3GHEH

Crystal structure of anti-hiv-1 fab 537-10d in complex with v3 peptide mn
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
229
structure length
222
Chain Sequence
b'QVQLVQSGGGLVQPGGSLRLSCVASGFTFNNYWMSWVRQAPGKGLEWVANIKQDGNDKYYVDSVKGRFTISRDNAKNSLFLQMNSLRAEDTAVYFCAREFSSYTDHLEYYYDYYYMDVWGKGTTVTVSSASTKGPSVFPLAPGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYTCNVNHKPSNTKVDKRVEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 537-10D, light chain
publication title Structural basis of the cross-reactivity of genetically related human anti-HIV-1 mAbs: implications for design of V3-based immunogens
pubmed doi rcsb
molecule tags Immune system
total genus 42
structure length 222
sequence length 229
ec nomenclature
pdb deposition date 2009-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3gheH01
4TUKH 3GSRA 1DUZA 3EHBC 2I07A 3GDBA 1QSFE 3PWPA 2EH8H 3QZWG 3HRZA 4L3ED 3VE0A 4HKXA 2BVPB 1U58B 2BFVL 3LHPH 2DQTH 3DLQR 4KDTA 3U6RB 4BYHA 1RZJL 5C0AA 3C6SA 4OLEA 5C0CE 3N50A 4Q7DA 4KVNH 3EO0B 4IOIB 5AZ2L 4QNPE 5FFLA 4U1HA 4NQSB 3TLRA 1NAKL 4OCWH 3O6MH 4U1SB 4X6CF 2X05A 1YDPA 4A2LA 4FQJL 4BK5A 3SDXF 5J6GA 2BZDA 1EAPA 1MFNA 4XP1H 3I6KB 3MNZB 3CPLB 2YPLD 1CGYA 3P30H 3VGEA 4HPYL 2RQ8A 3QDGA 3W2DL 4G5ZL 4ENED 3LQAL 4Y4FD 3BRGC 5D6CB 1ACYL 1ZE3C 3QZWA 3V7MA 3P4LA 3PL6B 1WTLA 4GAJH 3UTTD 5HI5D 2A6JA 3NPSB 4BKLB 5INDA 1KCSH 3UJJL 1ZHNB 4MNGA 1DL7H 2VLLB 3STBA 1OPGH 4KUZL 4TOYL 1OAYL 1IRAY 2GIYA 5JMOC 1KT2A 4G8IA 3REWB 5BV7H 5TFSH 3MV9A 4OF6A 3I6LD 5KVGL 2NX5E 2DDQH 3LDBC 5D2NE 1KENH 1FGVL 3BGFC 3QXVA 5EG6C 2CRIA 2OTUB 4I5BA 3LV3A 2XA8H 1DQDH 4PJGB 4Y19E 2NTFB 3RTQA 2BSED 4BZ2H 5DVMA 5C92A 4XMKH 2GSIA 3BH8A 3FO9B 2CQVA 3GI8L 1QR1B 1DJSA 4QHUB 2RR3A 1QYGH 2JIXB 5KBNC 5K9KB 5HHPA 3H42H 2EEDA 3H0TB 5HVHC 2R1YB 1FO0B 5CWSB 1E28B 3KPLA 1MF2H 2N7AA 4M3KB 5HHMD 4ZAKB 4TQEL 5TDNA 3SDDB 5F3BB 1QQDA 4H88H 1FH5H 2HWZL 3GSQB 3IGAB 3MCKB 4ODTH 3HI1B 4QHNA 2QSVA 3DJ9A 1B0GB 1BM3L 1U95B 2BVQA 1ZHBB 4H20L 3U30C 3DXAB 3UPCA 3TN0A 1OTSC 4OLVL 1CDUA 4ZFFB 5J4MA 5KG9B 1QFUL 5I74B 3PWJA 4LNRB 4JB9L 2YPKA 2ATPA 4OQTL 4POZD 1F3RB 3HUJA 5FKAB 1XF1A 3SKMA 4XI5C 1F6LL 5C07A 1F97A 4CU7A 4PFEA 3V4PL 1DSFL 1F2XK 3P11H 4NSKB 1U8LA 2OL3L 2GJJA 1PKQA 3UXFA 5F8QC 4PLJD 4HWBA 3QDGD 1DTUA 4IRSB 2ADGA 3MMEA 2WWMC 3O4OB 3MRLA 5FUZH 2DQCL 2LAAA 5D2NC 2HYMA 4EXKA 4LARL 4OLUH 3WO4B 4D3CL 3D85A 3PGFL 2VR5A 3PP3H 4CN1A 3NIFE 1ZLVH 5E9DE 3K81A 2BNRE 4HWUA 4KZEH 3MOAH 2VO5A 5CMAB 1R3HA 3WBDA 2ADJB 3DUSA 3B6SA 3IDYB 4NQCA 4D9QE 1NKOA 3MV9D 2G60L 5MENB 3GMMA 4CBPA 1F4WL 4TTDD 3SDYL 3GMQA 4Q2ZB 5EOCJ 1HN1A 4YQXH 1KNOA 3BP6B 1KCLA 2FX7L 2P7TB 5DUPH 1LNUA 5CS7A 4P2QD 3LKOA 1EPFA 3LMJH 5DC9B 3R0NA 4Z7VA 3S3PA 2Z35A 1MFAH 4NRZA 1JGVL 5C3LD 3ARFA 3BMVA 2P5EE 4UBDD 1NEUA 2YSSA 3OMZA 3MRCB 4JFFB 2ZP0T 5EBLA 3G9VA 3V2AR 1BEYH 2HT4C 5DO2C 3UDWC 3QIWD 4R26L 3TZVA 3KYOB 2JB5H 1J1XL 4PJDF 3LKNA 1NBZA 5CILH 3SGKA 3VXUE 3EZJB 4LFHG 2L7UA 1MLBB 2BOBA 3SJVB 4AG4L 4NCC2 5E5UB 2GK2A 3OKMA 3TGXA 4GXVL 3OGCB 2NY0D 4JRXB 2IPKB 3D0VB 1CE1H 1D5IH 5IFJA 1NBYB 3MRGB 3D0LA 5LBSH 2XACC 3TN0D 4D0CB 1KYOJ 3QUMA 5JOFB 1ND0A 3T4AB 5A2LH 5ENWB 5BJTB 2V5RA 1OAZH 2EDWA 5F9JB 1JFQH 4OCRH 1C1EL 1BJ1H 2UZXB 3FQNB 5D71L 4BZ1L 5KSBA 1ES0B 1ONQA 4C56D 4HZLA 3RWIB 4ZODA 4KMQA 4MJ5A 4S2SB 4NNXA 5EBWB 1JYVA 3QDJB 1YUHA 3GM0A 1JNLL 2V2XA 1NGXB 3IDGB 3ULUD 4HK3N 5T1LB 3KHQA 1VDGA 5HDQH 2VXSH 4XPHH 2OLDA 5DQDL 3MJ6A 3VXMB 2OSLA 1T1YA 3WN5A 1BJMA 4UV7L 3JWOH 2P46B 3MJ7B 1PZ5B 1GJIA 3FTGB 3D85D 3V7AG 1MIEL 5A3IC 2FJHB 4YDVA 4HS8H 3SDCA 3ARZA 2VZ3A 2CO6B 4L8SA 4NQCD 2VKXA 4Y2DB 1J8HE 2Z92A 4CJ0A 4E41E 3H7LA 2DQJH 3BD3A 2JK5B 2H3NA 4ODUB 4N0YH 1RVFL 5BW7A 1CE6A 2Q76B 43C9A 5CJ5A 2AP2A 1R24B 3INUH 5ITBL 5BVJB 3ZE2F 4KXZI 5MHSD 3LKQA 5E4EB 5IB5A 5CP7A 1EHNA 1NAMH 3IJHB 1BP3B 4ZPVA 1FZMB 3ARFD 4MAYC 1Q9WB 3X11A 4WEUD 3RWDB 3TJHD 4F7EB 4F37F 2BDNH 2BVOA 1XGUA 2VXVL 4PJBF 4HJGB 1V3JA 3QB7C 1URLA 4HLZG 2IANE 1H8SA 1J1OL 4X8JB 3ZYOA 3K2UH 1CGTA 3AXLB 1QP1A 5B39G 5DD0L 1NUFA 3QIBB 4OQ1A 5I1GH 5KSAA 4HFUL 1YEFL 4F2MA 2IPUK 1EO8L 1LO0L 2ARWA 4IOSD 4S0TD 2NNAB 5DWUL 3TM6A 1YEDA 2AEIT 4PJ5E 4JFOB 4ELKA 1KB5H 1N6VA 3GHEH 4R9HA 1IGYA 1OD9A 2XWBB 3RY4A 4KHTL 1AQKL 1KPUB 3PL6D 3KAAA 4U6YB 4N1EA 3MUHL 1S7QA 3TPUA 3HG1E 3ARGA 1H5BB 5JXAH 5E2VH 5D7JA 4X7SH 5ICZA 2IGFH 1H0DA 4AIXA 3IDXL 1CZ8H 2LAGB 3S34H 4ZG1A 4NYLA 4GJTB 3AAZA 2C3XA 3X14A 3SKNB 1W72H 2GJ6E 2ZNWA 5J06A 1JNNL 4K7PL 4MZ2A 3MROA 3OXRB 1NL0L 5I1DA 1WFUA 1BGXH 2J8UF 4N0UB 4N9GB 1G6RL 2Q86A 5D1QA 1AH1A 4MA7L 5F93C 3WLWD 4LFHD 3U82B 1KXTB 3C08L 5B39A 1OAXH 5K9JL 4XBEL 4HJJH 1JPTH 5DK2B 4YC2B 4J3VA 4LU5L 3N1MC 5LQBH 1X5AA 4U1LA 3SDCD 4MNHB 4LCCB 3QH3B 1G1CA 4KC3B 5ISZE 5GS0D 3U7WH 5CBEB 1H3UA 5DQJB 1ED3B 2A1WH 3B5TA 5J1SC 1KIQA 1XGPB 3VW3H 4Y1AE 1JZ7A 3UP1A 3O6FC 1PW3A 2J8HA 2CUIA 4K94C 4WENB 1S7TB 2DLHA 2NYYD 3QQ3A 3VWKB 1INEH 1R5VA 2CMRL 4BA8A 3O6LH 3RVWC 1YMMD 4PJCB 3RZWA 3UBXG 3DV6B 2WBJC 2P8LB 4Z7WE 2UY7A 4JFZL 1FPTL 1VACB 4ONFL 3EJZD 1C5CL 5EC1B 1WAAE 2CR3A 5DA4A 1KIPB 3V0AC 5EO9A 3CDFA 1OP3H 1KJVB 1RHHB 3BKYH 4OZGA 