PG2A 3SBWC 2YUZA 2AQ1A 5TQ0H 3F58H 2VLJB 3C5SB 4NYLB 1LD9A 2G5RA 4PRBA 4LASL 1JPGA 3STZA 1UENA 4JZJB 1EA9C 4NKIH 2V5SA 1K3ZA 2WBWB 2X1WL 1C5BL 4HXBL 4YC2C 2KZWA 2WUBH 4F57H 4PRPA 4LP5A 2AV7A 3ARSA 1ZHBA 3ULVD 1RUQL 2MCG1 3KXFE 2MJWA 4NUJA 3W9EB 2ADIA 3SO3C 2KL6A 4G8EB 1X5YA 4MWFA 2BSRB 1ZA6B 3HZYB 4KJWD 1C7TA 4Y5VB 1QFHA 4WUUA 4C59B 5FGRA 2P5EB 3NABL 3IFOA 2YEZB 3IU4H 3E8UH 3CLEH 5FYKE 1CGSL 3CFKA 3U9PL 1G7IA 1X9QA 3LQAC 3CFDA 3B9VA 4LNRA 2D7NA 2IBZX 3IETA 4NNPL 2D7MA 4PB9L 1ZWIB 3QUYC 4P3DA 4XP4H 1YNTB 4OF7A 1W2KT 3W5MA 1BZQK 4KJQD 3RRQA 4TPRH 1EEUA 1BAFL 4HS3B 1IC5H 3VWKA 4Y4HB 1BEYH 4XNMA 3CZFB 5EULV 3U0WH 3O2WH 4GW1B 3QDJD 5E8OA 1QBML 2BOCB 3O6MH 2IH3A 2P7TB 3A6CL 2HLAA 1OHQA 4M8QA 1MIEH 3SDAB 3R06A 4WEBL 2IADB 5ACMA 2IG2L 4F2MA 3LRHA 1GGCL 4JHBA 4OD3L 3UDWA 3FQUA 4PJBE 5C07B 3D9AH 3T4AB 3N85L 4JRYA 1E28A 1ZHNB 3CDGA 3I3EA 2IPTL 4QRSB 3L5WB 3CC5B 1TJIH 4F7TB 4XX1E 3EYFA 1Y18A 3WSQH 3LEXA 4WFFE 5FF6A 2E6PA 1YMME 3OJ2C 1MAML 5KTEH 4ZAKD 5IQ7L 1FO0H 4MCYB 4OV5B 5D7IB 3TFKD 1E6JH 4WU5A 2OXGA 2YA0A 2ARJA 1B6UA 1DBKL 1T04B 2X4NB 5C0IA 3MRJA 2FL5B 2GKIA 3QA3A 1CBVL 2F5BL 5HHMD 4OCWL 1KSRA 3RHWF 5IB3A 3MV7D 1QLEH 3LN5A 3Q48A 2HH0H 1BM3L 2OZ4H 2AI0H 3RVTD 4QXTA 3ZL4H 3FFDB 5HPMB 2GI7A 4HIEA 3D0VA 1CGWA 5GS0D 2RGSA 2VXTH 1INQB 3DSFL 4U1MA 3MNZB 2FJFB 2FGZA 5CLTA 4K3JL 4J1UB 3O6FA 1QRNA 2R0KH 2MTPA 4NJ9H 1MHEA 3MGOA 4PJXA 2XT1B 1A2YA 1D3CA 5FGCB 1A5FL 5CGMA 4AT6B 4UI2A 1YY9D 5GGUB 3QCVH 3QI9D 1JVKA 3GSQA 4ODUA 3ZSSA 3V0WL 2VDKL 3NOIA 4IRSA 1XF5B 1N8ZA 1E4XL 1RZ8A 5F7YC 4LVNC 3HE6A 4JN2A 2J8UE 4J3VA 1HQ4B 5D7JD 4HKBB 3JTSA 1MUJA 2NXZC 5D5ME 3E6HA 4P23B 2WQRA 3INUL 3BKCH 4LVHC 4YDLC 4IMLA 1RK1B 15C8H 3FQNB 5GS1C 1FZMB 3JV5A 3C5JA 2UWEF 4ZUWA 4Z6AT 4TNWF 4OUUB 3GIZL 1P4LB 4KTDL 1NCTA 4LEOB 5CMAB 4ZTPL 3TIEB 5C09E 3SGDI 5FA4B 5I1EH 5K9JL 5EUKA 1FSKC 3VJ6A 2EIEA 3HFMH 3B9EA 4XPFL 4JREC 4HSQA 4KMQA 2G60H 1HDMB 4PJ8D 2FECL 4K8RC 4WI2A 2YUXA 4HJGB 4NHCH 1MCCA 2D03L 2JELL 4N0FA 1I8KA 4R4FH 5TH2A 3O81A 3SDCD 2B2XL 1LO3L 4AIZB 5MEPB 4GBXC 4DWHA 1KGCD 4Y5YB 3VFUA 5C70A 1G6VK 3P11H 2OQJB 3UBXB 3OB8A 4PJDE 4C57C 1KIUA 1CFVL 4Z77A 1HXYB 4LSDA 4PP2A 3ILPA 1ZV5A 2O26U 4K3EH 3QNYB 5MENB 4S2SA 2ENYA 5JR1L 1L0QA 3P40A 1BLNB 4RSVA 4JFPB 3SCMB 4F3FA 1R3KB 5D1ZD 3NCJH 2SEBB 4LSVL 3F12B 2OR8A 3D0LA 1Q0YL 5C71A 3BIKA 3L3DA 4G42B 1KELL 2R2CA 1L0XA 3LN4B 1N5YH 2IQ9H 2A6IA 4CDHA 2ICES 3RQ3A 5IMOB 2IAMD 2KDGA 4GQ9L 5I1CH 2R1WA 3TN0D 4Z7VA 5EBMB 1EGJA 5HJ3A 1Q9LB 2KQMA 1B6DA 2PYED 3FJTA 4LFHD 4DOHB 5T3ZE 4MJIA 3GKWL 3MRBA 3OKNB 4GW4B 4UU9A 3MRNA 3Q5TA 2DYPB 2QQKL 4ALAH 5DJ8B 1HKLH 3GJFH 5CWSB 1I9RH 1FC2D 4X99B 3VGAC 2Q20A 1OB1B 1Q9WA 4JFHE 1BFOA 2WBJB 1HE7A 1NBQA 2A6DA 5E8NA 3GMPB 2ZOKB 3I6GB 4I0PA 2H9GA 3EO9H 4ONFH 4W4NA 5JW5A 1UACH 5HI5C 35C8L 5AAWA 3VI3F 3T4YA 1M7IB 2A73B 1TLKA 1UZ8B 4XXDB 4Y4KA 3SKOB 1FYTE 1NUGA 4P5KB 1F4XL 2NW2B 5F7FA 2EZ0D 5IT2H 1ROWA 1A7QH 3I2CL 1RUAH 4HG4J 3VXPB 4NRYB 4KY1L 3RVUC 4Z7OF 1IC4H 1RJLA 1Y0LB 3LV3B 2GY7B 3RGVB 1RZKH 1LE9B 3BW9B 1S9VA 5I6XB 3VI4E 1DL7H 4HWZB 4L4TD 3BP5B 2EXYD 3WJLC 2BNUA 4ODSH 2Z4QB 2I9TB 3D39D 4IJ3C 1Q0XL 1CG9A 2P8LA 4ODHH 5D72H 2C9AA 3FQWA 5FDWA 3HRPA 3B9KB 1N2RB 2OI9C 3LKOB 1KB5B 1KJMB 4FXLA 3S36H 4PGEA 4KC3B 3WXVL 3STLA 1WSST 2Y7QA 4MD4A 1GCFA 4MX7A 4TUOB 1G1YA 1CU4H 3QUZB 3IDXL 1XGQB 4LPXA 4K7FB 4EBQL 3SDXB 3BFOA 4XNQB 4BKLA 4X7TB 3MZTA 3I3BA 4OZGF 2DIBA 5D70L 3CFCL 1VERA 4KV5E 5IV2B 1ACYH 3SGKA 2CLRA 4LLAA 2QADC 1W8OA 5HGHB 2FDBP 4MAYB 3B3IA 4FQQB 4L3CA 4GW5B 4OTXH 4EN3B 4LARL 4TN9A 1JWSB 1RZFH 3MODH 4V1DB 5IB2B 1XGYL 5TPWH 5EORH 2AXHA 3PL6B 2HG5A 1O5DT 4DAGL 3FO2A 3U36A 4WCYL 4C56D 1AR2A 5HYQA 2ZUQC 3T3ME 5GRZA 4R26H 3JVGC 4LCYB 4DVRH 3LQAH 4Y16B 3BDXA 1DVFC 3GBML 5KG9B 3LKSB 1ZAGA 1BZ9B 2BY2A 2OTWA 2XN9E 4OCNC 4QRPD 1S9XB 3RJQB 1CE6A 1DSFH 3ARBD 2NZ9D 1ZA3A 3NAAL 3AXLA 5D7IF 4RZCB 4OKDA 2GUOA 1HYSD 3X12B 1X5IA 2XY2A 5ETUB 4P3CL 5JTWA 5IBUB 1RIHH 5GZND 3C2AL 3MLWH 5IFJA 4YDJA 3R0MA 3D3VD 3GSOA 4WVRA 1UC6A 4LKXA 4NP4H 1KTLB 4MNQB 4WEUD 2YD1A 3ARDB 4LSUH 1JF1B 3DX6A 4WHDA 1TQCC 4LSSH 1MCOH 1UGNA 5JQ6L 5CSBA 4NJAH 4W6WB 