1NM4A

Solution structure of cu(i)-copc from pseudomonas syringae
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper resistance protein C
publication title A redox switch in CopC: An intriguing copper trafficking protein that binds copper(I) and copper(II) at different sites
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Metal binding protein
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1nm4A00
3FAXA 2OMTA 2UZYA 2OMUA 2OMXA 1NM4A 1O6VA 2YA1A 1OT4A 5ICUA 1LYQA 1H6UA 2UZXA 3BC9A 4CILA 2OMWA 3BCFA 2OMVA 1H6TA 2C9RA 2WQVA 1M42A 1M9SA 2WQUA 2OMYA 2C9PA 4CC4A 2WQXA 2OMZA 3FAWA 1O6SA 2C9QA 4AW4A 4CC4C 3BCDA 3BZ5A 2Y5QA 2WQWA 2RA1A 1XEUA 1O6TA 1IX2A 4AQ1A
chains in the Genus database with same CATH superfamily
4H8HA 2GEEA 3DK2A 3PIQA 3LH8A 1MFDH 2VH5L 3S34H 2R39A 3SKNB 4F33B 4UZSA 4PHXA 3BUQA 3MUHL 1S9WB 4WIQA 3WL9B 3P9WB 5MEQB 2A77L 1QACA 1H9VA 2Z31B 3ISYA 3BDYH 3S36L 1ND0A 3MRPA 1OCRB 2NYZA 5A2LH 3N41B 4ALAL 3NJNA 4N0CC 4UDTB 1Q9OB 4N22A 2YGNA 1GS6X 1I9IL 2EXTA 2HX9A 1C08A 2C1OB 1MWAL 2X6AA 5C09B 5FA3A 3HS0A 4O9HL 3ZHLA 2XKUA 4ELMA 3GSNB 1BIIB 3O41A 4X80L 1UT1A 1RSYA 4NN7B 4QGTA 4UU9B 2GTWA 2X3AA 4R7VA 4DKAA 3II2A 1JGEA 1PD0A 4A2LA 2WQVA 4XXWA 2Q8BL 3B6SB 3MRIB 5BO0D 3ETTA 4L0YA 1KDIA 3ZX1A 5E08H 4OJYA 3MODL 5ITFA 1NLBH 3CV5A 5FKAA 3L3IA 4JDTH 1FDLH 3T65B 1OAJA 4H13C 4PUBL 2ZWKA 4MD5A 1KBKA 3MJ7A 4DN3H 5L2JB 5JHLA 1Z66A 4IKNA 4MKMA 1NC4A 1KT2B 3G04B 3QPXH 4W6XB 5DHEA 4LO9A 1VESA 3NSXA 5IHUH 3QUYC 5HGHA 5E9NA 3D4ZA 5F72S 5I0YA 3MBEA 2DW5A 1Q0YH 1LGVA 1T1ZA 5KAQF 1XTLA 3QIWA 3ZKNC 4IOFC 4YDIL 1XF5B 5E6SB 3IFPB 1G7QA 1N68A 3P4MB 1AGBA 4ZD3L 3G5WA 1RPQA 5FCUH 3L5JA 4HUUA 3DTXA 3EYUL 5IP4A 3DVNB 1UOLA 4DW2H 2QPFA 1D6EA 1HX0A 3K91A 5DJ6B 4G8FB 3MJ8A 4XMWA 5KVEH 5D1ZI 2FAUA 3L4VA 3GLEA 3NRQA 3QI9A 3TS8A 3TBVA 1HILA 1HHHB 4NJAL 4XO9A 1OGTA 3NYKA 3IJ9A 4EIZC 1NBYB 1U95B 3QUHA 4K3JL 3MLRL 1K4DB 3QUZA 4WY7H 1QSEE 4FNLH 5IFHL 1C5CH 1U8QA 4AGOA 4ORGB 2WINA 2H5UA 1ZHLA 1I7TA 1A4BA 4IOSA 2VM4A 4G7YH 1A3LH 3A23A 5ISZA 3FAWA 3T2PA 2WVSA 1SLVA 3QJQB 4HKJB 2X9WA 1KCBA 2ZX9A 3CFEB 4LBEB 4JPWL 5IROC 1UM5H 4CMMA 3G08A 4QHKI 3WNPA 2QGDA 3ARDD 1IBGL 5C0IA 1EZVY 1MCSA 5F6IB 5T1KB 2IGTA 2EKSB 5TGBB 2DLFH 3WIIH 2DWTA 3CMOH 5IG7B 4EQ2A 1J10A 5FUCC 2BY0A 1EMTH 3BZ4B 4HKZA 4Z78A 4L1LA 4NQVA 1YA5A 5K9JL 1YNKH 2IWFA 5LKNA 5EWIL 4OCSL 4YAQA 1YLBB 4KDTA 2RBLA 3BZEA 5TDPB 1LK2A 3BPCA 3K5SA 1GGCH 4GS7C 4HX1B 4A2HA 5E0QA 2ZCKL 4D9RE 3H7LA 4JBSA 2H6UA 1HEZA 2R0LH 4TUKL 1GGIL 1MIML 2PYEE 5DD0H 1SBBA 4QT5A 1CZ8L 4HIPA 4OQTH 1HH6B 5AL0A 1IT9L 4HWEH 3ARYA 3H9SA 5I1KH 1WAAF 4H7VA 1R1CA 5LVEA 1LXMA 4NKQB 1JNHA 4M9PA 4YGAB 1KCLA 2YUZA 4JZNA 2VRQA 3SHSA 2VISA 4PJ5A 1JD9A 4UM9A 2ZUWA 3MXWL 4KNTA 4TN9A 1QWHA 5FYLH 3X3GH 2PCYA 5I75B 3NCYS 2EILB 3GF8A 5HYSG 4Y2NA 5AAMA 1ACYH 1CT8A 1MNUH 3QO1A 2IBBA 3L48A 4FJYA 4LL4A 3Q6FA 1G0DA 2NY4B 2ATKB 2J8OA 4K3EH 1BCIA 2PETA 3V4UL 2BCKA 3BWZA 3BH4A 2YAFA 3HE7D 1EZVX 2B20A 2NY1D 1ZLSH 3DIFA 1AKJB 4F2MB 2GHZA 2M8XA 3MRBA 4FABL 4BFIA 4I48B 1T1WB 5JOPD 4FNRA 5J13C 3H3BC 5H8DA 2PTVA 3EZJB 4L3EB 5J12C 5E2WH 4NOBA 3PGDB 1ZMYA 5DU7A 2FEDD 2Z91B 3UIZA 1TNMA 1U92A 4IRJB 4BH8B 2PKDA 1FJ1A 3RX8A 2WLLB 6FABL 5TE7L 3CSYB 5FUCE 4Q74A 3VXQB 3VTMA 2E9BA 3QHFL 4LLMB 1TZAA 3K6OA 4JN1H 1VB9A 3U7WH 3UYOD 5A2BA 1LEIB 2BVPB 3QUYA 2V7NA 1CG9B 2X4QB 2V2WB 4N5EC 2DM2A 5B38G 5D8JH 1E6JL 1F4AA 1R24B 1V7MH 4N2EA 1ZA3B 2Z8VC 5JXAH 2ZXWB 4QJ3B 1J8RA 2WMPB 5KANI 5AOMA 4ONHA 3INOA 4JPIA 4H44C 1IMHC 1P69B 4G72B 3WS3A 3SKMA 4X7CC 4Y2DB 1MRDL 3DSNA 2WLJA 4XMKL 2WXMA 1R5IA 2Y6SC 4PRDB 5LN8A 2DB8A 3A4FA 2YRZA 5GJSL 4NO5A 5FYKE 1KXTA 4OZ4A 1ITCA 1N59B 2QGCA 4BYHA 2E7HA 1LP9E 1HAUA 1FL6B 5KSVB 4JL1A 4CA4A 2YQBA 1WUNT 1DVXA 3LQZB 5E24E 4IM8A 1Q1JH 4LSQH 5D71H 2DQCL 5HI5D 3SGJC 5I1EL 3MUGA 4N0FB 2WXIA 4FXLA 5J1TC 1KCUH 2CBQA 2X05A 4K2UL 5I19H 4YHKL 5LB1A 2QLYA 4MNGA 1H8SA 1BZDA 1YAZA 1E6OL 1Q9WB 4PJBE 1QLEB 3B9DA 3NJIA 4IU3A 4L4TA 5EOCL 4AEHL 5GGVL 3VFNB 1WA0X 3VRIA 5GRYA 4PJXB 5LQBL 3NZUA 3V0EA 3CQPA 2EIBA 3ZKXB 3L9YA 4RDQF 3HUJA 4G6KL 4MA7L 3L2LA 3D9AH 4WO0A 3IN0A 5TJWK 4OM0H 3TA3D 2P5WA 3MV7B 3QPKA 1KJVA 5A7EA 2PR4L 4GUQA 1JRHI 2AV7B 3CPLA 4JPSA 1AKPA 3MRNB 2J57A 3CXDH 4RRPG 1GA2A 3BZDA 1KPVB 4H8QA 2DOCA 3QZLA 2WD0A 3KXFA 2C34A 3QIUB 3HB3C 3NH7L 4OQTA 2X09A 4GW1A 2VLMD 1YYLH 2E9IA 1UG9A 5SWQA 3ZN6A 2QMKA 2Y6TE 5B7EA 3EDJA 3C12A 4M7ZC 4UB0H 2FHCA 4P23B 3B3IA 4OFDA 3T0EA 3HE6C 4JUTA 1G87A 3QEUA 1RLBA 5B39B 2BVQA 5L8JB 2G5UA 5HYEA 3IAQA 1Q38A 4F57H 3RDTD 4PY7B 4W4NA 2A4EA 5GGUA 2NY5L 1ZANH 2E56A 1KGJA 3K4DA 1RIVH 4P2QB 4RIRA 2NUPB 4ZXBC 4E9LA 4L4VD 2HJLA 4V11A 5IJVB 1XIWD 4NKDA 5FF6A 2VW4A 5KZCD 1EJFA 1O9ZA 2BIMA 1MFDL 1VZHA 3X1GA 2WO2B 3N9GH 2PO6C 2XX1A 3KCPA 5HVHC 3CUPB 4LLYB 4R6UA 3REVA 3KPRE 3A6OA 1HCZA 1MCWM 3ARBD 3VFMA 3BDYL 1R5WB 4XH2A 3KWWB 5F8RC 2VZOA 1DFXA 1CC3A 5F6HJ 1DP0A 1R3LA 2BS8A 4E9TA 3HC0A 4DK5A 4D9QD 2X28A 3KPQA 3VCLA 1SVCP 4MAUH 1X5YA 1MH5B 3CZGA 5CUSL 3L3OA 5D7JA 2E9WA 5CD5D 4IJ3C 5IQ9A 4HQQH 3TBBA 2IDTA 3RPBA 5KSBA 2VJ8A 1A7PL 4B97A 