3GHEH

Crystal structure of anti-hiv-1 fab 537-10d in complex with v3 peptide mn
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
222
Chain Sequence
QVQLVQSGGGLVQPGGSLRLSCVASGFTFNNYWMSWVRQAPGKGLEWVANIKQDGNDKYYVDSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYFCAREFSSYTDHLEYYYDYYYMDVWGKGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of the cross-reactivity of genetically related human anti-HIV-1 mAbs: implications for design of V3-based immunogens
pubmed doi rcsb
molecule tags Immune system
molecule keywords Fab 537-10D, light chain
total genus 42
structure length 222
sequence length 229
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheH01
3GHBL 3O9WA 3LHPH 4U6HA 1UGNA 2QSCL 5IBTH 4YHML 3QQ4B 4B0MM 1I1FA 5HHOA 1QFWL 1CL7I 1PYWA 2GKIA 3IDIA 1HEZB 1KJ2B 3PL6B 4HPOH 5HGGS 2V5MA 5L2KE 4XCFL 1NFDE 1G9MC 2Z35B 4NZRL 3JWDL 4JFXA 4P59L 5D1ZD 2GT9A 2EYSA 1G6VK 4PRIE 4QRPB 2AQ3A 5AWNH 1WF5A 1M7IA 1OY3B 3OX8A 5GGSA 1JRHH 1XCTA 2DQFB 3EJZC 3VGAC 5BJTA 4CMHB 2BNRE 3X3FH 2X4SB 1OPGL 4KVCL 4PFEA 3MRQA 1VEMA 3EJYC 43C9B 1JYWA 3QHZL 4P4KB 1TJHL 3RZCA 3SY0A 1T03L 2IMMA 5E9DB 1CIUA 4PRID 3OWEA 4RZCB 4M1DL 1A0QL 4K3JL 5LWYL 4WO4C 5D2LF 5HVHC 4OLXH 5F1SA 4ZOCA 4I48B 4AYFA 3ARGC 2YMXH 3FMGL 4WFFD 4R4BB 4ISVA 4JG1H 4ZDHB 4RAHA 1DDHA 1FVCB 4Y2OA 3CSPA 1A1NA 1UVQB 5E5RB 2P5WE 1MJJB 5DUMH 1S78D 5B4MC 4PJ5A 3TZVB 1XGQB 4H88L 3VXOB 1ONQA 1AGCA 5IHUL 1CTNA 2H2SD 3IJHB 3RZCC 3TBVA 5C0CB 1UKTA 5CEYA 2BOBB 5FEBA 4UT6L 3JWOL 3RPIA 3T77B 5BRZB 5JPMA 4QOKD 4YPGB 2DQGH 1NGWA 4IOIA 5HI5C 1MNUH 1XGRB 5DC4B 4ZUSA 4LASH 3BPNB 4WWKA 1UKQA 4FQ1H 4RFEA 1CIDA 5DK0A 1EMTL 4G6JL 1IKFH 2IBZX 4ZFOB 1F11A 4JGUA 1HOCA 4XNQB 3KXFA 2VZ3A 5CGYD 1XGPB 4W81A 3KWWB 5FYJU 1AHWB 3QO1A 1EZVX 1UB5B 1T3FA 4HJGA 1JGUH 3UXFA 3WFZA 1HQ4A 3SCMB 5IJKC 4HT1L 1TVBA 3TVMD 2YWZA 4J4PA 2PW2A 4R2GD 1U6AL 3DVIA 2ED7A 5CS7A 4CJ1A 2AQ1A 4Q58C 4M7KL 3MOBL 2R69L 3U9UB 1UH2A 3CX2A 4PRHA 3BIKB 3U2SB 2WBJA 5HDLA 4E9LA 3WNNA 3IJHA 5SWQB 1MQKH 3PDOA 4JFQA 3BMVA 1MF2H 4O2CA 2PYEB 3MZGB 5CP3A 4XP9L 4XVTH 3VH8B 1FGNL 4Q74A 1J1PL 3FB6B 1CL7H 4S11A 1JWSB 1ZHKB 4JFDA 4GRWH 2DQIH 3DV4B 2A6KB 3O9WD 5DK0B 3GSRB 5TDOB 5EZJB 1JUFB 4QHLB 1JGLL 1CZ8H 3PJSA 5DT1H 3O81A 4N68A 4IHOA 1Q0XL 3AROA 4E5XB 4JO3L 1EHLH 1UA6H 3ARQA 1ERNA 3DBXB 1GIGL 3DX7A 2PF6A 3C08H 2FIKB 3P77B 4Z7WF 2ARJQ 2X4UB 3DROB 2HLFC 4P46A 2NX5D 4OZHB 5IKCB 3WHE0 1U8MB 1A64A 4G43B 4JRYB 5EIIA 1G84A 5T1LD 3QEHA 4WFGE 5FAAA 4N0CD 4FMKA 3QCVH 3MUJA 1CFQB 3RNKB 5DQ9A 3SDDB 3G6JF 2BNUA 1JN6A 4M4RA 1XH3B 3TZVD 4QXWA 4JJ5A 3HS0A 2F5BH 1SEBA 1X5YA 1QSFB 4WDIA 4OCXL 4M7ZB 3LAFA 4OCLC 1MCLA 5FGBC 1DQTA 1RFDL 1HCFX 1CTOA 1Y18A 5L9DL 3MLRH 4CVUA 3DGGB 1S7XA 3T2PA 5HGHB 1X4YA 1SYSA 5D4QA 1OAYH 3I3DA 2XOTA 1U91A 1DVFC 3Q2CA 2NY1C 5DS8A 1NGYB 2CIIB 4FQIL 1FYTE 5KJRL 1MJJA 3MLTB 1WZ1H 1UEMA 4KU1A 3DI2B 4GQ9H 1CXLA 4U2YA 2G60H 5JW4M 3VD4A 5LXGH 3SGDH 3S4SA 3AB0C 1C12A 4NCC2 3RTQA 5CP7A 1FNEB 3QCUH 3TC9A 5M95B 4NJ9L 3C60D 4PREA 5D7SH 5T3ZD 4PJFB 5B8CA 2ARJB 2F53A 3LZFL 3QQ4A 5CJ5A 3KXFD 4QYOA 3B9EA 4RA3A 5DJ6A 3CFBB 4YK4C 3TA3A 4OLYH 1MUJB 3ZDYE 4LPTA 3LMJL 3FO9B 5ISZB 2X5PA 2AJ3B 4LNVA 4JQXA 5FV1L 3MRMB 1NBVH 1KTRL 1DQLL 4H8WC 1G7LA 4E42A 4EVNB 2VE6A 3D0LB 3O3BB 3G5XA 3VG0H 1CF8L 4KI5C 1NGYA 2CIIA 2D0HA 5J6GB 4NRXA 5BQ7A 4RNRB 2AI0L 4CVZA 1MWAA 4KV5E 1QFPA 2W9DL 3MLTA 4ZOBA 4GT7A 5JOPE 2QQLL 4LGSB 3ULUE 3HPJB 2ADGA 3BEWA 3O2DL 3QXWA 5EU4B 5JIPA 1EUUA 3PDOB 2JIXA 3E6HA 1CDYA 5I1KH 1M71A 1BD2E 5DZOA 1S9XA 4H0HB 3EKCA 4QRSB 2ARWA 3QA3A 5CSGA 3V52L 3AS3A 3INUL 4APQD 2YC1B 1FFOA 2EXYC 3RY6A 4OD3L 2IH3A 2ZUUA 1FJ1B 4OQ1A 4YR6A 1BP3B 1HK6A 5FK9B 4RGND 5ACMA 5FV2A 1FFQA 4NJAL 4DN3L 5A43C 3BX7C 1NBZA 1FNSH 1DZBA 1V5JA 4NQCB 4TUJA 3WKMH 1EH9A 1MRDH 2Z31C 4OFDA 4Q9RH 2APVA 3V6OA 4IOFD 3U2SA 4YXHH 1NLDL 3MRCB 5EA0H 1Q9WA 5CLWA 3QIUB 5JIIA 3EDDA 3EOTH 4J3WA 3VD3A 4DGIL 3HG1A 2J8OA 5DD1H 4NUGH 2HFFA 5IB4B 4GG8A 3BUYB 1A6TB 3GZKA 3O3DB 3K4DA 5E2WL 5TDNB 3ZKQD 1GC1C 3RVTD 1UWXH 4XP6L 1LO5A 4KHXL 3HAEA 4LF3B 2ESVD 2W60A 3TYGH 3B6SA 4LHQB 3NFSH 4GRWE 2B4CC 4XCEB 5HYQB 3NTCL 3FAWA 3W0WE 4M7LT 4L4VB 4JY6B 4FXKA 3SN6N 2A73A 5DQJB 2FEDC 2RCSH 3BEVA 5T5NF 5B3JE 3NCCB 4YR6B 3PXJA 3QULA 4LLYB 1KPRA 3SE3C 2X7LA 3BN9D 4Z95L 2ADFH 3F7YB 5E94A 2JCCB 4FZEL 2ICWI 3AFLA 1A3RL 3PE9A 1MCQA 2CKBH 5GGVH 4RSVA 2YEZB 1CS6A 5D1XA 5ESQB 3H7BA 2BNQA 4OV5B 1FO0L 3DARA 2G5BB 3F12B 4JGJA 2HKHL 3TN0C 1MFAL 5C0ND 4LCYA 4KPHL 2XN9B 3ZHDA 4LEXH 3F8UB 5D1ZA 1PAMA 2NY0D 2CKBA 3V6ZB 1OTUD 4GRLD 2B1AH 3NIDF 1D9KC 4NM4L 1FVDB 2W0FB 3ZE0F 2FD6L 4QYOB 2BJMH 3JZ7A 4G7VL 4OZGF 5KW9L 3CFCL 4IDLA 2R56H 1Z3GL 4PG2C 1OW0A 2NY7H 1VHPA 3GB7B 4ONFL 2VTFA 4LLMB 2YPLA 1YNKH 1KOAA 1S9WB 3C60C 1F58H 1P84K 2XY1A 2DBLH 1T7VA 5L7XL 1F90L 2AJYL 2P46B 2YPKA 1AD0A 3VWJB 4NBZB 4X0KA 5DHVA 3SBWC 1NUGA 2QQQA 1H3PH 2UUDK 1NGXA 2HFEB 3Q5TA 1FL5A 1C12B 3NH7L 1DQQB 5FYJH 3PWJB 4RGOL 3JTTB 3QDGE 4X9IA 2DJUA 4LVHB 1EEQA 3FRUB 5A40E 1DSFL 5DJ2B 5F6IC 4JHAH 4I0CC 3QIWC 4JM2B 4WDIB 2P5EE 4XVUC 5EFIB 2GTZB 4APQA 2R0WL 5KS9B 3PHOB 3LS4H 1N4XL 3OAZH 4ZD3H 