1NM4A

Solution structure of cu(i)-copc from pseudomonas syringae
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
102
structure length
102
Chain Sequence
HPKLVSSTPAEGSEGAAPAKIELHFSENLVTQFSGAKLVMTAMPGMEHSPMAVKAAVSGGGDPKTMVITPASPLTAGTYKVDWRAVSSDTHPITGSVTFKVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Copper resistance protein C
publication title A redox switch in CopC: An intriguing copper trafficking protein that binds copper(I) and copper(II) at different sites
pubmed doi rcsb
source organism Pseudomonas syringae
molecule tags Metal binding protein
total genus 12
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2003-01-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04234 CopC CopC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1220 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 1nm4A00
1O6SA 2WQWA 3BCFA 2OMXA 2OMTA 2WQUA 4AW4A 2WQXA 1XEUA 1H6TA 5ICUA 2C9QA 1NM4A 2UZYA 2C9RA 1IX2A 3BZ5A 3FAWA 1M42A 2YA1A 4CC4A 2OMZA 1O6VA 2RA1A 4AQ1A 4CC4C 1O6TA 1OT4A 3BC9A 2C9PA 1M9SA 2OMYA 2OMVA 2OMUA 2Y5QA 3BCDA 3FAXA 1LYQA 1H6UA 4CILA 2WQVA 2OMWA 2UZXA
chains in the Genus database with same CATH superfamily
1GHFH 1S7WB 4LCWD 2YPVL 3ZLQC 4KZCA 4BSVA 2GEQA 1N4XH 1SXCA 1LE9B 2PN5A 1T7WA 2WXQA 4OJFL 1I8MA 3JWOL 3NSCA 5ELIA 4PBVC 4CC4A 1EDQA 2XXGA 3J7HA 4Y9EA 4YWGH 5I0XA 2APTA 3Q1SL 2Z8RA 3RWCB 4HCFA 3DHMA 2XACC 1SF3A 1BF5A 3PF2A 4P4KA 2V5TA 4M43H 4I18B 3I75B 3UTTD 3E7JA 2CO3A 3BKYL 4PREB 3ZTDC 2RHEA 3QPXL 5K9KA 5KBDA 4BHUI 4GAYA 1Q0EA 1AGFB 4ZPVA 1TZ8A 4U2ZA 3ESNA 1C5CH 2ZXQA 4GNKB 3OJVC 3IJYA 2A73A 4ELDA 4PJIE 4ABQA 3AWGA 4LQ1A 2PTTB 2B39A 5SWQA 4CVWA 3TX4A 1ASQA 4B5ZA 5C86A 2ATPA 5DRZA 3DJZA 3MRLA 1FNLA 4KRLB 4NDMB 3ZO0A 4BSWA 3QDJB 5GISL 3SDCA 3OMAB 3SDDC 2QGCA 1F5WA 1JWMB 4FQJL 4PI0A 4O2FA 3JSSA 2V2TB 1J12A 4QHPA 1JJUA 4QKXB 2HN7A 1H3TA 3WKML 4L05A 4D9QD 4IKNA 5E6UB 2P8LA 2DM4A 4BE5A 3CHPA 1NGZA 5AVYB 2WHVA 1A7PH 1BW8A 1NLDL 4N0YL 1L7TH 2EYTA 1VKXB 2X6CA 1P6FA 3QJXA 4AEHH 1DDTA 1CXLA 2QQNL 4R84A 4PS4H 2F7PA 2HJLA 4GG8A 2BWQA 5DMIH 1XGZA 5DMKB 4LL9A 1QLFA 3HC3H 3DIFB 4XX5A 2I5YL 3D0VA 3FQTA 2R1YA 3S35H 3S5YA 3ZDZE 1NGPL 4PJ7B 3BVVA 3NYKA 4J3OF 3KLHC 1R3LA 2EDFA 3QQ9C 4OZHF 1J8HD 1G9HA 5G5DA 3F6JA 3R0NA 3MJ8B 3MV7D 1CDCA 2G5UA 2YIHA 3V0EA 1EXUB 2AEOA 4N6RA 4HISA 5LO7A 4IIQA 5I8CA 4PJAE 1J5OL 2XQYA 5GGRY 4XHJD 3SGKC 3CVHH 3VUAA 2CMRL 3ZX1A 3TBSA 4L3EA 4EI5C 1CGVA 4EI6A 4QHKJ 5KSAB 1E3XA 2IH1A 4OCYH 4YEEA 2HA1A 2APSA 4QYOB 2WZPA 3O3BB 2EABA 4TMPA 2CR6A 1XCTA 2NMSA 3RGHA 4MZRA 4ANXA 3LQAL 4MHHG 4OCWH 1MY7A 4F15C 3L3OA 3NESA 2JF1A 3R0MA 4HT1H 1P1ZA 3GS4A 1ZXQA 5LN8A 3QDGD 4R96B 3ZL2A 1RIVL 3RP1A 3AQXA 4XB7A 2HJKB 2Q7YA 1JZIA 2HX8A 2V2WA 5AD0A 1Q72H 2X0VA 2ISDA 1HK6A 4O9HH 3ZHFA 1RQ5A 2HB0A 1HHHA 4XVSH 1DBKL 1I8IA 2NYYD 3BX7C 1E3FA 5JOFA 1FVCA 4M7JL 4YDJB 1GS6X 2IPKA 4F57L 1M7DA 4R4FH 2O93L 1UWXH 2WLYA 4PJ8C 4UT7H 3RAJH 4BFRA 5ACLA 2GI0A 1AKJB 5IM7B 2WUCH 3UAJA 3WS3A 5D1ZA 3W39B 5FYJE 3QE5A 1XH1A 2ERJC 3EJCA 3X1GA 4YWGL 3WUWB 2PETA 4C83A 2VQ1B 3H42L 1IC5H 3MRIB 4XT1C 4K2UL 2NXYB 1I7UB 1KBBA 1UJ3B 2J72A 4IRZL 4PU2A 4GG6F 4QEGA 4NPYA 5E7BA 2HFGH 3B1TA 4Q4IA 1ZLVK 2BVUA 3QJFB 4PUBH 5AW4B 4F80A 5B39B 3RX5A 4F8PA 1ZKAA 3IU4H 4JHZA 3ULUD 3ZT6A 4JN1L 4ZUUA 1OSPL 5A7EA 1NKRA 3QP3A 3R18A 2C3VB 1WE5A 3PWNB 5EG6C 4UDUB 3LEVL 3VRLF 3QXAA 4ICXA 4F33B 1BQKA 1PGRB 3D2UB 3EHBC 1FAIL 2F53E 4JFFE 4JG9A 2J1WA 2ZWYA 3E9TA 3D2TA 2QHRL 1WFJA 4DGIH 1FBIH 4IOFD 1A6VH 4F58L 4WTZG 4ATTA 1A7PL 2DOCA 1YAIA 3ZRSA 1MQKH 1OTSC 2VW6A 4AM0Q 1H3PH 4AEHL 4XGZB 4UIKH 1GZPA 1ADQA 3GSNH 3H3BC 4KI5E 2X09A 4PS4L 4F37K 1WAAF 5BS0B 3UC2A 2KBGA 5DC9B 4YPJA 1E4JA 1JPTH 3BSZA 3CUPB 5KANI 5T1DL 1NMBL 3KXFE 4L4TE 5CBAA 4CKVX 5CGMA 4HU2A 2PR4L 2AJSH 3ZE2E 3VTMA 4BKSC 4K9EL 2VLRE 4YXLL 2H8PB 1H8OA 5INDB 2HTKC 2OCJA 1G6VK 3K80A 1RK0B 2GY5A 1HHKB 5IUSA 5ADOH 5IV2B 1SXNA 5IGXH 1I9IH 1UFGA 3HAEA 4G42A 3HCVA 2X1WL 4S1SL 2YAOA 5M95B 4JDZB 4N8VG 4LFHD 5KOVC 1IM9A 1T6VN 2AGJH 1U91A 3VI3A 5D7LA 1A1OA 3VD1A 1Z9NA 2NZ1A 2XX1A 3C6EA 2AK1H 4GQ9H 4W4NA 3ZGIA 3QDJD 4JDVB 1Q72L 4J3OH 3L3GB 1YEJL 4XVSL 4NKQB 3LVTA 4FTDA 4OAWA 5DHXB 4L8CB 5ESVA 3NDZE 4M8VA 4LSRL 5KYNA 3E6FA 5GGVL 3B34A 1I7TA 2WB1A 1ZPLA 4O2CA 4JFVA 4A55A 4DP5X 5F1OB 4LQFL 5DC0A 4ENEC 2Q2LA 4XRCB 3KJ6H 1MIMH 3ARBA 5CFAA 2VERN 2E6PA 1NFIB 3K4AA 1FNFA 1PDKA 3SPVB 4N9OB 1HHJB 2H2SD 3EJTA 3GMOA 5PCYA 3MPCA 4RAUB 1B0GB 1OTUC 2O4EA 3KBPA 4OZFH 3HRPA 1KY6A 2G75B 1SHMA 1RJLA 3KCPA 4ZMPA 3FSWA 4JFPB 5L4IA 1WITA 1QMUA 1QASA 3GSXA 4IBZA 4PRIB 1ZCRA 2VLKE 2YA1A 4AK2A 1JERA 1D5ZA 3SKOA 5DHYB 5AAWA 1P5VB 1T7VA 5KSAD 4NI6A 2D0FA 3C8HA 3K6OA 1J5IA 4TS6A 3UJIH 3NJJA 3LD8C 1NEZG 5FHBH 1DUYA 2LU3A 1AZCA 3U4KA 1UWFA 5AB9A 2EO9A 1UACH 3HS0C 3HZKA 4QLWA 4JM2A 4AC4A 4G5AA 3KYOB 1EFXA 3QJVB 4IKLA 5LN4A 3QCUH 4MDJB 5AKTA 1BAFH 5DI8B 4DGIL 1CGSH 5E9AA 4A04A 4XCYB 3Q8EA 3C9NA 1FO0A 2W9DH 1PZ5B 3HB3B 1NGYA 2GPZA 3UXFA 4Y5XA 3OKKB 5FIEA 3VU1A 1H3PL 4WSKA 1HOEA 5AUMB 3WE1A 2ZKYA 3FT4B 3PDDA 3VFUB 1F97A 4DAGH 3UFIA 3IFOB 2AAVA 2FYYB 1AKJD 4LSPH 4L5FH 3O2DH 4TM9A 2XZZA 5HYSB 4X5QA 