2EXWC 2VDRH 5I0VA 5J3HC 3LN4A 1V8HA 5DK0A 3EJYD 4DHLA 3D0LB 5IHZB 4AVJA 5EO9A 3I85A 3VI3A 3K0YA 5DF0A 4XBPA 2YJLA 5E08L 1C5BH 5ESVB 5IFJA 3ES6A 2FR4B 1QHQA 1FDLL 2YSSB 4XXDB 5TDNB 3VWKD 4Y4HA 4P9MH 4DN3L 3PS6A 2FLMA 2ZYRA 4LOUC 2NTFB 3QPXL 4ZPTA 5AZEH 3ZIYA 1IAIM 4NAJA 5KJRH 3BN9D 4UMSA 3K4ZA 5DEZA 2FX7H 5JW5A 3QIBD 4R3SA 3ENEA 3L4ZA 1XCTB 4OI9A 1Z6JT 4WUUB 1TF4A 2IADB 2YC1A 1GW0A 3D4YA 3QAZB 3MN8A 4KVNH 2E8YA 3GKWH 3HAEB 4NQEA 5ID1B 1PDKA 2PF6A 1HK6A 5JO5A 2AJZA 3QA3B 4PJAB 5FCUL 3ZZQA 5E2JA 3EOTL 5F1SA 3E6FB 5A6LA 1MNNA 2WGXA 3Q6GH 5MP6H 4DW2L 3ARTA 4YFEA 3WTYA 1Q9LB 1TMCB 3KPRA 1UASA 4HFUH 4K7PY 5KVEL 4KK5D 2F8OA 3I74A 2JKIS 1PY0A 1RJLB 2ADIA 4HXAH 1FIGL 3F2LA 4K8RH 4PJ7A 3WKPA 4GRMB 4C54A 2C8NA 4KGLA 4TQIA 4B50A 4PS3A 4RMSA 1JD7A 1LO4L 4FNLL 3LEVH 5DMJB 5FYKD 3ZZLA 1A4AA 3GSQA 5EOCJ 3MRLB 3IGLA 3GUFA 1KTKE 1L0PA 1EDHA 1ILSA 1M7IB 1ZVNA 3SDDB 3SE4A 2V2TB 4G7YL 4XPTL 2GJ6B 4AMWA 1UZ8A 1QA9A 4ODVH 4XNDA 5CBAA 2IMMA 4LEOB 2B08A 3N44B 1CGVA 5H37H 2OMTB 1UM5L 1UM4H 3B9KA 5E5RB 3LZLA 4LARH 1E5UI 4PV9B 3MAWA 3WGVB 3C2SA 1OALA 9PCYA 1PKQB 1C5DB 5IEHB 3NPSC 4V1DB 1P6FA 1EJ8A 2G0LA 3WIIL 2Q7YB 2OL3B 4FEMA 2ITFA 1EMTL 2R4RH 3IJYB 3ISWA 4EI5C 3AWEA 3LNFA 5E1IA 2APSA 1YNKL 3BWAA 3TEXA 1XXDC 2BSTB 3UAFA 4B9GA 5AOLA 1AP2B 1LO5B 4RVBA 2R0LL 1UB6B 4H26A 4HSCX 4ZS6C 4F8TA 4YLCA 1GJUA 4JFDE 4K7PX 5GSVA 3RKDD 5F0JB 4AL8C 2CO6B 3ULVH 4HWZA 4OQTL 1YDPA 4HWEL 3SY0B 2N01B 4U1MB 5I1KL 1ZHKA 3A6CH 3KH4A 4X8CA 3JTSB 2PO6A 4CDGC 3SPVA 2XQYK 4Z0BL 5HD8D 2WKOA 3GK8H 4PG2C 2CZNA 4HS3B 5FYLL 1OGAA 3RUGE 3RWIA 3X3GL 3LNGA 3MV9E 1BSIA 4MA1B 2WYIA 4MJIB 4AG4H 3OGCB 3QNXB 5JYMA 2H3XC 3HEIB 3O6FC 1ACYL 1MNUL 4N2GA 4AITA 5ADOL 1ONQB 3ZT6A 5IY5B 3BQUA 4K3EL 3EBGA 5F7KC 1AGEB 3OAUH 4LCIH 1ZLSL 5IW6B 4AYSA 4YSEA 1GC1H 1U91B 4KDVA 4V33A 2A9DA 5D6DA 4YFLI 2QSQA 1QR4A 3G7TA 2X6VA 5I26A 3IMTA 2E27H 5EZIL 1JWMA 4HUXB 5T1LD 3C8DA 4OZHE 3WUWA 5I1DA 1NANH 1E8WA 5HPMA 2BIQA 2W9EL 4HOMA 4E2OA 1E9QB 5SV3A 4KK9C 3WLBA 2VC2B 4ANKA 2LOEA 3ME0B 3P11H 2A9AA 3MLSH 3OBAA 5E8EA 3C6SA 3FPYA 2VE6B 5CS7A 1CDYA 3VTAA 3EG9A 2AEWA 2X4OA 3FTYA 5JW4M 1V3KA 5DQ9A 4JN1L 3U7WL 3NAAL 4ODBD 4BKLA 1QFWI 5FYJU 5F3HA 2R69L 3D3VD 3B2DC 2Y2WA 5BRQA 3ZRSA 2XWTB 5D8JL 2RB8A 4EUPG 3JYCA 1YECH 4WNQA 1H6TA 1T83C 1V7ML 4AI7A 3EOYG 1VEMA 3KYAA 2NDGA 3A21A 4YSSA 4YIQA 2IC2A 5K33A 3NJMA 4FXGB 4JRYA 1WBZA 3VFVB 5F3BB 1NPUA 4OLVL 1G6VK 3VX1A 4L0ZA 1MW0A 1ZS8B 3LKRB 1HINH 1JSYA 3EJCA 3OC5A 3QZMA 1DQMH 5H35B 5F1NB 2XY2A 2G30A 1UJTA 2Z65C 2HMIC 2NZ9C 3CFNA 5JIMA 1PZ2A 2C1PA 4G8GA 1BFTA 2Q2EB 2R59A 4B9YA 5IMLB 3REWA 3FUMA 4WWKC 5HHOE 4UCFA 4DEPB 4J12A 3L4UA 4U0RC 1BXUA 4OIFA 4FERA 1XF4A 5I6NA 4KKQA 5FX3A 4LSQL 3O3EB 1ACXA 5D71L 2RAMA 1KB5B 2DICA 4JN2B 1OARH 4UQ9A 4GUCA 3ROOA 3OM3B 3RKPA 1KCUL 3WJJA 5I19L 2HN7B 2JKWA 2YD3A 3L9RB 2IDSA 5BVJB 2DZEA 1TCMA 1XGYH 4OFQA 1M7DA 1A6AB 2CHZA 4MBRA 4XI5C 1H6UA 3U6RB 2VLLA 2WQSA 5KS9F 4F1ZA 5EF1A 5H37A 3UZQB 5C8JA 3O11B 3EOAB 5BUAA 2W0PA 4ENZA 5MERB 3D9AL 4Q89A 3PWNB 2A99A 3OJDB 3QS2A 4OM0L 3KYMA 3VAEA 1S2EA 4XVJH 3I9IA 3P73A 4N8UA 1NEZA 2F68X 1QZNA 1I7ZB 1PS3A 3CXDL 2BHFA 3KDPB 3SPHA 4P3DA 1E5CA 3EZ8A 1P4LB 2AQNA 4XZ4A 5IB3A 2XN2A 5D7LA 3N0AA 2BVEA 3LIUA 4NQUA 1MFVA 4FTVA 4L1DA 1KIPA 5JHAA 3WMPA 4AEIH 4E0RB 3FT9A 3Q8EA 3WN5B 1YYLL 2R2EA 4IS6B 3DI3B 3VFRB 1FI8C 1IEBB 3K72B 4NIYE 3U0PA 4UB0L 1W6WA 3PAVA 3DROB 4OUUB 3RNKB 4ZUSA 3O6FA 4R84A 3T1WA 4OIIH 2HCZX 2AVFA 2VLJA 4ZMAT 1RZJH 2WC7A 5IKCB 4F57L 2IOOA 5AVTB 1HXMA 2F7PA 3L4XA 1QSFE 2QDVA 3A67H 1AY1H 1ZANL 2IXQA 2QLVB 3TZVD 4HFWA 4KX7A 5HHOA 2EIZA 1JJUA 1RIVL 2R2HB 3DPBB 4B3VA 1RZJC 4Y4KC 1FZJA 1BWWA 1DR9A 1EFQA 3W57A 2WB7A 5D1XB 2BWIA 3QQ9C 3JXAA 3N9GL 4XMLL 1ZLUK 4YEFA 4HIIA 4K7FA 3QJZA 5DT1L 1WGOA 4TLUA 5ANHA 3MLTB 3R7QA 3VI4B 2XRAH 3EW3B 4EQ3A 3W3BA 4K0OA 1XGQA 1JF6A 2G3MA 4J4PD 4MAUL 3QWNA 2O5YH 4UUJA 3VRJA 1HWWA 2DEWX 1WVZA 1CXEA 3ARFC 1KIUA 3KPSD 3UCQA 2O5ZH 2RHEA 2EVHA 3BWUF 3MV9D 2QSVA 2NY3D 3TO4D 4E36A 2BSSA 2VDRL 4TNWK 3UO8B 1WA1X 1XF2B 2BVOB 4PIRF 3P9LA 2VN7A 4KU1A 2XWJA 3THML 2ODIA 1RIHL 5E94B 2R8SH 1O75A 1C5BL 3HZMA 2YAHA 3DPDA 3I9GH 2CDEB 2Y2TA 1RUPH 2QTVA 1WBXA 2CALA 1WH0A 2P1YA 3G9VA 4K9JA 4FD0A 4P9ML 1K5WA 4XX1G 4J3OG 1J5DA 3TN0D 1KBGH 3NDZE 1C7TA 2PXYC 1SF3A 3P0GB 1J8HE 3U48A 4JQXA 4M1CC 3K6SB 1QW8A 3HMXH 4FZ8H 5CSZB 3VSVA 1YMME 3QULA 2VSMB 4H0LC 2OFQA 1WDAA 2Z6FA 3UCRA 1L9RA 4KVNL 1P1ZB 4G1MA 3GKWL 4AOFA 2HFEA 5EFIA 1ETZA 3RFZC 1TOXA 4MHHG 2FEEL 1FSKB 1I1FA 2WSPA 4XTRD 5MP6L 2XHNA 3GINA 2F54E 3TURA 3PREA 1K8DB 1KG0B 4WLCA 4HFUL 1XB6A 3C75A 1BP3B 4HXAL 1T7WA 3ASNB 4K8RL 4PRIE 4X98A 5IQ7H 3N55A 1IJ9A 1XX9C 1KWKA 1MG3C 2QV2A 3EH1A 3VD7A 3ECBB 1G0XA 1W0VA 1JDCA 2FHBA 1J0ZA 3AREA 3AXLB 3LRKA 3VD4A 1Y6KR 3PJSB 1J12A 3CHOA 3D85D 1IGTA 4PGCB 3AU1B 3V4LA 4ODVL 1Q94A 3L95B 1BD2A 3O3DA 4ZYKB 1QFOA 4QRPB 2MCMA 1EXHA 4O2CB 1KLUB 2Y07H 2WO4A 3TONA 3FONB 4LARL 3S6CA 2HT2D 2HRPH 2P42B 2NY6B 1RL1A 4PJHF 4H1LB 1W2KT 5EBMB 5D1QA 4ZFFB 1XZWA 3M1CA 1BJMA 3U9PH 1U8LB 1A7NH 3GRWH 3RZCD 3UJIH 2B1AH 3BDXA 2IDCA 5JNYA 2VDNL 