4YUEH 3RBGA 4WHYG 5KSAD 2MMXA 2OL3A 1NGZA 1MPAL 1A47A 1MRFH 1W8OA 2AEWA 2CKBL 4GBXB 3UMTA 1FL3B 2DQUH 1SHMA 2XPGB 5IMKB 3DO7B 1U3YA 3TO2B 1FYTB 4JLRB 2ZUXA 1DDHA 4I3SH 4Z7QF 1UWGL 4FFWC 4ACPA 1JF5A 3X3GH 3FB7A 2DYPA 4ZO9A 3EO1B 2W0FA 4EN3B 3OWEA 5BZDB 2DBLL 1AD0B 3UJTH 3QJFA 1HIML 3ARQA 4M5ZH 4JY5L 4HKJA 3IKCB 3KJ4C 2JCCF 2XIDA 2YS4A 3PWUA 1LK3H 4X0KA 5D7JD 3WL9A 2B5IC 1F2QA 3BO8B 1QO3B 1NGWA 5ADPH 1SJEB 1A4JA 1EGJL 2R9HC 2VDQL 2XQYK 1T83A 12E8L 2PXYA 4NUJA 1NCDH 5EO0A 1CXEA 3UO1H 3EYOA 1OB1B 3UBXA 3D3VB 4LLUA 4ZFZA 2P8PA 3MGOA 2NY2B 1QPPA 4RAVA 5E8EB 2C3HA 4M62L 3BP7B 4OCXH 1JK8B 3KPRD 5D1QD 2ZUWA 4U1GB 3TWCH 2I24N 5GGTL 1RZGA 3WIHL 3H9SB 4UTBH 1UQSA 2BHUA 1BF2A 4XTRD 2FX9H 3NZHH 2R2EB 5DJCA 4X6CB 3MODH 4P59H 3GFUA 2B7DT 1FZKB 4Y4HC 5F9OL 5DUML 2Q8AH 2DM3A 2K7QA 2PO6A 5D72L 5KJRL 3F58L 3BZ4B 3QR2A 5FUCC 3BIKB 4PB0L 2XY1A 3GMPA 1KN2L 4JO4H 3S4SB 1RIHH 2CLZA 2DOCA 1BFVH 1A6AB 2ZOKA 3MNWB 4XXCA 3LS5H 5D70H 1I8MB 1RPQA 1OL0A 3L3IB 3ULVF 4OF0A 4OM1L 4PBXA 1WISA 2ILLA 1I9JL 1B0WA 1CTNA 3O8XB 1AC6A 4BH8B 1HQ4B 3B3IA 4YGVA 1GC1L 1V7NL 3V4VH 2UZYB 4GAGH 1FFPB 3GKWL 1NC2B 2X1OA 2Y72A 3U0WH 1H8NA 5JHDE 1W0VB 1ZVSB 1NCAL 2EYSA 4LKXB 4JDZA 1HXYB 1II4E 6FABH 3QUXC 4TSAL 5ESAB 3WFHB 5JO5A 1T5WB 3RHWK 2OXHA 4HAGA 5DHVB 1T0MA 2CIKB 1MVFA 1OSZB 3ZDZF 3QIUC 2XG4A 3FOMB 5I30H 1M6OB 2IAMA 4Z7UF 4LQ1A 3T0DA 5DRZB 3VXMD 1ZLUH 3C09B 3CH1B 1FFQA 1JF1A 1BQSA 1CGUA 1HHJA 2GITA 1LP9F 2HJFA 4HAFA 4OKDA 5HHOE 7FABL 3BEWA 5IVZA 1MFEH 3C2AL 2PXYD 1Q8MA 4OZHF 2DMCA 4J8RB 5D1ZB 2DD8L 5L7XH 1XF2B 4Y2DD 1J1PH 1JWMA 4ZXBC 3OR6A 3WFDL 3NABL 2HTKD 4R0LB 1DANU 3JV6A 3NCYP 1UGNA 4XXDB 3M17B 4Q9RH 5J12C 4HWNA 1M1SA 3UTSB 1I9IH 4GKNB 3T1WA 2PYFB 4MX7A 4JR9L 5E94A 2XI9A 3MLXH 4PB9H 3QCTL 2O5ZH 4IIQA 3LIZH 3VD4A 2HH0L 2J3SA 3W39A 3VMOA 1T66C 3PP3K 2Y06H 1A1OB 3GMRB 4LLAA 4PY7B 4UQ3A 3MXVH 2PO6D 3T77B 3TH2T 1KB9J 1FNAA 1U42A 4QOKA 3S37L 3OHXB 3RNQA 2J4WH 2I60H 3OL2A 5C2BH 4BJLA 5F44A 2BVUA 3BQUA 3GRWL 5I1KL 4LLYB 4LSQH 4X9IA 2W60A 3QIBD 4JPWL 4DEPC 1DANT 2E5EA 3CSPA 4JG0H 2WK2A 4PJAE 5D6DC 1CFTA 3D2UA 3EFDH 4MDIA 3VDBA 1G9NC 4JQIH 4UT9H 1IQDB 2VYRE 4MJIA 3FQXA 1N59A 4HUKB 3F62A 5I71B 4UU9A 5EU4A 4CDGC 5CLWA 1G7JA 5KVDL 1DN2A 1A21A 2Y5EA 4M61B 3RHWF 1NMAL 4JHWH 4LSVL 4MXVF 1D5BB 1BVLA 4NWUH 4MCZA 1ZGLP 2X4TA 5LCVH 5B3JE 3QCUH 4FQHB 5SWSD 4OCLC 3CX5K 4ZSOA 2FYYA 4PRDA 1F11B 4JKWA 4X7TA 1GRWA 3KNBA 1A14L 1G6RA 1UXSB 1MLCA 1BIIA 1S7RA 2X4UB 1U8MB 5C6PB 1AJ7H 3PNWA 5A16B 1GAFH 3VFNB 2WP3T 2UZIH 1X5KA 3PHOA 1OTTD 3BP5A 2MQCA 3QYCA 2IC2A 32C2A 3EO9H 3G6DL 4PJDB 4X9BA 4TUOB 4R7DB 2FL5A 5DVOA 4DFIA 4JJ5A 4YHZL 5I1AB 1HSAA 3MLSH 3UTQB 1U8IA 1F58L 2BOCA 4UQ2B 3ELAT 5DDHB 1RZKC 5FOJA 4MNQB 3IAPA 4FMFA 1LD9B 1U8KB 1ORSB 2R1XA 5L2KA 4KHXL 1MQKH 1U8HB 4POUB 4OBSA 4DVRH 1NDMA 1M7IA 4NQXA 1N8ZB 1OP9A 2A6IA 3RL2B 5D1XC 2EICA 1NGYA 1EEYB 2HKFL 1BQHA 3ARBC 5JW4R 5F7UA 1L4IA 2M2DA 3H9ZA 3C5SA 1I4FA 3GIZH 2NY4B 5F89B 3DVNB 3U9UA 3VG0L 5BS0E 1P2CB 3VWJC 3BQUD 4PREA 1QNZH 4WRLA 2X4OA 4WHDA 1I7RB 2CKBA 2DLEA 4PJ9B 3D2UD 3L5IA 3QEHB 4F33B 3PWLB 2FB4L 4X98A 4KKNA 3J7HA 4KI1A 3CSBA 3H6JA 1EEQA 4G7YH 2X4RA 4Z7NF 4UNVA 3P0YH 2ZUQC 3HE7B 5IP4A 1PYWA 1OAUH 4HEPG 1ZS8A 3FO1A 4OLWL 4YNYB 4U6VL 1LK2A 2H2PD 2EDYA 4Y7MA 3OAZH 1U3HC 5D5MA 2NY2D 3I2CH 4KRLB 1KELL 1J0JA 1G9MC 3G5VA 1EVUA 4X5XA 4JZOB 1ZA6A 5GGTA 3WIHA 4AIZB 3K74B 4G6KL 4D0BB 2CH8A 5F7DB 1Z5LA 1CK0L 3GJFH 3BZFA 3CSGA 3JWDH 5DS8B 5IVXF 2VITB 3SO3B 4LVNC 4P4RA 4PJBB 4OB5L 5IF0A 1RURH 1UG9A 3PIQA 2E7CA 5F6IB 1H3TA 1ZT4B 1I1RA 4FFZL 1MHPH 3GMOB 3LH2H 3PABA 5EC2A 3IDMB 3CFEA 2A9ML 1VSCA 2VDML 4AENB 5J11B 2BMKA 4O2CB 3VGHA 4CUCA 3O9WA 5C0EB 3VI3E 2AVGA 3OAYH 2VLJB 4KPHL 3E8UL 3O8XD 4X80L 3L3DA 3VFOB 5L2KD 5JLZB 1ZSDA 3MUGB 1RK1A 2QEJA 4JANA 4CADB 3FZUD 1CT8B 4AY0A 2FSEB 4ZD3L 4MAUH 1A6TA 1OT2A 3RWJA 2X4NB 1S9XB 3E3QE 4RMRA 4PJ8A 3SBWC 1C5BH 1NFDA 3WIFA 1X5LA 5DRNA 2Q7YA 1AGFB 1U92B 3GB7B 3F7VB 3HZKA 5JR1L 3NFPA 4U1NB 4M5YL 4MD5B 1Q72L 2XRAH 4RMQA 3QWRA 3VXPA 3L1OH 1PQZA 2J8UB 4XNMB 1ERNA 5BQ7B 3QXDA 3QA3B 5IIEB 1ZVHA 2G5BA 4K3EH 4HUUA 3QG7H 3PWPB 4KH2A 1CGVA 5LG1A 5HYJB 5DXWA 3F5WA 3X12B 3NPZB 1N6QH 3TA3B 5HDOA 3WXVL 5E8OA 3C6SB 3UYPA 4QCIA 4PGJA 2GSGB 2AJZA 3QPQD 4BFIB 3CZFB 4HUVB 4Z5RB 4DQOL 4IOFC 2VB5A 5I1IL 3ZT6A 4WCYH 5K59E 4ONHB 1ZGLA 3ULVL 2F9BT 3QXAA 5KOVC 5F21B 2YOCA 3LPGA 1AE6L 1F90L 3VFUB 4XAWH 4R4FH 4QYOB 4GKOA 1BVKB 4EI5B 1R5WB 1TENA 1UKQA 4J1UA 1J0IA 5KS9E 2X5PA 5A2KH 4TUKL 3AY4C 3DVGA 5DTFB 5T1KA 4YHPA 2EH8L 3TYGH 1I85C 1RJZA 1QBMH 2DQTL 5F9DC 1D6VH 1X7QB 1JZ2A 4N1CA 1R3IL 4RGNB 1WBXB 4GUPB 3QQ9C 3GRWA 3UROR 2X1XR 3GMLA 4FN0A 5CD5D 3O9WD 4KVNL 4O51B 1HZHH 5FGCE 4X9HA 1JGLH 3Q3GA 4G8IB 4OCSL 2GY7B 1HH6A 5EZJA 4OCWL 4PRBB 1JZ6A 2OJEA 3L7FA 1A9EA 1TCRB 4YHMH 4GS7B 3VXTA 2JCCB 4MA3A 2FZ3B 2FHFA 2H2SD 1IGJB 4PJ8D 5DEFB 1LEGA 2EDHA 3RTQB 1RUPH 1KXQE 4ODHL 3VFSB 4P46A 1AGCB 2I5YH 1EEZB 2XN9B 3RY6C 4IRJC 3UX9B 1ZLWH 5CJXC 1MFDH 3QWRD 1A64A 2VR4A 4JKLA 4FQXA 4GAJL 4P4KB 4DCQA 3KPLB 1HHIB 4E0RA 2YPLE 4KK9D 2FIKB 1KCSL 5ICYA 1D5MA 1JTTA 2SEBA 2UYLB 2FCBA 5DEGB 3MBEC 4Q0XH 3OGOE 