3JTTA 2CDGB 2FX9L 1JGEB 4PJ9D 1MJ8L 4JQXA 3G6DH 4HFWA 5CJXC 1EIBA 3IT8D 4AJ0A 1T22B 3TJEL 1MCFA 2NY6B 4NSKB 1D5IL 3UTTD 2DQFA 4YEFA 1MCNA 1H5BA 2Q7YB 1I8LA 3GIVB 1RUKH 3K2UL 2BDNH 4QXWA 4TOYH 1QNZL 1EJOL 4DEPB 5I1KH 1H0DB 2DI9A 3FCTB 3W39B 5HDQL 4XP6H 1JNNH 1E4XI 2W38A 4HUVB 2VKXA 3GMLB 2V5MA 4ZO6A 3PGDB 2VH5H 3PP4H 4ELMB 2QQLH 2HRPH 4LQ1A 3IXTA 5I1LB 3V4VL 1NL0L 4YZFF 3ULUC 4GT7A 4AY0A 1RUPL 1B88A 5DVOA 3QDMD 4PJCB 3VGDA 5H37H 3VXOA 3TCLB 5F44A 2GITA 2NYYD 1NLDL 4UILH 4XBPA 4Q7DA 3TVMA 5HVFB 3CVHB 4KDVA 3ULVF 3TPKA 1CLYL 2RQ8A 4JY4B 3RKPA 4I48B 1WBZA 1FVDB 3WXWH 5CUSH 2XZCL 2DDQH 3KPRA 5GRJH 4DW2L 4IRJC 2BVOA 5I16B 1BIIB 1D6VH 2ZG2A 1J0KA 2FECI 1WK0A 1MCDA 2C5DC 5C2UB 1IC1A 1LWRA 5JDSA 1LEKA 1J1XL 5E0QA 2X4SA 1AP2A 4LVOC 4JFEB 4K3DL 3UC0H 4MB3A 3WS3A 3BSZH 3CPLB 3WKML 1K5NB 3KLAA 3FRPG 4K8RH 4HIHB 4L29A 2HT2C 2VLME 3GSRA 4U1LB 1MI5E 1NGYB 4NQEB 3GI9H 5I0ZA 2XRAL 5GHWH 5LBSH 4JAMA 4PJ5A 5E9DA 1ORSA 3WL9A 1EBPA 5J0BA 1AGEB 1BMGA 1F4AA 2H8PA 4OGYL 4LLYB 4RMVA 4TSCL 2VZ1A 5GRUH 2G75B 4KFZC 1V7MH 3D85B 1J10A 2NR6D 3H7LA 3KDMA 4L4VA 1LO2L 4QEGA 3NPSB 3N1QC 2NY1B 4PJAB 5DEFA 2LTQC 4K23L 4NN7C 4PGBB 1YEJH 4GLRH 1S78C 2V2TB 5BRZB 4FP8L 4Y19B 5DT1L 1HHIA 5SWQB 4HCRA 1QA9A 1F58L 1B0GA 3QEUA 5F9AC 3OXSA 5K93A 2Z93A 3P4OA 4XP1H 2W07A 3VWKC 4O00A 1INEH 3JWDH 3KJ6H 4HX1B 1FLRL 5D7SL 4E41B 3BO8B 3TWCH 3EHBD 2NY0B 1QEWA 2Z91B 1BGXL 3R1GL 3CH1B 5I75C 1YN7B 4OFYD 3KPMB 4JPWL 3GSWA 4EIZC 2X89A 4LGRB 3CSYA 1YEKL 1I3UA 4HKZA 4QRRE 5E94A 5IBTL 3RAJL 4ZFOB 3V0AC 5LWYL 2A0LD 4WTXA 5GGRA 5LGHL 1D9KB 1AD9A 4MA3A 4IDJH 1I1AB 4KROB 5DEGB 3DROA 2YD4A 1QR4A 2DL2A 3BEVB 4D9RD 2JJTA 1FL5A 4OI9A 3PDDA 2ZCHL 1UWGL 4OF3A 3G9AB 3KHQA 3CU7A 4X9BA 3ZTNH 1I4FB 1FFRA 3X13B 1DQQA 2E7MA 5I15H 2BHZA 5JW3L 5T1MA 5CZXD 2YXMA 5DF0A 5KVFH 2VLRA 2R56L 2YD2A 5ID0B 1J1OH 1UM4H 2ZUXA 4Y2DA 4S0SD 2EYRA 3BP4B 3ULUE 2FB4H 4YXHL 4CGTA 3WCYA 4KUZL 1VHPA 1P5VA 3V5DA 5C0JB 5EPMA 2MNUA 3U82B 3V6ZB 1P7QB 1YPZE 3O6FC 4X6DB 4Y1AA 3L3IB 5GJSH 2Q8AH 3FO1B 1JWMB 4PJGE 1XIWD 2VE6B 2NLJA 1TMCB 1NAMB 4ZDHA 3MR9B 5E5UB 1F2XK 3MRLB 4HLZH 1SEQH 4IRSC 4MA8L 1Z9MA 2WIIB 3VFGH 4DFHA 4JKWA 4P5TB 2OSLB 3FOLA 3FRPA 5DMKA 1ZGLB 4KAQH 5C0BE 43CAA 4DZBA 1QOKA 3QULA 4NN6C 1IM9A 2KPNA 3UYPA 3F5WA 2YZ1A 4P59L 1NFDB 1LP9A 1NCDH 4X6CE 3C60B 5FYLE 3WLBA 4XB8A 2NTSP 3QCUH 4JCMA 4PRPE 3MCKB 1UEYA 1LK3L 4I3RH 2CDFA 1ES0B 5KVGL 1VFUA 3QDGD 1FV1B 5D8JL 4K7PY 3ESVF 3DGGA 4NUGH 2ESVD 4B50A 4PRHD 1YEFL 3VFMB 5JQHC 1ED3B 5C2BL 2BNRD 2B8OT 3C5ZD 3U0TA 4WUUE 3I50H 2R29H 4X80L 3G6AA 3NIGF 43C9A 4KDTA 2JJSA 2MCPH 4LP4A 1D6EA 3EUUA 3HZMA 3JXAA 5DR5H 4DKFL 1KLUB 3SJVD 5FIEA 3MGTA 2XTJB 1KPRB 4XCFL 5IHZB 3NN8A 5DD5H 5DMGC 3B6SB 3L3JA 4WFHD 3O9WA 3LKRB 2HJLB 1QSED 1U8LA 5BS0A 5EUOB 3CK0H 5EU4A 2DS4A 4PTTB 1OGAA 1VPOL 3WNPA 1KT2A 5C92A 3U2SA 1C5CH 3ALPA 5F7WC 5C3LD 2ATKA 5I8OH 5HGBB 3T65B 4K71B 2ZKHH 1NEZB 5T1DL 4BZ2L 4JRYE 3T8XB 3KPNA 5I1HL 4ELMF 3TA3A 3MROB 4IS6B 1NCAL 4Z95L 3N1FC 2B4CC 3GO1L 1MFDL 3FO9A 4X7DC 3EYSH 5DJDB 1AO7B 3RNKB 5DS8A 2EDKA 3HLAB 4RAVA 1JZ7A 2VXVL 4JFDD 1YYMH 3MCG1 1IGYA 1QFWI 1LDPH 1P4IH 2AXJA 3REVB 2VN4A 4I0PC 1CT8A 1U8MA 1EDQA 3WNKA 4AM0B 5H35A 3RIAF 1JK8A 4M61A 3N1GC 4U7KA 4Y4FA 4HKJB 2A6JB 1GC1C 4RGNC 3RZCD 4TVPE 3DRQB 4PG9A 1XGUB 4Y4KC 1B0RA 2B7DT 4CN4A 1II4E 4G8FA 4WO4B 1OSPL 4UBDD 3H42H 2AJSL 4X9IA 4D0BA 3ULUH 4XC3H 3E2HB 1KXVC 1DQDL 1PYWA 3V52H 4O5LH 2F5AH 1Q72H 4NOBA 1DBAL 3MUGA 1CICB 4M7JH 1TJGH 1N6QL 1TFHA 1QRKA 2AK4D 3ZTJG 3MO1A 4HQQL 2ZNXA 1QRNE 3L3HB 3H9SD 1C12B 1CIUA 4U3HA 1MH5A 4PJXE 1PJ9A 2WV3A 2YUWA 4JN1L 3SQOL 3EZ8A 2EDXA 5F96L 4NO2B 4OFPA 1NGPH 3DUHA 1MJUL 2H45A 4AEEA 2VABB 3ZO0A 3NTCL 4PJFF 2O5XH 4YE4L 3MCLL 2PKDA 3PWLB 4OUOA 1BF8A 3G04B 5HDLA 2HT4D 1UCBH 1R24B 4EDWH 1XCQB 2A1WL 2P48B 2Q86B 3G6JB 4C55A 5LXGL 3GB7B 3I6KA 2A38A 2HFEB 1DLFL 3MXWL 3VXRB 1MQ8A 4PJAF 5DFVD 5H8DA 4CMHC 4OCRL 4P2RD 2YC1A 2VRAA 1K2DA 3ORJA 1PG7W 1OP5K 3ZDZE 4P57B 5IK3B 4BZ1H 1CTNA 5FOJA 4D0DB 5JXAL 1JNLL 1N0LA 3AROA 4M6OL 4QHUA 4WGWB 4U1HA 3LAFA 4G6AC 4NO3B 4NQCB 3OJDB 5FXCH 4HK3J 4LPWA 4ZUVB 1V05A 4QNPE 3U48A 1K8DB 4EIGB 