4ZXBA

Structure of the human insulin receptor ectodomain, irdeltabeta construct, in complex with four fab molecules
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
214
Chain Sequence
QVQLKESGPGLVAPSQSLSITCTVSGFPLTAYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCARDPYGSKPMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 83-7 heavy chain
publication title Higher-Resolution Structure of the Human Insulin Receptor Ectodomain: Multi-Modal Inclusion of the Insert Domain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hormone receptor/immune system
total genus 45
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2015-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbA01
1IQDA 5TDPB 1HQ4B 4HUKB 4U1SB 3FB8B 3C8KA 3EFFA 4Y5YC 5T1DH 4EDXA 3TBTB 3UTZB 1YEKL 3QO1B 4PJ5A 3SGDI 3QRFM 4JPWH 5I8CB 4G6FB 3SDCD 1UH4A 4PRBA 2GJ6B 1LO3L 1YEIL 4DAGH 3MREA 5B39A 5JW3L 2O93L 3GI8H 4YHLL 2R2HA 4ISVA 1B88A 4KHTH 1GOFA 5DC4B 3NFPA 5IHZB 3EAKA 4MSWA 3HC4H 5CILL 4Y4KA 4ZQKA 2HP4A 4G3YH 3KYKL 5E1AA 4HT1L 1MPAL 3PHOA 3BMWA 1MJUL 3PWJB 4NKOA 3IKCB 3UTPD 3V9FA 1J1OH 5E8PA 5CSGA 1HH6A 4FFZL 3VXRD 5C86A 4FTVB 4QTHA 3WJJA 5KVDL 5FCUH 4MGXA 2A9NL 4XP6H 2X89A 4X6FB 3ZKQD 2ATPB 2DD8H 5SWZA 4F7EA 1JZ2A 4WUKH 3KNBA 4MXQD 5DK0A 5C09E 3P30L 1BP3B 2Y06L 3GSXA 1KTDB 1DE4B 1OAZH 1UG9A 2P8PA 3FO2B 4HPOL 1C1EH 4TSCH 4L9LB 3Q5OA 2MCPH 1T1YA 4X9BA 3MJ8A 4QRTB 4P2QE 4S1SH 1UENA 3CFDB 4UBDD 4ZXBC 5MI0C 2X7LB 1HXYB 5KVMC 1ES0A 5EOQH 2AV7A 3KR3H 3Q3GB 1T0MA 1OAYL 3EO1B 5DRZA 1UA6L 3RNKA 4PG2C 3WJLA 2I60H 2Z35B 4HKJA 2W60B 5TFSH 3HZMA 2OL3L 8FABA 1JPTL 1L0YA 5GGRY 3R1GL 2XOTA 1C12A 3QISA 3AMLA 4G7YH 4Q9RL 3ZKMC 1L4IA 1TMCB 4PS4L 1AI1H 3WLBA 5FF6A 1U8PA 5E5MB 1CS6A 1U95B 4XI5D 1J1PL 1UH3A 1B0RB 3ILPB 1YECH 5E2VL 3S98A 5IESH 5JQ6H 4WWKC 4DW2H 5DURB 4ODSL 2YSSB 1OGAA 3M8OH 5T33H 5K59F 3KPPA 2NTSP 4RDQF 4HPYH 1CTNA 2JB6A 3G6AB 1JN6B 1BX2A 1FDLL 4LF3B 2QLVB 3GMQB 1A9EA 2BFVH 1AD0A 3S96A 2XZQH 1IKNC 3OKOB 2FATL 4GRMB 5SV3A 1XF3B 4HIJA 5AYUH 4JKPL 1CR9L 3GSRA 1AKJD 2ADJA 2YC1A 3DRTB 5C0CD 3L3DA 1FVCA 1JUFA 1QSEE 5GIRB 3LKSB 5MEPA 4KXZI 3FB7B 3IFNL 2VLKA 4ODTH 4UDUB 3CFEA 1Q9WB 3PGCB 4XPHL 1FYTB 3L1OL 5KSBF 4UTAL 3EJZC 3FQTB 5IM7B 3WN5A 2IAMD 1FGVH 5F7EH 1KIQB 3MRKA 3L3JA 1CD0A 3PWUB 4M1CD 2D7TL 2Q1EA 3BPOB 4GAFB 1DQTA 2OMBA 3LN5B 3F7RA 1F4AA 3V4VH 5KZCD 1J0HA 2VR5A 2AS5M 4PJDB 2E7BA 3HNTH 1MHEB 1RZKH 3MRIB 2R0WH 1N6VA 1FIEA 3VXMA 1DN0B 3T09A 3VGAC 2ZG1A 3VE0A 1VADA 4YUEH 1BVKB 3CSBA 3HUJF 3M17B 3RWGA 3QI9C 1GRWA 2VLJD 3CU1A 3P0GB 4QRSB 1UM5H 1JWUA 4JFED 2H41A 3VMOA 5CBAA 1FNGB 2KUTA 3MRDA 1S7VA 2DQCL 3TCLA 4LLDA 3VH8G 1WWCA 3U2SA 1X5KA 2CMRL 3RUGF 2EDYA 3INUH 4GAJH 4F7PB 1BGXH 3PL6A 1U8LA 1VSCA 4ODUB 4WWID 2GJZB 1NMAL 5BV7B 4OI7A 4N0YH 4Z8FL 4GW1A 3NCBB 1HXMA 3BN3B 3VWKB 2J7LA 3MUGB 4X6CA 5IIEA 4E42A 5TQ0L 1U8NA 3BRGC 3BEWB 5D7KD 1PVHA 3BZFB 5IJKC 5FKAB 1RZGA 1NAKL 4MAYC 2H1PH 4KRPC 4XXDA 5I1CH 3C2SA 3JXAA 3CC5B 1WICA 3MR9A 4L3CB 4DN3H 1ULVA 2DQUL 2ZP0T 4MNGE 5GGUA 2B4CL 1KPRA 4X80H 2ITCB 3WDHA 4X5LA 4I2XB 1YC7A 5C7XL 4HGKC 2HRPL 3KLAA 2Q86A 3UTSB 3EFFB 3ARBB 1RZ7L 3DX9A 1JPST 1A02N 4ZS6D 4NWUL 3FAXA 2Q6WA 3DX6B 4QKXB 3EYSL 3IJYB 2WINA 2FEEI 1A1MA 3CMGA 5FYLH 1FNSL 3VXSD 3MV8A 2EXWC 3VXNA 4ODVH 3MREB 3G9VA 3IDJB 5D7LE 1F4WH 3H9ZA 2W0FB 2PUQT 4IIQC 4KQ4H 4L4TD 2J1KA 3BUYA 4JKLA 1P1ZB 4MSWB 1PLGH 3DYPA 3ZDZE 2VDNL 5I1AB 4E5XB 5HGGS 1YEDA 3O4OB 3WE6A 3PHOB 3UZQA 2GSGA 2Y1VA 4QXGL 2E6PA 4YDVA 3U4BH 5FO8B 3EDEA 1QHPA 1S5HB 5J6GA 1SMOA 5CMAA 3HE7B 2FJGA 4KTEL 2A6JA 4PJAA 4OT1L 2NMSA 4JO1L 5EU3B 4NWTH 2WUCL 5SWZB 1PZUB 1UGNA 1IGIL 2AJUL 4I9WD 2R8SH 3DBXA 1HHJA 5ILTH 2FHFA 3CXHK 3GSXB 1MCHA 2P8PB 4NN7C 2O26U 3J8F7 4C4KO 4XCNA 3MA9L 1T0PB 1ZLSH 4P2OC 1DTUA 4M02A 4ZOEA 1RAMA 5D1QA 5C08D 4URTB 3BT2H 2OZ4H 3OL2A 1S9XA 2VJXA 4U1IB 4Y5YA 1T0MB 2DMCA 5T5FL 2OJEA 3MACL 3U7WL 4BH7A 4PRHE 4FFVD 3DXAB 1ZVYA 2Z31C 3KPLB 2E6QA 4HKJB 5ITBH 1NH6A 2AJSL 4RA3A 3UPCA 1V7ML 3M1BA 1T5XB 2JKXA 4QHKJ 5CJ5A 3RI5F 4ENED 3QQ9C 5HI4C 4XNYL 2VZUA 3WLBB 3RKDC 4TYUA 4X6DB 1RZKC 5DS8A 2CXGA 4HX1A 1QSZA 3NOIA 5GGSB 5DJDA 3CX2A 1Q72L 3ESUF 4I0PB 3KPPB 1MCSA 2VB5A 4N8CH 4GUPB 5FEBA 4IJ3C 5TPWH 2PO6C 1OTTC 4B50A 4JPKL 3RTQA 4WTXA 1AD0B 3S96B 2CJUL 3Q2CA 5ADOL 1PZ5B 5K59E 1EO8H 4XVUD 1PKQB 1QLRB 5MERA 1JVKA 2PYED 3TO2B 2Q76A 3MLTB 2EH8L 5D5MA 3GSRB 4W6YB 1U3JA 3P0YL 5JR1L 3WV0A 1HZHL 2F54D 3TYFB 5GGTA 1L7TH 1JGLL 4GG8B 4PP1C 5D6CA 4ZXBA 4YGAB 3CFEB 1YY8A 2OQJB 1CLZL 4Y2DC 3RU8H 1Z9OA 2YWYA 3MJ9A 3B2UD 3KXFB 3QUMH 4NNXA 4RZCB 5CAYB 1DQJA 3U48A 4J23A 3EKCA 4FQCL 4QHKI 4MVBC 4KTDH 1IAIH 1WAAF 3WN5B 4OIIH 1QKZH 6FABL 1UACL 1E6JL 3MRKB 4UILL 3TH2T 1AY1H 3BX7C 4AEIL 5GZOC 3MJ7B 4KDWA 1PEZA 5KOMC 3HZKA 1BZ9A 1AFVH 1WWWX 5KSBE 5CSZB 1KEML 3IAPA 5I1JL 5ESAA 4HIIA 5AYQA 5DHYB 4MJ6B 5E2TH 5D93C 1M7DA 4J4PC 3QRGL 3L6FB 4U1NB 1P53A 2G5RA 1FVEA 5D1ZD 3H7BA 4JPIB 3ZL4L 3CAFA 4YAQA 5HGHB 3VE0B 2NX5E 4ONGH 2BOBA 3F65A 4MS8C 1LMKA 1BIIA 1KCSH 1T7VA 6CGTA 5CIPB 4JFFB 4JFYB 2GY7B 5I6XB 5B39G 4IOFD 1Z5LB 4LLVA 3RVWD 3ZZ1A 5E9DE 1MHPH 4R26H 