4ZXBA

Structure of the human insulin receptor ectodomain, irdeltabeta construct, in complex with four fab molecules
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
219
structure length
214
Chain Sequence
b'QVQLKESGPGLVAPSQSLSITCTVSGFPLTAYGVNWVRQPPGKGLEWLGMIWGDGNTDYNSALKSRLSISKDNSKSQVFLKMNSLQTDDTARYYCARDPYGSKPMDYWGQGTSVTVSSAKTTPPSVYPLAPGSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab 83-7 heavy chain
molecule tags Hormone receptor/immune system
source organism Mus musculus
publication title Higher-Resolution Structure of the Human Insulin Receptor Ectodomain: Multi-Modal Inclusion of the Insert Domain.
pubmed doi rcsb
total genus 45
structure length 214
sequence length 219
ec nomenclature
pdb deposition date 2015-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4zxbA01
4POUB 4PRDB 5MI0C 3QULA 1KIQB 2BDNH 2Q6WA 3G5XA 3RVUC 1FH5H 1P69B 2XKNA 4OJFH 5EUOA 2V2XB 3PJSA 5E95B 5DSCB 4XWGH 5DMKA 3KLAA 5BRZB 1EBPA 2HWZL 1FG2A 4OFPA 1QSED 4WCYL 1PLGH 2BY1A 3VXRE 2FATH 4X9HA 1QQDA 3HAEB 4WTZA 3X12A 3W82A 1QKZL 4IRSD 1J10A 4Z0BL 4HDIB 3ULVF 1OT1A 5E2WH 1S9WA 3EW3B 3I9GL 1HQRA 1XGUB 5I2IA 1G9NL 4MJ6A 3IJSB 4YEEA 4F2MA 4EUPA 4F57H 2O5XH 5IB5A 4HLZG 3CCHB 4F7TA 1T89C 4JAMA 3E1F1 2W9DH 2WWKT 6CGTA 5LGHH 1CGUA 4H88L 4C56E 5GRZA 2VXSH 4M6AA 2XIDA 2FGWH 5CJOH 4I48A 4PG9A 3U7YH 4JB9L 1WTGT 4PJGE 2I07A 5K9OA 3LRSB 3VE0A 2AJXH 5SV4A 5HYEA 5H37H 2QKIB 2JKXA 3BN9D 3UTTE 3SGEH 4FG6D 4LQFH 3ZKMC 1NJ9A 4OFKA 5AZ2H 3OF6A 1T66C 1ZXQA 3QG6B 3RI5K 2LU3A 5KTEL 5KG9B 4I8DA 1BZ7A 4QRRE 3RJQB 3PWVA 2D31A 3BWAA 3DSFL 4UT7L 4HUKB 4TNWK 4M03A 4NNYB 5DRXB 1NQBA 4RIRA 2ADGB 3AY4C 5FYKL 2J1KA 5GHWH 3LOWA 4PRBB 2VLKB 1UXWA 5LWYH 2XZCH 1QRNA 4MVBC 1EHNA 2RFXA 5HGAB 1KN4L 4KTEH 2FO4A 2Y07L 4X6FA 2OL3A 4YH6A 1XR8B 5GS1C 1T4KB 4KPHL 4GG6B 4P9MH 1AJ7H 1YMHB 4JY4A 3B2VH 4UDTA 4R26L 4OV5A 3IJHB 5A40E 4UT6L 2Y5EA 5JOEA 2ATKB 2A6IB 1CDIA 4LMQE 3RVXD 4P2OA 3U4EA 1H15B 5AAMA 4ZTOL 1RV6X 4ODTH 2DWEB 3BMVA 2MJWA 1RI8A 4Y1AB 1RIHL 4EI5B 2EKJA 4I13B 3WXVL 4CGTA 4NQTA 5BO1H 5K59E 2NY6D 4YNYB 5JQ6H 3MCG1 3RVVC 5LG1A 3MJ8A 5FF6A 5T3ZD 3SDXF 4NO0D 1FNSH 2WM0A 3TJEL 5DUPL 2NY2D 5EBMB 4UUJB 4OLXL 3V6FA 2VL5A 3MLUH 4Y5YA 2ENSA 3S3SA 1EXUB 4MCZB 4AQ1B 5CEZE 5B3JF 3NCYS 4OF8A 1OAYH 1YECH 1H0DB 3P4OA 1G1CA 5FAAA 5T1MB 3C6SB 3KAAA 4F3FA 1BQLH 2VZ1A 4M02A 4JFQB 3BO8A 3LKQA 4K9EC 4OUUB 5F7HA 4MAYC 3IU3B 4RFNC 2V9TA 1OSPH 2UYLB 1B2WL 2Q87A 1N3NA 2W0FB 3TYGH 2LAAA 1A2YA 3EYVA 3SE3C 1G6RL 1UGNA 5DURD 4LHUB 4OD1L 3TFKC 2BRQA 1FL6B 1XT5A 5K9OB 3HPJB 2PF6A 2LVEA 4X5WB 5L2KD 4XHJD 4H25B 2V2TB 4RAHA 5D93B 1G84A 3SDDB 3EJYC 3JWOH 2EYSB 3PDGA 4K7PH 2YMXH 1BVKA 3LMJH 1H3GA 4L8SB 1NANH 4M6MH 4DCQB 5KSAB 1S7VA 4G6ML 2PW1B 4DGYH 5FO9B 3TF7C 3RUGA 4HIXH 2GUOA 3UXFA 3S97C 2P5WE 2DMKA 2GEEA 4G6AD 1P4LB 5DJ2B 3WO4C 2X4RB 1S9WB 4HS6A 2XY1A 1K85A 1YEDB 4K7FB 3IRPX 4P0DA 4WWID 1IM9A 3CK0L 4MAYD 3X12B 5JIHA 1D5IL 3QXDB 4LPWA 3OAYH 1QLRA 5I16A 3O9WB 2IPTH 2DBJA 3CFCL 4RWHA 3RU8L 1RIUL 4CBPA 3MRHB 4FTVA 4JKMA 3RWIA 2DBLH 4OLZH 5B39B 2XKNB 5EUOB 3WXWL 1IKNA 4GKZB 1UKSA 4YHPA 3JWNC 4LFHG 3QULB 3SGDI 5CILL 4KU1A 2ZP0T 5KTEH 1HE7A 3IDIA 1RULL 4G6KH 4KWUA 3HI1B 2XKUA 4HZLB 3FB7B 2ZCHL 1FAIH 5IT2L 2XN9A 1NBZB 3NAAH 3QRGH 1MJ7H 3VXUE 1JHLH 2WIIB 3KPRD 1OM3H 5E6IB 5B8CC 5L8LB 1QHOA 4DZBB 4I77H 5K59F 3MYJB 4MDIB 5ICXB 3UCRA 4G8EA 4ELME 3TN0B 4WV1A 3V8OA 1AGEA 1NLDH 1P5UA 4DN3L 2WQRA 2EDOA 4EOWL 3WIHH 5M94B 5IWLC 1R5IA 1T5WB 2PETA 3JWOC 5L2KB 1EMTL 4HK0B 4TQEL 2CIIB 3F58L 4Q9BA 3MV8B 3GEWB 4I4WA 1YNKH 4DGIL 4AQOA 5KW9L 1HH6B 4WWKD 1E27A 4AEIL 2GAZB 1INDL 3PWNB 2DS4A 4GBXC 2PUQT 4GAJL 3MJ8B 4P9HL 1RUAL 1MFNA 3O3EA 1NC2A 3STBA 4IRJA 1MJ7L 5C8JB 3CDCA 5MI0B 4NO2B 2GHWB 3BHBA 4KMQA 1KENL 3RWFA 3WO3B 3EYFB 1DQDH 1QSFE 5DDHA 4WCYH 1KTDA 4XNYH 4GXVH 2A6IA 3FRPA 3B83A 3QUMB 1DLHB 3WS3B 4XC1L 3QJHB 2VDRH 2GSGA 4GBXD 4GG6A 5E1AA 5GGVY 2HT4C 2OLDA 4J8RB 3MRJB 4HIHA 1TITA 5EFIB 3ZDYE 4LP5A 1S7QB 1L0QA 2VKWA 4H26B 3VRJA 2E6QA 4YXKH 2ADGA 1TCMA 2CLRA 4TYUA 3HE7A 1OAUL 5DJZB 2OL3H 2OS7A 1MRDH 3D3VE 1I9EA 1SVZA 2VB5A 4OZIB 3T0VA 5JHDA 1CE1H 5ILTL 1AXSB 3PE9A 3NIDF 4A6YB 3IKKA 5BXFB 3KPNB 2XFXB 3VXPA 1MI5B 1MVUB 1MPAL 3MLWH 3KPSA 3U9UA 2OSLB 1LDSA 1CGSL 3LSOA 1FV1B 1S5IH 3B9KC 4NSKA 4JFPB 4BZYA 1IM3A 1RHHB 3E3QC 1MCOL 2DLEA 1K5NB 1AQDA 2H2SC 1DLFL 2ICEB 2YMXL 4CUCA 3LN4B 5HHOE 2XTLA 1KEGH 3CLEL 4IDJH 1TJGL 1R5WA 4N68A 3CXHK 4JFXB 3B9KA 4JFZL 1A3LL 4LCCC 4LEOB 2UZIL 5I76A 1CQYA 5C9JB 2QR0B 4JQVC 1MCNA 5EIIB 3O45B 4JRXA 1XFPA 1JHKL 4DUXA 3PP4H 1J1XL 1P84K 1P6FA 1IGYA 4WO4C 4D0CA 5J6GA 4OM0L 1HHIB 1Z5LA 1MIEL 4XWOC 4MXWL 5L0QC 1INQB 3FOLA 4UIKH 3SCMB 2E6PA 4UDUA 1XGQA 1CFVL 3DMMA 5DJAB 4LKCB 1BQHG 1ITBB 1MVUA 1RJCA 2G2RB 3T3ME 2Q8BL 3QHZL 4L3EA 3SDAA 5K9JL 5FKPB 4K8RL 3DV6A 5J56B 3EO9H 5KJRL 5AG8A 4P23C 1D6EB 5GZOC 2CDGA 3F62A 3H7BB 3ISWA 2ATPA 3JZ7A 2XPGB 3MCLH 4NCDA 1IGTB 5HYJE 4PJHE 3TBSB 1BD2E 3DETD 3RWJB 1F13A 1UM5H 4HBQA 5HHOA 2OZ4H 3QQ4B 5I1CH 3OGCB 4M48H 1DBKL 5CD3A 3OPZL 1FYTE 4NQXB 2EDBA 2R2HA 4XP4H 3VGAB 3WV0A 3O0RH 5JIIA 2EICA 3DXAD 3KDMA 3WJJA 3TBWA 