3G3LA

Crystal structure of putative membrane-associated protein of unknown function (yp_211325.1) from bacteroides fragilis nctc 9343 at 2.20 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
296
structure length
291
Chain Sequence
PAEAKYYIAGTITDATTGQELTTAKVTLGDKSVTSSFNEQVNYKAEGYALVVSADGYYPVKRQVYLNQVSDGQTSVATVNVALVSVEAAVIPPVVPPTDPETDINEGEATKVADKAVEVAKPSESTVTDMLAGTTATPEEKKALDETLEMAGGMKVGETTPEVLADGSILAITPVKFTNPIQDAPAMVPYFYNEGCELTGDVKEVAAPVAVAADIQKAFLSNAAKALNMNAGFVQKIGYTRISVLNGYSILGYTIKGQLVSKKLTFLISGKYYEGIVSYQKSVMIYPNYYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized membrane-associated protein
publication title Crystal structure of putative membrane-associated protein of unknown function (YP_211325.1) from Bacteroides fragilis NCTC 9343 at 2.20 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Structural genomics, unknown function
total genus 71
structure length 291
sequence length 296
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 3g3lA00
3HN5A 1H8LA 3G3LA 5K39B 3MN8A 4FXTA 4IYKA 4YOKA 3KCPA 5G5DB 3NJVA 2XHNA 3NJXA 3E8VA 4FL4C 1QMUA 4EIUA 1UWYA 2B59B 4WI0B 1NKGA 4U3SB 2NSMA 5AQ0A
chains in the Genus database with same CATH superfamily
2GQHA 4PJGA 3QHFH 2NY5H 1JGUL 2CJSA 5LCVH 2MPAL 2EVGA 3E8UH 2I9LB 4M1DL 3VA2C 1YY8B 1TO4A 1C5DA 2PPDA 2WPGA 3GEFA 5F7WC 4C83A 3D4YA 1OPGL 2YQBA 2IG2L 4HGKC 7FABH 1RPKA 4CGTA 4P46B 2YARA 2UWEA 3MV8D 2WGXA 1JNHB 1B0RB 1XGTB 3NZUA 1C7TA 4OVVA 2YMXH 1GW6A 5IIEA 1N8ZB 4LCVA 3ARBD 4KI5E 4Q2ZB 1UXSB 3CFBB 4B53A 1NC4B 1JZJA 3OV6A 1F4WH 3Q5OA 2NQCA 3IE9A 4BGDA 3GDCA 3ZTCC 1CPUA 4XXDB 2R2BB 4WI4A 3GI9L 4ZQTA 2R1WA 4BQ9A 1IEAB 1J9RA 4OJDH 1MCCA 5DK0B 3MO1A 5F93C 5CN1A 3WD5L 1HL5A 3CXFA 5H4YA 4AEIH 1OKEA 4KZEL 1P4IH 5BJTA 4PJHB 2EH8L 4L4VB 4YDJA 3WO4B 4PJDA 3DROB 1AXSA 4XPTL 1E2VA 5I74C 1TFPA 2AZAA 4AZUA 2R9HD 1TZHB 5D5MB 1FC1A 4A37A 2QKIB 4XBMA 5TE4L 5J12C 1P5VB 3CSYA 3VWJB 5L7XH 2W9DH 1BQLH 1E6JL 3G6AB 2YGQA 3MREB 4MJID 3P3TA 4UT9L 5IESH 4HK3J 2ZG1A 1SLVA 2J8UB 3N3EA 4HALA 3TEXA 1T04B 3KPMA 4Q0XL 1D5ZA 3KJ4B 4KHXL 4QGYA 1VPOH 5G5DB 4URTB 5E9DD 2IDCA 4I0PB 1FPTH 5FM5O 4M5SA 4ZMVA 1WD9A 4LVHC 3EZJB 3WV0A 1GYWA 1SMDA 3CDGB 4TYUA 4FQ1L 