3V5HB 3LKSB 5DC2A 4PMFA 3E1F1 1OANA 2VDMH 1EEZA 3U1PA 4AQ1C 3DBSA 1Z3GH 1WRFA 2FH8A 1M05A 3HI1A 4R7NB 1IKNC 4I18A 2WYTA 3GWJA 4IIQB 4YHYB 2I07B 2WLHA 2CHXA 1FFOB 1HXKA 3EUUA 4PS7A 2GW5A 1UXLA 2X41A 4C56B 3GK8L 1EDQA 3GJFB 4K9EC 2NNRA 1I82A 1CURA 1MZYA 3WO3B 4UOW1 4AG4L 4YHOL 4CSTA 1CVSC 2FSEB 2IF7A 2R1YA 3IMSA 5I0XA 5LGHH 5K1JA 3QDAA 2JFCA 3D48R 4GYBA 2H8PB 4Z7QE 3BPOC 4PRIA 1BGXH 3EOBA 4X6BB 1U3YA 4EN3D 4LB8A 3QUXA 1G9NL 1H3WM 5BS0D 3MMEB 4K55A 3OAUL 1FZMB 1T1XB 4LCIL 1CFTB 4GAYA 1E4HA 4M00A 4R8WL 1GC1L 2ZG1A 1F4YH 3HHSA 2CCVA 4M62H 2BO0A 1FC1A 5IQMA 2ADJB 4RGMC 5I66B 1BQ5A 2JCCB 5F9AC 4UDUB 1A8JH 1T22B 3O4OC 5D1ZB 5FO9A 2GBUA 3CSGA 4BFNA 1C8QA 4BGDA 3BN3B 3WDJA 3T6QC 2Q76A 3AQYA 3P11L 4Q4IA 4GP4B 3CH1A 1S7RA 3WJMA 3EADA 1ACZA 2GCYA 3GZQA 3QB7C 2ODHA 3OHXB 1O6VA 2PWGA 4OD1H 2OTUB 1HHJB 1RAMA 4TVUA 5AQ0A 3PJLA 1F90H 3K8MA 3SDXA 4ATWA 3MLUH 3BGMB 5GS0D 5DRXB 3KLAB 1OIOA 3JVGC 1ZA6A 1YECL 5HJ3B 3K6IA 4QCIA 4HDIB 1F1AA 1V10A 2R1WA 2QHRL 1UGNA 1YQVL 3HMXA 3KWXA 4HKXB 4PWFA 4J27A 3C5ZB 4E68A 3ARPA 5AVRB 4IBSA 4PJ8A 3R0MA 4RX4D 1H8OA 3Q1SH 1P2CB 3MCKA 5CD3B 1CU4H 1HINL 2FK9A 3L6FA 1DQML 3RJQB 4X5RA 3IFOA 2Y7QB 4HZ1A 2CH8A 2EC8A 4AENB 4ZAKB 3D52A 4WKZA 5E5MA 1AGFA 3B83A 2ZUQB 2EYSB 3EO1A 4O2FB 3J2PA 4PJFE 1MVUB 3KPPB 1OL0A 2GJPA 1CLZH 3BKJL 3M86A 5DRNB 1Q1PA 3CMGA 4P2RB 1L7TL 4PV8B 4XX5A 5CLTA 1OARL 1A65A 4P46A 4Z7UB 4QRUB 5AYTA 1A25A 2DLHA 3DBXB 3WUZA 1ZJBA 5IJDC 4PRHD 3WYRA 2IAMD 3VXOA 5ERWA 2Q20A 1XGYL 4PJCF 4I5BA 4POUB 4JFOB 2VITB 4DPAX 5HHXH 1TG8A 1G7IB 3FCSB 1CXKA 1EK3A 1AD0B 1M4KA 1J05B 4QKTA 2ZSWB 4PVNA 2VN4A 1XD0A 3UTTA 4MB1A 4JRXA 3UPCA 5LGKA 3NJKA 5J5EA 4Y2LA 3L3KB 4FQQA 2NNAB 2Y7MA 4OCYL 5DXWA 4FNSA 5SWZA 4XVJL 4U1GB 5KVFL 3WIFA 3GRWA 3V6OE 2EDLA 1D9KD 1WTLA 3UO1L 3BHBB 4XPBH 3VFOB 1M71B 2H1XA 1KXVC 1MHEA 2PPFA 2IANE 5EH1A 4U6TA 4RA3A 1FFPB 1HHKA 1WZLA 2HKAA 2RGSA 4G3YH 3EYFB 4AEIL 2WLKA 2FO1A 2W8CA 4ZQKB 1Q72H 2YSTA 2XA8L 4GG6A 2R0WL 3DX8B 1FGVH 3A5VA 2IOIA 5AKTA 1FA4A 4FQLH 1S7QA 4JREC 3OR7B 1I8MB 2WUBL 2X6UA 2XN9A 4Y1AD 3BRDA 2JF1A 5GRJH 3ECUA 3A67L 4WHTB 2CIIA 4U3HA 2OSLA 3W0WB 4NHUB 3UEQA 1WIOA 5DD6A 4B0MB 3HRPA 1YEDB 1RZ7H 2P9RA 2VR3A 1MFMA 2YD8A 1I4FB 3GMOA 5EDXA 4EDWH 4PJEB 3QZNA 3AB0C 1F00I 4ENED 2KLSA 3GSNH 2ZYSA 2FWUA 5EORL 1JF1B 5CMAB 4ZMXA 4PD4J 3L3GA 3QDGB 1CR9H 4OW6A 3ELQA 1PAMA 3CVCA 1EAPB 4RH4A 1YY9C 2BP5M 3CLWA 5HY9B 3NQKA 1CBVH 2F15A 2EO7A 2VDLB 2CAKA 1HS6A 2XRAL 4AYGA 2ZXEB 3N42F 2WPGA 4QHLA 1MFCH 3GJEA 4XOBA 4GAJL 1JPFA 2RIKA 2Q86A 5BV7C 2AK4A 4NN6C 1NDTA 3S9DB 5INDA 3ROLA 3FH5A 1IGIH 1FH5H 1YNTF 2AS5M 3GXMA 3HI6H 1A3RL 1PY9A 1F1GA 3JVGA 3M88A 4Y19B 2O5ZL 3U4EA 1AVAA 4Y9BA 3HZKB 3ALXA 2YR3A 3RAJH 5HJDA 3PL6B 4E41E 3HJEA 2AAVA 1JGUH 5CLZA 4J3OC 3BPLB 4I9WD 5BQDA 5CCKH 4ZNEE 4HJ1A 4GKNA 1EBPA 3EJSA 2R8SL 3SDAA 3V8OA 3I9GL 3EFFB 4KZCA 1RUPL 5C0CE 3IDGA 4QOKB 5L7XL 4P5KB 2KHAA 1T0MB 2J1WA 4X5WA 3WMQA 1UATA 4HXBH 4HJ0D 3CJJA 4AZUA 4XWGH 1OTSD 3F5WA 3VWKB 4HIHA 3HMXL 2CK2A 4FZ8L 3RGVC 3VVVA 2XC8A 4YLQT 5AOIA 3O9WA 2AEQH 4N8PA 1IKFL 3WEOA 4XC1L 1EXUA 2D31A 4NZFA 4X7DC 3PAZA 4Z7WB 2EDKA 2L7JA 2QADD 3K2MC 1T03H 3T0BA 1N5YL 3A22A 3FPXA 2DWEA 3NJFA 1PBYA 3MNDA 1UGKA 4PJGA 4F80A 4FJZA 5EB9A 2A9CA 2BERA 3K7UA 5AUMA 5FA4B 4NXKA 4MMXB 2ENJA 2XV6B 2FL5B 3UDWC 2AANA 5FDWA 3NCMA 5DQDH 4JGJA 5JQ6H 3GMPA 3ZK0A 4KKLC 4S1QL 3VA2C 3HCVB 3LZRA 4HZLA 5IQ7L 1I7RA 4L9LC 4OV5B 5D2NC 4LPWA 2UVEA 3KWTA 1KNOB 4NQDA 5L4MA 3GBMH 4NAMA 1KGUA 1PX4A 1CO1A 5LCVH 4NKMA 4OFVA 1OB0A 5LAXA 1BFVH 2V8MA 1FAIH 4XX1E 3OMNB 1S9YB 3JWNG 1ZEAL 2FYVA 4YSPA 1NDMB 2Y07L 1PW3A 1ZHBB 1NGPH 2PNDA 3B5TA 5DJYB 2HTKC 2HRPL 2X9XA 4AIZA 4CU7A 3V9EA 3N43B 1R3IH 1B88A 3QDMB 3V5KA 4HEPA 2OCJA 5BRPA 3U9PL 4EN2A 5IOPB 2ZSVB 4MD4A 1A7NL 3GRWL 3UJIL 2B1AL 4PJIF 4KROB 1RIUH 5HGBB 3Q5OA 1A1NB 2JJTC 5CEZH 3DK0A 1W0WB 1XGPA 3C60C 4LCYB 3SKNA 2X6CA 2XOTA 4F33A 1YEJL 5EIVA 4XNZC 5C3TA 1ZRUA 1Z3GL 5EEVA 5MEQA 1CD9B 1BECA 1A66A 2DLIA 4DVBB 4WW2B 2WUCL 4BUGA 4LRIC 5FB8B 4H8PA 4BFGA 4UDTA 4X4ZA 1RPUA 4TKWA 4AGMA 1HVXA 2C1OA 2MTAA 1JF5A 1GSKA 2WIIB 4P2YA 5LN4A 1T66C 3GSNA 1ETJA 4OLUH 1BIIA 2VABB 2Q87A 2J8UF 1XR8B 1IX2A 4YL4A 3ZO0A 2DMCA 5K1NA 4GT7A 1NAMH 2VKXA 2XBDA 2Y1AA 4UU9A 3DIDA 4DQOL 3PPSA 3FQNB 2KZKA 2BLFA 1HKLH 5D2NE 2IAND 1U58B 4ZMOA 4NCC2 5ELIA 4HUNB 4BZYA 3NJHA 5T8IA 3MRIA 2I69A 2VDQB 4KY1H 3EYQD 1BQUA 2JK5B 1F4YL 5JXED 4M62L 3KS0H 5E6IC 2YPLD 2JIXD 5FAAA 4D0DB 2FWSA 4Q2ZB 4D7PA 3PFUA 4WWNA 5L2JA 3BX7C 3BVWA 4JFFD 2EXSA 4HETA 2Y5QA 2DQFB 4OFPA 4P4KC 1KT2A 4F7TB 2WQRA 4QMEA 1RZ8B 4GUOA 5T1LB 1EFXB 3WOVA 3NIDE 3IETA 2X89A 3O2DH 4JHWH 4MA8H 4YH6A 3RU8H 5I73C 2DM4A 1RURH 3PWPD 4OD1L 2PP7A 3H2PA 3NABH 3NSYA 2W59A 1F90L 3MLUL 4PBXA 3P4MA 2W07B 3NCFB 4WU7A 1HQRB 4APQC 3I6GB 3F7VA 5F7EH 2ZCHH 3RWFB 3DVNA 1XT5A 3D3VB 4HYTB 4QHUB 4AYBA 3C6LD 2GITB 4Q0XH 3H0TB 1PZ3A 3E1ZA 1FCCA 4AX3A 4XPAL 4DEUA 4FKEA 4H40A 2P8MB 3UTSE 1II4E 3D25A 4AK1A 1CU4L 2X4SB 2ZWLT 1SXSA 1NBYA 3AMKA 5F89B 1K4DA 3D2TA 5LHDA 3GUTB 2Z8WC 4ORGA 1F5WA 1INQB 3QEQA 3WY4A 1WWWX 2FTAA 2C9PA 4Z9KB 2C4FU 