5ANME 1I7UA 1QYGL 1DANU 2PO6A 2X42A 4HBCH 4ETYA 1S7QA 1AGCB 5IG7A 1XF5B 2AXJA 3T08A 4OGXH 3VG9C 4PJCF 3MBXH 5GS2H 2HRLA 4J3SA 1Q94B 1CG9A 4M7JL 1ZA3A 1G6VK 1TVBB 4S1QL 5JXED 1S7RA 4U6VH 1X6LA 2MCPL 3S7GA 3ULSB 3GB7A 3GO1H 5DTFA 1ZSDB 1MEXL 1AGEB 3SDCB 3EOYG 3SKMA 5E8DH 2C7UB 1BOYA 4OZ4A 5IKCB 3CZFB 3GSVB 5KANG 4XRCA 3UJJH 4LHUG 1HH6A 4U4BA 3TYFA 4JFDD 1I7UB 4JJHA 2YD3A 2AK1L 1A0QL 3S4SB 4PJ8C 4PJ8D 2OQJA 1G7QB 5D1QD 3ZDXF 5F88A 2BFVH 5E1HB 1MRDL 1FRGL 4HKXB 2RCSH 4ZYKA 2XKSA 2P24B 3HS0B 1X5JA 3IFNH 1RZ8A 2VQ1B 5CMAB 5CJXC 5HD8D 3RWJA 1U92B 2EH7L 2VE6B 1DBBH 2CO7B 5GGTL 3EO1A 3OSKA 1I1FB 4P23B 1OSZB 4G9FA 2D4FA 4X98B 1MHHA 1MJUL 3W0WA 3LEYH 5BMFL 3R06B 1EVTC 4GKZA 4D3CH 1MHPH 1TZGL 3M8OL 3DMMB 4JY6B 3U46B 2ZCHH 5ERWA 3TVMD 3KXFE 4MLSA 3IDJA 3HPLA 3U0PA 1A3RH 5D7LE 3RVTD 5F93C 2FH8A 1IQWL 2D9QB 3KPRB 5DHVA 3SDDA 4GMSH 4G7YH 3X3GL 4UTBH 4IS6A 1BQHB 4QRRA 3LCYA 2XFXA 3P3YA 2R29H 4DKDC 2DL2A 1LEKB 3D18A 4N0FA 1OOAA 4P5TC 4F57L 5D7SL 3WIHL 4O2FB 3BUYB 1QOKA 3BXNB 2ICEA 3UTTD 3CPLA 1S7VB 3OKLB 5EIQA 3SOBH 1H5BB 3F6IA 2X9YA 3ZKND 2FBJH 3MRQA 2Q7NA 4JFPA 1DSFH 3MV9D 4WHDA 3VXRA 1N6QL 1JYVA 2DLTA 1Y6NR 3V5DB 3V4UL 2NW2A 3WUWB 4UU9A 1PBYA 2BOCB 1WT5A 1F3DJ 3UJTL 5FB8A 1T7WA 4JM2F 2ZOLB 2EYRA 2HT3D 1IGJA 4PJAA 2WBJC 3QIWB 5GGTH 3MRGA 2W9EL 4ZMAT 5IEKA 2WBWB 1M7IA 1YUHB 5J06A 4BYHA 4XB8A 4L4TB 1KTRL 1U8LA 3NCYP 4M62H 4X83A 5LCVH 3QCUH 1JPSH 1L4IA 5EC2A 1VFAA 4MCZA 1MF2L 5E9DA 3G04B 3WNOA 4OLWH 3SQBA 3HUJE 3BIKB 3I3DA 4M7LT 5FYLL 3DOSA 5ISZD 4LOUC 3GZKA 4NQDE 5GS2D 4GKOA 3P73A 1ZHNB 4PJCB 3AREA 3MLTB 1M6OA 3SE4C 5FOBB 4LCWA 1DBML 3TO2A 3DX9B 3QQ9D 2K1MA 1BIIA 3BEVA 2APWA 4LSQH 4Y2DB 1JGLH 1RZJH 5FXCH 4JGJA 3LS4H 3G5ZA 5KS9E 1F11A 1N64L 4ODVH 4OV5B 2LQRA 1SBSH 2GT9B 3MRKA 4OTXH 3QO0B 3TT3H 4ZOEA 5GISH 2Q76B 4Q6YA 2AK4A 1FZKB 4WGVB 1MCWW 1SBBA 2X4PA 3JXAA 2A83A 1IGMH 1PKQE 4PJHA 1ERNA 4S1DD 2UUDK 3PWUA 3FT3B 4FFZL 1NLBL 5ISZA 5C09B 4Z9KB 1CD8A 3NA9L 2JB5L 3SKJL 4JVWA 4LRIC 1I7ZA 5E5RB 3I84A 3W5MA 2X7LA 1TVDA 4HXAH 4OF3A 3CFBB 3IF1B 4LSQL 2XNAA 3KYOA 5DYOA 3WFBH 2D31B 1QYGH 3FQWA 4XT1C 2Q8BH 1P1ZB 3MNWB 1WC7B 3QFJE 1JNNL 3NIDE 1Q1JH 4PJ7B 3JTSB 1MCHA 3FO9B 3M1BA 1DQQA 5T33L 3P4LA 1KCSH 2ZCLL 3QIBA 5I16B 2KQMA 2BC4A 2E9JA 4EDXB 2VDML 4XVJL 1C08A 2IBZX 4RZCA 3T2PA 2J4WL 3MSPA 5I1JH 5HSFA 5EZLB 1BPVA 2R0LL 4PRID 2DTML 3DVNB 3L7EA 5EO1A 3QUYC 4P57A 5DURB 1O7VA 4MQXC 5EOCH 1WQVT 2QQKL 5LGJA 4KFZC 3MGOB 3FO0H 4TTDC 2X4SA 2FD6L 4FMFA 1SVCP 2EXWD 2EH8H 3CNKA 3BP5A 4KMLB 1Q0XL 1F8TL 2ADIB 4GKSB 4GAJH 3SOBL 3QUKA 1GZPA 4JPKL 4L1DA 2GK0A 1EZVX 3M45A 4NRXB 1CICD 4ZQKB 4DK6A 3L3IB 2BVUA 3L1OL 4U1KA 5FYKH 5C0BA 3I6LD 5GS0L 4X5WA 5E4IA 4P2QD 3TT1L 3HMXL 3EYVB 1I1FA 3A6BH 1EX0A 2W92A 4WWKA 2P4AB 3EYSH 3VFVA 2FEEL 5L2JB 1HI6A 3S9DB 3IGAA 1U92A 1J7VR 1Q9WA 5EOTB 4D8PA 4NHUB 1BVZA 1RJYB 2O26U 4WNQB 2DLIA 1J88A 4ZFFB 2BNQA 1CLYH 5HDLA 3HC3H 5HGBA 5JLZA 3ULSA 5DS8B 1IEBA 1DUYA 2MQ0A 4XBEH 4YNYA 1FFOB 2HJFA 1T7XA 3QQ3B 2V5RA 5F1NA 2BXYA 3AM8C 1I3UA 1A9EA 3VGBA 3A67L 1AXTL 2X1PA 5JPNA 1YUHA 1W0VA 4WFED 4EQ3A 3FAXA 2E7CA 1AGCA 5IG7B 2P44B 3KVQA 1VACA 4XWOD 1J86A 2DQTL 4K71B 3KLSA 1I1YA 2R2BA 3LN5B 4QHMA 3KDMB 3MTRA 5L8KB 4RA3A 1ZGLM 5TE4L 1TQCC 1ZEAL 2XQBL 4MXVF 4PB0L 2IMMA 3PWVB 1JHTA 5HYJA 1FIEA 1XR8A 4M7KH 1JWMA 4GQ9L 3PV6B 2EDXA 5HHMB 4LKXB 3B5TA 2CO6B 1HZHL 1M7IB 4LLMA 3DMMC 3ZTJG 2D7OA 3RDTB 1FNAA 4XCCH 4P5KA 5I1IH 1INEH 4JZNB 5F9JB 1F4YH 4PV9B 1Q72H 1FC1A 1FGNH 3QRFM 4QLRA 5ESAB 2Q8AL 2VWEE 1BZ7B 4Q0XL 1NLDL 5EWIL 1HHKB 3ESVF 3QA3B 2PXYC 5GIRA 4LKCA 5IBTL 1XMWA 2AXGA 4KKCD 2VABB 2ZZUT 3BN3B 3MCKB 1PYWB 3GJEA 4GKNA 4F33B 2APVA 1W72B 3SE8H 1INQA 4WGWB 1JFQL 1YPZB 2Y7QA 3TPKA 5F6IB 5TQ0L 4N0YL 3NA4A 5E5MB 5IQ7L 3ZSTA 4P48A 4AIXA 3FB8B 4A6YH 4JO3L 2VERN 5TE6H 4L3EB 4KROB 2FWOB 1ZK9A 3RWHB 2QJDA 4QRUB 1KJ2A 5JUEL 1DEEB 1T7ZA 3GHBL 4LPCA 4NHCL 3UROR 1TETH 4PBVC 3T0EA 3JWOL 1NDGB 4LF3A 3HC4L 5I1EL 4JPWH 1AQKL 4YDVB 3OXRB 5C6WH 3AS3A 4JY6A 3NPSC 5GISL 3U46A 5BZDA 4FXGA 4EUPG 5C0CA 3BDYH 3TYGL 4K8RD 2X2YA 5JW3L 3GJFK 3VMNA 2GITA 3RDTC 4ZUSA 1KFAL 3OKNA 3L3JB 4FOMA 1NEZG 2XA8L 5EO9A 1IZJA 5DO2C 4OZGB 4XCEA 2Q1EA 3QIUB 1FLRL 5DA4A 1BWWA 3L3GA 5TGBA 2J8UA 3QHTC 5DQJB 1W0VB 4NSKB 5KVMC 4JKLA 5C0GB 1G0XA 3RUGE 4PRIE 4PLOB 4D0DB 4GSDH 4J23A 5GXBB 2P8PA 4XMKL 4BFEA 4UT9H 3P77B 3DVFA 1ZLSL 5KAQG 1SQ2N 1J8KA 3MOBL 5AYUL 5K33A 1NFIB 2NY3B 4HWBL 4YDIL 3TM6A 3A6OA 1MF2H 3BDYL 5I66A 4Y4FC 1E28B 4MJ5A 3MLXH 1EAPA 4HFWA 1B2WH 4XXCC 2ORBL 3OL2A 4PJ8B 1G6RH 3SJVB 4JFYB 4LLWA 5HGHA 4KTDH 1H3PL 3MA9H 1CLCA 1IEBB 3WLWD 3WLWC 1BBJB 3BE1L 1T66D 3BW9B 4HLZH 3QHZH 4JM2A 4WO4D 1VADB 2QADB 1HXMA 2UVEA 3C60B 4M5ZH 3RGVC 4WV1B 4U1KB 5C0BB 3S36X 4GRWE 2VQUA 4IRSB 4YPJA 4HUVA 1BBDH 2XN9E 1JTTA 2GK0B 2X9XA 3CX5J 3SE8L 4HUXB 2W9DL 5DRZB 3QCUL 4X7CC 4FTVE 5C0RL 1EV2E 3W9EB 1FVDB 1SYVB 3IGAB 1HHJB 2W91A 1EAPB 4UT7H 1FZMA 5CJBA 2FEDC 3WDIA 4Z7OE 1DQML 1PEWA 3B8YA 4X7TA 2MKLC 1RUML 2BHYA 1KCRH 3BSZL 1BIHA 4OCLC 1F58H 4G7YL 4OAWB 1INEL 1WITA 1HXYB 3QEUB 4P59L 1ZGLB 4PV8A 1U93A 2X89D 2B2XH 4FRWA 2YA2A 1NEUA 1NMCC 3J7HA 4AH2A 1IAII 