1T0OA 3PGDB 2PW2A 4M1DL 4PYHA 1DFBH 4UUJB 2NY5H 4UANA 4WWKA 2CBQA 2ZD0A 1CGTA 5DO2D 4F20A 3T3PF 5DWPA 3GFUA 1CURA 1E9QB 2V17H 1CD1A 4NFCA 2OULB 3ZTCC 4DKFH 1KIUB 3DROB 5IVXE 3DTXB 4GO9A 3BP6B 4M3KB 3THML 5C92A 5DK3A 5CP7B 4RDQG 1DVYA 2NXYD 4JPIB 2FX9H 1O9VA 4Q6IB 2CLRB 1ZXKA 4LHQB 2WXLA 1AZNA 4QRPE 5DQ9A 5IGXL 4MA7H 1I9IL 1VA9A 2JTDA 4OV6F 2DYSB 2VZSA 3HFMH 4HIEB 3ZMRA 2M26A 3BZ4B 5T33L 1BFVH 1CS6A 1IO4C 2WWMD 5KG9B 2OMTA 1E28B 4HJSA 4BFGA 1UZ8A 2AK1L 2VC2L 4HLJA 4GQ9L 4FMFA 2W95A 1PYWA 4DP6X 1I7RA 2Z8SA 3D2UD 4H5SA 5AYQA 1QWUA 2YPLB 1EXGA 3BFOA 3EBIA 3RVXD 3WAKA 3TA3C 3UTOA 4EIBA 4NT6B 5I1CH 3QIWC 3IB4A 4F2ME 3U7WH 3LRSB 4FFYA 1AKPA 2CUHA 3GI9H 1SN0A 4MBRA 3QUZC 2LU5A 2CGRH 2OS7A 4UM9B 3OAZK 4GMSL 4Z5RB 2OL3A 4W4OC 2ZUXA 4P5MB 2IANB 1TJXA 4JRLA 1UOWA 3KJ6L 4PW3A 5IEHB 4Q97A 5BS0D 3DJ9A 4GAJH 1J1XH 5EF1A 5AYUL 2FCBA 2FZ3B 4JO4L 3C60C 4YVUA 2BVOA 2PNDA 3M1CA 4ZFZB 1KGYE 1EHAA 3KDMA 1IZJA 1R5IA 4P2QB 2UXVA 1CXEA 5I6XC 3C5XA 2X2JA 3DX8A 1CGXA 1YJDH 4KI5C 1FNGA 5DJDA 1A6ZB 5I6PA 4GPVA 4WQOA 4I0PA 4Z7NB 3OG6B 1FFQA 4OJDH 3NCWA 5CUSL 5EFIA 2P5EA 5KSBB 5FKAA 5E2JA 2DS4A 1K8DB 4M48H 1ZK5A 4C54A 1T4WA 4GKNA 2CIIB 2H1XA 2IALA 3NSFA 4HP5A 3UJIL 4Z77B 1FJ1B 1KOAA 3GJEB 1RZJC 1UACL 4AYSA 1CDBA 2XWJA 3OF6D 2PYEB 4R0LB 4BZ2L 1R24A 3JWNE 5KWYC 4Y2NA 3HRZB 1D2PA 3E1F1 1S3RA 3RDTA 5CP3A 5KSVA 2D7OA 3CDGB 3S2AA 5I8KL 5HPMA 1KACB 1DE4B 1PJWA 2X4RA 5B1JA 3FFCA 3JV0A 4H8QA 2LU4A 3PIQB 1CFSA 4LKCB 2W9DL 4WNSA 2A6KA 4XXDB 4U7KA 3W9EB 3WS6C 2R83A 4G3YH 3M1BA 4XMPH 1P7QB 1ID5I 1JXGA 2VT0A 4I0CC 3QXVA 1A3RH 4MLSA 2Z7WA 3Q8BA 4KFMA 2E9IA 4RGMC 5E00A 1ZT1A 5HVGB 3MR9B 1SJEB 5TDNA 1QR1B 1IVLA 2XDHA 3I6GB 5M94B 1QI3A 3VD2A 2GUOA 4X8XA 1A8JH 3SO3B 1CR9L 1W6WA 4UI2A 1RUKL 4GP4B 3BW9A 1XGRB 5FGBC 4DVRL 5IJKA 4NQSA 4HV8B 3PHQB 1KEMH 2ZOWA 3LS5H 3QUKB 3QJRB 5IJCC 3DI2B 4BFEA 1K8IA 2FX9L 2X5PA 4PRID 3QR2A 4G8AC 1KGCE 1JIBA 5K1JA 1F4YH 1UZ6E 3O9WB 4ZAKB 4OIAA 3HFML 4APQC 3TJHD 5HY9B 4H8UA 3UAFA 2FNWA 4IOIA 1E42A 1PX3A 4FQ1H 4QRUA 3ZKMC 1HWGB 2V7HA 1LEGA 3EG9B 3O4LA 5BVPH 3APMA 4KKCC 3K6DA 4RX4A 1E7VA 2XA8L 2A6IB 1Z9MA 5ITBH 2CO6A 5E4EC 3Q6GL 5I1EH 4N68A 3BP7A 2OMWB 1URZA 1ZSHA 4OD2B 4HX1A 2I32A 3LXAA 1GTFA 3OZKA 1CE6B 3PXJA 3P4LA 1XR8B 2ZCHH 3PWUA 3HB3D 5AKRA 2CG9X 4XZUA 1ETA1 3DUHA 4M6AA 3L3DB 2ZIDA 2AC0A 1H8NA 2HT2C 3RIKA 5C9KA 4OUOA 5E8EB 2XWBA 1I1YA 5FFOA 3FDWA 3KPNB 2V5RA 5JPMA 1OT1A 4I4WA 5IBUB 4BBWA 2JELL 2MKWA 2ED7A 4X6CF 3ERXA 4PJEA 3TLRA 2V0AA 1YNLH 4ZXBC 3TPUB 4ORGA 1E4KA 1VPOH 25C8H 2CLZA 2NDFA 2H32A 3M86A 1JFHA 5DEJA 3C6SB 3F65A 4LHUA 4PG2C 2WXKA 3NEXA 4XNQB 3IVKA 3ZE0F 1KV7A 3U6RB 2RH0A 1KNOB 4YZFE 5CZXD 3PWJB 3TZVC 2IOIA 3OJDB 1QBMH 1BGXH 1D9KC 2AXGA 1GYCA 2GIMA 3F58H 3EFOA 5ECGA 9CGTA 4Y19E 3T2LA 1TVHA 4OZHB 4XP5H 5EH1A 4KUZH 3QEQA 4GQQA 5CO1A 2E6QA 4Z7VE 2YPLD 4NQDA 1P2CA 3AM8C 3G9AB 5ACMA 1UJTA 5ACZB 4LRIC 4B95C 1NC2A 5C09E 5FB8A 1C5DB 2EKSA 1ZT4A 1N3NB 4JG1H 3F7PC 4OI7A 5FLVA 3T1FB 5DURB 2O30A 1A3RL 5ESQA 4RFOL 4UM9D 4A6YB 2W38A 5H35B 4FJZA 5IMOA 2D8KA 1Y07A 2IAND 3CZUB 2F08A 2DWYA 4KVCL 4ZMYA 1WZ1H 2B4CH 3ILPA 3UMTA 3AQDA 4H13C 4BFFA 1D5BA 4TSCH 4P2QD 2X4OA 2ZQKA 4MNQA 4W9IC 4X9FA 1KEML 4BDVA 5E9NA 4CA4A 3QQDB 3QI9B 5T5NF 1JGEA 1X5YA 3BPLC 3EKCA 3TVMB 5D4QA 3ABLB 1WFUA 1RZGA 4LKXA 3TEYA 4QRFA 3CDYA 5LUMA 1QFWH 4JCWA 5C0JA 1PG7H 2UWEE 4M61B 1NEUA 3VI4A 2FHFA 3DRQB 1PY9A 1M2VA 2P26A 2PYED 4JHWL 1AZBA 1EUTA 1HDMB 1EEQA 3FQ1A 4FQQB 4FA6A 3NZ8B 4WFHE 4XX1E 5EU6B 1ROWA 5A16B 4BCZA 1RL1A 1U8IA 1IMHC 3UBXA 1X5IA 2ATKA 5C0IA 1NGQL 1OSEA 1FZJA 1QOKA 2XVBA 3DURB 2BNRA 4GG6B 1J0ZA 2E27L 1XTLA 4JQIL 3CXFA 4JLRB 3G5VB 2WMPA 1YECL 3JWNC 5EB9A 3G5WA 4QTHB 4FA7B 1ZMYA 4AMXA 3A23A 5MERA 3E8VA 5C0DB 1P7QD 3P73B 1P7KB 4HZLA 5I8OH 4OI9A 1GC1H 5D4HA 3N1MC 4WKZA 3ZE1E 1XCXA 4BA0A 1IL1A 5B8CA 5I1DA 1NJ9A 3RPBA 4L2LA 1BFOA 3VRJB 3SE8H 3WHXA 1YNLL 3S8FB 4UQBA 1GOFA 3MFFB 2RFXB 3PHSA 4MXWH 3KLAB 1VCAA 2C9UA 2XN9E 1Q9OA 1BZ9A 1I3VA 3P0YL 5EN2A 3BWZA 5J12C 2APXA 1TVBA 4TF4A 1A0QH 5AW9B 1NFDF 3ZSSA 3DJSA 4IIZA 4U1SA 1T5WB 2J71A 3LPPA 3CSGA 4UT9H 5DJCB 3RIFK 1D5MA 1M6OA 2WZ6A 5FKPB 3MACH 3O9WD 4ZAKD 3CSTA 4LB8A 4XWOD 2E9JA 1DVSA 4PVMA 1RVFH 4P5KA 4NYLA 5GGSY 1PZSA 3F58L 2ROXA 4IRJB 1MF2H 3V6BR 2VIRA 3MHZA 3DGGA 3WN5C 3GSUA 4RFNB 4X0KB 1X4YA 2X4PA 1G6RA 1Y6NR 3RLSA 1OM9A 1NDMA 2ZCLH 3UYPB 2N0KA 3RWHA 4DO5A 5F0PB 3FQRA 4GRMA 4JG1L 3RJDA 2HWZL 4HLEA 4R97C 1EZLA 4NFBA 1LXMA 1IEBA 5DVNA 3BE1H 4ZNCD 4OKVA 2CDFA 1Z3RA 5FFGA 3BDBA 1A9EB 4XAKE 1K5NB 3BZEA 1WZ1L 4Y16A 3WFHB 2EYSB 4F3FA 1IKFH 2D73A 2EDLA 3N1FC 5JPNC 1CT8A 2Q7NA 1G9NC 3MNMA 2HSIA 4OTXH 2BSTB 3STLB 2BWDA 1EJ8A 4A66A 4N90D 4PLKD 4JK0D 5E03A 4MBOA 4PLNC 1JRHH 1UFUA 3L9RB 1YY9D 5IREA 2ZSWB 4WTZA 4YHKH 4Z76A 4TL5A 3GI8H 2G2PA 4F9LA 3I3DA 4HC1L 1TTRA 2ORBH 4R90H 1OAZH 4HIHB 4QOKA 2ZYSA 3H2QA 3QFJA 3IGAB 4U1KB 2OSWA 4XO9A 1L0YA 1EAOA 3M17A 5FGCE 1KT2A 3EZJB 1RP9A 3QXUA 4E36A 4AQZA 1LP9F 3MXVH 5AVZB 3TV3L 4IBVA 1UZGA 3N1PC 1FVEB 3LN4A 2W80C 5C0RH 1XF3A 2J57A 3FU9A 4WIQA 4E9TA 4HUXA 5GRJH 1N8ZA 2ZTBA 3AUVA 5D71L 4L3CA 2FWOA 3R4DA 2DQFB 4M7ZC 5DURD 2AERT 4LCUA 5I8OL 1CI5A 