1MFEH 2VWEC 2R69L 5BQ7A 1HH6B 2V2XB 2XG4A 3QQ9D 4NWUL 2NXYD 2NW3A 4FXKB 3DECA 3FOMB 3HMXL 4PBVC 5I0DA 3PV6B 3P2TA 3VD5A 4FFZL 3OGCA 1MPAL 3OKEB 1I8IB 1T66D 4M43H 3MRKB 3VWJD 2YN5A 3NCBB 1AHWB 5CEYA 2LVCA 4MCZA 1RVFL 2IALA 4NC0B 1KB5L 1MHPH 1M1SA 1LE5A 1Q94A 4HC1L 2IF7A 5HDOA 2DLIA 3ILQD 4XXCA 1YNLH 3DMMA 2OK0H 4MD0B 1OF2A 5I1GH 3ETBF 4YQXH 3BHBB 2F54D 4MJIE 2QKIB 3B5GA 1U36A 1HIMH 5EO0B 2AKRA 2BC4A 3EYQC 1WBYA 3WFDH 1S7XB 4PRDB 1T1YA 4JQXC 4RFEA 5KN5A 4UT9H 3QEQD 5F7EL 5GGSB 2CLZA 2WZPD 1IEBB 5ICXB 2Y06H 3EFFA 4PJBB 2BRRL 3QWRD 4HHAA 4Y5XC 1T1WA 4GAJL 1YC8A 1ERNA 4ODXA 5CJQL 3MNVB 1ADQL 3D25B 5DD6B 3QYCA 4TVPH 1GIGH 3BKYH 4Q0XH 4FMKA 1UKSA 3O11B 1IVLA 1I8LC 4OCYL 1PZ5A 4RGNE 3GK8L 5ESQA 4N8CH 5ACZA 2IBBA 2AJZA 1C08B 2CKBL 4OLZH 1FZOB 2ICWA 4OZIA 3CDYA 4PJHB 4F7EB 2BVEA 3BWAA 1DE4B 1MWAL 2EDWA 4GXUM 3PDGA 4BUGA 1J86A 3SKMB 3EDDA 4OF8A 1RUMH 4XNUH 3TNNB 4L3ED 4KKBD 3WFCH 3SY0B 4JKMA 4BSVA 3CVIH 4LCUB 4OIIH 3UTSD 4PRAA 3KNBA 5IB1B 3HI6L 3TVMC 2ITDB 2HRLA 4KQ4H 4DCQA 1JHKL 3QT2A 3VGFA 5DMYA 2VR9A 1RMFL 2OJEB 1A6VL 4ELKB 1RSFA 1GZQA 2AK1L 2G2RA 3D18B 3V2AR 1KV3A 2IPKB 5I8KL 1XGTB 4JFOA 2NY5L 5JO5A 4FZ8H 3RTQB 2JE8A 2FD6L 4G43B 3FQTA 1KTDB 1GYAA 1GL4B 3S88L 1A4JA 4R8WH 4PD4K 3QXVA 1ONQA 4MVBD 3S35X 1AI1H 1OAYH 5F1IA 4WW1A 4AG4H 5JNYA 1CK0L 5HYIA 1UWEL 1AD0A 2AEWA 4O2CA 4JM2A 4XP5L 2HKFL 4CVZA 3CJJA 2GFBB 4MB5A 2Q76B 2Z9TA 3QXTA 3JWNC 1ZLUK 4U1SA 3A6OA 1T21B 5DD1H 5JZ7D 1V3LA 3FQRB 4M7ZC 4PG2A 2VXUH 2Y5EA 2VWEE 4H8WC 2PO6D 3UYRH 3LKNB 1A7OL 3RPIA 3RWGA 4ZFFB 2W9LA 1IT9H 4ZQKB 4ZOCA 1DUYA 3MLZL 2RBLA 4QHKI 2VUOA 4HPOL 3SDDD 2AJUL 4URTB 2EO9A 2FX8H 1CR9L 5LVEA 4NBXB 1ORQA 3RHWK 3RVWC 5JOFA 1A6AA 1QVOA 2CRMA 3HUJA 5KOVC 5IM7A 2CDEB 1NUDA 3U4BH 2FBJL 4TQEL 5M94B 2CK0H 4JG1H 4YBLC 1N3NA 4WDIA 4N1EA 2PW2B 1EGJH 4DVBB 3TO2B 3WFBL 1MCJA 3I6LE 1NBZA 2DL9A 5L6YL 3LD8C 5DJ0A 3QUYB 5HY9A 4KVNL 4M03A 1JF5A 3R4DA 3RDTB 1UWXK 3HE7A 2B4CH 4WFGD 5F7KC 4AYFA 4X98A 1IAOA 5TE7L 3TH4T 2AEPH 4PREB 2ENSA 5I1IH 3LDBB 3NA9H 2BX5A 4M1CD 2DQJH 1D5BA 4PGDA 2UYLA 5CEZL 5DD0L 3U0PA 3FQXA 4GS7C 4ZMAT 3MYJB 4O58L 2F58L 2WWMC 4YBQC 2A9ML 1FCGA 1K6QL 4U1IA 1Z9LA 5C0AA 4F58L 3FB7B 5HI3D 3WHXA 4ODWB 3FN0H 5C0FA 4I9WE 4GMTH 2JJTC 1YC7A 3RA7H 1M05A 2LV4A 5D2NA 2EIZB 2FJGB 1CGUA 3KPOB 5CEXA 5IEHA 4U1JA 1U58B 4TNWK 2CMRH 4AEIH 5JLZB 1U91A 4OGXL 2FEEL 4QOKD 2F53A 2B1HL 1CD1A 3FN9A 2ADGA 1CE1L 4NC1C 2YPLD 3GRWL 5HXMA 5EZLA 2WK2A 4Y2DC 2I24N 1QSFB 4NM8H 4UDTA 2BP3A 2N7BA 1T83A 4KKNA 3VXMD 4DN3L 1CFNA 1MCEA 4JFFA 2QL1A 2R2EA 3MBED 5E6ID 2ADFL 4GMSL 4MJ5B 3S3JA 5B8CA 1G7QB 5DQJB 2X4QA 4Q9CA 2F74A 2YPKB 4FG6C 5I8CA 1L6XA 4Z7QE 4OSUL 8CGTA 4KKAD 1BQSA 3T1FA 2VZOA 3GGWA 3REWA 1AY1L 4FQLH 5A2KH 3G08B 5IJKA 4KGJA 3KPRE 1KFAH 3MRHB 1SEBA 1MVUA 4XNYH 4KQ3H 3GSNL 4FQXD 3NGBB 4XMKH 4GKSA 3KYMA 5I9QC 5F1KC 2VLKA 4M8VA 1TVBB 1MFAL 1TCMA 3SOBH 1L4IA 4XI5C 3MLYH 5GGQH 3TZVB 1OTUD 4AIXA 3EYVA 4Z0XB 1F6FB 4Z7NE 4YXKL 2DLFL 1CDUA 5F8RC 1KCUH 2VLJA 2CGRL 1X5JA 1S7QB 1AJ7L 3IFNH 2J8HA 3C5SA 4NYLA 4POZD 1GZPB 3F7RA 4KHTH 3L3GB 4HIJB 3BPCB 2K7QA 1T7XA 4JZJA 1HQRB 1SY6L 1GGTA 4YDLB 2E27L 4R90L 1P1ZA 3RWFB 3EOTH 4CU6A 4Y8DC 2D7TL 4NZTH 3W9EA 5L9DH 1OQOA 4G8EA 2BSRA 4PJ5E 5E9DE 1ZA6A 3HZYA 1NDMB 2VDRH 1BWWA 4Y5VA 1HHHB 4KK5C 4XNZC 5B3JF 4EKXA 2P5EA 3VGHA 4JREB 2YEZA 4KDTC 2JJSC 3K4AA 4L4VE 3L1OH 4UTBH 3RBSA 1MLCB 1JPTL 3GBNH 2HKHL 5HHPB 2Y6SC 2MKWA 3PHOB 4X9HA 1T0MA 3D1MC 1ZWIA 1YNTA 3O9WC 2R4RL 4GBXB 4Z7WF 4ZXBA 3QXAB 4HS3A 1ZT4B 4Y4HA 2PR4L 4XPAL 3OF6D 4RMSA 1QP1A 2XN9B 4C4KO 4JO1H 3UBXG 3CZFA 3QIUD 4GW1A 4J3OC 4NQDD 1FP5A 3TBWB 4PJ7B 1UA6H 2BOCA 1CQYA 2LU4A 2P7TA 4G9FB 3ZMRA 3SDAA 3ZDXF 2IADA 1GRWA 3AS0A 3ARWA 2XA8H 1BBJB 5C07A 3T4AA 4I18A 1EHXA 5AZEH 1LO0H 1ZHNA 1JHLL 3UO1H 3T08A 4QRSA 5JXED 3TA3C 4OI8A 3L5WA 1TCRB 1UZ6F 2Y25A 1A6ZB 1OQXA 25C8H 3CC5A 4F7TA 1MRCH 1L6ZA 1P84K 1B90A 1DBJL 4OIAA 3CSBA 1FDLL 4L9LC 1R3LB 4MCYA 4OV5A 5D7IA 2DQTL 1KENL 4YDKL 4FQ1L 3V4UL 1T04A 1VDGA 2X4NA 4H0HB 3TT3L 3O8XD 2FL5A 4RGMB 3VGAB 4Y4FC 5GGTA 4RMWA 1H3WM 1YJDH 5ALCH 5TQ0L 2FEDC 5C0CB 3DX8B 3F58L 5BMFH 2VLRE 5C6TH 5A3ID 2IBGA 