1NM4A

Solution structure of cu(i)-copc from pseudomonas syringae
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Copper resistance protein C
publication title A redox switch in CopC: An intriguing copper trafficking protein that binds copper(I) and copper(II) at different sites
pubmed doi rcsb
source organism Pseudomonas syringae
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1nm4A00
2WQWA 1M42A 2Y5QA 2OMXA 1OT4A 2WQVA 4CC4A 2YA1A 3BC9A 1XEUA 3FAWA 1IX2A 2OMVA 1LYQA 2RA1A 2OMTA 3BCDA 2OMZA 2OMYA 1H6TA 3BZ5A 1H6UA 3FAXA 2C9PA 1NM4A 2WQXA 2OMWA 2UZXA 2WQUA 1O6SA 4CILA 1O6TA 2OMUA 4AW4A 5ICUA 3BCFA 4AQ1A 2UZYA 1M9SA 2C9QA 4CC4C 2C9RA 1O6VA
chains in the Genus database with same CATH superfamily
3BGMB 1DJIA 4DSYA 1U8NA 3W3BA 4Y19B 3WAKA 1NGZB 1ZLWK 3ZHKA 2R4SH 1MCEA 5JOPD 3WJLC 4AJ0A 5ID1B 2GI0A 1RJCA 1CXIA 4QEGA 4BZ2A 2QZQA 4U1MB 2CGYA 2WQSA 2IAND 3B2UD 5H94B 4HJJL 4J23A 2BVUA 5BO1H 4GKLA 2YKLH 4Y2OB 1I4FB 2B9BA 1TEFA 3F00A 4AEHH 1X5MA 1MNUH 3X13A 3QHTC 1NFDA 2PYEE 3QCTL 3EJUA 4HWNA 3X1NA 3K71B 1M9WA 4AT6A 2CK0H 2ODIA 1T66C 2W1NA 2Z4QA 2XXCB 2P24B 2P44B 1BSIA 2C9UA 5JHDD 4NEHB 1KGIA 3R7RA 1TPXB 5EIIG 4ZX4A 1JCVA 2Z35A 4FXGC 3TO4C 3UC0L 4QCIB 1COBA 5H8DA 1NIEA 2NXZB 3CBRA 3DSFH 3GYRA 1I8KA 4J3OD 5C6WH 2BW4A 2Z8WC 4UV7H 4PMFA 5J5EA 4NZTH 2CR6A 3FAXA 4JHBA 3BSZL 1BZ9A 3BESR 3NCXA 3GGWA 3O6FB 4MNQB 3RIAK 1KTRL 1NOLA 1V7MH 4Z7WA 4G1EA 2VN5A 2AAAA 2VL5A 3C5ZD 1VFUA 2V3FA 2EO7A 3CXHK 4XXWA 3MODH 2OMUB 1OCRB 2BY0A 4AMWA 2DI7A 1MHPL 3AB0C 1ZJAA 2O6EA 3QUKA 2ZSVA 12E8L 4JAMB 3TM6A 1G9MH 3PAUA 4U0QB 1F6AA 1HQ4A 3V5DA 2R1WB 4QRBA 5LHDA 2VLKD 3BDBA 3CX5K 3ZTDC 3D2UD 4ONGL 5HI3C 4O00A 1JE6A 2OR9L 3RE0A 4ZZKA 1PD6A 1XIWB 2BZDA 2V7HA 2P4AB 4Z77A 3D0AA 3ECBB 2R7EB 1ZS8A 3FNKA 3LPFA 2J56A 1F6LL 1X5LA 3H9HA 5KS9A 1TTGA 1CK0H 1N8ZA 1THCA 1NKGA 1SN2A 2F1BA 2OZNA 1I85C 2XFXA 3ZT5A 4PJ5B 5TE4L 1SXSA 5EF0A 5B1JA 3DXAE 3N85L 4NZFA 2J21A 3FPYA 4WUKH 3MYJA 4DF9A 3QZBA 5T3ZE 4DGIL 3N6YA 5INCA 1CI3M 4R9HA 4AJWA 4EUPA 1MH5B 3FU3A 3UIZA 3WO3B 4C4UA 1GHFH 5C9JA 4GKSA 3WTUA 4OGQC 5D7LA 1HYSC 1XGQA 4U1KB 3QI9D 5MP6H 4UV4H 5D1XE 5D71L 1NDMB 3LIZH 1OT1A 1D5ZA 4M00A 2NDFA 3B3BA 1C7TA 5ABAA 4OD1H 3BAXA 4YHYC 1YY8A 4CC1A 3IGAA 2E76C 3NCBB 3U0WL 3ZDZE 3APMA 4PCKA 5HYFA 4JRXB 2V2XB 4GAYA 4XN8A 4LKCB 3G9VA 4AQEB 3MX0B 2WP3O 5L4IA 5KSBA 5ISZA 3Q6FA 3BXNB 3Q8AA 2N4IA 1AR1D 1Z2KA 2QADB 4XPGL 3AC0A 2ADFH 3STZB 5C6PB 3KJ6L 3MUGB 5LCVL 4WHTA 1H9VA 3DIFB 3OAYH 3ROOB 5FEBA 3UAFA 2N7AA 3AACA 3P4NB 3OKOB 5BRZA 6PCYA 4F24A 3WXVL 4NN5B 5EC1B 4IMKA 2WSDA 5LNEA 4D9QD 4XCNB 1K4DB 2OK0H 2IO5A 1SJHB 1FC2D 3EFFA 2ZNXA 2VDKH 5SWSB 4GKZB 1QBLH 3A22A 4I1PA 3B9DA 4HEPG 4PRPD 3MMEB 4N1EA 2VDQL 1IILE 1KCRL 3DURA 2Y9RT 3QZWB 4U7MA 2VO8A 4GNKB 4Y89A 5AUMB 2N0KA 4U05A 2B1AL 2DJUA 5HI4D 4A63A 5AVXB 4GAFB 4LLVA 4HA1A 4YFLI 5B38G 3D18B 3KPSD 3C75A 4ONFH 3H4FA 5DGQA 4GKOA 3OGCB 4JPKL 5DSCB 2YD7A 2VSMB 5JW3H 5LAXB 1IC4H 2X6CA 5FUZL 2P8MA 4NUJB 3U7WH 2X3BA 4OLEA 2X4OB 4N2GA 4HUMB 4C56A 3ZBMA 4RBPH 4F8OA 1CUOA 4LVNC 4AG4L 7FABH 3EDKA 5JUEH 4PJBF 3TBYB 3EDFA 4Z7UF 3NGBB 4GRWF 5CZVH 4AYBA 1BZQK 1YQVL 3F85A 3PE9A 3WUZA 5BCAA 4XHJD 2D9CA 2ZKHH 1C5DA 3GEWB 4W9HC 4WRLA 4X7TA 5JQ6L 1I7ZB 5I0ZA 2RFXA 2WN2A 4K3EH 3QXTA 4Q9RL 4IRJC 1U8MA 1USQA 4NQCA 5TE7L 1QATA 1F86A 3FONA 1LGVA 2DMKA 2IH1B 2DYSB 3V4PL 1CE6A 1NFIA 1OGAE 4ELMA 1PKQE 1T0PB 1DSYA 4OGXH 3CXHJ 5CJ5A 4WUUE 3SE9H 4E9SA 5J0BA 1N19A 2IBZY 4UU9B 1GZHC 2NCEA 3T71A 2DY2A 1U95B 3EO0A 4ZO6A 3U4EB 5GJTL 2HMID 1KJMA 1HZKA 1JF1B 2OI9B 4ZTPL 1UKTA 2X28A 4MCYA 4WAFA 3AY4A 3POCA 2DWSA 2DQGH 4H2AA 1GTFA 3TT1L 1P1ZB 4BQCA 1W0YT 2I24N 2UX7A 3P11H 4PBVC 3CIQA 2AI0H 4PJFF 4UOW1 3G5XB 1FFTB 1L9PA 2GY7B 3V4UH 3ZHNA 2YUWA 4BRVA 4AQ1C 4BA0A 1CBJA 3HEIB 3O4LD 4RISH 1AGCA 1QSFD 4NQQA 2Z7UA 3BKJL 3ATBA 3OKMA 4J2QA 3MBWA 3X13B 4GXFA 4MAUL 3RPBA 3T65B 4D0BA 4FFYA 5ALCH 1NFDB 3I2CH 2CJSA 5I1GH 2GUYA 4HUNB 2F7PA 4OH2A 4P4KA 3OMAB 2ED7A 4A6YB 4AT6B 3Q2VA 5I1AB 1GIGL 3CZNA 1I3GL 4Z7VA 3OQRA 3APNA 4MAYC 1WFOA 4B27A 2H0FA 4HF5H 5E7BA 3NK3A 3VTMA 1A5FL 4O58L 1RCYA 4XVTH 5AZ2H 5AB1A 2G4EA 1I8KB 5EPMA 1CDBA 5J9PA 3K2UL 5IVOA 4RFNB 2QGDA 1CXFA 3SBQA 2EC9T 4ZS6C 3KYMA 3A21A 1A4KB 1I8UA 1BZ9B 3O3DB 3OB8A 4LSQL 3MBXL 1NC4D 2NTFA 1MVUA 2G5RA 3V6OC 1RZIA 4Z7WB 1QO3B 4XP6L 4B60A 2VL5B 1ITBB 3Q5TA 4AV5A 3ZQXA 1O9WA 4FKKA 5DK0A 2AEPH 2QZ5A 3EDEA 1HHHA 3QUKB 1B88A 2ZSVB 5AOMA 2EH8H 3WIHH 1VJSA 3FO0H 4XNBA 1J1OL 4YFEA 4D8PA 1NC2D 1HQ4B 2ZD0A 4D9LH 3IWUA 4FKHA 2G3NA 4YPGA 3V5DB 2UWEF 5C0AA 4M3KB 5GRZA 4HSQA 2AEWA 4AEIL 1GSMA 1HSAB 3S35H 4QJ3B 4Y1AD 2AEQH 3SDYL 2EXYD 5J13B 2V7HB 3WG7B 1W80A 2DV6A 3ZE2E 3WTVA 4ZMLA 1ZS8B 4K5NA 4J12A 2IMNA 3D34A 3H9HB 3V7AG 3QUZD 1N8ZB 2XFXB 1Z5HA 1JI1A 3WHE0 1G7JA 2QBWA 4BKTC 5ECGA 3VNYA 3MYJB 2VWEE 3QG7H 1RD6A 4EUPB 2NY1C 2AVGA 5B1CA 5KSAD 3PL6D 5HHVH 2B08A 4YDKL 3TBWA 5C9JB 5EF2A 4GKSB 4YR6B 5D7LB 5IB5A 1XGQB 4E68A 1D5ZB 1G7QB 3FQ1A 3U9PL 3QQ9D 1KCWA 1YY8B 5EOCL 4HK3J 4RIRB 2DW5A 2NDGA 5I28A 4X8JA 3V6BR 5HPMB 2YD3A 3KEHA 3WOVA 4OCXH 5D7KE 1BOGA 