4XB7A

Crystal structure of dscam1 isoform 4.4, n-terminal four ig domains
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
395
structure length
395
Chain Sequence
QKGPVFLKEPTNRIDFSNSTGAEIECKASGNPMPEIIWIRSDGTAVGDVPGLRQISSDGKLVFPPFRAEDYRQEVHAQVYACLARNQFGSIISRDVHVRAVVQQFYESEVNNEYVIRGNAAVLKCSIPSFVADFVQVVSWQDEEGQLYGSLGDQQGTDGKYLVLPSGELHIREVGPEDGYKSYQCRTKHRLTGETRLSATKGRLVITEPVGSVSPQLSGNGNQEHITLTRVPKMGSVTLMCPAQAYPVPFFRWYKFIEGTTRKQAVVLNDRVKQVSGTLIIKDAVVEDSGKYLCVVNNSVGGESVETVLTVTAPLSAKIDPPTQTVDFGRPAVFTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESAEASAELKLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords Down syndrome cell adhesion molecule, isoform 4.4
publication title Structural basis of Dscam1 homodimerization: Insights into context constraint for protein recognition
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 59
structure length 395
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07679 I-set Immunoglobulin I-set domain
A PF13927 Ig_3 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xb7A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xb7A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xb7A03
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4xb7A04
1OAZH 1M6OB 4PLKC 4Y16B 1IGYB 2W0FA 1P5VA 3MZGB 1AY1L 4WFHE 5E7BA 4APQB 3V5DA 3BMVA 1QSEE 4XCFL 5C07A 2O61B 32C2A 1NAML 3JVGC 3WE6B 4ERSL 3H3BC 4HS3A 2ZUSA 2A6JA 1XGRB 3I50H 3BEWB 1T6WA 5IW1B 5TE4H 2V2XA 4NNXB 2BDNH 1OD9A 2PF6A 1QPPA 1DN0A 1WBZB 2L7JA 4WWKB 3WKNA 5DQDL 2GHWB 5EU4A 4GKSB 4OUOA 3LSOA 4JRYE 3BQUD 4Z8FL 4Y5XB 4MLSA 1ORSB 2HJLB 1TQCC 4XAKD 2BNRB 4FZ8L 4X4YB 2FIRT 1KXTB 1MCWM 1ZHNB 2R1YA 3TA3A 3WS3A 4C56B 1F6AB 5I1HH 2XN9A 4L9DA 4M1GL 1T7WA 3MODL 5CJXA 1J7VR 1A1NA 4LSTL 4OBSA 2QSQA 3RBSA 1JGLH 3WIFA 2KDGA 3K74B 4GRMB 4NHUB 5L9DL 2NR6C 5KVEL 3GHBL 3M17B 1MWAH 4FTVD 2YKLL 3NIDF 1MPAL 1MUJA 5TE6L 5B4MC 3GBLA 4P2YA 4HUXB 5HHPB 1XF4B 1MIEH 2ZCLH 2DQEL 3RPIA 5CKAA 1TVBA 1WLHA 3ARPA 2R69L 4NYLB 4PJAA 1MJ8H 4X7TB 3ARFB 3V8CA 1I3VA 5C71A 4YBLB 5I8EA 4LCIL 4OD1H 4LPXA 1YPZF 2FIKA 4IIQC 5JIHA 5IQ7L 1XF3A 1RUKH 5L88H 5IJKA 2X89D 1CBVH 3PHQB 1A02N 3G5VA 3KPRE 4U1KA 3WNNA 4J2XA 1AGFB 1ZEAH 4QHMB 3MOBH 3RIAK 3W9DA 5DSCB 1SYVB 3PWPE 1MLCA 1DDHA 2HFTA 1XZ0A 1XIWD 4ZFGL 4OFDA 5FV2A 1CU4L 2F74A 2WUBH 3VGEA 4D3CH 4PJHA 5E8EA 3D39A 3IFOB 4JM4L 3S96A 3G6AA 3QQNA 3TWCL 2A9MH 1SEQL 3BPLC 4I3RL 4OUUB 5MEND 4HUUB 5CSGA 3QNYA 1EGJL 2V17L 4Z7NF 3PWLB 2LAAA 1LNUB 1V5JA 2Q3AA 3GSUB 1JZ5A 5DXWA 2XFXA 1SMOA 5DMGC 3MUGA 4BYHA 4YDIH 1KB9K 3N9GL 3GMOA 3RIFF 4QCIB 1FNFA 3LN9A 3TBYA 4KI5F 3Q6FA 1NJ9B 1S7QB 3CFJB 5J6HB 4G8IA 4M03A 4K2UL 4L9LB 4K7FB 3L5XL 5EOTB 5L7XL 1RZKH 3QHFL 1MCJA 1T0NA 1WSST 2JB6B 1A6ZB 4BK4A 5D7JA 3SKNA 3MBED 5LCVH 1EEYA 4N5UA 3H9ZA 3I3BA 1ZLUK 4GAFB 3LRHA 1YUHB 5HBBA 4WW2F 3UZVB 2X44D 4ONHA 1T21A 3NCMA 2Q76B 4XNUL 4QHKI 1G6RB 2O5YL 1MREH 4G8EA 1LDPL 3DXAA 3LN4A 1FFQA 3OKMA 1T7VA 4H88L 3QFJB 4KJYA 3T4AB 4I2XB 5BZWB 4U05A 3T08A 2O5ZL 1KF9B 4Y4KC 2APTA 3FL7A 3PIQA 4XWGH 5ESVA 2V7HA 3C5ZD 25C8H 2J88H 4YC2B 4DN3H 1Z5LB 4X6BB 2Q6WB 4MNQE 4TOYH 1S7XA 3GMQA 3E3QC 4JY4B 4MD4B 5J12B 1QKZH 1JPFB 4OF7A 5KAQF 1MCPH 4MA8L 3VXSB 2P48B 1FYTD 1G7QA 1MFEL 4PRAA 1Z0NA 2VO5A 4P59L 2DKSA 3N85L 4JHBA 4M9OA 4XI5D 4Y16D 3GSQA 2P46B 4QHKJ 4APQD 5IVNA 3KLAA 4ZSOB 1I9RH 2LTQB 3W5NA 4X6EB 3FB8B 2BP3A 2IH1A 4ONGH 4PRIE 4PP2B 5TQ2H 2QTEA 2J8OA 1UACH 5JHDB 2B2XL 2W0FB 2HMIC 3ARTA 4PD4J 1KTRL 3CMGA 4WWKD 4NPYA 3L3JA 3QDGE 2P43B 3MRPA 4HIHA 1ZMYA 5E2TL 5CEXA 2B1AL 5C07B 32C2B 3IS1X 3GI9H 5A2LH 3MJGX 2BNRD 1PVHA 4U7KA 1TZIA 4HS3B 2A6JB 1MJJA 2I5YL 4C56D 1UWEH 2ZCKL 2ZP0T 2CRYA 2V2XB 2VH5L 4LLDA 1DN0B 3V52L 4Z7UB 3SDCC 2NXYB 3LSOB 3FO9A 3CK0H 5FUOL 3UTZA 1N7ML 2R2BA 4D8PA 1U8OA 4FS0A 1OAKH 4FHBD 2YPVH 2R1YB 3WS3B 3TA3B 2XN9B 1CG9B 1Y18B 4D2NA 2AW2A 1A1NB 3P4OA 3S8WA 1A21A 1FVCA 3WIFB 3ARFD 1UH4A 2VAJA 3KPTA 5ILTL 4NHCL 1BF8A 5E4EC 1MUJB 2AJXH 5JOFA 5CJ8A 1YEGL 1JZ4A 3OJ2C 1TVBB 2ZOKA 4PJAB 1Z9MA 4R9HA 3OJVC 1XGTA 3MA9H 1VFOA 4IRJA 1FZJA 4M1CC 5JR1L 5GGUA 4JVWA 1CF8H 2PO6A 2FIKB 5DO2C 1MFAH 2E6PA 3ARSA 3OXSA 2VDRL 1GC1H 2P5EE 5I74B 5I71C 4KK8D 1FJ1B 5DRWA 3G5VB 4QHNA 4U1KB 4WHCA 4D0BA 4C4KO 5IEHA 1A9BA 3DMMC 1Q0XH 4OIIL 3W9DB 5ERWA 1SBBA 3RBGA 5KSBF 1MLCB 3MYJA 1DDHB 5EZLA 1IGCH 1XZ0B 4OCYL 5IVXE 5BRZE 3HNVH 2F74B 3U7AA 4PJHB 4WCYH 5E8EB 2NY7L 2K3TA 3K3QA 3D39B 3S96B 1UVQA 3G6AB 5KSAC 1E28A 4XVJL 3QNYB 4NRZA 4ZO6A 2E7LC 3TGXA 2OMNA 5CLWA 5FYLL 1CXHA 4UOW1 2XFXB 3WXVH 3MUGB 5HHOA 5JA9A 5GJSH 1MFNA 4FQ1L 3GMOB 4L5FL 4XNXL 3IDGA 5D96C 3IGAA 3TBYB 3ULVC 3Q6FB 3RNKA 4ELMA 4G8IB 1YEHL 5JZ7C 2EYTA 4GG6F 4UBDD 1J87A 3E8UL 3HPLA 4DGYL 4DVBA 1DSFL 1T0NB 4XC1L 1PYWB 1P4BH 5D7JB 3SKNB 4HG4J 2W91A 1N64L 1EEYB 1HWGB 2YMXH 3C6SA 3QFJD 4NZJA 4N0UE 1D5XA 4I77L 4YO0B 4OM1H 5I0DA 3LS5H 3DYPA 4DQOH 4KRPB 3L3DB 5KSUA 3RGVA 4ONHB 2WWMD 2OI9B 1T21B 1QG3A 3W39A 5BQ7A 1QFWH 4PGJA 4ODXA 3WFDL 1A9EA 2ZUQB 1Q72H 1SJEA 3NACH 3DXAB 3LN4B 4CN6A 2BVPA 3OKMB 3PDOA 4HC1L 2DWDA 3HKFA 4KJYB 3KPOA 1JNLH 1IGJA 4H25A 1JTTA 2CMRL 3VXSD 3WKML 1IRAY 3PIQB 4TSAH 5ESVB 2V7HB 1SY6H 