5CBAB 5GJSH 3QFJA 3Q6GL 4M5YH 3TCLB 4JQVA 1MEXL 3MLWH 5HVGB 3HUJE 3NFSH 5DUML 4XMPH 4MZ3A 4RWHA 4CRPA 3VW3H 4NP4H 5DFTA 1A5FL 5I75B 4JN2B 4HKZA 4NNYA 3A0OA 3EGSA 4FQLH 4JGUA 4JEGB 3PUCA 4MA8L 1HXMB 4M7ZC 3SKNA 4NFDA 2APWA 1P84J 4X6CB 5DLMH 5IIEB 4E42B 1FJ1A 1U8NB 3RUGE 3M07A 3T1WA 2GY5A 5T1DL 1OTUD 4D3CH 3ULSB 5JHDE 2A74A 4JPWL 5DK2B 5IROC 4C57C 4XXDB 3NIGE 2X4PA 3O2VH 1VPOH 4DAGL 1FFQA 3GI8L 1FNFA 4HS3A 3RVXC 4KHTL 3T4YA 1YEEL 4HUXA 4WI2A 5I9QC 4M8QA 2MSPA 3HC4L 4CGTA 2Q6WB 4YHPA 1HQRB 3HE6A 4X4ZA 4KK8C 4G3YL 1G7QB 2WINB 1A1MB 2DLEA 3RZCD 1N0XH 4XWOC 1BQHA 3MV8B 2RQ8A 3VXNB 4WUUE 5E7FA 1BFTA 1J1OL 1F4HA 4KKBC 3ARQA 5C92A 5C6PB 3VFVA 1D3CA 1MCJA 3BUYB 2EKJA 4UUJA 3BN9C 1WWAX 5FCUL 2EXYD 4XP6L 3MODH 3E2HC 2DD8L 3WE6B 1AD9A 4WUKL 3VXUA 5HD8C 5JOEA 2GSGB 1HH9A 2HJKB 2EYRA 1OAZL 4M8VA 4TSCL 1C1EL 2ESVD 4UQ3A 4OGXH 2X4RA 1UB6B 4GXUN 2MCPL 2ICCA 1T1ZB 5CMAB 3VFOA 4QTIH 1CT8A 4FA8A 2VUOA 3HNSH 2O5XH 4S1SL 4NDMA 4C56A 3HCVA 4MDJA 5L2KA 1T89A 2B7DT 1LWRA 5EOQL 3T0VA 3KR3L 5E2WH 1RSFA 3MNZA 1LE5A 5CKGA 1ZVSA 2R0ZH 5C6WH 5C0EB 4HFUH 1VCAA 4I18C 3QDMB 2IBGA 3DGGA 3HUJA 2I60L 2AJYH 5TFSL 2KPNA 1UWEH 1SVCP 5EC1A 4P5MA 4UU9B 4HUWA 4O51A 4M7LH 4YR6B 5JMRA 4JRYD 2ZCHH 4G7YL 5D1QB 1C5CH 1FFNB 3DETC 3HZVA 1AI1L 4DJMA 4EBQH 3CFCH 4Y0GA 4F15B 1DUYA 2XQYK 2XTJD 3RUGA 4J6RH 4XRCA 2UWEA 2ADFH 1XF5A 4EIZC 1QP1A 4BSWB 1YECL 2DB8A 5IESL 5JQ6L 4NQDA 1F8TH 4EJ1C 4DW2L 3M1BB 3TZVD 3M8OL 5T33L 3UO1H 4KFZC 4WTWA 2RR3A 4HPYL 4ZSOE 2A83B 3U4AA 3E3QC 5EO1B 4YHYC 2R1WB 4IIQA 2CIIB 2VZ3A 5EC2A 3CFKB 3TBWB 3LV3B 5CZKA 2ZUUA 4EZMA 4P48A 2XZQL 4HX1B 1UXWA 4OZIA 5AYUL 1IM3A 1O7SA 1R3KA 5DJDB 4PY8J 1J11A 5HHXH 3TN0B 1FG2A 1Q9LA 1MCWM 3VG9B 5J89A 1WFNA 4N5EC 4ODTL 4WHYH 1WZKA 1XGYH 3RTQB 3ZT7A 2BCKA 2GCYB 4Y4FC 1T6VN 1NGYA 4ZPVA 2A77H 2L7UA 4M43H 1A7RH 4NQEE 1BIHA 4Q58C 1FGVL 3P9LB 2Q76B 5F7EL 1LDSA 5D5MB 3ALXA 5DJCB 3ARFA 5E00B 1EO7A 1RZJH 5KVGL 3QJFA 1GHFH 2JCCB 3MA7A 1JTTA 3RWHB 1A8JH 1YY8B 3GRWH 4N68A 4LPXA 4PJDF 5CD5D 5KW9H 2WP3T 5E4IA 5FYLE 4U7SA 3AROA 3ZHKA 2Z31A 3HNTL 5J11B 1RZKL 2R0WL 1P6FA 5TQ2L 3S36H 3WKNA 3F62A 3GFUA 3O3BA 1PY9A 2XA3A 3R0MA 3LQMA 4YUEL 3HPLB 3T4AB 4LQ1A 3SDDB 1WAAE 3BPCB 3NFNA 4HIIB 4PY8I 1UM5L 1NMBH 4G8GE 4OZHE 1M7DB 4LHUA 2XN9B 2Y4SA 4L4VE 1FVEB 4YAQB 3QUZA 3INUL 4PJHB 1BGXL 5IOPA 1BIIB 5C8JB 4N0YL 1QG3A 1HN1A 3ZT5A 3IT8D 4RIRB 2NW3A 1GZQB 1SYVA 4QOKA 3QFJB 1AO7E 3JWDH 5JDSB 2VR9A 2YPLD 3F8UB 2CRMA 2H1PL 3ZHLA 4OI9A 5I1CL 1IC7H 3JTTA 4NNYB 4QLRA 4DKFH 4G9FA 3SDAC 4DN3L 1ZOXA 3SKNB 4HEME 4WVRA 4X80L 1A4JA 4L8CB 3BDYH 1FJ1B 1O7VA 4Y2DA 5L88H 3DMMA 4WY7H 1T5WA 4RAHA 5F1KC 1HHKA 1NKOA 1JE6A 4MCYA 5IR1A 3EDKA 2O5YH 2N56A 5I2IB 4HMDA 1MVUB 5FYLL 2Q7YA 5DC9B 3TYGH 1KEGH 4ODVL 2O61A 4LCYA 3VXPB 5IVZA 4R96A 2EE9A 3ZTNH 4FXKB 1IEBA 2FNBA 1F4WL 2HLAA 1ZLVH 2SEBB 3QCTH 2MKLC 2PN5A 4KQ4L 2DBJA 3FRPA 2GJ6E 3SOBH 4TVPE 3T4YB 1I1AC 2OX5A 1PLGL 1A14L 4IRZH 4J4PA 4MJIE 4P4KA 4YHPB 4WGWB 1F11A 3TT1H 5I19H 3HE6B 2Z92A 1BHGA 3QA3B 4LSPL 4XNQA 1G1YA 1BQHB 3P9MA 1ONQB 1CCZA 32C2B 3GJFK 1XR9B 4OZFH 4JFQB 4W4NA 4YK4B 2UV3A 4JDVA 2V2WA 3ARBC 4L8DB 2FSEA 1XR8B 3VFVB 3ZDXE 3D85A 4LU5H 3N85L 4I0KA 5J12B 4HS8H 3K46A 4NWTL 3LH2L 1AD9B 1ZT4A 4LPYA 4PLOB 3VXUB 3BH8A 3MV7B 4X4ME 4DUVA 5IEKA 4M48H 2R8SL 1ZHKA 4FG6C 1X5XA 4YO0A 5ILTL 2L0DA 5CIPH 5GS3A 2AQ2A 2EYRB 4Y5VA 3RIFF 1YNTA 4UQ3B 1S7TA 2FCBA 2X4RB 5FUOH 1QR1B 3KPQB 5C07D 1QSFB 3VFOB 1ZLSL 1Q8MA 5JA8B 2XZCL 3W5MA 3HI6H 5L2KB 3BT2L 4GJTB 2QHLA 2VDLH 1H15A 3MNZB 4Y19A 5MENA 5TE6L 3WNLA 2VDOH 5T1LB 1PY4A 3SJVA 3HMXA 1DEEA 1YMME 1OAXH 5IROA 5IF0A 2P8MB 3VFUA 4JAMA 1RZJC 3H8NA 4UINH 5IQ9B 4O51B 4NSKB 1HCVA 3S37X 2BNRB 1B0WA 3ARGA 3O3EB 3S36X 2WBJB 3VXOB 2OZ4A 3HAEA 1QSVA 4I1NB 4X6DF 2ARWA 3QDJB 3X11A 5DMGC 4NQCB 1QQDA 5LGJA 3IDGA 3AY4A 2UWEB 4LPCA 4KK6D 3BP4A 1XF5B 3UC0H 2KH2B 3KLSA 4TVPL 4XBPB 1JYVA 5I1HH 4EEEA 4NQDB 4NO5A 1EHNA 2CLVB 5E6IC 2PF6A 3UTTD 2EDDA 3E6HA 5FAAA 2BVEA 3SCMC 3MV9A 2P4AB 1H8OA 3DNKA 4JREC 5TPWL 4Z5RB 1TZIA 4FZEH 2OR8A 1MCWW 4PGBA 2QQKH 4OZIB 4MJIA 1EO8L 2J88H 1VESA 1GGUA 4LBEB 4GRLC 5ISZD 1Q9LB 1I85A 2NNAB 2ZUWA 3B9KD 1OCWH 1L7TL 1NJ9A 4ODHH 3KPMA 4TTDD 4JFOB 3VXTA 3G6DL 3JWDC 2AW2A 4NOFA 5B21A 3C8DA 3RU8L 1SBBA 3LRSA 5DI8B 3V4UH 1NGYB 3QUML 3VXQA 3P77B 1RK1A 5FECA 4HUUA 4KTDL 1Z9SA 4XPFH 4I18A 4X6BA 2P48B 4OIIL 2VL5A 1QKZL 3EOBB 5HDBF 4XP5H 2K7QA 1MJJB 4WW1B 1AY1L 1D6EB 1FYTE 3ARFB 4JANA 5F3HA 5KVEH 3K8MA 1JZ5A 1KTRL 4RGNB 4LKXA 4QRRB 1AFVL 2GIYA 3QJFB 4PRIA 1CD8A 1I1RA 4KMTH 4MJ5A 5IW6A 1RI8A 4S10A 5E2TL 1TENA 3L5WA 5H94A 2OR7A 2XI9A 1J86A 3I3EA 4XNZC 3U0TB 4ZTOH 3O3BB 2JB5H 3SKOA 4RMWA 1L6ZA 1YMMA 4ONGL 2VERN 4EUPB 1FGNH 2NQCA 4PJDE 4Y89A 1KCSL 3RJDA 5JHLH 1SY6H 1LO2H 5CEYA 4NUGH 4EDWH 4FMKA 3BGMA 1RZIB 1MHPL 4R26L 5FHBL 1GGCH 1PKOA 4MCZB 5GJSL 3ZT6A 4M5YL 2XY1A 2ZZUT 4LHUB 2DAVA 3G04B 5I1DB 4J3UA 2E8ZA 3NFSL 4XMPL 3VW3L 3EO9H 3QUZB 1OSPH 1S7WA 1X3DA 3H9YA 1ZS8A 5IG7A 4GRWH 4LKCA 2VAAA 5GS1C 1E28B 1T7XA 1JWSB 2XY2A 4LARH 2NW3B 5DLML 1C8PA 2DL9A 4JRXA 1TPXC 3U6RA 2AK4A 3GUTA 1KF9B 4D3CL 2NZ9C 5CFHA 5I6XC 4X5XA 5I8EB 