1FG9C 1UWXH 3HE6C 3CMOL 2MQCA 5ISZB 3LPWA 4LSPH 4HOZA 4DIXA 2IDTA 3NCYS 2EEAA 1CGVA 4NPYA 2HXAA 4WHTB 2PPFA 4XE5B 5I1HH 2DQFB 4I0CC 3US1A 5IW1A 4XPHL 3IEAA 5BRZB 2HTLC 3TWCH 4XMUA 5A2KH 3ZKMC 3BIKB 3CU1A 3QQDA 3BE1H 4N5UA 2AHIA 1SUJA 2WJ5A 5IB2A 3J2PA 4G8EA 2J71A 4A2FA 2XTSA 1NUDA 2Z91A 5JZ7C 1EZLA 4NQUA 3DURB 3VFTA 5AL0A 2D4DA 4JFZL 4Y2DB 2J2ZA 2ENQA 4FFWD 1VGEH 4H7VA 5F72S 5JLZA 1FLRL 3HE7B 4LLVB 4PTTA 5H4ZA 3FQNA 4N90E 3QWRA 5HHME 3V5HA 4LB8A 1CFNA 4YHLH 1HINH 1OARH 4PWKA 1YYLH 3V7AE 3ILDA 2OMXA 1G9NH 1MG3C 3RVXC 3TVMA 4XB8A 2P8MB 1NH6A 2AANA 2WNWA 3U2SA 5LLIC 4O4YH 1T5WA 1M71A 4Z23A 4LO9A 2QT6A 3V0AC 4Q8BA 3ZO0A 3IJ9A 2E7CA 2XXFA 4ZQKA 3T3PB 2IOOA 4KZDH 1WRFA 2X9WA 1FZOA 1IQWH 1H3GA 2OMNA 2XQBH 3H1ZA 3DDFA 3PWUA 1RMFH 3C5SA 3PREA 2CXGA 1C5DB 2XTJD 4HUWA 4JGUA 4X7TB 2OBGA 4APQC 4NUMA 5L7XH 3KGRA 2RFXB 1F4XH 2G2PA 5CZXD 5D70L 1OGTA 3OR6B 4MJ5A 3DVNA 3TP4A 1U8MB 2CKBL 4NQCB 1CS6A 3CUPA 2XBZA 5CO1A 3PGDA 5CR8A 4Y5VC 1NMAH 1CE6B 1NFIB 3PP4L 4PRHE 5E95B 4X6BA 3CFEA 1FH2A 3DMMA 3QB7C 5T1MA 3TGXA 5JIDA 1DLFH 2ZCZA 3EO0B 3GHEL 4JDEA 3CZUB 5CGYC 3ISWA 4APXA 5GRUL 1YCSA 4GT0A 4YHKL 1KJMB 1TYJA 4OQ1A 3VRIA 3IXAA 1JV2A 2WXJA 1N68A 1F6FB 1QRKA 2V3DA 4JG1L 4MCYB 5D5MA 3U1QA 3HS0C 4JQIL 4L8CA 1UCBH 4OIFA 4HH8A 3NTCL 3EH3B 2ZOKB 2WLMA 4RRPA 1DCEA 4JKKA 5LBSA 1Z9LA 3CFMA 2DKMA 3AAZA 4FNRA 4KKLC 4R5VA 4LZKA 1WAEA 2F53E 4IDJH 5JHLH 1H3WM 3T3ME 5D2LA 2Q1EA 4YFDB 4M5YL 3FHQA 1DSWA 1WT5C 3D39B 3NIDE 1AGCB 3LD8C 5JR1L 1KGXA 4LCYA 3WY3A 3Q8EA 1QFUL 2YXMA 3EH2A 3MBWB 5FGBC 3OC8A 4QR7A 1MQKL 4TNEA 1LK3L 1FI8C 2NR6D 4UINL 4D0BB 4LP8A 4DUVA 2NYKA 4TTDC 3P9LB 4Y7OC 2JMRA 1L9MA 2BVTA 3G3LA 4P4KB 1ILSA 1B4TA 4FQXD 4U1HA 4LFHD 1G9MC 3VXNB 3TFKD 4GQ9H 4JPWH 1EHKB 4JFFD 3V9FA 2CH8A 4PY7A 2OMTA 2OSXA 1BYOA 2GJPA 4K9EL 4XPTH 3DETD 1ID2A 3IYLW 1EHLH 1NGPH 1L3NA 1EZSA 2FT7A 3WS6A 5EPMB 2FLMA 5J9PB 2XACC 3D1MC 1JL8A 1SF5A 3AFLA 1K8DA 4B9IA 3BH8B 1CWVA 4WI4A 3VWJC 3TT3L 1N67A 4M7KH 4OGAD 1MVUB 2X3AA 3WN6A 2R2HB 2BDNH 1RZIB 2AXJA 1N64H 1KB9K 4N0UA 2BH0A 1DBMH 5L9DH 4L48A 5LGHL 4NUPA 4FTVE 5DK0B 1NIFA 1C7SA 1UD8A 4UQBA 4X6CE 2AJUH 4V1DD 3H0TB 1NCTA 2EEDA 3A5VA 3RPKA 3ZE2F 4D8PB 4K3DL 1KYUA 1WV7T 4QIRA 3BEWA 3KLDA 4YPGB 5D4HA 5C0AB 1MW0A 1A0QH 3NJVA 2R0LL 5E0FA 1WWWX 1LL1A 1HL5A 4GP4B 2PUQT 3BP6A 3WSQH 4PLJD 5MEOA 2F19L 1MCIA 3MLXL 3NEOA 3HG3A 4OZFG 1S5IH 2E9JA 3OXSA 1KCVL 3K0YA 4XPFH 4ZW3A 2G9KA 4ANUA 1LNUA 4PB9L 4ZFOA 4BWUA 1MHHA 3LIUA 3F65A 4PJ8C 4WQOA 1RZGA 4NBZB 4B9JA 4MQTB 1AXTL 1RI8A 1G7JB 3NJXA 4WDIB 2BS71 3EJQA 4KTYA 2ZP8A 5ICUA 3RZCD 3Q2WA 3SDAA 4EQ3A 4RFEA 3UTOA 1MPAL 5IB5B 5KTEL 1GTNA 1N10A 1J5DA 5FK9A 3I3BA 1IVLA 1VHPA 1QFWL 4R90L 2JH2A 1NMCC 4RWHA 2CGRH 4X8JB 1UEMA 1P5UA 3IXTA 5CIPA 3V8CA 4I3SL 1CLVA 4R96A 1WF5A 3BP7A 4AE1A 5FHAH 1XF2B 3CD4A 1BOGB 3LKOA 2ZKXA 4AQZA 4FTDA 3MRPA 5BOZG 4GG6E 5JW4M 1S3KH 1WYJA 2EIEA 5F89B 4L5FH 4M5TA 4NPYB 4FZEH 3RPIA 4Z9KB 3GKZA 3HMXH 3EAKA 5IW1B 1U8CB 4HK3N 4B6ZA 1RZ8B 3P9MA 2QGEA 1INQA 5IJVA 1I7RA 1SN0A 1ED3A 2E7DA 4NP4H 4JRYA 2VZ3A 3ZDWA 1RZJC 4KNTA 1PZ5A 5AW6B 2F58L 1NPJA 3GSUA 2HKFL 3KH3A 5HDBE 4KI5C 3TIDA 2FHBA 4K0OA 3CSBA 2IPUG 2WANA 2Z0UA 3EOAA 2OW7A 4AM0A 1AOHA 3DJTA 1OP5H 1ZAGA 4E9LA 2J2ZB 4ANXA 1MW1A 4UOQA 3S3DB 5JLZB 1GZPA 1QLEL 5ICYA 2Y6SC 3FQNB 4DKEL 5JOEA 1KTDB 3VE0A 3VA2C 5J7CC 1F41A 3QORD 3VMPA 1TZHA 2QPDB 3QC5X 3FT9A 1JZ6A 2OMXB 1OZTG 1DANU 4OTXH 5L6YH 3TVMB 4C55A 4WU7A 3APCA 2JJSC 1T5WB 5IB4B 4KI1A 4Y0GA 4LOUC 3DA0A 2VXQA 2EXSA 2DQIH 2MHAB 4UZGA 4UB0H 5EUOA 5E56A 1NQBA 5TF1H 5KSVA 1UFGA 3UMTA 4ZQKB 2YO3A 2V5YA 3KBFA 1FN4A 3BWSA 2PPDA 2UZYA 4Z7UA 3DRTA 3RGVA 1AGEA 1FZOB 4IYKA 4NUGL 4LSTL 4L4VD 3PWUB 4IBYA 2UUDK 3OAUH 2GSIA 1LE9A 4XBPA 4MJ4A 1A9BA 2K3TA 1E9OA 2XWDA 3D51A 2F7RA 2EADA 3FB7A 1ODUA 1OGTB 1YZZA 1ZPLA 3NEEA 3P40A 3DVNB 4MJ5B 5IQOA 1Q9WA 4CU8A 4PJCA 4LAQL 3PGDB 1FBIL 1KB9J 4BFRA 4L18A 1G7PA 2XYCA 2BCMA 2QMKA 1HXMA 1HIML 3DMMB 1KGCD 4UNIA 3RY5A 2GHWB 4E5XA 4AE0A 1JNHB 5FLUA 2BRRL 2RTTA 1S7TA 4JDEB 4KROD 4APXB 1JYWA 2B1HL 1JZ4A 3HHSB 4PVMA 3BKYL 1T6WA 2K70A 4Q89A 5EBWB 3TBSA 1OM9A 2BJMH 4LPVA 5GRWA 3IXAB 4ZX6A 1FDLL 5CF3A 1UOWA 4GMTL 4N3UA 3KR3H 4L8CB 4XX1G 1OAZL 5IT2H 3NCWA 2IAAC 4YSOA 3AAZB 4PS7A 3S5LG 4P9HH 4POYA 1EJOL 1IAKB 2ATKA 3II1A 4WI7A 1Y0LA 3P1VA 3SPHA 4R7LA 3MOBL 3ZL4H 5D2LB 5C09B 2J6EH 1RPUA 3VVVA 4B0MB 5HBBA 2YOCA 1J86A 4GMSH 5CP7B 2WLKA 1OCOB 3HC4H 4Y16D 3SODB 4LCYB 3RL2B 3ZL1A 3V6OE 2WUCL 5I1DB 1WO2A 4UT9H 1UATA 4BRJA 4UTCA 5FM8A 1N6UA 4U1HB 4WW2F 4JO3L 2NLJA 3SE8H 4PY7B 3VD0A 2OMTB 5IW3A 4S10A 1E3FA 4ZUTA 1AZUA 5AW5B 2JQMA 4RAVA 4F2FA 3BSZA 1OTUD 1IAIL 3U2JA 1K8DB 4X6CF 1OAUL 4GQZA 2DLHA 3ECUA 2VR6A 4IGBD 4ILDA 3VFGH 2R59A 1K72A 3WMPA 4N0UB 4PJEE 25C8L 1M7IA 2YHGA 3C60A 2JKJA 3QIBA 4YE4H 3MVSA 4OLUH 4HLJA 4MS6A 3V10A 3D87B 4KNQA 4S1SL 3INUH 1OP9A 2DM4A 2O6PA 3OL2A 3RI5K 1ORQB 3A4FA 4UMSA 2VUYA 5AZEH 2QQKH 3IDNB 4F57L 1OTSD 4FI6A 3OKDA 5MEOB 4UTAH 3CX2A 3K1DA 4B5EA 1TZIA 3E6HA 3SD2A 5KVEH 3V95A 5JYMA 5EEYA 4ZFOB 5AYTA 2QKIA 3ULVD 3H85A 2MOQA 1CIDA 3G5VB 4JO2L 3I50H 