3FHAA 4MDIA 4P5TD 2JIXB 4XBGB 4NNXB 3RZCC 4NT6B 1YQ2A 4OD2B 4S1RH 3HI6H 2Z92B 4UAOB 1GZQA 1T7YA 5DEGB 1YMMA 3I6GA 3FRUB 1YY8A 2X4UA 4QHLB 5H35B 5D6CB 3VWJB 4ZFZB 4OFYD 2BY0A 1CZ8H 3O4LB 2A9NH 2A9MH 3T3PE 4P2RD 5C2BH 2CH8A 3H9HA 2AJ3A 1GGYA 5DJDA 2OL3L 5CD5C 5E70A 4G43A 4ZTPH 1SEBB 5C07B 4BZ2L 1IQDB 5T3ZL 3SE9L 4HJGB 1MRCL 2X89A 1RVFL 1VGKA 3RWIB 3T2NL 4LBEB 4I3RH 1NMAH 3V5KA 3T4AB 5D96B 2BOBA 1XIWB 1WSST 2DM2A 4YHMH 2OR7A 4NKDB 3RUGF 1A02N 1OPGL 5FO9A 3EAKA 3P30H 3WD5H 2HG5A 2NYYC 4X6DA 4LQFL 4WUUD 4E41E 2VXQL 3M1BB 5KS9A 3VH8A 4IM8A 2Y06H 2Z31B 1D5ZA 2XXCB 5IMLA 3FT4B 1MHPL 4HC1A 4XH2A 2DQEL 32C2A 1I3VA 1I8LA 1D5XB 2P5EA 5ICZB 1R5WB 3JSSA 3O11A 5DR5L 1KLUB 2F58L 1CK0H 3VD9A 4XP9H 1W72A 4XXCA 2AJSH 2HFTA 1AGFB 3VRIA 3OKEB 5MEPB 1RVFH 3DBXB 5GJTL 3QUZD 1II4E 1MCKA 4ODWB 4QGTA 3TH4T 3D0VB 3RWDB 3KJ6H 3W5NA 2X4PB 3GSXA 4PJIB 2QHRL 5HVHB 3E6HA 3V52L 4NUJA 3MUGA 1QFWL 1BBDL 4WY7H 4JZOB 1I9RH 4OBSA 3V2AR 4U1HA 4G6FB 5IWLA 1LD9A 5IJVA 1BIIB 5FHBL 2H1PL 4K3GA 2KDGA 4AIZA 4PIRF 3RWFB 3MXWH 1I8LC 3DYMA 2L0DA 3BP4A 5I1HH 4ZD3H 4MNGA 1XF1A 3AREB 3MLTA 5IVZB 4IOSD 1Z0NA 2PW2B 1ZLUK 2PYEE 2DQGL 2PYED 1R5IB 4K7PL 4Q58C 3BPCA 4N8VG 3EBAA 3CFCH 3ARFC 1LMKA 1F3JA 4PJFF 3D0VA 1HKLH 2ESVB 1CFTA 4L4TA 2HKFH 4ISVA 5HHXH 2CJUH 4KRPC 2OTWA 1GGIL 35C8L 1WF5A 3DVGB 1HIML 1C5DA 3RPKA 2X1XR 3VRLF 4PP1C 1V3JA 1Z3GH 3PHOB 3ZDYF 2EDRA 3WNLA 2A77H 2IFFL 4YEFA 4OFDA 1OSPL 4N5ED 2HFEA 1QEWB 3L3HB 2Z31D 3G6DH 3HUJF 2BZDA 4ODSH 4QGYA 4W4OA 1FLRH 4CW1A 5EA0L 1K4DA 3O8XC 3GI9H 3B2UC 1Y6KR 2Q7YB 4MD0A 2R0LH 4L8DA 5HVHC 5DJCA 4KAQL 3OKMB 4NQVB 3KG5A 4L4TD 2CPCA 2VSCA 1U3HC 1L7IH 4MA3A 3T4AA 1GGIH 2AXHA 3ZE2E 1NCAH 1QFHA 5CSZA 5IB2B 1S9KC 1OP5K 1OT2A 1A9BB 1SEBA 4IEFB 3L5XL 4LIQH 1AO7D 3FTGA 5D72H 3PIQA 1U8NB 4Y89A 5B8CB 2DICA 4X9BA 4ODTL 1ACZA 1QG3A 1UWEL 4LNRA 2FGZA 4J4PD 4UQ3A 3GSQA 3CCHA 4TTDD 5ACMA 4G5ZL 4C56D 4MS8C 3TNNB 1YY8B 4QHLA 1WBYA 3VWJA 3BRGC 1KEML 5F1IA 1NC4D 4GMTL 1CI5A 2QKIA 4EUPB 4LCWE 5BS0B 3QXTA 4KHXH 3QJFB 5F7UA 2H32H 3GBNL 1QLRB 5GRUL 1MCDA 3KHQA 5T1KA 3MLUL 1WV7T 3SO5A 3DRQA 2JJTC 3JTSA 1S7UA 2V7NA 2FIRT 3AUVA 2NY2B 3N1MC 3QWQB 1PEZA 1AO7A 1JF1B 4P2QA 5CHNA 2HH0L 3ULVL 5F88B 1TPXC 1AGDA 1K3IA 4F7EA 3SJVD 1QQDB 4HCRA 2WMPA 3FRUA 1ROWA 5C7XL 4WEUD 4Y4HB 2WLYA 4JDTL 4OD2A 4PGCB 3KJ4B 1U3JA 1ZHLB 1CICC 3KPQB 4M1GL 3UJTH 5TE6L 4LK4A 4O5LH 4G8GB 2R4RL 3ARFB 4XP1L 4JDVA 4I0PB 4C58B 3RL1B 4GUPB 3GM0A 4LVOB 5ID0B 2QEJA 3OXSA 2P8MA 3ZE0F 5EBMA 4OLXH 5F7NC 1F5WA 3DUUB 2X7LB 1JNHA 2C4FU 1T04B 4WY7L 3K46A 1A2YB 1CTNA 4YXKL 4OLVH 3RIAF 2BSRB 2OTWB 1FDLL 4G9DB 4LU5L 1BX2A 4KJYA 3F7YA 2ZUQB 4UINL 1WICA 1TJHL 1RIHH 4LEXL 1S9XA 4JRYE 5ACZB 3WUZA 3VFRB 3O8XB 4ZTPL 3B6SB 3Q5OA 2H9GB 3GNML 3HE6B 5IB3A 1JWSA 3IAQA 2ITCB 2P8LB 3QUMH 4Y5VC 2IPUG 1EHLH 4HD9A 4O51A 1JNJA 4XC1H 4FQ1L 2V17L 3NGBB 1D5MA 5CINH 2FJGB 4NQSA 2Y07H 4O02H 2Y06L 1BLNA 4OGAC 2VAJA 2BSSA 1GOFA 2YXFA 5C0EB 5C0CE 3DX7A 4JZOA 3FOMB 5SWSB 3JV4B 4TSAH 1U3HD 1ZS8B 1E4JA 1TZIA 3OKKA 4MDJB 1TCRB 1CLOL 1ZMYA 1KELL 1WTLA 3ROLA 4RFEB 3MPCA 3W39B 5CLWA 4CVZB 1FYHB 1BD2A 4OF7A 3DTXB 1VKXB 2DKSA 1JF5A 3ARDA 4E5XA 5FUZH 3OKEA 4GW4B 4KV5F 2KBGA 5IEKB 1VSCA 2J8UB 4OIBA 1WFTA 2NY2C 4YBQD 1EUTA 4R0LC 4HUNB 2FIKB 4YBQC 3RP1A 4MNQA 2CKBL 4N9OB 4QTIH 3CDGB 4WU7B 4XMLH 5IVXE 1YN6B 1X5XA 3D2UB 4QRUA 1YEKH 3RAJH 4WWKC 1SJEB 3VDAA 4M4PA 3GRWA 2NW2B 4LFHD 3V9FA 3WUWA 3FB8A 5TFSH 1U3HA 3HC3L 1IARB 1ADQA 2GJZB 4OJFL 5HI5D 1RULH 5BV7C 1RUPH 3N85L 1OLZA 2X4NA 3HE6C 4HCRH 3OXRA 3Q3GA 1BVLB 4YDJA 1V05A 1XF3A 4JFOA 1XIWA 3CFDA 4N0UB 3ULUF 3VDCA 4X4YA 1ACYH 3O45A 3UJIL 5JO5A 4M61A 5IHBA 3SPVA 2EH7H 5DJYA 2VKXA 1IGYB 2YBRB 3MNZA 4OLZL 3N06B 1HHKA 3HMWH 3RKDC 1NSNH 2M8XA 3G5YB 3ILQC 3LQAH 5E8NA 3L6FA 4OD3H 1TTUA 3TO4C 3RL2A 2OR9H 4EEEA 2NX5A 1B0GB 5F1KC 3GJFH 5IHUH 5E8OA 2IANE 1A0QH 1SY6L 3IDJB 4EUPH 2LV4A 3C6LA 1ZT7A 1AH1A 5C09E 4CADB 4M00A 5FCUH 4ACPA 5C0DA 2GJ6B 2LTQC 4F9PC 3HNSL 5K93A 3ES6B 1U41A 2P8LA 5FO7A 3FAWA 5LVEA 1ZT1B 1ZS8A 1TZIB 2EE2A 3OKKB 3MV7A 4MDJA 2HJLB 3G6JE 4QHMB 1J1OL 1YJDL 3MFFB 4OZIA 1T0NA 1A4KB 3IXTA 2X5PA 4G6JH 1PAMA 3MUY1 1X6NA 5FA4A 2PO6C 5EU4B 5D9SB 4P23D 4H0HB 1T1YB 4LVNC 4DUWA 4MHHI 3H9YA 2CXKA 3D25B 4H1LB 3TT3L 4AEEA 5IW1B 1X44A 2HJFB 3D69A 1RZJC 2G9HB 4PJ9C 4X6CE 3JV5A 5E94B 4X4XB 3UTOA 1ULVA 1FNEB 1KEMH 4ORZC 1U91A 2JB6A 4UV7H 2BSRA 4G9DA 4LMQI 2DYPD 2ICWI 1KCLA 3FRPG 4MA7H 4CMHC 4Z8FH 4GW5B 4C57C 3O6MH 2DI7A 2MMXA 2DJ4A 4WWKB 4LCIL 4KI1A 4YGAB 3MV01 4MXVE 3SY0A 4B5EA 2P8MB 3O2VH 4Q9QL 4LPUA 1TJGH 2BERA 1KV3A 1NGWA 2P48B 1CL7I 5JMOC 4XPAH 4J1UA 3PWJB 4PJ9A 2YUVA 2JCCF 3RNKB 1R3KB 3VXUA 4LASH 4TPRL 5J89A 2D7QA 4XCCL 3Q5YA 3U1SH 5I1IL 3BZFB 4AG4L 1MJ8H 5JZ7D 2ZOKB 1S5IL 3VXSD 4D9QE 3BGMA 5MP6L 3VMPA 4UIKL 1GGBH 4LCCA 5FKAB 3ELAT 5TE7L 7CGTA 3OR7A 4NBXB 3ZKMD 3H3PH 3RL1A 5E00B 3O3BB 5EU3B 1NBVH 2ZSVB 3F5WA 5B38G 2F15A 1NCBL 5EZLA 3LB6C 4EI6B 2CR6A 1P4BL 1C12A 1A7QH 1HWHB 1RUKL 1A7PL 1GOGA 4GRWH 2XWJB 1HSAB 1HEZB 3CFJB 1NFKA 3EDDA 4M1DL 1CR9H 1EO7A 1S7WA 3GJFB 2X4TA 5BV7L 2VLME 3BRFA 1U8PB 2AEPL 4F7EB 3CAFA 4H8WH 3OB0H 1CFQB 1Q8MA 1J1PH 