1GC1L 1XF1A 2XBTA 3QUGA 3KPOA 4OJCA 4QAWA 5BMFH 4AYFA 1QBLH 5B3SB 4H0GA 1FIGL 2YRBA 4PS3A 1E8YA 1RZKL 4XWGL 3JT0A 3QGVA 5KS9F 3U2IA 3S4SG 2HTLD 2NNAB 4N8VA 4YQXL 4HUWB 1HOCA 2W94A 4FHJA 1RPKA 3ZL4H 4GRLB 4Z7WB 4TUOB 4OCRL 3QI9D 1MFEL 2OP4H 5EUOF 5DQDH 5IB2B 3DXAE 3TVMD 1X7SA 4XB3A 4S0HA 3BSHA 4ZOEA 2BP5M 1ONQB 3MUHL 4FFWC 1NC4A 1QNZH 3BCFA 2E7MA 1J05B 1VRSA 1XSIA 4LHJB 4U6XB 3EYSL 5GSRB 5K93A 5LBSH 4X7FC 3PAUA 5AOKA 4FABH 1AH1A 4DP0X 4GUOA 5TQ0H 3NCFB 2C4FT 2XWEA 1YC7A 3U2JA 4MMYA 4BFJA 2YXFA 3CFJA 3T65B 3HC2A 2DDQH 3F7RA 5F9AC 5FOBA 3ZIMA 1ECZA 3H8NA 1TITA 5EU6D 5ADPL 5IMLB 1ZSDB 4XI5D 2OYLA 4Y0GA 1E4XH 4MD4A 1X5KA 1V7ML 1MI5A 5EBWA 4N5ED 5C6TH 3TBCA 2DQTL 4NSKB 2CCLA 5I75C 1WEJL 4PWIA 3T6WA 3KPQA 1ILUA 4GKSB 5TDOB 2GAZB 3V4UL 3TEXA 3GEFA 4YDKH 1BWMA 5DVOA 4NKMB 1BQHA 5TF0A 4CL7A 1T6BX 3EDEA 1KLFA 5FUZH 1S7SA 2YPVA 3BP4A 3K5RA 4G9DB 3NTCH 2VDMB 4FKKA 1RHHA 1NEZA 5ALBL 4OCSH 12E8L 3LXCA 2Y9RT 2IGFL 1LNUB 2YQ3A 4AGMA 1P4LA 3QA3A 3U36B 4YSUA 5BZWB 3IDGB 2W9EH 1NIEA 2BH0A 3O8XB 3U30C 1OGTA 4HWZA 4QRQB 3ES6B 4PEEA 5DF0A 5C0FB 4WJ5A 4XP9H 3HG2A 3MNWA 3T4AA 2XZCH 3HJEA 3HZMB 4YHKL 2Q87A 1DEEB 2BRQA 1X9LA 4HJ1A 3MA9H 5BRQA 4OY9A 4R90L 1WO2A 3NAAH 2VXSH 5BJTB 4MMXC 1LO2L 4JY6A 4ES8A 3A6CH 4IRJD 3D12B 1I4FA 2CRYA 1A4JB 1J8RA 3BD3A 1F2QA 2CO2A 3KPPB 4ILDA 5GHWL 3RY5A 3V0IA 5BOJA 3PAYA 35C8L 1NUDA 2ZJSL 3DYPA 1MJJB 3I85A 5EO9B 1YEHL 5HYJB 1BF2A 3MXVL 5JHBA 3EH5B 1IT9H 2VW4A 2WQAA 5AZ2H 3GDCA 3Q3GA 3PS6A 4L1TA 2P9RA 5FDYA 4R4NC 1YSOA 3J07A 1U8JB 5GRJL 1RHFA 2PXYA 2XZQL 1MFCH 2C1PB 4GAFB 1ZS2A 1VCBC 3G5XA 3ILQC 1IBZA 4UYQA 1MVFA 1MXDA 3RUGA 4HUUB 1AS7A 5F71A 5BMFL 4FC3E 2NSXA 3BAEH 3QUXA 3T0XA 3T0EB 5LLIC 4LEXL 4OGYH 2VJ0A 5LXGL 1RUQH 1FIEA 2QPUA 2BFVL 1T1XB 1Q9KB 4N9GA 1DL7H 4LMQE 2WJ7A 2ILLA 4OSUH 1KB3A 2J44A 1P4IH 2YR3A 1MFDL 1U2HA 4FXKC 2D03L 4QRRE 1QNZL 4H88H 5KANG 3GKZA 5F8QC 5BCAA 3WIFB 4S1DD 2NYZA 5HJDA 3OL2A 4G43A 1JI2A 3DUUB 1V3LA 4Y4KB 3FPXA 1X3DA 4EBQL 1PZUB 5BO0D 1OAUH 3RZCA 4Y4HA 4ODWB 1UC6A 3MX0A 1RI8A 1PAZA 2P43B 2XV0A 3RVUC 4P2OB 5CU5A 3LZFL 1A25A 2NR6C 4XMLH 3GBNL 3PAZA 1C7TA 1TFHA 4KGJA 2F8XC 5AZUA 4PJ9C 4K3EL 1UA3A 1QBAA 3V4LA 5C6TL 4HJJL 3ARQA 3S8WA 2X4SA 4BZ1A 3JV4A 1G7LA 1YCSA 5DZVA 2C1OA 5FM5M 5AW2B 2J8UB 4XMKH 1HL9A 4ZW5A 2H0JA 1OE2A 4YDKL 3PWVB 1TYJA 4XC3H 4XPAL 4JM0A 1CL7L 5B7MA 3PNWA 2PTUA 4LDOB 3J8F7 1W8NA 2Z9TA 5AOLA 2K6YA 3QWNA 1MIEH 4JKWA 4NO5B 1AGEB 1KPUB 3KLLA 2VLMD 1ZGLM 5B1KA 4Q6KA 2PWDA 5C0GA 4OCSL 3EXLA 3IGKA 1GPOL 5EN3A 2R56L 5DS1A 4D7BA 4F92B 4UTAH 4GRLD 3K71B 3ZKXC 1FV1A 1OP5H 4TNFA 4GXUN 1CDGA 5INCB 2R0LH 5K9OB 2P4AB 2OYKA 3N50A 1WC7A 4YHYB 3VH8G 5DTFB 4Y7OC 4C59B 1QVOB 5SWZD 2NQCA 3BAXA 3QR1A 4N22A 1N7MH 4G5ZH 4OVVA 1R0AH 3D69A 2H4EA 3A6CL 3HUJA 3LQZB 2YK1H 4FNUA 3RTQB 4AYDC 4OLUL 3IJHA 1VESA 3N91A 1HSAB 1L9MA 1BWWA 2IAMC 5DDHA 4WF7A 1XF2A 3V4VB 2A74B 1UADC 4YBLC 3CSYB 5I1IL 1WV7T 4MAYB 4NUQA 3MDJA 3VXSE 3DX4A 1LWRA 2WB7A 3ZE0B 5JA8B 3WDHA 5ANME 3QZPA 1J9TA 4X80H 2RCSL 4AVKA 4EIZC 2XQYK 5D7JA 1L3WA 1MFCL 4IEFB 4M6OH 1U3HA 3TBYB 1SVZA 4BZYA 5LG6A 1NGWB 1DR9A 3D0LB 5FYKH 4W6WB 1E3ZA 1EK3A 3MBEA 4FJYA 5C6WH 1NCUA 3EGDB 5FO8A 4CJ1A 5FM8A 4NQUA 2AEQL 2XPZA 2Y7LA 1G7IA 2BIQA 2BOBB 3VWJB 4LGPB 3SBWC 1WUZA 1RUQL 3KG5A 1BF8A 2EDBA 3DMMB 5EZPA 5KVFE 4KU1A 2CM6A 1E65A 3DBXB 1DL7L 4G6MH 4Z7QE 2FWSA 2ADJA 3O6LH 3MROB 3KM1A 3QXDB 1E6JL 1SXAA 4JG0L 4TTDC 2AJYL 4W9ZA 4E9RA 3VFVB 4ZO9A 2HKHH 2R4SH 3DTDA 1SBSL 3O8XD 5E8PA 5B4MC 5IHBA 1J5HA 1FORL 2O5ZL 4TVPH 3B8YA 2LVEA 5CCKL 3WJMA 4IRSB 2Z64C 3RWDB 5E6SB 3VI3E 2HRHA 4ZS6C 1CG9A 1YO4A 3RB5A 3MLYL 4JY5L 4YUEH 2BMKB 1MLCA 2WQXA 2H2PD 3IDMA 5MI0C 4MCYA 4PWKA 2ADIA 4XTRD 4G82A 4PG9A 3LIZH 2VZ3A 4G6JL 3E8UH 5H2BA 4UNUA 4YMPA 5DWUL 1TKWA 2PR9A 5HYJD 1AD0B 1CVSC 1Y0LB 4L9DA 5KN5B 4XP4H 1WF5A 3MLVH 3D3VD 2A9NH 4HUNB 1FFOB 5E99H 5EBMB 1BFSA 1U95B 3QUYB 3WHE1 4JFZL 2HJFA 4HWBH 4Z7UF 3BQUA 4FHKA 5GRYA 1I31A 5DJ8A 2A6JB 3RPIB 5AG9A 4MWFB 1VZGA 3B3BA 1TEGA 1GGIH 4OLVL 3UYRH 4KJYA 3T0ED 5IG7A 2E0PA 1ZT7A 1DTUA 4TNWK 5ESAA 4ZNEA 4FOMA 1LEIA 5C0AA 2UZPA 3HZVA 4UTAL 3AAZA 1RZPA 2A83B 1U8MB 1KN4L 1FL3B 1QQDB 2OJZL 3MOQA 1EA9C 3U1QA 4YSTA 4EVNB 1T1ZB 4GSUA 3RILA 5BZDA 3CQFA 2DQEL 1WCBA 5JTWA 1F6FB 3WXWL 3L16A 4NKIH 4OIIH 1N7ML 2H3NB 4KAQL 2BO0A 4MNGB 5I30H 3MRBA 4I3SL 4Y4KD 4IIQC 1CGWA 3BXNB 5DFTA 1WCQA 4U3SB 1U8LA 3P9LA 4JFUA 4F7MA 2PTVA 2FR4A 4WI7A 3DOSB 3C87A 4P2OD 4OBSA 4P9MH 1VEMA 3RWIB 1NFDB 5TDPA 4X80L 3F5WA 3L3OC 3WEMA 2N1TE 4O58L 3NQKA 3ATEA 3Q5OA 3MNVA 4M6OL 2O6PA 4HEMA 1U8NB 4DKAA 5FYKL 4N1CA 9PCYA 2HKAA 1P1VA 3MLXL 2XRAL 4NS0A 5E6YA 5LNEA 5I1GH 1HSBA 4WHYG 2Y06L 4URKA 5DYOB 1XZ0B 2YBRB 1CQKA 2QPFA 3KYMB 1Q38A 3DV6A 5IW1A 1I1AA 2J25A 3TIEA 5IK3B 3T6ZA 3RGVB 5GXBB 4PS8A 1E9PA 2VR7A 1ZVYA 4FNLL 2VLJB 4G6ML 4MB4A 5IROD 1HKFA 5T1LB 3OPZL 4XO3A 2EC9U 2CKBH 3COOA 1S5IL 4M6ML 3UAJC 1FFPA 3EJZD 4C4KO 3LZNA 1LK3H 1IEAB 1VHPA 3BMVA 3MV8B 3W2DL 3HE6B 1ZLSL 4TVPL 1YNKL 4YDMA 4B9PA 5GS1A 2D7MA 4PV8A 5HHMD 1LO0L 5IB5B 4HCRL 1CF8L 2FJSA 4AUJA 1FN4B 1A64A 2Z0BA 3KJ4C 1H0DA 4KX8A 1K5WA 4WSGA 5MENB 3WAJA 2PABA 5I23A 3DJTA 3V0FA 