5C2UB 3BI9X 4HC1H 1F6AA 2DDQL 5EU3A 3V8OA 1BLNA 3QUKA 5EWIL 4F7TA 1T7YA 1KENL 3WDHA 1ZMYA 1YJDC 1JN6B 3EJYC 4FP8L 1HOCA 1S7XA 2WBKA 4LLMA 3TO4C 3R8BB 4WJ5B 3IF1B 2AEQH 3G6JE 3E2HB 2A38A 2XA8L 5JZ7C 4XRCA 2UUDH 3D25A 4LCWA 1QOKA 4GMSH 5F1IB 5D7IF 2HFFA 5ITFB 2DQHH 1JJUA 2F8VA 4MNQD 4WHTA 4D8PA 1ZLUK 1A0QH 4AEHL 4I77L 1QYGL 5E95B 4RAUA 4QXTB 2D9QB 4PD4K 3H42L 5E5MA 4BUGA 3IU3A 4GRLB 1MF2L 4XP9H 5MEQA 4G3YH 5T1KD 1S78D 2XTJD 1B4JH 4H88L 3P4NA 3IXTB 1FH5L 2QKIB 5T5NG 4ZFGH 5CJQH 1RZKH 1NH6A 1CLCA 3P73B 4ODTL 1N5AA 3CFJA 1J87A 5IHZA 4PJ7E 4RFEB 3S96B 1BBDH 4FQLL 1QBLH 4UV4H 4JFDB 4TTGA 1P84J 1PGRB 4OGAC 1AD9A 1T2QH 1D9KA 4JREB 5EOTB 4H8WC 2YD7A 3REVA 3GMQB 1MJ8H 4P5TC 2YEZB 2Z91B 1LP9B 2V5MA 1ZT1A 3V0VA 1FZJB 4RFOH 5L0QC 3QPXL 4ONGL 5FXCH 2IPUG 1S9VA 1NGQH 3WLBB 1TTFA 1VGEH 4NHCL 3KVQA 3P11L 4M7LH 4K7FB 4U6HA 1Y6NR 3B2UD 3ZTNH 4OZHB 4P46D 4G80A 4TSCH 5CINH 4HIIB 1MREH 2V17H 3KLSA 3FJTA 3VFTA 3VMNA 1G7HA 4O2EB 1UFUA 4FQXD 1IM3B 5FUZL 4JJHA 3TZVB 3ME0A 3ZSTA 2H8PB 2A74B 4OLUL 3MLZH 4OIBA 3VFVB 4KKBD 4Y4KC 2HFTA 2J8OA 4ZS6C 2NQCA 5C08B 2V9TA 3BH9A 1WTGT 2CUHA 3IXAA 4QRSB 1VKXA 3GZKA 5JA8B 3RWCA 4KZEL 5AUMB 5CBAA 5H37G 5E6YA 3UC0H 3C60A 1T80A 5BV7B 1S7UB 2ARJA 4EIZC 1YYMH 1K8IB 3QUMB 4NNPL 3HCVB 4KRMB 4APQB 5I9QC 2DIJA 3RKDC 4YQXL 3WNMA 2VDNH 4NGHH 1G9MH 1LO2H 1U8JB 4QTIH 4HKBA 1ETZB 3U1SH 4LCWD 1RJCA 4GT7A 4RZCA 3T0BA 4O02H 2AK4E 4RQQB 5IB4A 2ARJQ 1FG2B 4HZLB 2ORBL 1S3KH 1DBBH 3FQTA 2WW8A 1BEYL 3AS2A 4NO2A 4LCUA 3X13A 1JWSA 1OGTB 5F97E 3NIFF 5KSVA 3P4MB 2JB5L 3O4LB 3V9FA 4JGMA 4NZTH 5CILL 2H26B 4DVBA 3ZKQD 3MPCA 3WN5B 1QR4A 4MJ6A 1WZKA 3TBYB 1YECH 1AHWA 2X4PB 3AB0C 1A7NL 2AKRA 4DZBB 5J3HC 5MERA 3VG9C 2XXMB 4LSSH 1CE1L 2Y6SC 3G6AA 1D5IL 4YAQA 3QISA 4QHLB 3OB0H 5DJ0A 4KZDL 4PRPA 4XP6H 4L8SB 1A6ZA 4TVSa 1D9KD 3NCJH 1OAZL 3VXOA 2PTUA 1YEGH 5ANMA 2C3VA 2FD6L 3H7BA 4G8GA 1FC1A 3BVNA 1Q94A 5FGBA 1JFQL 3QHFH 1P9MC 5C9JB 1WICA 4F8TA 4R4NC 4YHYB 4LHJB 2OI9C 2OR8A 1T21B 4HS3A 4GG6E 1SBSH 1KCVL 1U8OA 4S1RH 3RPIA 3IYLW 2PUQT 2BVOB 3T0EA 5HDQL 3KLAA 4WUKH 1DEDA 5I8EB 3JTTA 1JUFA 3SCMC 3RGVB 3JWOL 2XQYG 1P69B 3BD4A 1I7TB 3QFJE 3X3FH 4ETYA 3SGEH 5JDSA 3ULUE 3RVXC 1SMOA 1FYHB 3DURB 4W6WB 4H1LH 1S8DB 2ESVA 2EO1A 3C60D 3MJ9H 3CXDH 4KJQC 4RDQG 1OWWA 2VNCA 3FO2B 2C1PB 3IFPA 2DQJL 4N0YL 3BHBA 2P43B 3EDJA 3AU1B 1HE7A 2VZOA 4NZJA 3OAZK 5JPNB 5I2IB 5EU5B 3MREB 1VADB 1NAML 1TZHA 2GEEA 4NO0A 1QHPA 4I8DA 3NIDF 1LE5A 1JPSH 5KANG 1DE4A 5HVWA 5FKPB 1Z6JT 2ZCHH 5IJVB 2IWGA 3GJFK 2BDNL 4RIRB 5FHAH 3LN9A 5CGMA 5I1DB 2PR4H 2Q86B 3RZCC 1CDBA 4UOW1 3K2UL 1DCLA 4YFEA 4Y5YB 5L9DH 3MYZA 4HGWB 5I1GL 4OAWB 4JRYB 5IMLB 3G5YB 4PGEA 2XN9D 4KMTH 5ESVB 3GI9L 1CIUA 2HJLA 4LP5A 2C7UA 3G5XA 4Y8DC 1KLUA 3MRRA 1H3VA 2VE6B 3KG5A 1L6XA 4IJ3C 4XC1H 3W5NA 3OAYK 4PRPD 1MRCH 43CAA 2ICWI 4R3SA 3B9KA 4G8GD 1NLBH 2XNAB 4BSWB 5JXAL 2EIBA 5IVXB 1UZ8A 1TQBB 4RMVA 5DJ2B 2IGFL 4J23A 1RU9L 3TH3T 1CZ8L 3HMXH 3S34L 5A2FA 2R4RH 4F58H 4H5SB 2NW2A 1T7VA 3SE3C 1W72L 2P44B 3HS0B 3UZQA 4JM4H 2E8ZA 5A43C 1E27B 5KTEH 4PJXF 1J0YA 1BGXL 2W92A 3T0ED 1RK0B 3H3PH 3UPAA 3QJHB 3SKOB 3ULVD 3KPMA 1YMHB 1OAXL 3VXRA 1IGCH 3ZSSA 4HJJL 1JPTL 3L5WA 1TQCB 2BNQB 5LQBL 5B21A 1Z2KA 1ZANH 2Z93A 5IEHB 3U7WL 3SE9H 4PJGE 3L6FA 4M6MH 3U4BL 2D31B 2A1WL 1KJ2H 3QQ4B 3C9NA 2AJUH 1QVOB 3U0TB 3VW3L 4L9LC 4UILH 1I1FB 3QI9A 4WV1B 2XG5A 1XIWC 3MRFA 4OCYL 4M7JH 2APFA 5T33H 3N1QC 1FJ1A 4HIHA 2YN3A 3HI6L 3I3EA 4AEIH 4NO0D 5AAWA 3O6LL 5E7BA 2R23B 3QDMA 5GJSL 4LLUB 4NPYA 4FFVC 4OIAA 5FDWB 4A6YB 4PUBH 4L4TA 1NANI 4I18C 3V6FA 1LE9B 5A2JH 5DMKB 4U0RC 3AMLA 3M1BB 3K4AA 3DXAE 3DRTB 1SYVA 3BKYL 4YUEL 5TDOA 5CZKA 3VXSA 2D4DA 1UQSB 2EEBA 4JY6A 5E5RB 5D2LA 2DQUL 3CU1A 4C83A 1I3RB 3ARXA 5HI3D 1CICC 4LSPH 1KB5B 5C09B 4I3SL 1CBVH 4KFZC 4CU6A 5A40E 1ZTXH 1A1NA 4CU8A 3BGMB 3NPSC 2CDFB 5GGVH 2HAZA 3B9KD 3UJTL 5J9PA 2OTWA 5C8JB 2Y9RT 4FQ1H 3O11B 4EUPH 2ICEA 1LK3L 2EDXA 4K3JH 3T09A 3RWFB 5TH2B 3RKPA 4OFIA 5DVLA 3KDMB 4Z7WF 3OKNB 3MJ8B 4O5LH 3SKUD 2DM2A 1NCDL 3UO1L 2I9TB 2EEAA 3B3IB 1WAAF 1JV5B 5F3HA 5JW5B 4ZPTB 5F1SA 3PE9A 4U4BA 4NO3A 3HPLA 4YXLH 4OCXL 1ZLWK 2EYSB 3SKJH 4ZDHA 3ETBF 4YZFF 4Y16C 2HKHL 1H3PH 4PRAA 1IEBA 3MRDA 2GAZA 2QADC 3VXRD 4UTBL 1K3ZA 3EOTL 2FX9L 5MENE 3NZHL 4WWKA 2GTWB 2ZJSH 3MODL 4P59L 5GRXG 3VRJA 5C0NC 2R56H 3Q6FB 5I1CL 3LDBB 4EVNB 5LGJB 1NKRA 2ZUSA 3BGFB 5JUEL 1KJ3H 2IPTH 4UNTA 5HI4D 3SDDC 4JO4L 1IGIL 1BFVL 2WP3O 4J4PA 1BBJB 4GAYB 2J6EA 4YXHH 4OF5A 4JFFE 1EHAA 2K9UA 4KUCF 1MNUH 1QEWA 4WW2C 1BD2A 2CIIB 2UUDK 2ADIB 4N90D 1NDGA 4YH6A 3V4VL 5HVHB 3U0WL 1L6ZA 3BEVB 5HBBA 5CJBA 4Y2OA 1KPRB 4PYHA 5IM7B 4I4WA 3SJVE 5J6HA 5GGSB 4YO0B 3ESUF 4L4TD 1AGBB 4XNXH 2FGZA 4P48A 5MP6H 4JRXE 5AEAA 4DAGH 1K2DB 2DI7A 8FABB 3VXSD 3NFNA 4ZUSA 3PJSA 3U30B 4J3WA 3L9RA 4JFHE 1INQA 2HVJA 2NXZD 2DQFB 5FUOH 3UZEA 3O4OC 4WGVB 4D9LH 3QWOB 4MD4B 1I3VA 5SWQB 5D7IB 4QOKB 2PW1B 4XPBH 3J8F7 1HH9B 3MR9A 3QDJE 1WT5A 2EXWD 1QFWM 1U8QB 2PTTB 1MFEL 1YPZF 1YEHH 2LTQB 3ALPA 4PIRF 3QNZB 4UDUB 1JWUB 5L7XL 1HYSC 3IVKA 5GGRY 4M93C 1HNGA 5BOPA 4X4XA 1UACH 5DYOB 5FO7B 1NGPH 2YZ8A 2KQNA 3OSKA 1G7JB 1I9IL 2YBRA 3SE4C 5I8KH 1EAJA 