4K3JH 3C8KB 2A83A 5LGHL 3D25A 5DJZA 5JTWA 1S7XB 1AC0A 1UA6L 5BV7L 3GMQB 3VGDA 1AD9A 2Q7YA 4NZDA 5FM8A 1CZ8H 3UZQA 1S3KH 4AZ8A 4R26L 4PS4H 3SDXF 2GFBA 1G7QB 5JHDD 3LKPA 4PRAB 4X80H 1JGDB 3GSQB 3QDHA 4U1NB 3CMOL 2NY0C 1VGEH 5KOVC 1BAFH 3OPZH 3KLAB 5ICYA 4X6FA 5C07D 4CU8A 4A6YL 2PTVA 3HRPA 2IEPA 2EIEA 3SGJA 2VITA 4PFEA 4W68A 3G9VA 2X9XA 1QOKA 1VERA 2IH1B 5KTEH 1AR1D 5E95B 3RL2A 4YLQT 4NUGH 4NPYB 3L3JB 5HHXH 2NXYD 3MRPB 4HIHB 5CEXB 1A3QA 1T2JA 1KGCE 1DQDH 3GSNH 3BSZL 2DTSA 1TZIB 5DUPH 1MJJB 4Y19A 4RMQA 3TA3D 2XN9D 2K7PA 3MUJA 3Q2CA 4LLDB 4O5LH 3W82A 4QRSA 4AMKH 5C09E 4CVWA 1AJ7H 4JM2A 3BQUC 3QG6A 1FLTX 1EEQA 1TETL 3FO9B 3K8KA 3UTZB 2R2BB 3WFEH 4D8PB 5F6IC 1U8OB 2J2ZA 3ZT5A 2VISA 3S97C 2A77H 2BMKB 2GAZA 4LIQE 4RISH 3SJVE 3P4OB 4M61A 4ZXBA 4L8BA 1FVCB 2L0DA 2WINB 4TUJA 4UB0L 4Q6YA 5ELIA 5KW9H 1OTTD 4N0YL 4X5WA 1OT1A 3FFDA 3G5XA 1F4HA 2OCFD 3HNTH 4XP5H 5JOFB 3LB6C 3ZDXF 5DF0A 4MA7L 4OFKA 5A40E 2ZOKB 4AJ0A 4ZDHA 2YRPA 3SDDA 1XGTB 2D7TH 2FEDD 3RVWD 3BRFA 4U0RB 1GZQA 4ODSH 4IRJB 3RDTA 3OAYK 3H9YA 5GGUB 3HI5L 2PO6B 4KKNA 5DMJB 4JN1L 5CAYB 3F8UB 3NIGF 2UYLA 4JDZA 1OD7A 3T0AA 3GJFH 1CTNA 3OXSB 3FO0H 3V95A 3ULUH 3N50A 4JHAL 5BW7A 3G6DH 3D39D 3PGFH 4XWOD 5IMMA 1OAYL 1ROWA 5DRWB 4QHNB 4D0BB 2HRPL 5IQ9A 3DX7A 2IBZY 5IEHB 1A9BB 4XHJC 1ZLVK 5ERWB 1C5DA 4KXZH 3MYJB 1XIWC 5EZLB 1HKLH 4NKMA 4KJPC 3TT1H 3R0NA 5D7KD 1M7DB 1MQKH 3HZMA 1P9MA 3E2HB 3L7FA 5DK2A 1UVQB 1QRNE 1E28B 1F2XK 4NRZB 5F7DA 1A6UL 2R2EA 5D7JD 4G6KH 4MDIA 5HHOB 4MYWB 3N1QC 4PJ7A 1RIHH 3C08H 3CCHA 3CFCL 3IDGB 1QLRA 3IGAB 3LQAH 1TDQA 4ELMB 3IVKA 1G9NL 1TFHA 5GGQL 4KRPD 5JOPE 2EYTB 5DHYA 3HPLB 1V7NH 2GITA 2HTLC 4DVBB 5JOEA 1V3JA 3VMPA 3DXAD 4LSUL 5F7WC 2QADB 1F42A 3C6SB 2J8UF 1LP9A 1D5XB 5FK9A 2WIIA 5CJQH 5KSUB 2P8LA 3RGVB 2BNQA 3TVMA 5IT2H 3W39B 5BQ7B 4ODXB 1NL0L 4P2OA 2I27N 5ECJE 1A9EB 5DGQA 1SJEB 3B8YA 1TJGH 2BVPB 3PDOB 4MD0A 2DWDB 5HI4C 5IBLD 4HWZA 4K9EC 4PJEF 3LEVL 2HT2D 3KPOB 2Z31A 1IGJB 4H25B 1LO3L 5E5RB 4OF5A 3BZFA 1EUUA 4BFIA 2BFVH 4O58H 3MZTA 1RURH 4O2CA 4P57A 3FKUS 4HPOH 3WUZA 1Y6KR 5IB1A 2NX5E 2F5AH 4D9LH 4CVZA 2EC8A 4TRPL 3C5ZC 1GOHA 3UJTH 2A83B 4LIQL 4ZUWA 3P11L 3D25B 5DJZB 1BLNA 1HEZA 3E3QE 1KC5L 1F4XH 1FAIH 1AD9B 5DD6A 2Q7YB 5TPWL 2V7NA 2VNCA 2BSSA 4ZFOL 4NZTL 3LKPB 4UNTA 4XI5C 5EOCJ 1NMCB 2XTJB 2XA8L 1S9YA 4Q9CA 3L3OA 3JV0A 1S9KC 1GAFL 4APQC 2HJFB 5FECA 5ICYB 4TSCH 3MOAH 4X6FB 1IFHL 3BH8B 2WWKO 3UJIH 2GTZA 4WY7H 4ZOAA 3S35X 4YHOL 2FLRT 3BZ4A 5CIPH 3LEYH 4KTDH 3CD4A 1Z0MA 5C3TA 3JUZA 1U6AL 2ADFL 3MCLH 3QCUH 4U3HA 1BFSA 5D1ZA 3BAEL 4OSUH 2Z8WC 3UDWA 4Y19B 3EDEA 4JCLA 3GBMH 4XP9H 5MHSE 1UH3A 4JZNA 5CCKL 4G42A 5JA8B 2DWEA 4GH7B 1I85A 4JM2B 2DJSA 5E24E 2J8HA 3TO4A 1IE5A 3QG6B 2UWEF 4OF6A 3ULUF 3VI4F 2HLFD 4P49A 1OP3K 2VISB 1UZ8A 3UBXI 2GAZB 2G60L 4B5EA 1S9VA 2B39A 3VXUE 4M61B 4ZXBB 3LCYA 4L8BB 3TH2T 2DMBA 3KPQA 4TUJB 4CW1A 4Y5YA 5I17A 4IRJD 4YBLC 2UZIL 4X5WB 1CFNB 3FFDB 2PO6D 3G5XB 4N5ED 2EDNA 2IANE 3DVGB 3LKOA 1JGVH 3I9GL 2Q20A 5DFTA 1DE4A 3SBWA 2Q87A 4JFOA 3MNZA 3TPUA 4ZDHB 3SDDB 5F7MC 3ZHDA 4YWGH 2FEEI 1GZQB 4HKZA 3NFNA 3RDTB 2CGRL 2BVUA 1T66D 3WFCH 1C08B 4OB5L 1XF5A 5SWSA 2UYLB 4JDZB 4DCQA 1WAAE 1YEEL 4PJCE 2XYCA 2IH3B 3HC3L 5I1AB 5IMMB 3R0MA 1PG7H 4V2CB 4G5ZH 5IQ9B 5A2JH 3CXDH 2GJ6A 5KAQG 1C5DB 1C1EL 2KQMA 4P99A 3WNMA 1N59A 4NKMB 1QO3A 5HHOD 2ITDA 1XH3A 1G7JA 5CS7A 3HZMB 4K3DL 3QQ9C 1INEL 3L7FB 5DK2B 4NZUH 4L9LC 5T3XD 4ZNEA 4R2GB 1XR9A 3MUY1 5F7DB 3T2NL 2VLLA 2R2EB 1WIPA 2DLHA 3QG7H 1Q9LA 4MDIB 5E08L 4OM0L 4PJ7B 3AROA 5GJTH 2GJJA 4AIXA 3CCHB 3CFIC 1T3FA 2OZ4L 2QADD 2R8SL 1QLRB 2XQYG 2BXYA 4OLXH 4PJGA 5JXEC 3IVKB 2EXWD 4FFYH 4FABH 4BH7A 3ZTNH 1QVOA 2QJDA 3BKJL 5DHYB 2AXJA 3RGVD 2L4OA 2GITB 4PJ9A 3VG0H 4WUUE 4K71C 3MX0A 1IAKA 5IV2A 3MJ8A 3S7GA 1G0DA 1EMTH 5EZOL 1LP9B 1OM3L 2QHRH 4Q9QH 4HWBL 1SBSH 1E4XH 5EZJB 4AENA 1GYAA 2GIYA 5FK9B 4MJ5A 2WIIB 3EYUH 5EUOF 1VHPA 1VFMA 1HH9A 2WWMC 1GGBH 2P8LB 5EZIL 3UO1L 2BNQB 3TIEA 2M2DA 2B8OT 4J23A 4P2OB 3VXRA 1HZHH 3D85A 2E27L 3TT3L 2ZUUA 1BPVA 2JIXA 4MD0B 3QDAA 1CD1A 1WEJH 4J3WA 1WFTA 5A2KH 1YEFL 2Z31B 1Q9OA 1J1OL 4AL8L 5D5ME 5J57B 4XVTL 1W72L 1L9MA 5KS9E 4BFIB 4P57B 4O2CB 3UZEA 2XTJD 4CVZB 4LQ1A 4ZUWB 3LH2L 5I1DA 3V5HA 1FORH 2IPKA 1IKNA 1SYSA 2LTQC 1BLNB 1HEZB 2QSCL 3T8XA 5HHVL 5B3JE 5DD6B 4CDHA 3W0WA 2PXYA 2V7NB 3Q0HA 4XP6L 2NXZB 2BSSB 4N90E 5EU7C 3RVUD 4ZO7A 1CN4A 4WTXA 1S9YB 3L3OB 2W60B 4PGBA 2YA2A 1VFAA 3KDMA 5FECB 3VXMA 3DOSA 5E8DH 2GTZB 4P23A 5I8KH 3T0BA 3B5HA 1ERNA 4U6TA 4Y19D 4GXUN 3BZ4B 1Z3GL 5EIIA 1I9IH 5FCUL 5IVZA 2QL1A 3WSQL 3WV0A 3KPMA 4NQTA 4GSDH 4LVEA 3VFSA 1FHGA 1TENA 1P7HL 4JM2D 5F7YC 5AAMA 1T5WA 1CR9H 2NXYC 4HJ0C 4K7PL 1U2CA 4FQQB 2FBJL 1I1RA 1LO2H 2X4OA 2QQNL 1BOGB 4JG0H 4YFLI 1WF5A 4HV8A 4ZAKA 5CJXC 2HWZH 4G42B 4AH2A 4ZXBD 3EKCA 2DWEB 4M6OL 5GRVK 4RRPG 3TO4B 3GMPA 3DUHA 4C59B 4XAKE 1NCDH 2MNUA 2ITCB 1NUDA 5F7KC 1B90A 3NIFF 4OQTL 1UZ8B 1E6JL 1JHLH 4KRNA 3R1GL 1S9VB 4UINL 5E6ZA 4NO3A 4RX4A 1QRKA 4S2SA 5FIEA 4MXWH 3SDDD 4CW1B 3KPQB 4Y5YB 5MERA 5I17B 4MMZC 1A4JA 1OTTC 1DUZA 3ULVL 3RDTD 5EOCL 3IFPA 1MRFL 2NQCA 4C57C 1HCFX 2NZ9D 3LKOB 4MX7A 6CGTA 5H37H 3BYTA 5IJKC 1DE4B 1BZQK 3FFCE 4JFOB 3SEPA 