3WN6A 2DYPA 3BAYA 1RPQA 3DSFH 2EH8L 3CVIL 3RTQD 4Q52A 4ZW3A 3E8UL 3RNKA 3Q2CA 1VFOA 4LSUH 2UY6A 1FFNB 1G7MB 3BIBX 3BPOC 4MAYD 5L2KA 4XP4L 1J9SA 4DZBB 3D48R 4CVXB 4CVUA 4KTDL 2ALAA 1RERA 2K8MA 3BWUC 3DYMA 2ZZUT 4X7SH 5E99L 2P5WA 2GTWB 3V5KA 1F3DH 3F7KA 4M62H 2QPDB 2TSAA 4FCAA 4IHBA 1F3JA 4YL9A 2Z93B 5DUPH 1MUJB 2IIJA 5KJRH 1HQRA 4G71B 5E23A 4B3VA 1ZJBA 1CQYA 1MCBA 1E5BA 2BOCB 5EO1A 5LCVA 1H15B 2A1WL 3GRWH 1MCQA 4MD5A 3VWJD 4PRHA 1GL4B 2KZKA 1IC4H 3DMMD 1LP9B 3GZPA 4P48A 5GRVK 1CLOL 2DI7A 3HBQA 4OZIB 4HQQL 5HI3C 4HIXL 4RISL 1Y6KR 1H3XA 3VD3A 1MCHA 2P5EE 3WNIA 3FQXB 1QABA 3FH7A 3HHRB 1EO7A 1GY1A 1U6AH 1N64H 2HVJA 2JCWA 4NKIL 1IC1A 4UOQA 3FRPA 2A9AA 4KX9A 4IRSD 3CZFA 1U8PA 1VZHA 5AOJA 5I30L 3GGWA 5F7KC 3I2CH 1JWUA 3GJFH 4L18A 2VXQH 2J55A 4P0DA 4GRWF 2GT9B 2X0UA 3RHWK 5FW6A 3PQYB 3SODB 1UD2A 2EECA 4IKIA 3TEWA 3SCMA 3KMDA 4P9ML 4KRPB 4A2FA 2QMKA 4JX0A 3ORJA 4YXHH 4Z8FL 4NB7A 5EUOB 3MKKA 1FNAA 5FA3A 3WXVL 3BT0A 1HE8A 4BSVB 4OM0H 1BDYA 3HN3A 4A38A 4JPWH 3MJ9H 4G7RB 1MJ8H 2H1PL 3NRQA 4BKLA 4YHNA 1I8MB 3MU3A 4DPBX 3QUYD 1MAKA 4GYBA 4N28A 5I9QB 4JO1H 3ET9F 3HI1A 2EO1A 4XOAA 4X4YA 1NPJA 5I1GL 3Q01A 3AS3A 3S37X 5DEFB 3NZSA 4XBGB 2E7LA 1TZIA 1NANI 5L0QC 2W60B 5K9KB 3FQUA 3S34H 43C9A 4EEEA 2AW2A 3QG7H 5D7HA 4U1LA 3U48A 2A73B 2BP0B 4FFTA 1H5BA 3UBGA 2YRZA 3ARBC 4JGUA 5C0BA 1FGVH 2KUTA 1NCDL 4BHUA 1UD5A 2DB8A 3CLWA 4YDVB 2ETWA 4BSWB 1QA9A 1QYGL 4F8LA 1PLGL 1JPGA 5I1JL 4CU7A 2A99A 3OXRA 3N43F 5AW7B 2FJHB 3AT9A 4HS3A 4W9FC 5F6IC 3W9DB 2NQDA 3AXLB 3VXTB 4DGYL 2AJXL 3GHBL 2V9QA 4XCEB 2ZICA 2LU7A 3FONB 3O4LE 5I76A 2ADFH 2B8OT 2A0LD 2YWZA 4P2YA 1HCFX 5AAWC 3ESOA 5IVNA 3IJ7A 4QY8A 3CFDB 2GEEA 2D4FA 1MCFA 4AENB 4H1LB 1GSKA 5JO5A 2HJLB 1XD1A 3QDMB 3SIKA 2EILB 3KR3H 3S4SA 4N2NA 1QLFB 2OAAA 1R1CA 3HBZA 4DTGH 4JM2C 3GLEA 2R1YB 4WEUD 5I5IA 1S6NA 3VXQA 4M62L 3GPEA 3MUY1 4WO4C 3ZZSA 1KEGH 5FYLH 3LDBC 2YAPA 2NY2C 5G5DB 3T3ME 1BA9A 3G5YA 3QORB 5DUPL 5M7QA 4AT6A 4N6RB 5D7KE 3LJ3A 4NUPA 4HOMA 3II3A 3IXAA 1N0LA 4EI6B 1G7JA 1CIUA 1Z1WA 2DIAA 1R47A 4L3EB 4Y5XC 5DVPA 5TFSH 3TBSB 1IC4L 1NCWH 2W92A 2IADA 2CA4A 3RGVD 4R7NA 4XMZA 2VLJD 4HDIA 4D9LL 4QT5A 3VYOA 5T1LD 4JY4A 3BLBA 1LMIA 3W5MA 3UACA 5GGUA 1P1ZB 3MV8D 4LFHG 4MTMA 2BVEA 4WWKC 3HE6D 1U6AL 4LOFA 1N64L 4XODA 1IEHA 1NCIA 5IFHL 4FNSA 3FHAA 2Q7YB 1AI1H 3KH3A 2V2WB 2DTMH 2GK0A 3QDHA 5KBMA 1MFBL 4N5UA 4AVHA 5C0CA 3LNEA 5HVHB 5L8KB 5D70H 4F7TA 3UMNA 1J86A 3SKMA 5MEND 3OMIB 4PJXA 1FVCB 5C07A 3MO1A 1MH5B 2IPKB 4NZDA 1M7DB 4MA3B 5IQ7H 3LHPL 3QEQE 1R4XA 1S9WA 4OCNC 4YXHL 3UC0H 5CEXA 5DMJB 5CLWA 1G43A 2X53A 4NQDE 5D2LE 4NM4L 3LPOA 4PRBB 3U4EB 4NIYE 4ZMTA 2QKIA 2R2EB 3AJ7A 3UZEA 1KYUA 1N67A 5DMGC 3T8XB 1XMEB 1OV8A 2NUTA 5CEZD 4B53A 1WFOA 3RVWD 2BNQA 3ZE2F 3FBKA 2DJUA 4OIBA 1JSYA 3T9WA 3ARDB 4MS8D 4WCYH 1AS6A 2IDQA 4FQPA 2Q8AL 4DKEL 3BRGC 2RBLA 4QTFA 4ZX4A 2EDKA 4X98B 5DZOA 3UEQA 1ZLVH 4RMBA 4J27A 3S34L 2FO1A 1KDIA 3QG7L 2VZ1A 2OQJA 3O3EA 4L8SA 4MNQE 5EU4A 4YSOA 4JRXB 3ZHDA 1C5BH 4P23C 3MMEA 1CK0L 4JFTA 5FF6A 4ZUUB 4WLCA 3RKDC 4DP7X 3RWJB 3V0WH 3MAWA 1ESOA 4QRSA 4DK5A 4PGBB 4BGDA 4UOW0 1JF5A 3TIDB 1RP8A 4KMTH 5ENWA 3VXPA 1HS6A 1TEYA 1IGJA 3QJTB 4CSPA 5EOQH 2CM5A 1HL8A 1UM4H 1AFVL 4FP8L 2OI9C 3QYNA 3FXIC 3VI4E 4ZFOA 3MRPA 4DFIA 4CBPA 5HGAA 5E2TL 3S96B 5CN2A 4Z3JA 1OCRB 4MJ2A 3PQYD 1WZMA 2N01B 4MYWB 2YD8A 2Z3FA 4KRPD 4RBPK 3AACA 3ZUCA 5LVEA 2BNRE 2FX8L 3HIZA 3KR3L 2AV7A 3ZYOA 2K6ZA 2IPUK 1BJMA 2BXZA 1ECYA 4J6RH 3TWYA 3EH3B 3HW7A 2PYFA 5TK2A 1S7QA 3DVFA 2HUEA 1IKNA 1HZLA 4TLKA 2VZVA 2PP7A 4EQ2A 3WUWG 4KHXL 4AH2A 4OJEH 3EADA 2Y7OA 3I9GH 3JZ7A 1ET8A 3GQFA 2YAMA 2GY7B 3MLWH 3GSVB 3N3EA 1F90L 1PKQB 4ZW8A 3KPMA 2CKBB 1L5GA 2O61B 1TETH 4ALAC 2ZKHH 1P69B 5MEQB 1IM9B 1MQ8A 3L9YA 5DO8A 2DKUA 5FYJH 5JMRA 3FSVA 1YEDB 1KN2H 4CSZA 1ZE3C 5IMMA 4H4NA 1M05A 5A3IC 2P80A 2DTML 3QIBB 4MKTA 1MJ7H 4RGOH 3Q43A 4N2GA 1XX9C 2ZKWA 3DX6B 2ARJB 5H4ZA 1CLZH 3L45A 1TTBA 4OAWB 3UZVB 1ADWA 4JNXA 3ULSB 1FHGA 1JFQL 4LPXA 1AHWC 1ZHKB 3GB7A 3KWWB 3TWCH 4WEBH 5IR1B 5DJAA 1P7BA 2WIIB 2FQDA 4O2CB 1YN6A 3AG1B 3IAGC 1RY7B 5C3IA 1JK9A 4A7GA 4P2RA 3DLQR 3PHOB 4KK6D 2WV3A 2IGTA 1SLVA 3QDMD 1WJ3A 1XSJA 2DN7A 3EYOB 5EULV 5HSFA 2VITA 3GSRB 4XBMA 3MCYA 5JIDA 2CHWA 5F9WB 3KS0H 4FI7A 4OZGA 4G59C 1RJLB 2F74A 2H1LM 1YHPA 3ARPA 1OARL 4IKKA 4QGYA 3ZKND 1DQML 3PABB 3GSXB 3Q2WA 2KDYA 2OZ4H 3QORD 4JHUA 1D5ZB 2QSTA 3VH8A 3QK0A 4G11A 5GZNA 4EKJA 2AMGA 3OPUA 2HYMA 4E5XG 4L3ED 1GYVA 2D2OA 5IHUL 4P5TA 5GS0C 4WJKB 1N6QL 4UM8A 4J3WA 4JFSA 1MCRA 3ARYA 4K3GA 3LRKA 2WZPD 4K5OA 4FHBD 2R0ZL 4XH2A 3P3UA 2BVQB 1E7UA 3UBFA 3W3BA 5EZJB 3OR7B 1HHGA 4FQHA 5JPMC 1A6AB 4R7LA 4KMTL 1JYWA 3HE7C 1DQQB 1J1PH 4BFBD 5JQ6H 1PFCA 3U7AA 4NRYA 5I74B 1EFXB 4IQHA 1E4KC 3BEWA 3VFMB 4U1IA 2E3VA 3QNZA 4YHPB 1RZJH 2E7HA 1QP1A 3N85H 4MAUH 2OXHA 2WSPA 2G2RB 1IX2A 3CZSA 1FO0B 1INEL 3D39E 3FB6B 3PJSB 4KKLC 3QFJE 5AB2A 3OJMB 1XZWA 4ONHA 1XDTT 4E9LA 1Q0YH 4Q9RH 1UB5B 2WUBH 3MREB 2FQFA 5B1AB 4QXUL 3RL2A 3ZVVA 5BQ7A 5JW3H 4OD3H 3HC4L 2YUZA 4PJHA 1DO6A 5D1ZD 4PJ8B 3D9AH 5HYFA 2OSLA 2F7RA 3K6FA 1BREA 2APVA 2VL5B 2QSCH 4QO1A 3WNLA 3FU7B 1JZEA 1QW9A 1YN7A 1BVNT 1CD1B 3ARDD 