5DD5H 4L8DB 4PB9L 1NAMA 4JN2B 5FA3B 2O5ZL 5HHVL 3LIZL 4MCZB 4QY8B 1DZBA 1Q0XL 2X4TB 4LKCA 4WWKD 2F54A 4CMMA 1ODAA 1S7WB 3MXVL 2XQBH 4ZSOB 2FYYB 1BMGA 3MRJB 2AI0H 3I9GH 1RJYB 2I60L 5C2BL 3FFDA 3IJYB 2NY6D 1JHKH 5DQ9B 4J4PD 2ZUTA 4LSQL 4MMZC 3TBVB 4JRYD 4L8BB 5D9SA 3O0RH 1AY1L 3OJMB 3U7AA 1S7SB 4JG0L 3TBSA 1VB9A 4O00A 4BQBA 4WUUB 1P1ZB 2D0HA 1H15A 2BY1A 4M8QB 5KOMC 2C4FU 1MHHB 4L4JA 1F13A 2V2TB 2N7BA 1CGSH 1N6UA 4PBWD 1BECA 4YPGB 1HILB 1H3XA 2R0ZH 4K71B 4JHWL 4KTDL 4F57H 3ARDC 3FFCA 3ZDYE 3TJEH 4NWUL 1OGAA 4PPTA 2BNUA 5E08H 1HHGA 2MHAB 1KTLA 1MY7A 1UEYA 3QUZA 5LCVL 3QCUL 4BSVB 3OKLB 5H8DA 2X41A 1W72A 2F5AH 4XBGA 3MRMA 4X99A 3JVGC 2YD5A 1TVDA 1QTYT 2F53B 4HZAA 5JOEA 3MRHA 1BZ7B 2E8YA 3CFBA 1A8JH 4Y5VC 3LQZB 3TYFA 1G1YA 3OB0K 1A3RL 4CVXA 3BZEA 4FQCL 2GW5A 3F12B 5FYKE 3V5DA 2C4FT 3FB5B 1GAFL 5K9QI 1P4BL 4JHZA 3PHQA 3RPKA 5T5FH 4WFEE 4NRXA 2HVKB 3JWNC 1HDMB 4K2UH 5C0BD 3OR7A 1OHQA 3EO9L 4N0UE 4PR5B 2BNRB 2R2BA 5GSVA 1L9MA 4I0PC 1AIFB 3CVHA 3L3KB 5EIIA 5DI8A 3DVFA 4XCCH 4HXBH 3A6OA 1M7XA 3K8KA 4N68A 3MLSL 2YUZA 2Y1VA 5B3JF 5KVFL 3DMMC 5TE6H 5E2WH 4O58H 2B0SL 4NFBA 5LVEA 5B38G 5ACZB 1MQKL 3B8SA 3QULA 1I3GL 1UB6A 4DVRL 1OW0C 5C0CA 1HHHB 1R6VA 3BIBX 1UZ6F 5B8CA 3ET9F 2F54D 2A9NH 2YD2A 3FMGH 1WLHA 5MEPA 2GKIA 3U7YH 1KTDA 1EK3A 4P3CL 1Z0MA 4P2RA 5FM5M 3GIZL 3S98A 5GIRA 5SV4A 1QNZL 4KQ4H 4PGDA 5EO1A 1FL5A 1I8LA 3BZFB 1MCJA 4M48H 1IMHC 4PJCE 3RDTC 2OK0H 4HS6A 4MAYB 3BESR 2WANA 4YE4H 5IF0B 2C4XA 1UCTA 1H3WM 2VERN 4XT1C 3AREA 4EOWH 2AQ3A 3WKMH 1JIBA 1AKJA 3DTXA 4G7YL 3MLRH 3TNMA 5DMYA 1NCWL 3JSSA 4PTTB 2B39A 4RISL 3MLVH 7CGTA 1OAUL 3A67H 5FYJE 5B38A 2QHLA 2XZCL 4M7KH 1FYTE 1CG9B 2BY2A 3DIFA 3L3DB 3PGCA 5D7LD 2P4AB 2O5XH 2EIZB 5I17B 1QPXA 2NX5A 5IR1A 3BRFA 3CMOL 3MV7B 3I2CL 4G9FA 1PJ9A 1TETH 5DJ6A 4K07A 1UC6A 4FTVB 5ESQA 4ORZC 5HDLA 5EUOF 3TV3L 1I8IB 4OIIH 3JWDL 4Y19A 3MA9H 1T03H 3DARA 1RY7B 3D3VE 2L7JA 2GCYA 3VJ6A 3CFDA 1JE6A 1LEIB 1CVRA 3F7YB 1K85A 3BAEL 2EDEA 4NKOA 1JTOA 5FM4A 4R96A 4Z76A 2V7HB 5FM8A 2W65B 1MHPL 1QBAA 2BP3A 3LH2L 1K4CB 1MH5B 3H9SE 3O45B 4NKIL 5DFWH 2FHBA 4XWOD 4LLQA 3VCLA 3F5WB 5EORL 4LMQE 3OXSB 1QSFD 4BFBD 3HPJA 4XVJH 4X6CE 2YA1A 2X4SB 2YPVH 2YR3A 3V6OC 1C08B 1Z9LA 2QR0B 3B43A 2GUOA 4L5FH 3QSKB 5GS1C 5C0RH 5DFVD 5C0CD 1FO0H 4Z0BH 1G7MA 3VA6A 1MCNA 4Y5XC 4HW6A 4NKDA 4XCEA 1YEEH 2ENSA 5BZWA 1VFBA 3VXQA 3DVIA 2NXYC 3C8HA 3O6FB 4GRWH 5ACLA 4HMEA 4KK6D 2EECA 1CIDA 3L1OL 3MZGB 2NR6C 1A7OH 4IMKA 4PJXB 1AQDB 4CNIB 1VGKB 3THMH 4HCRH 4K3EL 4JDTL 4N8VB 3DVGB 3TVMA 3QG7L 4FMKA 2B4CC 3HE6C 2WBJB 4NRYB 4Z78A 3EFFB 2NY7L 3K0WA 4EN3C 1BHGA 2XWTA 1AKJD 3E6HA 3DX7A 4XI5D 1G0DA 4Z95H 1N6QL 3GEWB 4MJ2A 1YEKH 3GMLB 3G9AB 2MCPH 4NM4L 4Q9QH 3Q6GH 5FEBA 4GG8B 4HQQH 3FOLB 5E9DA 4XP5H 5SV3A 3HTLX 4WCYL 4AIOA 1IAIM 2FATH 4P5KB 1VEMA 2WWMD 5HYFA 1WZ1H 2X42A 1NEZB 2NX5D 3C6LA 4U1GC 3RI5K 2DI8A 4IHOA 1JYXA 3OB8A 4R4FL 3S6CA 3KJ4B 1L9NA 5DSCA 3JTSB 1T1WB 1NCTA 2B5IB 2VIRA 4Y19D 1R3JA 2A0LC 3AS1A 4C57C 5CEZH 4X5LA 2E9BA 3BYYA 2AV1B 1DVFA 2P5EA 4NCC1 4OGXL 3SY0A 4D2NA 3TYGL 3NH7H 4MB3A 3UTSE 1QBML 4PS4H 5JNYB 4E0RB 4HG4J 2R15A 3PF2A 4YK4B 4EQ3A 3DX8B 3CLEL 3FN9A 2IBZY 3WNPA 1RIUH 3S5LG 4R8WL 3ZE1F 1DN0A 1HI6A 3IKKA 5IB3B 3VXUA 1FFNB 1XF3B 1RZ7H 1HZHL 3ULSA 5JXEC 4JO3H 1JGLL 2RHEA 1IARB 2Q1EA 3OJ2C 4HV8B 1F6AB 2RFXB 4CN6A 3TIDB 1MVUB 4Y4HB 4W6XB 2IH3B 1OQOA 2C1OB 2DTMH 4YHML 1XR8A 1DEEB 2HT4D 2EO9A 2PN5A 3V6ZB 1OARH 5HHQB 5KS9F 3LS4H 5E24E 4NO5A 2O61A 3L5JA 1RUPL 4Z7WB 3VFWB 4U2ZA 4C4KT 4GAFB 1AGDB 3LRSB 2ATKB 1IBGH 2MJWA 2I5YL 2V5YA 4LIQE 1QLEH 5TE7L 4X6BB 4QRUB 3FT3A 1UJ3C 4JVPA 3QEUB 4XGZB 2AJSH 2ZUYA 1MFDL 1SY6A 1KOAA 5FO8A 4KTEH 1N7MH 4I48B 4HMDA 1Y6MR 2VL5B 4PJEA 5E5MB 3F7RA 1GL4B 1FV1A 3P4OA 1CU4H 2N1KA 3IU4H 4B7LA 3TVMD 2EXYD 4PRHB 2FO1A 4G42B 1XGQB 3SPVB 4W6YB 3GBLA 3S5LA 4P3WA 4WTXA 2HLAA 3QUXB 5GRUH 5T1MA 3GSVA 1CWVA 4JFXA 4M43L 3K3QA 1IAOA 3SE8L 3BWAA 1L7IH 5E9DD 2BNRD 2BSTB 1FN4B 4KQ3H 3H9YA 4AEEA 1FE8H 2AEQL 3RI5F 5E00B 4HDIA 5TDPB 2QLVB 4D9QD 1J8HA 1U3JA 3C6LD 1YNTB 1IL1A 4HUWA 4JQXC 5IWLA 4E41A 3HZYA 2LE9A 2DQHL 1E0OB 1MUJB 2A73A 2J2ZA 4QHKI 1A0QL 2IH1A 4PG2A 4P23A 4PJDE 5ALCH 5IB2A 2W0PA 4XCFL 4DFHA 5DHYB 1GCFA 1PX4A 5DRWB 4YLQT 2WLYA 1J86A 3GSOA 5E99H 3VFTB 1XH3B 1DVFD 4G3YL 2X89A 3LKSA 4N0FA 4ZXBB 1B4JL 4AYFA 1VERA 1XGRB 1G7QA 3T2NL 4MNQE 4L4VE 5SWZA 1CCZA 3HAEG 5CJQL 3ARRA 2IANA 3FQRA 5J12B 3KR3H 4JHBA 5IJKA 3VXUD 3HC0A 1T04B 2OXGA 3K46A 1FDLL 1JI1A 2IALA 4MAYD 1BREA 1T2QL 4UDTA 2ARJB 2R2HB 4PJ5A 2X4QB 1IEHA 3BDBA 4RFOL 3KS0H 3U83A 5JW4Q 5GJTL 1NGQL 5CGTA 4QRRB 1SM3H 1YPZB 4M7LL 1Y18A 4DEPB 3C5ZC 5CINL 5ETUB 4FZEH 5ID1A 3EOBA 1MREL 1X5FA 3MACH 4PRNA 2HRLA 3BMWA 3LKPA 2JJVA 5IBUG 3FQTB 4QXGL 2OZ4H 5JW4N 3N9GH 5GSRB 1ACZA 3LEXA 3MLZL 3CNKA 3TCLA 3D69B 3HAEA 4DN4H 2ZCKH 1FCCA 1MEXH 3GJFA 1TTUA 3NZ8B 2DICA 4XVTH 3RA7H 5DJDA 3UC0L 3OV6A 3G6AB 3G5ZB 1A1MA 5BXFA 1YYML 5I0DA 5DD6A 3BPCA 1K3IA 4MA8H 3PXJA 1I1AA 1ZHKB 4WVRA 4NQDB 5ANMB 2VDNL 3U46A 4BH7A 2K1MA 4NGHL 1G9ML 1LO2L 2K7PA 4LRIA 5CGYC 5ISZA 3VFPB 4QTIL 1MFCH 1X5ZA 1J8HD 1QRNB 3U1SL 4E41D 3RAJL 1K4DA 1FVCB 2A83A 1I75A 