3N1MC 5DGRA 4Z7OF 4U6HA 3O2VL 1VPOL 4CN4A 4P9ML 1TZGH 3QEUA 1NFDB 2XA8H 2HFGH 5F88B 4BZYA 4Z6AT 5IB2A 3DMMB 1EBAA 1N4XH 5BOZG 1U8QA 3WDJA 3MLXL 3MCKB 4U1GC 3DSFH 5I0DA 4YFDB 2Q7YB 1N0XL 3UTSE 2ID5A 3IJHA 5SWSE 4W4OC 2O61B 3QEQA 1JYWA 3MRQB 3P2TA 4NHCH 5A43C 2FR4A 1OAKH 3CX5J 2UY7A 3DPBA 3GMOB 3FFDB 3MODL 1A4KA 1KJVA 4P4KB 3GHBH 1Q0YL 1JGEA 2GKIA 2FRGP 3QNYA 1CDJA 3FQNB 4EI5D 3IETA 3PDOB 4QF1A 3P9MB 1EMTH 5LXGH 1ND0B 2MWCA 1H3WM 2P1YA 4ZUTA 4OGXL 3RVVD 2V2WB 2NY3B 4QTIL 3BEVA 1H0DA 3HNSL 2O5XL 2ZUXA 4P5TB 5ICXA 4JQXC 2FZ3B 1OWRM 2AJVL 5D8JL 5E2WL 5IEKB 3V79C 2R0ZL 3BH8B 4ZD3H 4NUJA 4RRPA 4YO0B 5HHNA 4OAWB 5C0AD 4P0DA 4Y5VB 2AJYL 4M93B 1UWEL 2FDBP 5IHLB 1RJLA 4N8PA 2CUHA 3MLSH 4M7LL 2LQRA 1EZVY 5I8OH 4M5ZL 1AIFA 1G6RA 3KLHD 1C5CL 2NY1D 5FUZL 4EBQL 2ICEB 5HGBA 1C08B 1TNNA 3CFCL 2P8LB 2MKWA 3LD8C 4J6RL 2A6IA 1DVFA 4QYOA 1VDGA 3IAQA 1TVBA 1BF2A 3TO4C 1F8TL 2NY0D 2IAND 1EFQA 1X7QA 3DXAE 5JOPE 3QIWC 3UO1L 5GGRB 4GRWF 1UVQB 3HAEB 1MCBA 5E8EA 4ZUWA 4FQQB 4HWBH 1I1AA 3X11B 1OY3B 2R1YB 3TH4T 5F44A 5LGJB 3IDGB 3D69A 3TNMA 5FA3A 1ZT1B 1MUJB 3O2WH 2DI7A 2DLHA 3E6HB 4X6DE 2BHZA 1BD2E 4WGVB 4LDOB 3D39B 2VQUA 4HUNB 3CDGB 4XZUA 5HHXL 1WV7T 5SWSA 3WS3B 4F15C 4WNQA 3BPLB 1HYSD 3LOWA 3U9PH 3U82B 5JTWA 4OF7A 1TZIB 1XGYL 4HAFA 2A77L 1HKFA 3QUYC 1U2CA 4M43L 4U2ZA 5BO1H 4R4BA 5C09D 3OGOE 2ZUVA 4RFEB 2OYPA 3L3GA 5ALCH 1X4ZA 2UZIH 1RIHH 2JCCF 3OKKB 1GHFL 1PKQE 4Y4HC 3FN9A 4N9GB 2VSDA 1DQMH 4P2QD 2VAJA 2WIIA 3GRWL 5KW9L 3VXQB 3CVHH 1RK1B 4I3RL 3STZA 3OWEA 3TN0C 1JJUA 4WU5A 4LSTH 3S36L 2DQJH 4KK9D 4JANB 3KXFE 4RGMC 5F3HB 1N6QH 4WI6A 5EZLA 4PLNC 2BMKA 4PV8B 1DQQB 3GRWA 4PRIB 5KSUB 4MJ5B 4JFDA 3QULB 5HDBE 5HHPA 5TF1H 3V4PH 2AI0H 3D18A 4U7MA 3OR7A 3DROB 4OFDA 1QUNA 3A67H 3MO1A 1KB5B 1XFPA 3SKOB 3IS0X 5E6IA 2NY4B 4U49A 3GB7A 5CWSB 4DFHA 1KC5H 2JJSC 4NQSA 4H5SB 2GI7A 4FHBD 2WW8A 3QUKB 1EUUA 1EFXA 5DHVA 2X9WA 4DGVL 4D0CB 1M6OA 4M7JL 3FRPG 4JFFE 5A16A 5CEZL 3JWDL 3MFGB 5I76B 1IVLA 3RY6A 3IGAB 4RMVA 5ICZA 2BXYA 3QHZH 4P57B 3GSNB 3Q1SH 3ARED 3CU7A 5D2NB 3SDDC 5L9DH 1UKQA 3OR6A 1IC7L 4DKFL 1ZS8B 1EBPA 4NN5B 1I4FA 5AD0B 2EDNA 4LKCB 1BVLB 2VAAB 3A6CL 3QQ4A 2WK2A 1CWVA 2IQ9L 1KXVC 2CLRB 1QSED 2R56H 1I7UA 5L88L 3V5DA 1MCRA 2UZXB 2R2EA 1RUKH 3EUUA 4PJ9B 5KN5A 1D9KB 3WUWB 2H32B 1JNNH 2O5YL 2R2BA 1KJ2H 4ORZC 3P73A 1NC4D 2BOCA 4MA7H 1H8NA 1RJZA 3TYGL 5I71C 1ZE3C 1KEGL 3BYTA 3QEUB 3S5LG 3ZTNL 4NN6B 4OGAC 3ULVH 1MI5B 3GMPA 3QCTL 3HC3H 4HH8A 4YBHA 3SOBL 1B4JH 1KELH 3BP7B 1ZEAH 4O5LH 3VDAA 2P5WB 4Z7OE 3OAYK 4IRZL 1LGVA 4NCDA 5D96B 3TT1L 3Q6FA 1N3NA 1P6AB 5I19L 1UM4H 2ZNXA 3SY0A 2PXYC 1Q94A 4HKXA 3IJHB 1AGDA 2VXSH 4IHOA 4D8PA 3BGAA 3O6MH 5GRVL 4NZRH 4MMXC 1XF2B 4X4XA 5J1TC 1QNZH 1LVEA 3WEXA 3O9WD 2X41A 1A4KB 5I1IH 4MNQA 4HS8L 4R97B 4OZGF 4D9QE 3PIQB 4EUPH 4M48L 4Q9CA 2BY1A 4QF1B 4Y2OA 4OZFA 4QY8A 4Y7MA 4ZUTB 5FUOL 3EHBC 3VGBA 1IKFH 4P23D 3VFPA 4XP9H 3HI6L 5FGCE 4WFHE 1MRCL 5EU5B 2HA1A 1BZQK 4UT6H 2VDLL 2M2DA 1G0XA 2EDFA 2VDOL 1JZ4A 1T2QH 3K1KC 1GOHA 1OAXL 4YHNB 3DRQA 1WISA 4GBXB 1RJLB 4LOUC 1QEWA 4UINL 3W0WA 2AXJA 4JG0L 3DSNA 3MNVB 1SBSH 2IEPA 4ZDHA 3V6FA 3PV6B 2FHBA 4XVJH 3I6LE 4R4NC 5CP7A 1A2YB 5C6TH 2X1QA 2X40A 5D7JC 1G7IB 1N5YH 1DVFB 5DJ0A 3LDBC 2BHYA 3UC0L 1D5ZA 3H9SA 4U1KA 1J18A 5I1HL 4KJYA 3UZEA 1ZHBA 4LCWB 2V9RA 3ME0A 4W4OA 3EJYD 5IBLC 2ZUYA 2MPAH 2BC4A 5D7LD 3RWCB 2E9JA 4S2SA 2ZG2A 4ZAKA 3LN4A 2VXUH 4FZEL 3W39B 2L4OA 5F7KC 2V7NA 5C2BH 3PE9A 3TNMB 2QQKL 5FA3B 5ANME 4GRWE 2WBJC 2J88L 3QIBC 1AGFA 1MFDH 1TCRA 4FQXC 1NGZA 3QH3A 3DO3A 4N5UA 3W2DH 1IILE 2LTQB 2D4DA 3C8HA 2IG2L 1FAKT 4NRXA 1OCWL 2WP3O 2FD6H 4ODHL 4FQHB 3VD5A 4ZO8A 4JB9H 3ULVF 4JQXA 4MX7A 3T0XA 3V4UL 4NIKB 5D1XB 4H0GA 1WIPA 2VLME 3CSYA 2F19H 4GT7A 3UCRA 1NGXB 1AGEB 4XP5L 2F5BH 3BI9X 5KVEL 4FQIH 3IF1B 5B3JF 2D4FA 3KPSE 2HVJA 1WBYA 1XGRA 5ID1A 3KPRA 4LP5A 1IAIM 1K2DA 1A9BB 3OKMA 2H2PD 4W81A 3STZB 1T1WB 2JCCE 4P46B 4PRHD 5D7IA 1CYGA 2GTZA 3BZ4B 4ZTOL 2JB5L 1NGWA 3DLQR 2P5EA 5JHLL 1SY6L 3ULVC 3QIWA 1LO2L 4G8IA 2BMKB 5EZLB 3QCVH 4J3VA 4NUGL 4O58H 4EDWL 1T3FA 4U1HB 7CGTA 3TNNA 1GGCL 4MD0A 5DUBA 3D18B 5B38G 1BQLH 3CMOH 1XIWA 3TJEL 3UX9B 4K3HA 1FL5A 5A2IH 3EO9L 3V0VB 1SY6A 1OSPL 4NPYB 4Y16B 4BJLA 1AGBA 2XN9E 2GITA 5CJQH 2J8UA 5C71A 2YWZA 3T3PF 1KLFA 1IC4L 3VRLF 1M6OB 1F5WA 4YLQT 2JIXB 3EJZD 4I13B 5DSCB 2NXZD 1QRNA 3CK0H 3BGFC 5ICZB 2H9GB 1A7OH 1GGBH 4IRSB 3ZLQC 4PBVC 5JPMA 4ELMB 3OR6B 1HHHA 1IGFH 1BOGB 1I4FB 1WIUA 2UY6A 3N50A 4WTZA 2LU3A 5I30H 3QQ4B 4ZUUB 5IK3A 2XA8L 2A6KB 2HFGL 5AWNH 5F9JB 1N4XL 4YBLC 3FB5A 1KN4H 5DJ6A 2R2BB 4P3DB 4N8VA 3P73B 3O3AB 3QDGA 2BOCB 1U8HB 3G6JB 4ZYKB 4OQTH 2VH5H 5AZ2H 4NHCL 4HD9A 3SPVB 3KPSA 3GMPB 3UZVB 2GQHA 2OI9C 3NBNA 5KSVB 4HC1A 1V5JA 5ENWA 1N3NB 3GHBL 3O2DA 1L6XA 5CZXD 1SQ2N 1JZ8A 3FJTA 1IAII 5CGYC 1Q94B 1EMTL 5LXGL 2OK0L 1T2JA 2WLYA 2NX5D 2Z4QB 2N1KA 3I85A 2VMFA 4QHMA 2VABB 5KVFH 3L5JA 4NYLA 3DUHA 5E9DD 1XF1A 2D03H 1AR1D 4MNQB 4UOW0 2YD6A 2I5YH 5E2UH 4HV8B 4ZD3L 5F89A 1JF1B 2F74B 3CIQA 1A3RH 2VISA 4QY8B 1M71A 4Z76A 3CDFA 3MGAA 3MLSL 3C5ZA 3MV7E 1P7KA 5I8OL 1WTLA 4OZGE 5DRWB 1P4BL 3C5JA 2VDQH 3WIFB 