4NC1E 4UNTA 2XIDA 4O02H 2Q3ZA 3VXUD 3FFDA 5HPMA 2P5WD 4PJEF 4NKIL 4YGVB 2AQ2A 2WUBL 1ZLVK 3RY4A 4F57L 5SWSE 3MNZA 2FJFA 5AD0B 2E8ZA 4J1UA 4Y1AE 3KJ4B 2GK0B 2YKLH 4PLJC 1QACA 4AT6A 1CDYA 2DD8H 2IEPA 4U6TA 3MRDB 5GGUA 3PWVB 2YPVH 2VAJA 4MXVF 1XF5A 1FFQA 1EHNA 3IU4L 3L7EB 1L7TH 3E8UL 2E9JA 3CLEL 1HQ4A 4E9LA 4U0RC 4P23A 5FDYA 5F1NB 3FQNA 4U49A 4XP4L 5CAYB 5I8EB 5JDJA 4P4KD 1WGOA 4OUUA 1P4LA 4TPRL 1IC5L 1NC2B 3MSPA 4LEOA 5CMAA 3CFJB 3AC0A 5GRYA 1BEYL 3TIEA 1OAQH 5FA4A 3U0WL 3O2WL 4H8WH 3O6ML 3JBG7 1MIEL 5E2VL 3UJIH 1HDMA 2QADB 3D9AL 4HJGA 1HHJB 2XACC 4U2ZA 4HAFA 3GJEB 3ARGC 3R8QA 4KK9C 4YDVB 1TJIL 3HG1B 1KNOB 5JHLH 4AIZA 5MEPA 3WSQL 4Y5YA 5CJBA 1MI5B 3KPLB 3UBXA 3L5XH 1HXYA 3L7FB 3TBSB 4HCRH 5KTEL 2BNQD 3HKFA 1FO0L 4GFTB 3QNYA 1E6JL 5MENA 1CGVA 3WNMA 2X2YA 1BLNA 1WIPA 3K0WA 5JHDB 4RWHA 4JFPA 5HI4C 3SCMA 1R3KA 5BS0E 4QRUB 5CEZD 2FATH 2SEBA 4MLSA 4TTGA 3F12A 4G8GD 2BVUA 3RWEB 2X6MA 4G42A 4MYWB 1OGAE 4NFCA 4MGXA 2WINB 2X4UB 1D5XB 5IMOA 5I71C 1QLEL 4U0QB 2HH0L 2HVJB 2OZ4L 2AI0L 1IBGH 1CDJA 5EBMA 1G9NC 1A7BA 1Q9LA 3ZL4L 4OD2B 2MFNA 3K7UA 5FAAA 2BXYA 4XXCC 3DMMC 1JGUH 3V4PH 2IPUK 2VXTL 3VGGA 3OKNA 4GW4A 1FAKT 5HHXH 1GPOH 1ZVHA 2DYPA 2FZ3B 2R0KL 5DJ8A 4GKOA 4NJ9L 5EC1B 3VFSB 5IFAH 4Q97A 5CWSA 2I07B 4X99A 5JMOC 3QRGH 1F45A 3PQYE 1OB1A 3O3DB 5FKPB 5M95B 2A77H 2WBJA 2PNDA 2BY1A 3QCVL 5DZNA 2E6JA 4I1NB 3QP3A 3GMPA 3I9GH 2FIKB 2RIKA 2ZOKA 3I6GA 1U3HD 3PF2A 3RUGF 2QSCH 4U1KB 4X9GA 4MQTB 2UZIH 2PXYC 1M7IA 2A73A 1UZ8A 2AEIT 5J8OA 4XXDA 3SKOA 4P5KA 2EE3A 2NW2A 2ZCLH 4FFYH 3BKCL 3W0WD 15C8L 1CVSC 4RCAA 3ZDYE 3VXPA 3P4NB 4GG6B 1GGBH 1Y0LA 3LV3A 3RGVA 2JCCE 1LE9A 3BW9A 1SM3H 5D7KE 3OAZK 4HWZA 4TTDD 3ZYZA 3BP5A 2XNAB 4XVSH 3VFRB 5I1EL 1TENA 5LCVH 2Z4QA 3WJJC 3LMJH 2I9TA 3HFML 5EU6E 1KC5H 1S9YB 4OJFH 5HGDB 2G60L 2APTA 5C6WH 3B9KA 3TPUB 4PYHA 1N2RA 1U42A 2NY2C 3LKOA 4NHCL 1KJMA 1TETH 1PDKA 4LLWB 4UQ2B 4XHJD 5DVNA 2ICWJ 4R4FL 1IARB 1BF2A 4HJJH 4TUOA 3CCHA 3QUZA 2V2WB 3P11L 5F97E 3DXAD 4JDVB 1YPZB 4K7FA 3SDXA 5CP3A 4XNQA 4HV8B 1G6RB 3BKJH 3EGSB 4X7TA 3VFWB 3K1DA 4K3EL 3GNMH 3VG9C 2QBWA 5IV2A 3TIDB 4P2OD 2W0PA 3NCJL 3TO4B 5HGHA 4FQQA 1N5YL 2IQ9L 4GW5A 4EN3A 4JM2C 1JWSA 1JZ2A 1A3LH 1J18A 4V1DA 5D7LD 5IB2A 5IVZB 5I1CL 1YZZA 5KW9H 4GRWE 3PL6A 1QPXA 3NIFF 2E6QA 1KEGH 4PG2C 4X6CB 1IQWH 4LCYA 4FTVD 1C5DB 4Y16A 4YHMH 3LOWA 5KG9A 1T5WB 1FN4B 4ALAL 4KRPD 1HKLL 1BZ9A 3S9DB 1I9RL 3ARRA 1YN6B 3QBTB 3C8KB 3AY4C 3QH3B 4G6MH 1UYWH 4UUJB 1S9XA 3QUXB 5DJZB 1KCRH 1J8HB 1Y6KR 5J6HB 2EDLA 1HYRC 4N5ED 4RZCA 3ARED 3KLHD 4K2UH 4WU7B 3EO9L 4HDIB 4ONFL 1E4XH 1UACL 2OR7A 3X12A 2EO1A 1NUNB 2H41A 1J5OH 2XKSA 1CI5A 5KSBF 3VXTB 2IANE 4APQD 1Z6JT 1KG0B 2LTQB 3MLXH 5IT2L 4LNRB 1F90H 3NPZB 1A7QL 3HB3C 1IGIH 1RUAL 5E2WH 1KTLA 4MNQA 3VRLE 1IC4L 1RZKL 3ARDA 5L2JB 1JF1A 3AS1A 5HGGS 3RZWA 1DL7L 4F37F 2CDGA 3EJYD 1JGEA 4ODSL 5T3XE 4YFEA 5I75B 3ARFD 4ODHL 4S0TD 5D2LB 4OZHF 5D72L 1I9JH 3RX5A 2NNAB 4H88H 4HJ0D 3S36L 3EOBB 1T22A 4NSKA 5AYQA 3CDGB 3TEUA 5EZJB 2DLEA 4BFEA 2Q7YA 1CU4L 2A83B 3GIVA 5D2NC 4ZUTB 1VCAA 3EYFB 3T3PF 1N6UA 3LEXB 2O93L 1VGKB 2H2SC 4KZDL 3HR6A 4PLKD 1K4DB 4I5BB 4NPYB 5ACLA 1H0DA 2DB8A 5TDPB 4OGAD 3FCTA 3HRZB 1JYWA 2YRZA 2ARJB 4HUVA 3GMLA 1ACYL 3PGDA 3B2UC 4JHWH 3LKQB 4RWYH 4ELMA 3PJSB 1BD2B 5FA3B 4X7CC 5KOMC 4NO5A 4P3WA 5I1LA 3S5LB 4OTXL 5IB3B 1JYVA 2K1MA 1RZFL 3MODL 3PWNA 1NKRA 4PJCA 4JVPA 5TPWL 3TCLA 4M3KB 5EORL 3DBXB 5B8CC 4RMUA 3CVHA 3K2MC 1FVDA 4R26L 4N0CD 2O5ZH 3FMGH 4DVRL 3LQAL 2BMKB 5IJKC 3VE0B 4U33A 1BVLB 5DYOB 3X3GH 5I16A 4DQOH 1BIIA 3C09C 4YEEA 3UZVB 4AEFA 3O4OB 4N0YH 1UADC 1WF5A 4LAJH 2APVA 3NFSH 1NFKA 3HNTH 1DSFL 3GSQB 3VA2C 3KPSD 4JFEA 5T1LD 3CPLA 1RIHL 1K5NA 2M26A 3MLWL 2HLFC 4XBGB 1KLGB 1JTTA 1MUJB 4QKXB 1S9WB 3HR5B 2Z8SA 5FB8B 4HIHA 5FUZH 4NP4L 4U1LA 1SJVA 1NGYA 3HZVB 4NQEA 2F8XC 4ZUWB 1Z9OA 4LSUL 2FWOB 4RDQG 5LGKA 4LSSL 1MCOL 2ILLA 4NJAL 2GJZB 4Y5VC 5E1AB 3GSVB 3P4MB 3NFNB 4QLRA 1MHHA 2DM2A 4LLYA 4YPGB 1JYXA 4XAKE 3RU8H 5L8KB 2G75A 3D85A 3OKKB 2PCPB 3G6DL 1XR8B 4OD1H 1FH5H 2BSED 5CGYC 5HD8C 2GQHA 4PJAA 3RIAK 1FORH 4AMKH 4PGBA 3HUJE 5BRZA 4R3SB 1T80A 2ZUSA 5SWQA 4ZXBC 1RUKL 