1F58L 4YH6A 3PP3K 1E27B 2V2TA 3P3YA 1FAKT 1W0VA 3MGTB 1KTLB 2NY7L 2DAVA 1G7LB 4E42B 3O4OB 4IMKC 2NY6B 4DZ8A 5DLMH 3LQMA 1JWUB 1OAKL 1KNOA 4PJDA 3E6FA 3BWAA 5C7XL 2DQJL 4HMEA 1I9IH 2YD3A 4Y8DC 3EYQD 2RBLA 5CJXC 4CVZB 1MFBH 3DRQA 4P2CG 2I26N 3KGRA 3O2DA 5T3XD 2GQHA 1ZKAA 5T3ZH 1KTDB 3DURB 2VB5A 3HZMA 3I50L 3QWOB 4TYUA 2FWOB 4GW1A 5IROC 3SQOL 3L5JA 2Q6WB 1KEGH 5ANME 5GRVL 5DDHB 5C0BD 1CDHA 3IJYA 3CX5K 2JJTC 1BX2A 4YNYA 2UWEE 4JPWH 1ZLVK 1IM3B 4MXWL 3EYVA 4TOYH 5FCUL 3L6FA 4GAFB 4Y1AA 3KPQA 4P9HL 3O6FD 1EK3A 5GRUL 1OVZA 5I2IA 5DA0B 4BK4A 1NUDA 1HDMA 1A14L 3MGTA 3NFSL 1LNUB 3MJ7A 4HEPG 4Z78B 1B6UA 1YEGH 4Z7QF 2C1OA 2HJKB 3TH4T 1R5WA 3KPLA 1DUZB 3IGAA 3ULSA 1PBYA 3EHBD 5I18L 3MO1A 2YZ8A 4NUGL 1LK3H 4XBEL 2BNQE 2IAMD 4KAQH 4NKDA 4MB4A 5C0BA 1T5XA 4UIKH 1N8ZB 5EC2A 5KSAC 2ZG1A 2P5ED 5E9DA 1QBML 2X4RB 1CQKA 1NLDH 2L4OA 2W60B 4A2MA 4WEBH 5L7XH 1IM9B 3PWVA 4ZFOL 3G6JE 2XN9A 3QR2A 1QO3A 4YHPB 5AD0B 2OQJA 4YHNA 4QXGL 2G75B 4GKZB 3I6LE 1UADC 2R39A 3FFCE 1S3KL 2AK4A 3KJ4B 1OT2A 3TN0D 1HHKB 4P46D 4XC3L 4X4XA 1HHJB 3IKKA 2Y1VA 5GGUA 5E4EB 1R3IL 1A6ZB 2XTJD 3OR7B 3INUH 3PWLB 1B88A 1GH7A 5DRWB 4BK5A 2OS7A 4EDWL 4I0KA 2AV1B 1IFHL 1RUAL 3RWIB 1R6VA 1N7MH 3LKSA 1KB5H 3ARWA 5D2NE 2JE8A 4OM0H 4EI6A 3GFUA 4JE4B 1EJ6A 3EW3B 1C5CL 4FRWA 5D1ZC 3HI6H 5KS9F 2CUMA 3S34H 4O2CB 3BD5A 3I6GA 3NN8B 3O6LH 3RU8H 1ACYL 3QDGA 2XTJE 4OTXL 1FPTH 5TQ0L 2R1WB 2RCSL 4UILL 3QCTL 2G9HA 2R4RH 1DBAH 4GW4B 1NBVL 2FJGB 4X4ZA 3FCTA 4MAYB 5ECJE 2I5YL 5F88B 2C3GA 1VPOH 2A83A 5D71H 3RHWF 1NBQA 2BSRA 4HH8A 3EO1A 4QT5B 3FT4B 2VR9A 5EO0A 1A9BA 2HFEA 4Y7MA 1KG0B 1LD9B 5EUOA 4QGYA 3UJTL 2V17H 2JJWA 4WENB 2QQKH 3QUXC 4WFED 4WY7L 3RWIA 5KN5B 3VW3L 1XIWC 2AP2A 5KVDL 1WZ1L 3U82B 3OHXA 4LIQE 3JUZA 5K33A 2D7MA 3O6FC 4UTAL 1CFQA 3HNVH 4Y1AD 2EC9U 2VRAA 4YDJB 1F2XK 2CDEB 1WEJH 1F3DH 5I74B 4JY4B 2XZCH 4D3CL 5EO1B 1K85A 2BMKA 2EDBA 3TT3L 1GGYA 3RU8L 2YD8A 4Y16C 3SDCC 1IT9L 1YN7A 5KVGL 3PGFH 1WZKA 4QRRE 1CU4L 1ZGLP 4XNMA 3V4VL 3QIWA 1ZT1A 3L3KB 5IB2A 3NIGF 2ZUYA 4S2SB 1J0HA 5D1QD 4G6FD 5IFAL 4XNZC 3T0AA 1N7ML 2AI0H 2DQTH 1A6UH 5E9DD 4KMTL 4C56D 1TZHB 4HUUA 2BVPA 3BPLB 4HQQL 5DHXB 3RWHB 4R4FL 1DLHA 3BVNA 4RA0C 4O2FA 1G9ML 2H1PL 4FFWC 4BELD 4EN3B 1BVKB 3MV11 1KCSL 2OI9B 5I1IH 2J88L 3WDIA 4H1LG 2BP3A 4EIZC 3LQAH 2JELL 3FZUD 3QUKA 3WXWL 3MUHL 4LCWE 3IS1X 3TBSB 3U79A 2PCPB 1LE5B 1U8NB 1HN1A 4WO4D 4KUCD 1HE7A 1WFOA 2BOCB 2ZJSH 3HB3D 1EEZB 3D0LA 3K74B 5KSVB 1CL7L 3HFMH 3D9AL 3BESR 3WKNA 4U0QB 5J13C 5EO9B 2B4CL 5IHBA 4XBEH 4P5TA 1SJEB 1AI1L 1DQJA 4FMFA 4Y4FB 1S78C 5GQBA 2FGWL 4C58B 5CD5C 3QUZC 4TSAL 4XNUL 2WWMD 4EUPG 3GM8A 3B2UD 2VKXA 5E5MB 1A7RH 5DMIL 4JKLA 2HFGL 2FL5B 1NCBL 3NABH 3L3DB 2C3HA 2JTDA 1I8IA 5DI8B 3T0BA 1DLFH 4U1HA 4UDTB 2OTWB 1RFDH 1JGUL 3GMRB 5JHLH 1INDH 4I3RH 3AMLA 3BKMH 5ISZE 4JN1H 4QF1B 1ZVHA 4AH2A 2BNQD 5HTSA 5ID0B 4DKFH 4NQUA 3BDYL 2OTUB 1NCCH 1XIWD 4CJ0A 1FHGA 3RDTD 4FQ2H 4YBHA 3X3GL 4HIHB 4ZFGH 1JNHB 4B7LA 3KYOA 1MNUL 4EUPB 1MCDA 1KEML 1E4XI 4V1DA 2RB8A 2WANA 4HXBL 3MRFB 3NVQA 4K2UL 3CGTA 4MB5A 5GGVL 1A2YB 1AGDA 1I9IL 3SJVD 1QO3B 4GLRH 1KB9K 3PWUB 2V7HA 1OAKH 2ADFL 3I6KA 4GW4A 3V7AE 1FZJB 4OI7A 3LQAC 3OKEB 1N6UA 5F6HJ 4UNVA 1J8HA 4CMHC 3U4AA 5JOEA 3BDXA 4JG1L 1JGLH 4XI5D 3NCJL 1IAKA 4L4VA 1QACA 5LGJB 3RDTA 3FOLA 1U2HA 5DEFA 3L3IB 1DBKL 3MJ9A 1A4KA 4KHXH 4L8SC 2IAMB 2CDGB 4X5WA 4EI5C 2G5RA 3OPZH 3V0WH 2PW2B 1Z0MA 1GAFL 4JDVB 2O26U 5JDSA 3RWEA 4R3SA 4OJFL 1NGWB 2DMCA 4WO4B 4IRSC 1H15A 4NNPH 4BFIA 3VWKA 4BFBD 3UPRB 3TFKD 1OPGH 5J12C 3X3FL 1WIOA 1ORQA 3MOBH 3OG4B 4MDIB 5CP3H 1B4RA 1HKLL 4ZFZA 5CBEB 1DL7H 3KXFB 4XNYH 2C3VA 2XWJA 4PY7A 2G9HB 4AL8H 3U0WH 4GKNB 4HUKB 3QG6A 5ADPH 5BVPL 1CLZL 5EO1A 2D03L 1JHKH 3ULUH 4DUWA 4HGMA 1BGXL 2VUYA 4YLQT 5JIHA 3QO0A 3OKLB 4NO3B 7FABL 2ZOKA 1JHLL 2IF7A 1QFWH 4ORZC 1Z0NA 1ZGLB 1FN4B 4NT6A 1JE6A 1X5XA 1Q1JH 1EMTH 3AY4C 4LLQA 3QUZD 2YD1A 2EXYD 3VWJA 2FIKA 3B2UC 1T6WA 4OD1H 3KR3L 5L8LB 2EDRA 3RWGA 1ZVSA 3FZUC 3KYAA 1ZMYA 3QFJA 2P43B 2LFGA 3UPCA 4OD2A 3C9NA 1A7PL 2I9TB 1T0MB 1KFAH 3UYRL 4O9HH 4HHAA 4H0IA 4JREC 2XQBL 1VB9A 2DQCL 5HDBF 3L9RA 2GCYA 1WUNT 1TETH 1UWGL 2EDWA 3PHOA 2PCPA 2OR8A 3MSPA 1SEBB 1RULH 5D5ME 3VFUA 4U1IB 1FLRL 4HWEH 3I85A 3P9MA 3QNYB 3S4SG 4U1LB 4XP6H 3U46B 1OQXA 4ODBD 3S35X 2DM3A 3SGKA 3T4AB 3BIAX 4OUUB 1PD6A 1FL3A 2QQNL 5EOQL 1HSBB 1U3HA 2Y5TB 2H3NB 4M7LL 5F9WC 1HHGB 3V4UL 4MD0B 5C0AD 1CDBA 2HVJA 3AS1A 1EHAA 2ILLA 4XXCA 2G60L 5E5MA 1I8KA 1NEZG 2PO6B 3KPNA 4R6UA 5I19L 5D7LB 4WW1B 3FT3A 1I8LC 1T0MA 1CT8B 2R4SH 1MVUB 2YA1A 3MTRA 4IOFC 4DN3H 4OGYH 2ZCHL 5EH1A 3CZJA 4CADA 3RL2B 4XCFH 4KWUA 5DJZB 4JM4L 1S7XB 3JUYA 4Z7WB 5C09B 3WE6A 1BBJB 1I1YB 2M26A 4CVXA 2HH0L 4NQSB 4ORGA 2VLJD 2XV6B 3SDDC 3DMMA 5I1DA 3E0GA 3IFLL 4G8GE 5I71C 1HQRB 4I3GA 4LPYA 1FH5L 4R90H 4POZD 4X6CB 4NC0B 5GZOC 5J11B 3PDDA 3WHXA 2V5YA 4D9LL 2DJ4A 3QB7C 2EH8L 2H9GB 3RGVB 4HFUH 3TPKA 1IM3A 3IDUA 2NY1B 5CIPB 3UJJL 5FYLH 1HNGA 3JWNC 4N9GA 5IW3A 1AP2B 2ITDB 1I3RB 2BNRA 5I1JH 2A9ML 2BRRH 3DVNB 2W59A 5DZLA 2DLFH 2NZ9D 5E2VL 4M7JL 3OKNA 4RRPG 3OJDA 3W0WB 2VLKE 2OBGA 1F42A 4XHJD 4Z7WA 2CDGA 2VXQL 