4O02L 2X9YA 5CSZB 2G9HA 3PQYB 3I75B 2GK0B 4Y1AA 1OF2B 2ZOLB 2UWEF 1B6UA 3ZKNC 1W0YT 1PG7L 4LVHC 4NZTL 2VISA 2X89D 4F3FA 1N64H 1SJHB 2Q8BH 2CGRH 5HGHA 4ZYKA 3GSNH 2NY4C 2VLJE 5ID0B 2DQDL 4PJFF 2IADA 2IAND 5GS3A 3IFOA 1UKTA 3NVQA 3O6FD 3QWQB 4LSSL 1OWRM 4POYA 1GSMA 5D7SL 3I84A 4PJ9C 4XP6L 4ESKA 4NN5C 2Q3ZA 4ODVH 3NCJL 1KFAH 4J3TA 5D1XB 3L3HA 3P77B 3BHBB 4PJ5D 2WUCH 3ARBB 4LHUB 4LCYA 5DJAB 5H2BA 4AMKH 1KJMA 4WGWB 5F88B 3LN5B 1P84K 1SJVA 1WFOA 1WIOA 3VWJB 2J8UE 3D18A 3D87B 1FG9C 4OSUH 1NMCC 3HG1D 1DLHB 1KC5H 3V79C 3OKEB 5FYJH 5IBTH 3WIIL 3PWPE 3ILQD 3ZHKA 5EU6B 1MCLA 4LEXH 4GLRH 5HYJE 3V5KB 1T89A 4WFFE 2VQ1B 1FCGA 2CPCA 3LKRB 4GOSA 4OUOA 2GJ6D 5C0AE 4BQ6A 4YBLB 1O5DT 3ROLB 4HF5H 3QAZC 4G8EA 3L3JA 1A6UH 3X3FL 1WC7B 2ZUQB 3DRQA 3GBNH 4K9EC 4WWID 1U93A 4ENEC 3MJ9L 5JPMB 2ZNXA 4MSWA 2FJFA 4LCIH 4G9DB 4Y4FC 4GW4B 3ES6B 1XF4B 3HMWH 3KJ6L 2Y7QA 3BUYA 5IG7B 1U3HB 4LAQL 4UIMB 1I1AD 4YDKH 1E4XH 2FECL 2WIIA 3PV6A 1A5FH 1RUAL 5DJ8A 5J11C 5I8CA 4N8PA 5ISZD 2E7MA 4B50A 1I8KB 1CDCA 4MDJA 4AM0B 5ALBH 1JPSL 1KLGB 2O93L 4Y1AD 2ZCHL 4LVNB 1V7ML 4HIEA 3ORJA 4RGNE 4W4OC 3V52H 3A6CH 5K9OB 2WWKT 2VZSA 1IEAA 2Z4QB 4MNGE 4ELMF 5DFTA 1LEKB 5L9DL 1TZIA 4LQFH 5JHDA 2AXJA 2X70B 2W9LA 3MRBA 4EDWL 1GGYA 3EYFA 3H3KA 4Z7QE 1EHXA 5ICXA 3MRNB 4KMTL 5FIEA 2YZ1A 3SQOH 4Q58C 3NA9H 4LLVB 1YYLH 5FCUH 3ECBA 2JCCE 1OLLA 4GXUN 3RX5A 4LOUD 4PG9A 2BCKB 3VFRB 5EUOB 4G43A 4KDTC 2XN9E 2R0WH 3O3EA 4RGOH 4U1MA 3GBML 1FJ1B 2FJGA 3CCHB 4F58L 5A2IH 3V6BR 4NZRL 1XCTA 3OZ9H 5E8PB 1UB5B 3BIAX 5SX4H 1NFIA 2DLFL 1YEJH 4JM4L 3CMGA 5HHOA 3RX8A 3QDMB 4M1CC 3QIUD 5KTEL 1XGYH 3MFFB 1WCBA 3H3PL 1MHEA 3F6LA 5AZEH 4HHAB 1RUMH 1G7PA 4LVOC 4OZFH 1SVZA 1IGCL 5IK3B 5FV2A 5CP3A 3QEQB 4NQEA 5GZND 4KUCD 3FQWB 4JDVB 3QXTA 4JFYA 4U1KB 5DC0A 1UYWH 5CLTA 2P24A 4LPYA 2VABA 1AFVH 1ZANL 3ZL4H 1CD1B 5F7LB 4LRNH 3SE9L 3KPSB 5TGBB 1ORQA 2HN7A 4M6ML 2DWEA 1IGMH 3QRFM 2AJUL 2IQ9H 5C07E 1KSRA 1JZ3A 3IETA 3DUUB 4RGNC 5KN5B 4JQVA 4M7JL 3OKDA 5T33L 3CIQA 3GSWB 2RIKA 1UENA 2XZAH 3FT4B 1I1YA 2N56A 1MHCB 3O81A 1SYSB 5HPOA 4AEIL 4FG6D 3FAWA 3F8UB 4ZMAT 1DQQB 1TNMA 4TNVF 5L88H 5B3NA 3PXHA 4PJAA 5CCKH 5FB8B 3JZ7A 4D0DB 4PUBL 1J10A 1P4LB 5EFIB 4OBRA 3WHXA 4PJEF 5KVMC 3M45A 2DQEL 3T04D 2E9IA 3RTQC 4JFDE 5JHDD 4QT5A 4OZ4B 1QA9A 3MRDB 5C0GA 1RUKL 5D96C 3WNLA 4X6EB 1UXWB 3Q48A 5HJ3A 2DM4A 1YEIH 4HIJA 4DKFH 1YA5A 3SO5A 4LSPL 1T7ZA 4LIQH 1PSKL 1LP9E 4Z18A 1CBVL 4P2OA 15C8H 1ZTXL 4JPVH 3BRDA 1QFPA 5GGVL 2IEPA 3KYAA 3FB8B 4X4YB 1YN7B 2CXKA 3PWVA 4FQ1L 4OZHE 1NMBH 2CDEA 4X9GA 4P99A 3I6GA 2F19L 1GPOL 2NY0C 3KPQA 4J3OC 3VFMB 2F58L 5DT1H 4E5XB 3A6BH 3CD4A 4IRJB 1GGCH 3TN0C 1X9QA 4GRWF 2AABL 2ED9A 4JGJA 4WW2F 5HHOD 1Q9OB 1EO7A 2OR7A 4KJYB 5C08E 5IMOB 3OKKA 5JOPE 4I4WB 3TT3H 4OV5A 1JHTB 5T3XE 5IT2L 4U6XB 3T65A 3MBEB 1KCRH 2VR9A 1BAFH 4HXAH 4Q9BA 5SX5H 4NT6A 1Z9MA 4HKZB 4QF1A 3Q1SH 2IBZX 2ZJSL 5HDBF 3PJSB 3D1MC 2BSSA 3H9HB 1E6JL 3BW9B 2GFBA 2G2RB 4GO6B 2EDDA 2FNBA 3M07A 2VAAB 4RNRB 3TO4B 3GHBH 1KJ2B 5FK9B 1MCIA 2OP4H 3O41B 5GZOC 5H35B 1SEBB 3HZVA 4R2GD 3W9EA 4YXHL 1G0YR 1QFWH 4NHUA 3BPLC 2HLFD 1M7DA 3L95A 5AG8A 5BS0A 1BX2A 1TVHB 5I16B 4H1LG 4JM2A 5FOBA 1YN6A 3E6FA 1EBPA 1HHKA 3O4LE 5INCA 5FGCB 3EYVB 4CVZB 1FZOA 4OKVA 2XZZA 2AEPH 4XNXL 4LHUD 4JY4A 5MP6L 5FECA 3CXHK 4YJZL 3FCTA 4DAGL 3WJLA 3UTPD 1NJ9A 3VWJD 3EIFA 4LBEA 5GRZA 3ARFC 1RMFH 2JB6B 5EUKB 1ZWIB 2ZG1A 1HKLH 3QO1B 3WV0A 3TJHC 5FUOL 2R4SH 3BPOC 4PGCB 1EJOL 1HEZA 3EBAA 4D9LL 2JF1A 2CLVB 3TZVC 2HG5B 5IMMB 5EZIH 3ILPA 4ZNCD 5LGHL 4P5TB 1T20B 5I76A 3SGKC 1X44A 3RQ3A 5L0QB 5BRZB 2PW2B 4NQTA 4HFWB 1AI1L 4H1LA 3TBSB 1VA9A 2QSQA 1YEHL 3MJ9A 5DJZB 3MC0A 3GSXA 4HX1B 1UVQB 4APQC 1U3HD 2D9CA 2KQMA 1UACL 1A2YB 3DBXA 1NGPL 2NW3A 3OKYA 3V7AE 5ECJE 3RFZC 1JCKA 5F7NC 4Y4KB 4ISVB 1RZFH 5I8KL 5DD5L 4HK0A 4NQVA 1MIMH 1MCOH 2D7MA 4ZFOL 1QKZL 3VXNB 1EXUB 1G7IB 5LAXB 3QUZB 4UT7H 4K23H 3EW3B 4ALAL 5TF1L 2XQBL 4Y8AA 2JKXA 3NTCH 2H6PA 1Z9OA 3V5HB 1T1XB 1R3LB 2AI0L 1N4XH 3I9GL 4FZ8H 5I9QB 3CFBB 3OJDB 1D6EA 3B4NA 2ADFH 3WN5C 1JHKL 2E6PA 5CAYB 1JVKA 3W81A 4WNQB 4PJHF 3ROOA 3O0RL 1NUGA 2X44D 2Y4SA 4OI9A 4UOW0 4OUUA 3SDCC 4MQ7B 4M6AA 2M26A 5DJYB 4Z7NE 1S9YA 1A6VL 3WE6A 4L8SC 1BVZA 4AT6B 4WU5A 3T2QA 3DX9A 2H32A 1CGSL 4R4BB 2VLRB 5BW7C 4LL9A 5MI0C 4JAMA 4AH2B 4R7NA 4F7CA 4KVCH 4F57L 2W9DH 5FF6B 3TJEL 4DZ8B 3AB0B 3GIVA 1RZJC 5E08L 5DA0B 1INDH 3F7QA 1B0RB 2NYYC 2BRRH 3VG9B 4LPUA 1F45A 1Q9LA 1I7ZA 1MCFA 3U9PH 1A7RL 2MPAH 3WO3B 4M7LT 5IVXE 3K7UA 4Q6IA 5IGXH 5JORB 2EYTB 1RZ8A 3TEUA 1KTDB 4WO4A 4P2RB 3SGJA 3KGRA 3QEQD 3IJSB 5T5FL 1MCPH 2UWEB 4PGDB 5E56A 3TBTB 3WEXB 2OI9B 5KSAC 3UPRB 2PYEB 1WBYA 4QKXB 2OQJA 1KPVA 4NJ9H 3MOBH 3SOBL 4XHJD 1IKNA 3CSYB 3IS0X 3ULUL 1FL6B 2Y23A 4BM7A 3KYMA 2BXYA 3ALWA 4L3CB 4FXGB 4WY7L 4IOFD 1KCUH 1PBYA 3WUWG 4XCCL 5IHUH 3AREB 4HXBL 3N1PC 4XMPH 4WW1B 1ZGLM 4BELD 3DTXB 4N9OB 4PJFB 3SCMB 1IM9B 2BNQE 3ARGC 5E2WL 1FQ9C 1U36A 5D7JC 4O9HH 4EUPG 5E6IA 4U1IB 4F15C 2DWDA 5E2JA 1JNHA 4LSDA 1HWGB 1T1ZA 4P57A 4MWFB 5GQBA 3DIFB 1N2RB 3TNNB 4NKMB 5JQHC 3PGDA 2A9NL 3FMGL 4L3EA 2AXFA 3U7YL 1R5IA 5CEXB 5D1QC 4MD0A 1I7UB 4HUXB 5HGAA 4QRPB 1U3ZA 4DKEH 