1ZSDA 2N7BA 5EORH 1U8NB 3TYGL 4BELD 2CK0L 3T0EC 2OQJB 3GGWA 4R4FL 3LZNA 2N7SA 4NIYE 4GRWF 4Y2DB 2UYLA 1NFIA 3TBCA 3VGGA 1J5HA 2IF7A 1L7TH 2MH4A 2VDML 5HYIA 5KUMA 4ZFGL 4CGUB 5CR8A 4A55A 3GIVA 4R5VA 1NCTA 2ENQA 1PKQA 3FFCE 4FFZL 4OV5A 1HIMH 2DB8A 5LHDA 3N1PC 4M6OH 2LQRA 3MLWH 3SY0A 3C09B 3SODB 5KS9E 3VAEA 2YA2A 3UJIH 4LARL 2DQEH 1OV8A 3GJFH 3RE0A 2HXAA 2BHFA 2KC0A 3LMJH 4ONGH 4M48L 5DEGA 1CFNA 4RVBA 3W37A 5DMGC 5A3ID 3FQUB 2OSXA 4L4TB 3I9AA 1S7QA 3D39D 1KGUA 4KXDA 3RZWA 1FZJB 1GW0A 4I2XE 3BPOB 3ZE1B 2XG5A 1ZA3A 4N0UA 1KG0B 3ML8A 3WNJA 1EZLA 2CRZA 4HEPG 4I3RH 5C70A 1UJTA 4I88A 5IMMA 3NSXA 4G7YL 5DUBA 4OLYH 5HYQB 3C6SB 4YO0B 4DJMA 4XMLL 1I53A 5LBSH 3IAQA 2J1YA 1LNUA 3AU1A 5IKCA 1FZKB 2OKMA 3FB5A 1T20B 4N3TA 2MCMA 1VA9A 3ZE0E 1T1WA 3LY6A 4LOVA 1U8OB 3QZMA 4F2MB 1Q9WB 1IIKA 3CXHJ 4OTXH 2FL5B 3V9EA 2YGPA 4X6FA 2RB8A 4NP4H 3C6LD 3D3VA 4WO0A 2EDTA 4AYMC 3W39A 1IQWH 1URLA 3STLB 1YZZA 2JTYA 2IMMA 4QRAA 4JHAL 4DFIA 1TQVA 4JANB 3WSQH 2OFQA 4U1LA 3N1FC 3ES6A 1MCPH 3ULUH 1VFAA 5I0WA 3HE7A 2OMWB 4P23A 4PJCF 1PZ2A 4ZFFB 1F3DH 5MHSE 3I9PA 2P44B 1MJUL 2DWDB 2FLMA 5INCB 4MAYB 5LVEA 4ANXA 2UZYA 3DMMB 3MNWB 1MCOL 1UC6A 1IZJA 2K6WA 1EH9A 3BUDA 2CIIA 1AD0A 2BJMH 5K33A 3FUDA 2VRKA 4HIIA 1EFXA 5F3HA 1QABA 2IXQB 4IJ3B 3WO4C 5CHNA 5J89A 5LCVA 2HVBA 3L3GB 3MI6A 1XSJA 2AHIA 4OM1L 1RZ8A 2QKIC 3FSOA 5FB8B 5DUPH 3WS3B 4LLYB 3P9MB 5KYUA 2C4FT 5I19L 3UFIA 2F54E 4JJOA 5E4EB 2BP5M 1OGAD 1BVZA 3CZUB 3M07A 4P5KA 1OT4A 4XBEH 4JRWA 4DERA 4YSQA 4K9EC 3KXFE 3PV6B 5D7JD 3KPOB 2FEDC 4I0PC 5DFWH 5JHAA 1NUGA 2YOAA 5B38A 2AITA 3FB7A 1BD2D 1HTYA 2QADB 1R0AL 2NLJA 3EJSA 3O4LE 2VITA 5ECGA 5EFIB 1VRSA 1MI5D 3U9PL 1IQDA 2FQEA 1S5IL 4J3TA 1A6AA 3Q2CA 4EVNA 3PFQA 1NPUA 4MCNA 2VLRA 1SJHB 2OZ4L 2DLIA 3FB8A 4G8AC 4XN5A 5IK3A 3Q2NA 3ARRA 1YYCA 4OZHB 2IQ9L 4I77L 2F5AH 4PLKC 3MV7A 1FSKC 5IOPB 2VR7A 4MD5B 1JHTA 3S35X 1QSED 3OKLA 2X53A 43CAA 1RPUA 4HD5A 1KBKA 5E6ID 1HESA 1BZOA 4FZEL 3RI5F 4QRRE 2R2EA 1T83C 2W1NA 5IMKB 5IT2L 5IQ9B 3TCTA 1IGJA 1CDBA 4DETA 5ISZB 4JO1H 4XHJC 3BAWA 3EOAB 5HYJA 3BGFB 3GWJA 4QCIB 1AYOA 3RP1A 1NTDA 2Y7NA 1WCBA 5IF0B 1FAKT 1E28A 1S3RA 3ROOB 1CUOA 4BH7A 1HHGB 3FU9A 1MW3A 3K2MC 5DRNB 2YMOA 3MYZA 5FYJE 4ALAH 4AX3A 3RWJA 