4EOWL 3B3IA 2VLRA 4JRYD 3WS6C 1N6QH 4MA1C 1IAII 3E2HC 4XGZB 1D5MB 1NFDA 2BFVH 1CGYA 1JNNH 4OLUH 1BBDH 4P2RA 3KPOB 5F7NC 5CJOL 4XVTL 4WI5A 2J4WL 2MQCA 1FVEA 4PB0H 4C4KT 5F1NA 3ZKMC 1F6AB 1ZAGA 3MLUL 5DD3H 4J12A 2FECI 3N9GH 4X8JB 5KJRH 3U4BL 5GGVY 3IFNL 1NKOA 3WDJA 5FHBL 4ZUUB 4HDIA 4FS0A 4GKNA 1MRFH 3SDXB 3SOBH 4QEGA 2NY5H 4XZUA 5D72L 2GUOB 4BH8B 1YEDB 1ITCA 1X5GA 3QXTA 4LF3A 4S1DD 4HF5H 1C16A 5A3ID 4HUWA 5J4MA 5D1QA 4RMVA 5I76B 1TENA 1PLGL 3CFIC 1JGVL 3UDWC 1CD1A 1FO0A 2I25N 3BDBA 4JDVA 4HS6A 4YJZL 1P7QB 4DQOH 3B3IB 4WEMB 2CRIA 1S7RB 1LP9E 3PWPE 3GI8L 3DHMA 1T1WB 4M4PA 3IDYC 5CSZB 1BQHA 3WL9A 1G7PA 3P11H 4CRPA 3MLXL 3JWOH 5DMYA 3S36X 4Y88A 1V7ML 1R3HA 4XBPA 3WUWG 1F11B 3AU1A 3D85A 4N0UA 5E6IA 1JWMA 5DUML 3TWCL 3G6AB 2XFXA 2XWBB 5MEPB 4OM1L 4JEGB 1Q0XH 1CDIA 2LE9A 3X14A 1UCTA 3ZKXC 2CJUH 2WNGA 1VFOA 3PWPD 5J89A 4YZFE 1D5IH 2AKRB 5GS1A 3O3AB 4V1DE 4PLJD 5DJCB 3O6MH 5L2JB 2FHCA 3TESA 5HDQH 4U1NB 2LABA 3CJJA 5CSBA 2CDFA 4KY1H 4G6KH 1MCWW 1PG7H 4PTUB 1B0RA 1U8PA 2C9AA 3CUPB 1J1PH 4XPGL 4XHQA 1FNAA 2NLJB 3GMLA 2IPUK 4R96A 5KN5A 5CEXA 3H7BB 3QPXH 3SKUD 4GAGL 3DX8A 4LCWB 3TA3D 3GRWL 4JFZH 1QSED 2CQVA 1A4JA 4X9FA 4OAWA 3MROB 2WBJB 1QKZL 3IAPA 2C1PA 4GXUN 1E4KC 4XCNA 4Y8AA 4EI5A 1TCRA 3WHXB 5DEGB 2IFGA 3X13A 2EEDA 3DTXA 4U31A 4Y4KA 4LP4A 2GCYB 1X6NA 1KPUB 1J12A 4G7YH 5HI5D 1NAMB 3O3UN 3ARTA 2A6KA 1NQBA 4KDTC 3DYPA 4YDLB 1MFEL 5D7KD 4MD5A 3N06B 1BFTA 5I1EH 1E4XH 5FGBA 4KJYA 1UM4H 2FECL 3MCLL 3EYSH 2Q76A 2HT2D 5DVLA 3TN0B 2RJMA 5E03A 4YHMH 4KZEL 2AKRA 2QSCH 1JMZA 3S5LG 1S7WB 3ARRA 4G6JH 4ZSOA 2ED9A 1D9KB 3ARYA 1ZWIA 3BGFC 1MHCB 4P9HC 4IM8A 1MJ8H 2Z92A 1QKZH 2R1XA 3IDGB 2Y36L 1NSNL 2YA2A 4J4PD 1EVTC 1T04B 3Q6GL 4TNWK 3BKCH 4EN3A 1CFTB 4K94L 3ARDB 1EGJL 5JQ6H 3V5DA 3HE6C 4YZFF 4IHOB 5CCKL 1T2QL 1WZLA 1MPAH 4KK5D 1UZ8A 4BKLB 4KXZH 2PTVA 2XA3A 3BIBX 3P0YL 1NGQL 2DKUA 2ZUQB 3MBEC 3CC5B 5GSVA 4PGCB 1TJIL 1QQDB 5EBLB 3ALWA 1P53A 2JCCE 3GMRA 3EYUL 3AM8C 1A9EB 3LEVL 4H1LA 4PGDB 2DQDL 4IMLA 5F6IB 1LWRA 3L3GA 2VZVA 5IMOB 1T20B 4JFFA 1MIEL 1A7OL 1T21A 4PRNB 4MCZA 1XF1A 3U30B 4OCRL 5BQ7B 1EXUA 3GHEH 3UZVB 4TUKL 2BNUB 3C8DA 4DKAA 5EZLA 1IARB 3K3QA 4Y16D 4LIQH 3SDCD 1SJXA 4N0UE 2IJ0C 1X5HA 1G7HA 2NY4D 3RVXD 1N5YH 3SDYL 4P59H 4PJFA 5I1AB 2OJEB 4XB8A 1P1ZB 5ISZA 1J0YA 1XF2A 3D87B 2V7HB 3K2UL 3IXTA 4M48H 1LP9A 3PWPA 4HWBH 3TA3B 2QSTA 4NO5A 4WWKD 4OLWL 4M62H 5CHNA 3O0RH 5HD8D 1I4FB 2OMBA 1MAJA 3TV3H 5GRVK 4KMLB 1VGKA 4DOHB 3BSZH 4BYHA 2I07B 3ZT7A 1IAKB 5FO7B 5SX5K 4Q9QH 3D69A 5L6YH 1F13A 4FFWD 1QSFD 1IGYA 3IFNH 2EDNA 1RMFH 9CGTA 3U83A 3U7YH 3D39A 4U6YB 3U9PH 2GHWB 5GRJL 5I1LB 4NO0B 1GC1H 4JM2F 2J4WH 2CIKB 4UB0L 1SMAA 3QRGL 1FGVL 5CJOH 2VIRB 2BVYA 4W4NA 3ZTJG 5BS0B 1FZJA 3I9GL 5EZIL 3HB3C 3O6KH 3WHE1 4QRUB 2ZOLA 4JHBA 4R0LB 1ZEAH 4QRRD 5FOBB 4JPIB 2IBBA 1QA9A 5F8RC 3DVFA 4LLWA 2XQYK 3PGDB 3O3EB 3U0PB 1FC1A 3GGWB 4WWID 4HX1B 3QNZA 4PTUA 2YOCA 1ZS8B 4WCYH 1P5VA 2AABL 3HNTH 1XCTB 3ZE2E 3OKDA 4KJQC 4TSBL 5C07B 3RKDC 4KJWC 1S7WA 3UTSE 4KK6D 1AC0A 5ADOL 5IJVB 5I17A 3ULUC 3DX6B 3DRTA 3BYTA 3NCBB 4O51B 3HG1B 3RRQA 3IRZA 4WUUA 4OZIB 3WNOA 2D7QA 1P7KA 1A6TA 5I0DA 1ZVSB 2UWEB 4NWTL 5E4EC 5DMJB 1NAMA 1RK0A 1UH3A 1PY9A 4TSCH 1K4DB 2AEPL 3CLEH 3U6RB 4HCRL 2ZOLB 4ZTPL 4KJYB 3AY4A 1QLFA 2A1WH 1O0VA 5IW1B 3O8XD 4JM4H 4MQXD 4MJ4A 2HP4A 5FO9A 1QBBA 3RBGA 1FL6B 5DD0H 3L5XL 1KIUA 4WI8A 2ZCHH 3CLEL 1TZGH 4K8RD 1P2CA 1WTLA 1V3LA 5GS0C 1D5XB 4RGNC 3JBG7 4K3DH 3HE6D 5E24E 4NWTH 1LO0L 4XVJL 2WLZA 1RUKL 2XKSA 1M7XA 3T0EE 5F44A 2K7QA 3MV8E 3MUY1 1VCAA 5I19H 4OZGE 5IMOA 4MS8D 4AEEA 1AC6A 2O5XH 2V9RA 2VC2H 4RDQF 5HI4D 3WFHA 4MAYC 1WC7B 4XI5C 1WIPA 1G9NC 4QTIL 1I7RA 2DQUL 3H3BC 1G7JB 5IB4A 3MLWL 4YHYB 2ZWLT 4PS4L 5EULV 5GGTL 1HH6A 15C8H 4AMKH 3MUGB 4R4ND 4HGKC 5DTFB 2EE6A 5DSCB 4M1GL 4ZS6D 3I3BA 4ONHB 1XGUA 4YGVA 4WI2A 3S37L 5E8PB 3K81A 5JXEA 2HRPL 1Y6NR 3QUXB 4C83A 3C6SA 4HGWA 3WIHH 2YPVH 2FX9H 5C0CD 4TTDC 5JW3H 1BVKA 4WV1C 4U1LA 1W0VB 2NY3B 5BMFL 2Y23A 3V2AR 2OR9L 4WFGD 3O6FB 3IXAA 1T21B 4UNTA 5EN2B 1A5FH 4J3UA 3S37X 1EEUA 3K0WA 5F9DC 2ERJB 2F19H 3RY4A 3VXSD 1REIA 2EIZB 3OAUL 2YUXA 5DFTA 3RI5K 3VH8A 4WWKC 2HN7B 4FZ8H 1Y0LB 2EDKA 4LDOB 1PW3A 2XTJB 2LTQB 5A16B 5EZJA 3NACL 3FRPG 4GXVL 1E4KA 4FFVC 1NL0H 3HAEH 3PGCA 3ARFD 5GZND 3KPSA 2VZUA 3CLFL 5D9SA 4R4BA 4DEPB 4PRPA 4PRIA 4HPYH 4HWBL 4J23A 2FO4B 1PX4A 5I8CB 3FFCA 4Z7UA 4ZXBC 1WWBX 4LARL 2DICA 5BZDB 2J7LA 4JZJC 4BM7A 3BFOA 4F7PB 3ZO0A 3N1FC 2RIKA 4HJJH 1MCCA 1XR8B 5C0EA 5KOVC 1ZA3A 5FKAA 4LCCC 3DROA 3IDNB 2DL2A 3VXRD 3D85D 3BH8B 3QDMD 2DB8A 4P99A 2VLRB 4NO0A 3Q5YA 1HKLH 4WUUD 5EBGA 1YEEH 5T1DL 4RFEB 4X6CE 5B39B 3TBWB 4O51A 2W91A 3ETBF 4O58H 1FG2A 3CFKB 3CXHK 4MMXC 1XZ0A 4Y89A 4Z0BH 3TM6A 4GQPH 3LN4A 4PJIB 1SHMA 3UTQA 2DQDH 4Y5VC 3F7RA 1JZ6A 4E41E 5HGDB 5LBSH 5F1IB 4S0TD 4UAOC 3E1F1 4PB9L 3BZEA 3RL1B 1QFWM 3VXPB 4KKBC 5EOCJ 4X7TB 2LU3A 4Y4FC 1U91B 4B53A 1T2QH 3STLB 3QUZB 1A1OA 3KYMA 3OJMB 3VXRA 4K94H 1AXSB 4XC1L 4U49A 2QKIB 3I75B 5EU6A 5IVZB 4U7KA 1NMAH 1IGFH 1FYTB 3UBXG 1R3KB 4K2UH 2PXYD 1DUZA 2EDTA 4MJ5B 2HTKD 5EU5A 4MQXC 2DLIA 1U8OB 4WTWA 3BW9B 4XPHH 1QYGL 