4NQTA 1QLEH 3Q2WA 2P4AB 4QO1B 5ACMA 3PAYA 1P6WA 4NUPA 4OZIB 4JLRB 1ODAA 3CFEA 2FLBT 1N3NA 3WG7B 3ARWA 5T1KA 3MKKA 2W81C 4ABUA 2EKSA 1LEKB 1J8SA 4U6VH 5TGBA 1BQKA 3DETD 5IG7A 2ED8A 5LCVA 3BZ4A 1EZUA 4S1DD 5EF2A 4LAQH 5AVUB 4AZ8B 1M2OA 2DKUA 2CHDA 4U1NB 1D6VH 1UXMA 5F9JB 3PQYD 3QHZH 3P4NA 4QHMB 5E8DH 3LEYH 1NCWH 1FE8H 4N2HA 1IFGA 1SLUA 4X6DF 2F9BT 1HH6A 2NX5E 5GZND 4GRLB 4GSRA 4RFOH 3ESVF 5E6RB 1BBJB 3JV5A 4RMBA 1HL4A 2FWOA 1SQMA 4GW4B 1F41A 3EDEA 2OMWB 4NKOB 1H3TA 1JZ4A 1CBJA 2JB5H 1INEH 4IGBC 3OF6A 3ECWA 3LRGA 4LCWB 4PBVC 3B2UC 3LSOB 4G3YL 3VG0H 3MRJB 2CD0A 1JP5A 3CVHB 1NBZA 1U3HD 4IBYA 4JDVB 4C83B 1XO8A 2DMBA 2KH2B 1RY7B 1E30A 1FGVL 3IDIA 3WHE0 2GIXA 3GM8A 4GP8B 3DV4B 4FQLL 4LMQI 1AKJA 1JCVA 4BQ8A 1B0IA 2E7CA 2PYFB 1G7PB 2W92A 4I48A 5GRJL 3RGBA 1DVTA 1YPZE 4CNIB 5FYJH 4L3EA 2OV0A 2X4TA 2D7OA 3PGDA 1NAMA 2VR7A 4HEMA 2Z91A 4NRYB 2L7UA 4TNVF 1RZ7L 4LCCC 2AJ3A 4IRJA 4BH8A 3EYSH 2ADGB 1IBHA 5E6IA 3IBEA 3CSYA 3VSTA 3GSNL 3VXQA 3O8XC 3V6FB 1RHHB 1NGWB 4P4KA 1EA9C 1CR9L 2XNAA 4E5XB 4XHQA 1CE6B 1LEIA 3GMNA 2BVPA 1CBVL 2OSXA 1CG9A 1RFDH 2X4QA 2V2WA 2C9XA 2OMXB 2UUDK 4LK4A 1DBMH 2JI3A 2N59A 1MFCL 1TQCB 1R24A 3ALPA 3QQ3A 3HN3A 3HG1B 1A21A 3QFDB 1TQTA 3AADB 2M1KA 2WMPA 5D2LE 1IGIL 1FH5L 4U1KA 3D6GA 3HI6L 2G60H 1F3DJ 3O2DA 3EJZD 4W68A 2K8QA 32C2B 4PRDA 3NZ8B 4Z8FH 3LQAC 1RZGB 3RAJL 4HJEA 1RK1A 4A7QA 1I85C 3IPFA 1EHLH 1N59A 1SJMA 1A7OH 1JGUL 4OBRA 3EHBB 3IDUA 2JLPA 4CSZA 5CCKL 1IKOP 2F2HA 3BFWA 4LZKA 4Z7VA 2EEFA 1AHKA 1FL6A 5BZXA 1KV7A 3HAEH 5KSVA 2J71A 3EGDB 4TLSA 3LQZA 3VXPA 2HLFC 4GI8A 3DVGB 4HXBL 1QHOA 1X5FA 2GT9B 1QSZA 5L0QC 1KF9B 4XWGL 4S1RH 1KC5H 1OCOB 1S9XB 4PREB 5CCHE 4NO2B 3D4GA 4OY9A 2D3LA 4N2LA 3KLKA 1Q9WA 4QXTA 4BCXA 2BS9A 2AQQA 3VG9C 4GO6B 3EKCA 4OF0A 2X42A 1THCA 4PD4K 4YBQD 4YPGA 1CXHA 3VFNA 1UD2A 2I9LB 4MMZB 4PJXA 1CICC 1T03L 4CKQA 1HE7A 3PHAA 3W9DB 5DC9B 4MBOA 3MV01 1C7SA 2VERA 2DI9A 4GKZA 1O5DT 3HI5H 3LAFA 4J3VA 4CJ0A 2GJJA 5IHLB 2KKQA 5FXCH 1IAII 4F7KA 5DQDL 2YMTA 2F0CA 5F44A 3MRNA 4RAUB 2R1XB 1G7HB 4RETB 1HH9B 3HN8A 3ZZ1A 2RH0A 4X8JA 1KPVA 4AYDC 4K4KA 4NERA 3SCMA 4PB0H 1BQSA 3QIUA 2OL3H 3GBML 5ILTH 1NLDL 3MFGB 4HLZH 5B4MD 5LCVL 3SBWC 4WV1B 1JFQH 1PZSA 1BFVL 1FAIL 1NC4D 4PW9A 4NUGH 3OJMB 2DBLH 4PWHA 1K3IA 3D33A 3GC3A 5B39A 1NGPL 2CCWA 3MBED 2G3XA 2AF2A 2AABH 3BSZL 1DL7H 3VXSB 4PY7A 4K5LA 5KYYA 1R3IL 3QIWD 4MCZB 3UP1A 4QHPA 1LE5A 5DLLA 2JE8A 4P2QA 4AY0A 2NUPA 3T4YB 1MI5E 1SLXA 2O4EA 1L6PA 5IJVA 3UGUA 3ARSA 2P44B 2XXFA 3K8LA 4MNQE 3DGGB 3FULA 3GEWB 5CEZL 2ZF8A 3UROR 1NFDA 2YS4A 4OQ1A 2XG4B 3CUPA 2MPVA 1MN4A 1L9QA 4LLYA 5C07B 3QI9D 5I15H 2EUWA 2XZQH 5HYJE 3MBXH 1VFOA 2UXTA 5GSRA 1R5WA 1QUPA 3KWWA 1MCOH 1FV1A 1AQDB 2AITA 3QUZD 5E5LA 5GZOA 5J8OA 5LJYH 1A4KA 3HLAB 2BW5A 4HGKC 3AWGA 3ZDZE 1MY7A 4IOSD 3CZNA 5DVPA 5I6KA 3DC0A 5KEZA 5ISZD 1MH5A 4OLUL 3BXNA 5AB1A 5AOJA 3RZWA 1R5VA 5AZ2H 4N2OA 2JKXA 4RWYH 2O6EA 1VERA 3DJSA 3H55A 1HKLL 1MRFH 3MUUA 3JWNE 4PV1C 3U0WL 2VC2H 1P0SE 4LF3A 3ARGC 2C3XA 4NGHH 1ZXKA 1J0JA 2YEVB 4ZOCA 3T2QA 2D9CA 2QHLA 3L45A 3OKKB 3VNYA 4KY1L 5DURD 3ZBMA 1LMKA 5BO1H 5IHZA 4KXZH 5ESVA 3RL1B 1OAQH 3ZKMC 1KTDB 1XGUB 3AWFA 1L0XA 2FR4A 1K85A 1YUHB 1DJWA 2YSSA 4KTGA 1OGPA 3IRCA 1IM9B 5TDNA 3D5OF 3AXHA 5C08E 4G7VH 4QRRE 4KX8A 2NTFA 3LPFA 2IQ9L 4ZW7A 2OMNA 2EDWA 5H4YA 2GAZB 2WWOA 3CSTA 4N8VG 3DUSB 4DAGH 2PCXA 3MNMA 2JELH 5JPNC 3O2DL 3RU8L 1XCTA 3WFCH 1CDGA 3BP6A 1UM6H 2BJMH 4FYRA 4WUUA 5D5MF 3HAEA 3PY9A 4PJ5D 4UM9D 5SX4H 5ID1A 5KUKA 5F1IB 2C3WA 5HGGS 1ZLDA 3PP4H 2F1AA 5F7EL 3E6FA 3E9TA 4QR7A 4PJBF 5FV1L 1IB5A 2ZPKH 5J6GB 4Q0XL 3RTQB 1AR2A 1CICA 3VXRA 1PYWA 2Y2YA 3QRLA 2C26A 4HF5H 3SO3C 3HA0A 3OR6A 4XWOD 3BP7B 1X5JA 2NW3B 5EG6C 2P45B 3WTUA 2IOMA 4C58B 4GLRH 4JM2C 2WCSA 1MCNA 4JS7A 1KB5H 1WO2A 3A3YB 1BOGB 3BEWB 4ZTPH 5C0AE 2L7EA 1M53A 4LVNC 3ZE2E 4ZMQA 3QWRA 2V2TA 2GJ6A 1KGCD 1MAJA 1QLEL 2ZWZA 3FFCD 4U7MA 2YXMA 2FYYB 2GEQA 4LEOA 3FQ4A 2CGRH 5FGRA 3DMMB 1YJDC 1I8UA 1AE6L 5AL8A 3LTVA 3RWJB 3HHRB 2OMTA 1X5ZA 4MDIB 3BQVA 3LXAA 3CFUA 1PKQA 1E5BA 2NTSP 5KAQG 3MUJA 1PG7L 3OLGA 4U6VL 4V1DA 1RZIB 4JO1H 5FO7B 2OL3A 3WELA 4M7LT 35C8H 3IJYA 4LAQL 4MCYB 4I0PC 3ZDWA 2CLVB 2NNFA 2P8LA 2VR8A 5LBVA 2IAMB 2BSTA 1EWHA 3AITA 3QHZL 2COQA 4R96B 5CR8A 3S36X 1LO5A 3AC0A 1S7UA 4XCCH 1UB6A 5E8DL 3LEYL 1NCWL 2NSQA 4QRBA 1F6LL 4LLWB 4AQEA 1H5BC 1MCJA 2DQTH 4GQ9H 4KO5A 4PTTA 3S5LB 3TC9A 3QUMB 3UBFA 3SY0A 2DKSA 6CGTA 3H53A 2JKJA 3JTSA 4RFOL 2NLJB 5E51A 3D09A 1P6AB 3NJLA 3QFJB 2WP3O 3WFZA 2DYPA 3Q44A 4HS3A 3WEXA 3VD3A 3BE1L 2VWEC 4OZGE 2CMRH 3B7UX 3PWVB 4AQ8C 3OGCA 3QNXA 1MQKL 1TR7A 3EYVB 2GK2A 1A4CA 3VG0L 1I3UA 2ZE0A 4QNPF 1ONQA 1HHGB 1ZVHA 4FFWC 2X53A 3F7PC 2BM3A 1F2QA 4EE2A 1N8ZA 2CBOA 3FSVA 1AGEA 4G7SB 4M4RB 2OULB 2WZ0A 4UV7H 4Z7NF 1U91A 1GGYA 4G9FB 4X7TB 4OF6A 3HC4H 3RRQA 1Z5HA 1F58H 4DCQB 5I1GH 1PEWA 4L4TD 1AYRA 5FYJL 1IARB 4FFZH 2XTJD 3ZE1B 4GIOA 5HBBA 5JW3H 1UEYA 1X6NA 1FNFA 1E9QA 3RLSA 2HLFD 4G8AC 3ME0A 3Q8AA 5I1LB 3OL2A 2QPEB 4JFTA 2VE6A 2A6DA 2P5WD 4PCTA 4BRJA 2WXPA 4X99B 4MNQD 1XH1A 1DLFL 4DOHE 3DUHA 3K2UH 1GH7A 1S7XB 3V9FA 