5FFOA 5IF0A 1CXKA 3BFQG 1SMDA 4EXKA 3DPDA 1A6AA 1KGYE 5I6KA 5E5MA 2QGCA 2PNDA 5E6RB 3HBGA 3QRFM 1FFPA 1TSRA 3UPAA 1BBDL 4LHUG 3SDAB 1YY9D 2E7LA 4Y2NA 2BNQA 3B7YA 5F0MB 4N2KA 5I17A 2YD9A 3TL5A 1UM4H 5SWZE 2KZKA 1AKJD 3FTVA 2JSFA 3FUNA 5AYUL 4PCTA 2FSEA 1KZYA 1I8LC 5KOVC 3GIZH 5E4EB 4MYWB 1P5UB 4R5XA 4MTMA 3D05A 1UH3A 2B20A 3WHXA 4U6VL 2EACA 4MJID 4X98A 4LPUA 5A2CA 1I53A 1UFUA 3LKOB 2BP0A 3MRPB 1SY6A 1WJ3A 1FYTE 1SVZA 4YUEH 5K1NA 2XWBA 1IAOA 1RLWA 3HZVA 2NY2D 4P2RD 4TNWF 5CR1A 2WZ6A 4QLRA 3WJJA 1PYWA 3RPIB 1H0DA 1KT2B 1YEJL 1KB5H 4JKWA 4H20H 3O2WH 3P9MB 1I7TB 1KV7A 1INQB 4A39A 1AGDA 3BQVA 4HOWA 1ED3B 1N18A 3MV7D 2CDGA 1BFTA 2B4CL 4IOFC 1UHVA 4L05A 4YC2C 5EZOH 3BSHA 3SDCB 1Q38A 3RWCA 3GSUB 2J5LB 2A7BA 4X9BA 1DVSA 1UA6L 3EOAB 4PGBA 1A9EA 2BY3A 4PY8J 3IU4L 1Z5LA 4AM0B 4Z7OE 3DI2B 4LSVL 3T0ED 4HXAL 1GZPB 5D96C 5HJ3B 2UZIL 3JVFC 2UYLA 1A02N 3BQUD 5GSRA 5DMGD 3AXIA 3VE0B 3C6LA 3H2WA 1M7DA 3JUYA 3B6SA 5DD0H 5GGRB 3VXQB 1TZHB 2SODB 3LRKA 4PP2A 5IEHA 4QRUA 2WZ5A 3ETTA 5F70A 1OK0A 1MI5B 4ZAKD 5L0QC 2I60L 3T4AC 4FYSA 1L7TL 1QASA 3IGUA 3UTSD 3MUZ1 3MZTA 4JFWA 2K6ZA 2VE6A 3GXIA 3WCYA 1GC1H 4ODVH 4OVUA 3QNZA 3TZVD 4N85A 2IQAB 5FO8A 5KSVB 4JRWA 4PRID 4LSDA 4Z7UB 3RGVB 3LSOA 1II4E 3T0XA 4M8QB 1W8EA 4OSUL 1E5BA 3ELAT 3G6DL 2GSIB 1LE9B 2DL9A 3LNIA 2SEBA 1E9OB 2JJWA 4M7LL 3OZKA 5IQ7H 2ED9A 4W6XB 1E4HA 3FB7B 4DK6A 1J8HD 3L45A 2F74A 3MNWB 4HIJA 2RQ8A 1Q9WB 2J43A 2VLME 2WWOA 4PJCB 4R7VA 5E4AA 4KDTC 1AHWC 1JXKA 4ADIA 2BHZA 4PQXA 2VR8A 2GAZA 1HXMB 2OR8A 3H8NA 4HEPA 4E5XB 2LAAA 4YXLH 1KJVA 2K1MA 1F02I 1S7TB 1D9KD 5DZJA 1HCFX 4UDUA 3TBSB 1OSPL 5DJXA 5E8OA 4OZ4A 2B3IA 3CU7A 2XZZA 3QEHA 4PIBA 3KPLA 5CLWA 4GEIA 3TOPA 3FBQA 1EZVX 2FEEL 5FFLA 1VSCA 4W4OA 5D8JL 3BGAA 4BFKA 5BS0D 4PJFB 4XP5L 3GBNL 1Z3GL 4OM0H 3TFBA 1KXHA 1Y0LB 4MB5A 2RJMA 2C4FU 2AXFA 3ZKSD 4R2GB 5IHZA 1DL7H 1X5FA 4PREA 4D9RE 4XRCA 4NRYA 4E9RA 2Y1VA 2N0MA 3DTDA 1KEMH 1XAKA 1KSRA 3SBPA 3K2KA 2EZ0C 4XVJH 5EB9A 2ITFA 3NYKA 4X5WB 1ZK9A 4YWGH 4ADJA 3RTQD 1BV8A 4Z3HA 1DVQA 4Y4KA 4ZUTB 3UG4A 3THMH 3HA0A 1CQYA 1QI5A 1KLFA 3W0WE 2ZOUA 2R23A 2KZWA 3UJTL 1A7QH 3HN8A 4ACPA 3D09A 2EVGA 4GT7A 2I5YH 2WXKA 2CMRL 3TBVA 4LSRH 3G5WA 1TNNA 1JGVL 3OLDA 2XQYG 1YEGH 4LCCA 3ZHDA 4YDIL 1DBKH 4UWQB 3QFJA 1M7IB 3MBEA 2OL3A 2NNXA 4R97B 3C60B 3FQRA 3QIBB 2FYYA 4JFEA 3OF6D 1SF3A 1UOVA 1EGJL 4W9DC 3ARFC 1J1PH 1Y7VA 5DRWA 1W8NA 2DIBA 2ITDA 2UWEB 3GBEA 4DFIA 3N44F 5G4MA 2J1KA 4F2ME 3OKDB 4PS8A 4OIIH 3SDDD 3F7YA 1TZIB 1CR9H 3E6HB 3UAEA 1BECA 2YA2A 4N6RB 1S78D 1EEYB 1WGVA 4C59B 3TA3A 4XNYL 4MBOA 2XZCL 2BIPA 1YMMD 4MKTA 1I9IL 4J4PD 5AW0B 2P80A 4Y4FD 4B95C 1BVNP 1J05B 2AJZA 1YQ2A 1FL6A 1KYDA 4MQXD 5IF0B 2B59B 2NY0B 5GHWH 5IVZB 3QUMH 1A6AB 3PHOA 5E5MB 3ME0B 3LH2L 2GKIA 2D3VA 3VFOA 3VD5A 1FFPB 4WEUD 5EIIB 4PHXA 2YGVA 1XH2A 2BNQB 2ZUWA 3HB3D 4I9XA 4KJWD 5D1QB 4KO7A 3ZE1F 5I1CL 1P9MA 1TF4A 3KPRA 4DZBA 3T0BA 3QULB 5IJBC 1L4IA 3GRGA 4WFFD 5SX4I 3EJPA 2NUTA 4HIQA 4AGLA 5IFJA 4DT2A 1FNSL 3V79C 4P23B 4KI5E 9PCYA 4WK2B 1A6PA 3S3SA 3WHXB 4OJCA 2EDFA 4AY0A 4ZW5A 1YEFH 4ZO7A 2VISA 4DGUA 4G8GD 2DKSA 4L9DA 2D9QB 3RA7H 3H3BC 1DBJL 5DMYA 4I8DA 3GJFK 4X42A 4NX0A 2D0GA 4CVZA 1ZWIA 3HRZA 2VAJA 4U1GB 3VW3L 4KV5E 1PYWB 1S3RA 3QT2A 4B9PA 1H0DB 4XPBH 2QPUA 1NAML 3DLQR 3K5SA 1AGDB 5KVFE 4F20A 4AW7A 3RWCB 1XF4A 5DHVA 5FHBH 3SYAA 1LMKA 4EI5B 4PGBB 1BF8A 4FQJL 1Z5LB 3C6EA 3R19A 3VVWA 1AACA 1YMHB 4LP5A 3MLTA 3CZFB 4YSDA 3DOSA 2Y3AA 1MFAL 1F8TL 3FTWA 4NJ9H 2UYLB 4ODTH 1JHKL 5EU6E 5G55A 1BZOA 1G6RB 3T8XA 4HW6A 4ENEC 4KXDA 3UAJC 5IEHB 4YDVA 1TJGH 2LQRA 2FEDC 4QRUB 5C2BL 5TDOA 4JKNA 3OMZA 3PQYA 1GOHA 1JHTA 1TQTA 2BNRD 4YSUA 2VE6B 1QPPA 1QFWI 3QNZB 4LF3B 2EUZA 1MJUH 4DETA 4HMDA 3ZDXB 5FO8B 1I9RL 3NQKA 3WKML 3LB6C 4Y9BA 2BMKA 2PO6D 3LSOB 2DLEA 2WMPA 1SVCP 4HXBL 3O45B 5IGXH 4PRBB 4Z3EA 1FGVL 2WBKA 3OPZH 1QNZL 1BJ1J 2CKBA 2ZXQA 3CBKB 3VD3A 2ZICA 4N2MA 2BS8A 4F58L 1LJMA 2F74B 3VXOB 1UACH 1FYHB 4P9HC 4E41D 1YDPA 3KW8A 1MFMA 1KCSH 1HXKA 5HGHA 2GPZA 4MDIA 5GRJH 1NL0L 3B9EA 2X2IA 2H9GA 1I7UA 5CN3A 5D7HA 5G2NA 4P59H 3DTUB 3MUHL 5FA3B 1E5ZA 1KJVB 5C0BE 5EWIL 3VXUD 1ADQL 2DQUL 3D06A 3CFQA 2N1TE 1OP3H 5DJXB 5D93C 3NH7L 3LN5A 4OUOA 4OZ4B 5E8OB 1L5GA 1IARB 3PWNA 3O2VL 3M45A 2VUOA 4PBXA 4PJ7F 2NRDA 5C08A 1U2CA 1E5YA 2F5AH 4P4RA 5E9DD 4ZFFB 1UASA 1J0KA 1FIEA 3LNHA 1T83C 1B3IA 1HSBA 1E5AA 4YBLC 2Z31D 4K8RL 4PGJA 1Z1WA 4TOYH 3S34L 2WCPA 1HILA 1BG1A 2FO1A 3QQ3A 2Z4TA 3UTPD 5IHZB 2DLFL 5E08H 4PREB 1NCWL 3MV9D 3VGGA 3CGTA 4P0DA 2PW2A 1R24A 2IC2A 4K73A 3GMPA 1KXQE 3MJ8B 3FCUB 2ZCLL 5CCJA 1MFBL 2FIKA 1HEJC 4QHLA 1EO5A 4OZIA 1KTJA 4P2OA 4Y4KB 3AS0A 2P5WD 3HI5H 2X9ZA 3ARBA 2KH2B 4N0YH 3DUHA 4HZ1A 4P2QD 2YAEA 4BZ1H 1KLFB 5J11C 4W9FC 4F5CA 1JGDA 5GGVH 3VB8A 1VACA 4KRPB 2R23B 4M43H 1GXEA 1ZVSA 4RWYL 4IIZA 2YZ8A 1PVHA 1T1WA 4GRLC 2O4EA 2EICA 3K81A 4NDMA 4CKQA 3WFZA 4G5ZL 3TBVB 5L2JA 2JNZA 3O6LL 4X6EB 3N0AA 2WLHA 4L3ED 1X9RA 2KDYA 5DF0A 3IDXL 1KLGA 4ZD3H 3MBEB 2OL3B 1QW9A 3GBMH 5IJCC 1TQVA 3FQRB 3IFNL 5ECJE 4NC2B 4JFEB 5EN2B 4CJ0A 3FUEA 5BO0D 1ZLUH 1B2WL 1CB4A 1OLZA 4EBQH 1BAWA 4PJ9C 