4MJ6A 5E1QA 1CFBA 1MCKA 5B38G 3PCYA 3I9GL 1SQMA 3KYKL 4TUKH 3GSWA 1ID2A 3LQMA 3TL5A 3MLWL 3L6FA 1B4RA 2X89D 5J6GA 5DVMA 2LVCA 1TETL 1RZ7H 4JRXD 5HXMA 5IBTH 2EUZA 3L3KA 1E0OB 2XG5A 5MEOA 5DQJB 4DEUA 2MWCA 4NHUA 1T1WB 2EINB 5FUOH 2CK0H 2KZWA 2VDLH 2RALA 3IJSB 4ZD3H 3MJWA 1MJ7L 5HHQB 4QRTB 3BH9B 3HNTH 3ULVD 2Z65C 3U4BH 3MUGA 1JHTB 2WLIA 2MCAA 4ESKA 1XIWA 1RUAH 4WEBL 3K72B 4XNBA 3NIFB 3ZDYF 4Y9FA 3LRHA 4NNXB 5IQ9A 5FECA 2WSDA 2OL3B 5I73B 3MV9A 4PGEA 2D31A 1MI5E 3BP5B 3VGHA 2NY6B 4QCIA 1F4WH 2VR8A 5F6HI 1DVUA 5CSZA 4G8FA 4V1DA 1R5IB 3P3SA 3QNXA 1P6WA 5GGTL 5F88A 2WKGA 4F7PA 3DX8B 5HYSG 3T2NH 2WWOA 4J28A 3PWPA 3PV6B 4XP6H 5LHDA 1E2ZA 1PNDA 4JRYA 3JV6B 5E8NB 3P11H 1TQBC 5GS3A 3VVWA 3WNOA 1T3FA 3Q7JA 1A2YA 4MJ5A 1KIPA 2FB4H 3T8VA 2VDKL 6CGTA 1KTJA 4WFFD 3QUMH 3X11B 1IM9D 2XWJB 5B8CC 4LNRA 1A6WH 1R24B 5JQ6L 3FH8A 3CD4A 4NC0B 1M7IA 3QIBD 4AGNA 4LCWA 1VEPA 1RZJL 2VJXA 3N85L 3LZPA 5CLYA 5F3HB 3DPDA 5D7IA 2I24N 3DUSA 2G60H 4Z3GA 1PY4A 4J2QA 2F0CA 1I1CA 1C12A 2EZ0D 1XBDA 4FLRA 1RULL 5SWSE 3VXUB 2OMXB 4X83A 2A4EA 4BRJA 3NJLA 4FG6C 4I0KA 5JW3L 2V3EA 4OD3L 5E00B 3E1ZA 4K8RC 5HVWA 3UTTA 3QARA 4AXWB 4JPKL 4IGBB 2DQDL 3GT6A 3R19A 1ZAGA 3WMQA 5EPMB 4B96A 1MG3C 1VACB 3POHA 3AXHA 1IBHA 1OTTD 2I69A 3GIVB 1HIMH 1TSRA 3RUGE 4TLUA 1Y6MR 2QV4A 2WNWA 3T2QA 5GGSB 3QSKB 4GRWB 5D93C 1BPVA 5HGBB 3L5HA 3Q44A 4K73A 3BSGA 1CCZA 1TU2B 1DQJA 3KPLA 3OKDB 4YZFF 2F7QA 4CILA 2G5BB 5DD1H 3KLHD 3EDKA 1MWAH 4HKXB 1OM3H 1NMCB 1AIZA 1CC3A 2HT3D 3CMOH 5HHXH 3KYNA 2AKRA 1O7SA 4ZUSA 4IOIB 1E4XI 1XQ4A 3CDZA 2XPGB 1U58B 4MX7B 2A7BA 4UYPA 2CK0L 3LEXA 5GSVA 5C7XH 4N2MA 4U1NB 1EFXD 2B1AH 3U4BL 4OF5A 4HJGB 3G04A 2DQIH 4HFWA 1T83A 1DJZA 1YPZA 2G30A 5IEKA 1INQA 4ELMA 2JK5B 4LPTA 4HIJA 2K3HA 4CN1A 3N42F 4U2YA 1XO8A 4MA8L 1YYMH 4DT2A 4H8WC 4XZUB 2JB6B 3VFSA 1W8EA 5LWYH 3QQ3B 4D0CA 3AU1A 2EDTA 3CTTA 4LLMB 2ZOKA 1LJMA 3QFGA 4G8GE 3WELA 4NO2B 2GQHA 3JWNH 2Z1PA 4I4WB 3QCVH 1TLKA 1GIGH 5F3BA 1OAXH 1RUPL 3FCBA 4YSDA 4YK4B 4X6EA 3ABKB 4CC1A 4PJEB 1KXHA 2EAEA 5KAQG 2A77L 1B3IA 2CLZB 1W2KT 2GFBA 4ZPTB 2H32B 1HI6A 1UD8A 1X5HA 4XP6L 4AZ8A 5I26A 3E38A 4XCCL 4MZIA 2XJLA 2YMTA 2Y2WA 5HDBF 4HALA 1M6UA 1FNHA 2EQDA 3IDYB 3U7YL 3NGBB 5EZIH 3MLUL 3SKJH 4EDWL 3PWLA 3IM1A 4JKMA 1B4TA 1BZ8A 2GBTA 5IJVA 2AEPH 2UWEF 3MZGB 1JZ8A 2RIKA 2BIIA 4X6FB 4KKQA 1KBGL 4IJ3C 2Q6WA 4MQ7B 2BW4A 1HKLH 1TR7A 4EAEA 4NUGH 3GC3A 3JYCA 3GNML 3IMUA 3FS9A 4KXZI 1ZTXE 3FO0H 3IU3A 2BRRH 4ZRGA 2G60L 3UGUA 1NC2B 1X5ZA 3HUJE 4U7SA 4PJBB 1LTXA 5LGJA 2IOOA 2F15A 1TNMA 2WINB 4D2NA 3E2HB 5EA0H 3FRUA 2ENSA 3LHAA 5FGSA 3O3AB 4JO2L 3TESA 5ISZA 2BZDA 3MRCB 2BZ7A 1Z5LA 4XO4A 3ZE1F 1ND0B 3Q13A 4NJ9L 2NY6D 3QUZB 1ROCA 1W0VA 3MJ7A 5EEXA 3FUHA 5EC2B 4OLXH 2CDEA 4F7EB 4WY7H 1UYWH 2EUWA 4O51A 1HIML 4BDVB 4BKTC 2F5BH 3EO9H 1O5PA 4P4RB 3CE1A 4M7KH 2V3DA 1WFTA 4MXQC 1IBGH 2CCWA 4WKXA 4L9LB 3QZNA 4OH2A 2HMID 3GZQA 1XR9A 3FK3A 4U3XA 5I6XB 4NXSA 2YD1A 4CRPA 4F9PA 2QPEB 3JV5A 1MWAL 1OM3L 4TQEH 2HCZX 5DK0A 3VDCA 3P30L 3EOTH 2B9BA 4QXTA 3WD5H 1DFXA 2LQRA 4URTB 5CEYA 1AJ7H 3PRZA 4ZK8A 2VO5A 2XN0A 3DO7B 1ZGLP 2HX7A 4D9RD 4X99A 3PNRB 3RI5K 1F6AA 3JWOC 5C0IB 5JIHA 4A2LA 1S7WA 1AG0A 2DQIL 3QRGL 4J3OG 4Z95L 5KYWB 4YE4L 4FL4C 4AG4L 2WTRB 3QJHA 4UQ3B 1UD4A 3VVVA 2VDML 4W9CC 5K39B 2WVVB 4UQIM 4AK1A 2OCCB 1GGCL 1L4IA 4EN3B 3HPLB 1KTLB 3VXUD 5LWYL 5HD8C 4S1QH 4ODTH 2BSDA 2COQA 2MTAA 2CCVA 5CD5C 3AQZA 3I75A 3KDPB 5F21B 3D50A 4XP1H 1GIGL 4IGBD 4M8UA 5F7FA 3WHXB 4RGMB 4FLHA 4JCMA 2EEBA 1LO5B 1NAMB 4OZFG 2IMMA 1N6UA 1UATA 3VGBA 4OQTA 4LSSL 4G6KL 4JFWA 2PTTA 2ZONA 5CNHA 4I48A 3SBQA 1E5AA 1THCA 3FUFA 3HNVH 4HKBA 5EZIL 5EF2A 2XVKA 4ZNEE 2PXYC 4ZX5A 4AQEA 4AUUA 1SJVA 3GS0A 1KJ2H 1PX4A 1IBBA 1KFAH 2A2QT 2AEPL 1RD6A 4K7PX 3VQMA 1ZLDA 2A5UA 2FL5B 2G5RA 2V5MA 2Z7ZA 4BFKA 1JV5B 1G4RA 1OANA 2JLLA 3O4OB 4JFQA 5E2UL 4TOYH 1F3DJ 1T66C 3B5HA 4E9WA 4HG4J 3ZKSD 4JJ5B 3TN0B 2Y23A 3QS2A 4P3CL 3FQRB 5DMKA 5E4EB 4OT1L 1ZLWH 4PJ7A 4Y7MA 2CDFB 2XTJE 2MH4A 3C5SB 3N1GC 2AQPA 1ETZB 2HP4A 3MJ8A 1HL4A 4Y16B 5CKGA 4Y4HC 2X40A 4M02A 2VDNB 3LQAC 4X50A 5CGYC 3NFSL 5CCGE 1CT8B 4MQXC 2ZNWA 3PXLA 4K3DH 3WEXA 2F5BL 3JUYA 3NA9H 4M7KL 4QYOA 2EYRB 3S37H 4J5VA 1G1KA 2J6EH 2XC8A 2WQSA 4HJ0D 1IBDA 3RBSA 4PGCA 4B0MM 1FPTL 1S5HB 1UD3A 4TQEL 5LGHL 1JI1A 1BM3H 4R96A 4DEPB 3BZFB 5JIIA 4AWJC 1JGLL 4ZQKA 2HJKA 2HLEB 1F2XK 1KULA 2JXMB 4AKQA 2AANA 3F01A 1OD9A 1R3IH 4QOKB 3CIQA 1PD0A 4D0BA 3C08L 3UTPD 3STZB 4ATWA 3WJJC 3GXMA 1V3MA 4YL4A 4UB0H 4ZJ9A 3VNYA 3K46A 5E08L 5I0DA 1FGNL 3OMZA 3CHOA 1AKJA 1ZV9A 2K7PA 1DBJH 1C08B 4FTVB 4AV5A 4N6QA 1NC2D 1XF3B 5F7EH 4HHWA 3ISYA 3W39A 1HH9B 3EXJA 4WW1B 4WW2F 2ESVB 1N8ZB 2B5IC 3VB9A 3EZ8A 1I53A 2FWOB 3UH8A 2OYPA 3WUWA 4ODTL 2JKTM 5L2KE 4PJ5A 3KPOB 1SYSB 4AYFB 5E4OA 4Q9QH 2R29A 3MRIA 4OD1H 2PCFB 4XP1L 2P5WE 1I7UA 1UJ3A 2YXWA 3QUZD 1OOAA 5C0ND 3SJVB 4IDJH 2DLFH 5FEBA 4N8VB 2BP3A 1HOCB 1OXYA 1W8OA 2A4CA 3QJFA 3CZJA 3TPKA 3OKOB 1BX2B 1X5LA 2WSKA 5E6IC 4Z1PA 3H9ZA 3B9KC 1CJYA 1XHHA 3DOHA 4WJG3 1G1CA 2IFGA 3HNVL 5ID0B 1N59B 5D7JC 2JCCA 2JKIS 3V4VL 3VGAC 1U3HC 2G4GA 1RZIB 2XHNA 5I71C 4PJGE 5FCSH 2JKJA 4F33A 3D2UA 4S1RH 4RRPG 4RMTA 