1ZLVH 1I8KB 5HGAA 5I6PA 1DBML 2XWTA 4X9GA 3KXFD 2Y25A 2WLNA 4LT7A 3TT3L 1T20B 4PH8A 4XP1H 5IV2B 2DLTA 3RI5F 4FFVC 2J6WA 4PYGA 4FXGA 2H1LM 3DGDA 4R4BB 3VFVA 3QXWA 1TZHA 1NZRA 2QPUA 5ES4B 4Z8FL 2VXVL 4XBGB 3T0ED 1QFUH 1ZS8A 2ERJC 2NW2B 2VWEE 3LKRA 5H35A 2NDFA 2C7UB 2NQDA 3LRMA 5FYLD 2BSRB 4RGOH 3PGCB 1A7OL 1JI1A 1IAKA 4N2CA 4RGNC 4Y88A 4J2XA 3FRPG 4Q9RL 2DQHH 2NY0C 5I5MA 3VWJB 2AZAA 4LPCA 4PPTA 3QZWG 3NIFE 1PLBA 2QKIC 3SE3C 3FB6B 5I9QC 3IBOA 2WNWA 3TCTA 4NRZB 1KB5A 1Q9KB 1V3MA 4JN2A 5TF1H 1X7TA 1KC5L 3JBG7 4KJQC 2PPEA 1O9VA 5FUOL 3UBXA 5EU5B 3CC5B 2HN7A 3L9RA 5BVJA 4UOZA 1GOHA 4PWGA 3QH3B 4MWFB 2O5XH 1G1OA 2UZYB 4NOFA 3LVEA 4NX0A 3UTOA 1A6AA 2ZX7A 1U8IA 1WFUA 2FE0A 2HLAB 3U6RA 3VH8B 3NSFA 4M93B 1U4FA 4M29A 5TK2A 3EOAA 2P5EE 5D7JD 4A1RA 4JFEE 3I3DA 1T5WB 5MENE 2XSKA 3HI5L 1VGKA 3HS9A 3UG4A 5MERA 1UURA 4KRPD 5MEPB 1TZ8A 4WFFD 3DLQR 5C2BH 1RZQA 4U6YA 1I3RA 1I7ZA 1N10A 2OR9H 2AK1H 5FR3A 1IGFH 1JPGB 1P4LA 5C0BE 3LNIA 5HJBA 2ENQA 1NCTA 4PB0L 4ABVA 2OL3L 3K6DA 5ILTL 5KSUA 2WXLA 3U1SH 4Y4HD 3F3HA 4E0RA 2FT8A 5C0AD 1JFQL 2A74B 4HK3N 3WN5A 5D7EA 3CU1A 5DJDB 2OI9B 3GIVA 4PLOB 4NUGL 1AG6A 3VFRA 4ZFGL 1WWAX 4PJDE 4AQ8A 4RGNE 1MCQA 2DBLL 2EVIA 2E5EA 4C47A 4OUUA 3RNKA 2VMDA 1QKZH 2R29H 3ARVA 3OB8A 2IFFL 2UXVA 5IKCA 1DL7L 2FECL 3NFNB 2QV4A 4WJG3 2K6ZA 3STZB 5ICYA 3CFDB 4X4XB 4RSYA 3FUKA 2W65B 4XZUA 4QY8B 4F7EB 1RSFA 4ELDA 3ZTNH 3I6SA 3GJFH 3UAJC 1E40A 3BPNB 1IRAY 3LRLA 3QJFB 5D1XA 5JIHA 3V0GA 4P3WA 3B7SA 4OZHF 3DUUA 3BESR 4P57B 3SB3A 2XZQL 3MBXL 4U2YA 4FFZA 3MLTA 3VI4A 2EXYD 1MCOL 1SXAA 1AJ7H 2H2PD 4KXBA 2H3KA 3LZFH 1KPUB 3BEVB 4ICXA 4S10A 5G5DB 5IM7B 3C08H 5KSAC 3BP4A 1HNYA 2WWKO 3G6JB 4R0LC 1QRNE 3FO0L 3GPEA 3CH8A 5AZ2L 2H6PB 1F4HA 1EXGA 4RWYL 2KUTA 3BKYL 5CCGE 4POZC 5J11C 4ZFOB 3B9KD 4NUJB 3SQRA 2BVOA 2VC2L 3CHXA 4A38A 3H7BB 4NGHL 3EJPA 4PFEA 1QG3A 2EDOA 1SOSA 2IO5A 2NXZD 3CCHB 3V95A 1U9KA 1OAQL 2CDEA 1AQKH 1XB8A 4KTEL 1KGWA 5CJQL 4BXSV 1T2QH 2Z64C 4PRAB 1JAEA 4X6FB 1I53A 5F0PB 4FQHA 4G7VL 1A5FH 3ZYZA 4XOCA 2JIXB 4BSVA 3K6SA 4UOQA 1YG9A 3NEEA 4QIRA 3DO3A 5HDWA 4M6OH 5CSZA 3H42H 3QW9A 1EDYA 4DAGL 1FNSH 1OF2A 3ULUH 3SE3A 4I1NB 3KM2A 3OB0K 1QNZH 3WFCL 2E7LC 1ILUA 1UM6L 2BJML 2DEXX 3SDCD 1P1ZA 2DQDH 3UX9B 1K3ZA 4I0PD 4NP9A 3QORB 1MCPL 3PABA 1AFVH 5JIIA 1OGAD 2HFFB 2FJUB 3PP4L 4P99A 3TVMC 1FF5A 5PCYA 4CGTA 4OSUH 2CJUH 3LS4H 4LHUG 3PDOB 3I75B 5E8OA 5JTWA 5DVMA 5CCJA 4GRWE 4EAEA 1LK3H 1K8DA 1KG0A 4X8GA 1MCEA 1IBZA 3BQUD 4HF5L 1N5AA 2MQGA 2VLKB 2ZKHL 1WD9A 2VJXA 4QD2E 5ALBH 4HU8A 3ETBF 4MAYA 4Y4FB 4YDZA 4EIBA 1KB5L 3IGKA 1BA9A 1NGYB 4GO9A 4ZTPL 4E9VA 1T5XB 3Q2VA 4P5TB 1PIFA 2FNWA 4F91B 2XPGB 3PWUA 1Q4NX 3S96B 3AU1A 2CHWA 4KUCD 5LXGH 4QTHB 2CGRL 1MPAL 2CR0A 3EIFA 3L1OH 4QRPA 2GI7A 4ZYKA 5JPMC 1JMZA 1CD0A 4O2CA 1KLUA 4EZKA 4ONOA 2ICEB 2WO3B 2NZ1A 4NRXB 3FONA 5AWNH 1AH1A 4JKNA 4KAQH 1NL0H 2FEJA 4FQXB 4L3AA 2R2CA 4P8QA 4YBHA 2O93L 4Y5XB 3O3AA 4JO1L 4ZFFA 1BIHA 1U8LA 35C8L 3F7YB 2DWSA 2VLRE 2BNRE 3KGTA 1DVFB 3LKSA 3ZQXA 1T6BX 3CQQA 1FUNA 5SWSE 3O6LH 5ABDE 2NYYD 2R29A 4XCCL 3S4SA 1DANU 2WXHA 1MCKA 2FO8A 3VFSB 5BVPH 1VAHA 1QI4A 3IDMA 4JRYD 2G3NA 2DQTL 4GQ9L 3MBWB 4M1GH 1LNUB 3UAJA 4R7NA 4YSRA 4YE4H 1MCFA 2XN0A 1OEZW 3SYOA 4IIQA 1WZAA 2I07A 3MCLH 3QCTL 3AACA 3O3UN 2WWMD 4C56A 3GJFA 5KVFE 5I74C 2QGEA 4OT1H 3ZSTA 4NCC1 4G8GD 2CMRL 3FFOA 3LCYA 3I6LE 2LU7A 3K71B 3APDA 1DSFH 1WK0A 4MS8D 5D7IF 2YOCA 3F64A 3BMWA 1OW0C 4NS0A 1DQDH 2H3NA 3F6JA 2H8PA 4JANA 4K8RD 3RHWK 5CLYA 3OKDB 4X6BA 1D5MA 2AKRB 3AT9A 4O5LH 1NANI 1OF0A 3MMEA 4G6AD 1IC5L 4B3EA 1FZMA 1T1XA 1BBDH 1QBBA 2Y36H 4JKLA 1J5HA 1CFTA 1U3HB 4UV7L 4KXAA 4GIAA 3D4CA 4RSVA 1USQA 1AIFA 3HC4L 1QI5A 2E6QA 3QQDB 4IEFA 3V0DA 1F58L 3GSRB 5I1GL 5AVQB 1TQBB 2ADJA 4ZO6A 4FFZL 2VDLH 2JCCA 5D96B 4P2OC 4UDUA 2MH4A 1T22A 4S1SH 5CLXA 1BVOA 5JW3L 1MWOA 1WFJA 5D1ZA 5LNEA 4BH7A 1T89C 3UABA 4EI6B 1TUPA 4WO4C 5DHDA 3NFSH 3A4DA 2YGQA 2ATPA 3DSFH 2MQCA 3FU7B 3ABGA 5CGMA 1GTNA 2AVGA 3MVSA 2C9VA 2FJFB 4X6CF 5FWRA 4PRBB 4TSCH 1I1RA 2OTUA 1HHJA 2F7OA 3K2UL 3X1NA 3BGMA 5DRXA 3KLAA 8CGTA 5FV2A 1DEDA 4WW1B 5HJ3A 4B60A 25C8H 4L8SB 4HDIA 5D7LD 3QXVA 3E8UL 3VXMB 1E3ZA 5EUOE 1NEPA 4FTVD 3IRPX 3ULVD 4XP1L 3C5ZA 5IUSA 1FHNA 3DOIA 1PGRB 3JV0A 3TNNA 3N3EA 5E4IA 3UG3A 4RFNB 4MQ7B 1DVUA 4F92B 4PRPE 1N64H 1E27B 2ICES 1H0DB 2VLJD 2Y7QA 4RGOL 1RZKL 3O4LA 1VHPA 3H4HA 4UZUA 4ZAKA 4AENA 2D7NA 4FG4A 3GXUB 4P5MA 4L8CA 3FT4B 1VJSA 3AROA 3MRMB 4MJ2A 1TTAA 1E8YA 2DQHL 5C0JB 2EYSA 5GJTH 4O2FA 2NPLX 2V3EA 4H8UA 3WEAA 5DMKB 1MVUA 3KPPA 1AMXA 1MQ8A 4HOWA 3ZGHA 3ZRCC 3VFWB 2CKNA 4P2RA 1KBVA 1V05A 1G6RH 1F11A 3OXRA 5DA4A 4Z7UA 4QRUA 4UIKL 1TZIA 3PIQB 3FQXB 4JPVL 1MVYA 1KIRA 2IDUA 3J27A 2OYPA 4JFOA 3TU6A 5FFOA 4EZMA 3FCSA 5L2KB 1AD0A 1TPXC 2I5YH 1HXYB 4W4OC 1NUGA 1T0PB 1C08B 3H9ZA 5FA3B 3HS0B 2NNAA 3CIAA 2MNWA 3GXTA 1J0KA 4X4KA 3JT2A 2OR9L 2AK1L 3B9AA 3GMRB 3MRGA 2GTWB 3BHBA 1NCAL 3PNRB 1M71A 1UB5B 2EIJB 4DGWC 3VXTB 1JIBA 3JTTA 4YK4B 3M45A 2XTLA 5MI0C 3EYFA 4Z3JA 4JZJC 3AFLA 3ZYJA 1BM7A 1T5KA 3L3IB 5A1AA 3X11B 5BRZB 4K3DH 3LPGA 3BUIA 3U30B 4PMEA 4PN6A 2ZXAA 