1WEJH 2BDNL 4KWUA 4DK6A 1BJMA 4Y4HC 4TOYL 4PB0H 5MEOB 1WFTA 2CPCA 4HX1A 4E41A 3BO8A 3U1SH 5I1KL 4AK1A 2Z91A 1MRFH 4NFBA 4XP6L 1JNNL 1YN7A 5MI0B 3KPMA 3DRTB 3V5KB 5L8JB 1U93B 2VUYA 2LABA 3NA4A 4KJPC 2VH5L 5T3XH 3PP4L 5IVXF 2QQLL 2HRPL 4I18C 4YGAB 3EOYG 1U8HB 2XYCA 1AFVH 1OTTD 5DMIH 3D2UD 4ZFOA 4EI5D 3ABZA 3VD4A 4UILL 3BIAX 1D9KA 3GSXB 5EFIB 1I1AA 3C87A 5C0AE 5DEGA 3G5ZB 5IW1B 4IOFC 3WXWL 3WNOA 3KXFD 2KBGA 1NCNA 1J0ZA 1SBSH 3BEVA 1AXSA 1YYLH 3PDOB 5CUSL 1JZ4A 2DDQL 4UU9B 3DYMA 5D2NE 3PP3H 5GRJL 5IVNA 4DGIH 4UB0H 1D6VL 1JWUB 4OZFG 4PY7B 2V6HA 1I4FA 1Y6NR 5ALBH 3TJHD 3X13A 1G84A 1Q9WB 3HN3A 5T1KB 2F53E 3DV4B 1FL6B 5MHSE 2DMKA 5ID0A 4MS8C 1HCVA 4KJYB 5JUEH 4K94C 3BSZL 3BP4A 3SE3A 4C58B 2XZQH 4FQ2H 4RGNB 1KTRL 5L7XH 4Q74A 4KTEH 5C0JA 4K8RL 3U46B 3ALXA 5E08H 3V6ZA 1P7QA 5J3HC 4R7NB 4X6DA 3L3IA 3GI9L 5GHWL 4B41A 4RBPK 5LBSL 1H8SA 3QEGH 2VE6A 1RD6A 3TH2T 5J1SC 1NAMA 3MR9A 3VI3E 1TQBB 3AMKA 3MRLA 3GSUB 5DJAB 3IB4A 1PW3A 2WIIA 4X6BB 1V7ML 2VLKE 5C86A 4P5TA 2OSLA 1ZGLA 4K3HA 3KLSA 3VCLB 4GRLD 5FDWB 2BHUA 5TFSH 4FFVD 4Z7OE 4LSPH 2VLJE 4G5ZH 1FFNA 4KK6D 4FHBD 5FCUH 4P23C 5HGAB 1YEJL 3BP7B 1WZMA 4YR6B 1YMMD 2V5TA 3K3QA 4NGHH 5SWZB 5D6DA 4JDZB 3C60A 3MGAA 4WJ5A 5D1XD 4XP1L 5L2KE 4FFWD 3IRPX 1INEL 3KJ6L 4BKLB 3LS4H 3MCKA 1N6VA 2E5EA 2LQRA 3TWCL 2EYSB 5L0QB 5CD3B 1ES0A 5JW4Q 4CMHB 1FV1A 5FV1L 2Q7NA 3DO3A 2R4SH 3SGJA 3CX5K 5J4MA 3VFMA 4KRNA 3QIWB 5KZCB 1FE8L 5DRXA 4ISVA 2P5EE 2ZP0T 3QIBB 1QFWH 2OL3B 1RU9H 2HA1A 1PEWA 3P73B 4NQUA 1FNHA 4OZGE 3BPOC 1KLUA 4IDJL 4U31A 5D2LF 3WUZA 3PWPB 1KYOJ 4JM4H 4PLOB 4R4ND 5D1QD 5IHZA 1KPRA 1X5GA 3B6SA 3LKRA 2HJLA 5KVDH 3SCMC 4DW2H 2DI7A 5IMMB 4HW6A 3ZTNL 5EUOA 3NCFB 2R23B 4KJQC 5F6IB 1VKXB 3CGTA 5C08B 3TH3T 4OFDA 4PTTA 4POUB 1JJUA 4NKMB 2P8PB 5BOZG 5I15L 4UIMB 3SEPA 1RI8A 4OM1H 5A43C 1ZA3B 4M6NH 1JGLH 2C4FU 5KVFL 2DQDH 5HGBA 3T65A 1WT5A 1J1OL 1UM4L 4O51B 1NEZA 3NMEA 1E0OB 2I27N 5SV3A 1UM5H 2FB4L 1YA5A 3T8XA 2DI8A 2DIAA 3AVEA 2VL4A 1U41A 1K9TA 5J13C 3MROA 1A6UH 4IS6A 3W2DH 1F8TH 3Q3GB 5C09D 3C8DA 5GJSL 4ONOA 4ZD3H 2Q8AL 1LO5B 5DJDA 1AO7A 3RNKA 5D7IE 1G0DA 3HLAA 2WBJC 4WRLA 4ZAKC 2XZZA 3JTTB 2CO7B 3TFKC 2M8XA 3QEHB 1SEQL 5H94B 4XAWH 3LCYA 3VFGL 5DQ9B 4AM0A 1CTOA 4HKJA 3UZQA 4KAQL 1YEEH 2A6JA 3GM8A 4OF0A 4HFWB 3SKJH 5TQ2H 3DRQA 3MLUH 1XGUA 3MX0A 4Y5XB 4WO4A 3B8SA 4HAGA 5EZIH 2DQFB 4NQTA 3Q0HA 4FNLH 1NCDL 3RGVC 2WANA 5I6XC 5EOCJ 1CICA 3QCUL 1W0YT 4LDEB 2FYYB 1JFQH 4I3RL 3L3HA 1C12A 2AJXH 1A3RH 1U8IB 3EKCA 5FGCE 4NUGL 4M7KH 2N56A 2J2ZA 3B9KC 3I50L 2R29L 2VSDA 4YHYB 2VABA 4M48H 1MHCB 1MOEA 2V7NB 5FK9B 2EEAA 1CXHA 3PWLA 2MCPL 3UTQB 4XCEA 2VMFA 4BM7A 5DFWH 3G04A 3RWHB 3QUZC 1R24A 1XCQA 5DR5L 1LEGB 4HFUH 2Q86A 2WWKT 3LQZB 3G6JA 2HFEA 5DD5L 3VXRA 4HK3N 1KTKE 3VFPB 3KPRB 1GHFH 4JFHD 4YZFE 5IHUH 3OSKA 4P57A 1KJ2B 3D6GA 5IK3A 3CK0L 5HYFA 1HINH 4U6YB 4D0DA 2DM4A 5GGVL 1S7VB 5JDSB 1IQDB 1S7TB 1BECA 1C5CL 2X4SB 5I8OL 4NO3A 4NQCA 3OJDA 1FYTD 3PL6C 1IKNA 4ZUVA 2ZKHL 3V6FB 1K8DA 2IFGA 1RULH 4YIQB 4QF1B 5KAQF 4JZOB 4DGVH 4LVEA 3BGFB 3GMRB 4Y16C 1V3KA 5I1AB 1ZVYA 3SDCC 2FH6A 4MA7H 2V2XA 4MQXC 1X5ZA 2OMNA 3EYSL 2HT3D 4FXKA 1J8KA 5MENE 4J3SA 3FOMA 4A2MA 3EOAA 5E7BA 3ROOA 1YYML 3PV6A 2AJYH 1LDPL 1P4IL 2AXFB 3OKEA 1I8IA 2OR9H 1K85A 3VRIB 4AH2B 4QHMB 1A7RH 1DBBH 1AHWA 3BDYH 4X7SH 1ZSDB 1A6WL 5DEFB 4L8CB 4WW2F 3H42L 3ULUL 4XC3L 3P4LA 2NXZD 4LHUD 1F02I 1X4YA 4KKCC 3V52L 4MDIB 4O5LL 2F5AL 1Q72L 3ARDC 4YNYB 1NC4D 4MD0A 1WFOA 4YBLB 2Z93B 5EIQA 4M7JL 3BHBA 1TJGL 2QKIA 1EERB 3PGCB 4Y7MA 5DTFA 1WLHA 5EO0A 4CJ1A 3LD8B 1R3HB 3FO0H 4JR9H 1T2XA 4MMZC 3MREB 1S7XA 3CXDH 4PRDA 2AAVA 5GGSA 1IEBA 1Z3GH 2WLZA 5ICXA 1NGPL 4HKZB 5IB4B 4PJBA 4PJIB 4Y8AA 3MNVA 3D25A 4K8RD 2NY6C 4MD5B 5DD6A 2COQA 2O5XL 5GGTH 2ZZUT 4TSBH 4RAUB 3O11A 3ARZA 5DI8B 1UCBL 1R5IB 5HHME 4EDWL 5KSUB 2HN7B 1WIOA 1C08A 1OVZA 2MKLC 4K94H 4JFYB 1FZOA 1WAAA 4DEPC 4XPBH 1FL5B 4PY8J 4WHCA 4PJHA 2BVYA 4F7EA 2L0DA 1DE4A 4BZ1L 2OMBA 4YHOH 3FONB 2VZUA 3SKMA 3GKZA 2VSCA 1BJ1J 1TDQA 2AK4A 2FLRT 3TNNA 2EXYC 4XB7A 4U6VH 3MV9B 1RHHB 3SY0A 4LCUA 5IB1A 2ITDA 5CCKH 1C1EH 3BN9C 1MFEL 3KWWA 1WZLA 3H7BB 1HK6A 2OJEA 1RY7B 4M7LT 