5D1QB 3MNZB 3TPUB 4B7LA 2DKMA 1P4IL 1LD9A 1RUPL 3RUGF 1VEMA 4HKZB 3NFNB 4M7LH 1IVLA 1UJ3A 2C3XA 1RZFH 3U48A 3VI3F 4NOBA 5SWSB 1XF5B 4DCQB 2AJZB 1S7WA 1B4JL 4L4TA 4Q0XH 1QBLH 4EI5A 5EORL 5AG9A 2GJ6B 1T04A 2WLZA 3QIBA 4R2GD 2DI8A 4M4PA 3DX6A 3RHWK 4QYOA 4DZ8A 1N59B 1KBGH 1RZ7H 5HVHB 5E2WL 1HYSD 4S0SD 2ITDB 4LHJB 1XH3B 5KVGH 1G7JB 1W0VA 1NANI 3MLPA 3ZKXB 5C0BE 5MENE 4N0RA 2FGZA 3LIZL 4O51A 4FG6D 2WP3T 3BJ91 1XR9B 1EZVY 2VLLB 1EHNA 3LQMA 4HEME 1Q9LB 4R0LA 3F7YA 3NAAH 1I1YA 1T3FB 2VZ3A 3BD4A 3BIBX 3CSGA 4JQIH 2NYYD 4OCXL 4PJGB 3VFRB 3X3GH 5F70A 4KRPC 4P4RA 4Q9RH 4BH7B 2HFFA 1QVOB 2OI9C 5GRYA 2BNQD 1INQA 3TVMD 1I8LA 4PJ9B 3OBAA 5TF1H 1INDL 3LKRA 1NPUA 1IAKB 1S7SA 2AEQL 4P2OD 1ND0A 5IV2B 3IU3A 3SDYL 2E8ZA 3S3PA 3MJ8B 3MLUL 3H42H 1TPXB 2XOTA 4F7EA 1AH1A 5D7LA 4AENB 1FBIL 2CK2A 4MJ5B 5CILH 3VA6A 2Z31D 3WDIA 1HH9B 3BO8A 4LPVA 3GSWA 3S34H 3TIEB 1YPZA 4PUBL 1S5IL 1YEKL 1C5CH 3VXRB 5GGTH 5DUML 3D85B 2HN7A 4QO1A 2JIXB 1CD1B 1BVZA 2HT2C 4GKZA 4WEBL 1Q9OB 2P8MA 3HUJE 2OYPA 1J0YA 4K23H 5DD0H 2NXZD 5EG6C 1TJHL 2E9IA 4GAGL 3MXWL 4C54A 5I1DB 3V5HB 2IPKB 2EDKA 4X7SH 5INDA 1SYSB 2FEEL 2X4UA 7FABH 2EDRA 3T8XB 5JQHC 5E03A 5EN2A 1DL7L 3B5TA 3W0WB 1G1YA 2PXYB 2Y36H 2COQA 5AYUH 3W5MA 2AJYH 1CCZA 1N2RA 1IC5H 1JGEA 4PGBB 2IBGA 1VFAB 3MLWL 3KDMB 2ERJC 3VXMB 2MQCA 2ZUXA 3ORJA 1QZ1A 4P23B 5D1ZD 4ZO8A 2DBJA 2AJUL 3PP3K 4BFEA 4U1HA 1NBVL 5EIIB 3D9AL 5CZXC 5IVZB 3KPMB 3VFSB 1N5YL 2EIZA 1T5WB 3TO4D 4WW2A 1G0XA 5F96H 5C0IA 2X4OB 2VN4A 4LKXA 2Z91A 3GRWA 1MEXL 4ZAKB 3QUZA 4EI6A 4OT1H 4AEHH 4AH2B 5E1HB 5ENWA 2ZSVA 5J9PA 1C12A 2KZWA 4HZAA 5BCAA 2XZCH 3DNKA 3GMPB 3K2UL 2HLFC 1OPGH 4M6AA 4XMPH 3JWOC 3QUML 2IFFH 3IJYA 1A7BA 3DSFL 3EFFA 3TBVB 4PLJC 15C8L 3JTTA 4NO3B 4S2SB 5D1QD 5F9DC 3B9KA 5IESH 3KLSA 5MERB 4U0RC 1A4JB 1AGDA 1DUZB 4IRJC 3BEVA 1EXUA 1JF5A 1QUNA 1NGPL 3IFPB 4UNUA 5J11B 4HIXH 1NFDE 1BQLL 4LKCA 5SWSD 4MJ6A 4MX7B 1LMKA 1CWVA 4Y7MA 5ADPL 1X5IA 2A73A 4DEPB 1J11A 3RJQB 1LD9B 4IRZL 4NC1E 4OD3L 5GRJL 2GJ6D 3OKYA 4JKPL 1T66C 1UJ3B 1BFOA 5IMLB 1Q38A 1PAMA 1MWAA 4ERSH 5FHAL 5E8OA 1GXEA 5D9SA 2HKFL 2BRQA 4RDQF 1S7WB 3E2HC 5L0QB 4R97B 3BZDA 1HWHB 5GISL 1F90H 4EI5B 4L4TB 5CP3H 1ZVYA 4G9FA 4K9EL 1T04B 3QIBB 5ITFB 5C0AE 5IFHL 2MWCA 4OCNC 4JFDB 4QYOB 4DZ8B 5DLML 3O2DL 4G8GE 3MREA 4L3CA 1FN4A 4GJTB 1NCAL 1W0VB 4OLUH 4JQXA 1JYVA 3EOBA 2GKIA 2ESVE 2QV2A 1EA9C 1I3GL 4TQEL 4O51B 2YA0A 3BOVA 4NM8L 3WDHA 4WRLA 1HI6B 1ACZA 1MCOH 4PJ9D 3MPCA 5HGGS 4XPBL 1MPAH 4X6CF 1JUFA 2PYEA 2JJVA 4R0LB 2FX8L 4E41E 1I1YB 3DURB 3U4BH 5BS0E 4XMLH 3TM6A 4KAQH 1H15A 4EEEA 4P4RB 1R3HA 2H32H 4UAOB 2HFFB 3RGVC 2DQUH 1INQB 1ZXQA 4LPTA 4ZTPH 1E4KA 2GK0A 3LKRB 4NC2B 1LE5A 1S7SB 4OZIE 1ND0B 2X4NA 3VXRD 2VLMD 4E5XA 3IU3B 3D85D 4PGEA 5DT1L 1G9EA 4YHZL 1ETZA 2JIXD 3QFJE 4LVOC 1RUMH 3GHEH 4F7EB 2C3VA 5D7LB 2C3HA 5I1KL 4PG2A 5DZLA 5E70A 3BO8B 3GSWB 4QNPE 1YPZB 3UTPE 3LPFA 4ODHL 3OKLA 3FT3A 2HN7B 4J3UA 5GHWH 2WW8A 1A5FH 3TCLA 1SQ2N 2O5XH 4GKZB 1N4XH 4JM4H 4DWHA 2P8MB 3TWCH 5KSBA 3W0WD 1CFVL 2PXYD 4MD5A 2BVYA 1NBQA 1JTOA 3QO0A 1MAKA 2XTJC 1CGUA 4LSRL 3DHMA 4ZSOE 4LGPB 4X0KA 3VXMD 4NCDA 5F3BA 2X4UB 2MCG1 5INDB 1HH6B 2QQLL 4U6HA 1H8OA 4JFHD 1EPFA 4P23D 5EN2B 4DTGH 3WL9B 2OTWA 5FF6A 4L1HA 3HG1A 4TNVF 5EU7E 5L7XH 1N2RB 1UM4L 4WFFD 2Y23A 3ZYZA 1FVEA 4TUKH 1JGEB 1I8IA 5D7SL 1EO8H 5D71L 4N8PA 3V5KA 3MV7A 4KHXH 4RRPA 4GG6A 1OARH 3KLHD 1ZLSL 4YAQA 2EC9U 3MBXH 4ZNCD 2DQGH 4RFOL 4U1HB 2ADGA 4ZAKD 1C5BL 2E7BA 3LV3A 5LWYH 5T5FL 3BKCL 1WIOA 1D9KC 5CZVL 4JM2C 1BFVH 4JPIA 1T4KA 2EIZB 3BE1H 1I1FA 1RULH 2D31A 5F9OH 5T33H 4WW2B 5C0IB 1ZOXA 4IMLA 5I1IH 5EO0A 4YHPA 4LDEB 5TFSL 4LKXB 2Z91B 5KVFH 3EHBD 2FWOA 3S3SA 3ARBA 3QUZB 4EI6B 4RX4D 4FP8L 4ZXBC 2A0LC 5ENWB 5HJ3A 5ID0A 2ZSVB 5J9PB 1F58L 4OCWH 1C12B 3NFSH 3AS2A 5C0CE 3OV6A 3IJYB 4M6NL 3BP6A 3KVQA 3EFFB 3VFGH 5JIIA 12E8H 2PTUA 4X5XA 5KVDL 2VUYA 2BSRA 3B9KB 5SX4H 4MZ2A 4UOW0 1CDBA 1O5DT 1AGDB 3RDTC 3BEVB 3LQZB 1M7IA 1EXUB 4JLRA 4MAYA 4HUVA 5C0FA 4OZGF 2NZ9C 1FV1A 4LKCB 3SDXA 3OR7A 2XKNA 1RSFA 4DGIH 3FQTA 4POZD 3RX8A 4DGVH 4KUZH 4S10A 3BGFB 3IAPA 4P4KA 4JFYA 4ODUA 3KAAA 4FXKA 1CQKA 2A73B 1A7NH 4L4TD 4EI5D 1EDQA 4X8JA 3UYOD 3QIBD 2AJVH 2OR7A 3ZE2E 1BFOB 4BQBA 4LEOA 3BPCA 3BUYA 3QXWA 1MWAB 2VDLL 3S4SG 4PJHE 2ZNWA 5E8OB 4JQVA 4XMKL 5D9SB 3QXAB 1NGWA 4W6XB 4K8RD 2EYSA 1MHPL 2IALA 1I4FA 1VFUA 4HS8L 2Z35B 1HQ4B 4R2GC 2YD9A 3STZA 1HCVA 3F62A 1FL3A 3SE8H 5FUOH 4Z7WB 3P0YL 2M8XA 3ZLQC 4L3CB 3O2VH 1FN4B 4HHAA 3HE6C 3F58H 2YD7A 4ZO9A 5CGMA 5H2BA 3EOBB 5BO1L 3A0OA 1OSPH 3TV3H 2AXFA 1CFSA 3NN8A 4FG6C 5DZNA 5F9WB 5JUEL 5D2LF 1NANH 1ZLWK 5ILTH 4NHCH 1FPTL 3E1F1 5I19H 1PG7X 5L8LB 1MFDH 1JUFB 2PYEB 2XRAL 1TITA 3F5WA 1N0XL 3WNPA 1VACA 1R6VA 3PE9A 1H15B 5D7LD 3C8HA 1R3HB 4LSVL 5EOQL 3TVMC 4YFDB 2GK0B 4IMKA 4P2OC 4LMQI 4UT7L 3L5HA 1LE5B 3C87A 2X4NB 4E5XB 1VENA 3I3DA 5IFAL 2X4RA 4WI4A 4P46A 4PGEB 3EIFA 2OTPA 1ETZB 2EIBA 5DURB 3GK8H 3CLFH 2C3VB 5DQJB 3EOTL 2Z31C 2H1PL 1KN4H 4O2FA 4Q74A 1KYOK 1AE6H 1RK1A 1FC2D 3D0VA 4JDTH 3F7PC 1A6TA 4LSQL 5FM4A 4EN3C 1FGNL 3MJ9A 1OGTA 3OKLB 1RUAH 3FT3B 4QLRA 2W9DL 4JPVH 1ZSDA 4ZTOL 3TCLB 1NUFA 4YXKL 3VRJA 1NCTA 5KSBB 4MD5B 2NXZC 2MTPA 3QO0B 