2OJ1A 5DRWB 1NDGA 2EUXA 3I9IA 2HPTA 4FA8A 5I0YA 4WI9A 5CJQH 2D7NA 2CCLA 4K07A 3MDJA 4MMXB 1JGUL 1SBSH 4W9LC 1FE8L 4V2CB 1T2QH 3F7YB 2HKHL 4TSBL 1BEYL 3M86A 1SN5A 4BWTA 1JGLL 3D0VA 5KWYC 5C07B 4LFHG 3TA3B 1ZGLA 1XGUA 1D7BA 3LEYH 2ZJSL 3KDMA 3ZK0A 4UMGA 2AJZB 1FL6B 4DP1X 2VR9A 2WSKA 4FOMA 4OQTH 1RULH 2QSVA 3D33A 5G5DB 5KVGH 5HPOA 1P4LA 2LFGA 3U0PA 1DBAH 4TNWK 1FNHA 1OAXH 4LRIA 4ZYKB 1LEKB 2EIBA 1AQHA 1WE5A 2E46A 3KPRB 2LU5A 1DFBH 4HSAC 2IQ9L 3FUKA 4N8VA 3RDTB 4DZBB 1FORL 1IAII 4KK9C 4LGPB 2AJXH 3JT0A 5HHOD 2QQNL 4DEPB 1CF8H 2OR7A 3SOTA 5IFJB 3ECQA 1R3KA 1CZ8L 4B41A 3KWWA 1PL3A 4EF3A 2NZ1A 2MIZA 2X4TB 5DFAA 1A4JA 2NW3A 1P69B 3QCVH 3L4VA 3L3GA 3V0JA 1HC1A 1KCUL 4HS3A 2QPEB 4CVZB 1ZWIB 3HRZB 2DQTH 3EH4B 5CFHA 3TPKA 2A5UA 1J9CT 4JUTA 4F9LA 5D1ZC 4RMRA 5C7XL 3CH8A 3VWKD 5EC2A 1MUJB 5EEZA 1VFAA 3EJYC 3HFMH 1YSOA 1NSNL 4JZOA 2Z1PA 2AEIT 1GC1C 1FPTH 3HG5A 3PWPA 1XF4B 3NFPA 5KG9A 5DHVB 4QPEA 3QEQA 3O3BA 4IHOA 1E3ZA 1X5AA 1IGIH 3GJFB 1JZJA 1N9PA 3L5XH 3UBXI 1NCAL 3CDGA 2X1WL 4U3SA 4G7YL 4MCNA 2Z64C 3QHZH 2F7IA 3VXMD 1MIEH 1QVOA 2WO3B 4PRNA 4KC3B 1Q90A 4LCWD 1OCWH 1QKZL 1A6ZB 3JWNH 4JFVA 4M6MH 5GRVK 3T8XB 4EZMA 3QUYA 3EOTL 1IBYA 1XBDA 4YDVB 4BUHA 1JWMA 4F7CA 2PPEA 2C3XA 3PQYB 3B3IB 5IMOA 2XCMC 1JP5A 2VMCA 2WZPA 5C9KA 2DWDB 2EIKB 5DUML 1JFQL 2DKUA 2X7LA 3GHBL 4MSWA 1ZE3C 2BMKB 4WFGE 3SCMD 1JPEA 5F7UA 2WMPB 1OWRM 1KJ3H 1L9SA 1P7QB 3O81A 1I8AA 1CBVL 3QJQB 5FCUH 2CKBB 3CN0A 3NIFE 1ZD6A 3KGSA 4DWHA 2P5ED 1JWSB 3BJLA 4V33A 2WBJC 4B50A 3IDGB 1LWRA 3HR6A 2CHXA 3QZPA 4Z3TA 1YDPB 1FVEB 1U9KA 2NQCA 1OAKL 2H32A 3UJJH 5IHUL 5HGHB 4NRXA 4URKA 4WCYL 3QJVB 2EYTA 2G5BA 5IHLB 3ARGA 3EBIA 2DD8L 2H9GB 1I7UB 3UDWA 2BC4A 1E4JA 1H6UA 1EERB 1NPNA 5J1SC 5I30L 1CDUA 3RJQB 3T0VA 2NY4C 1L5GB 2X6MA 3G6JA 4NQDD 5JQHC 3QJTB 4LQFH 4HCRL 1V7NL 5C08B 3KPOA 5IQLA 4ZXBD 3AWGA 5L2KD 2NNAA 1BFVL 1VB9A 5A16B 4P4RB 5HGBA 3KWUA 5CBAA 3HBQA 4CL7A 2YQGA 1CD0A 4WI0B 2ZWSA 2CO1A 5LBVA 4DCQA 4PU2A 1HSBB 3OHMB 2J1WA 4ZMNA 5KBKA 5GS2H 3MLYL 2NXYB 1M05B 5AZUA 1HILB 1BFOA 2VIRB 3QQ3B 1FGNL 4Z0BL 4ZMOA 2CPUA 4HIIA 5ILTH 4GBXA 3CVCA 5MEQB 2BHFA 3JTTA 4I89A 1CICA 5DHYB 3UEQA 1O7DC 3NJKA 4IKJA 2PW2B 5EZIL 1R24B 3P3UA 3CLEH 1N5AA 3C5JA 3GMPB 2ZIDA 3F6LA 4WW2B 2MQ3A 3BIBX 3V6FA 1QG3A 3FTUA 5LXGL 1XCQA 1OALA 1JD7A 4QHLB 5IFAH 1PG7L 4OCLC 4P2OB 4MXVF 1MNNA 5A6LA 5TDNA 2HLFD 2GUOB 2WLLB 5DD3H 2MOGA 5DFVC 1CF1A 1JGDB 5INDA 2QDVA 2EIMB 3N04A 1HZHL 3F58H 4QOKE 1N4XL 1ZVSB 1CLZL 3DOHA 4XE0A 3I74A 2A74A 2AQ2A 3LQAC 4XPAH 4QHMA 5L2JB 1KWKA 1QRND 3GMOB 5JIQA 1H9DA 3JT2A 2K6WA 1KLGB 3O3AA 4PJIA 3S97C 3M7FB 3DX0A 3NP4A 5F1IA 2ZWLT 5GSVA 4LLDA 3VFUA 1TQBC 2XWEA 4FZ8H 3RUGA 5JPMA 1R5VB 4YAQA 4DKTA 3NA9H 2Y2YA 2FEEI 3P0VH 3SE6A 2Y1AA 1B0WA 4FEIA 3AG3B 1DQLL 1UM5H 5I1IH 2F1EA 1T1YA 1EMTL 1F4AA 4P46D 2F54E 5C0GA 3I9AA 5HJGA 3ULUH 2WVSA 4L37B 5GS1C 2BERA 1KN4L 3D0VB 3QCUL 1AANA 1U8HA 2GJRA 2QQQA 3UBXA 5K9JH 1PW3A 1XGUB 3B4NA 2IXQB 4XWGH 5IBTL 3KDMB 4Z8FL 6TAAA 4S1DD 3X3FL 4YK4C 1M3IA 4HG4K 5F9AC 4NM4H 3U9UA 5HD8D 1B9KA 4KK6C 3SE3A 3BD4A 4HK0B 5MERA 3WXWL 5DTFA 3QDME 3MGOB 4K7PX 1KTLA 1P4LB 4GAGH 1CLCA 2XN9D 3U0PB 4Z7IA 4KVPA 2OTWA 2PWHA 5C2UB 3A6BL 5JDSA 2IWGA 2J8OA 4MA8L 1UTDA 3VQ2C 4BZ2H 4RRPM 1Q72L 3VM7A 5ID0B 4QGTA 1KPRA 4UT7H 2F68X 2ED8A 5FYJH 4Y5XC 1ODAA 2MCMA 2HFGH 3RG1C 1MY7A 1RKRA 4AOFA 3RX9A 3G7TA 1R3KB 3Q8CA 3KWWB 4KVNH 4R4FH 2DN7A 1D2OA 3O0RH 4NQVA 4RDQG 5C0CD 4J8RA 5EEWA 2NW3B 3BGFB 2VB5A 3L3GB 1W0VA 4KQ4L 4PVNA 4HS3B 1CGUA 5EU7C 2IANA 2CO4A 1LO0H 2FWOB 1YJDL 5E6ID 3HNVH 3TESA 2AK1L 3EBAA 3MRQA 5EC2B 2A9NL 2GYSA 4WO4A 2D4FA 3FRPG 2HVJB 1RURL 5I71B 5KN5A 4JZOB 3TJPA 3MSPA 3CIAA 3D3VE 3PWPB 3NFPB 5KG9B 4H1LH 3T5WA 3QEQB 4BJLA 1VGKA 3GQFA 4FQQA 5JHDA 3O3BB 4IHOB 2UZPA 1A7OH 4KK5D 1QLEB 3LJ3A 2X12A 4PR5A 1NMBH 2OMZB 5FGSA 4NHUB 3P2TA 4JPIB 5K1JA 1ECYA 5GS0D 3FB6B 2NSXA 1QVOB 5KW9L 4PSRA 4PRNB 4YZWA 2FGWL 5I5JA 3A67L 3MUY1 3BKMH 2KKQA 1QYGH 4PV9B 2FRGP 4H25A 4JPSA 1MCFA 3CZJA 4M3HA 4G3YH 3NJHA 4PN6A 5IMOB 2C34A 1KZQA 3WD5H 1OSYA 3ARTA 1BIIA 3UACA 3GM0A 5PCYA 1L7IL 5D7IF 2X7LB 4MSWB 5HHQA 4M7JL 3KLQA 1SYSA 1ECZA 5DJ0A 1M6OA 1F3RB 2VLKA 5DWUL 1LO2L 5F7LB 4XBEL 3K72A 3E2HB 4CSSA 1XO8A 2HUEA 3P0YH 5GIRA 2W9EH 1MRCH 2A6DB 4EUPH 3TPUA 4G9FD 1CG9A 2AV1A 1RZFH 4NO0D 4FULA 3S2CA 4K5LA 3BP5B 3QDGB 2A38A 4AYFA 4WFED 1WAAE 1AKPA 4RSVA 5I1LA 4GKNA 2H32B 4LBAA 4NRXB 5E8DL 3NCEB 3BN9C 3OZ9H 1U41A 2EYTB 2V5MA 3BSGA 3ORJA 4I18C 3ARGB 1EPFA 5F7DB 2XKSA 5T5FL 2X3CA 4MWFB 1E4WL 1XXFC 5KJ4A 1DUZB 2GFBB 4P5TA 3UJIL 1E2VA 4LBEA 1DSFL 1URIA 2WIIA 3CFUA 5I8OH 2WXLA 4IMLA 1YUKB 2CHZA 1YUHA 5PAZA 2FUTA 1VIWA 3AWFA 1ROCA 1TTAA 4J3WA 4L3CA 5CINL 3QI9A 2X38A 5F9OL 4R26L 4PJ7A 4XOCA 4UTBL 3KPOB 2JJTA 2NNAB 4D0DA 2QR0A 2ICES 5CBAB 1CGXA 5J3HC 2WO4A 4BXVA 4CMMB 5C3TA 1Y1UA 1JS4A 4DCQB 2Z7ZA 5B3JE 3MLVH 1CDIA 3NK4A 1CVRA 4HG4J 5KVEE 3QFDA 1F4WL 4YBQD 1BFOB 1KIUA 4H0HB 4HIIB 4GBXB 1UD6A 1F3DJ 3JTTB 3KPPA 1CICB 3QNXA 4U1NA 1GRWA 4X7SL 3GHPA 1N5AB 3C5JB 1E8WA 5AW9B 3GI8H 4UYQA 1QWUA 4P5KA 2FLRT 4GJTB 5HYJE 5AAMA 1S7WB 4HOMA 