2NPLX 2J8UF 1D6EB 1NEZA 3UPRA 2DWEB 5C07E 1MAML 1N8ZA 2LAGB 1G9NL 4WW2B 3TT1L 3E6HB 4YXLL 1Q9LA 1YEDA 3KPQB 1EEYA 3B43A 1AFVH 3QHFL 5LGKA 3BDYH 1WV7T 2NY1D 3CZFB 5SWZE 1JI2A 3CFDA 3OJ2C 5AD0A 1FIEA 3B4NA 4UTBL 2Q86B 3VFMB 4UQ2B 3CLFH 3U0TB 1NL0L 2A9NH 2F58L 1DDHB 4KRPC 1A6WH 4Z18A 1I8MB 2EE3A 3OR7A 3PWLA 3LEYH 1UQSB 4G43A 4GFTB 4G8EB 4ALAL 4OLZH 1I7UA 4MSWA 5JOFB 1U8QA 2ZCLH 4MD4B 4I2XE 4GS7B 3KYKH 1FDLL 1C5BH 4F7EA 3QQ3B 3SE9L 2X4RA 1D5ZA 3MR9A 5AUMA 2MOVA 4U6XB 2VLME 4Y5YC 2BFVL 1E6OL 5IBUB 2IAMC 4OGXL 1G6RA 4EI5B 1MWAH 5HHOD 1QPXA 3B5TA 2ORBH 4X80L 2ITCA 5BOZG 2CJUL 5JHDD 3OGCA 3BO8A 3HAEB 2X70B 3WIHL 4YEFA 4G8FA 4OM1H 4Z7OF 3L9RB 3E3QE 3V6BR 5F89A 2D9CA 4UZGA 2X40A 4JY4A 1GVIA 1GGIL 2M2DA 2A73B 2NXZD 1SQ2N 5HVFB 1KENH 3BP7B 3MOAH 4OFVA 4U1GC 3CPLB 3ZMRA 1KIRB 3F58H 4LAQL 2DLHA 2RFXB 3I84A 3QIUA 4JFPA 2ICEA 2P7TB 3MRRA 4HS8H 4QTIH 3P11L 2XQYG 3QWQB 5IQ7H 2VSCA 2DQTL 4M61A 5HHVL 1V3MA 2A38A 1AO7E 3REVB 2R1XB 1C1EH 5J3HC 5J1SC 4HWNA 1IGJB 4XPTL 1KCLA 4FFYL 2NW2B 1OARL 2C3WA 4K7FB 4NO2A 1FP5A 5GIRB 3L5XH 5KVGH 1IT9H 4YFEA 4QOKE 1TLKA 2ESVA 2C26A 4JO1L 2I9LA 1LO2L 1AGEA 4GJTB 3P9MB 1F45A 2V2XA 4R97C 2MQ3A 2X1XR 3IFPB 4R7DA 2Z31A 4H20H 5IB5B 3SOBL 5GGSY 1L0YA 3U1SH 1QZ1A 4Y4HB 3GSWB 1TMCB 2LQRA 3DBXA 3CVHL 2FDBP 2YEZA 5HVGB 1GPOL 3OB8A 3MMEB 4LSUL 2AJXH 5KVEH 2DYPA 1OAZH 1Z9LA 4FG6D 1UXSA 2F15A 4K7PY 1TZIA 5H2BA 4QLRA 1H0DB 1I9JL 1OSPH 2OL3A 1JHTB 4TSBH 1JYVA 5IGXL 3ES6A 3KPSB 4IS6A 5J8OA 4Z8FH 3BZEB 4MA7L 4YAQB 2GY5A 2W0LA 1WFNA 1VPOL 5D71L 5HHQA 2F8OA 3UTOA 2BRRL 2FLRT 4EJ1C 1TETL 1UWGH 3SKMB 5HYFA 2VYRE 1QEWB 1ZEAL 2PO6C 5DVKA 1I9EA 1RK1A 2V2WB 3D39E 1BLNA 2E5EA 3MLSL 1RIHL 3V5HB 1JBJA 4PJDB 1Q9WB 2DYPD 2YN5A 4X6BA 1LEKA 4P5KA 5ANMB 5A3IC 4D9LH 3VGAB 4MNGE 4YHLL 3JTSB 1A7PH 2C7UA 4NQVA 1P4BL 2CUHA 4P2RB 3VFVB 3KYOB 3P9WB 2YS4A 3EO9L 3H8NA 4P4KC 4PR5B 3BN9C 4N9GB 4WW2F 2UZYB 1RUAH 1X7QA 2CIKA 3O41A 5GS0H 4ZO6A 1K8DB 2K1MA 4EDWH 1JZ4A 1EJOL 5I71B 4F7MB 1NMBH 4N5ED 3VFWA 3WMSA 5L0QB 3LH2L 5LAXA 1JHLH 3D6GA 3FB7B 1RJYB 5ACZB 2VZ1A 4UDTA 1NDGB 1XF5A 4LU5L 3W81A 2X4NA 5L8KB 2VDPH 1KSRA 4QTHA 4JHWL 5DJDB 1RURL 2AXHA 1KCRL 1MCPH 3D39B 4HBCH 1V7NH 2DL9A 3G6DH 32C2B 4DUXA 1NJ9A 4FQXA 2XA8L 2NY2D 2K7PA 4UIKL 3V0AC 4RWHA 2Z91B 4OIBA 4HIJB 3NGBC 1ES0A 4U6XA 3STZB 5ESVB 3H0TA 5EOQH 1EDQA 1NAKH 1RZGB 2B39A 3G04A 4U33A 3VFVA 5KZCB 3L3DA 1CD9B 3GUTA 3S7GA 1IGJA 4L4TD 5GISH 3E2HB 3ARBD 3UYOD 3Q5OA 5DRNB 1MELA 3CFDB 2BHUA 2DDQH 3RVUC 2BHYA 4DW2L 4ZOAA 3TF7C 1QBLL 1FRGL 4JQVC 3MREB 2R0LH 2XZQH 3CDCA 1KIQA 1ZK9A 1RPQA 1HEZA 1N5AB 3SCMC 2NNAA 4D8PB 5JNYA 2VNCA 2B7DT 3IETB 2ZOKB 4O9HL 5GS2D 1TPXB 1HSAB 1E4WL 4QWWD 2D0FA 4JPWL 5LGHH 3RWEB 3O11B 1S7TB 4FQXD 4RFNB 2PNDA 4X5WB 5HHMD 1KEGL 4MNHA 2E27H 1DUYB 3MJ8B 3VXMA 1CI5A 4OFYD 2EXWD 3MBED 1D7FA 1L7IL 3REWA 4PY7B 4HK0A 1J86A 1GOFA 4H1LH 5C86A 4M43L 5I1CH 2ZUWA 3GSNA 4OD2B 1N59A 4FTVB 1ORQB 4ZNCD 4ZFGL 4GSDH 3UTTB 6FABL 2IALB 3KLAA 5FM5O 4DKFL 4JN1L 1E4XL 3UX9B 3L1OH 1FZMB 4POYA 1JHKL 1ND0A 5E8EB 3ULUL 4H25B 3WFCL 4U1NA 3DETD 3E6FB 3K4AA 4MA3A 1CICA 4JY6A 5DRWA 4G7YL 2HVKA 5TFSH 3L3JB 5EWIH 4JFPB 5ID1B 3QNYA 4GMTH 4F2MA 1RJCA 4NC1E 5L2KB 4PJDF 4K3GA 5CMAB 1RUQL 5T5FL 3L7EA 4ZSOB 5BV7C 5K9OB 1OAQH 5JA8B 4ELMA 3ZKXB 2X1WL 1F02I 2Y7QB 1YA5A 4MD0A 5D1XB 3SDXF 4OBRA 3ULVE 3SE4A 1H3PL 3O4LE 1OTSC 5F9JB 2BY3A 5HDQL 4NM8L 2F54A 4RDQG 4Y2DD 4FXGA 1UM5H 3NCJH 5C09E 5D6CA 3S35L 2EYRA 2PYFB 4AT6B 3MNZB 3MNVB 3O45B 4G3YL 4IMKA 3ULUF 5D7IE 5IB5A 1CVRA 8CGTA 4Q6IB 3N50A 4NT6B 4F37F 1NCAH 1U9KA 1DVFB 2GJ6A 4LLMA 1YUHB 1J18A 2X89D 4AEHL 4OB5H 5IB1A 1CFBA 4PRAA 1IE5A 5BXFB 3W0WD 5F96L 2B0SL 4P57B 4Q0XL 4R4FH 2EO1A 3VXQA 1KELL 5HD8C 3QI9A 3QUYA 3JV4A 4X5LA 4XNMB 1T4KB 2MCPL 1MFAH 5IF0B 1IKNA 4OV6F 2P4AB 3DOSA 3OXSA 5A16A 1BZ9A 1HXYB 2IH1B 1DP0A 5DRXA 3SBWA 3HCVB 1CXHA 5F8QC 4OF0A 4DTGH 4IOSD 3VFWB 1GHFH 5EPMA 3VD5A 4BA8A 2B2XL 2AJVL 4CN1A 4C54A 1RVFL 1Q72H 4QHKI 4KK6C 3BGFB 5CILH 1ZT7A 3S5LA 5E99H 2BSSA 2OX5A 4M8QB 1KBGL 1I3RA 5JUEL 5ILTL 2VDKH 2AV7A 4PD4J 1KC5L 4S1RL 3MRJA 2XZCL 1C7TA 3K4ZA 1WQVT 4CN6A 4Z76B 3EOAA 2A6IB 3TYGL 3RAJL 1QSFE 4Z77A 2J5LB 35C8H 1KNOB 3HNVL 3OF6D 1U58B 3N9GL 3LKSB 4TSAH 1AXSA 4HIJA 3VXMD 1XGQA 3TBWA 1AI1H 5J6HB 4PB0L 1HWGB 3WYRA 2JJVA 3QZWB 3BXNB 3ULVD 3RGVA 1YEJH 1IAOA 2R2EB 2VL5A 4P2YA 4ZUWA 1NLBL 1P4LA 4XRCB 4OCWL 3BE1L 3PP4H 4PV9B 4C56A 4NNXB 4UUJA 4ZTOL 2FB4H 4PJIE 2VXQH 4EOWH 2VDLL 2DTSA 3Q48A 1JF1B 1U93A 3EGSB 4WU5B 5C0AB 3BAEL 3QDGD 5JDJA 5F21B 3QIUD 3MA7B 2XKNB 3HZYA 4LCIL 5DMKB 4E41D 5IJKA 1INQB 2H6PB 1I8IB 1JV5B 1NCDH 2I5YH 4CVXB 2GUOA 4BH8A 2YSSB 4FQCL 2C4FU 2HRLA 5IUSA 1RUPH 2X4QA 2IPTH 4RFOL 4OD3H 5INDA 4ZUVB 5FYLL 4KC3B 1GGBH 1CLYL 5DFWH 2OTPA 1FPTL 5FXCH 3P0VL 3O2WH 2QHRL 1SJHB 3SHSA 3L7FB 4YDIL 4X6CA 4Z78A 4AENA 3LRSA 1DQJB 5IT2L 1S7QB 4M5ZL 3ZKND 5DR5L 1MCIA 2VH5L 1D5MA 1NFDB 1OTSD 3D48R 3CVIH 4XMPH 1AIFA 5TF0A 4OCMC 4MDJB 1TNNA 2W9DH 4P5TD 3GSNB 4PBXA 1WCBA 1I1RA 2BCKA 3GSOA 3QISA 4ODHL 4YHIB 2HLFD 2JK5B 3KLDA 2HYMA 2BC4A 2MKLC 2F54D 4Y2DA 1T5WB 2QADB 3QXDB 1QOKA 2ZUSA 5DO2C 4LLDB 2E7LC 