2DICA 4DUWA 4LGPB 2VN7A 1QSFE 1WF5A 3FT3A 3GSNH 3JV0A 1SJHA 2ICWJ 4K9EH 2R0LH 5HY9B 5FV1L 3DRQB 3QAZB 3U9UA 4UAOB 1QEWB 3C60B 3R06A 3X14A 4YFLF 5EN2B 4R0LA 1R5WA 4WHYG 4N0FA 2ERJC 1F45A 4HWBL 2H32H 3KYNB 1XGPA 4ONHA 3VGDA 4XGZB 2FYYA 5DJ0B 3O6FD 3NABH 1Z6JT 1HHGA 1D5ZB 3H9SB 3N0PB 1SEQL 4U1KB 4CMHC 2IPUK 4XAKE 3O2WL 1LO0H 4KJYB 3QDJE 5FDYA 1G84A 4NQCE 4NO2A 4UBDC 4WUUD 1W2KT 4M1DH 3C87A 3U9PL 4ZOBA 4WI3A 4IMKC 3LN4B 5HDQH 3DECA 3T2OA 5TDOB 3ZYJA 4PUBH 4X7EC 4TOYH 3QG7H 1F90H 3O4LA 1I7TA 4ZOCA 5BO1L 5C2UB 1TCRB 3QH3B 3X3GL 3CLEL 5ALCL 4X98A 2DJ4A 2BVTA 2ICWI 1K4CA 5F7NC 1RIHL 3G08B 1NDGA 1DQML 4Y5XC 4TQEH 5FO7A 3OHXA 1WVZA 3RWJA 3GJFB 1N64H 3P0VL 2V5RA 3AB0C 4R2GB 2NLJA 4LSTL 3EZ8A 4WO4B 4F7MA 5LBSH 2APXA 5AAMA 3FT2A 2AEPH 5BVJA 3ULVE 1N6QL 2NXYD 1T1XA 1CTOA 1N7MH 2DQIH 1OP9A 4KPHH 4BQCA 1A7PL 1XGRB 2QV2A 4Z7NF 1EDQA 1H5BC 3CVHA 4XVSH 1F58L 4PV9B 5TF1L 4QCIA 3OKMB 4NKMA 3V4PL 3CFJA 4RGNE 4QRRE 2AI0L 1DFBH 2JTDA 3OB0K 4I48A 1AJ7H 4OI8A 3D0VA 1NGWB 2VLRE 3BVNB 4F8QA 1KC5L 5IHUH 2DBLH 1GZPB 1T3FB 4HUMB 1NMCC 4NCC1 4TTGA 5GRJL 3TNNB 2WUBH 3KVQA 1QLFA 2IAMC 5F96H 1FAIH 1XIWB 5K9JH 1HDMA 3NCEB 4Z7UF 4M1CC 4PRPE 3FZUD 4LNRA 3QHZL 5JXED 3Q1SL 4FQXA 5L9DL 1YPZB 1JWMA 1HK6A 1AGBB 3FFCD 5DQDH 5JW4M 4LRIA 3QNZA 2J8UB 4J2XA 1WWBX 4IRJD 3VGFA 3FCTB 4WI4A 4JO2H 2R56L 2ZOKA 5EULV 1G7JB 3OPZH 5J7CC 4EOWL 4YNYA 4CJ0A 5HYSB 4MD5A 3LZFH 3KG5A 3T1FA 4ZTPH 4R8WL 4CUCA 3T3PE 1KJ2L 4NQED 5GZOD 3QXDB 1HHHB 4MA7L 4OZFG 4PJXF 1R3HA 2FEDD 3PQYA 5GGVH 5SX5K 4DWHA 1DDHA 3C6LA 4Y1AA 5IK3B 4OKVB 5D6DA 2IPKA 4QGYA 4W70A 3ULVL 2IWGA 5DGQA 1FP5A 3HC3L 43C9A 4KKAD 1B4JL 1KELL 2V6HA 1ZEAL 4O5LL 1WSST 2PTTA 3S3JA 1NFDE 4K9EC 3T04D 3EO0A 1JPSH 4FXLA 2W9DH 5HHOE 4L29A 5HYFA 2VXSL 1CGYA 4LLMA 5C9JA 3O6ML 4NZRL 2CKBA 3C6SA 3DX8A 4PR5A 4PJ9C 1QNZL 5E8DH 4QHNA 4CNIA 4XCEB 5I1IL 1BM3H 5ENWB 1QBMH 1SJEA 1MCEA 4L4VD 5FK9B 4XHQA 4DGYH 4WDIA 3U83A 3G5YB 4DVBA 4G8EA 4OSUH 4KDVA 1V3LA 1E4XH 1OOAA 3BIKA 4XP9L 4NYLB 2X70B 4ZS6C 3WIHH 5HDLA 4MB4A 1U8JA 4MDIA 3QQNA 4MWFA 5BZDB 4UT6L 5IMOA 3UTPE 3RGVC 2H3NB 2VXQH 1E0OB 5F89B 3OZ9H 3BZDA 1T2QL 3B5TA 4QT5A 2VISB 2BK8A 4M9OA 1M71B 4Z76B 3EFDH 2KZWA 4JZJC 5F93C 4HHAA 2ZJSL 1AXSA 1ZA6B 3C5ZB 3S3PA 3RVXD 1SBSL 2GK0B 4XVJL 35C8H 5C6TL 3F7QA 5DT1H 3TVMB 4RMSA 1DBMH 1HI6A 2YBRB 3O8XD 4APQA 4MXVE 1A47A 3FT3B 2DM2A 1NBYA 1OF2A 1N5YL 1SJHB 4ETYA 4PFEA 2AKRA 3KWWA 2OTWB 1ZAGA 2B1AL 4JGJA 1DR9A 3MZGB 5L0QB 3QO0A 2R23B 3R06B 3VDBA 3X14B 2AJZB 4RX4D 4TPRH 4LMQE 2MPAL 4RMTA 3BN9D 4R0LB 3V6ZA 2GJ6D 1Q38A 1XGPB 2VXUL 4TVPD 1U93A 4GBXC 2FYYB 5C2BL 5HD8D 3VRJA 2CDFA 2P42B 4LSQH 2DMKA 2C7UA 1MFDL 1P4LA 5EIIA 2XWTA 5DEFA 4K3JH 2HVKA 2PTVA 3EBAA 1CQYA 2FD6L 5C3TA 3OKNA 4P2RA 4FFVC 4JB9L 2BVPA 2Z93B 1I1CA 5DWUH 1U8OA 3D39E 3SDCA 4BZ2H 1FCGA 3BESR 3CZJA 3FHQA 2F19L 1CFTA 1I7TB 3TFKD 4JFZH 1UT9A 1TQBC 5FIEA 4FTVD 3EYOA 3JV4A 4PRNA 3WSQH 2F5BL 5CINL 3WD5H 1JNJA 3ARDB 4X4YB 4X98B 4FQIL 4ENEC 1K4CB 4YDJA 1FL6A 2OP4H 4PGCB 1IEAA 3G5XB 1NDGB 3FN3A 4UDTB 5J56B 4PB0H 2X4SA 3OHXB 4CVZA 5LJYH 1DZBA 4CVXA 2A6DA 3RWJB 1F00I 5C0CE 1A22B 1ITBB 4OM1H 5IB5B 4BFBD 2GSIB 2Z8SA 5CS7A 1TLKA 4F7MB 3OX8B 1JCKA 5EZOH 2E7HA 5ESVA 5BVJB 3VXRA 4LLAA 1I9JH 4LVHC 3WIIH 1AC6A 1WCBA 4WTZG 1QVOB 3BQUB 1CLYH 3QCVL 3CCHB 1MIML 2R4SH 3DOSA 4O58L 4QHLA 4F33B 3I9GH 2GFBA 4QCIB 4B5EA 4NKMB 4UOW1 3CFJB 3GSQA 1BQLL 3CMOL 4MD4A 4I48B 3H9HB 1KG0A 1DN2A 3EOAA 2Y07H 2VDMH 5ACZB 4Z7NE 2E7LC 3KYMA 3A6BH 2F5AH 1U3YA 4N8VG 5D7SH 2HKHH 5DDHA 3HG1B 5CJQL 5FM5M 3DO7A 4N5ED 1YN7B 3BKMH 3TESA 4IMKA 1I3RA 4LPVA 3KYOA 1QLFB 4JLRA 1OWWA 5DURD 2NY5H 1HDMB 3CK0L 5GHWH 1A7OL 1GGBL 4NM8H 5IMLB 3PWVB 1OL0A 4XBGB 5EO9B 5ETUA 3RY4A 4RWYL 3FQUB 2X4UB 1IGFL 1K4DB 3V8CA 1QO3B 2EDWA 4IDLA 1A1OA 2YRLA 1DL7H 4FXGA 5DA4A 5J06A 1GC1H 3PJSB 4Y5XA 5D2NE 5AWNL 3TPKA 2IMNA 4JY5H 4LCUB 5D1ZC 4YNYB 4MD5B 5HYEA 3T1FB 4XNUH 1BBJB 4PP2B 5EG6C 1R5VA 4YQXH 3O41A 3K4AA 1U3ZA 4IOFC 3RVWC 4NZTH 2GHWB 1R3HB 5J0BA 3PQYB 1G7PB 1FYTD 4O4YH 1BPVA 4DKEL 1DDHB 1BAFH 3C6LB 2VH5L 5J1AB 5AZ2L 5D7KE 1RZ8B 3GJFH 5I16B 3DUSB 1UQSA 2C4FT 2EEAA 2VZOA 4MQ7B 1TVDA 2MMXA 1JYNA 3VFTB 3EYVB 2VC2H 2I9TA 1L0QA 1MI5E 1INQA 3KHQA 4KVCL 3B8SA 3RIAF 4L29B 5FV2A 1EEYB 1F97A 3NPSB 4OQTA 4QWWD 2P5WE 3IJSA 3FO9B 1BREA 2QSTA 5HJ3A 5I74B 4AH2B 1FE8H 4PR5B 5KVFL 3H3KA 2B1HH 2YN3A 3PGDA 1OTUC 5EPMA 4QHNB 3QIUB 2IAMA 3VXSE 4UIMA 3QP3A 4S1RH 1SJEB 3OMZA 1KB5L 2I5YL 4NQUA 5E2UL 2XPGA 1FFPA 4YDIH 1A6TB 4JJ5B 3ZMRA 2AVGA 1A3RL 4RFNB 3SDXF 4L4TE 3IAGC 4OD2A 4KKCD 5EU6A 1NEUA 5LGKA 3ECBB 3ZE2F 2Y7QA 2P24B 2VDQL 4ZFOB 4FNLH 4XNXH 2FX7H 4NBZB 3B9EA 4ZODA 1JPGA 4MDIB 2X9XA 4ZFZA 2NTFB 3GSNL 3RZCC 4PJIF 1NBVH 1XF4B 4QT5B 2ZOLA 3VWKD 3K2UH 4JVUA 1MCCA 4K9EL 2R0LL 2VLJA 4HHAB 1AXSB 4JFEA 5F9DC 4DEPC 1JGVH 2EXYC 2WM0A 1NL0L 4I9WE 4L8SA 3WHE1 4JFHD 4Z7UA 3OKLA 4APQB 1KIRB 4R4FH 1OF2B 3NABL 4GS7B 5F6IB 3KWWB 1NCNA 5C08E 5IW1A 1PG7X 1LO0L 2BY3A 3QO0B 3UTSD 1OAUH 3ARBD 5H2BB 5A3ID 5I17B 2O5ZL 4M1DL 1QR4A 1U8MA 3QQ3B 3CPLB 4LCWE 5HDQL 3ARRA 4L9DA 4KKNA 5AEAA 2BVOA 4P49A 3RWEA 4DZBB 5K9OB 2P7TA 4PUBL 2VR4A 3S35X 