1XCQB 2VDOL 4IIQC 4WKXA 1OT2A 1NUFA 3D25B 4NNPH 5TDNB 4ZMXA 2Z8VC 4NOFA 2YLHA 5E2JA 3VQMA 3E1ZA 5GZNC 1DVFC 4DW2H 2BCKA 4JFQA 3MRCA 1UOKA 4JFTA 4ZW7A 3A3YB 2XV6B 4GSDL 4M1CC 4OLYL 1KELH 5LUMA 3EXJA 2DMCA 4KTDL 1UC6A 4QHMB 3QO0A 3KPSA 2WWKT 1S9XA 1EGJA 2FJGB 4CSPA 2HVKA 3KAAA 4YSQA 2BFVH 3O8XC 1MEXH 3O3AB 4D7PA 2APTA 1IGCH 2CO7A 3PWJB 4LCUA 4PJIB 5IREA 4J3UA 4JHVA 4M6OH 5F1IB 2YAPA 3VFUB 4LLDB 1RUAL 2CPCA 1YEDB 5DZAA 5L88H 5JPMB 1THAA 3FCTA 3OKYA 4YAQB 3MA7A 3KCWA 4WI8A 5JHMA 3KLHC 3CCHA 2AKRB 3R06B 4MA7L 2JTDA 5EF3A 4BDVA 5B3NA 4A68A 1MF2L 3GSWA 3A6CL 4C56D 1EA9C 2JI3A 3C12A 2YA0A 3JV5A 4FLHA 3T2PA 1U8HB 3UBXB 4QRSA 1JZEA 1XH3A 4EMZA 1BPLB 2HH0L 2XWZA 3KVQA 3FH7A 3ZKXB 3EFDL 1A7NH 3L3HA 4FP8H 3U9UB 2RA1A 3B9VA 2MPAL 3FXIC 3VDBA 1S7RA 4HJEA 3Q5YA 5FDYA 5DTFB 4M7LT 1TPXC 4XXDA 2B5IB 1KTLB 5F7MC 2A6KA 2YUXA 2NXZC 3AG1B 1W15A 2DQJH 3WTYA 3WO4B 3ZE1B 5H35B 2OTWB 2BINA 2VDRB 1EAOA 4K23H 4GW1A 5ERWA 5JDSB 1UYWH 3AZUA 3JWDH 4G8FB 4N6QA 1AFVH 2VAAA 2A77L 1KPRB 2WSPA 3O6FC 4MXQC 3NVQA 4UF7C 2EDMA 5CCGE 3LKRA 4P2AA 4FFYH 1K2DA 3GPSA 4J8RB 5B7FA 4XVUD 1DLHA 1HWHB 1N59B 1VADA 4M61A 1W0VB 1OIOA 1BF2A 1NAMA 2QELA 2IANB 4FEMA 4OI9A 2E6PA 4ATTA 5KVDH 4M6NL 1QSFA 1CYGA 2XVLA 3HG1A 2P26A 1I75A 4BQ9A 1KEGH 4KRMB 1PSKL 3MRQB 3VRLF 1XIWC 2WYIA 4OF3A 2H2SD 5F21B 2GQHA 2DJSA 1D5BA 1KFAH 1Z32X 4P3CL 1H3XA 1Q1JL 1F11B 5I8EA 3ECWA 2JQAA 1F58H 1U91A 3OLEA 4FQQB 3VDCA 5JHDB 4HUVB 4ZSOA 1GMIA 5ADPL 2VQ4A 4Q52A 5AVUB 4FJZA 1FAIH 3LZOA 4PR5B 1ERNA 4G1MB 3TH2T 3ZUCA 4AQ8A 3QS3A 2Z93B 2AMGA 1M9SA 1EO7A 1MFDH 4R3SA 2DQHH 3TYFA 2Z8RA 1BQKA 3NZUA 4NAQA 5ESVB 2XZQL 4YEEA 4M1GL 3PAZA 1I1FA 2NX5A 1BJ8A 1EV2E 1NC4A 2QLVB 2FD6H 5HJBA 1D6EA 4H25B 4KHTL 4KKBD 3SQBA 4QRQA 3D8MA 3SJVE 4ZFQA 4Y7MA 4I77L 5TQ0H 1FA4A 3EDDA 4Z78A 2VABA 5DD1H 3WKYA 3OJDA 2AAVA 4WHYH 5F7NC 1SYSB 2AK4E 1NC2A 5HHQB 5DRNA 3WTXA 5E6YA 1M6OB 1XF5B 2ZOLA 2VLKB 5EG6C 1P7KA 3D2UB 2XY2A 4POZC 2QADC 4RDQF 4PJXA 4FERA 4XNUH 4Y1AA 1TNMA 3L5JA 3I75A 3AVEA 5C0AD 2EVIA 5ITBH 2Y06H 4KY1H 3NCFB 3SPGA 1JD9A 2AV1B 3K4AA 4I88A 5CU5A 5KBMA 1ZLEA 2BOBB 4NN5C 3EJZC 1IM3D 4AYFB 3SQRA 1ET7A 3DX1A 4PWGA 5DDHA 5I1LB 5AVTB 4GKNB 3QUZA 1LO5A 2AJSH 2EDDA 1Q8MA 3WIHA 4A2LA 1F3JA 5I8CA 2ATPA 2AXWA 1U3HD 4TPRL 5DQDH 2MNWA 5F9WB 3L2LA 2IPKA 2FWSA 2O72A 1TZGL 5E23A 3VMNA 1QBBA 5C7ZA 4AYDC 2WXNA 1MIMH 4YX2L 4AMXA 3PL6A 1OAQL 2WIIB 4NWUL 1Z9MA 4OJYA 1O7DE 4IMLB 1DQDH 5GGSA 1CLOL 1M3JA 1SNRA 4HWEL 4N20A 4AM0Q 4L3CB 4EIGB 5B3JF 3QI9B 2BNUA 1LVEA 2BFGA 2ZUUA 4PJ7B 3SKOA 1VAHA 3MRGA 4JM4L 4MHHI 1AZRA 5IB3A 4K71B 2XWRA 1OB1A 1URLA 2AQNA 2NQ3A 2PKDA 3UOAB 1L6ZA 1D6VH 3MRNB 1INEL 3Q1SL 3WFDH 4BH7A 3IDYB 1A6VH 4LOVA 4B97A 1A3QA 4GSRA 3PAYA 4U1LA 5B39A 1C5CH 4KQ3L 1MJ8L 2ICWI 3ATEA 1FLTX 1C8QA 2XVGA 1EVTC 4FQIL 3QFDB 5KYUA 1TCMA 3CNKA 1AR1B 1UWXK 2FZ3A 1J1XH 1G87A 2H8PA 2XTLA 4W81A 3NGBC 4U1NB 3KWXA 3H2QA 4XNZB 4DQOL 3RHWF 4IJ3B 5IR1A 3HAEA 4UOJA 2YOAA 5KYXA 3DX8B 3QZOA 3C09B 4EKJA 4AJVA 2BSSA 4P5KB 2RHEA 1ORSA 3TH3T 2Y1ZA 4X80L 3QR1A 2P3YA 2R69A 4OCWH 3FSAA 2J8UF 5JNYA 2ADIA 3TTSA 4PRPB 2J12B 5IROC 1RUQL 2E7BA 3JZ7A 5DR5H 4FI7A 2BCKB 1EO8L 2PYEA 1XL4A 2ZUYA 4JFQB 3SPVA 4ADGA 1IGJA 3ULUC 3H53A 2NY5C 4HFWA 4OKVA 1UOLA 1YPZE 5GGTL 1B3JA 1GYAA 3KPSB 4A7TA 3DX4A 4CJ1A 1BD2D 3QIWD 4HIHA 4YSTA 2X88A 2OI9C 2CO7B 4LCUB 3ZE0E 1IBGL 5E2UH 2VQTA 2G9HA 3QWRD 3Q2CA 3VFMA 1LE5A 2VDKB 3FB8A 4QT5A 2ZYIA 2XA8H 3T6QC 5BVJA 1IEAA 5MENE 2ENYA 3O3EA 5A6MA 4OV6F 4NRZA 3N1PC 3UABA 4BDVB 4XMLL 4PS4L 4RZKA 1CFQA 2XXMB 3VFSA 5DJ6A 4PVBA 5C8JB 1PX4A 1W8OA 2ALAA 5D6DA 1U42A 3ROLA 4IRZL 4XCEA 4QRSB 5FO2A 1XH3B 3W5MA 5B4MC 1NANI 4JO8A 3ZVVA 3ZSSA 4UIKL 3W9DA 4AENB 1TENA 3L3HB 4J5VA 2C3VB 2R8SH 2GHZA 3WDJA 1MCLA 1S7RB 3LQZA 4TQEL 1DR9A 1KBWA 2O26U 2YFNA 5EMYA 3W1ZA 1QWHA 4XXDB 4PJDE 4QXGL 1D5IL 4M9OA 2A6KB 5FS5A 5EU7E 1YNTA 2FWUA 3ML9A 5LBSH 1HNYA 4J3VA 1HHKA 1MW2A 1JPTL 2F5BH 3HC3L 1N6QH 1Q9OA 4IRSA 3CC5A 3PHSA 4KPHL 3SIKA 2VAAB 1U8KA 2IPTH 3SPJA 4GQRA 3TCLA 1HL8A 4OB5L 4P49A 3MTXA 1TTRA 1I9EA 3RVWD 1ILUA 3EYSH 4J6RH 4MX7A 4XXWC 1G1KA 2XETA 1K2DB 4IKNA 2NZ9C 3GK8L 1PEWA 5D1XA 2QEJA 3QK0A 1MZZA 3L08A 4M61B 4DEWA 3SYQA 4JMXA 1TUPA 4X0NA 2E7HA 2W0PA 2B0SL 4KMTH 2ZXAA 3O4LB 4ABQA 1QSFB 3MLWH 1KIPA 2ZXBA 3KXFE 4D2NA 1H3PH 3FU6A 5TE6H 3BPNC 5CKAA 1KPVA 2JJUA 4Z7QB 1SJEA 2NR6A 1KXVC 4Z3IA 3FUFA 3PGFL 3GSXA 5J13C 1D5BB 4RMBA 4HJ0D 4D0CB 4QAMB 5FYJU 4XTRD 4FQXA 4ES8A 3Q48A 3ZW3A 5I8EB 4G80B 1SHXA 1U91B 2XNAB 4JFFA 4OCYL 5BRPA 3ESUF 4ZSOB 4UBDD 3AS3A 2R9HD 2IDFA 3HI6H 5B1JC 4MZIA 3F84A 3EJCA 4M1DL 1NFAA 3LZNA 2X4SA 3GMMA 5DS8A 4R3SB 2LTQB 4Y5YA 1H8LA 3TYFB 6PAZA 5IOPA 3O9WD 2ZSWA 1IC7L 1VKXB 4KOBA 5ICXA 3HPJA 5SWQA 5CAYB 2CRYA 1I1FB 2ICWA 4HFUH 5CUSH 3CVIH 1JK8A 1VZGA 3JWOC 1NC4B 1HVXA 1IKNA 1WK0A 2XWTA 4TRPH 1A7BA 1D6EB 4I4WA 4XP4H 1OTTC 4JO1H 2P5WE 3GLEA 4QRQB 4P2QE 4FQLH 1RK1B 4AC2A 1WAPA 2B39A 3PLYA 4XP1L 3V0WH 4ZFGL 3M6DA 2W9DH 3Q06A 2LOEA 4Z78B 2FX7L 2VABB 4V1DA 2X44D 2WAHA 3AM8A 4JM2A 2V5RA 2AZAA 3OJDB 1NC2B 1LQBC 5DRNB 3WLWC 4ODWA 5FYLH 1P7KB 2YC1A 4PJXB 2H47C 