4GBXB 1RUPL 5EG6C 3VI3F 1FNFA 1S9VB 5HGBB 4R26L 5EBMB 5EBWB 4D0DA 4XZUB 3MRDA 3QH3A 3MA7A 1WT5A 2VITA 1UJTA 2H32A 3NZHH 4F37K 5FYKU 5SX5H 3UBXI 2BK8A 2X41A 5D7IA 1FSKB 1DEEA 1U8QB 4MZ2A 4WEBL 3QI9D 3QUYD 1CD1B 4MA8L 1QBMH 2F54E 1WFUA 2W0PA 3K8KA 1DVFD 4JM2D 4WY7H 4KAQL 3RZWA 4WHCA 4L5FH 3DO7B 1YDPA 5GS3A 2R23A 1FFNA 1F4WL 1CLOH 2MPAH 1L9NA 2IH1A 3OKEA 1UZ6F 4U6TA 5E08H 2CLRA 5FYKD 1FBIH 5MEPA 2NW2A 5LJYH 4OT1H 2F74B 1TJGL 4G8FB 2EEBA 1R0AH 1A14H 5J57B 3OQ3B 5MP6H 4PGZA 2O61A 4GBXA 1J05A 5GJSL 3WD5H 4PJ9D 2I24N 4P3DA 3X14B 4F58L 2WWMC 2BOCA 5H37G 5I8EB 4L4VD 2MQ0A 4OF5A 4TOYL 3GO1L 4P3WA 3D18B 3ZT6A 2CDFB 3LKRB 4UIMB 2WQ8A 5HHXL 3QXAB 1IZJA 2GSGB 1U8PB 3CUPA 1S7UA 2AK1L 1OAXL 4LLQB 5ISZD 1HINH 1KB5L 4ZQKA 1HH6B 4ZFZB 5B38A 3RNKA 2GK2A 1UJ3A 5IT2H 4WNQB 4KK9C 1UXSB 4M6OL 4G8IB 5JZ7C 4JKKA 1FYHB 1CFNB 1RZJH 3BD4A 3G6AA 4K9EL 1H3XA 2ZCKH 2BY0A 1GIGH 4ZXBA 3MRJB 5DLML 1S3KH 3LN5B 2XZAL 3EYFB 5I73C 1AKJB 4WHYG 4RAUB 3VRLF 1U93B 3O4OC 1PSKL 3WJLA 1JV5A 4AL8L 4HH9B 3S35H 4F33A 4YHYC 4BSWB 4JDZA 3T1FA 4G6MH 5F7YC 4I0PC 1EFQA 3PP4L 3ULVF 1N0LA 1VACA 1AE6L 3C87A 4G6AC 3EJYD 1JTPA 1NLBH 2NYYC 3MGAA 4NKQB 4PJ7B 4F8TA 3BXNA 3D18A 1V3KA 1RU9L 2E6QA 2P8MB 5IVNA 3WO3B 3ZKSD 1N64H 1N64L 3TO4D 3RA7L 3UBXB 2FEDD 4XP5L 2OL3H 5CINH 2X4SA 5CEZL 4QNPF 5D2LA 2AXGA 1T7YA 5IQ9A 1A7QH 3DUSB 4PRPB 5ENWB 1J8HB 4U3XA 5FUCC 4DCQA 2Y07L 1DLHB 3BVNB 1RJLB 4Z7UB 2Y9RT 1NCWL 1C8PA 3J8F7 2N7BA 4U6VH 3C8HA 4J8RA 2FJFA 3ARPA 2Q8AL 3S97C 4KGLA 5EUKB 3VXNB 5IBUG 5EC1B 1A4KB 1OM3L 3IYLW 5BRZE 4OGAC 3QPQD 1YEKL 4H0GA 3ULSB 1ED3B 25C8H 2WUBL 4QTHB 2EICA 2IPKB 3C5SB 3T1FB 1IKFL 5DMGD 5DO2D 4NQVB 3MRGA 4LRIC 4OBSA 1QSEE 5I1DB 4DOHE 4WTXA 5KSVA 4WTZG 1R3KA 4JZNA 3N0PB 1HINL 4PRNA 4NUJB 3MJ9H 4JFDD 1OSZB 1MOEA 3QDJE 4IOIB 3CNKA 5C0IA 1MVUA 3CFEB 2WUBH 4M6ML 2DQJH 4OIIH 4I4WB 4RIRB 3NPZB 2VAAA 2V9QA 4OF3A 5DZNA 4GBXD 5L88L 1HHJA 4HBQA 1QG3A 3GNMH 4PJGB 1IAIH 2NQCA 1BD2D 5B3JF 4LLWB 4LGPB 2E3VA 1T3FB 3VXTA 4L3ED 1YC7A 5FKPB 3BZDA 3QIWD 4LLVA 2APXA 2ZZUT 3BWAB 2D31B 2EDHA 4Y5VB 4V2CB 5ICZA 3TCXA 5BRZA 3RPIB 1JTOA 3EOYG 4RX4D 3T77A 2P42B 1AQKH 2FGWH 4UAOB 1OAQL 1U8OA 3D1MC 4HFWA 5EZLB 3WFEL 4JFFE 1H9VA 3D9AH 2VQTA 5MEOA 2H2PD 1VFMA 4WJ5B 4RCAA 4GMTL 2VQUA 4XH2A 1KTDA 3DURA 3VXUA 5DJYB 4YXHL 4X9BA 1GJIA 1MRCL 1QSVA 1Q0YL 1N59B 4FTVA 4OSUL 4GKSB 4EIGB 3G5VA 4L8DB 3U6RA 3KPTA 4I18C 2BHZA 1FNGA 1CR9H 4Y4HD 4G6AD 4XVUD 2UZIH 3HR5A 4H25A 2KPNA 5HJ3B 5AAWA 1NMBL 4PJGA 5D1QB 1A1MB 1EJOH 3QDHA 5FO9B 3DNKA 4WW2C 4J6RH 4OFPA 1KIPB 2GITA 5J9PB 2O5ZL 3FN3A 4YX2H 1JNLH 3ARFB 1NC4B 3DX7B 2HKHH 1YPZB 2V5SA 5F1NB 2FX8L 2XG5A 3WS6A 4Y5VA 2WINB 1QHPA 5FYKL 3Q6FA 1G7IA 4AEFA 3NIFF 2JKXA 3F5WB 4P2QB 5ETUA 2D7OA 3P4OA 5ICXB 5K9OA 4TUOB 4ZFOA 3JTTA 4FZEH 4C59B 2IFFL 4XAKE 5EB9A 1F6LL 3O2WL 5DTFA 2Z93A 1H5BA 1GGBL 4JFDB 1IM9A 5IW1A 4IRZH 4RFOH 2VZSA 5JO5B 2E8ZA 2IPTL 1XH3A 4JVWA 1P4IH 4FQCH 1FRGH 1XGTA 3S96B 2Y25A 4WUKL 2N4IA 3NFNA 3WLBB 5FA3B 1PG7X 3RUGE 5K93A 4Y16B 3SDCB 4CN4A 3QEGL 1CLOL 1WCQA 4R7DB 4Y5YB 1F4WH 2GAZB 5I17B 4POUB 5EUOE 4L4JA 4ZO9A 1P2CB 2IG2L 2VLJA 1FNHA 2L0DA 4EQ3A 4L5FL 4N5EC 3QCUL 4XNZB 1MHPL 2CK0L 4ONGL 4Z7VA 4AIOA 4G8IA 4N9OB 3BQUA 1UYWH 1OAZL 4OGAD 2AK4D 1A4JB 3BPLC 2AJXL 5KVEL 2EDYA 3I3EA 3VMOA 3WIIH 3QRFM 2RAMA 1GPOH 5SX4I 4U1GB 1IM9D 2YKLL 3MX0A 1X3DA 5DVOA 2VN4A 3SDAD 3MODL 4NJAH 4YNYB 3U7AA 3BP4B 3P73A 4P49A 3CMOL 3H9ZA 3GK8L 5MENB 3CU1A 2ADIA 1ZE3C 4KI5D 2Z8SA 4BSWA 3PQYA 5JQHC 5TF1L 2UVFA 2F5BL 5ITFA 4KTEH 5ALBH 1L6XA 5BZDA 3EFDH 3MRIB 2A83B 1SMOA 2HA1A 5J1AB 1YQ2A 1I7ZA 4Z76A 3ZTJH 3RVWC 1U8KB 3FRPA 2QL1A 4L4TE 1EERB 5J13B 3O8XA 5HGAB 1D9KA 1PJ9A 4OM0L 5DJ8A 4XCNB 5D2LB 1TVHA 2QTEA 4YHLH 5J6HA 3LN9A 2ARJA 1MLBB 2E9JA 4U1MB 3TBTA 1E4JA 5EPMB 5B39A 2AEQH 2ADGB 1RIHH 3BEWB 3P0VH 2B0SH 5CP7B 2VDNL 4Y4HC 2ADJB 3W39A 5KSBF 4HUVA 1QSFA 4N0YH 4WIQA 1DQLH 4HKJA 5C07D 3ZDYF 5DJYA 3MBXL 2FSEB 3OKMA 4YO0B 1FYTD 1BZQK 3EZJB 4DGYL 4GOSA 3NCMA 4DKDC 5TE4L 4QXGH 2I27N 4P23B 4HD9A 3QDAA 3TPUB 5F3BB 5C0FA 1CZ8L 4JO2L 5ICZB 4GH7B 3QUZA 3IF1B 2YD7A 2VE6B 5T3ZE 1DR9A 4KKLC 5ABDE 3GSVA 2YXMA 4FQQB 4HFWB 1GOHA 3WSQH 5J9PA 4K7PX 4NQDD 3BH8A 3LCYA 3WDHA 3T0EA 4QY8B 2R29H 4ZUTB 3STZA 5JXAH 1K8IB 1TNMA 4M7KH 3PHQB 3RAJH 2DKMA 2CMRH 4YHNB 3UAJC 3H9SE 2YHGA 5IHZB 2A9NL 3FHQA 2HMIC 2A6JB 4LQ1A 3MYZA 4TNVK 4MHHG 2IMNA 2XZZA 1P1ZA 3CH1A 4YFLI 3F7PC 1TIUA 3VMPA 2XIDA 2AJVH 1B2WH 1ZA3B 5FKAB 3OJDB 3JVGA 5L2KD 1T20A 4YGAB 4L8SB 1YEFL 1BOYA 43CAB 6FABH 1C5DB 4O4YH 4ZPVB 4MJ2A 5H94B 3BJ91 5JMRA 3WIHA 4PJGE 3FFCD 4RMRA 3F7YA 2CGRH 3DIFB 3TZVA 5L0QC 1J1XL 4IRSB 2XRAL 1L7IH 4D9QD 1LEIB 1G0XA 5SX4H 4HLZH 3BQUD 3L3HA 5BW7A 1V05A 4UT6H 1CQYA 4KK5C 4H8WL 4XXDB 1BM3L 1OP5K 4LBEB 4IDJL 4ZO7A 4KK8D 4LAQH 4H88H 1U0QA 3C09B 5C0GB 3MRNA 4ZUTA 2VIRA 1M7DA 1CFSB 5TDNA 4GXUM 3PHQA 1QLEH 3UJIH 3VFSA 1BHGA 4G3YH 4MZ3A 2RGSA 1SEQL 4ZD3L 1CDGA 5D7IB 1FG9C 1MWAL 2NR6D 3GB7A 3O11A 3FQWA 1KG0A 1LD9A 1MFCH 5EUOB 4P3DB 2HVKB 5ITFB 4AM0B 5CEZD 1MF2L 2FEEI 1ITBB 1I1AA 3BP5B 4A2LA 1ADQH 2Z9TA 3KPRD 4PBVC 1A02N 4FP8L 1XAUA 3WS3A 1IGMH 3W9DA 5IR1A 