4KQ4L 3QQ9D 1WJ3A 4XTRC 1AGEB 3STLB 5FAAA 3D9AH 3LAFA 4MLIA 4TUJB 5I15H 3WUWA 4WEBH 4EOWL 3MLRL 1MCKA 2JJSA 3WFCH 3RZCB 3MLYH 3QUYA 2YC1B 4EUPA 2YPLA 4HT1H 1EFQA 1KIRA 4P9ML 1CS6A 4KMLB 3FRPA 4M7KL 3JV4B 4K7PY 5C09E 3L3OA 4I3GA 3ZKMD 1W0WB 2O5XL 4IJ3B 4PP2B 4NC1C 2BC4A 4X7CC 5MEOA 4OD2B 2E7LA 5AWNH 2KL6A 4C4KO 1QLFA 3O3AB 4PGBA 4PJCF 1RUQL 2CLRB 4WO4D 5DLML 3G6JA 4XH2A 5EZLB 1A9BA 2DBJA 5D8JH 4OIIL 5KZCD 3MA9L 1TQCC 1T03L 4PV9B 2ITDB 2QV2A 2RGSA 4V1DB 3W0WB 4H26A 1MI5B 3AFLA 3CDGA 2O26U 3HB3D 5D4QA 1ZKAA 4ELMB 5LWYH 4X5WB 5I8OH 2R8SH 1CF8H 3V4UH 2XKNA 2XXCB 3T2PA 4S1SH 5TE4H 3MNVA 3NACH 2IFFH 5JZ7D 1FAIH 3MSPA 1JP5A 2XTLA 3E6HB 2HJKA 2A6KB 4XVJL 5C0FA 3DX7B 1S5HA 5KAQF 2I9LA 2D7TH 2DKUA 3BKCH 2IQAA 4G6AD 1GZQB 3KXFB 1T83C 5I6XC 3MBXH 2PXYC 4L5FL 4PJ7A 1OP5H 5C0RL 5DVKA 1BQLH 1K8DB 1IAIH 1FO0L 4Z0BL 4QXUH 2QSCH 2HTKC 1FVDB 4D94A 1JPST 2AJVL 5A1AA 1YEEL 2W9EL 4JKKA 4L9LB 1CFQA 1XIWB 2Q6WA 3AUVA 4MQXD 5I1EL 4U6TA 3T1FB 1A7OL 5F1NB 2KUTA 3T0WA 2H9GB 5TQ0H 5EA0H 4IS6A 1M05B 2PO6C 4DGYH 1IAKA 2DIBA 1RJLB 4KI5E 5CZXD 4PLNC 3AC0A 5E8NB 2APVA 3FHAA 3S35X 4I18B 4Z95L 1LO5A 4XXCC 4U0RB 3QUYD 1YEKL 2Z31B 3C8KB 2BSRA 2MCPL 2APTA 4Q9QL 1U2HA 3Q6GL 4JZNA 5HYQA 2XFXA 4ZTOH 4HQQL 1QACA 3RL1A 2FR4B 2OCFD 3LEYH 4XP5L 4ETQB 4EDXA 5IOPB 1CICB 2VLKB 1KEML 4QOKE 5D7IE 2FATL 3QO0A 5GGQH 4YHOH 1WZ1L 1BZ9A 4FQQA 1OSPL 2DJUA 3OG6B 1MFBH 3MRKB 5D93C 3MRPB 4UUJB 2NLJB 3NGBC 3IRZA 5ABDE 2VDLH 4X6DA 1WBZA 4ZS6D 2KBGA 3MA7A 3DETD 4QRTB 1P7KA 1K5NA 4JEGB 3RUGF 2F15A 4I13B 4AQOA 3P3YA 1TJIH 4LLDB 5T3XH 4MJIE 1A6PA 3FONA 4XPGH 5DURD 2AK4A 2NY1C 4NNYB 1LQSR 4HWZA 1QLRA 3QUMH 2IAMC 3BFOA 4PJEB 2FEEL 2Z8VC 3KWWB 3NH7L 5DJXA 4PS4L 1U8NB 1W2KT 3T8XA 1A3LH 3SDAA 4YHIB 4M1GH 4P2QA 3HNSL 4GW5B 4Y16B 3S5LB 3LPFA 4NIKB 3FKUS 4GMTL 3SGEI 5FA4A 2QADB 1WWBX 2QQLH 4JO3L 4X8XA 4CW1A 4ZSOE 2EE3A 4YWGH 2RCSH 4OD3H 3TF7C 4G7VH 1GGUA 4JZJA 5EN2B 3W82A 2DTML 5SX5K 5H94A 5F1OB 3QIWA 4HWEH 3U36B 3JXAA 2FECI 3T4YB 4PJIF 3ZO0A 1OARL 1ZOXA 3SGDH 4HH9A 5E1AA 3LS4L 4GRMA 3EYSL 1EUUA 1XT5A 1T22A 2ZSWB 4KI5C 2MTPA 1T0NA 4WUUE 4OFVA 4YR6A 3HLAA 2LU3A 2F8XC 3LB6C 3RVVD 4GRWB 2D3VA 3RWHA 5IB2B 4WW2B 2AJSL 1DUYA 1CFSB 4IIQC 1UM5H 4KTEL 2V5TA 3UYOD 3RP1A 1S9WA 4OLZH 3LN4A 4GG6A 3HI5L 4Y88A 1NCBH 1CU4L 1CDHA 5DUBB 3D39B 2J1KA 2ID5A 1JGDA 4TRPH 3KYNB 5C3TA 4OFYA 4OZIF 3MYJA 2AERT 3BQUC 5GRUL 3LY6A 4HBCL 4C56A 3DNKA 1RZJH 2LVEA 1VFAA 4K3GA 3QFJA 2F53E 5AZ2H 3ZT5A 3T08A 2LTQC 2MQ3A 3NCCB 1L7IL 1QSEB 1UH3A 2ICWJ 2D7QA 1A7QH 2L0DA 1N5YH 1NAKH 1JYWA 3IB4A 1A4KA 3NCYS 3ZKSD 3OG4B 1T5XA 4Z9KB 4J2XA 2CK0H 2GJZA 3CFIC 5DMGD 3DPBA 2E27L 4ZNEE 5TJWK 5IESL 2APXA 1CI5A 5ALCL 1ZEAH 1MCQA 2H2PC 2BY0A 5ILTH 3W2DH 2AV7A 2VUYA 3I3BA 2AK4D 3BP4B 3KPTA 3CZJA 1Q9KB 3I02B 2EYRB 1VESA 3DYOA 4ZUTB 4M93B 1ACYH 2B1HH 2BVPA 2NZ9C 3FQUB 2GT9B 5C0IB 2NY3D 3SDAD 2VRAA 3I50H 4XZUB 4TN9A 3GNMH 3KR3L 3U6RA 3BT2L 1N3NB 4KUZH 1Q1JH 1OAYH 3EO0A 3NAAH 4IOIA 1NBVH 3V8CA 4DOHE 1P7QB 4FA8A 1JZ4A 4NQSA 1XEDA 4W81A 1T4KB 3JUZA 4U1SA 2Z8RA 2HFGH 1FGVH 4HLZH 4F37K 3DROB 3QRGH 3HR6A 2ITCA 3VI4F 3RZCD 4K71C 1LO3H 3RWEB 2RB8A 1SM3L 3I6KA 3MNZA 1F6FB 1D5XB 1JHLH 5HYSB 3PDDA 4QTHB 2G9HB 1F8TH 3IDNB 4FZEL 4C59B 5JIPA 3MACL 3FZUC 1QD0A 2OZ4L 1J05B 1RZIB 4XAKE 1D5ZB 2QBWA 2WWKO 5D6CA 1F5WA 3PL6A 3R06B 3BKMH 2EKSB 5F6HI 5FHBH 4BKLA 4DN4L 2ZCKL 1XZ0B 1ZHNA 4L8CB 4S1DC 4ZYKB 1TZGH 4FFYL 2AAVA 2VLLA 5J13C 4OFYD 4F7PB 3QNYB 3ARDB 4XVTL 2IADB 3RA7L 3U4AA 5FYKL 1IGFL 3REWA 2IFGA 3UYRH 3LRHA 3QFJD 3MV7E 4OV6F 4MA8L 2YK1L 3C2SA 4MB4A 1R3KB 1FNGA 2OTUA 4JB9H 4LASL 4FTVE 3NIDE 4AL8L 4Y5VB 4PJHB 1MFCL 2NTFA 3IDIB 3L5XH 1B2WL 4KY1L 3FO9A 1NCCH 4MQTB 5I1HH 1QR1A 4PTUB 1TITA 3VGDA 3K4ZA 4QHUA 1R0AL 3QPQC 4DGIL 5AYUL 5K9KA 4KWUA 2AQ2A 3H0TA 2R1YA 5CWSA 1T3FB 1E28A 4D9RE 4I0PB 4IBLT 4ZAKA 1N64L 5F3BA 2DQCH 2Q8BL 4LARH 2CGRL 4TSBH 4D3CH 3O6KL 3DMMB 2VXTH 3GSQA 3IGAA 1XIWD 3HI1A 4QGTA 4ZQKB 5GRJL 1U95A 3ARPA 2GTZB 1ZHBA 1IC7H 1KACB 3DXAA 1OOAA 2QJDA 4ZFFA 5KG9A 4E42A 1YMMA 3QFDB 3C87A 3BE1H 4ODVL 1ULVA 1KFAL 4LNRA 4KKCD 4A6YH 3BUYB 5L2JB 1F4WH 4KAQH 2IBBA 3PUCA 4MS8D 3MV8B 5E8DH 3DX6B 5L8LB 3HZMB 2VLME 2FX7H 4AMKL 2AJ3B 3WJJA 4PJXE 3O9WC 4NSKA 3RX7A 5FYJL 2R0KH 3R1GH 5IBTL 1IC1A 3RDTB 5J7CC 5CIPA 1S7VB 1GOFA 4IRSA 3CC5A 4LEXL 1LGVA 1GC1C 3VRLF 5CSGA 3FRUB 3WFBH 4LF3A 2WAHA 1J1XH 2YMXL 4PJ8C 1PAMA 3OX8B 4HF5L 3VDAA 4XNYH 1TZIB 3EUUA 3P0VH 3VD5A 3WDIA 4X4ME 4GXVH 1I9RH 5CMAA 2ADJA 4LCIL 5MENA 2WV3A 1JRHL 4Q2ZA 4YDKL 1E4XL 4KK9C 3BP6A 2MKWA 3KPRA 1A5FL 1CN4A 2P7TA 2X1QA 3Q5YA 5DK3A 1MCWW 2EDBA 4Y16D 3WHE1 1C5DB 4LEOB 4BZ1H 5ALBL 3BSZL 3OAUL 4JFQB 4ZO8A 3UZVB 3MRCA 3NOIA 4JFFA 3AM8A 1F3JA 2JIXD 1ADQH 1EFXB 4GSDH 1CFNB 3V52L 3IDJA 4XHQA 2CRMA 3A6CL 9CGTA 3KYOA 5EU7C 4KU1A 1A6WL 5I19L 3HHRB 1MHEB 4GKZB 4ZAKD 3SDDD 5ADOH 4LQFL 1MLBA 3D5OF 4UV7H 3SJVA 4BK4A 2A6DA 3E1F1 1QRKA 3GSNB 1K9TA 4NQEB 1JGEB 2FWOB 5HD8D 1IFHH 2P45B 1UT9A 3OGCA 1MIEH 4JRXA 3CFKB 3D0VA 2IPKA 3CUPB 1KN4H 2OX5A 2FO4B 2VABB 3NA9L 1NBYA 1P53A 1YYLL 1G7LB 3MRGA 5FUCE 5FCUL 3DXAD 3MRQB 4D0CA 5GS1B 5JOFA 3T4AA 3DHMA 1F3DH 5ENWA 5BJTA 1B4RA 1S78C 