4UU9A 4M02A 2ICEA 4LARL 3FB6A 1SMAA 4YHLH 1JPST 5ACLA 2D7MA 4KI5D 4X0KB 5F3BB 4U6HB 5I1LB 2AGJL 1E6OL 1CD8A 1IT9L 1KPUA 4JO3L 2OTWB 4M7ZB 5FF6B 3HG1B 2XPGA 1MJ7H 1NGQH 2QQQA 1IGFL 1FVEB 1MCHA 1JK8A 1I8IB 3IDYC 4U1GB 3NPZB 1G9MH 1N6QH 2Q7NA 5ESAA 1H3UA 4RFNB 1AHWC 2VXQH 3V5KB 3MV7B 2KUTA 3U1SL 1H3PL 5D1ZC 5IHBA 4GG6B 4N1HB 3UDWC 4YAQB 1RHHA 2G75A 2HT4D 2ADGB 3QUZD 1FGVL 4HXBL 1TTGA 3LV3B 2J8UA 4JPIB 1T4KB 3TO4C 1I1FB 2D31B 3F6LA 3QBTB 4TVPD 4IMLB 1UWGL 3FHAA 5EO0B 1RPQA 4YHPB 4RAHA 2BNUA 1W0WA 1RUQH 2FWOB 2VR5A 1JGUH 5FOBA 2CMRH 3ARBB 4KDTA 4Y2DC 5IOPA 3Q6GH 1F00I 3BDBA 3V79C 3Q1SH 4UV4H 4YDKH 3CLEL 5HJ3B 3B9KD 4Y5YC 5ID0B 1DVFC 3PXJA 4NRYA 1ZGLP 5DA4A 1UKQA 4PJEA 4P2CG 1JYNA 3KPSE 2ICWJ 1FIGL 2FD6H 4ONFH 3BP6B 4QXUL 3AVEA 3QHZH 3GSNA 3TH4T 5IGXL 3KJ4B 4G6AC 4ODWA 1KCRL 1FVDA 3RVTD 2BSRB 2B1HL 5GS0H 1IEHA 1CDYA 2R9HD 3RX7A 1FNEA 4Y88A 2UUDK 2IQAA 5J7CC 4JLRB 4MAYB 1U0QA 4HUVB 5C0FB 3IF1B 2VTFA 1FV1B 1NKRA 1BD2A 3OR7B 1U8IA 2XKNB 3SDXB 3QWQB 3FQTB 4EBQL 3OAUH 5T1DL 3HE7C 3MJ7A 5K93A 4P4KB 4JFYB 4ODUB 4PJ8B 4PJXE 4FXKB 4Z5RA 4X8JB 1KTDA 4FQIL 3ZE0E 5JNYA 4DK3A 4LEOB 3MRDB 3BPCB 3BUYB 5HVHC 3UTQA 4LP5A 4WUKL 4P3CL 1CDIA 4PB9H 2RQ8A 4TTGA 2C7UA 1HN1A 1UEMA 1DCLA 1UB6A 1NGWB 4KGLA 4W4NA 3RPKA 2NY5C 3ZKXC 2EYSB 2IALB 1I4FB 1MQ8A 2OX5A 4YZFE 1YZZA 3STZB 3PWUA 1FL3B 1UM5H 3OKEA 5HHOE 1IGML 5HYJA 4K7PY 1Y6MR 2PYED 4HHAB 4POYA 1R5WB 1KJMA 2ZG1A 3QIWA 4J6RH 5H2BB 2VR4A 4M1DL 5MEQA 3RU8H 2AXFB 3IJHA 1CFSB 4UV7L 4KPHH 3GJFA 3DSNA 3NN8B 1L7TH 2UWEA 5T3XE 4PJFF 3MLZH 5F1IA 1DQMH 3P30H 1VADA 1U8NA 5DVOA 5FO8A 1AQDA 4R4FL 4OBRA 5H37G 4LVNB 3BWAA 3I6KA 3F5WB 2R56H 3QEUB 4MA7H 5DHXB 5DURD 1VACB 3LPGA 1KCSL 3QZWG 4KKCD 1N8ZA 2Q8BL 3PL6A 5IP4A 1MVUA 4EXKA 1I1AA 3ZO0A 4JGMA 3U7WH 4RWYH 1DBJL 2RGSA 1RIVL 1BECA 2X4RB 4P46B 4KC3B 2AERT 4HQQH 1EHAA 1YNKH 3H7BA 4HCRL 2YUVA 4QRTA 3VD9A 2HRPH 4O2FB 1RK1B 3D0VB 1IZJA 3U83A 1A6TB 1MFCL 1MF2L 1C16A 1BWWA 1RJLA 2Y1VA 3I2CH 5H8DA 5IHZA 3MACL 1OGTB 5DZOA 3ZYJA 1X4XA 1M4KA 1QNZH 1ZSDB 1XR8A 3G6JB 4HD9A 1T1YA 5T3ZE 4MQTB 3U30B 2XA3A 3VRJB 1X5AA 4B0MM 2PXYC 4LLVA 2YD4A 3JWOL 3G08A 4YPGA 3HG1D 4LU5L 2BJMH 4JAMB 1HINH 4UU9B 2A1WL 3FB6B 3OB8A 3RAJL 4HWUA 3PGCA 4X9HA 3MV7D 5B8CC 2VZVA 1GPOL 3MRKA 1KPUB 5A3ID 1JZ2A 6FABL 3LS4H 1YJDC 2XPGB 2ZOLA 4RDQG 2CD0A 1JK8B 4YE4H 4WNQA 4Z7UF 1YN6A 1UWXK 4LSUH 1PJ9A 2DQFB 5ESAB 5DJ6A 4HGMA 2F5BH 4R4BA 4EQ3A 1RHHB 2MHAA 2V5RA 4PB0H 4XPHL 5DC4B 4LGSB 3ARBD 1LWRA 5J1SC 1T03L 5CHNA 1EJOH 4YH6A 1JTPA 2FHFA 2J8UB 1IAIM 4HUWA 2NY1B 5DVKA 3U0WH 4Z95L 5EUOA 4FQHA 2BNUB 2RCSL 4JPKH 1SM3L 1NAKL 3LEVH 2BSTA 3EHBC 4LHUG 1W8OA 2BX5A 2A9NL 4I9WD 5FOBB 1YECL 4NQCA 3K4AA 3MV8A 1LK3L 4PP1D 5IOPB 1I7ZA 4K94C 4HUMB 5CIPA 3IS0X 4LVHB 2XWJA 4TRPH 1FG2B 1F4WL 4NRYB 2XZAH 2DQCL 4PJEB 5IBUG 3O2WL 3V4UL 2B4CC 3WJJC 4MAYD 5EWIL 4R4ND 5IVXF 2FATH 2R1WA 5T3XL 2NZIA 4MGXA 5C0RL 4NKDA 3GSNB 5TPWH 2IG2H 4FQ2H 4ODWB 2B20A 3S4SA 4P4KD 1FVDB 3VU2A 4U2YA 2XQYK 5I73B 5FUCC 2VUOA 3BT2L 4RBPK 4Q9BA 1A7PL 1FNEB 2CQVA 2IQAB 1SJVA 4L8SA 1NBYA 2WK2A 1AI1H 1BD2B 1U8IB 5M95B 4POZC 1FP5A 3MJ7B 5L0QC 4R97C 4YHKL 1UGNA 1T89C 4Z5RB 1EK3A 5I8CA 1JWSA 1U2HA 4LGRB 2W07A 4HBCH 2X42A 4OGXH 5E9DE 1J0KA 5JNYB 5F44A 3ES6A 4V1DA 3UTQB 3WUWG 3S6CA 4MMXC 3VFUA 4TNWF 3QAZC 4P2QA 2C7UB 3WJLC 1UB6B 4K8RC 2ENYA 4XPGL 5CCKH 1H3TA 4L3EA 5E6IA 1EJ6A 1D5BB 2AI0H 2J6EH 3HZVA 3HLAA 1MI5E 4TULL 1WWBX 3PWUB 4CJ1A 1QD0A 3OKEB 2Y06H 1ZKAA 1MHCA 4PJ7E 5HYJB 1KEML 3O4LA 1Q8MA 2V2WA 4R0LC 4BZ1L 3BGMA 1JVKA 1KJMB 3QIWB 3DX9A 5MEQB 2AK4A 3UCRA 3IJHB 5JLZA 3VWKC 3GJFB 1A7QH 4GW4A 5ANMA 2VC2L 2UWEB 4JRXA 4UAOC 5F1IB 3V9FA 1VADB 2RJMA 5FO8B 1AQDB 4I0KA 1OOAA 5IROA 4OJFL 4P46D 3BWAB 3LDBB 2E9WA 3I6KB 2PTTA 3QCTL 2ZUTA 1VA9A 1N8ZB 3PL6B 4NP4L 1MVUB 3WFZA 1I1AB 4JANA 5K59F 3MC0A 1KTKE 5D2NE 2C5DC 1PG7W 4UIMB 4Z76A 1GGCH 1WWAX 5GZOD 2DQJL 5DHVH 4PIRF 5EA0H 3H7BB 3TESA 4MNGA 5ALCH 4OZ4A 4OFYA 3RWFA 3HC3H 3RUGA 5J4MA 1I3RA 4QRTB 1PKQE 3VFNA 1ZTXH 4G6JH 1J8HE 1KELL 1C16B 1IM3A 1RJLB 3RA7L 5IHZB 1CLOL 1WFUA 3VXOA 4M93B 1XR8B 4Z0BH 3SQOH 5F97E 1T1YB 3EO9L 3LKNA 4HWEH 3BRDA 2AK1H 1N6UA 4LLVB 2EEDA 4YPGB 4GXVL 2W0KA 5GS3A 3ARZA 5A1AA 1NDGA 1BBDL 2YC1B 5LKNA 3UTOA 2XNAA 4DKFH 3FOLA 4KMTL 1QFPA 1DBML 5HDQL 2E7MA 5D72L 5IHUH 3PGCB 4NFBA 3ARYA 3WXWL 5DMIH 4BJLA 3MRKB 1UEYA 4WDIA 5CSZA 1E27B 1E4WL 4WI5A 4JO2H 2H2SD 5ESQA 2ZOLB 1S9XA 3A6BH 3FTGA 2OXGA 3QEGL 3TJEH 1F8TL 2YEZA 4WNQB 3GB7A 4KZDL 3LVEA 1EO7A 1YN6B 3FQRA 1KULA 5D6DA 2VDKH 2NY1D 4PGCA 3ARDC 4MVBD 1L0YA 4S1RL 5CSBA 3MUHL 5DJ6B 1ONQA 2Q1EA 4GG8A 4R4BB 2MHAB 4OFIA 2BZDA 1BBJA 2HT4C 4PV9A 3QUZC 1B88A 1HHJA 1L4IA 3E6HA 5CHNB 4HWNA 4NKIL 2YUZA 2XXCB 2ZCHL 1RVFL 2FH6A 4M43L 4O02H 1NGZA 4HUWB 1LEGA 3WCYA 2FGWL 4XPAH 5EUOB 2OTUA 4FQHB 4JFQB 4M7JH 3HC0A 1UKTA 4RGMB 2BSTB 2CDEA 4NQCB 3NCYP 4NC0B 1IC1A 2MQ0A 4MSWA 3MV8B 2VDNL 4WFED 3C9NA 1I7ZB 3HMWL 5CIPB 5HYIA 2XWJB 5IB5A 3BYYA 4JFPA 5C86A 1OGAA 1YYLH 4W4OA 2R1WB 3BHBA 3CU7A 1BD2D 2EZ0C 4GQ9H 4NKDB 1N0LA 3BGFC 2X1PA 3S4SB 3RVTC 4LCCA 1IC4H 1JZ7A 3ARXA 4TPRL 1J5OH 2ORBL 1DFBH 3KJ6L 1KCVH 2R9HC 2APFA 3V2AR 4UT6L 1U9KA 4YXHL 4L8SB 1NBYB 3HC4L 3QUXA 