4I5BB 3ARGD 2PYEA 4KI5F 3BPCB 3TBTB 4UOJA 1IRAY 3OGCB 2D2OA 5CUSL 2BNRD 4RFNC 3A67H 3TNNB 3KS0H 2E9IA 1G6RB 2GTZA 4RMWA 2Q87A 4OZFH 1JZ3A 5F7UA 4E0RA 4HWZB 4BQBA 4CDHA 4HPOL 3TCLA 2CKNA 3VFNB 8FABB 3MJGX 3LHPL 1MAMH 3ULVH 3L3KA 4KPHH 4YIQB 5DHYA 3RDTB 3DLQR 2H41A 3VCLA 5JW4R 4Y19B 2R1YB 3GMPA 4LASL 3SJVE 2GSIA 2CPCA 1NCNA 3PWJA 5F9WB 5F7HA 4GAYB 3FO1B 2N7AA 4KUCF 3KPNB 3NCYS 4X6DA 3TH3T 5IKCA 3ESVF 3K8MA 4K7FA 4BQ9A 12E8L 2ADJA 2VXVL 1K4DA 4Q6YA 3JV6B 3D25B 1M4KA 2N1KA 4X6DE 4P5MB 4BFGA 3QDMA 1KLGB 2EDEA 4XNXH 1R24A 2EZ0D 3IJYB 5D2LE 4X7CC 1OP5H 3PQYB 3CCHB 2GY7B 5IK3B 4Z5RB 1Z9MA 2HJLA 3G9VA 3BZFA 4C83B 1KIRA 2QSVA 5J1AA 3T2OA 1YMHB 4X4YA 4Y19E 5E7FA 3BT2H 1U8KA 2XYCA 3CU7A 4NFBA 5H8DA 4FA8A 3NMEA 3TVMB 5IMLA 1B6DA 2YBRA 1YNLH 4L3AA 3ZHLA 1J0IA 1G7JA 5F7KC 4OZGB 4Y5XB 1KJ2H 3D39D 4Q6IC 1JRHL 2FATH 3RGVC 4QRUA 4PLKD 5E6ID 4I8DA 5GIRA 2XACC 1LO0H 4ZUWB 1MRDL 5AWNL 3IDJB 3F6IA 4K55A 3DVNA 4RAVB 3RKDD 3HZVA 1MI5B 2PXYA 3ZYOA 2HT4C 4UV4L 3RX5A 4LARH 5I66B 1YY8B 2R15A 3T0WA 1R5IB 3WCYA 4F57H 3DXAA 2DWDB 4JG0L 2X4OA 4UT9L 3MFFB 4LEOA 2DD8L 2HJLB 5I30H 3QEQA 1BOGB 5BO1L 2ATPA 1L0QA 3BN3B 3VXTB 4KTYA 1PZUB 4JPKL 4MQ7B 5FA4B 4FFYH 1C1EL 1B90A 4A6YL 1YYMH 1P4BH 3OKKA 1T0PB 2DQFA 1Y0LA 2Y5TA 4AQ1B 5C0IB 5IFHL 5KVMC 3FB5A 1ZLWH 2EDQA 2DI8A 1II4E 2AQ2A 4P3CL 5DVNA 1ADQA 2CD0A 5C70A 2ZG3A 2J5LC 4XPAL 1GXEA 1S5IL 2ZKHH 4OLEA 4X6DF 1TQCB 1UENA 1I85A 2F5AH 4ELMF 4MNQD 2AJSH 4UV7H 1KN2L 5HI4C 4UOW0 3M1BA 4MJIA 3NCEB 2AK4E 5IW6B 3P2TA 1UB6B 3L5IA 4I48A 4QXUL 5DRZA 4E0RB 4XBGA 4W70A 2F53D 2P8LA 1NAMH 2J6EL 3FT2A 4RMUA 1J5OH 3FOMA 1I4FA 1WAAF 1S5IH 2ZKHL 3TJHC 1PKQB 4EI6B 4U2ZA 5IVZA 3K80A 3ISWA 4HIIA 3AREC 3IDYB 5AG9A 3ARVA 5CJQL 3BKYL 4PR5A 5GS2H 4U6YA 3QEUA 3TO2A 1A7NH 3H9HB 1J0ZA 4F80A 4JFYA 2LAAA 5IVOA 3BGMA 5D6DA 3SPVB 4GKSA 1SM3H 2OSLA 3GI9L 3G04B 3VXSE 3IU3A 4Q9QL 5INCB 3O3DA 2F58H 4X6EA 2KDGA 4NKIL 1I3VA 2PYEE 3TV3L 3UC0H 3MLRL 5F7FA 5DRNA 1B9ZA 4M62L 5C0RH 2F74A 1LO2H 4UTBH 2A1WL 4FQLH 1AR1D 1KGCE 1NANI 3SQBA 4HCRH 3RWDA 5HHPA 4ETQB 4UV4H 1PKQE 1NC4A 1GGCL 1BFSA 5F3HA 1NC2D 4K9EC 1QD0A 2X7LB 5EU6D 5AYUL 4LMQI 2QADC 3VFPA 4QRRB 4ZNEE 4N5UA 2ZPKL 4OZ4B 4N1HB 4GBXC 1RZ7L 1JYXA 5CZVL 1K5NA 5IMLB 2WBJC 3SKJL 5CD3A 5ADOH 4BZ2L 2IPUG 4Z7UE 1A3QA 3DTXB 3PF2A 3P0GB 1A7OH 1NFKA 2CSPA 3QPQC 3C08L 3HMXL 3FTGB 3F58L 2BY2A 3UO1L 1FSKC 4I77H 5HYQA 4XC1H 2XTLA 1XGYH 1XF3B 4KRNA 3BT2L 5D7KE 5F9JA 5GHWL 3EFFA 4IRJA 4JO3H 4BZ1L 1EHLL 1KIQB 2DTML 4YDLC 5F88A 3MCG1 2Q86A 1A3LH 2PXYB 3PIQB 4JFOA 5FA3A 5FHAH 4D2NA 4LFHD 1D5BA 2H2PC 2YN3A 3IETA 3RGVD 1FIGH 4X5XB 4S1QL 3IS0X 3MOQA 1X5KA 4PRHE 2P5EA 3TVMA 1F4HA 3FHAA 2PR4L 5EOCL 2H26A 3BKCL 1T22B 3SCMD 1VACB 1AD0B 2BDNH 4Z0BL 5MERA 2BVUA 1I7ZB 3CXDL 3B9KB 2XY2A 5CJ8A 3KDMA 5AAMA 3U7YL 4FFZL 3LN4B 2Y36H 4G8GA 4Z7NE 4HKZA 4I18A 3LEYL 1G7PB 4HWUA 1MI5E 2PW1B 3VD9A 3SGEI 2E7MA 4JZOA 3OKOB 4X99A 3G5ZA 3ULVL 2PYFA 2ED8A 4LNRB 5E2UH 3O0RL 5E95B 2RHEA 5EDXA 4YGVB 4F3FB 2ZUQC 3MCLH 5KS9A 4NQEB 1XR9B 3WXVH 3M8OL 2YD6A 3BP7A 3C6LB 4NRYB 3TBYB 4FQJH 4HPYL 3BKJL 3LKQA 4JCMA 3I75A 4J8RB 4KI5E 4MLSA 3H3PH 2R2HB 1FFPA 5DJCA 3JV4B 4LIQL 4PJEB 3L7EB 4WFEE 4M9PA 1ED3A 1QYGH 4ODVH 3K7UA 2YPLD 3W9EA 4AIZB 3WO4B 1MLBA 4PUBH 4LKXB 4FFZH 5TJWK 3DUUA 4IEFB 3DX8B 1FFRA 4GRMA 2AEWA 2PTTA 2VXUH 4NHCL 1I9RL 5EU7E 3F62A 4I0PB 5FUOH 2OL3B 2PR4H 4LHUG 3IB4A 4U1HB 2ENSA 1W72A 4P9ML 4XCCH 2VDML 4EZMA 1M05B 3FJTA 1DANU 3SPVA 2ICWA 2OR9H 2AV7B 3R0NA 1E28A 3R8QA 4DZBB 2HKFH 4QHNB 5K9QG 5IV2B 3W5NA 1VGEH 3TPUA 2AXFA 2HAZA 4NQXB 3TA3C 1NGQH 1F3JA 2P47B 3P0YH 4HV8B 4OLXL 5MEQB 4K3JH 5LWYH 1A3LL 4MNGB 4L8CA 1F2QA 4Z7WE 5F6HI 3WUWA 5MENE 4WHYH 1NC4D 4XCCL 1T6VN 3C6LA 4NRYA 4L4TA 4PP2A 5FUOL 4F15B 2EO9A 4I77L 1TJHH 3VXQB 4F7PA 3Q6GH 4EVNA 3GJFA 4RMSA 4RBPH 4PLNC 4EUPA 5C0EB 4HK3J 3FQXB 3CSBA 5IMMA 1TZIB 5H2BB 4HXAH 1MHHB 1EO8H 1S8DB 3R1GL 2DQHL 2DQUH 4LOUC 1OSZA 4MNQE 1MHCA 5CGMA 3NPSB 5I8KH 1DN0A 4ODVL 1MI5D 4RQQA 2IANB 5DUBA 3VJ6A 3GI8H 5BS0A 1EGJA 1ZA6A 2ZPKH 2R9HC 2YA0A 3RTQD 4D0BB 3HPJA 1RUKH 5IB3A 1WT5C 3V6OE 4GRLB 3MGOB 3V4PH 3WV0A 4DQOL 1KB9J 4ODTH 4R0LC 1IQWH 3AM8A 1J10A 1A6AB 1YZZA 3UTQB 1LMKA 2BC4B 5BOPA 4XWGL 2WV3A 1WBZB 3RJDA 4AK1A 2A6IA 3G5XB 3N1MC 5T33L 3NBNA 2AXFB 5HPMA 4NWUH 2D7TH 3OKLA 2W92A 4NO3A 1DQDL 5ANMA 1BWMA 5ALCH 4PJ7E 4NRXB 2C3XA 1W2KT 1GZQB 2YPLE 2OXGA 3UROR 4JANB 4WFFE 5IESH 3C5ZB 1BZ7B 2C4XA 4KMQA 1YPZA 4OUOA 1JGEA 3QUMB 4NN6B 1JTTA 3HMXA 3EOBB 2Z91A 4HKXA 4XAKD 4MQSB 3MRNB 4X83A 4OFKA 1KGCD 2X9WA 1Q8MA 3OXRA 1UXWA 3SJVB 4HUMB 4M1CD 4KY1L 1GZPB 1D6EA 1LO4H 1UACH 5LAXB 1PYWB 3IDIB 4PJFE 2G75A 1IZKA 2PO6D 3MV7A 2B8OT 1OD7A 3QDGB 4BZYA 3HR5B 2Y06H 5DFVD 4M7JH 3PQYE 1FN4A 3HC3L 1ZSDB 2FZ3A 2A9MH 3QH3B 4ENEC 5EOTA 3Q1SH 4XMLL 3MMEA 4RGNB 32C2A 3DGCR 4PS4H 3I9GH 5EZIH 1V7MH 3KDMB 4PJEF 3KPRE 1A9BB 1G7MB 4I18B 5IFHH 3OZ9L 5CBEA 1F4XL 2JJSC 1RZJC 5TH2A 3W2DL 4AIZA 1RZ8B 5H35B 1QSZA 3BPCA 1IC4L 2X89A 3EJZD 3G5ZB 1WBXA 4ODWB 4FQHA 4JPVH 3GM0A 2PO6A 3MV7D 3QEQD 5JW5A 3QQ9C 4CNIA 3VFRB 1UXWB 2W0KA 4MQTB 2JB5H 3V5DB 3VXUE 1FC2D 3JV0A 4P4RA 4MCYB 1QFUH 3KLAB 