5FGBC 3OR7A 1ZS2A 2R29L 3ZMEA 1CFQB 5AVWB 4ODTH 1I8MA 1CQYA 3V79C 1PLGH 4XAWL 1IGCL 2J73A 2XVBA 2X9YA 2G3ZA 3W0WA 3MBEB 4NHUA 1NCNA 2B4CC 3DHUA 1YEDA 4L3CB 1PNDA 3UTQA 4P59H 1P4BH 3NN8B 2JKTM 3N1QC 1G7QB 2JSFA 4KRNA 2HUEA 2G5BA 2YFNA 4YBLC 3FC8A 1GW6A 2TSAA 1JF1A 1WAAA 5CMAA 3T77B 3QDGA 1EAPA 1HYSD 1WS7A 2YUWA 4IRSB 2BNQA 5HY9A 1D6EB 5C6WH 4HHAA 2PW2B 5DHXB 1AJ7L 4O4YH 1QEWB 4XR8C 5IBLC 3ARED 1KBPA 4JG1H 3TCLA 1HILB 3LZFL 2VDQH 2KPWA 2DTSA 1OGTB 3C08L 3K8KA 4PVLA 5J4MA 4WGWB 2YD0A 1U8QB 3U7YH 2ZQKA 3ZDXB 2YXWA 1BD2D 2I9TA 3B34A 5LBGA 1CD1B 1MG2C 3RWEB 2EH8H 4FG6D 3I6LD 4NP4H 3PL6A 5FW7A 3MLXH 1FC2D 4DFIA 4K5NA 1JTOA 2GYSA 2NY2C 5E99H 3P9MA 4CMMB 5D1QD 3G08B 1DYZA 2N1KA 2A6JB 1RKRA 2I25N 4XODA 5C0IB 3EFFA 4G43B 1T2QL 4QOKA 4DPRA 4P5KA 3DWTA 1T0MA 1NOAA 3KBFA 1EJOH 2DDQH 3BYTA 4N90D 4HMDA 4HKZB 1A5FL 5F7HA 4Z78B 4UQ2A 3ECVA 4NQVB 3I9AA 1QYGL 5HHME 4YAQB 2ZUVA 1TJGH 4PJFF 1AHWC 1LK2B 3BPCB 4M6OL 4NN5B 3H42L 2VMEA 1AO7E 1FNSL 3GLDA 3ULUL 5DTFA 1HEZB 3O81A 1OQOA 4LVHB 4Z7WA 4JO5A 5E6ZA 4AXWB 3QJSB 5I6OA 5DJXB 3H9SB 1AFVL 4A7UA 3HN5A 4JPKH 5HVWA 4LPYA 3L81A 1G6RA 3HG0A 4PJ9C 2CJUL 3LS4L 5FA4A 1E8ZA 2Z35B 1LK3L 2FL5A 1HYRC 3IU4L 3OXSA 4FXKA 4HA1A 1YRKA 4KOBA 4M5TA 4XB8A 5KVGH 4DP5X 3QUXD 5T3XH 1UWGH 2PLTA 1TETH 3RPKA 5AB9A 5ALBL 2APFA 2WVVB 3LD8C 2BP0A 3P69A 4OV5A 2VXTL 3HR5B 3F58L 3MJGX 2AJSH 1BJ1J 1NKRA 4HD5A 3D39E 1KNOA 5I16B 1NSNH 3NK3A 5F7BA 3CLEH 3MRBB 3KLHD 1U0QA 4HMCA 3H2WA 2CJ3A 3OWEA 3L1OL 1XGTB 1S9YA 2JJVA 3ASWA 1ZHBA 3O6MH 5E4EC 3KZ8A 1NINA 2VDKB 5AWNL 4U7KA 4KAQL 4MYPA 1NL0L 2G9KA 4FI6A 5DZVA 1HWHB 1FJ1B 1JDAA 2GG1A 2EACA 2Y22A 5HYQB 5IUCA 1BMZA 1KUMA 5IMMB 5IOPA 2ZSVA 1WFIA 4ZDHB 4FLQA 2BOBB 4OD3H 5HGBA 3G5VB 1PD1A 1A1NA 3HS8A 2BFVH 4QTIH 5EO0A 3QUYB 1ET7A 1P53A 1W0WA 1HJBC 4OI7A 4LCYA 3O6LL 4IKLA 1IO4C 4NN7C 3KBHE 1AO7A 1JS4A 1TVHB 3IGAB 4PJ8D 1DDHA 3V0JA 5BVPL 4BFBD 5JW4Q 2XFGB 2CPCA 2UWEE 3CVHH 2PYEB 2VR9A 4G6MH 4M1GL 5IESH 5DZJA 3T04D 4DVBA 5MEOA 4YE4L 3QJHA 1R4XA 4W1TA 3SKMB 3WS3B 3MOAH 1QFWH 4M02A 2LU5A 5FB8A 3MCLL 5CFAA 5ITBH 3T6VA 4MS6A 2MJWA 3F00A 1H3PL 4NO5B 1LDSA 3K6NA 4MZ2A 1A3QA 2WIIA 1URIA 4OZ4B 1DSFL 2VABA 1YEFH 2Y1VA 1XR8A 4WHYG 1DQDL 2WVUA 4FYTA 4F9PA 3FQNA 3KE0A 5F3FA 2QDWA 5BXFB 1KZYA 2YA2A 4AUYA 3G5XB 4JKPH 1TQWA 4U1HB 1LO0H 4P46D 1FHGA 2ZXQA 4MB3A 1BBDL 1QLRA 2Y36L 4LVOC 3FN9A 4G5ZL 2O5NA 5AVXB 2JK5A 1LD9B 5IVXF 1J1OH 3MUGB 4ILDA 4D0DA 3CFJA 1A6VH 2VDLL 2HTLD 4UF7C 1G43A 1SFHA 4MNGB 4G83A 4S1SL 1SHXA 3IS1X 1MXGA 4GBXC 1D5BA 4X5LA 1VZIA 2A6KB 3RYMA 4YX2H 3RVXC 4IU3B 4F7TA 3UTTD 4JRXD 1NGZA 3VRIB 1VFMA 2JKSA 3NFSL 3QPQD 1EFXA 5IREA 4NZDA 4KKCC 5INCB 3DTDA 5SWZD 3S3DB 5C09E 4PGJA 4TSCL 2K70A 1E4KC 3OC8A 2V9TA 4M7LH 1L9PA 4W6WB 2W07A 2FB4H 4GO8A 4GS7B 4MGXA 1ZTXL 1N6QL 3T8XB 2I24N 5I8KH 1JV5B 25C8L 4ACPA 3RWFA 1CGSH 3N2JA 1PIGA 1BAFH 4QHUA 1ZTMA 2GITA 1SF5A 4QWWC 3TH3T 3VGFA 3H0TA 4BK5A 4FA7B 1KIQB 3P0VH 1T4KB 1XQ4A 4UT6H 1NIDA 3NCXA 4KJWD 2OR7A 4IMLB 5DZPA 1P84J 2P8MA 2X4SA 1JRHL 3KD4A 1N64L 5CSBA 3NIGF 4PLKD 5F89A 5TDOB 4ZUTA 4L0PB 1INQA 4XNYL 5T3ZH 2BVQB 3PFQA 2JV6A 2NSXA 1N8OE 3DTUB 1OPOA 2GY5A 2BP3A 3FB8A 5AOZA 5J6HA 1QUNB 1LP9B 4TSBL 4OZIA 5GGUB 2VXSH 4F8NA 4Z77B 4J28A 5E8NB 3F83A 4D8OA 3BVVA 1U8HB 1SGKA 4DH2A 1QNIA 3CSPA 2YD4A 1KB3A 5J13B 5FF6B 3CWGA 3VD9A 4J3OF 5E9DE 1LEKA 3UTZA 3FCGA 1ZGLA 3TM6A 2W1NA 3CFMA 4DGUA 5J1AB 1W15A 4AZ8A 3NCJH 4U1NA 2QVTA 3FQTB 3DKHA 2QSCH 1P5UC 5F9JA 4F37K 1FNLA 5KVDL 4CC1A 2AK4D 4P05A 3FCBA 1PFCA 1TQSA 3K2KA 3QDJE 4Y16A 2X6MA 3HC0B 5DFVD 4K3GA 1BQRA 3S37H 2EICA 2VUYA 1HEHC 2GY7B 4MQXC 4M8VA 3L3OB 5DZ9A 4LLUA 1ML0A 2MKLC 2OMUB 4HIJB 4ODSH 1BBJA 5IQ9B 1HFUA 4OF3A 4KRPB 2ED6A 4F8OA 4GW4A 4U6XB 4U1IA 1MCCA 4H88H 2OMWA 4NKOA 3LN4B 3SDAD 5CN3A 5IK3B 1CYWA 1B0WA 1ZVSB 3LSOA 1PCXA 5EO9B 3VI3B 3MRJA 3NCWA 3VXUA 3CVHA 2PPAA 4JDVA 4QDGA 5GRXG 2JKNA 4QRTA 1YN6B 1IJNA 4Y4HB 3WTSA 2X2JA 4N2KA 3O9WD 2PYFA 4ODTL 1PLGL 1R9FA 4CNIA 1IQDB 5JW5B 4N3UA 2ALWA 2WY3B 4R3SB 4UINH 5EU6A 1FYTA 2VW7A 5L88H 1EIBA 4HWBH 4M6MH 3B2VL 1CGUA 4GKSA 4NRYA 1JXDA 3S3SA 4B5ZA 3KPNB 5LNDA 4P59L 2QGBA 2WQUA 3BH8B 1P4BL 1THAA 3HKZA 2ADGA 3OV6A 4NQEB 1PDKB 2IALA 1GYVA 1ASPA 1A2YA 1ZD6A 3CE1A 2WGNB 5AEAA 1MCIA 2AJZB 4Y2DC 3QG6B 5BPPA 2DYRB 4R2GC 3V6FA 5C92A 1RHHA 1ORQB 1NGWA 1DQQA 1CE6A 4LHUD 4ZI8A 3KPRB 1H19A 2EDHA 2XUWA 3MJWA 4ORZC 4BWWA 1YNLH 1FBIH 3S3JA 5FFLA 4O4YL 2ADIB 2HG0A 4JG1L 4YOKA 4NQDD 2OX5A 2VDQL 2K4WA 3HRZC 3HG1A 3QFDA 4HBCH 3VGHA 4ELMF 3N1MC 1JGVL 4EMZA 1YEIH 1UKTA 2WNXA 4Z3TA 4DGVL 2I26N 4F2ME 2X12A 1C16B 3U7YL 3GSQB 1H3XA 5K59E 32C2A 3NZ8A 2EH8L 1RZGA 3I9PA 3PYCA 4MHHI 1CD8A 4NP4L 1QA9B 2MNJB 3GS0A 4JHUA 3MLXL 3ULAB 2X38A 3DVFA 1WD8A 3V55A 3UYRH 1DSWA 5KG9A 3HB3B 4TOYH 4DETA 4N2DA 5HDBF 3SJVA 1DLHB 4KNSA 3CD4A 4UT6A 4MLIA 3EGDA 1EJOL 2DDQL 3MZGB 5KS9E 3BKMH 4M7ZB 5GRUL 2VR5A 3HE6B 3KW7A 1UC6A 4WI4A 3X17A 3L5HA 3G6AB 3L5IA 4TMPA 1S9XA 2AXGB 1RZFH 1ZV5A 3FO2B 4NQCE 4OFKA 4PREA 4NO2A 1HC1A 2ICWI 1T1YA 5CILH 2Z31D 4HS6B 4BDVB 4KRLB 4QXWA 4ZXBB 1TO5A 5I8CB 2NY7H 2KDGA 3BWUC 1YDPB 2I9LA 