3MRQA 4ZOCA 3B9AA 3SDAA 2XG4A 4OCMC 3MXVH 4XVSH 1JWSB 1UZ6E 43CAA 4R90H 3HHRB 3NPSB 1IQWL 3ES6B 4V1DB 5HYJD 4M5YH 5EB9A 5CLTA 3VFUB 2VXSH 5JHLL 5C08E 4JQXC 3GO1H 4P2QB 3QIWD 4DKEH 2DD8H 1JWUA 5F9WC 1Z9OA 3ULUD 4L3EB 5E6IB 3QZWA 4ZQKA 4K3EL 2AVGA 3HZVB 1VCAA 3HLAB 3SOBL 4E42A 1MHCB 3H3PH 1JRHI 3O4LB 2V2WB 2ZNXA 2ATKA 3BGMB 2Y9RT 5FYJD 4GBXA 3DX9B 2AK4B 1X5FA 1CFQA 4XXCA 4UINH 1A3LH 2ZWLT 3O81A 3SE9L 2MPAL 5JLZB 4GW4B 4XP1L 3PL6D 3QUKA 5ANMB 3FN0H 4JRXB 1WZ1L 1I1AD 4XCCL 3BKYL 3CSBA 3EFDL 3QXUA 5DD3H 1EO5A 1E4KC 3FT2A 4FQXC 1CLZH 2ICCA 4KK9D 3O0RL 1YYMH 3TC9A 2PKDA 2F54A 4KKCC 4LASL 1TCMA 2CKBH 3AB0C 2QR0A 4JANB 2GJZB 4HS6A 1BJMA 4HKXA 3CFDA 2VLME 4OCSH 3T0VA 1RZKC 5JQ6L 4Z76B 4YIQA 1WTLA 3HPJA 5I15H 5GS1A 4MNGB 1NDMA 2OR9L 4OZ4B 3RWFB 2FHCA 3IFNL 3RUGB 1RU9H 5I1CH 1NEUA 3SGKA 1OCWL 1KCUL 2CIIA 4NQDE 3MLSL 1YY9D 1AXTL 1CDJA 3VXOB 3OGCA 3DUSA 3C6LA 1YMMA 1DR9A 3LKNB 3V0WL 5FUZL 5IK3A 4M7ZC 5DYOA 2DMCA 5MI0C 1G7IA 4JDVA 4MDJA 4KHTH 5EBWA 1NDGB 3ALPA 4YXLH 4NO0B 4U1GC 2XNAB 3FOLB 3OXRA 5GGTA 1KIUA 1NCCH 1GHFH 4OCXH 4ZPVA 4OLWL 2XZZA 3GIVA 5J8OA 5GSRA 4WDIB 5CSZB 4FFVD 3AREA 4X6CA 5ESQB 4MXVE 1KJ2A 4LHUA 1RD6A 1S9XB 1EVTC 3FTGB 3GMRA 1INDH 1F02I 1K6QL 2YEZB 3MRRA 3GB7B 4MQXD 1Q1JL 2EECA 3FQRB 3BGAA 1TZGL 2B5IB 4PGCB 3RL1A 3ZSSA 4JE4B 1ONQB 3U82B 4GG8B 5EC2A 3S3JA 4GOSA 4S1SH 4YHYB 4NQCD 4PV9B 3MV8D 3BN9D 1DBBL 5CUSL 1HHJB 1F97A 3E6HB 3TEUA 5DUMH 5INCA 1JHKH 1NGZB 1TTFA 1LEGB 1DEEA 3S88L 2OTUB 4HIJA 4WEBH 1IJ9A 2CDEB 4D9RE 4ZOBA 4PJCF 3KJ4C 3WFBH 4QTIH 4MSWB 4PP1C 2PR4H 3C9NB 4OGZA 3SCMA 2VDPH 4HK3J 1I8KA 5IB5B 4ZYKA 4CN1A 4FXGA 4JFPB 4MAYC 1OGAB 4R4NC 3ME0A 4XC3L 1YC7A 3BHBB 1NCBL 5I8OH 1PZ5A 4MS8D 3WUWA 5I30H 4LCCB 4AK1A 1MCKA 5FUCE 1ULVA 5J6GA 4M4RA 3P0VL 1HNFA 2YXFA 4KDWA 1J0JA 2P24A 2JB5H 1OAQL 1YQVH 1AQKL 4V1DD 3QUXB 4BZ2L 3MRQB 4JB9H 3KYMA 4P9HH 2AJUH 2XV6B 4KUCF 4P2QD 1D7FA 1QBAA 2N7AA 1UCBL 1FFOA 4L4TE 3ZKMD 4I0PA 3B2VL 4L3ED 3FZUC 1LE9A 5E6ID 2XZQH 2VDML 4L8CA 3ZL4L 43CAB 5JIKA 4TTDD 3SE3C 4H0HB 3O4LD 2BY3A 1EV2E 3PF2A 3LD8C 4NN5B 3STLA 3T0EA 4UDUA 2AK4D 1JWUB 3QNXA 1GC1C 2VZTA 4JRXD 2R4RH 4PTTA 4GAJL 2CH8A 2NW3A 3KXFA 5ADOL 1U8JA 3QZWB 4ZQKB 1J05A 3HZKB 3CNKA 3K2UH 5FA3A 5MP6H 4NZRL 5SX5K 3CSPA 4E42B 5L2KA 4M62H 4X98A 4GBXB 2D7OA 3DSFH 3U9PL 4QRRA 2Z93A 4L4VB 4GRWH 1CFQB 2VXUL 3QUKB 4KZEL 5D5MF 5K9JH 5KS9F 2NTFA 1K8IA 3FHQA 1MCLA 4IMKC 3FT2B 5CP3A 5IM7A 4NOFA 3L1OH 1YJDL 3U7YH 2DQIH 2R0LH 1GH7A 2BSED 5TE7H 2VXTH 4BQ6A 1T2QL 5A2FA 4JJ5A 2F54B 5IWLA 4OFYD 1ZT7A 1NC2A 1UJTA 3QXTA 5HYQA 5B3JF 4YEFA 2QR0B 4K07A 1OVZA 4HS6B 3ZHLA 5GRJH 4OZGA 4NBZB 1N3NA 4HKXB 4HK0A 4YGVA 3CFDB 4NNYA 4JR9L 5HHME 3NCJL 4G7VL 4GUPA 2OK0H 4HH8A 4O4YH 4YIQB 1V7ML 1WC7A 3MV11 3IETA 4MAUL 1PSKL 3RWDA 2GTWA 3MRIA 1J18A 2AABL 3HPJB 1LO4L 4I3GA 5GS1B 4DVRH 1NDMB 5KN5A 3QRGL 1CLYH 3U30C 4JFFE 4HJJL 1D5MA 2X41A 3VWJC 3RWHA 1X9QA 5GXBB 2CIIB 5ICZA 2H32A 3OGOE 1OTUD 3B8SA 4YGAB 3UPRA 4HF5H 2DI7A 4GQPH 5F89A 3OGCB 4PRHE 5DD1L 4F57H 4K94L 3DUSB 3C6LB 1YMMB 1ZLWH 1CGSH 2IGFH 1JN6A 4P5KA 1JPSL 4Z7NE 5IK3B 4TQEH 3LZFL 1GJIA 4TN9A 3L5JA 5DYOB 3D87B 2YD6A 1UYWL 5D8JL 1CXIA 1G7IB 3BWUC 3QT2A 4JDVB 5EO9A 2FHBA 4MDJB 2BRRL 5EBWB 3VA2C 4M48L 3V6FA 3WO4C 2V5SA 1ZAGA 5D2LA 5CP7A 3EYSL 3IU4L 4ZPVB 2J4WH 4Z7VB 1KEGL 2X40A 3GIVB 2CR6A 3QULA 5GGSA 3THML 5GSRB 3AREB 2H2SC 3MRLA 2Q8AL 4X6CB 1KJ2B 4LHUB 3GMRB 1NMAH 4HPYL 3TYGL 3MRRB 2ZPKH 1GRWA 5E2JA 4YHZH 5FYKE 2NY1C 4MVBC 4NNPH 3KWWA 3RL1B 3VD5A 1F13A 1CICC 2DKUA 1TQBB 2PNDA 1JNNH 5EC2B 2C1PA 2JJTA 3H3KA 5IBUB 4P2RE 3OJDA 35C8L 5I1KH 3W11D 2LAGB 1IAIH 2G5BA 1JRHL 1J1PL 4KDTC 4YBQD 3BI9X 3OKKA 2EDEA 4LVHC 3WLBA 1MIMH 2D7NA 5I18L 4KK5D 4K8RL 2OLDA 5INCB 4AEIH 2DTML 4WFGD 2E3VA 1DEEB 1OGAD 4HIJB 2JJWA 1I9JL 3BPNB 3Q5YA 4PRNA 4O00A 4LF3A 5IFJA 1SVZA 3SCMB 4NGHL 1QSEA 3QXDA 4WI8A 3DJ9A 4FXGB 4N0CD 2HFEA 4H1LH 4JHWL 2W1NA 4P9ML 3VD7A 8FABA 3QUXD 1I7RA 5I0ZA 3PP4L 4CDGC 1PZ5B 2DQDH 3WUWB 4JRYA 3KGRA 1H8SA 5JXAL 1C8PA 1WITA 4XTRD 3N0PB 4H8WH 4PY7A 5DTFA 5J6GB 2ADJA 3HI6L 1RIUH 2E7CA 2LU3A 4GRWF 5D71H 3X14B 1Q0YH 1KB5H 3LY6A 1FNSH 4I4WB 4V2BA 2I60L 5L6YL 4RFOH 2R29H 4R3SA 1C5BH 1A6PA 1FFOB 4XNYL 4I0PB 2E5EA 4Y5VA 4G9FE 3BKCH 1KFAL 1J1XL 3UYRH 1DQLH 4XZUA 5J13B 1LE9B 1AO7E 4QXWA 1Z2KA 3PV6B 3O8XC 4L8CB 3IT8D 3FMGL 1BGXL 1OT2A 4NJ9L 3O6FA 3STLB 5B38B 3MRCA 3QIWC 4GBXD 2PUQT 4NWTH 1DBAL 3T0EB 4UDUB 4EOWL 1FCGA 3QNXB 4HMCA 4LSSH 2VZUA 4PTTB 4NFDA 2NW3B 4PGZA 3KXFB 5JORA 4BZYA 1U8JB 1J05B 5FA3B 2VE6A 5CJOL 4X98B 3RTQA 3LDBC 4JKLA 3KPRA 4XHQA 4QRRB 4CU6A 3KR3L 2Z93B 1QSVA 1A64A 2F54D 1J8KA 5J89A 1LO0L 3PL6C 4FFWC 3S36X 3NABL 3HUJF 1DBKL 1I1AC 1XGYH 4ORGA 2DDQL 2K1MA 2NTFB 3S35L 1K8IB 2JE8A 1MOEA 4CMHB 5IM7B 4G43A 4KK9C 2IADA 4LRNH 5I66B 1U8QA 1DQJA 2VZ1A 4YR6A 5C7XH 4NN7B 2CUIA 5FO7A 3MNVA 2WBKA 4NRXA 2KH2B 4JJ5B 2VAAA 3DETD 4FQJH 1PFCA 1NC2B 5HYQB 3T1WA 1RZGA 5FYKL 3WIHH 3LQAC 3PUCA 1KOAA 3CDCA 4Z78A 4OZGB 4UIKL 3RVXD 1N3NB 4HK0B 1BZ7A 4YK4B 4NNYB 4YGVB 3MCKA 2XACC 3GRWL 4GUPB 1WC7B 3IETB 4D9QE 3ALWA 3NGBC 1ZK9A 3RWDB 2GTWB 3MRIB 4PBVC 5E2VL 5KN5B 3C6LD 3JWDC 1YMMD 2NMSA 1OAZL 5KSBE 1D5MB 4MLIA 4XNZB 3RWHB 1YNLH 