1H5BC 4UT9H 1A47A 4WV1B 1JZ8A 5KSUB 4LHUB 3GK8H 2BX5A 3CMOH 3TO4B 1IGIH 3T65A 3V6FA 1N6VA 2B1HL 3T4YB 3MODH 4KK8C 1JP5A 2AEPH 3VXOA 1SM3L 5FHBH 4LVEA 1ZS8A 1UC6A 3K46A 4H1LB 4PGDA 3CPLA 4LLAA 2ERJC 3PDGA 3F65A 3MLUH 5DD3L 1U8LA 1CG9A 3OZ9H 3BMWA 2YRZA 1MREL 1DBML 3MC0A 4WWKB 3V79C 1S7UB 5E8DH 4J3XA 3HUJA 4HHAB 5C08B 2XTJC 2LTQC 1HOCB 4XNQA 1DN0B 2NW3B 5DK2A 4M5YH 4U6HB 4YHKH 3RUGF 3CDFA 3T1WA 3X12A 3D2UA 4DGVL 2P1YA 2ZSWA 1MEXH 4GRLA 1RJYA 3CC5A 5EU3A 3DV4A 3HC3H 4PGBA 3JV5A 3EYUH 3PHSA 1AXIB 5E2VH 5KBNC 3DECA 4K71B 4ZXBB 4FQXC 2BNRB 4GUPA 1M6OB 3KHQA 5HY9A 1P4IL 3HE7B 1BJ1J 5ID1A 3WE6B 1U8HA 1UFUA 2WIIA 5GGSB 3ZKMD 3L3OB 1OCWL 5BJTB 5HGAA 4L3EE 4M6NL 2P5WD 1G0YR 5DUPH 4ZQKB 4XGZA 4N8PA 1OD9A 1RHHA 2IGFL 5IVXB 3IRPX 1NSNH 1UG9A 5FYKH 4P46C 4GG6F 3QFDB 3KR3H 3LOWA 3VI4F 1WC7A 2X1OA 2IWGA 4KKNA 2HH0H 5DD6B 2V2TB 5IMKA 1VFAB 4NWUL 4QCIA 5DRXB 5HYSG 5ERWB 1AKJA 1FAIL 4G9FB 1HHHB 5E8PA 5EUKA 3VXNA 3WFDL 1I1YA 4XWGH 5I1EL 3U7WL 1MUJA 1W72H 2DMKA 2EKJA 3HKFA 3EDJA 1IQWL 5GGRA 3O3EA 3A67L 3U0PA 3TBVB 1LILA 3MA9L 2AJUL 5CBAB 1LNUA 3MJ7B 3OMZA 1MHHA 4XNYL 4L1DA 3O8XC 2E7HA 1T80A 3ILQD 4MJ6A 1DL7L 5HHNA 1OAUL 5I8KL 2CUIA 1IGML 1RIUH 5KOMC 1EO8L 1VFBB 4LRIA 1X5JA 4YUEH 2EIDA 5DWUL 4HIIB 2A74B 4HDIB 3MGOA 2RR3A 3QZWA 3DMMC 3IAQA 3T0DA 1I7TB 3KAAA 4AJ0A 4MS8C 4KUZH 3MRFA 2GYSA 3B5GA 1RJLA 1PG7L 2DBJA 1X5IA 3EJJX 1F8TH 3GSNL 2OSLB 5DD6A 3DGGA 3QUMH 4S0SD 5C0AA 4GKZA 5C92A 1QLEL 3OKDB 4EBQL 3J7HA 3FONB 2X4QB 1FL6A 4JAMA 1I9RH 5HJ3A 5C2BH 1I7UB 5JOFA 1K6QL 4M6MH 5BS0E 1XR8A 3BH9A 4L3CB 3H42H 1IAOB 3ARFA 2X4PB 2QHLA 3B9VA 2GJZA 2VL4A 4C56B 4UINL 1R3JA 5ACLA 2L7UA 3VRIB 3TYFA 3WJLC 3UTSD 3BJLA 3OGOE 5I6XB 3AU1B 1LDPL 3GUTB 3MRLB 4UDUA 1PLGH 4HK3N 1LO5B 1HHIB 3WXVL 4QRSA 1MFEH 1MQ8A 1LQSR 4XCEA 3SGEH 4MLIA 2VDOH 5GRXG 1NCWH 5E2UL 4LLVB 1B0RB 1P7QA 1Z6JT 1HI6A 1ZTXH 4KZDL 5HYSB 3LRGA 3QULB 4PJ8D 5CEXB 4X5XA 3SE4C 3KYMB 1T4KA 5C0BE 1CGXA 2D4DA 5EZOH 4YHOL 4W4OA 2OZ4A 1FV1B 3HUJB 4XP5H 3ZL4L 4GAGH 3CSGA 4OJFH 4XX1E 3FO1A 1I1AC 1F6FB 4PYHA 5IP4A 1O7VA 4XT1C 1S7VA 3R8BB 1ZHNB 4OLUL 1YPZE 1AH1A 3OHXB 1F5WA 1AE6H 3GMMB 1FFNB 3NFPB 4G6ML 3MXVL 4JQXC 2FGZA 2EKSA 5FHAL 2IALA 4I3SH 3TO4A 8FABA 2E6PA 3SEPA 1SYSB 4R97B 3LQAL 1EAPB 4G42A 2WIIB 1ZOXA 1RI8A 4BZ1H 3EUUA 3FFCB 4PJ8A 1KCSH 2YZ1A 4E41B 3BZ4B 2XNAB 4TVPE 1Z5LB 5GGRB 3AXLB 1IEBB 3X17A 2R2HA 3PABB 1I1CA 3VWKC 4PJGF 4JFFB 3WNPA 3JXAA 5FDWB 5IBLD 4MJ6B 4PJFF 2AGJL 4S2SA 4QXTB 1FL5B 3OAYK 5AYUH 1OAXH 3OR6B 1MJUL 3DSFH 3UTTE 1VKXB 4O4YL 2WAHA 2VOTA 2BXYA 4MVBD 1YEFH 3GMNB 2W1NA 3RDTC 4WW1A 1NH6A 1CFNA 3QFJD 3W5MA 1ACZA 1I8LA 4WHTB 3VGFA 3OAYH 4V1DD 5C0RL 1X5LA 4NKMB 3WLBA 5D6CB 3AUVA 1RK1B 4QHNA 3TEUA 4NBXB 3ARZA 4YQXH 1DLFL 3MRIA 2V9TA 5MENA 3ET9F 2JJUA 1IILE 2ATKB 1TJGH 4FHBD 3FQRA 4P5KB 5CHNB 5A1AA 1JZ2A 2O93L 2R4SL 5DMIH 1FBIL 5JXAL 4QGTA 3U4BH 1YECH 4CDGC 2R29L 5FDYA 3QNXA 1A7NL 4OKVA 2RFXA 5FOJA 1CCZA 2G5BA 3F12A 5HHOE 5ESAB 1T04A 1JJUA 5D7LA 2LU4A 5GJTL 1NCUA 3BRGC 1CT8A 2NXZC 3H7LA 1I85C 3FAXA 3OR6A 2IQ9L 4LLDA 5BRZD 5FB8B 4I9WD 2DWEA 3VE0A 2WIMA 3FB7A 3VXPA 3MLZL 3BYYA 3C5JA 1U2CA 5EBWA 2AAVA 5CIPA 3TVMC 3QUKB 4HAFA 4ISVB 3LDBB 4L9DA 2EDXA 4NZUL 1WAAA 4JPIA 4Y5XC 3UTSB 4EUPH 1ZLVH 4UV7L 1ETZB 2F5AL 2EDDA 3WN5C 4ACPA 1G9MH 2H1PH 5IW6A 4IRZL 2V2XB 4LCCA 2EH7L 3KJ6H 3UJJH 1J1OL 2KQNA 2VLRE 4DVRH 5IMMB 2IFFH 1RZFL 1X44A 1JZ7A 1WBYB 4WI6A 1TVHB 3S34L 3AC0A 3NGBB 4L4VE 1FH5H 4R90L 5D96B 1PDKA 4TQEH 2GJJA 4OD1L 2CLRB 3VDBA 5F72S 2FIRT 1EZVY 1DBBL 3TO2B 1JNLL 3EFDL 4J6RL 1QA9B 2MWCA 1ZLSL 1WBZA 5C0GA 5D5MA 4NGHL 3PP3H 3PWUA 3U36A 2R0KH 4D3CH 5IHZA 3QNZB 3ZZ1A 4NKOA 1T1YB 4KK9D 3VFSB 1IBGH 4NDMB 2Y6SD 5CZXC 3V5KA 1I8MA 1DN2A 1BJ8A 1PKQA 5IM7A 1TPXC 4HS3A 4MAYD 3IU4H 3IAGC 3WIIL 2X1QA 4N0CC 4ZAKA 4Z7VE 2XNAA 1TQCC 3BE1H 3EDFA 2DQEL 4KJPD 1OGAD 5HSFA 4HK0B 1YEJL 3PABA 4OZ4A 1QR4A 1ZHNA 1JWSA 2IG2H 2OXHA 3HRPA 1BQHB 1U41A 1KB5A 3KYNB 4CMMA 4R0LA 4KTDL 3I6KB 5BW7C 1X5ZA 2VABA 5MEOB 1R3HB 4YHIA 5F7WC 1Q9OA 5EORH 1HHIA 4YC2B 4NQDA 1YMMB 3I6GB 2E9BA 4HJGB 1MHEB 1T5WA 3VGBA 4JJ5B 1J8HD 4KVNH 2XWBA 4GG6E 3JVGC 4MCYA 5JUEH 4P9HH 5FKPA 2VZTA 3N85H 4HS6B 4I13B 3FCTB 4MAYA 4NZDA 1Q72L 1BD2A 3WNMA 4NCC1 4PJBA 3OF6A 5DK3A 3VU2A 5GS1B 4JJHA 3T4YA 4NO0D 2VO5A 4GMSL 2ATKA 4PRHB 3Q0HA 4G80B 4OIIL 3SGJA 2OP4L 3HI6L 1UH4A 1U8MA 1CXKA 1KIPA 2GITB 1F00I 2NZ9C 5BV7B 1BMGA 3VCLB 2AEIT 1TTUA 4DFIA 1F3RB 5TGBA 1GOGA 4HZAA 4NSKA 3WEXB 5D1XC 4Z6AT 2G2RB 5I8OH 1VADB 3LRHA 5JW5B 1SBSH 1KTKE 4X6DB 4G8GB 2NTFA 3EYOA 3X3GH 4HIXH 4LL9A 3MUGA 2DRUA 1NCCL 2Q8BL 4ODUA 3LEXB 1T2XA 4I1NB 4FTVD 1AD9B 5TPWL 2XI9A 1JF6A 4PJAA 3V0VB 4Y4HA 2R8SH 3CDGA 2VLLA 1KCVL 4GUPB 4DK6A 3DVGB 4LK4A 2NLJA 4NM8H 2R0WH 1FZKA 1X6LA 5I15L 4UOW1 4D9QE 3MUZ1 4LQFH 3IXAB 1ROWA 2XPGA 3ARBA 4LLUB 4X9GA 3T2NH 3P4OB 5DFVC 4RGOH 2D3VA 5IR1B 2GSGA 3NH7H 2EDOA 5I18H 3GEWB 1A6VH 3V0WL 1XGUB 3HFML 1RUQH 1EPFA 4LQFL 4NIKB 3EYVB 1DE4A 5I15H 4LCYB 5T1KD 4LOUD 4WHTA 1BWWA 1W0WB 4QRTB 4U7SA 5EWIL 1YEIL 1T1XA 5TFSL 1CVSC 1X5AA 3RIAF 1KCVH 4K8RL 1PSKH 5CGTA 1LE9A 3UP1A 2R8SL 2Q76B 3UJIL 3WFCH 4PJCE 