3MBEC 4B9FA 1W72B 4KROC 4XN8A 4ADJA 4JAMA 5CN3A 4NCC1 2AK4B 4NBZB 1DVFA 2NY3C 3FZUD 4R9HA 1RIHH 4HH9B 4I7ZC 2N59A 3OKNB 4E9SA 4JPVL 4LCCB 2WOBA 3US9A 3B7YA 3BKML 4XGZA 2DJMA 4MD4B 5BS0A 3BRFA 3PPSA 2ZF8A 1GGBH 4FQLL 3VXRE 4FA8A 4K9EC 2B2XH 2IFFH 1UM6H 1EHKB 1TJHH 4Z3IA 3H85A 4FJ6A 5HDOA 4YSSA 4XMVA 3D25B 1E4WH 3OV6A 1Q0XH 2ZPKH 4RMVA 4EN3D 4EZJA 5C2BH 2AQTA 4XAWH 5IKCB 4Y5VB 2H8PA 3GPSA 5INDA 3MLZH 5DFWH 4D3CL 4OB5H 1RU9L 4R7XA 3ETBF 4NAQA 2FGWH 4NGHH 4W9HC 3VXMB 1HHKA 5AVWB 2XYBA 5IV2A 4PBWD 3VA6A 4GUQA 5FW8A 2FJGA 4UBDD 1DLFH 1F58L 2F7OA 2P7TB 3S37L 3R1GL 2ZP9A 1GGUA 3PJLA 4JDZA 5CIPA 3FB5A 1AR1B 3ZDYB 3IDIB 4R3SB 3WO4B 2PCXA 1T1YB 3MNWB 3OXSB 3NJGA 3T4AB 2XVLA 5J12B 4JDVA 4WV1C 5SWZB 3L3GA 4PLJC 2AI0H 3M8OH 4FZEL 3SDAB 3V7AE 1CB4A 4GKLA 1PQZB 1OT2A 2NNFA 2DBLL 4JY6B 1NINA 2N0MA 4FFVD 4CNIA 1BQLL 4L8CA 1T2QH 4W93A 1I4FB 1UOLA 2GSIB 3QO1B 1X5MA 1PAMA 4XPFL 1SNRA 3O2WL 4H8HA 4UB0L 5CS7A 2R0KH 1A02N 2JLPA 3O6MH 3RVVC 4CU8A 4KFZC 5FLUA 3IFNL 4JHAH 5BV7B 3US0A 2AXHA 4NUMA 2HG0A 4QXWA 3TN0D 1NFIA 3MKGA 4JANB 5F7EL 5KJ4A 4AC2A 1TCRB 1MSPA 1HHJA 1KB5H 1NMAL 2K6WA 2ED9A 4Z18A 4RAUA 1UA7A 4XR8C 1B0GA 4DHLA 4KBPA 5DHEA 4UZGA 2G75A 3B7TA 3VB8A 1I7ZB 2GK2A 4ZTPH 4JFPA 4Q9QL 3F62A 3FT3B 5HI4C 4PRIA 1K3ZA 4Y16D 1XAUA 2VWEE 5DHYA 5CJQH 4RGNB 5H37H 1P5VA 2XQ0A 3A22A 3QPQC 5TE4L 1U30A 2XTJC 1UWGL 1BSIA 2NDGA 4GXVH 5LGKA 2AXWA 4G8EA 4R26H 4WFED 2NY1C 4EJ1C 3QHZL 3VSQA 1NIFA 3VCLB 4NQCA 1U93B 1A1NB 5AWNL 3OB0H 5L9DL 4G43B 5AVUB 1RZFH 3KYOA 8CGTA 1YEEH 1KXTB 3B9EA 1PZBA 3MJ6A 4MDJA 2MPAH 1TQSA 3BWUF 2KC0A 3H2PA 5DI8A 3VX1A 2Q5BA 3J2PA 2IGLA 4XCYA 3RZCB 4DFHA 3BKJH 1RIHL 2A6DB 4QOKD 1PZ5A 1I1AC 1KYDA 1MAML 2ZYRA 1UKQA 4HZAA 2B1HL 3OKKA 2EDOA 3BDYH 4ZS7H 1B2WH 5GGQL 4PD4K 3VQ2C 5AUMA 1FE8L 5HGHB 5I2IA 1SPDA 3FT4A 1BQ5A 3VFUA 3IFOA 4DKDC 1TLMA 2IFFL 1UM6L 4KY1L 4JR9H 1TJHL 7TAAA 4Z78B 4FTVD 5C07E 1N5AA 1Z0MA 5I1AB 5HYSA 4U1JB 3PGDA 4UUJA 2FATH 2C1OB 2F8OA 4GSDL 3IDNB 4UZUA 4XNUL 2ESVD 4LGRB 4KXCA 4XPHL 3LV3B 1E9QA 1ZA3A 4F8TA 4M4RA 1KIUA 1ZTMA 3DROA 4MASA 1J0JA 5CP7A 3K91A 4Q6IA 2BNQE 3SOBH 4FXGC 1Q9LA 3CH8A 3SJVD 5C0GB 1DLFL 4Z7QF 1ES0B 5DZNA 5GJTL 5IQMA 4DSYA 4HIEA 4YHMH 5DRNB 3BZ4A 4XB8A 3WFEL 3GUTB 1QLEB 1E27B 3QS3A 4YHZL 1GGYA 1TMQA 1E28A 1JXDA 5DR5L 1L6ZA 3LPWA 1JZFA 2QELA 1MJUH 4JEGB 4PB0L 5J89A 5AL0A 3P3RA 3A6BH 3FKUS 4L0ZA 1BZQK 4LARH 3EJYC 1A4KB 2YPLA 3P3TA 5CEZL 2YOCA 3D05A 3BUIA 4L8DB 4NT6A 5JW4M 4NENB 1J8SA 2B16A 1DVQA 3CK0H 1T4KB 3LRSA 1NWPA 1P5UC 1ML0A 1OALA 2AK4D 4WUUA 3IGLA 2R0KL 5A6IA 3O6ML 5TF1H 4PRAA 3DK0A 4UM9A 1JVOA 4OFPA 1ZV2A 4KMLB 4P5MA 3MCLH 4JHAL 5IEHA 5HDBB 4EPSA 1KCVL 2R2BB 2YUVA 4ONOA 3EYQC 4ZFZA 4Z0BH 4N2OA 3L08A 4BE6A 3HHSB 4MAZA 1PEWA 2VM4A 4RZKA 1II4E 4ZTPL 4MRCA 5FO8B 1LDPH 1HZKA 1WTGT 1A6ZA 1OHQA 2OZNA 2HLFC 3E6HB 4FDWA 4KO7A 2D3JA 3CVHA 3S0PA 1G7IB 2FDBP 5E9DB 3V9FA 3OAUL 1KTRL 3P1VA 4M7LH 4WI5A 3SE9H 3LYRA 3VXMD 1K8DA 5HHOE 3A3YB 2CIIA 4I1RA 4Z77A 4OGXL 4GXVL 1FJ1A 3LVEA 4R26L 5DJZA 2YA2A 3GJEA 4IU2B 5MEPB 1U21A 1YQ2A 4R0LA 1AR1D 1MHPH 2DIJA 2FUQA 1Z5HA 4H8VA 3HRZA 5DEGB 4BRVA 2VXTH 2X42A 3FU8A 2AVGA 1KJVB 3UDWA 1RZFL 3CDGA 4YOKA 1HYSD 4RRPM 1TO5A 1CBVH 3TFKC 3FN3A 2VRAA 4UINL 3SDAD 3MNZB 3PIQA 3Q5YA 3MLTA 4JM2F 4LKCA 3ELAT 3H6AA 1T0PB 5JXEA 2VDRH 4XXDA 4BQ9A 3LZLA 3M6DA 3BDYL 1TQTA 2JJUA 1P7QA 3U0PA 5H2BB 4PVLA 4YGVB 4FNPA 1H5BC 5GJSL 3ARGB 3L3JB 4U1GB 1U41A 4HPOL 2NX5E 3MR9A 1SJEA 2KZ1B 1QR1A 3I6GA 3MA7B 3ZQXA 1SHSA 2FHBA 4OJAA 2FSEA 1XGRA 1DZ0A 4HV8A 3PHQA 1TJIH 3X1NA 1IIKA 3QUKA 4BFIA 2DLTA 1NCCL 3ZXAC 3TEZA 3QUXD 3CHQA 1TJGH 2ENYA 3NP3A 4W6XB 3SOBL 1ZT7B 2ENQA 3NJFA 2O5XH 1LEIB 4OZGE 4K3JH 1VDGA 5C0AB 4X4XA 4RGND 3ARVA 3RU8L 3HZVB 3O9WA 4ZAKA 4YHML 4XOEA 3HZ3A 3MRRB 5DD5H 4M5YH 4AV4A 1O6VA 4IMKC 4QJ3B 3MLRH 3EG9A 1V05A 8FABB 2Y3AA 1A7QH 1JDAA 2VWEC 2EVGA 3A6BL 3FF8A 4WK0B 1ADQH 5GRUL 5L4JA 2FBOJ 5I0WA 1JL8A 3MSPA 4JO3L 1GYAA 3IPBA 1YMMB 2QVMA 3DDFA 4FXKB 2OMWA 2WCPA 3BSZH 1D6VL 4H25B 5CZRA 3CK0L 4YDLB 1EMTL 2M8XA 3N0PB 4ODHL 4WI4A 1B6DA 1CE6A 1UVQA 1U8LB 5E1HB 3U2SA 3ZGHA 7FABH 3RZCD 1M9WA 1XR8A 4PVBA 2V8MA 3WEAA 5TF1L 5L7XL 5KVFH 4N0CD 2OR9H 1P4BH 1FSKB 4D0DB 2I7SA 1K4CA 4BA8A 3L3DA 4KNQA 1AE6H 4IBTA 3OKEB 2ZKXA 4LXFA 4NOFA 5JHDA 1PX8A 2YFNA 3BAWA 1BVNP 3F5WB 4HIIA 2QVIA 5T5NG 3KPNA 3MNVB 2P8MB 4AE1A 4Z0BL 1G5AA 1NFAA 3HAEH 5IB1A 4NBYB 5BW7C 3FHEA 3TPUA 4DW2H 1BVLB 1RV6X 1SXSA 4KKRA 2WZ0A 3C6SA 3Q48A 4EIGB 5IW3A 1AZUA 4XNQA 1WBYB 5IW1B 3U6RA 1KNOA 2FT8A 1IGMH 4QF1A 2GC7C 2HG5B 2WVUA 3DV4B 3PWJA 3VSTA 5HYEA 3OJDA 5E5RB 4ZW7A 1G5GA 3TT1L 2QKIC 5AW5B 3UZEC 3V6OA 4ZMAT 1M56B 4GS7C 5DUBB 3KM2A 2YUXA 1JGVL 1JG9A 1TDQA 1X9RA 2YARA 4PV8B 1IQWL 4OZHA 3SEPA 1MCNA 4JE0A 3EJQA 3L5WA 5F9DC 1H0DB 2Z4TA 5ACZA 4DN4L 3NCJL 3WMPA 5JQIB 1P84K 4JZJC 3NMEA 1KBWA 1CD8A 3O6FB 4FFWD 4P57B 2DYPB 1C5DA 4X6DE 5FO2A 2G0LA 1E40A 3B6SB 1EJ6A 1N3NA 2WN3A 3HOGA 2O5NA 4L8SC 4KXBA 1OAYH 3D09A 4YDIH 1JD9A 1OW0A 2OCFD 4F7CB 4U4IA 3NP4A 4A6YA 3Q2NA 5H35A 1RURH 1E50A 5IJDC 3FULA 1S2EA 3X1BA 2ZUSA 4K7FA 5KBKA 3VFGH 4NNPH 1G7PB 2UXFA 5JA9A 1SFHA 3MV9E 1LDSA 2VNCA 1XEUA 2MTPA 3QQDA 3H55A 