4NBYB 4PRBA 5ICZB 2H32B 3UPRB 3SO5A 5IR1A 5F89B 1NLBH 4LNRA 1UADC 1MSPA 3VDAA 3MQIA 3I50L 1ACYH 5LXGH 2BDNL 1JN6B 4P5KB 4LLQA 3SGDI 5JUEH 1JL8A 4Y4HC 4MCZA 2FDBP 5DD5H 1FRGH 3ARED 1ZV5A 4DFIA 5GSVA 1BP3B 4LHUD 5EO9B 3BPOC 1BIHA 3VFMB 3V6FB 4ETYA 1QFHA 1D3CA 5I1GH 2H3NA 5I1HL 2XRAH 5L8JB 1QFWI 3T2QA 5D2LB 1N0XH 2HVJA 5CP7B 2YWZA 4WHYH 4GMTL 5BVPH 4PJFA 1JGLL 3EOYG 3MO1A 5T1KA 3BDYL 4Y4FC 5GGSB 4FFVC 2F53A 3QP3A 5I2IB 3MRLB 3ZTJH 2EH8H 4I48A 1MWAL 4J4PA 5IB4A 4MNQA 4JZJA 1GGIL 5CFHA 5DC9B 1CFBA 1MIEL 4PJBE 2ZCLL 3KWWB 2VERN 2YK1H 4Q6IA 2WSKA 1OL0A 3L7EA 3QRFM 2C1PB 3EOTH 3OJDB 4QHLA 4OF3A 2G5BB 4HXAH 1K3IA 2X70A 3BN9C 3ARGA 5FHBH 2YD2A 4UTAH 3OKKB 3SCMD 4OD1L 3SQBA 3WLBB 5FV1L 2WM0A 3BIKA 1RUKL 4Y8AA 5L88L 3QEHA 1CBVL 3GNMH 3L3GA 3ARQA 3BDXA 3F7RA 4PRNB 1ZEAL 3MOBL 4HIIA 1UXWA 4KVCH 3AMLA 3QDGA 5IFJB 4LF3B 5LBSH 1QSEB 1SHMA 1EX0A 3CC5A 2HRLA 3WBDA 1JNJA 3QXDB 4MCYB 5K33A 4D3CL 5E0QA 2WUBL 5TQ0H 4JKWA 2YBRB 2HFEB 4X6EA 1XCTA 8FABB 4HC1A 1I7RB 4PP2A 2A9ML 4PBXA 3PG2A 4QEGA 3LMJH 4TVPH 2EIDA 4AY0A 1UWXH 2V6HA 4JRYB 1CQYA 4I0PD 4JFZH 3UTTE 4PY7B 5DTFB 2ADJB 4YDIL 4WI9A 1G7PA 1QHPA 3RWEA 1MCNA 4W81A 1BQUA 2NY3B 1KJ3L 3SGEH 1NQBA 3W2DH 2M1KA 3IDUA 5C92A 1D6EA 3QI9A 1KT2A 1U3HA 3T0ED 1RZKL 4IHOA 3O3DA 4R3SB 1PBYA 4Z7UA 4RAVA 4Y5VB 1QFOA 5LCVL 3KXFD 5E6IC 5HI5C 4XZUB 5FYKU 4RGOH 1FSKC 2V2TA 4OZIF 5L2KD 1CG9A 1Y18A 3D18A 2X4TA 5E2UH 3O6FB 3MRCB 4QRRD 4PLNC 3MLXH 1G7LA 4J3VA 2DM3A 1DQQA 3CLEH 1NGYA 1CVSC 1MREL 5JORB 4ODTH 4S11A 4DOHE 2VE6B 4AM0A 2P5EA 1ZVSB 5CMAA 3RTQB 4HLZG 3KPRB 4RBPH 1NC2D 4XWGL 3V8OA 1X5LA 5HVGB 3SKJL 3UC0H 1ZS8A 2VQTA 25C8L 4ORGB 2J88L 5IVXA 4DN3L 4TOYL 5DFVD 4G43B 2IADB 4OKVA 4X7EC 1WICA 1HIMH 1QKZL 1U8QB 1DQJB 4U1SA 4YR6B 1FJ1A 1MCPL 1UENA 4KXZI 5FO7B 3MNVB 3MLYL 1RZJC 4BSVA 4NRXB 2VAAB 3QDME 1RZGB 2VQUA 5GRUL 4Z78B 3NIGE 2YPKA 1BZ7B 1I9RL 3MCKB 2Z8SA 1KIPA 1ORQA 1OTSD 5CBAB 4ZFZA 4ZUVA 1YMHA 3O4OB 4ONGL 1VPOH 4UMGA 5TQ2L 2QQKH 1UACL 4IRSC 4EUPH 4B53A 1EBAA 3C2AH 2LVEA 4PRBB 1LEKA 4N8VG 1NUNB 4YPJA 4J3SA 4QWWC 3NH7H 3GI9L 3GM8A 1HHKB 4N0UA 5IR1B 1UWEL 4LNRB 4UDTA 4JO4H 2K9UA 1MRCH 5BJTA 4LLQB 1CE6A 1PYWA 4MCZB 4FA8A 1RJZA 5C2BH 5GSVB 3CK0L 4MHHG 1U3JA 1OAKL 2H3NB 2YPVL 4YO0A 5H35A 5D6DC 2B5IC 3ZKNC 4BA8A 3L3DA 2HVJB 4ORZC 4QGTA 1KCSH 4PJFB 4FMKA 3HB3C 3MO1B 5T1KB 3EDFA 3QJHA 4YHYC 3GSOA 1WUNT 2F53B 4Y89A 1ZGLA 4I48B 3MR9A 3HMXH 4NUJA 2N56A 1IM9A 1IAOA 4DKAA 5IB4B 2L7UA 4MNQB 4JZJB 1BHGA 3RFZC 1JBJA 4Q6IB 3L7EB 3W11C 2YPLE 2IPTL 4QHLB 3MA9L 4XRCA 5C6TH 5C9KA 3R8BB 4YBQC 2X70B 1KXVC 2H2PD 2ZUYA 3ARGB 3C8KA 1UH2A 1QSED 2CO6B 1MFAL 4QRQA 3ZE2F 1XT5A 3Q5TA 1GC1L 5FYLE 3BIKB 2NY2B 3QEHB 4W4OC 1A47A 4TNVK 3L3GB 5FGCE 3DHJA 1OF2B 1RHFA 2J5LB 1BMGA 3EJJX 1Q0XL 1JGDA 4HIIB 1UXWB 4U1NA 3QDGB 4LU5H 3CH8A 4LCCC 4HBQA 4JRYD 1IGCL 4EZMA 3CC5B 3KLDA 4Y1AA 3ARWA 5BOZG 1P53A 4P5TA 1K85A 2NY3D 1FE8H 1XCTB 3QUXC 3D2UA 3QEQE 4XVUC 3SDAC 3RWJA 1IC7H 4YX2H 3I75A 3EJYC 4CL7A 4XTRC 3WXVL 1NKOA 5GJSL 1G7PB 3RWEB 1U3YA 5KJRH 5EUKA 4XH2A 4Z7WF 3L3HA 4KQ3L 2DAVA 2CSPA 5GPRA 1YEJH 3O45A 1TNNA 1D6EB 3O6FD 3BVNA 3QI9B 1KT2B 1U3HB 4XPHH 3R4DA 1WT5A 1RV6X 4IHOB 3O3DB 1P4BL 4RAVB 4LNVA 4AG4L 3OKOA 2HH0H 4ZFOA 1S8DA 2YMXL 2ILLA 5AG8A 2V2TB 3PWNA 2RIKA 2EKJA 4Z95H 4OM1L 3LS5L 2BMKA 4DQOL 3D18B 2X4TB 3RTQD 2FB4H 4KTEL 3KPRD 1GOFA 2WINA 1G7LB 1QFWL 2R0KH 2UWEE 2J1KA 4UZGA 1DQQB 1NGYB 2ZUWA 1Q72L 4Q58C 3NACL 3DV4A 1XGQA 4L4JA 1K9TA 5B3NA 3JWNC 2BVOB 4NJAL 4EVNA 3T2PA 4AM0B 2P5EB 5CMAB 5D7IE 1JNLL 5C0RH 5J3HD 3B2UD 4NDMA 2EC9T 2GQHA 4TSAL 3K8LA 1SY6L 4K3JL 3NMEA 1ZS8B 5HHNA 5IVXB 4IBLT 1MVFA 2D7QA 1HDMA 4OZHE 3V4VH 4OKVB 2J6EA 3X3FL 1QFUH 4U1SB 1S3KL 2IF7A 4BSVB 4PS4L 5GS1C 1QRNA 2F19H 3DETC 5I75C 4X80L 5HGAB 2JJSA 3SGKC 2VQ1A 4XPFH 1R3KA 1BAFL 3OPZL 4JREB 2YPKB 3WN5A 5TDPA 1M7DA 1CXFA 4RMVA 1KIPB 4YUEL 2EO1A 1ORQB 3H2WA 4ZFZB 1QLEH 3EO0A 4ZUVB 1T2XA 1YMHB 3ROLA 1VFBA 3C6LC 4ZUSA 3OHXA 2ZSWA 3ZMRA 1ZA3A 4NUGL 5EU6A 1A6WH 4G7YH 1LEKB 2JCCF 5T3ZH 4M8VA 3T04D 1DQDL 3GSNL 3INUH 3BD5A 4N0UB 1KN2H 4TUOA 5DUPL 2ARWA 4BZ1H 4NQEE 3FO1A 4PGDA 4M7KH 4UDTB 3RWGA 5DHVA 3DARA 4R8WH 4O5LL 1CE6B 5BJTB 4AMKL 3MJ9H 5T1KD 3AFLA 3RZWA 1X5HA 4WU5A 1AJ7L 1RJZB 2F53D 3AREC 1G84A 2OMBA 1E4XI 4J4PD 1A6VH 3SGDH 3WFEL 4MNQD 4HAGA 5E99H 2CUHA 5H35B 4Y4KA 4FNLH 2A77L 5HXMA 2V9TA 3HZYA 4RISL 4GMSH 5TDOA 4PR5A 2NX5A 3QJHB 3GSOB 3NVQA 1VSCA 5ICXA 3TBTA 1KTLA 5KW9L 4ZD3H 1ZGLB 1P6FA 2FBOJ 3VW3H 3MR9B 3QB7C 1L6ZA 3ARGD 4NUJB 4RGNB 4X99B 1IM9B 3RGHA 5JO5A 1IAOB 2V5MA 3HNTL 4XP5L 2VLKE 4YEEA 4GXUM 4K3GA 3LOWA 2ZG3A 4LAQH 4GLRH 4NQCE 2D7TL 4DAGH 4XRCB 1TCRA 2QKIA 3CZFA 3BKMH 4ODSL 3QDGD 4PJXF 3SCMC 2F58H 4RMUA 4QRQB 4NWUH 5CEZH 2X9YA 2ZKHL 3FO0L 2X09A 3PGFL 3SO3B 3NCEB 1CXKA 3SY0A 4F7MA 3EJZD 3LAFA 3HNSH 2HJFA 1HKLL 1VKXA 4XNMB 1DLFH 3K7UA 3CDGA 3BH8A 3IFLH 4YZFF 3TT1L 2ZG2A 1A7RH 4Y1AB 1MQKL 4OTXH 5D72H 4P5TB 3CGTA 3IDJA 5HDOA 4JFEA 4EDXA 2KPNA 1OSZA 3DTXB 4S1QH 3D2UB 1AFVL 1BFTA 3V7MA 1EFXA 4HFUH 5FCSH 1R3LA 3QI9D 3RWJB 1U3HD 3SDCA 4Y2OA 1MCQA 3I75B 4I0PC 1FL5A 1OY3B 3PQYA 1J9CT 1R5VA 1DANU 1RIHL 3C08L 1KNOA 5J13C 5T1MA 1V3LA 1XAUA 5GS0D 2DN7A 43C9A 5EUKB 