4X0KA 4Y1AB 3I75B 1U21A 2R4SL 1UZGA 2YR3A 2KZBA 4G6JL 1RERA 3BVWA 4OZHE 4YHML 3RGBA 3DTXA 2XWCA 2E4FA 1UUNA 2ZNWA 3BAKA 1UWEL 1UH2A 3QUZB 3VX1A 3KL5A 5I1JL 2Z34A 1LO5B 1MDAA 2YGQA 4ICWA 3T1FA 2YK1L 2XFGB 1F3JB 5I8CB 3RFZA 2I25N 2HJLA 2IPKB 2XU9A 4J3BA 1A14H 1WBZA 1PTZA 4HWZA 5CIPH 3KNBA 5DXWA 2Y36H 5FYLD 1AHMA 4Y2DC 4PLNC 2DH3A 3PL6B 5HP5A 3FO9B 1EDYA 5GGSB 3JV0A 3HE7C 2ENPA 1CFVL 1PQZA 4XWOC 2H26B 1OSZA 3SKOB 4OGYH 3DSFL 2Z3FA 4Q2ZA 5BMFL 1EX0A 2L8AA 2OP4L 5IB3B 2ZWYA 4HHGA 4Y1TA 1JVKA 2VDNL 2ESVE 1IL1A 2K6YA 3RIFF 1B0GA 4UT6A 4BH7B 2EDBA 4K2UH 3WUWA 5KYYA 3VI3F 3HCVB 5EEUA 2AABL 4K7PH 2YSTA 1F90H 5BVPH 1QR4A 4PGCA 3B83A 5BJTA 2FZ3B 2I7OA 1JMXA 3JWNG 2H8PB 5HHOE 3UG5A 2UX6A 2ICEA 4FG6C 4G6AC 1G9ML 4C57C 3N41B 2I07A 4YGVA 5LQBH 5FOBA 3U4BH 5KYXB 5E4OA 4ZUVB 5CWSA 2G60H 4PJGF 1ASOA 2IG2L 1HXYA 2BSSB 4ZOAA 5GJSH 5ADOL 1WA2X 5IMKA 1ORSB 4GXVH 3ZMEA 5KVGE 1YPZF 4WU5B 4YDJA 1RJYA 2WCGA 2UY7A 4JRYD 1OXYA 4Y19E 2F8XC 2YSSA 2ZKWA 3NDZE 3VI4A 2PYEB 4JHWH 2RCSH 3SPVB 1IGJB 3GXUB 2AQQA 2VXQH 4XMPH 2C1OB 1JRHL 2Y7LA 3NZHL 4HFWB 2CKNA 2H1PH 3F83A 4ALAH 3ZYIA 2FX8L 4PFEA 5I1KH 3HNSH 2QVTA 2WZAA 4WUKL 1BREA 1E4KA 2CM5A 3QORA 4HIHB 3N91A 4RAUB 4KFMA 5IQ9A 3SY6A 3KH4A 1BQRA 1NM4A 3BPLB 3OKNA 4ZQTA 1SM3H 1LP9F 3AY4C 2G9HB 5L4MA 2BSTA 3DYMA 3CK0H 3QHFH 1T2JA 4UQDA 3SZKC 3GIVB 2AMUA 2ICWJ 3DJ9A 3FB8B 1O75A 4QT5B 4X5RA 1HCZA 3LIZL 4EQ2A 5BVJB 1IEAB 4OD1L 5BZWA 3O3EB 4QRPD 1HN1A 1FNGB 1ZHKA 4N2BA 4NRZB 5A2BA 4LDCA 3JWDC 5C0EA 1CFQB 5DJ6B 2WBXA 2OV0A 4L4VA 1YLBB 2K9UA 5I18H 3ROLB 3BLPX 1PEZA 4TVPD 4MNQE 1UXSB 4FQ1H 2XTJB 4PJDF 4BFGA 1VEPA 2UUDH 3RX7A 3SSGA 1MWAL 2F0CA 3I9PA 1NGQH 4MMZA 4I0KA 5F8QC 1YAIA 4P4KC 1TYRA 1UEYA 3TONA 2KL6A 3D52A 4X7CC 1D2PA 1M2OA 3BP4A 4LNRA 1EXHA 3LQZB 3T6ZA 1WVZA 4X99A 2D3LA 4KH9A 2ZX9A 4PVLA 4WTXA 4ZODA 1BA9A 4PS3A 1DO6A 4R83A 2NYZA 4LGRB 4CGUB 2GBUA 3BH9A 2TSBA 2V9QA 3JWNE 3OG4B 1YNTB 4LEOA 3QZWG 1QFPA 1QBLL 5F96L 4HJJH 3W11C 2CK2A 3CC5B 1E9QA 3FT4A 1U8KB 2NY6D 4L1SA 3UXFA 1SHWA 3LNDA 4M6AA 1PZSA 1TVHA 3ILEA 2CO6A 3FQUB 3QCTH 1ML0A 3EBGA 3VGFA 1T4WA 2VN3A 2C9AA 3L54A 3PV7A 4JHAL 3AG2B 4ONFL 1CFTB 4PJ5E 2XV2A 5CD5C 1A4AA 3UC0H 5BUGA 5JW3L 1A66A 1U8LA 1LO3L 4UI2A 5EOQL 5F71A 1IUZA 4FL4B 1RZJL 4O5LH 3A23A 3BSZH 1FWXA 1X3DA 1N12A 2BO0A 3GJEB 3U4AA 3QXUA 4I3RL 1GA2A 1H15A 3GSXB 5JUEL 2A3TA 3X11A 5CZVL 4N0RA 4QJ4B 1BXXA 2JELH 3FT1A 4FQXB 4IBZA 3G5ZA 1LILA 1MHPH 4JFFB 1QSED 1M7XA 4TXVB 4MNHB 3IJHA 4JRXE 5E2WH 3LKQB 2G4GA 1T7YA 2KBGA 3L7FA 4K3EL 2ITEA 1N8OE 4QWWD 2X4SB 3GMMB 5DS8B 3HS9A 4Y5YB 4ONGH 1T03L 2ZXGA 5IOPB 5KVFL 5ICXB 3HPJB 5SWQB 2ICWB 1JK8B 1AGFA 3POHA 4OGXL 4MD5A 2OR9H 5IMMB 4IGBA 3A4DA 1AD9A 4I4WB 1WLHA 4ERSL 1FZMA 2BIMA 4NKMA 1A1NA 1NBZB 5BV7C 4RA0C 2CDFA 4NO3A 1QHPA 5K9QI 1WZAA 3L6FB 5SWSE 1N5YL 1MN4A 3WNNA 5D7IB 4V1DB 3KL3A 4OZHF 3N85H 2IALA 2O5YL 5CEXA 2G3XA 1I1AA 2VM9A 4XR8C 2VLLA 1L0YA 5LN8A 1ZGLM 2X1OA 2YC1B 1HNFA 3P11L 5IQNA 3P3SA 3ECVA 4X0KB 4JB9L 3KYOA 4LEBA 3TIEA 1X44A 3RL1B 3V4UL 4BSWA 2M8XA 5D71H 5F1KC 3DTXB 2K78A 1BM7A 2FTAA 2X4PA 3FRPA 5I9QB 5EZPA 3U0WH 1UT9A 1H19A 3T1FB 1OCCB 1C16A 3H56A 1QFWM 3CVHA 2HJLB 5I8KH 2Y7OA 2YA1A 1WBZB 4HWZB 2YKKA 3KNBB 5E1AB 4TUUA 4XPGH 2ARWA 2VRKA 3RZCB 4JK0D 3MRMA 5LCVH 1SY6H 2K3HA 4UTBA 4HF5L 1RIUH 1PQZB 4LMQI 3V0HA 3MLZL 2KS0A 1OSZB 4LLYB 5HDWA 5SX5H 3WXVH 3RWDA 1AKJA 3RLSA 3IAQA 3VH8A 3T09A 2XN1A 2D2CC 3ZZLA 1X7SA 4RGND 1A3LL 4FQCH 3RILA 1BGXH 1IL1B 1UUSA 3B7RL 3TVMC 1B0GB 3IMBA 3TBCA 2XPGB 3EOBA 5KYYB 4MJIA 2XVBA 4YLCA 2NYYC 3SPIA 2VDQH 2KPNA 3IDJA 3ULUE 2EDQA 2ZG1A 4JO4L 3CSTA 2AEPL 1BMZA 3C2SA 3L3JA 2B1AH 4PGCB 5BJTB 1MCQA 1N7ML 3MV8D 4LU5L 2EH8L 1G7HA 4FXGA 3TO4A 1XDTT 2I07B 2XSKA 3V0GA 5FOBB 2MFNA 3K4DA 5CWSB 3H42L 1T7VA 4JDVB 1HT6A 1HXYB 3MV7A 4ODXA 1ZV9A 4PWIA 4D3CL 1HQRA 2OYKA 5FUZH 5T33L 3WNLA 2O5XH 1EHAA 3EBHA 1RJYB 3LZQA 3REVA 4ZMTA 4GY4A 2BK8A 4MD0B 5IVXA 3B7UX 3UMNA 2UY7B 2DM3A 4CA4A 2KPWA 2YSSB 3VI4B 3IJEA 4M4RA 4NFDA 3T2LA 3FU0A 3DMMC 1QQDA 3T0EA 1QZ1A 4QRTA 1ITCA 3ERXA 4EUPG 1YQVH 1ZRUA 5FYJE 3BQUA 1MZYA 1E7UA 2BVOA 4U6XA 2NY7L 3JSSA 2JKLA 3QORB 1XD1A 4X9HA 3RWIA 2FIRT 4BCYA 5CJOH 1NFDE 3MQIA 3Q01A 2EDRA 3OKNB 1XHHA 5JQ6H 3VFVB 4R0LA 4L4TA 1E2ZA 4Q9RH 3C6LD 1TMQA 4ZAKA 2WUBL 1HNGA 4FJ6A 2XHNA 1CMOA 3W56A 2VT0A 2HT4D 4CMHB 5AW3B 3V4PH 1AO7D 4HMCA 5BZWB 1ZHKB 4PRIA 5C0EB 3U6RA 4FTVA 1I85A 4KWUA 2E7MA 2YJLA 4L4VB 4NZUL 4WO0A 5DCCA 5GJTH 1SVBA 2DMBA 2YRZA 4FNLL 5KANG 3T08A 4RMQA 4ZTPH 1T21A 1X4XA 4Z7WE 1CLYL 3E0GA 1J8HA 1DJWA 1KBGL 4MMZB 1MLCA 1PLGH 3TT1H 4G8IB 5I1EL 4LNRB 2KHAA 3D85D 5CS7A 3AGWA 5CLZA 4R7DB 4CC4A 4B53A 1NUNB 4LKXA 3BE1L 3ES6B 2J44A 2QTVA 2VDLL 3B9KD 2G0LA 5DJZA 2VLJA 1TIUA 1FL5B 4PUBH 3T2NL 1D9KA 4KROB 2XWXA 4Z18A 4E36A 1P5VA 1XSJA 2W07B 1F2XK 4LESA 1E9QB 3BI9X 1MRFL 5FFGA 3NMEA 4MAUH 3ASOB 1MHEA 2APSA 1D5RA 4O02L 3LKPA 3QO1B 1AZZC 3OB0K 2Q20A 2HLEB 4AI7A 3DPBA 2JCCA 3CDZA 4E9TA 4X50A 2W88A 3MPCA 5BS0A 5EH1A 2XBTA 4E9VA 1XEUA 4PJAA 3M1BA 5GISL 2FJFB 3RURA 1A5FH 4O58H 1ZLVK 4AXWB 1U8LB 2QSCL 3K2UH 3BVVA 3DV6A 3APFA 4FNSA 