1K8DB 5KSBB 3B9KB 3VFWB 2HT3C 2GIYA 3E2HB 1IJ9A 4JLRB 1EEZA 1LP9E 2VR4A 4KC3B 3G08A 3MMEA 1KPUB 4QHKJ 1U42A 1NAKH 1HHIA 1Z5LB 4FMKA 4JFHE 1CGVA 4GAFB 3LKRA 1KJVA 4QRPA 1J05A 3EJZD 4PJHF 3X14B 3AU1B 1MRCH 3GIVA 3W2DH 5T1DH 3L3HA 4KUCF 3NFPB 5I6XC 4NOBA 1KB9J 4OSUL 4G7VH 1D7FA 3F7PC 4ODUB 1H3UA 1H8SA 1GVIA 5JPMB 2EIZA 4PRHB 4DQOH 4HF5H 4NJ9L 4AY0A 4QF1B 4PRNA 3RHWK 4QEGA 4U7KA 2FX7H 2UZYB 3WHE1 4HIHB 3MLZL 1PSKL 1WAAA 3IFOA 4S1RL 1IC4H 2OK0L 5EO0A 4NFCA 4PGJA 5E9DE 3ARPA 4Z7VF 5F9DC 4QRPD 5FYKE 1JGDA 1FAIL 4AJ0A 3AMKA 5F71A 4Z7QE 1X7QA 1G7HA 4ZFOB 2Q3ZA 1AE6L 4H88H 1I8MB 4UDTB 5DZNA 4KHTH 4N1CA 4ORGB 3X3FH 5EC2B 4YUEH 5LQBL 1MEXH 2D0FA 4MNGB 1KJ2H 3GBLA 2YSSA 3SE9H 2MWCA 1KCUH 1KTKE 3B9DA 1BGXH 3ULVC 1MCBA 1UADC 1R3IH 3S34L 5KVEL 3FCTA 4Z8FL 5I1LB 3VXRD 3MRBB 4OGYH 5EU6B 5IB4A 5E8EA 5LBSL 5I0DA 5MEQA 3BPCB 3O6FC 3MFFA 4RMQA 2APFA 3GSNL 1BQLL 1FYTB 3DX8A 2F53A 1FNHA 3EYQD 4LLVA 4ZFGH 4Y5VA 2WBJD 3P9LA 5F6IC 3MBXL 4PD4K 1RHFA 4MJIA 4G6KL 2GJ6A 4U6HB 4JZJA 2JJSC 1CYGA 1UXWB 1PG7X 1IC5L 5SX5H 1ORSB 1BFTA 2M2DA 1Y6MR 4PRHD 3LKNB 4PY8I 2ORBH 3OKLA 5I8OL 2E7LC 1WZ1H 4IIQB 1F58L 5ICZA 5DVKA 2CIIA 1YA5A 1N7ML 3QP3A 5ENWA 5ID1B 3L5WA 2HMID 1P4IH 1HKLL 1U8KA 5L7XL 3TESA 3PGDB 5DMIL 5HYSB 2XZAH 4LLDB 4OB5L 4M6NL 5C0FA 4IMKC 3QUKB 1S7TA 1GCFA 1QBML 3OG6B 4XP5L 3V6OE 5D5MB 1JF6A 3MREA 4RDQG 3B5GA 4IJ3C 3DLQR 4GW1A 1C1EH 2WIIA 5ERWB 3O3AB 2DJSA 3G6DL 4CN6A 4L4VE 5GQBA 2NY4C 4PJEB 1IQDA 4U2ZA 4Z95L 4AT6A 4HC1H 4KK5D 1AD0A 5DVOA 4JPIA 2LFGA 2BNUB 2VDLH 4K7FA 4YO0A 4KKBD 4NC1C 3W0WB 1NDMB 4MXWH 4MNQB 1TNMA 4X5XB 2NY7L 3KJ4C 4X98A 5INCB 3ZMRA 1FZJB 3KYAA 5GS1B 3PDOA 3LHPH 1ZVSA 1OAKH 3RTQA 2JLLA 2CJUL 1A6AB 2DMBA 4FABH 5DMKB 1RJLB 2UZIH 5AYUH 1RZ8B 4HWBA 2ZSVA 2NYYD 3IRZA 4N9GB 1HQRB 4TVPE 3MV7E 4ENEC 4IIQC 3H9SD 1K8IB 1IGCL 1ZE3C 4L3CB 3IS1X 3IVKA 1EVUA 1KLGB 4HC1L 4DGVL 5D7IB 4GXUN 3BP6B 2CDEA 3J8F7 3QDJB 5ANMA 3BZEA 1SYVA 3O4LD 5ETUB 1MIML 4AL8L 4WUUB 1OARH 2QADC 2IMNA 3SGEI 4GAYB 1FO0H 3GSWB 1QFWI 2PTTA 4HUXA 3P11L 2R0ZL 4I9WD 1P2CB 4S2SA 3ALPA 2C7UA 1QFWH 1XCQB 5EZOH 1CGXA 3K74B 2FJHA 2QSQA 4WW2F 3NTCL 2MKWA 3B6SA 4FQPA 2ZSWB 3HNTH 3O8XA 4HWZB 1PZ5B 4MAYB 5F3HB 5IMMB 2PNDA 4MA8H 3VFSB 3EFFB 3T2OA 1Q94A 3T0EE 1GRWA 4K8RC 2FATL 4YHLL 5CFHA 4LSDA 3FQNB 3SHSA 3UYOD 1CFSB 4TUJB 3OXSB 3VI3F 1B4JL 1XGYH 1BZ9A 4PJGA 2AV1A 4KZDH 1V7NH 4Z7OF 4HUWA 4GS7B 1JGUH 4KKAC 4PJIF 1BBJA 4XMLL 4JQXC 5C0AE 3V4PH 4DWHA 2B0SL 4HZAA 5KSAC 3TZVC 5I71B 4YZFE 3Q6GH 3HNTL 5D9SA 3R8BB 4FXLA 4O2EA 2A1WH 3W9DA 3OR6B 5HHNB 1Z9LA 1VFBA 2NNAB 4KROC 3L1OH 4TSAL 3HN3A 5ESVB 4L3ED 1FHGA 2YK1L 1MWAA 5DHVH 5GS3A 5BQ7A 1HK6A 3TBWB 4MB5A 3F12A 4GMSL 3MBEB 4PP2B 1OTUC 2EO1A 4WVRA 5KVFH 1MIMH 1NFDE 3DV6B 1IBGH 3WNKA 4KZDL 2VWEC 4HWEL 4CADA 1A6AA 4AYFA 2MSPA 1BFOA 5TDOB 5MERB 5I19H 4F7MB 1DQJA 1PFCA 2AI0H 2V9RA 1YC7A 5KVGH 4LARH 4O2FA 3PUCA 3IDXL 1T21A 3H7BA 1LVEA 2P42B 3EYOA 1AHWA 1TJHH 5HDOA 3HG1E 4P3WA 2F54A 1VESA 1ZHKA 3O6KH 1MCLA 3JV0A 4HHAA 5EU7C 4MD4A 5IEHB 3B9KD 4N0UA 3FFCD 5J1TC 5EBLA 3FFCE 3PXJA 4Z7WE 2KKQA 4XMPH 5I0ZA 1T80A 4JFEE 3HZKA 4NQEE 1TLKA 2I25N 3MODL 4UI2A 4X8XA 1M4KA 4M5ZL 4NO0B 3B43A 3GGWB 2IAMD 4EVNB 1MJJA 1I9JH 4ESKA 3DMMD 4PG9B 1AXSA 2YUXA 2NY6B 1MFCH 1CXKA 1JNLL 5E5UB 3MBEC 1SYSA 3PHOA 1P7QA 5HHOD 2VYRE 1AQDB 2BP3A 3W9DB 1CD1A 5HHMD 4X99A 3W11C 2M26A 4KZEL 2W38A 4NO5B 2W0KA 1QSEB 3W39A 4XPHH 5E1AB 3RIFF 1CLZL 2HJKA 4KK6C 3SN6N 3MOAL 3WFHA 25C8H 4GXUM 5J57B 3JV4A 5GRUH 3D9AH 5D7JA 2ZKHH 3EDFA 4P5MA 4ZFOA 2IAMA 1GPOH 1Q38A 4D2NA 4K23H 1OGTA 2AV1B 3DARA 3QDME 3D3VD 3F7YB 2CLRB 5DJZA 3WS6C 4O9HL 3HB3D 4HH8A 4ZFGL 4Z7UB 2YPVL 2EDDA 2X1QA 3QCVL 4Y19B 5CWSB 3WFEH 3CZFA 5L2JA 4OM0H 3C9NA 1A6WL 4I5BA 1RSFA 1G7JA 2IH3B 3PP3H 5IVOA 4XVSH 3KJ6L 5E03A 5IK3B 3QDGA 2HT2C 4EIGB 4U1IA 4V1DB 4DZ8A 5JXEA 3K81A 1J12A 4R90H 4O2CB 3TN0D 1HWGB 2AJUL 2YD2A 2EE6A 1LNUA 1QACA 4PRPA 4ZO7A 4FFWD 4ONFH 5CEYB 5E6IA 3V6ZA 5IR1A 2PO6B 1FFOA 2HLFD 3MV8D 4XCNB 4YLQT 3MRFB 3LPGA 1FZOB 3AM8A 1ADQH 2R2HB 3PGCB 5GSRB 3GUTA 1NFDF 4M5YL 4JANB 1RJYA 4WNQA 3QFDB 2QQQA 1RK0B 3CLFH 4KZEH 3OB0K 4L8BB 3GMMA 4QHUB 5F21B 3MXVL 4P3CH 4Z77A 2JELL 4U1GC 1KSRA 1U58B 2HLFC 5JORB 2IANB 5IBTH 2E7MA 4XB7A 3NCFB 2D3VA 2XPGA 1FZJA 3B2VL 3QXDA 4TSBL 4K3EH 4HCRL 2A9NL 3UC0H 3QEQE 1CVSC 2EZ0D 1J87A 4L3AA 5HPMB 4QY8A 1EO5A 2ZOKA 3D85B 1HH9B 4JHAH 3HMXA 5HXMA 1T1ZB 2X41A 3DURB 5DT1L 5J12B 1N4XH 2B39A 2H8PA 3ARGA 4MJ4A 4Y4KB 1I9IH 1AD9A 1U8JB 4YIQA 3RVTC 2NY4D 1G7MA 4YHOH 1KCVL 3RWEA 4R97B 3F65A 3QFJD 4RMWA 2PO6D 1YNKL 3TO4A 3VXSA 2WBKA 1VFOA 5D2LE 5DYOB 3M07A 5ITBL 3CU7A 5IFHH 2X09A 3QWRD 1CR9L 5C0RH 12E8L 3LEVH 3ET9F 4HS8H 5FGCE 4JPKH 5E24E 4G6FD 5FOBA 5F9WC 4PJCA 1OARL 2Q7YA 1X4ZA 1A3RL 4Y4FB 3U7YL 3DX8B 3PDDA 2AK4B 3S88L 5HD8C 3BD3A 5F70A 1CVRA 3R0MA 2KZ1B 3F7QA 2O5ZH 2VTFA 2GT9A 3MRKB 2I60H 1ORSA 1KOAA 1DBAH 2OXGA 4QXGL 1EMTH 4PJDF 4TQEH 4YE4L 1UCBL 5GSVA 3FCTB 2R1YB 1QNZL 3GSOA 2YA1A 1ZHNA 1WT5C 3TZVB 4PP1D 1MFEH 4F3FB 3B8SA 2Z91B 1I8MA 4HMEA 5HJ3A 3QO1B 1I8KA 2W0PA 5ACLA 4FQLH 1FGVH 5E8EB 1YEHH 4GBXB 4UZGA 4NQUA 2MOVA 3VA2C 2R0KH 3QNXB 4GT7A 1V7NL 