1ZXQA 5SWSB 1IZKA 4ELKA 3FZUC 3D18A 3SDXE 1L7IH 2IPKA 1XGTA 4YHNB 2X4OB 4JFZH 3IAPA 4G43A 3RTQA 1J9CT 2VXVH 5GRXG 3AS3A 1I7RB 5DVLA 4U6HB 4M43L 1A1MB 5I9QB 5KANI 1EVTC 4NKQB 5ITFB 1YEDB 4YAQA 5GPRA 1EHLH 1ZGLP 3LSOB 5HI5D 1RQ5A 4V1DE 1MHPL 2GFBA 3KYNB 2OP4H 1FFOB 3V9FA 2EXWC 5MEQB 1PY9A 1T21A 3FQRA 1OP3H 1YNLL 2OK0L 4JDTH 5I1GL 3WV0A 4G8IB 2EYTB 4YQXL 1JTPA 4HS6B 5I1DB 3MRQB 3O3UN 3LKNA 1NGZB 1HIML 5E8EB 3MC0A 3QUMB 1A1OB 4A6YB 1J0IA 4ZFFA 1KGCE 3SE4C 4MQSB 2MMXA 4ZQKA 3S37X 3WFDL 4R6UA 5BXFB 4UT9L 2B1AH 4HD9A 4JRXB 2AGJH 5A1AA 2Y06L 2YZ8A 2DTMH 3NPSC 2NY1C 2OTUB 3QSKB 1JMXA 3O6KH 3ARBC 2JIXD 4TVPL 4CU8A 1GIGL 3BKYL 4Q0XL 2WSKA 4U1GC 2CDEA 1HYSC 1A9BB 2Z8VC 2QHRH 4N8CL 1KIRB 1CL7H 2PW2A 3OKYA 4DVBA 4OLZL 3MGTB 1FNAA 4M93B 4U7SA 2X1QA 1A0QH 2NY0C 3QUYA 3DVGB 5FM8A 3RVVD 3RDTA 5BV7B 3GHEH 3TESA 3ZKNC 1KULA 1I7UB 2PYEE 3NIGE 1CWVA 4WI8A 5F93C 1RUML 4PREA 4L3AA 4XNUL 3MA9H 3WFCL 3BGAA 3BUTA 4TUJB 4N0RA 3CVIL 3BXNB 4OIIL 1AXIB 4XWOC 5TE4H 2VZTA 1D9KC 1BQLH 4KQ4L 4OCMC 4Z7UB 1DEEB 5HYJB 1I1AC 4KROC 1KPVB 3FB7A 4ODWA 1YEGH 1IAIM 1NDGB 2X4PA 4ZFGH 5AEAA 2FJGA 2CXKA 3KPOA 3RVXC 5BVJB 1DVFD 3VXNB 5HYEA 4AQOA 4V2BA 3BEWB 3PQYB 3F62A 4FZ8L 4L9LB 5DS8B 5JLZA 5CP7B 3RX8A 1MFBH 1W0WB 3ARYA 1IGYB 3K74B 4R8WL 3B9DA 4CNIB 3OAYK 1OAYL 1W0VB 3O0RH 2X9YA 4ELME 4AG4L 5I18H 1A6PA 3SE3C 1QSFA 4MB4A 1DZBA 3GUTA 3OAUH 1G0XA 2H6PB 5F71A 1MFCH 1KB5H 2EE9A 5E95B 4IEFB 4MJ5A 1G7QA 4MHHI 5DQJA 4JGJA 5DD1L 2E7LA 2NYYC 3OTTA 1I9EA 2YPKA 5BO1H 4MQ7B 2JCCB 2VXUL 4AZ8A 1GOFA 3ME0A 1FG2B 1AC0A 3UYRL 5CP3H 1DANT 3MRHA 3DUUB 3TBVB 1IT9L 4QRRD 5EU6B 5DMJB 4ESKA 1FZJB 1TVBA 4P9MH 3TZVA 4LCWB 4Z0XA 1RZJC 4IOIB 4DKEH 2FX8L 4WI6A 4UOJA 1JHTB 1S7QA 2EDBA 4P2QD 1GZPA 4HIJA 3AU1B 5BJTB 2Y5TB 3BPCA 1DQMH 3U4BL 3GK8H 3PV7A 3C60C 3BRDA 2CK0L 4JG1L 3MUHL 2CRIA 1HQRA 4P49A 1BOGB 1KACB 1EGJL 4F80A 5D6CB 1B4JH 3U9UA 4NQEE 3RWFA 1RURH 4JPKH 3AS2A 3N1PC 4R2GD 2J8UF 2VXSH 4LRNH 3NCCB 1WFNA 4PJFE 2B4CL 1NDMA 2XQYK 4JGMA 2AEPL 5D5MF 5I1IL 1RAMA 3NA9L 4EOWH 1KF9B 5I17B 2DQJL 4XBEH 1QUNA 4YX2H 3ULUD 1XMWA 1LVEA 5C9JB 4GRWB 3CMOH 4P46B 3TBTB 3ZYIA 1MLCA 2XXMB 2IFFH 3E6FB 4PJAE 5HHPA 1T5XB 3PHOA 5ISZB 4M5YH 3ARGB 3FN0L 3RA7L 4GMTL 3O4LB 4LCIH 4EXPX 2D7OA 4GBXA 4YK4B 3QXAA 1ZT4A 5DURD 2BY3A 1CFQB 2JB6B 1DQJA 5CKGA 5EOTB 5C7XH 2XN9A 2NZIA 4IRJD 2NY5H 2CMRL 4AEIL 3K46A 4PJ7A 2NX5B 2XI9A 4G9FA 5C0BD 1FFPB 3QXWA 5DO2D 4K71C 4PJDF 1BBJA 4NM8L 4XZUA 3BZ4B 5I71B 4ONGH 1J88A 1TCRA 2IANB 1A6ZA 1PQZB 4N68A 2A0LC 4U6XA 4PRPD 2AJVH 2HT2D 1BJ1H 3WMSA 1NLBH 1QKZH 1EHAA 1R3LA 4M4RA 4FQLL 3IF1A 2J3SA 2AP2A 4RX4A 4OLXH 1NCWH 1KFAL 2AKRB 3E3QC 3K4ZA 4AIOA 4XMKL 1E4KA 4WUUD 3SOBL 1A47A 1DDHB 3MLYL 3CZJA 5GGQL 2W9EH 3UPRB 2HTKC 1HWGB 5BVPH 1CR9H 1KCUL 4E5XB 5C0CA 3DX8A 1FNSH 4S11A 3OX8B 4WO4C 3IFNL 3L3KB 2ED8A 4G6FD 4KHTL 3E2HC 5CILH 2PXYB 1BWMA 1S78D 2Q3AA 4YGVA 2YD5A 5E6YA 1H8NA 1CICC 5GS2H 1G7MB 3CVHH 3Q2CA 4F15B 4HWUA 2DKUA 3QDME 5FHAH 3VWKD 5AD0A 1LHZA 3M8OH 1VADB 3EOTL 4NZTL 5L9DL 4R9HA 1DFBH 1OCWH 4U2YA 4LPYA 5F6HJ 3MRDA 2VDRL 1XIWC 3PWVA 3ZYJA 4PV9B 4YHKH 5TE7H 5INDB 1FIGH 1PFCA 5SV4A 1N7MH 4JRYD 4AL8H 3L7EA 4BSVB 3L1OL 4UTBL 4TNVF 4ORGB 2GAZB 4ZG1A 3VI4F 5I30H 2NY2B 3FN3A 3NACH 7FABH 4KZEH 3GBNL 1UG9A 5KSAB 2C7UA 4LU5H 5F1NA 4OCXH 4BELD 5I8EA 3DV6B 2E7BA 3G5VA 3MRGB 3P0VH 1AKJB 1NC2A 2H32B 3CFJA 4EZMA 2QSVA 3BMVA 2XOTA 4JO1L 1ZS8A 3VG9B 5DDHB 3P77B 1UA6L 3BYTA 3B43A 4F37K 4YLQT 1V7NH 5LAXB 4TVPD 3VDAA 3MLTB 4KMTH 2XA8L 2Y72A 1ZHKB 1IKNC 5IW6B 1SMAA 4RMTA 1HHJA 4BH7B 2FRGP 4OLUH 5AZEL 1LO0L 5ICZB 3UO1L 3GJEA 5AG9A 4UV7H 4ZS6D 2P42B 4YDVA 3HG1A 25C8L 1MRCL 1KNOA 4I13B 4LMQE 4P2CG 1MI5A 3KPLA 1BJ8A 4TULH 3L7FA 3TBSA 3O6FD 1QRND 3GM0A 3LN9A 2QLVB 5E5MB 3JVGA 2D2OA 4Z7UF 1OOAA 2ED7A 5JHDA 3ZHDA 3PHSA 4QRUA 3ZKSD 1Z9SA 2OJZH 3RWEA 4IRSD 3M45A 1AHWC 2C3HA 1YJDL 5ALCL 3HE6D 2WINA 4YXKH 3IS0X 2X4UA 1D5XA 1ORQB 5BMFL 4MJ2A 2UWEB 1T20B 2HVJA 4J12A 3V0VB 1J0JA 5C6TL 1T6VN 1PEZA 2VDNH 2R2HB 4O02L 4OD2A 2W59A 2YD6A 4D0CB 3FL7A 1RZGB 3DVIA 1N3NB 5CFHA 2OM5A 4WDIB 2P46B 3ISWA 4MZ2A 4ZODA 4RQQB 1DQTA 2FZ3A 5F9OH 1NSNH 5EC1A 3VFSA 