4PWHA 4CUCA 4IBWA 5D7LE 4BK5A 3CFIC 1GH7A 4KXZI 1PIFA 2C9XA 3MBXH 4NOBA 5DC0A 1H15B 2FCBA 3QPKA 4PP1D 4XP6H 1IAIM 4YXKL 1CGYA 2CALA 4G6ML 5IP4A 3NZ8A 2NCMA 2XX0A 4KO6A 4RGMB 3IJHB 4W9JC 1E4XI 1JOIA 3WI9A 2OL3H 3WELA 1IC5H 1J1OH 3N1GC 3QH3A 3TA4D 4I1RA 4WK0B 5L8LB 5MHSD 5ISZE 5B1BB 2MSPA 1OL0A 3LRSA 2Y2WA 1WPCA 4TSCL 4WTWA 5SV3A 1BJ1H 2F8OA 2WO2B 4S2SA 3SDAC 1QBML 3SDYH 5JXED 3F01A 3DUSA 1AGFB 4MD5B 2ZCKH 4IGBB 5BRZE 1AD9B 1RFDH 3CZEA 4NKDA 4OUUB 1K3IA 1FZMB 3RVUC 1A1NB 4KMLB 4PWFA 5HDQH 3PXHA 2CDFB 4NO3B 2HZHA 2WXMA 3QUGA 1P5UC 4X8XA 4MVBD 3U0TB 3QFJD 5DHEA 3B5HA 2IALB 2WINA 5CEXB 5EU5A 3RIKA 5IBLC 1UCBL 4JCWA 2VLLB 4H0GA 3BD3A 2X6VA 4YDKH 2EDWA 1AGBA 1X5KA 1WSST 2Q7NA 2HT2C 5E00B 3FK3A 3KYOB 1RZQA 4HUCA 3TIEB 1TJMA 5F6IB 3KLSA 3U9PH 2R0WH 5K1VA 2W0FA 1AY1L 1YEWA 1YMMA 1UVQA 5EOCH 1Z5YD 4J4PA 8FABA 3FRPB 3SDCC 3ALWA 4QRAA 4Y4FA 2OSLA 1G43A 3RVVC 2WZ0A 5EV7A 3L81A 4I85A 3TNMB 1C16B 3OZLA 1AYRA 2KLTA 4BINA 2J5LC 4HIEA 3CVHB 1IU1A 4WIQA 3I6KB 3T3PE 1IBFA 1ONQA 1YC8A 1AS8A 4L8DA 4KY2A 2B1OA 4GQ9L 4JPWL 4P5MA 2Z92A 3FDWA 5IFHL 5KAQG 1A2YA 1KBPA 4K5OA 3NCYP 4G9DB 4NXSA 3VD2A 4WSGA 2Q10A 2VMDA 3MKGA 3FSWA 4Q14A 3L9RA 4AQ1A 1NCIA 1AKJB 2A4ZA 3VH8B 4A7GF 4IBTA 2FQGA 5T3XE 2EE3A 4NQCE 4XVOA 1I8MA 4FYTA 4M7KL 3EOBB 3B43A 1ET8A 2F18A 2OZ4L 4MJIB 5F7HA 5GZOC 3X1BA 4OFIA 1QACA 2Q8BL 3P30L 4OJFL 1RK0A 3AROA 5DHVH 3RFRA 4JFZH 4P2RB 3TJHC 2NY2B 4G42A 3L3JB 5A3IC 1ETA1 1RY7B 3RGVC 4EDWL 3IPFA 2AJUL 4MAYA 1ASQA 1FLRH 1G7HB 1U8JA 5FUOL 5FYKE 5JQIB 2H0PA 2DLTA 2X5PA 4WEBL 2DBLL 4BD4A 1DZBA 5DC9B 2I69A 3MV7B 2CA4A 3M1OA 3MV01 3L1OL 1HQRB 2D7PA 3WSQL 1NOFA 3L3OA 2J8UB 4QXVA 5DD6A 5D2NA 4WHYG 3REVB 1FH5H 1I1YB 5IVXB 3FQWA 2IIJA 2O5NA 4FNTA 1NFDF 3IJEB 5GGTA 4JL2A 2UVEA 2QSQA 1AOZA 4HWBL 4DHLA 1KULA 3T0EB 1G1CA 1F4HA 2P47B 3HC2A 3D39E 4QRTB 3SYCA 2IDUA 3BQUB 1D7CA 3MU3A 3TU6A 1QR1A 2X87A 2BVOB 4U6XB 3ARQA 5CFAA 3FOMA 3RWIB 3BRDA 1PAZA 1UZ8B 1LP9A 1IGFL 5AW8B 4R0LB 4L4TB 3G5YA 4ZAKB 2CKBH 4FKEA 1MG2C 3UTSB 1GYCA 4WWID 2BNRA 4OGZA 5BZXA 4EPSA 4FN0A 4UOZA 3IKCB 2ODHA 3TZVB 4MQ7B 1W72A 2ADGA 3H3KA 5FA4A 5KVDE 1KJ2L 1HL4A 4DO5A 3MXVL 4PRIB 4IRZA 2PO6A 1T04B 1F2QA 1Q4NX 3LYRA 5G4OA 4OJAA 5FHAL 4R2GC 5GRUH 4YHKH 3ATAA 3MI6A 5EO9A 4GAJL 4DP9X 2DJMA 1T21B 2YPLD 4JG1H 5BOJA 1R0AH 1HJBC 4H8HA 1J8HB 5KEZA 1MLCB 2MWCA 4FZEL 2VZSA 3NAAL 5AW4B 3IPBA 3HMXL 3NTCH 4M93B 4E41A 1FSKB 1X5IA 1T5KA 1EBAA 2BSCA 4KRLB 3BUQA 2F1AA 1YN6A 3PUCA 4LKXB 3ESNA 4L8SA 3QXAA 5C0AE 1BMGA 3MRFA 5KS9F 1UD4A 4M5YH 2VLJB 4B3EA 1D9KB 2GIYA 3VXUA 3EO9L 2GK0A 2XWJA 2WLNA 1P5VB 4E9QA 3HE6A 1J9QA 2H45A 5JR1H 4O2CA 4CSZA 1MQKH 1JRHI 1LK3H 1MHEB 1J9RA 4DGVL 4XN1A 3LKPB 1XX9C 1JUFA 3DPBB 2JCCB 3BEVB 3CDZB 2OCCB 4R97C 3C60C 5TK4A 5E9DA 2XG5A 3QIBC 3R8BB 5BS0B 3VD4A 4BKSC 4K9EH 4GOSA 4MQSB 5SWZA 3TURA 3F6IA 1EQWA 5AW1B 4KK8C 3M1BB 2VXVL 4PJAB 3ZHLA 4OTXL 1KYOK 1BVKA 2I9LA 3AUWB 4X7FC 3V0VA 1NWPA 2JK5A 4BH8A 1A3ZA 1MAML 3GSNL 4TV3A 3VFRA 2GEEA 2ZE0A 2EXTA 3MV9A 3Q3GA 3CC1A 1PZ3A 2K45A 5HI5C 1FYTA 5KSBF 1Z3RA 3JYCA 3N42B 3E38A 1DHKA 3DK0A 3EYOA 4GSXA 3OAUL 3MRDA 3NZ8B 3RTQB 3S4SA 3TWYA 2B16A 4AZ8A 3T77B 2GITA 3IFLL 4KZEH 1X5JA 4PD4K 1U33A 8CGTA 4GO8A 3QWQB 3QR2A 2P49B 4K3DH 3U4KA 3GNMH 2Q7AA 1MJ7L 4XZ4A 2R0LH 4RGOL 1SDDA 2Q7YB 1N3NA 4S2SB 3KHQA 3ARBD 2E7LC 5D1QC 1LQSR 1CTOA 1WD9A 3MLXH 5IEKA 4FFVC 3BWUF 3QE5A 4BSJA 4M56A 4WI3A 4NKDB 2YIHA 4BFJA 1KCVH 4PB9H 4Y8AA 5DLML 4NQSA 4V11A 5K59F 4B9KC 4P23C 4APQA 2FR4A 1AXTH 2RGSA 4G72B 4RRPG 3Q7JA 4L1HA 2RQEA 2NQDA 2WTPA 2WINB 5EU5B 3KR3L 2FB4L 3GSVA 3II2A 4PBWD 5EBLA 1AQDA 2EIZA 3TEYA 5IT2L 5LGKA 4EO5A 4Y5VA 4G6KL 1TZ8A 2A4EA 1GYUA 4AVHA 4YZFF 3SDDB 2DIEA 4U1GC 3BT0A 1V3JA 4YXHL 3VGBA 5KTEH 4EI6B 2IGLA 4P9HL 3P2BA 2BP8A 3T3PF 4U1IA 1QFWH 2J6EL 2MJWA 2QHRL 3CQQA 2WXGA 4J6IA 3TN0D 1YMMB 1UVQB 1VEOA 4ANVA 3DWTA 5KSUA 1PDKA 2DWEA 8FABB 4Y4FB 2OSLB 5I26A 3MUUA 4EN2A 4I3SH 2OMBA 4HIEB 4UT9L 5AVZB 3NSDA 4JN2B 3FFCD 2O5ZL 2XI9A 3FZUC 4EI5C 1JHLL 5CZRA 1MFVA 2GJ6D 2HWZL 2ERJB 1FRGL 3SE8L 1S8DA 4C54A 1A2YB 3CZKA 3LTVA 4MAZA 4ELMF 3M17B 3N1QC 4EZKA 1YNKH 4NLHA 1WT5A 2C4XA 4XMVA 4ZUSA 2P43B 4A2MA 2HRGA 3CSPA 4A7VA 3MGTB 1GCFA 3TEXA 4A7QA 5FLVA 2F58H 3V7MA 2Z7YA 1I8MB 3VI3B 2HKFH 1L9NA 4FG4A 3VFGL 4MCMA 4G8GB 5EDSA 2WP3T 4OR1A 2DB8A 1KPUA 3O6KL 1AC0A 2PWGA 4UIMA 1ETZA 5IB1B 1E5CA 3FU5A 1JZGA 4MAYB 1QAWA 1JN6A 1GGBL 1QLEH 5AOZA 1U8JB 1R3IL 4DKEH 3OAWA 4MRCA 4PJGB 4HS8L 1CXHA 1WHPA 4HJIA 3UROR 2JXMA 2YAHA 3ILQD 4TN9A 1RUKL 3VWJA 4M8VA 3VCLB 3L3OB 1WBXB 5D2NB 1J5OL 4YSPA 2I26N 3WDHA 4F2EA 5KVEL 1UB5A 2ARJB 3IE9A 3RWGB 3F8UB 3ARXA 4NB7A 3ISRA 4HJGA 3CHRA 3V0EA 5I73B 3QG6B 1UXMA 2ZUTA 3WL9B 3LZPA 2MH4A 4RMWA 5D2LE 2X10A 5C09E 4Z7VF 4NUGH 4LSTH 3QEUA 1MCPH 3VXMA 2V0AA 3FUMA 2WK2A 3VSUA 1QR1B 4LCWA 1GJWA 3FOMB 1PX3A 1MVFA 4L2YA 1SXZA 3E3QC 4ZTOL 1ZANL 1LP9B 3DIDA 1JGEA 1NCBL 2AXHA 1IGML 3W0WA 5KAQF 1CURA 4EI0A 3G5YB 4IBVA 3NEXA 3IMWA 4W4OC 3ABKB 2BNRB 3NCJL 3QUYD 4LAQH 4ZX3A 1UM4L 1RK7A 2CNYA 1HE8A 4DQAA 1W72B 2ADGB 3VXRA 1IE5A 3TNNB 8PAZA 3MRLA 3MNDA 3B5TA 2FK9A 1HIMH 