2WXGA 4DPAX 1EJOH 3QI9A 4NKDB 1JHKH 3K2UH 2CO7B 4V1DE 5E9DD 2R2HA 4J12A 2YFOA 3TO2B 3ULVL 3H2WA 2F8VA 1ODUA 2WP3O 5JYMA 4KKZA 3PWPE 5CILH 5DD5L 4BFOA 1UCTA 3C2SA 4LAQL 1JDDA 1FLRH 1LD9A 4M61A 3MLRL 3QT2A 4R6UA 2K9FB 4WW2B 2R8SH 3DRQA 3L5JA 4QLRA 1WD8A 3OKLB 2GJZB 2PLTA 1HDMA 4FQQA 3UO8B 5EEWA 4HBCH 4X4MA 3NZ8A 5A16A 5EU6A 4HUKB 3D7PA 1JNLH 4BSJA 3CZFB 1IKNC 3U46B 4AITA 3D51A 1KCUH 1YEGL 1EZVX 5C8JB 5EEYA 3CLEH 3VD5A 3QNYB 7FABL 1JS4A 3OAWA 4GG6A 1I3GH 4FKHA 2OXGB 4JLRA 3S3JA 2YD5A 3G5VA 3ZYIA 5KVFL 3TH4T 3QQ4B 3SCMB 4QTHA 1ZVSB 4KQ4L 1HZHL 4M6NH 1AO7B 4LCWE 3P73A 1P7KA 3L4WA 4GAGH 3O2DA 4MHHI 2PCYA 5D7IE 1H8SA 3ARGD 4JRWA 1PW3A 2LFGA 1IM3B 4M8QB 4E0RB 2W5PA 1C16B 4KI1A 4E41A 4YNYB 1JPSH 2HH0H 2PPEA 3PY9A 4BKLB 4GI6A 4E9VA 5C71A 2WLLB 2X9ZA 4NFDA 2FD6L 1FZMA 3HI1B 4X4YB 1ZOXA 1WA2X 2G4EA 2RFXA 3MFFA 4ABVA 3U79A 2R39A 3KLAA 3FAWA 3UTTE 1TZIB 4R4ND 4DP9X 4FLOA 3NDYE 1JXFA 4LL1A 2WIMA 1T03H 1AXTH 1BQUA 3Q8CA 3AC0A 1GJWA 1ZHLB 1TOXA 3ILQD 4BXVA 1LQSR 43C9B 3L7FA 3G7TA 2K78A 3OGCB 4NJAL 4KXDA 1C1EH 1CWVA 4U1LB 5C0AD 5DJCA 5FKPA 1WAAA 2NQ3A 2NUPB 1B88A 3QPKA 4UV4H 1VSCA 1SQ2N 3EFDL 4K15A 3S6CA 3ZT5A 5C0BB 4FFYH 4YFLI 1QPXA 4PRDA 2P49B 4IRJA 2DJSA 1TQWA 3LN5B 4W9EC 1JPGB 1JZ5A 4A67A 3B7UX 1OKEA 1IGIH 5I1LB 2Y22A 3FMGH 3W57A 4RMQA 5I6NA 3T6QC 4DWHA 4D9QE 1AP2B 1YMMD 2P44B 3BGFC 3UYPA 3V0DA 4F5CE 4P06A 1J0KA 1N19A 2CA3A 3ZIYA 4P5TC 4HGWB 5D2LF 4P46B 5E2VL 1WUNT 3LH8A 2WBJB 5EV7A 1A9EA 1YPZE 4ZODA 1EDYA 1K5NA 4ELME 4LSQL 4AW4A 3VFGL 2GBUA 4B9CA 4KJWC 4XCFH 4PV9B 1PIFA 3ATAA 2OMZB 3L1GA 1VJSA 1J8HE 1EEYA 4DP1X 2GB2A 3MV7E 3P54A 1EJOL 2EDQA 2BSTA 3UIYA 4HYTB 1JHKL 1OT4A 4HH8A 1Z9OA 4XPGH 2EIDA 1N0LB 4RRPA 1G7JB 3GMQB 1FH5H 1G7HA 3GO1H 3Q8AA 4CADB 5EBLB 3ZHNA 4EZLA 1ZA6B 1T2XA 2HRPH 1ZHBB 3L9RA 4JW3A 1FO0L 1W0WB 4JY4B 2AQ3A 3I50L 2FNBA 1F1DA 3QDGE 4QTIL 1U92B 1FHNA 4HIHA 4KPHL 4U6VL 5FXCH 4PHXA 3NUKA 2AABL 4NNYA 3CV5A 3IGAA 4U1KA 3WSQL 1HWHB 4JDEB 1JNLL 2GK0B 3ZZQA 5C0CB 4ALAH 2PUQT 4K7PH 3VI4F 4F7TB 5KVEL 1GW6A 1F02I 2MRYA 3QG6A 1ZE3H 4PJXB 1FVEA 3FL7A 1N9PA 3MO1B 3O6FD 4QUOA 3K1KC 2DYPD 2Y0SA 4XNXL 4HFUH 2PPFA 4M6NL 1RZKC 5D5MF 3BKCH 2DQFA 2LAAA 2ZYHA 2I25N 1JYXA 3EJJX 4CMHC 2HH0L 4DGVL 2MKLC 2EXSA 3BPOB 4AIXA 3V52L 3NIGF 4KRMB 2NNAA 1XL6A 4TUJB 4HUWA 4LVOB 2KHAA 4AUYA 1A7OL 4YO0B 4Z7WA 1CZ8L 4TUOA 1PFOA 2YSSB 1XIWC 4EUPH 1LE5A 3FB8B 2QT6A 1RCYA 2XQBH 2L0DA 3D1MC 3O3EB 4XNAA 3TV8A 2FLBT 1ONQA 4KO5A 2GJPA 3VXSB 1V3JA 5SWZA 3MMEB 4U6XA 1AYOA 2R1WB 2BSRB 5ANMB 4Q8BA 1G9ML 3OHXC 4DESA 3MC0A 2BY3A 2J5LC 1INDL 2H0PA 3V10A 1MCWW 2R27A 2YO3A 3VFWA 5MHSD 1H3VA 2NY0C 3VXPB 3VWKA 2OL3L 2QJDA 3T65A 5GS0H 3V0HA 1IGIL 1IGJB 2ZG3A 3P9MB 1WZAA 3QWQB 5IMLA 1ZSDA 4JFYB 3KLKA 4H0LC 4NP4L 4U0RB 4RWHA 4AV0A 3AY2A 3IMSA 3TEUA 4AIOA 4JS7A 3SCMD 5I82A 4GKSA 4ZI8A 1PIGA 1E5CA 5CSGA 2W81C 3T0WA 1AO7D 1J1OL 1UHVA 4YR6A 1TPXC 4NKMA 3I84A 3G08A 1RAMA 1IM3D 3IMTA 4GUPB 3BLKA 4G9DA 1J18A 7PCYA 5FHAH 1T04A 1BXXA 2Y7NA 3GM0A 3UX9B 15C8L 3P3YA 3VG0H 1CDUA 5CLZA 4LBEB 2CHNA 4HS8H 4MJHA 5ETUB 1NGXB 1LNUA 1IGYB 1QEXA 1XGYH 4MCNA 5K33A 1X7TA 3ETSA 5BZWA 1OGAB 3IDGA 1AAJA 3O8XA 4QRQA 1E4HA 3ES6A 5C0FA 2ZX9A 3KPMB 3I3EA 1VADA 1L5GB 4WI3A 2W65A 5MP6H 4DPRA 3NG5A 3HZMA 1DEEA 1D7CA 3D85B 1IU1A 1HEZB 2ZYIA 3AY4C 5F1NB 5C0BD 5BJTA 4GSRA 5AALA 3TTYA 2Z31B 1A4JA 4JVUA 4PR5B 3KPPA 3QDJE 2YUWA 1ODAA 5CMAA 5CU9A 3EGXB 4K7PL 3N55A 3PP4L 5EO9A 2F7IA 5HYJA 5F1IB 4H40A 1DSFH 1XT5A 1SM3H 4GFTB 2NY7H 2YKLL 1SY6L 1YN6B 4CGTA 2C1PA 2PF6A 4TSBH 1JK9B 5B22A 3ZT7A 4P46D 4EMZA 2DWTA 3NH7L 4HUUA 2WBJD 4L4VB 4APXB 1CLYH 1F8TH 1TYEB 3VTTA 5A2LH 1RPUA 2VITB 3T0EA 4Q56A 4IBLT 4IHOA 1BFTA 2B14A 2Y1VA 4PJ7E 1USQA 3QO0B 1T1XA 2FWLB 2F74B 3CXDH 1Q9KA 2Z91B 2XKSA 2GJ6B 2ITFA 2EACA 3NPSC 1T83C 3UG5A 2OTUB 4JQXA 3UERA 1G94A 1J0YA 3LKSB 4WO4B 1EJFA 4ZMOA 3FCTB 3VQLA 1M42A 2AQSA 3H4FA 3A5VA 3WIFA 4PMEA 4Y8AA 3ZDXB 3FNKA 5E8OB 5KUKA 1PZAA 3DUUA 4QMEA 2YPKA 4V2CB 3F64A 1XGTA 4XHJC 2AJVH 5CZVL 1JNNH 1KTDB 2EEXA 1AANA 2V4LA 5GS0L 2VDOB 3WO3B 4ANWA 1CTMA 4P2OA 3IWVA 3BEWB 1GVIA 3QNZB 5C0CD 1JUFB 3NN8A 3NABH 2I9LA 1N68A 1UH3A 1AQ8A 2GTZA 4I2XE 2DD8L 2BJMH 2DMGA 2I60H 4MCZB 2WC7A 2AQ2A 4HPYH 4UQAA 3UTZA 2F54B 1FFTB 4GEJA 4YFEA 1YEKH 1BMZA 2OMVB 5BQ7B 4I9WD 5F0LB 5CN1A 5FAAA 2ICES 1I82A 4PJHB 2NYYC 2FSDA 1MCWM 3CAFA 3JUZA 4MB5A 5I5RA 1C9SA 4NO5A 4RFEB 5FHAL 1MCEA 1KPUA 1E5ZA 3ELQA 3CVCA 4QO1B 3FCGA 3ZRFC 5ICZB 5K69A 5IROA 3B2VH 4PV1C 1UWEH 4MJ6B 1JZ6A 4K8RH 1CFTB 3ILDA 2CZNA 3K71A 4Y2DB 4HOZA 2VCOA 2VDQB 2VR3A 2WNKA 1G6RH 4UT9A 1DEDA 5K9OA 3ZQ9A 2IPTL 4N2BA 2W0KA 2YD0A 2QLYA 1YVLA 5MP6L 3VXSD 2AVFA 1WH0A 3L3KB 5HI5D 3RY6A 3H6JA 2EVJA 3S3CB 2XG5B 1F4HA 2D3LA 1EHLH 1T7YA 4X6CA 4P23B 3LQZA 3RTQA 4YLQT 4A2HA 1HSAA 3LS4H 1XSKA 2PWEA 3V4VA 2A74A 1NAKH 2IDTA 5E0FA 4MAYA 1DSFL 2AJ3B 5K59E 4AJVA 2GYSA 4GLRH 1JGDA 5D6DA 3U1SH 2OMYB 4MDIA 4LASH 4O5LL 3QHTC 4IEFA 3NJHA 4O02B 3TBYA 1S7VB 2CBTA 2HZHA 3LOWA 1NGWA 2JI2A 5BS0E 3EGDA 4IOFC 5DVKA 1JYNA 2VLLA 4MFHA 3WIIH 2ENPA 3KW8A 4YSQA 2BOBA 4H8WH 3VWJA 5F88B 3DMMA 4ZMNA 2DW5A 3ZMEA 3DBXA 2CLVA 2YOAA 3MROA 5PAZA 2ZOOA 3VFVA 