4MA7L 1FO0L 2Z35B 4KHXL 2XXMB 5CWSA 3CMOH 4R4BB 5DK3A 4BQBA 4ELKB 3TO2B 1RU9L 4HBCL 5JXEC 3VXNA 4BKLB 1A4KA 4TUOB 1KXVC 1SJHB 3IXAB 4M3JA 3L6FB 3VWKB 1NGPH 5KANI 1NAMB 4X6EB 2ZPKH 2BOCA 5AG9A 1KC5L 2HJKB 5AEAA 2Z31A 4UNTA 1E4WL 3TVMA 2E27L 1MI5D 3QHFH 4QRTB 2MCPH 4XNUH 1IKFL 1IFHH 1SJVA 2YEZA 1PKQA 3H0TA 2FO4B 5CD5D 1AD9B 4NZTL 4U6YB 4KAQH 1AFVL 3OJDB 5CLTA 3OB8A 4KROD 1JRHI 4MD4B 4F37F 1W0WB 5C07D 3UAJC 2WUCL 3VXMA 1FLTX 1JNNH 5DZLA 3S5LA 3VE0B 4XZUA 4G80B 1UACL 3AU1A 1C16B 1RMFH 4DKEH 2AK1H 3NFNB 3GI8L 4XNMB 1A6ZB 1ITCA 4NRYB 1PD6A 1XGTA 3C8KA 5C0JA 5FGRA 2NY1C 1KFAH 3VFOA 3P0VH 1T83A 3O4OC 5D7LD 4GOSA 3VFTB 1LILA 1U8JA 1I75A 2OZ4L 2D9CA 3BKML 1MUJA 3KXFD 5IMOA 1DQLH 3REVB 3V5KB 4YHZL 4LCYB 1I4FB 5FDYA 3KPLA 3IJSA 1I7TB 4F2MB 4KY1L 1RIVL 3LS4L 2CMRH 2Z8SA 2D03H 4IHOA 4KVNH 1I3RB 3OAZH 3K0WA 3MRLB 2HVKA 3C2AL 5D8JH 1ORQA 1OP5H 3V7MA 4P99A 1U8HA 4RGMB 2EDKA 4FQHA 1OAQH 1GZQB 1O0VA 4O9HH 1MREL 1I1CA 2BY2A 4EI6A 3G6AB 5IQ7H 3CC5A 3GKZA 4WI2A 4ONGH 4CVZA 6FABH 1KIQA 1FGVL 2OJEB 3MJGX 1YPZF 4K7PX 4IJ3B 4BFIB 4PR5B 4N0CD 1RJZB 1L0YA 1J0KA 1ZHBB 4N90D 5FKAA 3S98A 1N26A 1N7MH 1A21A 4LDLB 4KDTC 2E5EA 3HZVB 1FCGA 1NSNL 1P4IL 3DPBA 2BSSB 4J4PA 4S11A 1Z6JT 3TYFB 5CJ5A 3SDCC 3BAEL 3WJLA 1N64H 5BZWA 2YZ1A 4Q9RL 5I15H 1U91B 2JB6B 3GSVA 1S7SA 1CU4H 3TC9A 1I9JL 2VZTA 4HAGA 1T03H 2X9WA 5IESH 2VAAB 3O41B 4QXTA 5JR1H 1CD0A 4X4XA 1RUPL 1UB5B 5JW4Q 4OLYH 3VFPA 2PTVA 2X4OB 3SY0B 3KGRA 4TUJA 1G7QA 3HI5H 2DIBA 2BNQD 5FF6B 3U4AA 2J3SA 5J1AA 1BGXL 3VRLE 3QUML 3PWPE 3N9GL 1DL7L 3DO3A 1NC2D 1MCQA 1X4XA 5F89A 3KYMA 3EO0A 4NGHL 1GHFH 5DMGD 5FM5O 2DQTH 1MCRA 4URTB 4E41D 4U1GB 2R29L 1JVKA 4PJFE 3ILPA 5DEFB 4F37K 3VDBA 1R24B 2Z8WC 4ZO6A 3BT2H 5DJ8B 5KVGL 5TH2B 1TZHA 4IDJL 4YXLL 2A9ML 3EIFA 1S7UB 2V7NB 4RRPA 4U31A 3IKCB 2XWTB 4NZUL 3UZQA 4WFHD 5EU7E 3EJYD 4ZOAA 2V9QA 3ES6A 4D0DA 3IFLL 4X8JA 2FX8H 1KENH 2JK5A 3HZKB 5K9KB 2N1KA 1ZVSB 1QRNB 1PLGL 1DQDL 4C55A 2B8OT 4J6RH 3GRWL 2XZCL 3PG2A 4JREC 4PRIA 1ONQB 1WBXA 3FQXB 2FWOA 2Z93A 3H7LA 3BWAB 3CXDH 2XTJE 3MROA 1KJ3L 5CILH 1MSPA 1AGBA 3DRQB 2ZUUA 3MRRB 3BT2L 1KTLB 5E2UL 4DEPC 3MGTA 3RJDA 3KPSD 4YJZL 2DI8A 5CZKA 1IRAY 1FORL 1BM3H 4NM4L 5D71L 1F6AA 2ERJB 3QNYB 3UTQA 5J9PB 3PWPB 1J0JA 3WIIH 3QPQC 2FHFA 2AJSL 1OB1B 1DQQB 3EFDH 4JHZA 2VDLL 2F54B 5FGSA 4M43L 5J13B 1MVFA 3GRWH 1DE4A 2V5MA 4NRYA 2ICCA 4TVSa 4I0KA 2BCKA 2IBZY 1D9KD 3VI4F 1C16A 2NX5E 3RDTA 5IB2A 3GK8L 3UPCA 3HA0A 2YWZA 5GGRB 3VRJB 1JJUA 4LGRB 1KIUA 9CGTA 2VDPH 1CU4L 2MQCA 3C2SA 3MRIA 2VLJE 3H0TB 1CF8L 3CIQA 4OCXH 1T0MA 3NH7L 4UOW0 5GGUB 1QD0A 4M7ZC 4MD0B 3MGTB 4M1DH 2F53B 1GH7A 2UV3A 5ESAA 3TZVD 4I18C 3EOBB 3LKPB 4R6UA 1FIGL 2WW8A 4O00A 1FBIL 3KPPA 1KG0A 4A2LA 2AERT 3QIWD 2DQIH 2DKUA 3H2WA 3RX8A 1KPRB 4X7FC 4IOIB 3BI9X 2VN7A 3GBNH 3DVGA 4NKQB 4LLQA 2X70A 5E2VH 1JHTB 4WDIA 2DI9A 4PJGF 3IKCA 4K23L 4LSVH 5EB9A 3WFDH 2OCFD 4R2GB 5IROC 3BIKA 4PJXE 1B9ZA 3QDGD 1KTDB 5IB4B 5MEQB 3ARVA 3EHBD 3QXAA 1U8IA 5F7KC 3D1MC 3EYFA 3OAUL 1E4WH 2DM7A 5SV3A 1SJXA 1WZ1L 3O3EB 5DUML 4PFEA 2NY7H 5HHPB 3QQ3A 3WHXA 1NCTA 2OXHA 4YR6A 1U6AH 5GS0D 1MCJA 4G8IA 4I4WB 4JEGB 4NZDA 1MCOH 4LVOC 4LSSL 1IL1B 5FYJU 3ROOB 2B20A 4I0PA 4GG6F 2OK0H 5C08E 4BQ6A 1UXSB 2ZWLT 1RJZA 1Q0YL 2VISA 4WTWA 3CGTA 3CVHA 3OJVC 4BFGA 2FBJL 1Q9WB 5EOTA 4D8PB 3O6FA 1D5BA 2NY3D 3VXTA 1S7SB 1LE5A 4WO4A 1RJLA 3AS1A 2IFFH 4PJ9D 3U79A 4PUBH 4QOKD 4FFZH 4YFLF 4WUUA 3ZL4L 4H0GA 2UUDH 5BO1L 4OQ1A 5BV7B 1VA9A 2X1OA 4OZGE 1WUNT 4D0BB 5D1QA 2EYTA 5E8PB 4XAKD 1PX4A 3EDKA 3QIUD 4ZO9A 2GFBA 1F90H 3GHBH 3BEWA 5DD6A 3EO9L 1K4CB 4FQXA 4LRNL 2MPAL 5I19L 4Y4KC 1S78C 3SKUD 1FE8L 4LDEB 5B39A 5CUSH 5EOCJ 5TFSL 4R97C 5DEZA 5AWNL 5C0IA 4J7RA 1NL0H 3QIBB 3GMRB 3O6FD 5DEGA 4QY8B 4JG1L 4X5XA 5CS7A 3REVA 4GQ9H 5HPMA 2H1PH 3GHEL 3MRCB 4GRLB 1T1ZA 3KR3H 1AP2A 4ZOCA 3TO4B 4P57B 2V2TA 3G6JF 3HI1A 4BUHA 2CK0L 2R39A 3FQWB 2VIRB 5B3JE 2AJ3B 4YDLC 3ZT7A 3RWEB 1FCCA 4P4RB 2DIJA 1AD0B 4XPFH 1OHQA 3VXMB 1JI1A 1T0PB 4WUKL 2KL6A 1HHHA 4LPXA 1KEGL 2FECI 3ARFD 5B4MC 2B0SH 2IADA 5DJXB 3ZLQC 4QXUL 3BO8B 3LKQB 5ADPL 2IH1A 4LLYB 2XWBA 4UV4H 2B1HH 5ALCH 3UTSE 1YY9D 1AE6H 1JP5A 4ZUWB 4WU5B 4DVRL 3N85H 3OJMB 1LWRA 5SWSE 3DUHA 3RPIA 3UP1A 3PGCA 3GUTB 2YUWA 3IFLH 1OP3H 5D2NE 1NAMA 4V2CB 4XWGL 1BZQK 3HNVL 1NBYB 4XCNA 5I1LA 4MJ2A 4NUGL 2NZ9C 2B2XL 4G7VL 2BX5A 4ERSH 3GDBA 3V6OA 4PJ9B 5FYLD 4NBZB 4L8SA 5DI8B 4AMKH 4YHML 2CUMA 3W11D 4AENA 5FFLA 3DSNA 1KJ3H 4NGHH 4H25A 2YD4A 4QRTA 2EXYC 1F3JB 4NPYA 5CEZD 1HSBA 1UH3A 1LK3L 1KB9K 3MACH 4UTAL 3B9AA 1I8KB 3P77A 1F11B 3PGFL 4N90E 2DQJL 1GIGL 4G42B 1HZHH 1GC1C 3KPOA 3NAAL 3QRGL 5CP3A 2VZOA 2D0HA 2ZCKH 1J11A 4IOIA 2Y36H 4U1IB 1G7LB 4V1DA 3RBSA 1JZ4A 5F3BB 3WNPA 3IAGC 1KB5H 1F90L 2B1AL 2W9LA 4EBQH 3GSXB 4CN4A 3ARXA 4ZNEA 5DWUH 2AJUH 2YOCA 4MVBD 4NC1E 2ARJB 4OCYH 2EKSB 1MCCA 1NMBL 3H9SE 4X6FB 5KG9A 2B4CC 3SE4A 4C4KO 4Z6AT 1FDLH 1Z2KA 1DVFC 1A1NB 2A73B 4Y1AA 4R9HA 4S1QH 2I5YH 1SYSB 5TGBB 2J5LB 4UB0L 3QEHB 5HVWA 5DGRA 5T5FL 1H15A 1IGTA 3VGFA 1IGJB 3C08H 2RCSL 4PGZA 4V1DD 2PR4H 3R1GH 1I8IB 1YNTB 4M5YH 3HNVH 3L5HA 4RFOL 4NO0A 5ECJE 3SDXE 3KWWA 1X5GA 3V5DA 5F7MC 4ZUTB 