2H32H 4PJ8A 5BQ7A 4N5EC 2PO6B 4N2IA 5DJCA 2BRRH 4KKQA 5I2IA 5K9KA 4PD4J 1MWAA 2WXFA 4WY7L 3W9EA 4TYUA 2B1HH 2VW4A 4Y1SA 5F0PB 3BKYH 2XN2A 3N5AA 5DVKA 2R56L 4DFHA 1EJFA 4OFYD 2BOCA 4GAAA 1E43A 3C8KA 4N0UE 2P5EA 3AUVA 4GMTH 4CNIB 1REIA 4OCRL 1MW3A 4OFDA 2QJDA 2Y7QB 2YMTA 1OAZH 3ZZSA 1DQQA 2CCVA 4I1NB 1KB5L 1ZIAA 4W9KC 3UO1L 3VJ6B 4E41B 1QA9B 1YN6B 4Y4KC 2JKNA 4H26B 1AXIB 4L8SB 1TG8A 1S9WA 1EJOH 1S9VA 1N0LB 1UWYA 3QXAB 2F8IA 4OBSA 3MOBH 1SEBB 4KRPC 2NZIA 5CLXA 2JF1A 3ASWA 3VXUB 2GTZA 3U48A 4JNXA 2GK0B 2XWJB 1SOXA 5MEPA 1JF5A 1IC1A 1R75A 2DMHA 3NSXA 5GRXG 4NQDA 2EXWC 3QDJD 3HJEA 1ZHNA 3CH1B 1JUFB 1L6PA 4LVHB 4TQPA 4ZXBA 1A6UL 1IX2A 2X89A 3MBEC 4F91B 1QNIA 5L2KA 3BKCL 4JO3H 5E9DB 2XG5B 1KLUA 2HTKC 15C8L 1XGTA 1XD0A 3UH8A 2Y25A 1VFBA 3OMNB 1HWGB 4F33B 2Z31B 1BVKB 2I9LB 1HS6A 1X9LA 2VDPL 3V0VB 1PD0A 3WIFA 5JIMA 4LPWA 4MMXC 3VFRB 1IAIH 2CAKA 1GC1L 3FFDA 4FG2A 1OAUH 5DJ2A 3X12B 3LS5L 5I82A 3MV9B 4N1CA 4OCMC 2VWEC 3O2DL 3OVUB 3L17A 5AOKA 5B8CA 1FVCA 25C8H 2W60A 3TA3C 1TQSA 3NRQA 4YHOL 1XZ0A 2D0HA 3EYOB 1RIVH 3CLWA 1BEXA 2ID5A 2R15A 3E9TA 4AZ8B 3WFCL 4WTZA 1HDMB 2GITB 5IQ7L 1SFDA 3OKKA 4S1SH 3DDGA 4ANWA 3OJ2C 3B56A 4WW1A 1ZGLP 1PFOA 1SDDB 1BQLL 4F57H 2YD4A 4AEEA 4ELKA 1EHNA 4E5XG 3GS7A 3NP3A 4N87A 4AQOA 2AS5M 2UXGA 3GMNB 2VRQA 3LRHA 43CAA 1P9MC 1QRNA 1XGYL 1VDGA 4L3EB 1B90A 3FT2A 2Q6WB 1SXNA 3L13A 4YXLL 4I9WD 3RDTC 4NS0A 2VZ1A 3O11A 2LU4A 4DEPC 3ESMA 4JO2H 2FR4B 5D55A 2FT8A 5JW4N 5DA0B 1CE1L 4GSUA 5LVEA 2VERN 3N55A 4JUSA 2EIZB 2Q8AL 4N68A 1BBDH 1PY0A 5I24A 3E7JA 4M8RA 4Y5VB 1QEXA 3HRZC 4N9OB 4P46A 3BO8A 1GS7A 2IWKA 2VDRH 2MNUA 5AYUH 2XG4A 5KSUB 1MI5E 2DWEB 1PDKB 1FQ9C 1DP0A 1XTLA 4CSTA 1JMZA 4U6VH 2J72A 3H9ZA 2BW5A 5F9JA 5JOFA 3OHXB 3VGDA 3RB7A 5C70A 1JAEA 4Z7UE 4Z3GA 2DS4A 2ZAIA 3RNKA 3RX5A 1S8DB 2XN9A 4GXUN 5CBEA 4AL8L 5JPNA 4PRAA 4OLWL 1YEJH 4AUJA 3LVTA 4WSJA 1BBJA 4X6FA 2MEJB 2ZOTA 3CN2A 3UYOD 1DANT 3W39B 3X17A 2R2BA 4ZUSB 3EJRA 5D4QA 2B4CH 3LHAA 5T1KD 4PJCE 3IJSA 5AB9A 2E75C 1G7LB 3DVFA 4DPCX 5D5MF 1UA6H 5C0CA 1YEGL 2G0KA 3WEAA 2IDQA 2D7MA 4NHCL 5FKAA 4UIMB 5TFSL 5FM4A 1ETZB 4LSVH 2EYRB 4HXAH 2IMMA 3L8QA 3SBWC 3US0A 1NLBH 4AK1A 2RBLA 2UZIH 1AXSA 1CIUA 2V7NB 5E6IA 2VTFA 2VZUA 1WFTA 3VWKB 4J3OH 4AGMA 3SHSA 4I0PD 1FCCA 5D2LF 2LFEA 4JVPA 2XJLA 4KKPA 4MXWH 3MRRB 3LXUX 1ZT1B 4WO4D 4F8QA 1L7TH 2MPVA 1RLBA 4PJFE 4LQ1A 5E8PA 2KLSA 3CDFA 3CQPA 5C92A 4FQHA 3RWFA 3BUIA 3VG9B 4HJGB 3LQAL 1EEQA 2WWMC 2A0LD 1T1ZA 1EAPB 4QD2E 4HUKB 3UG3A 4TUJA 2DMGA 3KYAA 3QEUB 4QY8B 3VXMB 1TMCB 5LDSA 3V4VA 4OSUH 3G6DH 3SQOL 4LCWB 3GLDA 1XF3A 3MC0A 3W57A 5IIEA 3JTSA 3T0DA 5M94B 2IBBA 1JGEB 5E4IA 3RX8A 1SLVA 2ZPKL 4H1LA 3ZZQA 4ODSH 4BFNA 5D9SA 3WE6A 4HUXA 5KYWA 2E8YA 1CDYA 2EINB 4K4KA 3VXRB 3DHPA 2DICA 3IBOA 3MRLB 3RBGA 2FBJL 4JL1A 5BQ7B 2BP3A 4R84A 3SCMB 3VFNA 2NXYC 5DJCB 5K9KB 5I2IB 1MWAB 1YEFL 3S3BB 4FQ2H 2XXGA 3KL0A 2OXGA 1A7RL 1OSPH 2YS4A 3ELQA 4NC1C 2AJYH 3FS9A 1ES0A 4G9FA 4JFSA 3WIAA 3C8KB 2Q76A 2P5EB 4NO0A 3OMIB 3DBXA 3LEVL 4WW2C 1SMOA 1MVYA 5D8JH 1DQQB 2IBGA 1NEZA 2UY6A 3GBNH 4A2EA 4P2OC 1Z3GH 4FX5A 1I8LA 1S9WB 1S9VB 2UWEE 3QGVA 4JDTL 5IG7A 1KWGA 1PLCA 4LDEB 3Q44A 1JCKA 3NFSH 5EF1A 3LPPA 2GTZB 4TUKL 4LDOB 1AP2A 3ZKND 43C9A 5MEPB 5E2TL 2GABA 4PGZA 4NQDB 4P5TD 2JKRM 4ZG1A 1ZHNB 4XNAA 4E42A 1RZ7L 3QJRB 3KCPA 3GC3A 2XZAL 4ZXBB 5L2KB 4ODTL 5JA8B 1UD5A 5F7YC 1J5HA 1KLUB 1DQMH 1BVLA 4FFZA 3DROA 1Q0YL 1U3ZA 2APVA 3KZ8A 2HN7A 2G2RB 4HPOH 4S1RH 1ZLDA 4AEFA 4F93B 2BIOA 3WIFB 2F61A 3AJ7A 1YVLA 1RL1A 4XAKD 1W6LA 2BNQE 3FFDB 5D1QE 5DJ2B 2WC7A 1OQXA 4RQQB 3GEFA 1NDTA 1PKOA 2ZP9A 2C3GA 1OK8A 5E0QA 3WBDA 4RLDA 2OSWA 1JGVH 2R2EA 5B8CB 3QXVA 4YDIH 1S7XA 3L4UA 3WIIH 2QFRA 4FLRA 1DFXA 1XZ0B 3WY1A 3UAAA 3CXDL 1T4KA 4O2EA 1EGJH 4YVNA 2R27A 2IGFL 4GG8B 2CJUL 4TLUA 2CUMA 2WNGA 3OKKB 1M1XA 3LHPH 5AKSA 5D7JD 1Z0MA 4WW1B 2E6QA 3T4AA 5AKRA 3OR7A 1EXUB 3IFOA 4KKAD 1DN0A 2XC8A 3B1TA 4K3JL 4LIQH 4WFHE 1R6VA 5GRJL 43CAB 3WLBA 3L3IA 1QRNB 1EBPA 5DS1A 4JN1L 5CMAB 5AWNL 2KUTA 3BVTA 1A22B 2XZCH 3O11B 4HJSA 4TL4A 4BFOA 4BIKA 2Y7SA 4MMYB 3QIUD 2DQEH 2Y23A 1S7SA 4WNSA 5CN2A 1GGIL 1I9JL 4XC3L 2XRAL 4AUYA 5I15H 1RIHL 3L16A 2CO3A 3BGFC 3RU8L 4DKFL 3A6OA 2YFOA 2F5AL 3P4OA 4KDTA 1AHWA 2HYMA 1L0XA 2GK2A 4KJQD 4MS8D 3K6FA 4P46B 5DZLA 3CVDA 2AQTA 5EUOF 5I1CH 3BO8B 4EIZC 4F9LC 1Z9PA 3BISA 4QF1A 4TOYL 1Z9SA 4X9IA 2XG4B 5I71C 2WJ7A 3HKFA 2WLIA 2ZT9C 5E08L 5DO2C 1JG9A 4DKAA 2XJKA 1QABA 3S96A 1KTCA 3ZDXE 5F9JB 3WFBH 2EUVA 4P48A 1DBJH 2X53A 2HT3C 1WIOA 3MJGX 1TOXA 4DP7X 4K5PA 4PJCF 4YDMA 3RNKB 2XN9B 5CBEB 4Y2LA 5JPNB 3ZR6A 1U3NA 4PRAB 4GEJA 2X2YA 2WY3B 2V8MA 1BBJB 1NAMH 4X6FB 2YMOA 2QV4A 4YH6A 1MFCH 2OZ4A 1O5DT 2H3XC 1KIQA 4MNGA 4FA6A 4HGKC 3IJSB 4TSAL 1WA0X 1Y6KR 2EAEA 2JCWA 3D69A 4N0CD 2JJVA 3I6LD 1N70A 5C0CB 3VXSD 4FHBD 3L5IA 4ZD3L 2F2HA 5FKAB 3CN4A 5FM5M 4X4XA 2Q86B 3EUDA 4CDHA 4LARL 1MFAH 1F8TH 1U8NB 1AXSB 4AQAA 4W4NA 3E2HC 4LHJB 5E6IB 1JHKH 2WXPA 4L1BA 4RZCA 3E3QE 4JQVC 3RNQA 2K7QA 4F15C 2IEPA 1WFMA 4BFFA 1SBSL 1XCXA 1T89C 3HG1D 3NPSB 3NJGA 1MJJA 1T2QL 2H2PC 3D50A 2YD5A 4OD3L 2P8PA 4Q97A</