3OKMB 2I07A 2XKNB 1AO7E 2YKLL 2FH8A 3O3DA 2W9DH 2DD8L 2VDMH 5FKPA 1QQDB 4N8VB 4X4MA 3TBYB 2YPVL 4D9RE 2FIKA 4QCIB 3E3QE 5IOPB 4KMLB 4U1KA 3HA0A 1L7TL 1OAKH 3H9YA 3ZE0E 5CJXA 1T89A 3L3OB 3DSNA 4H26A 1MAKA 5IB5B 3TV3H 1JUFB 5J1AB 3P4NA 4GG6A 1CYGA 4UBDC 4JKKA 4JVWA 5EH1A 5DMGD 4AEHH 4BH8B 4MJ6B 2P5WA 3T0EB 2XNAA 1OAQL 3VFRA 5F70A 4LSRH 4WWKB 4H8WL 5D71H 2VQ1B 1WWAX 1S9YA 5HGDA 1NAMH 3IDJB 1T1XB 3UJIL 3TPUA 3X3FH 5KS9F 1HOCB 3UJTH 4LLWA 4UQ2A 4S1QH 1CFBA 1RZJH 5ITBH 2Z31D 3S5LG 4KPHH 3IJYB 5JHLL 4OCLC 2MOVA 2V2WA 4MJID 4JDVA 1YPZA 1NGWB 2BK8A 3QWQB 2E9IA 4HV8A 1G6RA 3EGSA 3G6JE 4HCRL 3VFWA 3RTQC 3REWB 3VXRE 3GBLA 1U3YA 5HHOB 4WV1B 3TIDA 2EEDA 4IMKC 1SVCP 1AIFB 2FATL 3C09B 1AGCA 1YMHB 3VDCA 2CRYA 1PGRB 3TO4A 4I0PD 4GQPH 4LL9A 4LPUA 4GAFB 3C6LB 1FVEB 1MIMH 1CGYA 1UT9A 2IMNA 2WNGA 4HUXB 5F7UA 3QDGE 5IVZA 4LDOB 5HBBA 4Y4KD 4NQCE 1UXWB 1IBGL 4B7IA 2Y9RT 1TITA 1DJSA 3QFJB 2BNRE 4X6CA 4Z78B 1JGUL 3V4PL 4X7FC 3CUPB 3PXJA 1GGYA 5L2KB 1C5DA 3SDYH 1FJ1B 3AM8C 4M3JA 3NH7H 5E4EC 5HHXL 1GPOL 1T5WA 3TM6A 1FN4A 1NBYB 5IFAL 5FOBB 4X83A 1P1ZB 5JPMB 3VW3H 1YN6A 1TZHB 3QRGL 3C8KA 3FFCB 1CLOH 1EFXB 2K7PA 3QH3A 2A77L 3Q6GH 4UUJA 3QUXA 4C83B 1EH9A 3I9GL 4LQFH 5DJZA 4ONHB 1J8HA 3WD5H 1KPUB 5J6HA 2RFXB 2QSCL 3TGXA 4WU7A 4HDIA 2KUTA 2UZIL 1M6OA 4WTZG 1T66C 3U7WH 3DURB 4O4YH 3VWJC 2XA3A 4OZGB 3SQBA 3VXTA 3ECBB 1KG0A 3T77B 2ZCLL 3T2NH 2HFTA 4FFYL 4MNGB 2WQ8A 2ZPKH 1T0MB 3HCVB 5GZOC 3IDYB 5DHVB 1GGBL 5L2JA 4ZXBB 5T5FH 1SM3L 2YR3A 3RDTC 3ILQC 1KEMH 4XVSL 1IAKB 2KZ1B 5LCVL 5F1SA 3LDBC 3LMJL 2H3NA 1KC5L 5HYSB 4OJFL 2EE2A 5D2LA 5E2VH 2DQHH 2QR0A 4HWBA 3VXSB 5IIEB 5JA9A 2I60H 4G6AD 5TGBB 1NCBH 2NNAA 1TETL 4I18B 5KAQG 3EOBA 3MLRH 2R0LH 5EZJA 1PKQB 4HJJL 4WEMB 3H3PH 3LHPH 2A83A 4ZUTA 3MLPA 4POYA 2ID5A 1VGKA 1K4DA 4I5BA 4NPYA 5GGVY 2YWZA 3BKJL 4NO0B 1WAAE 1X44A 5E8DH 5TDPA 3GNML 2YMXH 3S34H 3I84A 3HRZA 4NRZB 3RIFF 2FO4B 1ZHLB 2HJFB 4PJHE 2HJKB 1XGRB 4CVUA 3LKQA 3PJSA 1BD2A 5FA3A 5DUMH 3MA7B 3S5LA 3O2DA 2AK4E 3OB0K 1A3LL 3DBXA 3OWEA 5KW9L 1JF6A 2P24B 4L8SB 5JW4R 1EO7A 1KB9J 2NY4B 4FS0A 2E7LC 2ITCB 1KEGL 3I6LD 2GJ6B 4YDIH 1IQWL 4F8QA 1EXUB 2BMKA 4YHML 3VE0A 3LS5H 1BVLA 5DYOA 1VEOA 4YHZH 3NGBC 1BOYA 1FGNH 3ULUF 3IAQA 4DUVA 3EYQD 4G6ML 1UYWL 3TZVC 4B7LA 4OLYH 5IJVB 3QPQC 5E70A 4UT7H 4ZYKB 1KCRL 1K4CB 4PJEE 4K2UL 5IQ9B 5SX5H 5FUOH 1J5OL 3QXDB 4XBGA 1KLGA 4QY8B 3MLXL 1S9WA 3HR5A 3CXHK 2DOCA 1F90L 3UX9B 5FB8A 1IGIL 5E2WL 5A2LH 1JGDB 3HZVA 2BFVH 1KBGH 3AAZB 5HVWA 3NBNA 4MXVE 2FWOA 1XF2B 5AAMA 5JZ7C 1AXTH 1HZHH 4WHYH 4PP1C 1FRGH 2EDDA 3CFEB 2GJZA 5ADOH 5C0EB 5E1AA 3GSVA 3P4MA 3NFNA 4G9DB 5IF0B 4YPGA 4LLVB 1A4KB 2FHFA 4WTZA 1GVIA 3ZE1E 3OKKA 2PCPA 5HSFA 1XR8A 1I9JL 4HBQA 4TVSa 3FB8B 3P0YH 3WS6A 4H88L 3V7AG 2BSSB 5FYJE 3SKNB 3TVMD 1MCHA 1EUTA 3MV8D 5FYKH 3K8LA 3D48R 4R3SA 2MPAH 3S35H 4ZTOH 5EU5A 2R1XB 3BPOB 1X5FA 2VYRE 4XNXH 4HEPG 2B0SH 4LLQB 5MEOA 3F8UB 3JUYA 4FABH 1X5XA 1U9KA 3V79C 3TYGH 1ULVA 5DA0B 5I76B 3WIIH 1MCBA 3DRTA 3V5KA 1PG7X 1U93A 2RJMA 3J8F7 4UT6H 4JHWL 4RWYL 2V9RA 4BQ8A 2EH8H 1U8HA 5IUSA 3QDJB 4LCCB 4ZO8A 1IAIH 3GSXA 5EFIA 3G5ZA 5IW1A 2O5ZL 3FMGL 4IOSD 4X8JB 3PDOA 5J13B 4QHNB 3X11B 4NWTH 1O7SA 2MQCA 3X3GL 4PJ5D 3BH9B 5E9DD 4DQOL 1JWUA 4PY7A 3ZKMC 2DM3A 1E4KC 4RGMC 4N0YL 5I73B 1I1YB 4X5WB 1A8JH 5CZVH 3NFSL 3P9LB 1F11B 1NCCL 4XPTH 4ZAKB 1KN4H 4NZUH 5T1KA 2W0KA 4Z5RB 3HNTL 4L4VD 3DV4A 2X40A 1FL6A 2ZCKH 5IMLB 4ZO9A 4J3TA 2BOBB 3FT3B 3OG4B 1CXEA 4KJYA 1SYVB 3RVWD 5DFTA 3IJHB 1QSFE 5HHMB 2ORBH 3CNKA 4W81A 1WCBB 1U95B 3U46A 4Z8FH 5EZOH 1UVQB 3MV7B 1TPXB 5FUZL 4JHAH 4R7NA 3KJ4C 3UTSE 3VFOB 4BFIA 2NMSA 1ZLSH 1YNKH 2D0FA 5B38B 2X89D 2H1PH 4M6MH 2GCYB 3QZWG 5DJAA 3GSUA 3RU8L 2CIIB 2OXHA 4X6BA 4GG8B 1U2CA 1P6FA 3VCLA 2C1OB 1A14H 4OD1L 2JK5B 1FH5L 2VAAB 4KDWA 3B8YA 1OTUC 3LRGA 5CLWA 3LZFH 2NY3D 3QI9B 1FORL 4AMKL 5F88B 5HGAA 3BP7A 4YBQD 4YR6A 4LIQE 4POZC 5SWZA 3CCHB 4JDZA 4Z0BH 1JPSH 1WEJL 7CGTA 2UUDH 4PB0L 4KZDH 5D7JB 3RWIB 3U1SL 3IKCB 4F7PA 5K9OB 2EYSA 5CD3A 1MRFL 3RX7A 2EIDA 5L88H 1G0YR 2XQBH 1G7PB 3ZLQC 5E00B 4NT6A 5K33A 5T3XL 3I75B 3QIWA 4BQ6A 2VLRD 5FFLA 5K59E 1HWHB 2V17H 1AFVL 4Y2DD 