2CDFB 4WFFE 4TOYL 2V2XB 3QG7L 3LS4H 4L3EB 1I9RH 1BOYA 1KPUB 2C7UB 4PJXA 3LEXA 2WQ8A 5LKNA 3HR5A 2AEQH 3P4NB 1QFOA 2XWTB 1OTSD 1YA5A 5DEFB 2PCPB 4K7PX 5HGAB 2XTJC 2IALB 3NA9H 4P2RB 1PSKH 2DRUA 3OJMB 2C3WA 4TQEL 2NY5C 1U8OB 4PJGA 3ZKND 3SDCB 4EI6B 3NN8B 1N64L 1H3TA 3CSGA 3VXSA 3LEYL 3VI3F 2C4XA 3RPIA 4OCMC 3HE7D 5F1SA 3BWAA 1U3HB 4K07A 3TZVC 3JV4B 4NO0D 4PJ7F 2BRQA 5LBSL 1RURH 3F7VB 1GSMA 4JZJA 5B8CA 1MELA 3GBLA 4PJBA 5SWZD 1N7ML 2DQIL 1GC1C 4KPHL 4CVWA 3MRGA 4JQIH 5EBGA 2NCMA 2X4SB 3BISA 5AUMA 4XVSL 5BS0B 4TNVK 3OGCB 1RUQH 3LQAH 5F1NA 3HZYA 1DFBL 2GT9A 5J13B 3VFWA 3VD9A 2F54E 1AJ7L 3TBVA 1YDPB 2WV3A 5EU4B 2GYSA 4PJ8C 1S9YA 4ZUSA 1GJIA 4MNHA 1FBIH 2FJFB 3IDNB 1WCBB 5IHUL 2DBLL 2OCFD 5JOFA 3DXAD 3MNWA 1TIUA 3MGTA 1B6UA 4QRQA 2WUBL 4WO4C 1OB1A 1P84K 3DURB 3GSQB 1I3VA 3MGOA 1FAIL 5F96L 2MQ0A 4NCC2 2VQTA 5ICYB 4KHXH 1CICB 2I24N 5K9JL 1KG0B 5L6YH 1F02I 1LILA 4HG4J 3SDYH 2VZSA 5DQDL 2VZ1A 1BD2D 5K93A 2APBA 1SMAA 5KTEH 2AXGA 5SWQB 3DO7B 2EIEA 3FO1A 5CD5C 3MBEC 5CEZD 4HH9A 2Y6SD 4JO2L 1I3RB 1CFSB 3W9EA 4PGEA 3KYOB 1LE9B 4JLRB 4I0PD 4J8RA 1G9MH 3OPZL 2FL5A 3LZFL 4R3SA 4KZEH 4LSDA 1WFTA 3QUXB 2HYMA 1UZ6F 4A2MA 5FM4A 5GGVL 2EO1A 4I77H 1CU4H 1FFOB 1JMXA 1II4E 3O3DA 3NVQA 4YHMH 3LB6C 2EECA 1FPTH 4JHAH 4ELME 3QWRD 3FB6A 1KCKA 2FBOJ 2A0LD 4NBXB 3RWFB 3RNQB 3UROR 1RULL 4EUPG 1R5VB 3CUPB 1JPSL 2W9DL 3DV6B 1OQXA 3ZKSD 4K71C 3WHXB 3KXFD 3MX0A 4S0SD 4S11A 4XPBH 3I02B 2PYFA 3FQRB 4YHIB 5EO0A 4D0DB 1KTKE 3P4MA 1UQSB 5DD6B 2DLFH 5E8DL 3G6JE 4GMTH 5ITFB 2H26B 2PYEA 1QBML 4WV1C 1T2XA 4ZO9A 2BSRA 2I9TB 4ERSH 1NUNB 3T0EB 4DGYL 2E7LA 2R0KH 2DWEA 3IU3B 5IWLA 1KACB 4OSUL 5HJ3B 1GH7A 1FL3B 4EVNA 2DQFB 1M7IA 1E4XL 3BJ91 4G6KH 4X8JA 2DQGH 1UXSA 2FX8H 5EPMB 1DEDA 3WIHL 4OLVH 1WEJH 1I9IH 1IZKA 3I2CL 4WRLA 3IDXH 4YPGA 4JFFD 1G0YR 5F1IB 3ORJA 2VXQL 3BKCH 2NW2B 3OZ9L 4HLZH 1IT9H 3QCUL 3L9RB 1BLNB 4PLKD 1MAMH 3UTQA 3OKYA 4OD2B 5EU6B 5HVHB 3EFDL 4QRPB 1LO5A 5KZCB 4X5WA 2DIBA 1FZJB 1JRHH 5LVEA 35C8L 2Q8AL 3OB8A 5DT1L 3SDXE 1DBML 1F2XK 1KFAL 5CUSH 1ZT7A 5D1ZA 3RWDA 1BMGA 3MRPB 5D9SB 5HHMB 4GLRH 3NZ8B 4D9RE 1R3IH 3HI1A 1W72B 3ZE2E 1NFKA 4QHUB 4U3HA 3FQXA 2AK1H 4NHUA 2VLJB 3P40A 2J3SA 2H8PA 1QPXA 3VCLA 3L5XH 3D9AH 2X4QA 4PJIE 2A73A 3BW9A 4TPRL 1CI5A 3X13A 3MCLH 1CN4A 4L8SB 1K3IA 4P2CG 4PYHA 4F9PA 3NCJH 1CD1A 2HFEB 2OLDA 3GKZA 3MRNB 1FZOA 4LSQL 4N0UB 5I66A 2C1OA 1J1XH 4LCCC 1BEYH 4HULB 4K3JL 3IFLH 5HYJA 3V7AE 2XTJE 4KRLB 1PQZA 4TSBH 3QXAA 1U8MB 1XEDA 1G9EA 3EDJA 2BVOB 5DWUL 1NDMB 2CXKA 4WU7A 3MJGX 1QFHA 1B6DA 2W9LA 3WFZA 5ACLA 3LEXB 3T77A 5IVXA 4JFZL 4D9QD 2J5LB 3BPNC 3WSQL 1X5FA 5DO2D 3H3BC 3ZSTA 2BRRH 5BRZA 2OP4L 2CIKB 4KK6C 4PB0L 3L3KB 4ODBD 1G9MC 2CKNA 4MAUH 2AJ3B 4PJGB 4WFHD 2JK5A 2Z0BA 1TZHA 2QR0B 3RPIB 3JUYA 4OM1L 3H2WA 4FFZH 3UJIH 4CADB 1CGXA 5EZOL 3OV6A 4HZLB 5KVDH 1I9JL 4LSUH 2FH8A 5IB4A 5B8CB 5E24E 3WIIL 4PJBB 1XZ0A 4U6XA 3QWOA 2CO7B 4AEFA 3PHQA 5FB8A 1CLYL 5DJYA 3QDMD 2R4SL 4J3XA 5DA0B 1RY7B 3I9GL 3N1GC 4Q97A 5F1NB 4MA1C 4HPOH 2GT9B 3ARDC 1LP9B 1R6VA 2ESVA 3C09C 5CD3A 4RFOL 4H0HB 1H3GA 5D1QD 3TBVB 2Y07L 2VDML 1ADQH 5DJ2A 3A6BL 2F5AL 1KBGH 4TTDC 5D7SL 1EGJA 2HKHL 5JOFB 4TSAH 5EUOB 3KJ6H 4E41A 5ESQB 4Z7VB 3BKML 4QRQB 2CDEA 4XPAH 2DS4A 3SKUD 1BVZA 3GIZH 4BUGA 4U05A 1QD0A 2A2QT 5GHWL 1JPTH 4GAYA 5TGBA 5INCB 4NM8L 3BQUC 2NY2B 4JRYA 2R39A 4PS4H 3S9DB 4NRZB 4X9IA 1XCQA 2AXGB 4YXLH 5ELIA 1DL7L 1J1PH 5E8NA 1J8HA 1GC1L 4PGEB 1YPZE 3N1PC 5E2VH 4JY5L 5JO5A 3EJJX 2AV1A 1BJMA 4OFPA 3TN0D 1NBZA 4XNUL 3TZVA 4YQXL 1KJ3H 4JM2B 4U33A 5H35B 3RTQD 4XPTH 4NZTL 4O4YL 2OSLA 3D3VB 5BJTA 1BAFL 4JFPB 4J3OC 3WFCH 2ORBH 4OFIA 3PWNB 2D0HA 3R4DA 1J0ZA 1FN4B 4JHBA 4Q6IC 2VC2L 5C3LD 1QYGH 4GFTB 3V5HA 1R3JB 4PRDA 3IVKB 1W0WA 3MBXL 4XH2A 1EXUA 2DQHH 2PYFB 1AQDA 1FE8L 2CO6B 1JPFB 2B1HL 1XH3A 4F2MA 2PYEB 1EO5A 3G5VB 1FRGH 5J3HD 4PJ7A 4S1RL 2IC2A 2D7TH 4I3SH 4N1HB 4YDIL 3SDDD 2FIKA 2FJHA 1UJ3B 3PF2A 1P7QB 1XAUA 3DIFA 1N26A 4EN3A 4Q9QL 1AQKH 1CG9B 2XN9D 3TCXA 3IDYB 5CP3H 3BMVA 1SVZA 3OXRA 1TTUA 1R5IA 3BSZH 4FNLL 1D5MA 4XNXL 2FX7L 1MWAB 4YXKL 3WUWG 3P4OA 5FO9B 1MQ8A 4JZOA 4H88H 4LMQI 1NBVL 2WQRA 2J6EA 4X7SL 3OG4B 3K2UL 4PJEF 2R29H 3QFJD 3UTQB 1EV2E 2G5BA 5IEHB 3QIUC 3RL2A 4OGAD 1LO5B 1DLFH 2ZSWA 1QFWM 1JGVL 2YXFA 4O2FA 5L2JB 4YFLI 1EAPA 4LVNB 3FOLB 1Z0MA 3OG6B 1JNHA 3GJEB 4EI5C 4R4FL 1Z2KA 1VERA 2E3VA 4QEGA 4HLJA 2Z9TA 4NT6A 1T0NA 2XXMB 2LAGB 1KCUH 3DYMA 3CXHJ 2FB4H 1OAQH 2W65A 3VCLB 1G9NH 4NKIH 1OAUL 3RVTD 4XXCC 4IS6A 3IFPB 2A73B 3BW9B 5HPOA 4OM0H 1SYSA 1IAKB 2YPLA 1AP2B 3EW3B 5HHQA 1NAKH 1CD1B 5E70A 2NZIA 4WV1A 4X9FA 1CK0H 1FZOB 1CDBA 3LS4L 1I9RL 3VFRB 3GSWA 1IM9A 4MA3B 3RL1B 2XKNA 2AEQL 4LLUA 1VB9A 3KLHC 2BSTA 4LHQB 4UB0H 5L7XH 5HYJB 2L7JA 2NY1C 1PQZB 3VH8A 1NEZA 2K7PA 4NWUH 1S7SA 3NA9L 2I27N 1PSKL 3L3OA 5F6IC 5E1HB 5C0BB 1FH5H 3UTTE 1FNSH 1P9MC 4WU7B 4CDHA 1JYXA 4XNMB 5D72H 4RQQA 3RDTB 3D48R 5IVXB 4HZAA 3IS1X 4HGWB 4YHKL 2XFXB 1RURL 4BM7A 1HEZA 1RK0A 2F53A 2QSCH 5BRZB 1ZHNB 5J8OA 3DVGA 1JFQL 3VXUD 3MV7D 1JNLH 4LLYA 4JQIL 4JY4B 1G7MA 1RUQL 3LQAL 4QXGH 3UDWC 4LLWA 5IKCA 2YEZA 1W0VB 4JM4H 1QSFD 3QFDB 3IFOB 3L5IA 2HRLA 