1S5HA 3WFBL 3ZYOA 3SPVB 1R6VA 2WINA 3PV7A 5I1AB 1KJVB 5EOCL 3S35H 1N2RB 2YKLL 2B1HL 3DV4B 5ALCL 2MPAH 1GYAA 3DRTB 1CICB 1RZKH 3EOTH 4JPVL 5B38A 3K8MA 3VXQA 1MHEA 4Y1AD 4Q9QH 4HKBB 1HIMH 1WZLA 1K6QH 2VR9A 3ZE0E 43CAB 1BREA 1ZT4B 5IW6B 4XPTH 2I07B 2E27H 3QHFL 4H0IA 4XNUL 2NY0C 4PJXB 5TDPA 3NPSB 2H26B 3OAUH 4IS6B 3CSBA 1WK0A 1XGRB 2F53D 4F7PB 1AHWB 3KPRA 5DHVB 3FQXA 3IAPA 2GJ6D 3GSUB 1YJDH 4K55A 3QG6A 4U1LB 1W72H 2VE6A 4Q6IA 3OAZK 1DZBA 1IAIH 1XH3B 2BVOB 1VKXA 5IOPB 2GK2A 3BE1H 3OBAA 1AKJD 4L4VA 4P4KB 4P49A 4PV8B 3ROLB 3U9PH 4YFEA 2AXFA 4BH7B 1NAML 1BECA 1MAMH 4X6BA 3DSFH 1N0XL 2X1WL 3AREC 5DC9B 3MRNB 1NUNB 4H26A 1BOGB 2HTKC 1PDKA 3ZL4H 5IMKA 2JIXA 2JJUA 1D5MB 1FPTL 2V7HA 3VWKC 1KN2L 1ED3B 2UY7A 1KJ2L 5DSCA 1IVLA 4HKZA 2JK5B 4RAUA 3R8QA 5ADOH 5K9KA 4HPYH 5SX4H 1QPXA 2RQ8A 5DMGC 1TCRA 5DWUL 1UYWH 4GS7C 5B21A 3VGDA 5C3LD 1YNLL 3DUSA 3GK8H 2ID5A 1EZVY 4K8RH 2EE3A 3NZ8B 4CVXB 4KRPB 4DOHB 4PLKD 2NNAA 1YEKL 4A2MA 4ETQB 1NPUA 4XVUC 4TRPL 2GCYB 4FXKA 4M1CD 1Z3GL 3VFNA 5FYKU 4YHYB 1DSFL 5K9QI 1ZLWH 3KLAB 4M7KL 5BRZA 3ULUE 4HUVB 2DKMA 5ALBL 4N8VA 3PQYD 4Y16C 1OGAB 3GSRB 4YGVB 2XOTA 4YHNB 4PRPB 3VI4E 1MFAH 4C56A 5F9OL 1E28A 4G9FE 5EPMA 3I3EA 1IM9D 1HXMB 2X4OA 1FFPA 3LN9A 1OAZH 1LEGA 3CUPB 4XCFL 2BNRE 5FA3B 1I1AC 1FGNL 4LSPH 5KSAD 4NHCH 2Q8AH 2C4FT 3MO1A 3KPQA 5HI5C 1W2KT 5EG6C 1RU9H 3BX7C 4GKSA 2IGFH 1RZJL 1JK8B 2EIDA 5C0DB 3HC0A 3OTTA 4NQEA 3U30C 1UJ3C 2IPUK 5BRZD 3JWDC 4NC0B 3BZDA 3UDWA 3MLSL 4WI4A 4HJJL 1UEYA 3T0WA 3VJ6B 5LGHL 4M1GH 5JHDE 4LGPB 4K3JH 5CD3B 4MQSB 3ZHDA 5C09D 3O8XD 1X9QA 5SWZE 5CEZH 2B7DT 2DBLL 5EBWB 2PXYD 3I02A 5DGQA 3S96B 5HYIA 5T1KD 2AEWA 3C6LD 3PL6A 2CDEB 2BVYA 5INCA 3U4BL 4K2UL 2NY5L 4BFBD 3X11A 5F1OB 3QUZB 2J2ZA 3RGHA 3CXDL 4D9RD 4W6YB 4Y5XC 3I2CH 4X6BB 4F7PA 1PW3A 1KXQE 4O58H 2R9HC 3SDYL 4GG8A 1SJEA 2AXFB 5KS9F 1QFOA 2LU7A 2ICWB 3ZE1E 3U1SL 1T0MB 2NLJA 1OB1A 1ZTXL 5B38B 1BVLA 4KKNA 5D7LB 1IM3B 3FFCA 3KXFB 1TTFA 3ARTA 4ODXB 4JRXB 1U0QA 1LDPL 5IFAH 3WLBB 2DM4A 1GHFL 4WENB 1S5HB 1YN6A 4ZO8A 5E2UH 5C9JA 5ID1A 4OFVA 1P4BH 4JCLA 2HYMA 2YD7A 4MMXC 1QEWA 4D9LL 1A7PH 3QNZB 3Q6GL 5T33H 1YEFL 4HFUL 1A7BA 2ZUQC 1NAKL 2EC9U 2LE9A 4WHCA 4KQ3H 2AJVL 3LS5H 2NTFA 3VXQB 2Y6SD 5D5MA 1VGEH 2VO5A 3GMQB 2A73A 1YEJH 1JHLL 1UB6B 4R2GD 2R9HD 1MFBH 1MLBB 4LLDA 5E2TL 4AL8H 4K3HA 3MRMB 1H3PH 3NPZB 5CGMA 2R56H 2E8YA 1T1XA 3LPWA 4AEHH 3SKOB 4HXAL 4EDWH 4H8WC 4Y16D 4LIQE 3FJTA 4M6ML 4IRJD 2AGJL 3MRPB 4XPGH 4NCC2 4JRXE 2CMRL 3PQYE 4Z7NF 1JMZA 1G6RB 3MRBA 2GTWB 5AUMB 5GGQL 3TA3B 3FN9A 3MZGB 2Z35A 1JK8A 4KI5D 4RCAA 1RUQL 4MSWA 5GS0C 4R7DA 5HY9B 5F1NB 5GRXG 3U7AA 3QJHA 5DJ0B 5L6YH 4LAJH 5HGBB 3LKOB 4PJIA 2FH6A 1HDMA 2PXYB 3G04A 5ESQA 2OJZL 5JNYA 1Z9MA 3QDMA 5IVZA 4M6OL 5CP7B 4APQC 1A14L 1UG9A 5EN2A 3C5ZD 4N8VB 4R7NB 3TZVA 1ZHLA 5DD3L 4UOJA 5A2LH 3SDAD 5JDSB 2GAZA 4JFEA 4LL9A 3CPLB 1WCQA 1BAFL 4Y4HA 4PRNB 4LIQL 1D5XA 2P5EB 1CT8A 1BHGA 1V8HA 4KK9C 2CXGA 1MWAH 1FC2D 1RUQH 2BRRH 4FS0A 3VXOB 2J7LA 4PBXA 5IMLB 1FFNA 3ZYJA 3PWLA 2HVJA 2YPLE 4NQCE 4OD1H 4FQXD 4YXHH 2CIKB 2J6EH 4BZ1L 2EDHA 3BVNA 2FHCA 1A4JB 1WFOA 1QO3B 5DHYB 1UM4L 1AHWC 2DQUH 4DW2H 2IH1B 3G6AA 4LLYA 3BKJL 2XWBB 4NRZA 1HI6B 3LKRB 3VU2A 1YYLH 3DNKA 3TGXA 4P46B 5F7FA 2FR4A 5FHAH 2OR8A 2W0LA 4J12A 4KVCH 5IJKC 4HJGA 3G08B 3MMEB 2FCBA 3ZKQD 5JZ7C 5F7DB 5JW5A 4AZ8A 4HZLA 3GSNH 3ZTNL 4P4RA 4FQ2H 3C2AH 1YEDA 4HPOH 2O93L 3HB3C 2CDFA 2ICES 3RA7L 3WNNA 4PR5A 1BJ1J 1QBMH 1NFDA 3V6BR 3P0GB 4Y2DC 4J3UA 2NXZC 1FNGB 5D71H 3SCMC 1QVOA 4G9FB 4PJFB 1QFWM 2EEAA 4OFIA 5BS0A 1IT9H 1S7XA 1UM6L 3WIIL 4UB0H 3O6KL 4I0PD 4LCYA 3N1FC 2CQVA 1UENA 1RD6A 5INDA 3H9ZA 1EEZB 2N7AA 5LQBH 1YMMD 4MA3B 2ZG2A 4I0CC 3OX8A 2YC1B 3MV7D 2GW5A 3BVNB 4GH7B 2JJSA 3KPMB 5GJTH 2GFBB 2DD8H 3QEQB 3BEWB 4TN9A 3QDJD 1K8DA 3M17B 2HTLD 1TMCB 5KN5B 3KS0J 5ENWB 1FFRA 4UIMB 3BGMB 1RMFL 3TO4D 43CAA 4DKEL 3RAJL 4P23A 5FUOH 5JA8B 1FVDA 4Z5RA 3MRCA 3V95A 2IC2A 4U7MA 3DRTA 3D0LA 1JFQH 3M8OH 4RX4D 2APTA 4NM4H 4JQVA 4PJFA 1MI5E 3CVHB 5DRNA 2CK2A 4L8DB 4XNQA 2EDNA 3X13B 5DUBB 3C60C 4OSUH 4LLVB 2A83B 1OGAD 4RBPH 3IF1A 2FECL 3BFOA 5KBNC 4EOWH 1VENA 3ARED 5CEYA 1NBVL 3QEHA 3EGSB 3V6ZB 2BSTA 4P46A 1J0HA 4POZC 5J8OA 3FT3A 5EN2B 3EYQC 1JN6B 2AEQL 2HRPL 3C60A 4E0RB 4PJBF 1JPTH 5C0NC 5JNYB 1F4WL 3QFJA 5IHZA 5KOMC 3QO0A 3PGFH 5TF1H 4DKFL 4NQXA 5IW1A 2HFGL 4X7EC 2FHBA 1QSFB 3T77B 1KULA 1CQKA 2G9HA 4JFFA 3KHOA 4Y19A 4BK4A 3FL7A 2RR3A 1QLFA 3HMXH 1TVHA 5I73B 3CX5K 4PJ8A 2C26A 1KGCE 4FQIH 2NQCA 4LSTH 5TF0A 4KK6D 3DROB 3D39E 5I1KL 3RQ3A 5JPMA 2VQTA 3D39D 2NXYD 4KK8C 3CVIH 1MQKL 3WSQL 4HH9A 4TRPH 1GC1H 1BJMA 4MAUL 2CGRH 1KIPA 1B0RB 1LEIA 4PG2C 4J2XA 3LPFA 4KUZH 4JCMA 1AC6A 5GGUA 4X6DB 1LQSR 1L6XA 1MCSA 1ES0A 5KSVB 3BSZH 1JIBA 4ZDHB 1RIVH 2QLVB 3CSYA 4NZJA 4QHNB 3O0RL 1Y0LB 4P59H 5SWQA 3VFUB 4X0KA 3L5IA 4NIKB 2XZAL 1JYNA 5C07A 2DQHL 3GGWA 1E4XI 2YD6A 1DBJH 5FGBA 3L5XH 1DE4B 5EZOL 3MOBH 4O4YH 4PJ5A 1ZANL 3C6LB 4X4YB 3WDHA 3O4LA 3VH8G 5I8EA 4MQXD 1EJOL 5CSBA 4FHBD 4Y19E 5IB5B 3TJHD 3FOLB 3EDEA 1EGJH 3QISA 3BXNA 4CVWA 2BOBB 5CGTA 3CU1A 4PJBB 3QG7H 4JHAL 4MD5B 5C6TH 4XBGA 3D18B 1RQ5A 1LEKA 4AIOA 2NR6C 