3O45A 3QIBA 5DMIL 2OL3A 1U0QA 3RGHA 3P73A 1PVHA 1XGPB 5FYJH 6FABH 4IIQC 3MJ7B 3ZDZF 5CJ5A 1MQKH 4PJ8B 3FB5B 3RKDC 3PWPA 4Y1AD 1IJ9A 1N26A 4FG6D 2VLLB 1SBSL 1YYLL 3ZYOA 1NMBH 2CUIA 3LIZH 5IGXH 2B39A 5J57B 2Y4SA 2W91A 4DGIL 4UB0L 3SDCB 2XFXB 1RFDH 2QHLA 5IMMA 2R23A 2L7JA 4DTGH 1VKXA 5ALBL 4J3WA 5C08A 3IVKB 2J8OA 4NKMA 2P8PA 2X7LB 4PJ7E 4UIMA 2HVKB 3QIUC 4G9FE 1AGBB 2X9WA 5F7NC 2EC9U 4HXAH 4GJTB 2H26B 4O51A 1IM9D 1EX0A 2CK2A 2M2DA 5D1ZB 5JUEL 4WFGE 2XZQL 4FQ2L 3I3DA 5D9SB 5L7XL 4KTEL 3WHE0 2WAHA 3D2UA 5E08L 2IAMB 5JXEC 3Q3GA 5E24E 3IDGB 3VDBA 3TN0B 5T3ZH 2VZ3A 1LO5A 3QEGL 5HHNB 1JNHB 2VIRB 2PYEB 3QEHA 2GYSA 4FZEH 2HTLC 1MCWW 5H94A 4Z7VF 2CLVA 4KK5D 3G5YB 5DQ9A 1H8OA 3TNMB 2GSGB 5DJ6B 5TFSL 4EVNB 3IJSB 1URLA 1T89C 5C0CE 4BFGA 4LSPL 4Y5XA 4G5ZL 3GEWB 5FCUL 3IXAB 5ILTH 1P4BH 4NGHL 2YPLE 1W72B 3E1F1 3O9WD 2FYYA 3VXME 3LS4L 5BS0D 4MDJB 5FGBA 3HNVH 1U8IA 1EO8H 3QG7H 4M5ZL 1OGAD 4M02A 2R4SL 1WCQA 3SGEH 4HIIB 1VACB 2YK1H 2AABH 2PTTB 4L4TB 4NO5B 3T3PE 3RY5A 1UKTA 1V3MA 1MHCA 3QJFB 2V7NA 1QFWL 1RU9L 3PWNB 4NN5B 1DLHB 5FK9A 5EOQH 3D39B 3UTQA 3RWHA 4GUPB 3TA3D 4P0DA 3FRUB 1LEGA 4O2FB 4DUWA 4LIQH 3LQZA 2W65B 4JM4L 5KJRH 4KI5C 5CIPB 3VFPA 3CMGA 2AEQH 5KVDL 1ZOXA 3GMNB 1KJ2A 2JJVA 4S1RH 4U6YA 4IRZH 3TO4C 1JTOA 5H2BB 1HH9B 2L4OA 3TYFB 1S7VA 4OM1L 4Y4FD 4K7PX 1IQDA 4OI7A 1S7TA 3ZZ1A 3HI1B 2DM7A 4M6NL 1JGLL 2DQDL 2FEDD 2X9XA 3V6FA 4FQHB 1UM5L 1P5UA 4G6JH 4YIQA 4QF1A 1LILA 2R0ZH 1XF1A 4JZOA 4JPVH 3W2DL 1A6UL 3HG1E 1F8TL 3GMRA 5DA4A 3FAXA 5AG8A 5I1AA 3LRSB 4ZD3L 3BD5A 4MSWB 3OQ3B 4OBSA 4YFLI 4C56B 4WNQB 3IGAB 1OAXH 3L95B 3QUXC 3BIBX 4PJFB 4PLJD 5JHDE 1T6WA 2AXFA 1MHHB 5KVEH 4XAWL 4D3CH 3VRIA 4J4PA 4QHMA 4AH2A 4F33B 4UNUA 4XCYB 4WIQA 1YEEL 3F6LA 3SKJL 5TQ2L 3MLUL 4XP9H 1ZSDA 4MJ4A 4QRPB 4UOW1 4L8CA 3STBA 4OCSH 3ARBB 3GJFK 1Y6MR 5EZIL 4MDIA 4U1GB 4FNLL 3JV0A 1AGDB 4JY5H 3HI5H 4YNYA 4LLMB 1I3GH 2P49B 3PGCA 1JFQL 1EV2E 3D3VB 1R3HA 2XY1A 2AJXL 1AGFA 1A3RL 4JY6B 4UV4H 3MREA 4JB9H 5HTSA 1NBVH 3F7VB 4M7KL 4LHUG 4X4ME 2AXGB 5IB4A 4Q58C 4PJIA 5AYUL 2J5LB 1FE8H 4M48L 4QXGH 4MD5A 2CIKB 1VSCA 3QG6B 4PJ9B 3BPLB 4RAUA 2PF6A 4XTRC 2R0WH 3B4NA 5DI8A 4FN0A 1R5IA 4KK9D 5KSUA 2HN7A 4HFUL 2ERJB 4WUKH 4JFYA 4XWGH 2D4FA 1EAJA 1F2QA 3RP1A 1T3FB 2P47B 4GG6E 1FIEA 1AXSB 4H1LB 3UTTB 1GHFL 4LHJB 5IHUL 2P5WE 4R4BB 5HI4D 1HINL 4N9GB 3FONA 4Z9KB 1J0YA 1GOHA 2EDRA 4O9HL 3MV9A 1RHHA 1H9VA 3CIQA 1UFUA 3AMLA 5B21A 3T09A 3SKUD 2A6KB 2E3VA 1RULL 3DYOA 4DGVL 3H7BA 3MJ9A 3DMMD 2DMCA 5BZWB 5SWSA 3QDMB 4MA7L 1FPTH 1EAPB 2CQVA 4YHNA 3O4OC 2X4OA 4FRWA 1RIVH 3U7YH 4N1CA 4KI5E 4BZYA 3B2VH 4H25B 5DGRA 3RBGA 3KLDA 4M7LH 2AJYL 1YQ2A 3IYLW 1VFBB 1OAZL 2HMIC 2CD0A 1I7RA 2OR9L 5EU3A 4U6HA 1A1MA 1A7RL 1I3VA 1CDHA 1M71B 4Z7QF 1DBBL 5E5RB 5ITFA 1YEDA 3BDYL 3UTZB 4NOFA 2GSIB 4X7SL 3DVFA 3LSOA 4W6YB 3KYNA 3V95A 1FFNB 1FFOA 3LQMA 4PRID 5MEQA 2EKSB 3F7QA 2K9UA 5DGQA 2ADJB 5IP4A 4ACPA 2ICWI 4WJ5B 1U8JB 4G8IA 2EYTA 4Z7NF 2HAZA 4HS6A 5I1DA 2D4DA 2C4XA 3MRQA 3UYOD 4XVJH 1NGZA 2YWYA 1IEHA 4Q6IB 5E8EA 3QUMA 3BDBA 1A1OA 4A6YA 4L1DA 3FO0L 4JR9L 2AVGA 3CXDL 4KRPC 5BXFA 1NGXB 1TZIA 4JRXA 4QHLB 2Q8BH 2VISB 2BNQE 1Z3GL 4P2YA 1ZLWH 5J11B 3UMTA 3WS6C 4H0IA 4Y0GA 3VMNA 1KOAA 2OTUA 1J8HE 3P0GB 4NZDA 4ISVB 5DRXB 1YQVH 4NNXB 5GGTL 5CEZE 3ZE2F 4TSBL 4HULB 1A9BA 2DJ4A 1KIRA 4X4XB 4I0CC 3C6SB 3WDJA 2DQUH 4K94L 5FEBA 1EEZB 5HDBF 3QHFH 4XPBL 1R0AH 4OLWH 1EK3A 3DVGA 5MI0C 4HPYH 1I7UA 4DN4H 2Y07H 4J6RH 4YHOL 5GGVH 5HVHC 1M7DB 3HPJB 3KYOB 5E99H 4D8PB 3EJYC 4U6VL 4TUJA 3HMWH 5LQBH 2DKSA 5D2LE 4JM2D 1NUFA 3BXNA 1DEDA 1ZT7B 3T2PA 3VGBA 3CAFA 5CCKL 1C1EL 1I3RB 3OZ9H 4Z7UA 5IWLC 1DEEA 1EUUA 3CFIC 3FHAA 5IFHH 5HYJA 3MRCB 1KPVA 4RRPG 4TNVK 2DBLH 3BQUD 4OZFB 3NZ8B 4S1SH 1NDGA 4ZNCD 5BVJA 1L7IL 3VXNA 5DXWA 5JOPE 1KIQB 1UB5B 3BEWA 4JFZL 3PQYA 4PLKC 4WW2C 3QRFM 4L9LA 4ZOEA 1DBMH 2Z92B 5CP7A 4RMQA 1W0WA 3BVNB 1PY4A 2FGWH 3LB6D 5J6GB 3MLVH 4CNIA 1W0VA 1CLCA 1BD2E 5E56A 3LEVH 5K9QG 1EHLL 5GGRY 3W9DB 3DIFB 4LDLB 1A6WH 5E7FA 2H6PA 3VFVB 2OP4L 4JCLA 3HB3D 3BRGC 4MQ7A 2JCCA 4JDTL 3UAJC 3NCMA 5E2TH 3BWUC 1XT5A 1FG2A 1A7NH 4JANB 4PGCB 1G6RH 3HE7D 4LSTH 3DUUA 1TQBC