2J1XA 4MMZA 5C09D 4ELKB 3W9DA 4TRPH 1QTYT 2CUIA 3P02A 1YQ2A 4JPKL 4HBQA 1AR1C 5FHAH 3V0WL 2PO6B 3SPVB 4LE8A 5HVHB 3FTSA 1Y0LB 1JZEA 1FG2B 1OGAB 3RWIB 4HOZA 1CTNA 4FL4C 4PW3A 5KVGL 2HFGH 2JQMA 4CC4A 1V55B 1TETL 4RAUA 2R1XA 1G7HA 1SJHB 5FYKU 2IBGA 3BAJA 2Y06L 1S5IH 2WQWA 3WKMH 3VDBA 3UJTH 1RQ5A 2J12B 3V6ZA 1H9DA 3VE0B 1NSNL 4N28A 1DQTA 2FNBA 3CZFB 4IJ3B 4ZFQA 3CLEL 2QR0A 2PP9A 4DPBX 1NCUA 1CIDA 3T2NH 1X5KA 1OE2A 3GPSA 3L1EA 1E67A 5J57B 2QQNH 5I1DB 1H8NA 3O6ML 5F7WC 1MFAL 2E6JA 2X89D 4ZFZB 1NAKH 4RDBA 3VXSA 1I8LA 2AAAA 3U7AA 3ISRA 1MHHB 1NCGA 1KFAH 3QUMH 2OCFD 1PAZA 3AS1A 3C6SB 1GZPB 2R4SH 3K74B 4MCZA 4OTXH 5C70A 2EVFA 5FECB 3APFA 3GHEH 2X4OB 2Z0UA 3HVDA 1J48A 5DQ9B 3MV7E 5E00B 3OKMB 2H1PL 2PABA 1NBVL 2F5AH 2SEBB 1NPJA 4KK6C 5T33H 4JFDB 3CVHL 2YUXA 4G6ML 3BI9X 4PWIA 5IESL 5J1SC 2J1ZA 3X13B 4AE1A 4HWBA 3MOAL 1QFWL 5K1VA 1WBZB 1ZXQA 2H2SD 4PG9B 3EO9H 3RJOA 3UMTA 3HLAA 4ZG1A 3DXAE 1YUKB 1QBMH 2ZUUA 4GFXA 3QEQD 4GQPH 1WEJL 1IE5A 2HJFA 3RUGB 5DO8A 4YHPB 1YEFL 4A7GF 1TTGA 5LXVA 3QAQA 5TQ2L 3IWVA 5BW7C 3AY4C 2HH0H 3HRZA 3BAKA 1LYQA 5D2LF 5I18L 4JKPL 5I1JH 1JNLH 3ARQA 5T1KD 5AW1B 4HIEA 5D7HA 1XF4B 1B0RA 5JOFA 1J1OL 1FVEB 2QFPA 3HR6A 3RL1A 1FNGA 4EKXA 1KTDA 3RWHB 1XGUA 3ROOB 2HA1A 2FJGB 1YUHA 1IM9A 5JOEA 1ZGLM 1XEDA 4UBDC 4YX2L 1M7DB 3OKLB 1CF8H 2WK2A 1WZMA 2GAZA 3Q05A 4OGZA 1NGXB 4BCYA 3NPSB 3DUSA 4U3SB 2WZPA 2Y1YA 1TFPA 3FBKA 4GH7B 3I50L 4EI5B 4POYA 2CJSA 2MKWA 3VGAC 3KYMB 4N0YH 5F1IA 1B3JA 3EJRA 3S5YA 2FB4L 2YK1H 3WFHA 4ANXA 5CEZD 1DBBH 2DIBA 3R06B 5I8KL 4A2DA 3SDDC 1EANA 1NWPA 3OF6D 2ZWNA 1VKXA 5J6GA 1BAFL 4P3DB 3RTQA 5IB3B 1QFPA 2ITEA 4UT6L 2NY4D 4CRPA 4UT9H 3ET9F 3BP7A 4KQ0A 4Z23A 1AKJD 1U8NB 5F7YC 3GJFK 4LP4A 1BOGA 4CVWA 4PJHE 4Z7OF 1UD8A 5EHFA 1JG9A 4LFHG 4ZUSB 4DP1X 4JFXB 3O6FB 1NC2A 2GUOA 4L3ED 4WI3A 5EIQA 1D2PA 4YPJA 5T3ZL 4IBZA 1UT2A 4XXCA 5FS5A 2XJKA 5IB2B 1UQSB 1SOXA 3CHQA 2FYYA 4GUPA 1NCCL 3L2NA 4IRJD 2VXSL 3DMMA 2IXQB 3L7FA 4H1LG 5HHOB 5D7KD 4KY2A 4HD9A 1OE3A 3GO1H 3UL4A 1DTUA 3SPJA 3FQWB 4FQ2H 4HCRH 4UM8B 3U46B 3X1FA 3GS7A 3QNZB 4H0HB 4PJAE 1RZIA 3IS0X 3KDMB 1FORL 2GBTA 5FO7A 3SE8L 2D3JA 2F53E 2JJSC 3ABLB 1G9EA 3IMBA 4FYQA 1A14H 1M1XA 4XGZB 4MCYA 2CLVA 4HIIB 4PYHA 1KXQA 1OQXA 4K7FB 2WP3T 2QSCL 4ZBJA 1NDGB 4MA1C 4U05A 1PEZA 3HUJF 2B3RA 2ZAHA 4PCYA 4KI5D 4H8WC 4PLNC 4HJGB 4A63A 3EFOB 1FN4B 4LLWA 2QQLH 2NR6C 3QUMA 4S0SD 4LKXA 3VRJB 4YSCA 4PVMA 2LR4A 2AEPL 1S7TA 1KIUB 2NLJA 2Q1EA 3OWRA 4BQBA 3KJ6H 3QFJA 2XIIA 5J0BA 1BHGA 5GS2H 4QAMB 1P84K 1SFDA 4MJ5A 2DD8H 3MV8E 3PWVA 1KPRB 4ESKA 4FAAB 3KJ4C 5IB4A 2D3NA 1LO3H 2X9ZA 4HJJH 2VXQH 3ZDZF 4Z6AT 1HHGA 3OKEA 3CFKB 2PWEA 1XEUA 4GY4A 4N85A 3TV8A 3NSJA 5B8CA 4FF9A 4M4RA 1IGML 1QATA 2IPTH 3DX1A 3M7FB 4QXVA 3RVUC 2XTSA 3D0AA 5D93C 4G9FA 2J88H 4DKFH 4X7TA 4I1PA 4JDZB 2DEYX 5BMFH 3II3A 3MPCA 4DCQA 1KBBA 4WWKB 8FABA 3D0VB 4UINL 3W11D 3B2PA 3ZPDA 2YEZA 5L88L 4HWBL 2E7MA 1I1AC 12E8H 2JMRA 3ZDYB 4G1MB 5I1LA 3VGDA 5A3IC 2HSIA 3L5XL 2ZAGA 5E4AA 3LN5B 3MV7D 4HV8A 3OAZH 4KKAC 4X99A 2B0SH 1I1FB 4OJFH 2CDFB 2RCSH 3R0NA 5A2KH 2DKMA 2NT0A 5IQOA 1S7XA 2ESVE 4MJIE 4DKEL 5I6XC 3PXHA 1I8KA 2LT9A 4TTDD 4ZT1A 1WHOA 1KCSH 1JZDC 1YNLL 1FBIL 3DV6B 3D34A 3DJRA 1EGJH 1CMOA 3GB7A 3SCMD 1JHLH 3QIUD 4XC3H 1H3UA 1OSZB 1BEYL 4ZX3A 4HBCL 4CDHA 3ZUNC 5IV2A 3CHPA 1YEIL 2IV9A 3H8NA 3IMWA 1M7UA 3AREB 4XCYB 4LSDA 3EJQA 4R4BA 5KSBF 4FEIA 4N5UA 1X7SA 1KCWA 4P23D 4XBGA 2NW2A 3FQYA 3L54A 1Q94B 2BSRA 5F7AA 2D7QA 3O3DB 5JHDE 1P1VA 4LRNH 3MV8A 3PGCA 1MCHA 5DMIH 1TDQA 1GL4B 4PJCE 1OE1A 5IJKA 2J56A 4FQPA 4P2QD 3OPZH 3VWJA 3F05A 4DZBB 3UAAA 4UT9A 2V7HB 3RL2B 3OX8A 3BKML 4XVSH 3FB6A 3TLRA 4AW7A 4WI2A 4JO4H 4NRZA 4TS6A 1Q9KA 4XN4A 4J1UB 3OKNB 5D9SA 7CGTA 1H8LA 5EU5A 4AK2A 5FEBA 1J8HB 3NGBC 4LBAA 3QH3A 5FYJD 4MWFA 2XYBA 2Y69B 4K23H 3OG6B 4ADIA 1YMMB 2UZYA 5GZOD 4Y4KB 2NY7L 3GTTA 1M05B 3PP3K 4WHDA 3FB5B 3VH8A 3SZ6A 4TRPL 4I18B 4UOJA 3VFTB 5FHAL 4NENB 5LO7A 1RJZA 1T5WA 4I4WB 4HCRA 5AKVA 3LVTA 4OCXL 5MEPA 2V0AA 1BOYA 1EO8H 3F6LA 1G9MC 5KJ7E 1BQHA 2F54B 3OMZA 1AZCA 2MOQA 2HFGL 4PJ7F 4F2EA 1J9SA 2R1YB 7FABH 4UILH 4A39A 4XP9H 2RA1A 3FQUB 3KYNB 5K9QI 1E5YA 4F24A 4PRIB 1J9TA 1JPGA 2LFGA 3MRDA 4YDNA 1U8CB 4JVWA 5EOQL 3SYPA 3UJTL 4DO4A 1MDAA 4YGVB 2BZDA 2FECI 3ARFB 3RGHA 5T1MB 3T2NL 3HHSB 3ZUCA 2A74A 1KEML 1RV6X 5DJDA 4OZGF 2R0KH 2Y7NA 4AKQA 5FPIA 3X3FH 1BFOB 1MFUA 5ENWB 4X0KB 1UYWH 2QQNL 5KANG 4X5XA 2ROXA 3G6DH 4F5CA 4HS8H 1LHZA 5FO9B 2F58H 5C7ZA 4DGYH 2X0UA 3T3MB 4WUUD 2X4RB 3NFNA 3CH1B 1KFAL 3IDYB 3QUML 4OTXL 2OCCB 4Q6YA 3STZA 2R4SL 4WSJA 4BCZA 3CFDA 2GCYB 4X4XA 3GHEL 2VMFA 2VXQA 2W65A 4QY8A 1ZAGA 4F7EA 4RCAA 2PXYB 1F42A 3BZFA 4IU2B 3GZKA 3SDXB 3Q2CA 5I76B 4MKTA 1ZE3H 1BZOA 2YUVA 1JYNA 2WWKT 4Q4EA 5DR5H 3CZUB 3VXRD 2PWDA 2EIKB 4P57A 5G2NA 1CK0H 2LV4A 4W9EC 4NCDA 1I1AA 5T33L 1NOLA 1X5IA 3RFZB 3KVPA 2IEPA 2WKOF 4H0IA 5DYFA 4Z76B 4KK8D 5JHBA 1WLHA 1Y1DA 3EO9L 3IF1B 4Y5YC 1HWGB 5IM7A 2XIBA 1YAIA 3T3PF 2GJ6D 3IFOB 1S3KH 4KXZI 5F2FA 1G94A 3JWDH 4WKZB 2H6PA 5E5MB 2DQGH 4NC2B 1AGFB 4ICWA 4TVPH 2H41A 3RVTD 1FZOB 5I8OH 5FUZL 3EO1B 3CVIL 3ETBJ 