3FFDA 4MA1C 1EANA 1OGAD 1KCRH 3MOBH 4HSCX 3GTVA 3WIHL 5HHPB 2H26B 3S88H 4RAVB 1NCAH 1A2YB 5DZJA 1A6TA 4JDTH 4MJ5B 5EZOH 4XNMB 4UDTB 3GXTA 4IRSA 5ABAA 1L3NA 4MZ2A 3RWDA 3U6XS 3KPRB 5F93C 3ESPA 5FPIA 1ZD6A 4I18C 5D7EA 1URIA 3D85D 2BZCA 4N8CH 1JNNL 1ITBB 1MNUH 3UPAA 2F58H 1S9YA 5CWSB 2Z31D 4ODUA 1A7NL 1LO4H 1PSKH 5TH2B 5J1TC 3F04A 3QEHA 4AQ1B 1NBZB 4AKPA 5KN5A 4EOWH 4HEPG 1EGJL 4LPYA 1OAJA 4HMCA 5EBMA 1U95A 2BY2A 3QUYA 5DEZA 1OP3H 1EVUA 5AAMA 1EZUA 4RQQB 3RPIA 1DCEA 2A6JA 4H2AA 1AD9B 4JMNA 3L81A 1L0QA 4MWFA 1QHQA 2E4TA 4L4VD 3O0RH 5DD0H 3DTUB 2GG1A 2WXMA 1F4XH 1MVYA 1SBBA 2DQUH 3RI5F 5HGGS 2EIKB 3DBSA 1UWEL 1CGUA 3DX0A 1LEKB 4TPRH 4DH2A 3CQQA 1ZV5A 3BQVA 4EUPB 3JTSB 1U8MA 2QADB 5JDSA 2GJ6D 4PRIE 1FL3A 3TM6A 2IDFA 4B9GA 3ETBJ 2ZUYA 1G6RL 2H2SC 3G3LA 2FT6A 4WO4D 3RX8A 4PTTB 4X4KA 3SOTA 1T1ZA 4EVNA 5IMKB 5LBSA 1THAA 1A6UH 2X7LB 4JFHD 4U05A 2VJ8A 5ABDE 2H3NA 3CDZB 1J5CA 4IBUA 2F18A 5JHAA 2C3WA 4G9FB 3P02A 4M9OA 3VGGA 4DQOL 3BXNA 3LEXB 5SV4A 4U3SA 4AEEA 4BH8B 1S7TB 3GXFA 1E8WA 5KSAC 4HXAL 1ILSA 1NAKL 3DOSA 1YG9A 1BHGA 2AQ1A 3HNSH 5JIPA 1ZIBA 3G04B 3F12B 2VDNL 2YPVH 3RWIA 4KRNA 1NFDA 3HN5A 1MDAA 3VQ1C 2PW1A 4LASL 2O6DA 4OJFH 3SGEI 1U8NA 1RJZB 3P4NB 3JWOH 2F54D 3GWJA 4M00A 4PRPB 3Q1SH 4JE4B 5DYOA 1MFVA 1XZ0A 2HPTA 4ZMVA 2YBRA 1VFMA 2LW3A 3TYGL 3VFPB 1BVOA 2JNZA 3CLFH 3QPXH 4L29A 4X6EB 3TT3L 1WZKA 5IK3A 4J23A 4E2OA 1L9PA 2VLJA 3NJIA 4KVNL 2WLJA 3W11D 4Y2DD 1KENL 5C0EA 1IEAA 2Q76B 3HE6A 5D2LB 5DO2C 1NCAL 5KTEH 3OG4B 3T71A 2YXMA 1WT5A 4ORZC 3TP4A 5IB5A 2Q10A 1V5JA 2XYCA 2X12A 2FTAA 4FQJH 5MENA 5BRZB 1UH2A 1KY7A 1UJ3C 1V7NL 2Y72A 3BT2H 4KZEL 3AG2B 1QFPA 4P23D 5F72S 1V54B 3ARWA 1NLDH 1LO4L 4LCVA 4N0YH 4YHIB 4WWID 5T3ZD 2YPLE 4A1RA 3IFLL 4OFIA 2WWMC 3FOMA 4U6YB 1FFNA 1G7MA 1U3NA 2BS71 2NW3A 3MYJB 5T8IA 4JKPL 1ZS8B 4DZBA 4PVNA 4A63A 5EZLB 2I5YH 5IFJB 1KPRA 1ORQB 1NGPH 1S78C 3RVXC 3UBHA 5ISZB 2IANE 1A14L 3T6VA 3UJJL 3OZ9L 2CGYA 2Z93A 4UQ2B 5I28A 2XWRA 3CU1A 2KYIA 5DD0L 3L4YA 3MJ7B 1W0VB 1F4XL 1J5OH 3F7QA 4P2QE 2BOCA 3VMPA 4PWGA 2CMRH 4HWNA 2VXUL 1LP9A 3KW7A 1FLTX 1BXUA 1HESA 2QQLH 3D4YA 3KBFA 1F00I 5DSCB 2E75C 3P2BA 4LLYB 4AVJA 4Z7NE 4UTBA 3LQAH 4DK3A 2IWGA 4WTQA 5HDQL 2BY1A 1PKOA 5D5MB 3ZZ1A 5KSBE 4ACPA 3FQXA 3AGVA 3EYUH 1DBMH 5EDXA 5DK0B 2CHDA 2OR8A 3I9PA 4JB9H 4ABUA 3P4OB 2H6OA 4BELD 3KPRD 1TQCB 1DBKH 5D8JL 2PYEE 1IB5A 5IFAH 1E6OL 5KS9A 3NIGB 2GT9A 3PQYA 2D9CA 4M7JH 4Y5YA 2KMWA 3IN0A 3HR6A 5EUOA 3ECWA 4XN2A 3LKOB 4OR1A 1R5VA 5JYLA 1IBYA 2COVD 3QJHB 1SEBB 4L3FA 1JVKA 3Q1EA 3WE6B 2BCKB 4KV5E 1NLBL 1FG2B 3NFPB 1CYGA 3ARRA 4BWWA 2BVPA 4B9YA 3KCWA 2UZYA 3CZKA 5H4YA 3RWEA 3WKPA 2EP6A 3BN9D 1BECA 1RFDL 2XOTA 1AOZA 2SEBB 1CMOA 3H42H 5DEFA 3W37A 4XBGA 1VAHA 3IXTA 4N4YB 3PFQA 4K2UH 3E80A 2W60A 3CLFL 3HBGA 2NY4C 5CXPA 4IRZH 3TO4A 5GRVL 3U0WL 3LXBA 4CMMB 1HX0A 3QAQA 1IAKB 1UCBH 2BP0A 1SVCP 1ZTXH 4KKPA 2E47A 3ZTNL 4I48B 2QADD 1KCSH 3BESR 4JN1H 5KVMC 1OSPH 2C9SA 3M1OA 4HKBB 5EOCL 4CU6A 2XG4B 1YYLL 3G9VA 1NUGA 2XWDA 3K8MA 4LEEA 4YDVA 1DDHA 3LEVH 4YPGA 4AQEB 4RNRA 3RURA 1H9DA 3I6LD 5D93B 3WGVB 3FCSA 1ZHNA 1EAJA 5FM5O 4J4PC 3RWFB 5BV7L 2X6VA 1FAIH 2FECL 5EWIL 2DQGL 2FJHA 3IK2A 2X88A 3W9DA 3AXLA 1NDTA 2QHRH 3VXTA 2NZ9D 4JFQB 4G9FD 3FONA 4XCEA 3BT2L 4F58H 1I8KA 3LSOA 1YUKB 4Y2OB 5IWLC 2PCPA 3I9AA 4ODSL 1M7UA 3CFDA 4H20L 5DZPA 3TJHC 4AENA 4H1LA 5D7KD 3ZO9A 4BD4A 3OAYH 4XE0A 1BYNA 3QDMA 4Q89A 3PYCA 2ZWSA 4EDXA 4LIQL 3H9HA 5T1DH 1NMBH 1WIUA 2PR4H 3L4VA 3BVWA 3IBOA 4K9EH 2IJ0C 5TE6L 4PRPD 1T2JA 1XTMA 4YXLH 4E9XA 3QORA 5FCUL 1IIIA 1KPVB 3KBHE 2EO7A 3HB3C 2Z7UA 1D5RA 1QG3A 2P8PA 3WEXB 3C8KB 3VAEA 4ADIA 2AEWA 5AENA 4F1SA 1HXKA 2QDWA 4OLYL 3K6IA 1LK2B 2QQLL 4S1SH 4N90E 2HT4D 3FSZA 3HI5H 4PGCB 3FQ4A 5DRWB 1NZRA 4PJGF 3EYUL 1DBML 3QIUB 4ZQKB 4JB9L 2QPSA 3C6LC 4ISVB 2YC1B 3J27A 5K9JL 3V6OE 1LLAA 1YEJH 4BZ1L 5D4JA 2FJFB 3WI9A 5IFAL 5BRZD 3V55A 1NEPA 4D0BB 4B50A 2H45A 2H3XC 1MH5A 3V4PB 1JV2B 4LSRH 4MA3A 4OZHE 5GGVH 4JZOB 3WKQA 4LNVA 3H56A 3U4EA 2DV6A 4NZUL 4PRBA 4LQFH 2J20A 2R2EA 4OLZH 3NZHL 3T8XA 3H3PL 4HWBA 2JJSA 1M57B 5HYQB 2J4WL 5AB1A 2H7WA 5IW6B 1QLEL 1DSWA 1Q1PA 1FNSL 3ARDA 4PJ5B 5ISZD 4QR7A 4I5BA 1KCWA 3HZYB 2AS5M 1AGCA 1W6LA 4X98A 2F1EA 3KAAA 2X89A 4JRXA 1UCBL 1ACYH 4MB1A 1FC1A 4KZ0A 1ZTXL 2IQ9L 1OD7A 3SQOL 2FE0A 4F24A 3GUFA 1KCSL 2CO1A 4NI3A 2Y07L 5E95B 2YD6A 4MXVF 3RWJA 3EFFB 1W9XA 4OUUB 2JCCB 1EAPB 4PGBA 2X3AA 1NA8A 2VXVL 2YAEA 1TUPA 3TIDA 3BPCB 3HS9A 1OWRM 2EXTA 5F9OL 4GW4A 5EDSA 3CFIC 2J43A 3PE9A 4JAMB 4YHOL 4E9QA 5TE7L 5K9QG 3DSNB 1DVFB 3S96A 3GMRA 1E2VA 3D52A 3ZY7A 3NT0A 2ZUQB 5EU6E 1I85A 4H8PA 4Y1AB 3FTGB 1WHPA 4KJQD 1B0IA 2Q0ZX 4GG6E 5KTEL 4OVUA 3HC0B 1QUPA 4KQ3H 3DHPA 4B6ZA 4R0LC 4BFNA 3ALPA 4M1DH 3HRZC 4HAKA 4DNLA 4J39A 3GMNB 3SPGA 1EEZB 2JQAA 1X9UA 4LZKA 1ETB1 1U8KB 3ABZA 4XPBL 2MQ3A 1OWWA 4E5XB 5DRXB 5FDWB 4AZUA 2QLVB 3THMH 4NC1E 5ILTL 2MEJB 2EE6A 2J1ZA 3T77B 1S9VB 1KXVC 1OL0A 2FJGB 2VDPB 3GSVA 1XGQB 1PKQA 4K8RD 1JTTA 2CKBA 1J10A 2O61A 5HP5A 5T33H 4A7SA 3Q6FB 5CIPB 3HI5L 4KDWA 4ZTOL 5MEQA 3FB5B 4ZMXA 3NK3A 1YEDA 2VMEA 2VC2H 4X9GA 2ZG2A 3SO3C 1IBFA 2VQTA 3CXHK 4WU5B 3QIBA 2HPOA 3I02A 4HJTA 3DX6A