3T08A 4ALAH 1AHWC 5L2KD 3AM8C 3GEWB 1FBIL 4U1JA 3WFHB 1XZ0B 1UZ8B 1S8DB 5T1LD 3PHQB 3HKFA 3T65B 5ECJE 3ARWA 1Y18B 4DN4H 4PJFF 2DJSA 2V7HA 4HS6A 1C16A 5ID0B 4KHXL 2BNRD 2WBJD 5L6YL 3ULUD 5FOBB 3TBYB 4FQJL 5C07A 3JTSA 4XAKD 4RBPK 1E4KC 3SDYL 3WO4B 3UBXG 3QDJD 2W0LA 4NQCD 1CDIA 1EEZA 5IMKA 1A1NA 1F6LL 3BHBA 3VDCA 1OGTA 4E41B 2VWEC 5T5FH 5J13C 4NRYA 5IBTH 2LE9A 4NQDD 4RAVB 1KB9J 3G5ZA 4MJ4A 3HG1E 1G9ML 2X42A 4LSSH 4LVOB 4E9LA 1E27A 4GAYB 3TBSA 4KZEL 1HILA 3LY6A 4U1MB 1B0GA 5J9PA 4KU1A 1DBKL 4I77L 1HHIA 1CU4L 4CMMA 1XCQB 1TVHA 4YHML 1CICC 4PGJA 1J8HB 2B5IC 1FPTL 2HJFA 4JHAL 2BVYA 2HTLC 3CX5K 3CNKA 1T04A 1TDQA 3I6KB 3VJ6A 3WCYA 5HPMB 1I1FB 4P3CH 5EBMA 4X7TA 1JL8A 4K23H 3HI5L 1CXIA 3UMTA 3S34H 3CJJA 4KROB 5CEXB 1QBBA 2G2RA 2OSLB 3ULVD 3GIVA 1T21A 2ZUQC 3MMEA 2BZDA 1FLRH 5IV2B 1CFQA 1T80A 3FOMA 1D7FA 2DLFL 2Q3AA 4GMTL 3ARFD 3QUXC 2E6JA 3AREC 4RGND 4QRRD 5JR1H 3OTTA 5ISZA 2RFXB 1G9NC 3B9KA 2Q8BH 2RB8A 3TT3H 4XH2B 2CR3A 3HC0A 4GKOA 1NANH 3ZE1F 1S7QB 2HT2D 1TJIH 5MEQB 4G6KL 3LKQB 2DQGL 2FX8L 4OLVL 4DKDC 1WEJL 3GMLB 5KANG 3IDXL 2B0SH 3BKCL 4PRPD 2DIAA 2FIKB 1IT9L 2AJXH 5DQ9A 4JFXB 4EN3B 3KLDA 5CSBA 1CXEA 4LHUD 3ABZA 3PWPB 3OXRB 1CVSC 1R5IB 1JRHL 3SBWC 1KNOA 5C0RH 3QUZD 2YZ1A 4PGDA 3P4OB 2D7NA 4HXAL 4ZS7H 1FNEA 5CUSL 4G6AD 3T8XB 4GG6A 1FZKB 2AK1L 4ORGA 4ZFFB 2BNQA 3Q6GH 3L5XL 4JCLA 5EUKA 1NKRA 1T66D 3D9AL 3MCLL 1IGJA 5EZIH 4ZUVB 3C08L 4PJEE 3NCJL 2KKQA 4CW1B 3WBDA 1PAMA 4H0IA 4Q6IA 4ZFGH 4NT6B 4NJAH 1BEYL 5D2LB 5DD1H 1I3UA 4P23C 3IFLL 3LQZB 4IS6B 1EHXA 4P99A 3UBXI 4TSBL 4IOIA 1SYSB 3MRJA 4HAGA 3HMWH 5HHQB 4V1DB 5BCAA 4YEEA 4CAGA 2AXHA 2IANE 3U0PB 3ZDZF 4E0RA 3MUY1 2ZUTA 1IM9B 3E8UH 4UNVA 3Q5YA 4XHJC 4AT6A 3TH3T 2BRRL 4P4KD 1YEEH 3VH8B 4L3EE 4UQ2A 3KDMA 1NGPH 2NY6B 2I9LA 3L3OB 4WHCA 5FYJH 3QYCA 4MAUL 5KS9A 4F37F 3EYUH 4RQQB 2NY3D 3FQWA 1DUZB 4K7FA 1X6NA 3EJYC 4X99B 3OF6D 5EORH 2XWBA 3UJIL 1Y6MR 3LAFA 4OCLC 5CJBA 3OB0H 4P5TD 2F53B 4LSUL 2UYLA 4ZFOL 3DVGB 4LLYB 5CHNA 4JJHA 5JMOC 3QEHA 1ZTXL 4GW4A 1X44A 3V7AG 1G7MB 1E4XI 2J5LC 2IH3A 2Z8WC 4RA0C 1WLHA 4EI5A 2FO1A 4LLWB 3PXJA 3O0RH 4H1LB 4LAJH 2KQNA 1NAMB 1OP3K 5JZ7D 5KSAB 2HG5B 2YN5A 2UVFA 3GSOA 3K74B 1ADQL 3AU1B 4HUVB 5BS0E 4YDKH 1KBGL 5DQJA 2VWEE 3S4SA 2EYSB 1YQ2A 4NQTA 4TSAL 3KJ6L 4PJCA 3JSSA 3SQOH 3ZO0A 4WW2A 2JJTC 3GGWA 3GSUB 2AEIT 1CFBA 4U2YA 4XPAL 2OJZH 2DM4A 2V7HB 5DJXA 1ZGLA 1CFNA 4HS6B 3GIZL 5C0AA 2D0FA 1ADQA 3VWJB 5KANI 4WCYH 1FO0H 4Z7WF 4LGSB 2NYYD 3F7YA 1KJMA 4CBPA 3U46A 4PJFE 1EEZB 3BHBB 1U8KA 5TJWK 3X12A 3B4NA 3LKPA 4YXLL 1EA9C 1YUHB 2H2PC 1Q9KB 1D5XB 2BVQA 4C83A 3G5ZB 3TIEB 3F5WA 2OL3A 2QL1A 3D39D 1E27B 3GMNA 3AC0A 2IANA 4JM2F 3LS5H 3H42H 1KJ3L 4DOHB 4HFWA 1QLEH 4XPTL 5J9PB 5JXAH 4CMMB 3RX5A 3HFMH 1TVHB 1FYHB 3WFCL 1BF8A 3LHPH 2ORBL 2HJFB 3D0LA 3V6BR 1NCWH 4NQXB 5F7MC 3UDWA 1UEYA 4LPWA 3MYZA 2V5TA 4BKLB 1S7UA 5J4MA 1WT5C 1RHFA 1QYGL 3QNXB 4X7TB 4XC3H 3AM8A 3BWUC 1T21B 3MMEB 2JE8A 2DQHL 2PW1B 4L1DA 1JI2A 2NXZC 1CFQB 3BKJH 2DWDA 3ROLA 1NC2A 3WNOA 5TH2B 4JM2C 2ENSA 4GO6B 4KJQD 1FRGL 1KIPB 5C09A 1ORSA 4QRUA 3C5SA 4I3SL 4IMLB 4PRID 3K81A 5KVGH 3SKMB 3OJ2C 3O6LH 2IADA 4P2QA 2X9YA 1HWGB 1AQKL 4O00A 4DZ8A 5T1KB 3T0EE 3BSZL 3IKKA 3NCYS 5TQ2H 4QXUH 3QPXH 2NY4D 1XGQA 4A6YH 1N5AB 4H88L 4ELKA 5JIIA 3ETBF 3ZE1E 2VXVH 5FOJA 4GKSA 1MREH 2R29L 4AENA 2AXFA 1T20A 5DEGA 4GKZB 1E6OL 1DLFL 4PJFA 5HYIA 1LHZA 3RWIB 3D25A 2I07B 1NEZG 5I1GH 2VE6B 5CZXC 3U4EA 3IDMA 1UJ3C 3JWOH 3IDIB 2X4NA 1VFAA 1H9VA 3NPZB 3IDYC 5MHSE 15C8H 1WFOA 3L3IB 4FQ1H 1KCUL 4YIQA 4ORGB 3TA3B 2FB4L 3NIGF 1OAQL 1E4JA 2BNQB 4YC2B 5EH1A 4YDLB 1G9NL 4NKIL 5HHME 4ETQA 5EUKB 4PJ9D 4OLUH 3I3DA 1D9KD 4B53A 1NFIB 5DZOA 1AR1C 1IGJB 4OM0L 3ROOA 3U79A 3F12A 3SO3B 2CQVA 4LLQB 5DR5H 5BQ7A 3MRCA 1IRAY 1CK0L 3BP6A 4JGMA 4I5BA 1MI5D 1RHHA 1YZZA 3MQIA 1I7RB 2OTPA 1QSEA 2NR6D 2IH1A 1IQDB 2P5WD 4UB0L 1INDL 3ZKXC 5L7XL 3B9DA 3C8KB 4N0UE 4EDXB 3QZWA 3MRJB 4PJ5B 2X10A 3E6FA 5BZWA 4G42A 4NOBA 3U30B 1FH5L 3OAZK 1SM3H 4PRBB 4NKDA 3RGVD 1NC4A 5D72L 4HIHA 4HJ0D 1NCDH 5B39B 1N59A 1ZWIA 2R2HB 4ISVB 3NFPB 2QSCL 1A14H 3LKRA 3KDMB 4Y4KB 1PBYA 3F7PC 3SBWA 1JNLL 4ZQKB 2I9LB 5DRXA 4XC1H 3CFBA 3O6FC 5E1AB 1UKTA 4EXPX 4LSPH 1OW0A 5KS9B 1TITA 4JM4L 4NKOB 3HHRB 2YRPA 4Y88A 1ITCA 4CJ1A 1ZSDA 5E8PB 5BMFH 1HH6B 2XWBB 1GXEA 4ALAL 4QTHB 2BERA 3KJ4B 3N85H 4L8BA 5C0GA 1A6AA 2D31A 3O9WA 2QKIA 5CHNB 4F7EB 3LH2H 3LKOA 3RDTC 2Z8VC 1D5BA 3KNBB 1OM3L 3HPJA 2HJLA 5DK0B 4DN4L 4GBXD 1W72L 1PG7W 5GRYA 3MSPA 1M7XA 1K8DA 4AQOA 1T1YB 2ED7A 1LEGA 3MJ8B 2XZCH 1XGTA 2ZG3A 4ZO6A 1ES0B 4PJCB 2AV7B 1DVFD 4MLIA 3KPNA 5DRZB 5TE6H 4P9HH 4D0BA 4WW2B 5IBTL 3RNKB 1ZGLB 1HIMH 2YZ8A 3BYYA 4LCWD 1JV5A 4LSSL 3HZMB 1VENA 8FABB 4WFFD 2NXYC 4Z7VE 2YD4A 1ZLUK 4F58H 1C12B 1F3JA 4PY7A 1KJMB 4MNGA 1MHCA 2C3GA 5FF6B 1U8KB 1U8PB 3EYFA 2E7MA 3GMRA 2EC8A 2BVQB 4TVPH 4Z7WE 3PABA 1J0KA 2OL3B 5CJXC 4RNRA 3PNWA 1K9TA 1OGAB 4YJZL 4HCRL 4P3CL 3MRLA 4K23L 4BYHA 2JB6B 3S34L 5D7LA 4M3JA 1BX2B 3ES6A 5D1XD 1A9EB 1L7IH 5EIVA 1FLRL 2MFNA 4HIJB 3JWOC 3FZUC 1N6UA 5A2FA 5JXEC 1AC0A 4R9HA 2ADJB 2YC1B 4OJFH 1S7UB 1QA9A 3L3DB 4HLZG 1FVCB 1JUFB 2IF7A 5MEPB 