5HGBB 5IQ7H 2XTJC 1BFOA 4L29B 4OQTA 5F9JA 2CDGA 5IFHH 4Y5XB 1OP5K 3TH4T 2EE2A 2V2WA 2G75B 5GGRB 3FQNA 1F4AA 2NXYB 1ES0A 3LSOB 3RWIA 3OZ9L 4S2SA 4WIQA 5EBWA 5F7FA 4YZFE 3QDJA 4PRHE 5F72S 1NGXA 3IDGA 3W11D 4ODBD 4IRSD 5T1LA 2VXVH 1KG0B 1J0HA 1P5VA 5AZEL 3VXMA 3HE6B 1RUML 1J1OH 5C0DA 3MJ7A 1PZ5A 3GSUB 3FTGA 3WD5L 5JHLH 3B2UC 3NN8B 1UYWL 4P46C 2P5WB 2YD3A 4HFUH 2FJHA 1U2CA 1EUTA 4B5EA 3BWUC 1L0QA 4RBPH 1X4XA 4M00A 4LRNL 3STZB 4Y2DA 5CEZD 5CHNB 2VL4A 1IGML 4FQXC 5MEND 2EKJA 2JK5A 2IQ9L 4ODUA 1AQKH 3ZYJA 4YK4C 3GGWB 3WSQL 3H8NA 2Q76A 1R24A 3QNXB 3LVEA 3HC3L 5BVJA 2XZAL 2LVCA 3I6GB 2VOTA 4F9LA 3IDXH 1EHLH 5CD3B 3QEGH 4ODWB 4J7RA 1FZMA 2D7NA 2E3VA 1Q9WA 2ZCLH 5FO9B 5IB1B 1GOGA 4ZS7H 1X4ZA 2WINB 3RWDA 4F7EA 5L88L 4JFFD 5CCKL 1JNNH 4YX2H 4HJGA 2C26A 5JW3H 1U8PB 1G6RH 4X8JA 4KGLA 3C08H 3EGSB 4PY8J 4IMLB 3AXLA 3SJVD 3QIBA 3HUJF 4LSRL 4MA1C 35C8H 4ZUWB 2NNAA 1ZA3B 4XPAH 4DKFL 4JRXD 5LXGL 4LIQL 4JFOA 4M4RA 2E6QA 2BSSB 3WNKA 2OZ4A 2XWBA 4JPVL 4U6YA 4JFHD 4QRRE 3KPNB 1YPZE 5F96H 4F7MB 3RUGB 1H5BA 4WU7A 3PDOB 5CEYB 5IEKB 4PV8A 2ENYA 5HPMA 5DT1L 1JPGB 1XMWA 3A6BL 2Q87A 1H3GA 3S36X 1GGCL 1A7BA 3RNKB 5SWSA 1UJ3B 3SKNA 3QDJD 1D9KC 3RWGB 3OXRA 3U0PB 3WS3A 4N9GA 4RX4A 4N0UA 5T1LD 3TT3L 3KPPB 1JPFB 4XPFH 3GMNB 1QZ1A 4OZFB 3AS0A 5KSUB 3O3UN 1NUNB 4KDVA 5GXBB 3O2WH 3GM8A 1KCRL 4HXAL 1FNEB 5DK2A 3Q1SL 5CSBA 5EBMB 2FDBP 3UTZB 3BXNB 4Z7VF 5F7EL 4NQDE 4MNHA 5ANME 4LCCA 3QH3A 4PJIB 1NC4B 1FVEB 5CBEA 1QRNE 5DQJA 1E4KA 3GHBL 1ED3A 3DV4A 5T3ZE 1HXMB 2DAVA 2P48B 4N1HB 4TPRH 1ZHLB 3PQYE 1XGPA 4P3DB 2DBLH 4RMTA 4Z0XB 1QFWL 5FYLE 4K8RC 5HGDB 1S7TA 3C60C 1OM3H 3VWKA 1B6DA 12E8H 3HR5B 4CVWA 1J5OH 2COQA 1DFBH 4JFEB 4WI9A 1MAKA 1F4YH 4HBQA 4I2XB 3MRIB 1CD8A 4WDIB 4LLWB 1ZLVK 3CVIH 3DV6A 4JN1H 3CX2A 2UV3A 1VACA 1IE5A 3MV8D 4OZIB 4DK6A 3DBXB 2M1KA 4M62H 5F7MC 3FO0H 5EC1A 5DRXB 1BJ8A 3WIHH 2WBWB 2ESVE 1KJVA 3KPOB 1RHHA 1RMFL 3C5JB 4MXQC 2FBOJ 4GBXA 1HKLL 5IMKA 2XPGA 3S36H 1C16B 5KSBF 3DO7A 1FBIL 2R4SL 5C9KA 3TO2A 4G8FB 1KGCE 1FYTA 2VN7A 1L0XA 1FC2D 1CTOA 1TJHH 4PB0H 4ZUUB 2NZIA 1GH7A 3EO1A 1KN2H 3UTPE 4EN3A 5BZDA 1AD0A 3P9LB 1FGNL 3S4SG 4K3DH 1IGTA 1GYAA 3IKCA 2EIEA 4DTGH 4Z77B 1AHWC 3BO8A 1QO3A 1SJEA 4NC2B 4PRIB 2DMBA 3B5GA 3C5ZB 4GKSA 5EU6E 3ZDXF 1C8PA 5FYKD 4YDLC 4G6ML 2XY2A 1OB1A 1JMXA 3GKZA 3P9MB 3C8DA 1XCQB 2W0LA 3D3VA 5EPMB 4WFED 5ELIA 3G08B 3IFNL 4HPOH 5E8EA 2IMNA 3BP7A 4RX4D 3ZHDA 1JK8A 3CX5J 1AC0A 1CQYA 5FGBC 1FRGH 1NCAH 4X4ZA 1BQHG 4BQ8A 1RZFL 4Q9CA 1UZ6E 3H9SA 4O2FB 4OFKA 1PLGH 1MIML 1MCOL 2DQIH 4ZUVB 2YUWA 4EI6B 2P8MB 1YY8B 1IILE 2R2EA 3PWNB 4K23L 4UT7L 2Z8SA 4X6CA 2EC9U 1Q9LB 2X7LB 3MLWH 3NTCL 4XCYB 5DR5H 3BZ4A 3T0EC 1N4XL 3BIKA 3SDXA 5IQ9B 3UCRA 1J9CT 2ADFL 3S4SA 5LKNA 4NKQB 5IW1B 4JPIB 1A6AA 2BERA 3MNWA 4QRQB 3O3BB 3L3IA 2UY6A 1AO7B 4L4VB 3L7EB 4IDJL 2Y5TB 5GGUB 4MLSA 3O8XA 7FABH 2AXGB 4BH8A 2R1WB 1HQ4A 3VWKD 2V7NA 5JIKA 4L1DA 2FEEI 3OPZH 1FFPA 2A2QT 1NC2A 2DD8H 3P2TA 1W0VA 1TVBB 4ORGB 1ZVSA 4LVHB 2Y36H 1J11A 4LKXA 1WZMA 1HXYA 2EC9T 1WWAX 3H2WA 4KVCL 5I66B 3VRIB 4PLKD 2W9DL 5ESAA 1Y0LB 4X6FB 3WFHA 1OTUC 1T5WA 1INDL 1TFHA 2HT2C 4P9HL 5DHVA 4RWHA 2DWDB 2CIKA 5FYKU 5ERWA 4K94H 4GW1B 4GBXD 5FYJD 2NR6D 3U2SB 2HH0H 3FOMA 4H25B 1M6OA 2D0FA 4NN5B 2DJ4A 2R29H 4JRWA 5EUOE 3P0GB 3GJEB 1FLRH 1FYTD 3D6GA 5IGXL 5DRZA 1R5IB 2RBLA 3CH1A 4YBLC 4EN3D 5IW6B 4UB0L 3MGTB 4ZTPH 2VH5H 3TFKD 3X17A 4JPWH 5HY9B 2P5WD 3QDME 2WIMA 4XVSH 4NJ9L 1MCWM 1NMCB 1EGJA 3ZTJG 2XZQL 1E6OH 4J8RA 5D1ZA 4GQ9H 1XF2A 3RJQB 4KKLD 2XOTA 1KCUL 3FB6B 5JDJA 1J88A 3D3VD 1YC7A 5IHUL 4XMPL 2BVYA 3QEQE 2PCPB 3B9KC 4R0LA 1FFOB 4XXDA 3T0AA 3M17A 3UTSA 5KVDH 4GKNA 5EOCH 1UCBL 3QAZB 4O9HL 2PYFA 3ARVA 1AXSB 3H9SD 4FQ2H 3KPSE 2YD1A 3DGGB 3WNOA 3NFSH 3N85H 5IKCB 1XGTB 3GMRA 1A1OA 4PY7A 4U1JA 4Y4FB 1MJUH 3PDGA 2F74B 3T77A 3UTTB 3OHXA 4P5MB 1A14H 3WFEH 1OCWH 5CZVH 1X6NA 4DKEL 4LLYA 3R4DA 1DBJH 5FCSH 1DQTA 3LEVH 5B22A 3D9AL 3TIEB 4PP1C 1IQDA 4OZGF 5I15L 4OCMC 4YFLI 1UA6H 1XF5B 3ZYIA 4WEBL 2NY5L 3ARUA 1NC2D 4NC0B 3WFCL 5IBLD 3MLYL 3L3GB 4FXLA 1CDYA 5DVNA 3QI9C 4M61A 3Q2CA 4HT1L 1IC4H 3FN0L 5C7XH 4N0CD 5C0FB 4ODSH 5J57B 1D5BA 5J1AB 1MWAB 5L8KB 4FQHA 1C12B 1VEOA 4LSTH 1F11A 3GSRB 1DUZB 2Q7NA 5HHMB 2I07B 1A7PH 1UXSA 2MOVA 3HRZB 3VE0B 1KBGL 4HKXB 1U8MA 3MZTA 5A16A 3VFNA 3L5HA 1BD2E 3ZE0F 5D8JL 4A2MA 3MCLL 4U7SA 3NBNA 4XVUD 5C0AB 4YGAB 2NXZC 4PJDA 4U1HB 1CYGA 3ZE1E 5LWYL 5C70A 5I8OL 1OP3K 1CXIA 4M1DH 1VPOL 4TUOA 1CF8L 5D1ZD 4R7DA 4S1SL 5TE4L 1YDPB 3NACL 5I1AA 2CKNA 4H0IA 1FAIL 4LVOB 3UTQA 4UQ2A 5DDHA 1FHGA 4J6RL 2W0KA 4S1QL 5BO1L 5J6GB 1EAPB 3UTSD 4MNQA 3IDUA 4M6OH 1U8KA 1ORSA 2D7TL 3BKCL 4F8QA 1U8HA 2CJUH 3RVTD 5HYQB 4OLWH 5DD3H 3QDGB 3ARSA 1JTPA 1BQLL 1N8ZA 1IAIL 4QXUL 2QSCL 1EEYA 3QZWB 4RBPK 2FGWH 2ICWA 3LHPL 2FH6A 2A6JB 1EERB 5INDB 3DVNA 4G6KH 3TESA 4MNGB 1CK0H 4K8RH 1YY9C 2YXMA 4TNWF 4WWKC 1I7RA 3NCMA 5JW4M 1KT2B 1WIUA 3WXWH 3MV9B 4OB5H 4PJ9A 5TQ0L 3EKCA 3QEHA 4F33A 3PWLA 1AXIB 1OT1A 3HKFA 3O6ML 2X40A 5HTSA 4DGYL 4I5BB 3K1KC 3LV3B 1BOGA 2EDRA 4J4PC 3HE7A 4XP1L 4M8VA 5AAMA 2P49B 1JYNA 2GSIB 5EDXA 3BH8B 3P30L 2KZWA 5D96B 4ZTOL 4YNYA 3LEYL 5GRWA 1P6AB 