2UWEF 1KJVB 2GTWB 3L3OA 5BVJA 3DXAB 1YEHL 3RNQA 1JPFA 4OZIF 5HPOA 5EBLA 1NEUA 4Y19A 2Z35A 4WGVB 3W11C 1WBYA 3MV8D 3CDGB 1QTYT 5DJDA 1RZJL 3GIVA 1HHGA 4LEXL 4JY5L 3SQOH 4HQQH 2ZUTA 4NNYA 4YHZL 3RI5F 3HC0B 2Y4SA 2DM7A 5IVXE 1NGXB 3RWJA 2VQ1B 3C6LC 4QRQB 3VGDA 1CGUA 2MHAA 3WIFA 2DLTA 5FM5M 3KVQA 25C8L 1ZA6B 1E28B 4DZBA 4PYGA 4HUUB 1Q9KA 1OM3H 4NP4L 4KJPC 2UYLB 3SE8H 3BZFB 3VD7A 2Q8AH 2YSSA 3BHBA 4EKXA 1EEYB 5AYQA 4NN7B 2A77L 4JN2B 2OJEA 1CBVH 3WD5L 3WO4C 5DQDL 3ZYZA 2Y07H 3M1BB 3LS4L 4ORGB 4LHUD 1R5IA 2B5IC 4P48A 4XTRD 4CGTA 3DJ9A 2HFGH 3OX8B 1K2DB 2V6HA 4UQ2A 5C71A 2H45A 5SV3A 2V7NB 4JHAL 5GISL 4M8VA 4CL7A 2MPAL 4XNUH 5E08L 1Z2KA 5E2WH 5D6DC 5CINL 4KTDH 4ZFFA 4ZS7H 4FN0A 3GMQB 4L8BA 1RU9H 3MCKA 5D7JC 1D9KD 3WSQL 3BWUC 2PKDA 3W39B 3MJ6A 2QQKL 3G6DL 4HUVB 5EA0L 4L9LA 2NX5B 4QY8A 4F15C 5E1AB 5JTWA 2X4TA 3RX8A 2X10A 3RVVC 1VA9A 4MJIB 2FJGA 5F7EL 1YNKL 1FNSL 2BVTA 3V7AG 1Q9LB 2VJXA 2VDPL 3SDXA 3NZHL 1JPGA 1X4XA 3GSQA 2R56L 2BRQA 1FVCA 3ZYIA 3KPMB 5KW9H 5C0FB 5I1IL 4Y16A 2BSRB 3SDCA 4R26H 2ATPB 3KNBB 1CK0L 1RAMA 4K9EH 4LVNC 3LH2H 4Y2DC 4NM4H 3PL6D 2APWA 3KG5A 5C0JA 3G9AB 2AEQL 4GRLC 1IC7H 4ERSL 4M6OH 5DJXB 1DUYA 3MJ8A 3THMH 4PRHD 1KCUH 3OKKB 4MJ5A 1WFTA 5I16B 1QBAA 1MCOH 3DIFA 4PJ9B 5CWSB 5B22A 3R06A 2CKBL 1A3RH 5DR5H 5INCA 1KCUL 4YDIH 1BIIB 4MDIA 2MCG1 2QHRH 4JLRB 3TT3H 3ILQC 4JKMA 3AAZA 2EH7H 2LVEA 3KJ6L 4WU7A 2O61B 3LVEA 1T7ZA 2VMFA 3RY5A 1P5UA 5AG8A 1CK0H 2EIBA 1JUFA 4YHPA 1KPRB 4BSVB 4W4OC 2FNBA 4F7CA 2EYRB 1HI6B 3GDBA 2ZSVA 1LHZA 4NZUH 4OZFG 5E8NB 1YQVH 2HWZH 1I3GL 2IADB 4E5XA 5E2TL 3B8YA 3MV8B 4QRRA 2FB4L 1F97A 1E0OB 5GGQL 4LLUA 2VSDA 1FQ9C 3JSSA 4DGIH 2P44B 3L7FA 4Q97A 5CD3B 1D5ZB 4D9RE 3QI9B 3QUYB 4NQTA 4MAUH 1AO7A 2WLYA 2V17L 1T1ZB 1CGWA 4KDVA 1G7IB 4ZS7L 2Q7YB 3RWJB 2F54B 3WS3B 2VLKD 3EFFB 3X11A 2EECA 2IBGA 5K9JL 2DMBA 5DDHA 2PW1A 1AGEB 3GKZA 3WNKA 1HXMA 3RWDB 4MB3A 5I73B 1BECA 3T65B 3V6FB 2UYLA 1DBAL 5GRUH 2UV3A 4LKCA 3B9AA 4NGHH 1J0KA 3TFKC 1OQOA 4P5TC 1KBGH 5TQ0H 1U3ZA 5F3HB 1EV2E 1EFXA 4MXVE 3TCLB 3VFNA 5FCUH 2B2XH 3VFPB 5I1KL 4PJ7A 4RX4A 3O4LB 1AR1C 1YMMD 5EO9A 2OJZL 1C5CH 3FT4A 3ALPA 4XPTH 3DSFL 3H9SA 3M07A 4R2GB 1U58A 3QCVL 2H26B 1LEKB 2CK2A 2WMPA 4X6BB 3BRDA 1EA9C 1HXYA 4QRQA 3GMPB 3UMTA 5B38G 2J3SA 2A0LC 1ZHLB 3GJFK 3DYMA 4I5BA 3FQUA 3LD8C 4WHDA 3THML 2KH2B 5E56A 5KANI 5MI0B 5KSBE 1OB1B 1OGAB 4JY5H 3BQUB 3VA2C 4KJQD 5I75C 4PG9A 5T1MA 2R23B 3A6CH 4KJWD 1RJZA 2CO6B 3BP6B 4UU9B 4XPBL 2CR3A 3X11B 2UZIL 1QFOA 3MQIA 1GGIH 1W72B 3T3PF 4YAQA 3LMJH 5ERWA 3BP4A 1NUNB 4K8RH 4PGCA 5BCAA 2IQ9H 4L8CB 4X4YB 1A6PA 3RVVD 4HJ0D 1CFVL 3G5YB 5LXGL 4MYWB 4XPFL 5K9KB 4MXQD 3O4LA 1QUNA 1IEAB 5GRWA 3LRSB 3ILPA 3FQXA 4K71C 1NJ9B 4FQXB 1MQKL 4JFHE 2NXYC 1AIFB 2NR6C 1KLGA 4PRPE 35C8L 1J8KA 2IANA 1M05A 2H32H 3DPBA 1JNJA 1HCVA 1BIIA 3SO3C 1NDGA 3N1QC 3GNML 2NTSP 3CVHA 1KC5H 1HILB 1H8SA 5ILTH 2EYSB 5CILL 5DURB 3FQWB 3RHWK 5I66A 5I1HL 4L4TB 4PP2B 5T1LA 3V5HA 5CGYC 5EUOF 2YK1L 1GHFL 1SJHA 4F7CB 2Q8BH 1YMME 3TBSA 5J0BA 2YBRB 3KLHC 4F8QA 2HVJB 4F7TA 3DUUB 1ES0B 1WAAE 4JFFD 4XP1L 5T3ZL 1SBSL 4C55A 3QJFB 4JRXA 4UINH 3KS0J 1BQUA 2HTLC 2F8XC 1U95A 1RZGA 1CYGA 2BZDA 2BOBA 4RGMC 1M71B 5EU5B 4UQ3A 2OP4H 2FRGP 4AEHH 3HE6A 5HVWA 1NMAL 2OCFD 5F1IA 4GMSH 2W38A 3N1GC 1YEKH 2NZIA 5D7LE 3BUYA 3CDYA 3FKUS 4WW2A 1FNLA 1NCAL 5C8JB 1MIMH 4EBQH 4OZIE 1PKOA 2PN5A 1PZ5B 3WUWB 4TULH 4D8PA 3B6SB 2XZQL 2YMXL 3FMGH 4X7SL 1UM5L 3MREA 1BVLB 3ZYJA 4JAMB 1KUMA 4YIQA 5DHYB 5D1QC 3DMMB 4M1DH 3BEVB 1J87A 4MA3B 4GAJL 1I3UA 3QDJA 4Z0XB 2GSIB 3KPSE 4YFLF 1BD2B 1DSFH 1T03H 3ARFC 5GZNC 2EZ0C 3IJSB 5HYJB 1Y6KR 1JFQL 3LV3A 5DWUH 5FYJL 3T2NL 4YUEL 2BERA 3U9UA 4YHOH 2R69H 5LQBH 5B38B 3RWCB 5KZCD 3OG6B 3KPPB 1MCPL 5FF6B 2EDFA 1P7HL 3V7MA 4LBEA 3GMOB 4HT1H 2M1KA 3CFEA 1B0WA 2VDOL 4LSSL 4Z7VF 1GZPA 5TDOA 2CXKA 3LSOA 2X9YA 4HX1A 3NFNB 3CFCH 4FXGB 4G7VH 1GGUA 5I8EA 4HJ0C 3BO8B 5KVFH 2R0KL 4RAUA 2JCCA 1C16B 5C6TL 4XWOD 4UBDC 4F33B 1F4YL 2KBGA 3A0OA 1OWWA 5I6XC 3BIKA 4TRPL 4DAGL 1DBBH 2VLJE 2IAMA 1D6VH 4YFDB 1AO7B 1IEBA 3EO9H 1RIVH 3O2DH 4JVPA 3T0ED 4DK3A 5CEZE 1CGSL 3ROLB 2DS4A 4X8JA 3TJEH 2X1PA 5I1GL 1IEAA 1B0GA 1U8IA 1K6QH 3BP6A 4UU9A 1E4WH 3W9DB 3LEXA 4P2QD 4J7RA 3VG9B 3NIFE 1S5HA 3STBA 4F58H 1MCRA 3HCVA 3VGHA 5BMFH 3VFRA 2GW5A 3E3QC 5MP6L 2W9EH 3I02B 2BXZA 2ESVB 4PY8I 5CD5D 3SE3A 3S5LB 2DDQL 3FB8B 1AXTH 3MNVA 3T8XA 1HILA 4QHKJ 4OT1L 3QXUA 4F2MB 3MACH 5FGCB 1T0NA 1JWUA 5JIKA 5T3XH 2J2ZA 3LZFH 2FR4A 5DS8B 1BREA 5SWSE 4M5YL 5C1MB 1B3JA 4HLZG 5D7SL 4JRYE 4NJ9H 4DWHA 5C6WH 1A22B 3RP1A 4OKVB 4XBPB 3NA4A 2DM4A 1OAUH 1DBMH 2O5XL 2VC2L 5ESAA 1J88A 1T89A 1NKRA 3LPWA 3DX9B 1WITA 5DJAA 1KCRH 4LSUH 3B5HA 3Q3GB 2ITDA 1H0DA 1B4JH 4JHWH 3KLHD 5DD5H 4NKMA 4Y4KB 4PBWD 1VFAA 4QCIB 5FGRA 3L5WB 3M17A 5HHOB 1SYVB 5D1XD 4P23C 3EOAB 1XMWA 2HTKC 3FT2B 4RISL 3IF1A 3HAEG 5FM4A 1RZKH 4CVWA 1R3LA 5IFJA 3L3IA 4U0RB 3UTZA 1RHHB 2EIZA 4IJ3B 1SJEA 1U95B 5HYJD 2Y6SC 5CZXD 3SKNB 1IC4H 1KXVC 1EX0A 1MJUH 3S4SB 4HKZB 3VH8G 3IJSA 4NUJA 1C08A 5IEKA 2Z31D 4URTB 3MV9A 1RUMH 3VDCA 1MSPA 3LV3B 2FBJL 3IDGA 2IC2A 3NIDE 2R2EA 4DVRL 5IMKB 1X4ZA 1J1OH 1Q9KB