4HDIA 1LNUA 1YN6A 4IRJC 2VLKB 2Q8BL 3TT3L 1LD9A 1WQVT 2DQDH 3G6DH 3VRIA 1WJ3A 4P46D 4DGIH 1TJIL 3ROLB 1NC2B 4H1LH 4PG2A 3L3JB 2E9WA 1KENH 1WBXA 4OZHF 1ORSB 1X5YA 3GO1H 1TXKA 2XT1B 5E4EB 2B0SL 2FEDC 2F58H 4CN6A 1OVZA 1S78C 2AJXL 2APTA 1SJXA 4YPJA 1R3LA 3SE9L 1AH1A 3MRFA 3PDDA 2YUXA 3MJ6A 5FYJE 4BFIA 4Z77A 4KKAC 4DZ8B 5FHAL 1J05A 4PREA 5GS0D 3BXNA 2W38A 5C0RL 3VXMB 1BFOA 4PRHA 1XGQB 4ZS7L 4Y16D 4WWKA 1VADB 3F58H 1EEQA 1YNKH 2W9EH 2XKSA 3MCG1 5BXFA 3LSOA 1B4RA 3RWGB 1R0AH 5L8LB 4GKSB 2F8VA 3K0WA 4AENB 2JIXD 2EEBA 1JWUB 1T20B 5DEGB 2XICA 4PPTA 5FHBH 1NLDH 3MRDB 4ZOAA 1S7VB 1PYWA 4LLDB 2ZCKL 5I73C 1IKNA 4JR9H 4IRSD 3IRPX 3U2SB 2ZWLT 1ROWA 5EZIL 3U4EB 4WHDA 5C0IA 3PL6B 4ZFGL 1VFAB 1U8LB 3RAJH 1VFBA 4K2UH 2QADB 4GW1B 4NJAL 5DD1L 2DM7A 1I1YA 4ETQB 3VA2C 5IB3A 5F72S 4BFEA 5T1MA 5IFHL 4M3KB 4R7NA 1RZGB 3HMWL 3BH9A 4FFWD 2PW2A 2F8OA 1CD9B 4BQBA 2IFFH 2WWMC 3MR9B 3KYAA 4P9MH 2VDPH 5GGUB 2QQQA 1KPRB 2IMMA 3E8UL 1FSKB 4GOSA 4U6VH 2IH1B 1T83C 3KLAB 2Q86B 3R8QA 3RFZC 2HAZA 3DX9B 3S4SG 4JY6A 3O8XC 1NGPL 3MLXH 3E6FB 3GK8L 2QBWA 4G42B 5B4MD 3R8BB 3ZDXF 5FYJL 2FLBT 5E5UB 1RJYA 5JUEH 3EYUL 3GMMA 4YX2H 1ZWIB 5ERWA 3QI9A 5EORL 5C0BE 2C1PA 2VN4A 5DD0H 5KSBA 2GUOA 3KPOA 2HFFA 1J0YA 4MNQD 2QTEA 1MCPL 2CRIA 4OCSH 1BJ1H 3H0TA 1N2RA 1Q0YH 1YEDB 3BO8A 4UIKH 4JKMA 4OV5A 4YDVB 5FXCH 1OSZA 3O0RL 1WZLA 2NX5A 5J6GB 4X9GA 4D9RD 2FJGB 3DV4A 2NY6C 4CL7A 2DF3A 2A6JB 1KPVA 4CDGC 4PJAB 4YDKL 3RHWF 5C0GB 4FP8H 3MRHA 5E9DA 2QKIB 4KQ3H 1YNLH 2AJVH 2W92A 5D8JH 3SQOL 1ZGLM 5J57B 5IJKA 3DBXB 2HJLB 2HTKD 3IXAA 1HHJB 1JRHI 2OJZL 3TFKC 4MAYA 4CVUA 1V8HA 5BV7H 4WHTA 3VFMA 3C60D 1FNLA 3RIFK 4XCNB 3Q48A 4WCYL 3MOQA 4M5ZH 1FO0L 4GLRI 1KLGA 2YHGA 1S9WA 1XGTB 5FUZH 5MP6H 1GCFA 1S9XB 4DVRH 4Y5YB 5F21B 1NUDA 3KPNB 2OJEB 4BH7B 4D0BB 4AK1A 4G5ZH 4L9LC 4K3EL 1RFDH 3WXVH 3ZDYF 4F9LC 1X5IA 1BBDH 5JHDA 1X5GA 3TV3H 4DFIA 1DP0A 4OGYH 3MLRH 1F3JB 1MCNA 3H42L 3LS5L 4L4JA 1QLEL 4IEFB 5JXAL 3HFML 5DS8B 2E5EA 3LHPL 1NCWL 3PABB 4N0CD 3B3IA 1ZHLA 1S7XA 7FABH 3FFCE 2YPKA 4EXKA 4KUCD 3MRLB 4KKLD 4PJ8D 4DQOH 4WUUA 4XC3L 2ARJA 1KULA 3MYJA 3NCFB 4AG4H 3QG6A 4R2GD 3U36A 4ZNEE 3BKJL 4WEBH 4WO4D 5MERB 2V2TA 2LAAA 2Z8RA 5JDJA 4WENB 3V2AR 1A6PA 1QA9B 1U36A 1VKXA 3REWA 4P2OA 4TNVF 5D6CB 4ZXBB 5MI0B 1LD9B 2YXMA 3O6LL 3O6KH 4NNXB 3QWQB 4W6WB 1DQJB 1IEHA 1ZLVK 3MBED 4HWZA 2I25N 3VU2A 4I3RH 5C1MB 1JK8A 4QXUL 3QPXL 2VKXA 1IJ9A 4A6YL 3QT2A 5GISH 3HZKB 1BZ9B 4N9OB 1A7QH 2VXVL 1MREL 4BH8A 5ESAB 1BFVH 2N4IA 1XIWD 3LB6D 1J05B 1AGCA 1YY9C 3FT4A 4PREB 3DI3B 3BPOC 3BXNB 3QZWG 5I1GL 5LCVH 4PRHB 1EERB 4A6YA 5HSFA 3H7BB 5GXBB 4WWKB 5CJXA 3JWOL 2BOBB 3PWPE 4QWWC 3LSOB 3WS6C 4LLVB 4MQXD 15C8L 4FQ1L 1A6ZA 2PO6A 4ZSOA 4DGVH 2VIRA 4M7JH 1CDCA 4XTRC 5TF0A 1H8SA 4OLUL 4NZUH 4QGTA 5CEZH 5DC0A 1Z3GL 2YA0A 4Z0XA 5A1AA 5GGQH 4Q2ZA 3WFBH 2G9HA 3K8KA 5DR5L 1OD7A 4HKZB 4HMEA 1Z9MA 4LCIH 3EGSB 1VFBB 4KKCC 3A6CH 2IQ9H 4OCXH 3U1SH 4FZ8L 3SHSA 5IJVA 1CIDA 5F7DA 2YRZA 5IB3B 2AGJL 5A2LH 3MLZH 5D2LE 2F15A 5M94B 2A74B 1UEMA 4UTBH 5BV7C 2RIKA 3BH9B 3GKWH 4LNVA 4NQEA 3VWKC 1SM3L 2X4PB 2J12B 2VKWA 4YDLC 1NCDL 1VGEH 2H2SD 3OKDA 5EOTA 4EQ3A 1U91A 4HS3B 4AQ1B 4V1DE 2FEEL 3MRRA 4HUXB 4M8QB 4JY6B 4L1HA 2G60H 4KH2A 4XC1L 1YEGL 2EDBA 4OGZA 4KWUA 4Y8AA 2DMBA 4HKBA 1RJYB 3PWLA 3VGAB 1AXTH 3FRUA 1IGCH 3GMMB 5ERWB 1UKSA 3I50H 5JA9A 3QI9B 1WZMA 5BMFL 2E27L 5KSBB 5A3IC 2HFFB 3K2MC 1L9MA 4UUJB 5JW5A 4YH6A 4FN0A 2J4WL 1WAAA 2WMPA 1R24A 1N2RB 4G8GA 4OZHA 1NCCH 4U6YA 5JNYA 2KDGA 4FTVE 4OV5B 5E94A 1LEIA 3STLA 1HH9B 4L4VA 3VD7A 2EZ0D 3S5LA 4HWUA 1OTSC 3B6SA 3HNVH 1CT8B 2XG5A 2OXGA 4M6MH 3O4OC 4NDMB 3JV6A 4C56B 3HCVB 4MDJB 3TVMD 2ATKA 1IGMH 1MRCH 3ZKNC 1LE5B 1ZVSB 4P9HL 1AO7A 5HHVL 3U7AA 25C8H 3IXAB 5LAXA 1CVRA 1DANT 3DGGB 3HUJB 4MAYB 3HE7C 4KRPB 1HIML 1KT2A 1MCIA 5EC1B 2H6PA 4P5MB 4HUWB 4JG0H 2C3XA 4F7TA 1KLGB 4F58L 3V5KA 2N7BA 4CU8A 3HZVB 1ZVHA 3W9DA 1T83A 4HF5H 3RBSA 1ED3A 1DUYB 3RUGB 1CGWA 3O8XA 2BNUA 3NCMA 4XRCB 2NY7L 4K94H 3MRBA 2YK1H 4XAWH 3GNMH 5J6HA 4KK5C 2IQAA 3CXDH 4BSJA 5JHDB 1FVDA 1LQSR 2DM3A 3T0BA 4U3XA 5TDPA 4G9DA 4U1SA 3DVIA 3MV11 3FB8A 3V6OC 3UTZA 2EDEA 3QO1A 4RX4A 4IIQB 3BKYH 3ZDYE 5I8CA 2B2XH 5EC2B 3UJTH 2GJ6A 1L7IL 3UXFA 1UXWB 3PV7A 1NCTA 1IM3B 4ZNCD 3ARDD 1ZHLB 1S7XB 1R3KB 1U9KA 2EIZA 4OJFL 2YPKB 1FG2B 3GDBA 2DL2A 3AS3A 2IG2H 3W82A 2ARJB 3MYJB 3BAEH 2DQDL 2Y6SC 2BCKB 1KIUA 4V2BA 4ZPVB 3QG6B 4OD1L 3PWJA 2D7OA 4I0PC 4DGIL 3IKCA 2D7PA 3IYLW 1EAJA 1CDGA 3STBA 1NAML 4X4MA 4NN7B 1KENL 2UVEA 1QRKA 1M4KA 2KZ1B 4LL9A 3GO1L 4X6FA 3BQUD 4P2OB 1VHPA 2F58L 3GSVA 3MA7B 3QUMA 5FCSH 1KTDA 1DE4A 1A7NH 2A0LC 3FO2A 4HWZB 2Z31B 4L9LA 1WUNT 5F3BA 1T4KA 3WLWD 4QRTA 1WBZA 3NACL 3EZJB 1REIA 3CFDA 3HG1D 3F58L 4OD3H 2W9EL 1YNKL 2RBLA 1V3MA 4R90H 3Q3GA 1R0AL 3EO1A 1K5NA 5D4QA 3NFNB 4BH8B 2E9IA 3WN5C 4C54A 2Z35A 4UNUA 1NLDL 2W60A 3WYRA 1AGCB 3TJEH 4JR9L 5E4EC 1J0IA 2P45B 5IOPB 5KBNC 5E5MA 5LQBH 3RAJL 1U95A 5T3XD 5I8KH 4K2UL 3RZWA 1A6ZB 4X6CF 4XB8A 4IJ3B 4Z78A 1IC4H 2PO6B 4QOKB 1SYVB 3DHJA 4Y4FA 2Y5TA 3AGVA 2YSSA 1CXLA 4Z0XB 1OT1A 2HFTA 3G6AA 3PQYD 1JN6A 3JTTB 2BY2A 5M95B 4PLKC 2IFFL 3C6LD 4G9FB 