4XH2B 3KS0H 3L3HB 3LQAL 2FX9L 2X9WA 3FQUA 4FQCH 3VXUA 4O2EA 3O45B 3BVNB 2QHLA 4A2MA 4YQXH 1SVCP 5FGSA 1V7NL 3CH1A 3F65A 4L3EE 1FZOA 1EAPA 2EKSA 3OKOB 3QIUA 3A6OA 4ZFOB 1S8DB 4PTUA 3JWDL 2ZCHH 2IANA 5GZND 3B43A 1JE6A 4O9HH 3PWNB 2FGWH 4UT9H 3FJTA 1T83A 2P5ED 5CJQL 5DRNA 3VGAB 2MCPL 2C4FU 3B3IA 5FGBA 1U58A 4PRPA 3H9SA 4QXGH 4BUGA 2MOVA 4U6YA 1CFNA 3DV4B 1TJGL 3OZ9H 4RFEB 3DVFA 1XGQB 2NY4B 2DYPA 4H1LG 5DR5H 3DVGA 2EDWA 4EVNB 2EH7H 1KLGA 3O6KH 2BERA 4PJCA 1DN2A 4NN7C 4UOJA 3DMMA 4O58L 4HPOL 1OB1A 4NDMB 5C8JA 5F3HA 1Q94A 2F5AL 5EU3A 3CFEA 3UJTL 5HHNB 2WV3A 1KENH 1C08A 4YK4C 2A38A 4F2MA 1HDMB 1XF1A 4X6DF 1F4XL 1FAIL 3UROR 3HC4H 2N7BA 4XNQA 4N8VA 1JPTL 2IH3A 5I1AA 3G6JF 1MJUH 1QRNB 4N8CH 4OQTA 4PJIE 2E7LA 3ZDZF 5IBTH 1XCQA 4CNIA 1WQVT 4XNZC 1QSFE 2P5WA 2VQ1B 5FYJH 3KPPA 1R3KB 3P2TA 3WN5B 4TSCL 3RZCA 3MSPA 3K4ZA 5TDPB 3UJIL 5FKPA 1F4YH 1WISA 4WY7L 1C7SA 3EO0B 3ROLB 1VFBB 3LEYL 4NQXB 4KTDL 4ZUSB 3U2SA 2OP4H 3MRBA 3OHXB 3IAGC 1QYGH 3MLTA 2ZSWB 5DJ0A 1ZA3B 4WUUA 1UT9A 3MCLL 5SX5H 3RY6C 3PDDA 4U1LA 5EU6B 2CKBA 1BREA 4WU7A 1D5IH 3HR5A 1B4RA 4OSUL 4TUOB 1BWMA 1AGBA 4JJHA 3FO1B 3W9EA 4PGDB 3GBML 5EBLA 2VWEC 5LVEA 4IDJH 3RWGB 5DHVB 3P0GB 3MLVH 2AP2A 4KTYA 5TDNB 2OL3H 4WU5B 4XCCH 1M71A 3CVHH 2IQ9L 3MBEC 1DP0A 1FH5H 1RFDH 4RGND 1A3RH 1IM9D 2IJ0C 1CDGA 4OGYH 4X4ME 4Y4KB 5EZJA 5E8PA 5D5MA 3HZYB 2VJXA 2KZ1B 5KS9A 5TDOB 4PR5B 2NX5B 5EO1A 5ICXB 4G3YL 3TBTB 1KTLB 5JO5B 1PY4A 4UQ3A 1V3MA 2JKXA 5HVFB 1JGVL 3MOQA 2Y4SA 4PLKD 2CK0H 5BOPA 1NH6A 1MFBH 3DVIA 1TCRB 2QKIB 2WANA 3CZFB 1KCUH 3MLSH 3WIIH 1KGCD 5EIVA 1AXTH 3MRNA 5E7FA 4Y1AD 3VGHA 4P5TD 1MCEA 1NLDH 2WP3O 3ZE1F 3V0WH 1PG7L 2WUCL 3BP7A 3D2UD 1IAMA 4BQ9A 4G5ZL 1FYHB 4ZODA 3PXHA 4Y16C 3SY0B 3CXDL 4X5LA 4F7MB 2E6JA 5C70A 3L5WA 2W60A 1VKXB 1FDLL 3GMNA 5KVMC 1YDPA 4MQSB 1Y6NR 3CDGB 5HDBF 2R0WH 2XTLA 1I7TA 2X4PB 3IDJB 4JFEB 4WHYG 4EDXB 1KB9J 4KY1H 1OSZB 1WZKA 1EEZA 4NZUL 1EFXB 1R3LB 1DUYB 3ZTJG 3QXVA 4WWKC 2NR6D 4URTB 3SDCB 4ZPTA 3I85A 1FL5B 5JW4Q 3PQYB 4Y5XC 3QG7L 4FQQA 1ZHLA 1RZJL 4JY5H 1R5VB 5GJTL 5B4MD 1KNOB 5T1MB 4OAWA 3DYOA 43C9B 4Z18A 1GL4B 1BOGA 2OM5A 4OLXL 3FQUB 2W92A 3AM8A 3VXUB 4O2EB 2QLVB 4FFYL 1MCIA 4FABL 3ZTNL 2GSIA 3ET9F 4Z7OE 3VG0L 1ZE3C 2ARJQ 3CH1B 4KKBD 1FZOB 1EAPB 2EKSB 1JI1A 3QIUB 4X7FC 4PTUB 2ITCA 1EMTL 2IANB 4QTHA 1PX3A 1LO5A 2NY5H 2R2CA 2NY4D 5E94A 4Q9QL 2QHRL 1B2WH 3VMOA 4MJIE 1SBSL 1E4XL 3FFCA 4JO1H 3GFUA 3RTQC 5ID1A 4XAWH 5DRNB 5H94A 1GGBL 5HY9A 3ARFC 3DVNA 3GEWB 3B3IB 1BJ1H 1H3XA 1U58B 4PRPB 3H9SB 4NBXB 1HZHL 3RY4A 4U6YB 3AS0A 2DYPB 5D70H 1WEJL 2VSDA 1KLGB 5I71B 4PJCB 5J3HC 4OLYH 2EDYA 3DV6A 5D1QA 2F54E 1RMFH 4X83A 1QRND 3DMMB 3IAQA 2D03H 3S9DB 1OB1B 5C8JB 5F3HB 1Q94B 5EU3B 4ESKA 3IDXH 3CX5K 3CFEB 2HKHH 5DMGD 5F7FA 1MELA 3TF7C 1FORL 4TNWK 3GKWH 2DQTH 2AJZA 4F2MB 2B0SH 1MAMH 2W9EH 4PD4K 4XNQB 4N8VB 5C0BA 4KK8C 4RNRA 3O4OC 5JOPD 1JMXA 4XXDA 1F45A 1J0IA 1XCQB 3B2VH 3CUPA 4CNIB 2P5WB 5EU6D 3KPPB 5E8DL 3RZCB 3I02A 1JIBA 4JN2A 3RY5A 1IKFH 5D96B 5FKPB 4OCRH 2D7PA 1J88A 3QSKB 3U2SB 1I9IL 3MRBB 4QRUA 2ARJA 1WIUA 3MLTB 5DJ0B 4BUHA 1BM3H 4WUUB 4GSDL 2V5TA 2FLBT 5EIQA 1S7VA 4U1LB 2CJUH 3IDNA 1CR9L 2AJSH 2E6QA 3A67H 2CKBB 4WU7B 3WD5H 1LO2L 4UTBH 2MFNA 3HR5B 3ULVE 1BEYH 3E0GA 4Y4KD 3VFRA 1AGBB 3W9EB 5EBLB 1Z9LA 1DEDA 2HWZL 4UBDC 3CJJA 3EBAA 1REIA 2NX5D 1M71B 2XKSA 3L3IA 4M3KB 3X13A 1NCDL 4JZJC 4GO6B 1ADQH 5SWQB 2QBWA 1T0MA 5E8PB 5EFIA 1JHLL 4MWFA 2I25N 1OAUH 3HUJA 5D5MB 1T2QH 3DUUA 2AQ3A 5KS9B 4MXWL 4LPWA 1FFRA 3QUYA 5EO1B 1JZ8A 1T20A 4NKQB 2AJ3A 3ARGC 3MLRH 2A2QT 3ZKSD 1MCRA 2VXVL 4XT1C 4YC2C 2QEJA 4NCC2 3NCJH 4UQ3B 4G7VH 1CE1L 1NMBH 1T80A 3OAZH 5DA0B 1EIBA 1II4E 4D0CA 1PSKH 5J12C 3GIZH 4U31A 2AABH 1LO4H 3PHOA 2YD5A 5DRXA 1G9MC 4EUPG 1FL6A 1R3IH 2J5LC 4HK3N 2HMID 2P7TB 2NY0B 4G6MH 4QOKE 1WCBA 4M7LL 2BHYA 1RZFL 2APBA 2WBWB 5J56B 3NZHH 3LHPH 3MRNB 1UZ6F 1IEAA 2C3GA 4TYUA 4K94H 4TSBH 2PCPA 1AXSB 4JFED 3MV9E 1S7UA 3T4YA 1JPSH 3BP7B 4Q0XL 1EFXD 1ZT1A 1QBML 2B4CH 2VABA 4H0GA 3L5WB 1CL7H 3SDCD 1S7RA 4U2ZA 1RZ7L 1KBGL 4XPTH 3GMNB 3PQYD 1YDPB 5KVGL 2FX7H 1CDHA 2Y07H 1I7TB 1GIGH 1NCWH 4HG4K 1JFQH 1EEZB 4UQ2A 3VXUD 1KEGH 3IB4A 1AR1C 1PW3A 3QI9C 5C0ND 3THMH 4ZPTB 5DMKA 5IF0A 4XP4H 4OLVH 4M9PA 4MJ4A 1ZHLB 2NCMA 3JUYA 3QIUD 5F6IB 4OAWB 2IAND 3NAAL 5GS0C 5CGYD 2O93L 2EXYD 2VIRA 3TA3C 4JQIL 4U49A 1CDCA 1ZT4A 3CZJA 3X3GL 5JW3H 4H1LA 4Q9RL 1A7OH 3KYKH 2GSIB 4M6MH 3ROOA 5TF1L 3TYFA 3DECA 4PJDE 4PRPD 3H9SD 3KXFE 1MHHA 4QTHB 1LO5B 5E94B 5L2KE 2DYPD 5SX4I 4AT6A 2PW2A 4OLZH 3U46A 1P7KA 3TBVA 3FFCB 3KPNA 4U6XA 2UVEA 5CILL 5GGVH 5ID1B 4LK4A 5H94B 1KB5A 4U4BA 3S34L 5HY9B 2R1XA 3DMMD 3DVNB 3S37L 4FTVE 4F15B 5GGTL 2CRZA 4N9OB 5JDJA 2JELL 3ESVF 1FFPA 1WTGT 1JNHA 4JHWH 2BY0A 5I74C 3VMNA 3P4NA 1QA9A 3DV6B 1U8PA 5DD0L 4K23L 3RVWC 2FEDC 5K9QG 2GYSA 5D4QA 3STBA 1OQXA 5C0AA 1OWWA 5TF0A 1EHLH 4CAGA 2V9RA 5IMLA 2P5WD 1DZBA 2I9TA 4JREC 4G8GA 4X7SL 7FABL 5AWNL 3RZCD 1SEBA 2ESVA 3R06A 4KUCD 5C0BB 1IBGH 2YZ1A 4RNRB 1MY7A 4XWOC 2Y36L 5JZ7D 2ZZUT 4XXDB 8CGTA 1IC5L 5ITFA 3WMSA 2EEBA 3CUPB 4WUUD 5F8QC 4GRWB 3HN3A 3ARRA 3FO2A 4JFDA 4MXVF 4XBEH 4MJ2A 3FMGH 1U42A 4HKBB 3I02B 4E41A 5EDXA 4JN2B 1BGXH 4F80A 