4KPHH 4KJPC 2LABA 4Z8FH 1G9NH 1CLOH 5GGQL 5HHPB 5H94B 1MFBL 1AXTH 1BZQK 5TDNB 5BRZE 4JZOA 1QQDB 2VDLL 3LQMA 4AIZA 4D0BA 5F7DA 1DL7L 3B9EA 5JR1H 1OPGL 3DECA 5H37H 4QHNB 5DS8A 2NY0B 1TJIL 2VITA 4M5YH 5E2TH 5T3XL 4XPGL 2BVQB 5BV7L 4KI5F 5TFSL 4PJBA 3QG6A 5C86A 3ZMRA 4HGKC 3TN0B 1V3LA 4P0DA 3QUML 4GLRI 3A0OA 1ZT4A 3BZDA 3PWJB 1A3LL 2YPKB 2ATPB 4M1GL 1NBQA 3FFCE 3HUJB 1DQDL 4AENA 1JGDB 1WITA 1OGAE 2YN5A 3JWOC 3SKMB 4BZ2L 5T3ZH 4O2CA 4XMKL 5C07B 2KKQA 1MRDH 5C0EA 2QQLL 5E6ZA 1WT5C 4L4VD 3WXVH 2VLJA 3EDFA 1U8LB 3VFOA 2RCSL 1PKQB 4OD3L 3MUGA 5JLZA 2YRPA 4CADA 4G7VL 5FYLH 1JRHI 3ZKND 2CRZA 1CT8A 2FSEA 2ADGB 2EDLA 4HWEL 5I75B 3MMEB 1E4XI 25C8H 2WMPA 4CMHB 3MRLB 1MJJA 3VGFA 2GJZB 1AGFA 1U92A 3GB7A 3F7VA 3D85B 1AE6H 2JJTA 2NY4D 4U1NA 1U6AH 4NBYB 3BPLB 3VA2C 4LMQI 4MD5A 4NQUA 1R3HB 2J8UA 4XNMA 5BQ7A 4OLZL 3DUSB 2VLRE 3B6SB 4NQCB 3QA3A 5IIEA 1YC8A 1NCBL 4PJ9D 3GMMB 1MQ8A 1TJGH 2WQ8A 1KNOB 4TRPL 4NUGH 4MVBD 5HYJA 1GGIH 3X12A 1LNUB 1R3IH 3LKOB 4M4PA 3TA3A 3HE7D 4Z7VB 2Z35B 4NRZB 2BVEA 3ARFB 2GSGA 1GHFH 2YSSB 4BFIA 3CZFA 4HUVA 4OCSH 4Z5RA 1A7QL 1N5YL 3BPOB 4OLXH 4ONHA 5EBLB 4P2RE 3VGBA 2CK0L 2ITCB 3LKNB 1NBZB 2UWEE 2PYEE 2BOBB 3RVUD 3VFUA 4QYOA 3M8OH 2W91A 1BVKA 1XFPA 1ZEAL 3OKMB 4EI5A 1R5WA 3MOAL 4ODHH 5IROA 4KRPC 5SX4I 3QUZC 2ICCA 5ILTL 1QUNA 4HJ0D 1X3DA 5IFJB 3N06B 3D0LB 1T2XA 4YHNA 4PJFE 4PBVC 1ND0B 5DTFA 3UTOA 2B1HL 4JO1H 1EX0A 5J8OA 4OGZA 1CD0A 1X7QA 5DUPL 4MXWH 4NDMA 3I50L 4LDEB 3GNML 1WBXA 3LMJL 4GUPA 4TULH 1MFAL 3RBSA 5KSBB 1WGOA 1ONQB 1Q1JL 3DHJA 4O51A 1WWCA 3NAAL 1NBVL 4GXUM 4M03A 4MJ5B 2VLJD 4NNXB 4NBXB 4G9FE 4PRBA 1YUHB 5EWIH 2HFGL 2V2XB 3BN9D 2V9QA 1TCRA 1MJ7H 4FP8H 3QRGL 1FNGB 2JCCA 2MSPA 4QRPE 2FZ3A 4NFDA 1OD7A 4XWOC 1S5IH 2OSLB 1IGJA 1LO3L 5DEFA 1T1YB 1JHLL 2XWJA 3VFSA 1HCFX 1N0LA 1AGCA 1F8TL 1EEZA 2XN9A 4YDVB 4AEHH 3SDCB 4I77H 1UKSA 5DFVC 5LBSL 1V05A 5HVFB 4R6UA 5B8CC 1F4XH 4P4KA 1L0YA 4IDLA 2Z92B 3BKML 3DSFH 1HHIA 5FHBL 2FIKA 3JV0A 2H3NB 3PWPD 4OCRL 1CE6B 5MI0B 1X5HA 2X6MA 5CKAA 43C9B 1TZGL 2EE6A 5D5MF 3TT1H 2UYLA 5HYJD 5DEGA 4WFFD 4CKVX 1B9ZA 3LKQB 5IB5B 3TA3D 5CP7B 1K6QH 4KK6C 1I8LC 5C0AD 1GZPA 4FQLH 3UYRL 4ZPVB 1V3MA 3X11B 1NFKA 4E42B 1YMMB 1JN6A 4X9FA 4FXKA 4M1CD 1XGUB 2AW2A 2VXSL 3AREC 4WJ5A 4XPHL 4KROC 3IF1A 1WEJH 1LWRA 2VSDA 2KDGA 3L5XL 3QPXH 3LZFH 4ONGH 5F1IA 3W0WE 4V1DE 5ITFA 1NCCL 4HH8A 5I1HL 2APBA 1MI5E 4NHCH 5K9QG 2YHGA 5KSAB 4F80A 3HNVH 3MUZ1 2FRGP 4HS8L 4EI5D 4ELME 4F2MB 1J8KA 4QXTA 1YEDB 5CIPB 4KRNA 4ELKB 3CC5B 2RAMA 4GRLA 1IGYB 3RIAK 4UINH 4DJMA 4LF3B 4AZ8A 1ROWA 4TSBL 3QDHA 1S7QB 3IXTA 2QKIA 3INUL 3TPUB 5BVPH 2VXTL 3ARYA 5E4IA 3P73A 3ARGB 4RGND 3KXFE 4AEFA 2VQUA 5D7JB 5ICZB 5DK0A 1NFDF 4RFEA 3S96A 1H0DB 1REIA 4F15B 4NN6C 5DGQA 1IC7L 4JFDA 1X5JA 4Z7UA 4NYLB 1AR1D 3AAZB 1N0XH 4WFGE 2IMMA 2E6JA 3BE1L 3X14B 5EOTA 3AMKA 4XBPA 3S9DB 1EEUA 4Q6YA 1QSVA 4A6YL 4KAQL 5E8DL 1RIVH 4NNPH 3MROB 2WUBH 1UM6H 4ZOEA 2YEZA 2Z91A 1LP9A 3KPRB 5D1QB 1FZJA 3R0MA 3WLBA 1QFWI 5B39B 3RTQD 4K7FA 4OZHA 1WFNA 4FQPA 4CDHA 2R0KL 3R1GL 1CXFA 4HIIA 2E7BA 4U1LB 2ORBH 4OI7A 1KB5L 1CDJA 3GHEL 1F3JB 1YNLH 2HT3D 4N0RA 4O2EA 1IM3A 3IDJB 3WFBL 4P4KD 4BQCA 2H8PA 5E70A 2A74A 3VFVA 3IFLH 4XNYL 5C08A 1KIQB 3OBAA 2A6DB 3K8LA 3P0VL 4QRSA 4X7SL 5E2VL 2J6EH 4ODXA 1A7NH 3B9VA 5AUMA 3GK8H 2VLKE 1KYOK 1I9RL 2FX8H 4IMKC 3QQ3B 1R5VB 1S7UA 2VXUH 4YBQD 1K8IA 4KZDH 3HCVA 4APQA 4OF3A 3TVMC 2EXYC 2LV4A 5EZOH 5DGRA 1BFOB 2FD6H 2CDGB 1U8JA 1ZT7A 2DQGH 2V2WB 5C0JA 1ETZA 1FIGH 5C07D 4RQQA 5L6YH 5EO9B 1FG2A 4OZGB 4PJEE 2OL3B 1NGZB 4LVEA 1KCVH 3RIAF 1ADQL 4GSDL 1IC5H 4K55A 1YJDH 1OGTA 4W4NA 3P4MA 4GRLD 4EIGB 1P4IH 1DDHB 3O4LA 5B4MD 2H26A 5ADOL 3C6LC 3FB7B 2DYPB 2W0FB 5GZOD 3QJFB 3TBYA 5C0DB 2X4PA 4HKJB 3PWUB 4NM8H 1JZ8A 1IFHL 4X0KB 4DZBA 3WL9B 1CFBA 1KN4L 1NGWB 5GHWH 1A4JB 3JUYA 1OAQH 1INEL 4JFDD 4QHLA 5I6XB 2PXYB 1YNKH 4NUJB 3WDJA 5EO0B 1J12A 3EYOB 3UAJC 1DVFC 3UBXB 5IQ7L 3DYPA 4ZFZB 1B88A 2P8PB 3MGOB 4RAVB 2Y07H 5IFHL 1I3UA 2J5LC 5C9JA 1RZGB 4GRWE 3DSNA 4V2BA 2Z31C 1PVHA 3AS3A 4YHKH 1T21A 2XKSA 1MRFL 4RMUA 3V0WH 5DJCB 3D39E 4H8WH 2PO6B 1CFVH 5SWZE 5I8EA 3X3GL 3GMPB 5HDBE 3TZVD 2FEDD 3RGVA 4M5ZL 2CLZB 4RA3A 2OBGA 1I7TA 2ZOKB 5C08D 5JHLL 5JOPD 4JE4B 1QSEE 5ADPL 3DURA 3T3PE 1S8DA 4HULB 5T3XD 5I0ZA 3GI9H 4TVPE 4ONOA 2UVFA 3O2DH 3O2VH 4YGVB 3FO2A 2C1PA 3MGAA 4FS0A 2BX5A 2DTSA 4APQD 3MJGX 3BN3B 1MCCA 3TWCL 5D93B 3AU1A 4JDZB 3NGBB 5JPNA 5I2IA 4WU7B 3P40A 5EU5A 2C5DC 3MREA 1RU9H 1VADA 5JO5B 1FNSH 1EHLL 4PV8B 3QEGL 5F9WC 3MCG1 5CEZE 5HPMB 2ZCLL 1T0MB 5FKPA 3BJ91 4ZS7L 5SWSB 5IJVA 3V95A 2Q8AL 4RIRA 2NY1B 1M71A 4YX2L 2IAMB 3DI3B 3KYKH 3WS3B 5JW3L 3SEPA 3O4LD 1RIHL 3T3MF 4DUWA 2EDTA 1T0PB 4Y5YA 5IWLC 1JF1B 3LS5L 5D70L 1BFSA 4HGWA 1HHJB 4I0KA 2GITB 1PFCA 4JRYA 4OAWA 4WFHE 5IMLA 3MX0A 3G5YA 35C8L 1MOEA 2HJFB 5L8JB 4PG2C 4P23C 5ESVA 2P1YA 2AJYH 4XPAL 4OT1H 3BEWB 5IVZB 2VE6A 4KK5D 4GAGL 3CVHH 1JWMB 3GUTA 3U4BH 4HMCA 2VAJA 3OR6B 3DV4B 1WVZA 5F96L 3HN3A 2XNAA 6FABL 4BSWA 1UEMA 4R90H 3JV6B 4NN7C 5CJ8A 5C6TH 5IVXA 5DJ2A 1LVEA 4OCYH 3KHOA 5EH1A 5IJKC 4MX7B 5T5NF 4H5SA 5E94B 3HI6H 3KLHC 3BYTA 4IIQB 4RCAA 5I30L 3HS0A 3W39B 2GHWB