3GMQA 2VDPL 1I8MA 3OKOA 1A4JB 1XF3A 4JFHE 5FYJU 4U6VL 1Q0XH 1MHHA 4KJWD 4Y2DB 4ZPTA 5B38A 1EJOH 1T5WB 2BJMH 5I75C 3DRTA 1HHKB 2EIBA 1F4YH 4MCYB 5IR1B 4PD4J 3RKPA 3B5HA 3L3HA 2IBZX 4I2XE 5GIRA 3LKSA 5DD5H 3FTGA 5JUEL 5GGTH 2HWZH 4UDUA 1Q9WA 3PGCA 4LCYB 4YX2L 4PJ5E 4R96B 1FYTA 3ILQC 5IVZB 1IEBB 2HLAB 1GYAA 1DLHA 5DD0L 5IM7A 3QIUD 1KIQA 5IFAH 3LRHA 4U4BA 5D93B 4K94C 4OCSL 3PWUA 1F11B 5I0ZA 2Z92B 4JKWA 4UIKL 1NANI 1FORH 3GZKA 2WANA 3LN5A 2ICWA 4XNQB 1FSKC 4OFYA 4AJ0A 2LU7A 2OK0H 4JDVB 3QSKB 3VGHA 4PJDA 2FSEB 1MHEA 3D85B 5JW5B 1I7ZA 4HG4K 1DN0A 4FP8L 3MV01 2GJJA 4KQ3L 4S1QH 1YNLL 4G8GB 4OLWH 5TE4L 1BVKA 1ZT4B 4RBPH 5JNYB 5KAQF 2QQNL 5I18H 2XXCB 3M17A 1ZHKB 4I3GA 1MH5A 4M9PA 5E94B 1LEIB 1ERNA 5FKPA 4QRSA 5BV7L 1YNTB 3S5LB 5DO2C 4AY0A 4AL8H 1S7TB 1FNGA 5SWZE 3SDAA 4M7ZB 1P4BH 3JV6B 3ARXA 4HK3N 4APQD 4M1GH 4XCYA 5MP6L 4BELD 2DDQH 1WK0A 4DVRL 1H15B 4Y19B 5MENB 1AO7B 4G5ZL 3SJVB 2B20A 4ODUA 2EIDA 2ICES 1RFDL 3WXVL 1DEEB 5IF0B 1BBDL 3VWKA 4DK3A 3VFUB 3V6OE 4JAMB 2H6PB 1VACA 3TPUA 3TV3L 3BEWA 3ARGB 5HDOA 1EEUA 2V9TA 3MLRL 4OGYL 1UADC 3BZFA 5FKAA 3W9DB 1PFCA 1DSFH 1U2HA 2DTMH 2ITDA 1QQDB 3QBTB 2BVUA 2BNUB 4L3ED 3BP4B 2LU4A 3CC5A 3VI4F 2WSKA 1SEQH 2DLIA 3D6GA 2VDRH 4NO5B 5D1QC 1FVDB 4IDJH 7FABL 1FLTX 1DQLL 4G9DB 1KXQE 3MV9B 4PTTA 3UTSA 3ARBA 4DQOL 4P2RD 2EDQA 5CEZE 3RVUD 5ADPH 3DX6A 2EDJA 3QXVA 3IJYA 3BD3A 3DX7A 4OV6F 4B7IA 1OGAE 3E2HB 4AG4L 4PGBB 3ZYIA 1U3HD 2K1MA 3IDJA 4MJIB 1MCKA 4WEBL 3AMKA 5D5MF 2JELH 3MUZ1 2W0FA 2EIZB 4I0CC 3X3GH 1U92A 3CLEH 1P1ZA 5F8QC 5I1AA 4E5XA 5HVWA 2RAMA 1KLUA 1NJ9B 3KPMB 2XQBH 5BS0D 3VXTB 1DBJH 3O6KL 2EKSA 3LRSB 2V17H 5GRZA 3P0VH 4X6EA 5FO8A 5FECB 4HUUB 1S5HA 3PG2A 4I18B 4X6BB 4KJPD 2VL5B 3VG9C 2VLKE 3HE7A 4NO0A 4OF8A 4KAQH 2M1KA 4KMLB 5GISL 3RTQC 2PNDA 4LKXB 3GI9H 5EU3A 2VTFA 1A7PH 3GSVB 1UWGH 1A7QL 3QUMB 5F9AC 1IQWH 1ZA3A 5C9KA 1BFVL 5IW6B 1F58H 2UUDK 1CICD 5LGHL 3L5WB 5H94B 2DI9A 2HTLD 3MROA 5F3BB 4IM8A 1T4KB 3MLYH 3WNMA 5LCVL 1WBZB 1OPGH 4PJHF 1VEMA 1YMMB 3T0WA 3ULUH 3SCMA 3V6OA 4U1IA 1RVFL 5CEYB 4M62H 1K5NB 1VA9A 4OLEA 3VXME 1LO4H 3DXAA 4YHYB 3KPLA 5J11C 3BGMB 5GRJH 1KYOK 4NZUL 2EC9T 5J3HC 2ZKHH 1T5XA 5GGQL 4AEEA 1MFAL 2PTUA 3QUXD 3WFBL 1HINH 4NNPH 1S7WB 1BJ8A 1E4WH 4GRLA 2ZPKH 5IG7B 4HIXL 4LCIL 4X6DA 1BD2A 1GGIH 4ODWA 5HVFB 4OCXL 3U1SL 4Z78B 5LWYL 4JRXB 5HI3C 4Y4FB 3U6RB 5GGSA 5I1LA 2AK4B 2Y5TB 4EOWH 3GUTB 4I0PA 3MLZL 4BK4A 1TCMA 4R8WH 3KPTA 4LDEB 4X5XB 4UTBL 4X6CE 3P9WB 1MQKH 4GUPA 3GKWL 2R69H 2OR9L 4OCRH 1EHAA 3L5HA 3UAJD 4U6HB 3ZYOA 1P2CA 3BRDA 1VGEL 4JQVC 3DWTA 1I8MB 1PZ5A 1X5HA 3AVEA 5H8DA 3LMJH 1MHHB 1PKQA 1QLRA 5IB2B 4UT7H 4ZPTB 3TO2A 5B38B 2AABH 3QWRA 5T3ZD 3MLTA 1U8QB 2G60L 4XWGH 3T0ED 3TYFA 3L3HB 3FTGB 4JE4B 4GG8A 4GAGH 1AXTL 3D2UD 3QDHA 1IGCL 2OQJA 3QEQB 3KXFA 3I50L 4RZCA 3ALWA 3RVTC 3OBAA 1DLHB 3ZSSA 2FR4B 4QXTA 3TJHD 1OP3H 3MV8E 1KJVB 2VRAA 5FM5O 3MJ7A 2Q20A 1JGEB 1NCCL 3QNYB 4LAQH 4U3CA 5EB9A 3IETB 5CSZA 2ICWB 4OFVA 3WNPA 5EU6D 4QRPD 1J7VR 4AEHH 5DHYA 4MJ6A 3HNVL 4HWEH 5GS1A 5MHSD 3L6FA 3BEVB 1H0DB 3HE6C 4M6ML 1I7ZB 4U1NA 2WBKA 5ICXB 1IGML 4OLXH 4JPIA 1QACA 5HHMD 1KN2H 5HGHA 5DFVD 2EDRA 1ACZA 3MFFA 5FFLA 5CIPA 4JFFA 4YK4C 4JFYA 25C8L 4LSRH 4NUJB 1MH5B 5HHNB 4PJAE 1Z5LA 4WFED 5EA0H 5FKPB 5KJRH 4PGZA 3HA0A 3HTLX 5FM8A 3SDAB 5J12C 2ZJSH 2DQEH 3ULUF 3V95A 4Q74A 1AIFB 3DARA 3QDME 1G6RB 4XHJD 3NGBB 2DQTH 2W0PA 3BZEA 3BE1L 4HF5L 3IXTA 4XCYB 5HGBB 4MJ2A 2UWEF 4JN2A 1CDYA 2A6IB 4QYOB 4K94L 1K6QH 2YK1L 4XAWL 3GNML 5E0QA 5GJTH 1XT5A 1TVBB 2B1AH 4KVNH 3CXDL 2HT3D 1VACB 3TPUB 1X7QB 5DJZA 1T89C 5JIHA 3HLAA 3PP3K 1S7RA 4D9LL 4J7RA 3ULSA 3BKYL 5E8EB 5DK2A 4ZUWB 5BW7C 2B2XL 1I1AB 2ITDB 2X44D 3UJTL 4OZIF 3D69B 1YEHH 4H1LG 1NGQH 3H6JA 3ULUC 4CKVX 2P43B 3LRGA 3GM0A 4PTTB 4U0QB 4XZUB 5SWSB 4WNQB 3VI4E 1HQRA 3JVGC 1G7QA 3DX7B 3BAEL 2FHCA 2WWKO 4M6NH 1MF2H 1UC6A 2X05A 4R4BB 2AERT 4FQPA 5CINH 1U92B 3QPQC 3L3GB 1G1CA 3S8WA 1CFVH 1KLUB 5IHBA 3UPAA 4F57H 5D5ME 2WIIB 2EKSB 2VNCA 2HJKA 4BZ1H 1A7NL 4X6EB 2PETA 1V3JA 3S88H 4J1UA 1J5OH 1MAKA 1ZLWK 1UB6A 4U31A 4WU5B 1T1ZA 1FC1A 1FC2D 3TO4A 2HH0L 4NO0B 1LDPH 4LASH 4OD3L 3BDXA 3HRZA 4KUZH 5JW4Q 2MJWA 4R90L 3AXLA 3SO5A 2DLTA 1MIMH 5C0EA 3JZ7A 4OUOA 3QDMA 1ZA3B 3MLUH 4JFDB 5HHPB 3MLPA 3HMXH 3SGKC 1M05A 1HWHB 2FH6A 3ARFC 3DI2B 3C9NA 4UU9A 3MROB 3OR7B 4YR6A 4RGNC 2NY2D 3MO1B 1EVTC 5E6IB 5FGSA 1KCRH 1FFNA 3GB7B 4NQSB 3SCMB 3HAEH 5LQBL 5I8KL 1EFXB 1Z9LA 3AS0A 4N0RA 5DHVB 4JREB 2HT2C 4BSWA 2E9BA 4PJHE 3MZTA 4K3GA 3QXWA 2Q7NA 5A16B 3QHTC 3BUTA 3QUYA 4LEXH 1EH9A 4JM2D 3WO3B 2A83A 5CJ8A 5EO1A 3QFJE 5ANMA 2R1WA 4RWYH 2CIIA 3D3VD 2IGFH 4GRLB 4M7KH 5DK3A 3CFKA 3TBWA 3LV3A 1NFDF 1BD2B 4ODWB 3OAZH 2MTPA 4Y4HA 2YUVA 1RUAH 1Q0XL 1I7UB 4TVSa 3QUZC 3V5DB 5I1LB 1EJOL 2BJML 1BECA 2R2EB 1GVIA 5KN5B 5KG9A 1F4YL 3TN0A 5GGVY 4G6AC 1A64A 4MLSA 5DD5L 1SEBA 2XKUA 5GGTL 3MLVH 2HWZL 1RJZB 1YMHA 1P2CB 4DKEH 2GCYA 4P3WA 4LEOA 3ET9F 4YHOH 3MJ9L 1T66C 4KGLA 3P9LA 1EUTA 5IFAL 3K8LA 5DJCA 3GBNH 5FYJD 5IB1A 5E00A 3Q6FB 1OLLA 1FNAA 1FORL 3SY0B 4C59B 4XNZB 4KVCH 1P7QD 2JCCA 4JCMA 4HKXB 4IHOB 1AGDB 3RWHA 4D8PB 5C0JA 2JJSA 3DMMC 1BQS