1KTLA 3MA9L 2N4IA 4I48B 4FP8H 3RVVD 4U0RB 1IKNC 3TEUA 4RSVA 3DI3B 4HQQL 1OTTD 25C8L 5D6CA 3F12B 1B3JA 2ILLA 1ONQA 1T22A 1QSEE 1WBXB 1UZ8A 1MAKA 5T3XD 1IGFH 3DYOA 4S10A 3QNYA 2IBBA 1S3KH 4U3XA 5I30H 1IAOA 1XGUA 2ZPKL 2ZUVA 5I2IB 5F7WC 1JE6A 3ESUF 4X7TB 1YEIL 4HH9B 3G6JB 1O7SA 4JN1H 4L4JA 3QEUA 3UTPE 5L88H 4AM0A 2RGSA 3DI2B 2MQ3A 4JO3H 3QIBC 2VZSA 4AEHL 4PGEB 2HTKD 1FZMB 2DM3A 4KVCL 1HCFX 3CMOL 4QTIL 3VFNB 5EBWA 4PJCE 3SKMB 3VGHA 4YHKH 4OI9A 2H45A 1ZLVK 4XVTL 1MFEL 3HZYA 1DDHA 4HGWA 4Z7VA 5GRJL 1JPGB 1IL1A 1ZV5A 2GKIA 5F97E 4L5FL 4MA1C 3P4NB 4TSCH 4HGMA 2JTDA 1I7RB 3SO3C 2HKHH 4YGVA 1AI1H 1JN6A 4YHNA 3UBXG 3UJIH 4Z7WF 1EHXA 5IB1A 2FX9H 1M05A 3SE3A 4LHJB 1CGSH 3IU4L 2DIAA 1OLLA 1KB5L 2B1AH 3TH2T 2K7QA 1ETZB 3DHJA 2G5BB 4KMTH 1P6AB 3BP6A 4CAGA 4W81A 1BEYH 1XGPB 5C70A 8FABB 1Q9KB 4M1CC 4GRLC 5A16A 1DN0B 2APBA 1K8IA 5DUBA 3FB6A 3OGCA 2D7NA 2D0GA 5ICYB 2J8UE 3K2MC 1BF8A 4Q6IB 5IMKB 3GSWA 4R96B 3G5VB 4WUUE 2HP4A 1SY6A 4S1SH 5DQJA 1UEMA 2ITDB 1T3FA 1XIWC 5F6HJ 2DDQL 1FJ1B 4HIJB 3FQTA 2CLZA 1RY7B 3MRLA 4OZGA 3G6JA 3TJHC 3FQRB 2ZUXA 3MV7B 4G8GA 3WNMA 4EVNA 5CIPB 3WFCL 3T0AA 5TJWK 3FONB 1PSKH 3MQIA 1AR1C 1V5JA 3CC5B 2AEQH 1CDYA 2NY1D 2YR3A 3OWEA 2R69H 1KJMB 4NM8H 4YDVA 1UZ8B 3QUXD 1KJ2B 3DGGB 3E3QE 5IHLB 5KVDL 5A3IC 3E0GA 4HMDA 1ND0A 3A6BL 5T3ZH 4XCFH 1NMAL 4XZUB 1F4AA 3C6LC 4L29B 3UO1H 5CSZB 5DQDL 1DL7H 3FO2B 3N9GH 4L4VB 4P4KA 3SBWC 1AXTH 1A9BA 3PABB 4LLUA 5F9JA 3RY6A 1M7DA 4OV6F 3TNNA 2VABA 3LIZH 3NCJL 3BH9A 1TDQA 4U6YA 2WSKA 3BZ4A 1RHHA 1LO5B 4MWFA 2YEZB 4HEME 1XGTB 3C8KB 3LRHA 4PPTA 1PQZB 4KGJA 1EDQA 3VXPB 1B4RA 1TZGH 2NY1B 3GFUA 4PP2A 3SBWA 3B4NA 4LPVA 2I9LA 2DYPB 1W0WA 3BYYA 5DVMA 3DXAE 2Z8RA 1AKJB 1DUZA 4P4KD 1C7TA 1RK1B 1I1AD 1MH5A 4R4FH 5CP3H 4EKXA 4X9GA 2JJWA 3A6CH 1OAKL 1P7QD 5I6XB 1JBJA 1WZMA 4RFEA 5ESQB 2IQAB 3P9LB 4ORGA 1JTOA 3BP7B 1WLHA 3T4YB 1EO8H 1WFNA 5EU6A 4G8FA 1MY7A 5I71C 3QCVH 1S9YA 1S9XB 2VLRE 3GIZH 4JG0L 1N5YL 5FCUL 4J8RA 1ZGLP 3ARRA 4LCWB 2YZ8A 4IRJB 4NQSB 4XP1H 2J88L 4PY7A 1E6JL 1FAKT 4OZIF 4O51B 1KNOA 3H42L 5DVLA 1JGEB 1FVEB 1QSFD 2BNQB 5ID0A 3K4AA 3QQNA 3O41A 3OKDB 5EIVA 3GMNA 4JJ5B 5JOFA 3VW3L 1AQKH 1M1SA 3BP4B 3K2UL 4JQIL 5EDXA 4AENB 5AYQA 1CF8H 4OCXL 4NN6B 1QA9A 3STZA 1S78D 2HTLC 2BJML 4DZBA 3FFDA 2PCPA 5ICXA 1JGVH 1CL7H 2M1KA 5EORL 1B6UA 3VG0H 1ADQL 2WZPD 2ZSWA 4HWZA 5SX4I 4NWTH 1IC1A 2MHAB 2VZUA 3QG7L 1FNLA 5SX5K 4RWYL 4HXBH 4M6OH 2FZ3A 3RWDA 3ULUD 3L7EB 4M43H 5ELIA 2OTUB 3BPLC 3DX6A 3FT4A 2EEBA 2G5RA 1VERA 5EU6E 2NXZD 3RX5A 1NUDA 3L95A 1OVZA 4XPBL 3HE6D 5CZVH 5L9DL 4DN4L 1U2HA 4PRAA 1AFVH 3LQAL 2H8PB 5HGGS 4Y4KA 2R1XA 2AJYH 4PTUB 1OW0C 3MUJA 1IILE 2QHLA 3NZHL 1ZANH 1HQ4B 1UWXH 4JFZH 2AABL 3C5ZA 2ICWA 4WI8A 3WL9A 4UT6H 3IVKB 1PY4A 1LE9B 1NCWH 4NBYB 5CIPA 1CXLA 1ZWIB 2FEEI 3DVNA 2P5ED 4YUEL 5EO1B 1YN7B 3QH3A 3BYTA 4L9LB 1R3HB 3HG1D 1AP2B 4WFHE 1YDPA 1D9KC 2IJ0C 3IT8D 5BVPH 2AJZA 2AV7B 3CFBA 4H1LH 5HPOA 3REWB 3TV3L 4F9LA 4HKJA 5C0CD 2FO1A 2DQDL 4QYOB 3RVWC 3Q48A 3MC0A 1GXEA 3I6GB 4P5TA 3WN5C 5CINL 1P7KB 5EC1B 3FHQA 5FK9B 5KOVC 3QFDA 4PRAB 4UQ2B 4PB0H 4KXZI 3D3VA 5GJSH 2YD5A 5CJQH 3I2CL 1OAUH 1QUNA 1WC7A 1JUFB 3THML 3FB5A 4OT1H 1BM3L 2X4UB 5H35A 1HHJA 3EOAB 4YX2H 1A1OA 4D9RE 3OJDA 5JXAL 4YR6B 3NBNA 4KHTL 4JO4L 4P46D 4XHJC 1EHAA 1VPOL 1KUMA 4QHUA 1A6UH 3VXTB 1LE5B 1ZTXH 2B5IC 3V5HA 4EBQL 3C60D 4XC3L 3KNBB 4CU6A 2DQCL 3RY4A 1DJSA 1K4DB 4LVHB 5AZEH 3OKDA 3VXOA 2BNQE 3U30B 3GB7B 5DTFB 3OG4B 3L5WB 3QEGH 3MODH 3GMLA 3S37L 2ZNXA 2ZUYA 3VD5A 1TVBA 4P46C 2GI7A 4QNPF 4MSWB 3SDYH 1UH2A 4LHUD 3WSQH 2V5TA 4UNUA 1ZEAH 4L8CA 3GSRA 4YHIB 3EUUA 3BQUA 3CH8A 5IB1B 1LO4L 2YK1H 4IRSA 3CH1B 1OP3K 3O6FB 4FQCH 2VLRB 4JRYA 4JO4H 5C0ND 3QDMB 1LD9B 5IJVB 3QB7C 3D39A 3QXAB 1AR2A 1F3RB 5CEZL 2UWEB 2XZQH 1HCVA 4UTBL 4TULL 4Y4HC 3E6HB 3O2DA 1N8ZB 3ROOA 4FG6C 2HAZA 1I3GL 3QEGL 2FYYB 1MH5B 4HJ0D 3WHXB 2RFXB 4PLNC 4NO5A 1PG7L 1LP9A 3IJYB 4B7IA 1CD9B 1T1YA 5IESL 4X6DE 1FE8H 1INDH 4W68A 1WIPA 1NL0L 3EKCA 3H3BC 1EFXB 2ZOLA 4U1HB 4I2XB 1F97A 3O11B 4YC2C 4XI5C 4G6AC 3SDXB 2UWEF 3FQUA 5D7KD 4HT1L 5DK2B 4U0QB 2XQYG 1XCTA 5DJ6A 1H3XA 3S4SG 1MOEA 5J12C 3V0VA 2R0ZH 4LVEA 3LY6A 3OZ9H 4X7SL 1BFVH 4WHTA 5L9DH 2F19H 2NTFB 4PRHA 5EBLB 5I8EB 1S8DA 2RIKA 2H6PA 2QSCH 3OKNB 1QFUH 5EIIA 2V6HA 4JG1H 4CN1A 4JO2H 1ND0B 3RHWF 4N0FB 5EUKB 2NTSP 5IQ9B 2MCG1 2R8SH 1U8MB 4HEPG 1DTUA 4X9IA 2P5WB 5D7KE 3KXFA 1KN2H 4KTDL 5F9WB 1NKRA 2H32B 1M7DB 2F8XC 2Y4SA 2E6JA 5MERA 2XQYK 4F7MA 1PJ9A 2Z31C 2IPKB 2Z92A 2CLVA 1YEEH 1RIUH 1DBJL 4PBWD 5CEXB 4KRMB 4JR9H 5H8DA 2E7BA 2VLKD 1A7RH 5BVJB 3UPRB 1CE6A 3DGGA 4P9ML 1UA6L 5SWSA 2EDLA 3TIDA 1NAMH 3QUZA 1T2XA 5ESVA 3S5LG 4PV9A 4LOUD 1X5ZA 1KCKA 1OTUD 2ESVD 3BKCH 3DIFB 3QZWB 3EO0B 2R8SL 4NN7C 1BJ8A 2QQLH 4UMGA 5F9AC 4NJAL 1QBLL 3GIZL 5AD0B 2N7BA 3VG9B 1A7NH 3NCMA 4PRHE 5L8JB 3C5JB 3BKJH 4PRDA 4XRCB 4BQCA 1MY5A 1DFBH 3IDGB 3SKJH 5F44A 4RFOH 5HGDB 4WTXA 4OZFG 3MX0A 2ARJA 4Y5XA 3QXUA 3TNMA 5JHDB 5GGSY 3HRZA 4XPHL 4S0SD 4HIJA 5E99H 3AXLA 2E8ZA 2YN5A 2OI9C 4RAVA 2KZWA 1T1WB 1YC8A 5IBLC 4R96A 5ACZA 3T3MF 1OQOA 2PN5A 3KYMB 4FN0A 1ZA3B 1ETZA 2FJGA 4ZUUB 3L3OA 1K6QL 4JREB 5BW7C 