5JXEA 3RI5F 5BS0A 1YEDA 4F58H 2OJZH 1IZKA 4I13B 4QRUB 4FQLH 2ARJB 1HI6A 1YY8B 4LPCA 4KMQA 1AR2A 4GT7A 1S7VB 4OZIA 5D7JC 3IDNB 2KBGA 5CKGA 5AYQA 5F96L 3WIHA 3QWOA 2XIDA 5M94B 2OQJA 3DURA 3ZSTA 5I1EL 2VWEE 5D2LE 4PRDA 3KR3H 2OR8A 2DLTA 2PW1A 5EH1A 4AEHL 3CDYA 1AC6A 4PPTA 4H5SA 2XZCL 2ZUQC 3L3IB 4RGNC 1OPGL 4XMPL 3X13B 4ZG1A 5HD8D 2IFFL 1UM6H 3M8OL 1T0MB 5EFIB 5GIRA 1P1ZA 3MFGB 4MWFB 3HUJB 4JFXA 3DUUB 3T0WA 4DW2H 4N90D 3B5GA 3TH3T 5IESL 3QUYB 3BXNA 4NIKB 2NY0D 1LEIA 1T20B 3QYCA 2AJ3B 1CIDA 1R0AH 4HIXL 4QF1B 1FO0H 5LQBH 5IBLC 2YD8A 1J0HA 2R4SL 3DYMA 4D0CB 1NCUA 3PHOB 5DRXB 1KJ2H 4UNVA 1FL6B 3SKOA 3SO3C 2VSCA 1MNUL 4WJ5A 3EGSA 4EDWH 3A6CH 1ZGLM 3H0TA 3HTLX 5F7EH 7CGTA 1WCBB 2DBLH 2C4XA 4IDLA 4WTWA 1DLHA 1HH6A 4UI2A 2G5RA 2DQHH 1IEAB 4P5TC 1FYTE 2PCPB 3WL9A 2X6MA 3NA9H 1S7UB 3T4YB 1H3GA 1F90L 2Q3ZA 1ZT1B 1TTUA 4YHML 2VABB 1S7RB 2HP4A 5FA4A 1X5GA 1PLGH 2YUXA 3QCVH 2R23A 4OLUL 5E00A 5DWUL 3BIAX 4JG1H 3QJFA 3SPVA 4U6VH 4MNHA 3WHE1 4GMTH 2FRGP 3L3KA 4UQ2B 3U6RA 3BDYH 4H20H 1TNMA 4ODVH 4MA1B 1QP1A 1MCOL 1WT5C 3OB0H 5DMKB 2CDGA 5FAAA 5IF0B 2P49B 4F7TA 3T0DA 2D0FA 1GGIH 1M05A 4LQFH 5GGRA 3Q5OA 2BNRE 5C0CA 3LB6D 4C56E 2WLYA 4KWUA 3U4BL 2VIRB 5AZ2H 4XMLL 4KAQL 1ZT4B 3FFCD 4H1LB 3VGAC 2DQUL 1MRDH 4LEXH 4ZTPL 3ROOB 2EEAA 4NM4H 4KKBC 3TYFB 4RQQA 2XXMB 4ISVA 1NFDB 2GCYA 1MHHB 4NO5A 1RUML 2NY4C 3GHEL 1K8DA 3Q3GA 4AT6B 2PW2B 4KVNH 1K3ZA 4UILH 3U46B 5DJ8A 1P7KB 2VDQH 5AZEH 3KPNB 4U6XB 2HFGH 4C83B 3T3ME 1KB5B 2R1XB 4XHJD 3CVIH 5KOMC 1WZMA 3LQZA 1A14L 4RIRA 4KJPD 2PO6C 2X5PA 4XB8A 5C0EA 4N5EC 4JGJA 5GHWL 2EDXA 3M1BA 1A5FL 1CT8A 3EW3B 3EDJA 3F7QA 1FFPB 1JNHB 1PEZA 1CGWA 4POUB 1ZA6A 2O5XL 4QGYA 1N4XL 5C0BD 3P4NB 4F7PA 1H8NA 1QA9B 3ZZ1A 1U8PB 4PJ5A 1AY1H 1D6VL 5C0AB 2JJSC 2BC4A 4XCFH 2I9TB 1NAMH 4IM8A 4G8GB 3WN5C 2N4IA 2DF3A 1KJ3H 1G6VK 1SEBB 3QXAA 5B22A 2ESVB 3ARUA 3R06B 4DTGL 1NFIA 3VCLA 2Z35A 2HTLD 4G9DA 4TUKL 1HQ4A 3B9DA 5DQDH 3QHTC 4Z8FH 5HGBA 3HI1A 3FO2B 4Z7WA 2RAMA 1EO8L 2QSVA 4FZ8H 3VGBA 4E41B 4KHXL 1HK6A 1OARL 5BS0B 4J3OC 1UKSA 4M1GH 4BH8A 3MODH 1YEDB 3MBXL 4LSTH 2DQGL 3VFTA 4K71B 5L9DH 5LWYL 4Z7VF 5KVEH 3GHBH 3B4NA 1BFVL 4OZIB 2YKLH 3BE1L 5TE6H 1RULL 3B6SA 5F9OL 5T33L 5I1IL 3QWOB 5HI4D 5C0JA 1JWMA 2OQJB 2QADC 3P40A 4NT6A 2DQEH 5KVFL 2WAHA 3MGAA 2R69H 3K1KC 4PRDB 4DN4L 2EXWC 1GSMA 4JHZA 5C0DA 4PJFE 2PW1B 3UTSA 1I8MA 3ECBA 3SKJH 2F53E 2G9HA 3Q48A 4H5SB 4OCWL 4XX1E 5IMKA 3QUYD 3P4MA 3NFSL 4LCIH 4EUPA 5D1XA 1FC1A 2YZ8A 1EBPA 4ZS6D 2FL5A 5IQ7H 1B3JA 4I2XE 5TGBA 5DQJA 5GIRB 1P1ZB 4ZFFA 3MLYH 5L2JB 4MB4A 4JFXB 3VFGL 4F9LA 12E8L 2W0PA 1KSRA 5GRUH 3BXNB 1LEIB 2BHUA 2GK2A 4AEEA 4ZFGH 3CX2A 4X9BA 1HQRA 1CU4H 2ADIA 2JTDA 5DI8A 4QHUA 3CX5J 4DGIL 3H6JA 4DGVL 4KUZL 3VXSE 1SEQH 4I3RH 5F9AC 2EE6A 3SKOB 3I6GA 1F3DH 1A7NL 1EGJH 2V17H 4WJ5B 3EGSB 1NMCC 1OP9A 3H0TB 2AJVL 3C8DA 3V5DB 2XI9A 5DJYA 5CD5D 3HMXA 3N9GH 4OZFH 4YDLB 1DLHB 3SGJC 1NCNA 5I1LA 4LCWA 5D6CA 1X5YA 1X3DA 4KRMB 4K2UH 2AKRA 5JHDE 4LLYA 3L5XH 4HCRA 2JCCA 3RVUC 3QHFH 5EU4B 4KK6D 3UYPA 2YHGA 4I18A 5FA4B 3SE8L 5C07E 1WV7T 3O2VL 2DM4A 2LU7A 2CRIA 5ACZA 3F58L 2R23B 5E00B 1QHOA 5ALBL 3UJJL 3QJFB 3SPVB 1OSPL 3TV3L 1BQSA 1TMCB 4MNHB 3N1PC 1A4KA 3L3KB 3U6RB 5C0NC 3VH8G 4XNUH 4Z7UE 2CDGB 2O5YH 5KSVA 5I19L 1LDPH 4F7TB 2D4FA 1MFDL 3KYAA 3QIUC 4R7NA 2WNGA 1M05B 4H88H 3KPSA 5GGRB 5C0CB 5CGYC 2DIAA 2EXYC 2O5ZH 2XN9E 4H26A 3RPIB 2R15A 1T83C 2VLJA 1TLKA 1WBYA 1L9NA 3HR6A 1CI5A 2WMPA 2IPTH 2CKNA 1HHGA 5FGBC 2GSGA 5I8EB 4RQQB 5J0BA 3CSYA 3K4DA 4ISVB 2GCYB 3C09B 1HKFA 3DO7A 3D1MC 4NO5B 3TJHD 1K8DB 3Q3GB 1XF3B 3GK8L 3B9VA 1FAKT 3CLFL 5BXFA 1FG9C 5DJ8B 3CXHK 4MA8H 4PJAE 3IDIA 5B39G 4PJXA 1KN4L 1MFEH 4XBGA 4CU7A 4P59H 1AE6L 3SDDC 3N85H 4JDTL 4FFZL 4LRIA 5C0AD 2VRAA 4U1MA 2A6DA 1RUAL 4RIRB 5C0EB 3IF1A 4JPVL 3M1BB 4G8GD 1CT8B 1T1WA 1X4YA 1ZA6B 3QQ9D 3RVVD 2ESVD 5IMOA 3MYZA 2X05A 5BW7C 1G6RL 4F7PB 4PJ8A 2B2XH 4PJ5B 2FH8A 4WV1A 4LLAA 4ELKA 5E2TH 2B1AH 4YHLL 2BC4B 4JFDD 3MRDA 5DJCA 1SJXA 1JI2A 1S9WA 5HTSA 3RZCC 4E41D 2I5YH 3D39E 4KMLB 5JXED 4KQ3H 3TNNA 3VG9B 2ZCKH 1NFIB 5BS0D 1P9MC 3HRZA 2PYFA 2VH5H 2ZJSL 1MJ7L 1NGQL 4XCNA 3VCLB 4G9DB 3V52H 4Y8DC 1QSZA 3VD4A 4AG4H 5HGBB 3HI1B 3MFFA 5ETUA 1N6QL 1CGYA 1G9ML 1HYSC 1N7MH 5D7KE 2VXQL 2QSTA 1R5WA 4BH8B 3U0PA 4PJBF 1WGOA 4M3JA 4KTEH 1T7XA 3VFTB 3UTPD 3TNMA 2C3WA 3FOMA 1U3ZA 4G8EB 1MLBA 3B6SB 5F7LB 2Y25A 4NJAH 1YEGH 1JWMB 5C0JB 4NT6B 3QEUA 1HHIA 2FO1A 1MHEA 2NYYC 1RUQL 3PWJA 1JGUL 4DUXA 2D3VA 5C0DB 3Q6GL 4R6UA 3Q1SL 4UV4L 2H6PA 3FRUA 3UTSB 4YDKL 1I8MB 3ECBB 2G9HB 3D3VA 5IMKB 3DWTA 5JR1H 3P4MB 4EUPB 4RGNE 5D1XB 4J3TA 3DXAE 2FL5B 5HD8C 5JMRA 2BVEA 2FD6L 2VDRH 2XQBL 4ONFL 5TGBB 1A6AA 1WCQA 3QHZL 3X3FH 4ZFFB 4GW1A 3T09A 1T1XA 5K59E 4OIIH 5GS0L 1HE7A 1XGPA 2ICWA 5LGKA 4OCYH 4X6DA 4GS7B 4WENB 5AD0A 4Y0GA 1HQRB 4BK5A 2ADIB 4YUEH 3G6JA 2P4AB 5DI8B 4QHUB 3V7AE 4JCMA 2NY7H 3EYVA 1FNLA 1ITCA 2DLFL 3UXFA 5J06A 4W6YB 3OAUL 5FOJA 4CN4A 2SEBA 3P77A 4P3DA 3I6GB 4XVJH 4HIEA 2E7HA 4JAMA 1XGUA 2B7DT 5FYLH 2DS4A 4HJ0D 2ERJB 5DJYB 4FQ1H 4Y1AE 4L5FH 4MQ7A 4XNXH 1KJVA 3ZDYE 4PB9L 4LCWB 5D6CB 1YEHH 5M7QA 1L6XA 2AKRB 3E8UH 4LLYB 2JCCB 4DGYH 4DUWA 1D9KA 1DSFH 4XC1H 4I0CC 1CK0L 1N64H