4PS4L 1KYDA 3ATBA 1UXWB 3NA9L 4Z7QB 5I1JL 1JNLL 2WTRB 3H7BA 4MCMA 4JFWA 1EGJA 2AERT 4V1DD 1X5MA 1HSBB 2D7PA 3CCHA 4JJ5B 2V33A 4UT7H 5DFTA 2A7BA 1PSKH 3ULSA 4R7LA 1I75A 4XNMB 4OCMC 1ZT7A 2VZUA 1U36A 5CINH 4PRAA 5ESQB 2AXFB 3ABKB 4KUCF 4NKIH 4NM8H 5BOPA 4X4ME 5IVZB 5ERWB 1FSKC 4I5BB 1CF8L 1BAWA 1WIUA 3NIFF 2WJ7A 1YY8A 3ZY7A 3NCYP 4L37B 5L6YL 5C86A 1FAKT 3TJEH 3LZNA 3OHMB 5BZWB 1OP5H 5SV4A 2YQ2A 4N0YL 2BY2A 5ACZB 3QORA 2DYPD 5SWZB 2YK1L 4AV0A 5LLIC 4RA0C 4ISVA 3WIFB 2HFFA 1DBBL 3FUNA 1SVBA 4WSGA 3TF4A 2F61A 1P9MC 3FUEA 3N0PB 3QZPA 3UBXI 4AQ1B 3PDOA 1Q8MA 1J87A 3VGBA 3NJXA 3FH7A 5ABAA 4YXKH 4ZSOE 2VDMB 1JVLA 4UT9L 2JLLA 1WS8A 3UC2A 1GYWA 2VLKA 4B7IA 2VXUH 1Z9NA 4A67A 5CNHA 4Y4FA 5DD1L 1NGYA 5DUMH 5KOVC 3WN6A 4GG6B 2XVKA 4AVIA 4HPHA 1Z3RA 1A64A 3ARDC 4P5TA 2B9AA 4JFHD 5BOJA 2XN9B 2XPGA 1HTYA 2WBXA 3S96A 3BPOB 5TD4A 4ZO8A 2B15A 2GBAA 4L1TA 2GJZA 3AMLA 3NPZB 1AZRA 2ICEA 4GNKB 1E65A 1QP1A 4XP4H 3RQ3A 3GEFA 1XSJA 1Z0MA 2JI2A 4LU5H 3GO1L 4FQXA 4FQ2L 1MCLA 4Y5XA 4PJDF 5EEYA 4I2XE 4JY5L 4RGMB 5IF0B 1WC7B 4PB9L 1A14L 2BMKA 3O4OB 1DVFA 3DJ9A 3CBRA 3UP6A 3SO5A 5TE6H 2JQAA 4M6AA 3CX2A 1JZ8A 3WD5H 4EUPB 5IW1B 5I6MA 1P7KB 3TWCH 4QHLB 3VFSA 1EHAA 1FVDB 3U4AA 4KKAD 4L5FE 4BSJA 2AK4B 4FQCH 1LNUA 3ROLB 2ZOLB 1AACA 4YSOA 3EFDH 4RESB 2AQRA 4YDLC 4LIQL 2OP4H 3KJ6L 5E1HB 4KJPD 1P5VB 3DRTB 3HE7C 2NY1C 2DD8L 2G9HA 4OJCA 3AT0A 5EU7C 5JLZB 2CBMA 2X1XR 4QRSB 3H56A 1P7QB 1LO3L 4HJJL 5EO1A 4J23A 2VXQL 2N7SA 3TFKD 5DS1A 3OKDA 1RK7A 3C5XA 2AKRA 2BW4A 2HT3D 2FEDC 2BZ7A 4JFSA 5K9OA 3CDFA 4X5WB 3S35H 3ILQD 1OP3H 5TQ0H 3OHXC 4G82A 4DKFL 1BF5A 3VD0A 4PHZA 3UC0H 3NOIA 4P3CH 5BMFL 1BF8A 4EIGB 3BT2L 3OZKA 1N12A 1S7WA 3GSRA 1L5GA 4PJIA 4M6NH 1MW2A 5B22A 3O9WB 4WTZA 5DRWB 4GJTB 1Z9LA 4MSWA 4MXWH 4N24A 4TPRH 3GLAA 1M56B 2K78A 12E8L 5KBNC 1PLAA 1E42A 3IJEB 5FK9A 5DCCA 1UCBH 4GXVH 4J3BA 2MSPA 1DJXA 1IC1A 2DWEB 4W9FC 2ATAA 1XGZA 1JYVA 4JNXA 2FJFA 2ZTBA 2B0SL 4OJFL 4PRBA 4B5EA 2RCSL 5AUMB 3NJJA 5BQ7B 3JYBA 1E9OB 4JHBA 4ZFOL 4W70A 3PWLB 1T80A 5AALA 2ZX5A 3AT8A 3BUYA 3FS9A 4WW1A 1GKOA 1EGJL 2VQUA 5DZNA 4DJMA 3GSXA 1JHLL 3FRUA 4L8SA 4XC3L 2J8UA 3VXMA 1QI3A 2L0DA 2R2BA 1I7RB 4LEXH 3SKJH 3E6HB 1VACB 3R4RA 3RI5K 3H3KA 1FRGL 1IAIH 4OGAD 3F12B 5EU7E 4GRWF 5LAXB 1E27A 4WFGD 2WZ6A 4E41B 3NVQA 4LRNL 5JOPE 4UNVA 3QG7H 5HI5C 3B7TA 5FM5O 1GXEA 5DMIL 2ISDA 5IIEA 1IBFA 3KG5A 3MRMA 1SMAA 4DGIH 5C6TL 1S78D 2YD1A 3IDJA 5DMKA 3CHRA 5F7LB 5EULV 4KO9A 1XH3A 5C0CB 1HCVA 5D1XD 3VFWA 4JREB 4CU8A 4JO4L 4NJ9L 3KWUA 1XSOA 4BM7A 5EIIG 5D4IA 4LCUA 1XVSA 4AIOA 2VTFA 2AMGA 3W56A 3S3BB 1XGPB 3D50A 2EE6A 4FG0A 3FTWA 4JO3H 3FQXA 4B7LA 5HTSA 2UY6A 3TA3C 3T6ZA 4K23L 4U1LA 1UENA 4DVRH 4YO0B 3AB0B 5L2KA 2WYHA 4R4FH 2LU4A 3Q3GA 1LJMA 3RY6C 4Z5RA 2Y7SA 4RBPH 1HXYA 1O7SA 2OZNA 1EO8L 3BH9B 4G42B 5CP7A 4CN1A 3ZMNA 7FABL 4UILL 4OCLC 2BSBA 3GMRA 3LKOA 4XP9L 2VDKH 3ILDA 4ZTOL 1N7MH 1W0YT 5BV7B 1UB5A 4NN6B 3VXTA 3NESA 2Z93B 3R4DA 3HOGA 1MW1A 1U42A 3ZR6A 6TAAA 2E7BA 1M2VA 3QVAA 5DGQA 1A1OA 3RDTC 2OW7A 4I7ZC 5ANMA 3GBNH 4YQXL 2N7AA 3WNIA 4ZMZA 3X11A 2BXYA 5BRZA 4RQQB 1UYWL 4EBQH 3T2LA 4LLAA 1N2RB 3ZTJG 4XRCA 1M57B 3G6DL 4PTUA 1XIWC 3ARZA 1E3FA 4HS8L 1CFQA 3P2DA 4DT2A 4D94A 4YDKH 2F58L 2V17H 4DGYL 2DTMH 3AJ7A 5FW8A 3WNOA 2X5PA 3LXUX 1Z9SB 4I85A 4K5PA 2WBJA 3IETB 4G7QB 4L8DB 3WS6C 2A0LD 2LABA 1K8IB 1QBLH 4L3CA 2PCPB 3ARBC 2EZ0C 4UWQB 3NN8A 4E5XG 1B0GB 3RGVB 4X6DA 3ZHFA 4WU7B 4PGBB 1SDAB 3DHPA 5DR5L 3F7VB 3ZTDC 5CJOH 4B9CA 1CK0L 4YZWA 3T77A 3TBYA 4LQ1A 4IRSA 4YC2C 1RUQL 5CD5C 3LXCA 5KJ4A 2IDQA 4MAYD 2PW2A 1Q90A 2HT4D 5HPOA 4L8BA 2RQEA 2MOVA 2EKJA 3PWJB 1QEWA 4UQAA 4DWHA 5DS8A 4BEIA 2FH6A 4UV4L 3ZE0F 4MAZA 3W39B 3D25B 3SQBB 4EOWL 1OZUA 3EJYC 3L1FA 2W38A 2VLME 2NRDA 3RVWD 3VD5A 3JWDL 3GGWB 2Q3ZA 3QEQB 1CD1A 2ICWB 4QRPD 4LFHD 5FKPA 2AZUA 5EUOF 2CO2A 4TVPL 3RWEA 2FZ3B 1MCRA 5I8OL 1AG0A 1F2XK 1IFHH 4L9LB 3VWKC 2AJVL 2XQ0A 1HOCB 1HZHH 5B1BB 2NY6D 1SEBB 2GBVA 3QARA 3BN9C 2BIPA 4M5YH 4UT7L 1PFOA 2A6JA 3QIBC 5JA9A 1N3NB 4ZO7A 5DHMC 4G43A 5E1AB 4IHBA 5K39A 3TOPA 4L4VE 5CINL 4NKIL 1OAKH 5JYLA 2IAAC 3W37A 3SYQA 3BIAX 2UZXB 5CLWA 4Z0XB 5BNXD 1RMFH 1J1XL 5LBSH 4HPYH 3P4NB 3EF7A 1WFMA 3NIDB 1VF5C 2VZTA 3GT6A 2E47A 1V3JA 2DIAA 3TJEL 1LE9B 4F9LC 1KMGA 3MNZB 1VFBB 3VYOA 1T21A 4AXWA 4C56D 1UA6H 4KK5C 5DJXA 4L4JA 2PWHA 3H9YA 5FYKH 4Y19E 4UNIA 3V0FA 4D9QE 2IH8A 2P3YA 2BCMA 3C60B 1A3ZA 3E38A 4XNZB 4NAQA 3OTTA 2FWOB 1E4WL 2I60H 2WAHA 4G6JH 1ZTXE 2Z35A 2EEXA 1FNAA 1LTXA 4NZTH 5TFSH 3LNDA 1D2OA 4FLOA 2HKFL 2VXUL 2VW6A 4JX0A 3SBRA 2WVVA 1NBZB 5F21B 2VSCA 4RISH 1OAUH 5DUML 3UTSB 3HR5A 1SJVA 3W2DH 4OLYH 1J11A 3DGCR 3IDIB 5I16A 2I7OA 1C8PA 1OTUD 1QSEA 5C0RH 4E42B 5IHBA 1ASQA 1X9UA 4KITB 3GZOA 1EX0A 2D0HA 5D1ZD 5KVMC 4ODWB 1NPNA 2E75C 4P0DA 1XGTA 1J9RA 1DBAL 2X4TB 5LGJA 5E9AA 1NAMB 4XP4L 4NBYB 1XZ0A 3G3LA 2AJ3B 3H6AA 4IMKC 5E6IB 4GW5B 2APXA 4WW2C 1MREH 3FL7A 3RKDC 2B8OT 5HYQA 3GDCA 5IMMA 4UZGA 2WWNA 4ZDHA 1XIWA 2BOBA 4HIQA 4P4KB 4UMGA 2XNAB 3G5VA 4XBMA 4GI6A 3GMNB 5TE6L 3RVVD 4N3TA 3WD5L 3C5ZD 1T0NB 3P3RA 3US9A 2MEJB 5HD8C 1QOKA 3TWCL 2BWQA 2V4LA