1I7RA 2WAHA 3ZHLA 3UPAA 2EDYA 5JDJA 2ED9A 3QAZC 3DO7A 5F96H 1DN0A 3WFEL 4ZD3L 2X10A 3CVHL 3IDMB 3JV6A 5E2TH 3GI9L 3HNSH 2BNRB 5EOQL 3VMOA 5DUPH 4EZMA 5LWYL 2OM5A 4KJYB 2H3NA 3WKMH 3U2SB 5DRNB 2QADD 3C9NB 4WW2C 1CGYA 15C8L 2F19L 1UKQA 3WD5L 4UILL 4OF0A 5KVEH 2OR9L 1UQSB 3A6CL 2CKBH 4X4ME 3BKYH 5HHXL 3VFVB 3ZT6A 1IAIM 4Z5RB 4RAVB 4Y5YC 1A3LH 1UT9A 1A6TB 4PTTA 1QBBA 1LK3H 4D9LH 2VNCA 3DETC 5DK0A 2GJJA 1ZHBA 4G8GD 4K94L 1TQBB 5BVJA 3UPRA 1F02I 4XP9L 4N9GA 2R0WH 3L3DB 4I2XE 4PGCA 4W4NA 5C0CB 4B41A 2P5EE 4QTHB 2P8PB 5I1GL 4OZFA 3CXHJ 5DT1H 1U36A 3TBTB 4W6WB 4ENED 3RY5A 5LAXB 1F42A 4BUGA 1G9EA 1UWGH 4PGBB 2Q3AA 4Q2ZA 5FYLE 1TFHA 3E2HC 4JFHD 5D1ZD 5AD0A 5DO2D 5GGTA 2EO9A 3L3GB 2H32A 5HHQB 1GGTA 1ORQB 3ARWA 4QRSB 4QOKE 3W0WE 1NDMA 3CJJA 4LNRB 2W60B 4R0LA 1FNFA 3FZUD 5CEXA 1JMXA 5FO7B 4NN7B 2VDOL 4WW1B 4JPIB 4Y2DD 4RGMC 4PJBA 1QNZH 4PJBE 3O6LL 3THMH 1KELH 3CD4A 1DR9A 2HT2D 4IMLB 4S1SL 1S8DB 2LTQB 3REWA 4BZ2H 1CK0L 4UDUB 3GSUA 5I1AA 1HHGB 2I9TA 2DQFA 3VFOB 3VFTA 4NKIL 4QNPE 5FM8A 1JZ3A 1RZGB 2Y72A 1WISA 1RZFL 4IBLT 4FFWC 4X6CB 1VCAA 4LEOA 4W6XB 1CFNB 4DTGH 3PGDA 1OY3B 1H9VA 3ETBF 5IW6A 2NXYB 1RFDH 4D0BA 4MHHG 1EERB 1PG7H 3FQUB 4HKBA 4O02L 5DJYB 4G6MH 2FIKA 4JO1L 2W0FA 1K5NA 4I2XA 3RY6C 2XQBH 3TFKD 1N2RA 4Y8DC 1XF3B 1D9KA 3DV4A 4PB9L 2YN3A 4NFBA 3O3UN 1EFQA 3K7UA 4F15C 3V0VB 5KSUB 4Y0GA 1J18A 1H0DA 3O9WD 3P4OB 4K94H 5JW4M 3UYRL 2IQ9L 3MLYH 3TT1H 4WW2B 2YPLA 4NQCA 4UUJA 3IFNL 3V6FB 3VFUA 4MXQC 2IPTL 3F7RA 3JVGC 1HKFA 1U95B 4CMHB 4RMVA 1H5BC 3D39B 3OR6A 2ZUWA 3KLHD 4U6XA 4Q9CA 2VLJB 3PHSA 1A1NA 4CJ0A 4CNIB 1X5IA 4R4BA 1CLYL 1IE5A 2VDKH 2ARJQ 5MEOA 5GZNC 2EKSA 1CL7L 1UWEH 4MQ7B 1QSFA 3BJ91 3T77A 2PYEB 3HE7C 2R2BB 4TSCL 5KZCD 4E0RA 4XP6L 5CIPH 3P0YH 3VWKA 4DW2L 1KT2A 3DX7B 3QIWC 1RUMH 1RPQA 5DC4B 3VGAC 3WXVH 3WIFB 2A6KB 4BKLA 4OKDA 2CKBA 4N0UE 4E9LA 4XPFL 3PP3K 2QSTA 3JTTA 1U3ZA 2R1YA 4W70A 4DN4H 3H42H 1MFDH 1Q9LA 1LO3L 4RMUA 1IGFL 4JHWH 4P2OB 4JFED 3QNXA 4JE4B 1KLUA 4M8VA 2K9UA 4KRNA 3OHXA 1F8TH 1NBZA 3ZO0A 3QFJB 4P2CG 5C2UB 4JM4L 5GGVH 5IVXB 4Y16A 1D5ZB 4JN1L 1YEJL 1NKOA 4HJ0C 5DI8A 3B5HA 4ODHL 5DJXA 1V3MA 2ADIA 4M4RA 4M48L 4GAYA 1J1XH 3QIWA 4GRWF 1UM4H 2DQUL 2HKHL 4LP4A 2NLJB 1MIEH 4N8CH 4KY1H 1WEJH 4ZFOL 5MEND 3RVWD 1MQ8A 3ZYZA 3RPIB 4M9OA 5HYSG 3NFPA 2YPLB 4NQCB 1NH6A 4UU9B 1R3HA 5IFAL 4G6JL 3QCTH 2A6DB 4ZUWA 1VDGA 3OKOB 3WYRA 1P9MC 2YKLH 4APQD 1G7MB 5C9KA 1AJ7L 2Z4QA 1C5CL 3QT2A 5T1KB 3EOTL 2IADB 3L9RB 3RWGA 3GKWL 4EDXA 5EC1A 5IM7A 1JV5A 2VLJD 1N5YH 3D85D 4N0YH 3S96A 4MYWB 1AGDB 4UQ3B 1BVKB 1J0IA 3T65B 4HS6B 2R0KL 5E8PA 3BD4A 3O3BA 1NCCL 3NOIA 1FNSL 5EU3A 3S3JA 5E00A 5DD0H 4HX1B 2HLAA 3WN5A 2IF7A 1KACB 1A7RL 2R4SL 4F9LC 1AY1L 4PJDA 3NIGE 5C0IB 3P40A 1S7WB 3GJFA 4OZFB 4OTXL 1L7TL 5IP4A 3AGVA 3DXAB 1HYSC 1GGUA 3MJ7B 2VXUH 2BMKB 1ZGLA 3V79C 3SQOL 4XBEL 1PVHA 3SDDC 5D1QB 5C0AD 2FZ3B 5EZIH 1XGPA 3MRFA 1FZOA 4XNYL 2YPKB 2HFEB 4G8GE 5C71A 4Q97A 4G8IB 4MCYA 5EPMB 3LDBC 3ZDZF 4F80A 4QT5B 4ELMF 5LBSH 2V17H 5IFJB 5DJCB 4XGZB 2VISB 2HVJB 5C07E 4HFWB 3MACL 1JPGA 5I9QB 4Y16B 2F5AH 5D7JB 2WBJA 1IGIH 4PYGA 2BNRA 4YFLI 1WIUA 4WDIB 4MGXA 3O3DA 4ALAH 2CK0H 1FRGH 5CJXA 1T5XB 1Q9LB 3I3BA 3TWCH 4QWWD 3BEVB 3LZFH 3DX9A 1G6RA 2IALB 4P2OD 5FA4B 2MTPA 4RX4A 4U6XB 5AUMA 3TV3H 4WJ5B 1DVFA 5IW3A 3QIUA 5C6PB 3JBG7 3MLRL 3U4EB 1U95A 4UV4L 5KSBF 4LRNH 1FN4A 2VXQH 4P5MB 3VXUD 1G7HB 3U6RB 3AXLB 4CMMB 4KKLD 4CVUA 2SEBB 4AEIH 5GGSA 4NN5B 1ED3A 1U8OB 2D7PA 1LO5A 2VSDA 4F7CB 4ZUVB 2IG2L 4WFGE 2YRZA 1NUFA 1B0WA 1KPRA 1SEQL 1V7MH 1IAMA 1AKJA 4L4VD 3MRPA 4NUGH 4OGZA 4N1HB 1EIBA 1ZHKB 3P11H 3NGBC 1I9IL 1DVFD 1CIUA 1NGQH 3UTSD 5BZDB 3QQ4A 4DTGL 1YNLH 4WIQA 4DGYL 5FKPA 1TENA 3WLBA 3AVEA 5BMFH 3RTQD 1JYWA 4XI5D 3MR9B 3BISA 1C5CH 4JFOB 4PLKC 2V5SA 5GGRA 1X5HA 1E4XH 4HS8L 2D2OA 4TSBH 3SEPA 2NX5B 1X5LA 2QV2A 1G1YA 1OP9A 5IQ9A 3EJZC 5GS0H 3FMGL 5TDNA 5I76B 3HCVB 2YD1A 4M7ZB 5DJDB 1GJIA 1P5VA 1CFNA 1OAZL 1T21B 3IDYC 4OZHF 3JUYA 5F8RC 3S35X 2NW3B 3ME0A 4YHYC 5E99L 2VLLB 2ZG1A 3NN8A 3O6ML 5D7LA 3GMOA 4GSDL 3I75A 2XV6B 2WWMC 4XPBH 3LQMA 5CZVL 4FZ8L 1A8JH 4JDZB 1G9MC 5CUSL 3ARGC 4XNZB 2IFGA 2X4NB 5EUKA 4HDIA 4ONFL 4HIXL 2G60L 4POZD 2P24A 3HS0A 3VFGH 2XTJB 1N0LA 5BXFA 3VFMA 5TH2A 3EJJX 3VG0L 4BQ9A 5D2NA 5DK2A 1WFUA 1AI1L 1VEMA 3F7VA 1KCRL 2JB5H 1FJ1A 1VFBB 4ZUVA 1MHCB 3W9EA 1YEEL 1WEJL 4R4NC 2F74A 4OZFH 2XN9D 3RNKA 4J3TA 3MLPA 4BSVA 2Y25A 3STLA 1LP9F 5HVGB 2VQ1A 3TA3C 1JWMB 4JPWL 5D2LF 1DLHA 5GGSB 3O3DB 2GSGB 4QWWC 4HUWB 1DVFB 1G7IA 3U9PL 3OGOE 4PJAE 1A7OL 3VFGL 3JVGA 1HNFA 3ILPB 3IDMA 2A74B 2J5LC 5DEFA 2EEDA 2VLRA 1SM3H 4JRYB 4S2SB 4E41B 1YPZE 2IALA 4KKAD 1S7RB 5GGVL 4ZFFA 1JGVL 1OGAE 2R23B 5EORH 4XHQA 4PG2A 3R1GL 2PR4L 1KYOK 4HK3J 3OPZH 3MJ6A 4BSWA 5DUMH 2Q86B 1KCUL 5JHLH 1HINH 2FJHB 1UJ3A 1ZSDA 5DDHB 4U33A 3VGGA 2HKFL 3BH8B 4ODVL 3HR6A 2W9EH 4JDVB 5DD5H 1UCBH 3SDCD 3C09C 5I17B 1QR1A 4HIEA 4FZEH 1L9MA 1DN2A 1T2QL 3HFML 3RWCA 5J1SC 3F8UB 5CJ8A 2VLRD 5IV2B 2EECA 1LK2B 4LARL 5EU4A 1C8PA 1GGCH 2V7HB 4CU8A 2JCCE 2G60H 2XICA 1WWAX 2YPVH 2YS4A 2WLZA 5E0QA 4E41A 1QBLH 1CTOA 4ODSL 5I1HL 4MCYB 5FM4A 3MA7B 3T1FA 2FRGP 4OZGF 4K7PY