5JTWA 3B6SB 3H3KA 3QNZB 4P59L 1I4FB 2FCBA 2OM5A 3O2WL 3QIBD 4XZUB 3UTSA 2CO6A 2CUAA 3HC0A 5FR3A 2RGSA 3O3DA 4P2CG 4KROC 2CGRL 3MHZA 4AC4A 5SX5K 2G3ZA 1BLNB 5D9SB 3NYKA 4YDIH 4UUJA 5EIVA 4HSQA 5KG9B 2FBJH 3IVKB 1IBZA 3Q5YA 3AS1A 4UIKH 3STZB 3E8VA 4IHOB 5HHOE 2O61A 3K72A 1WFOA 3LKPA 1HC1A 4IRJD 5HI4C 4F92B 1D5BB 2BHZA 3GJFA 4MNGA 2X2YA 1ZVHA 4HK0B 4YHYC 1WWAX 1U8MB 5DVOA 3MUJA 3C60C 4H8WH 2DEWX 3X3FH 1HQ4A 1KOAA 4Y1SA 2GY5A 1ICTA 5B22A 1UVQA 5FA4A 2VDQH 1CG9B 4TPRH 2BOCA 3SQBA 1T5WA 3VXMD 1FL6B 4KC3B 3IXAB 1VLXA 1VGEL 5KSBA 2GPZA 1QEWA 2FWOA 3EYOB 3DX0A 3HBPA 4WW2B 4XAWL 5B39A 2F58H 3T2OA 5LBSA 2OI9C 5IB5A 4TNWK 1SM3H 4ZNEE 5GS0D 4BH8B 2NY7L 1TKWA 5IJDC 3U2IA 4J3XA 2R0WL 5HSFA 3U1SL 1H6EA 2VR4A 4LZKA 3L6FB 3M45A 3ETSA 1ITBB 1GS6X 4PJHF 4F8TA 3DK0A 5GJTH 4HUXA 1HNFA 1SF5A 4N1EA 5D5MF 1BJ1H 2DIEA 2PXYD 4PJAE 1CTOA 4Q6IB 1FFPA 2DMBA 4X6EB 3BFWA 1ZHKB 4MQXD 4W9KC 4G6MH 1EJOL 3Q8EA 4QRPD 1P0SE 2QZQA 3DETC 3P77B 2J8UF 2DQDH 2VISB 3OMIB 3D07A 3T0VA 2XYCA 4WWPA 1A47A 3HVNA 1N5YL 4JJ5A 5D8JH 2XZZA 1L0XA 2R69H 1LQSR 3KYKL 1I8IA 3IMSA 1X5GA 5DJ0A 5CIPH 1K85A 3MRQB 4YPJA 3VYNA 1QPPA 1XL6A 1MFCL 5E1IA 2AERT 4BSVA 1AQDA 4RMSA 3SE3A 2JI3A 2W07A 5GGSY 4MDIA 4PVMA 1F4HA 3L4XA 3OSVA 4H13C 1FDLH 5L2JA 3NTCL 3KBFA 5J6GA 4JY6A 5L4JA 5LQBL 1YAZA 4Y4HD 2A0LC 3FU8A 2F53D 4N2IA 1OALA 5IBTH 1XF2B 4MJHA 5L8JB 3D4GA 1ETJA 3OKEB 2E59A 2IH3B 2WXJA 3Q44A 4O9HL 1KTJA 3H6AA 1RZ7H 2LU3A 4OCNC 1RZFH 4GT0A 3R0NA 3B2DC 4HWZA 1MOEA 4YX2H 1SFDA 3V2AR 2EC8A 3MV8A 5LN8A 2X40A 2D7NA 5L6YL 3BN3B 1N0LB 3DURB 5DMKB 3EO0B 3O41B 4FXGA 3ARBA 4JZJC 3TN0B 1F1DA 1FNEB 1TJGH 4HJGA 4H1LH 3QC5X 4Y16A 3AW5A 4PSPA 4IK7A 5K9JL 5D6DC 3RGVD 3ZE1F 5TDPA 3JVGC 4UILL 1U8KA 4DNLA 3U36A 3IKKA 1D9KC 3HFFA 4NM4L 2R0ZL 5D2LE 1FZOB 1OTUC 3K8LA 4QXGH 4WDIA 4ZMZA 3ESNA 5BZXA 3BFOA 5TH2B 2CQVA 4EKXA 3EGSA 3MBEB 3MRRB 3FF7A 3VSTA 3AUVA 4U3CA 3SGDI 4JW3A 5HVWA 3ELAT 2XVLA 3SYQA 2CD0A 1CGSH 2OX5A 5GXBB 3IDYB 2FE0A 3OTTA 1SEBA 3C5ZD 4V2CB 2P43B 4RZKA 1RMFH 4ZAKC 1FE8L 1RUKH 5BS0B 4MJIA 4NQXA 5ADPL 5DK2A 4K4KA 5EU6D 1G7IA 4EUPG 4X99A 2DQCL 5I6LA 2JB5H 1D5XB 1TSRA 4JLRA 3NFNA 3T71A 2R1XA 4HKJA 4QYOA 3U4AA 4K8RD 5AW8B 1R46A 3EBGA 3RX9A 3MZGB 3S3JA 1LK3L 3WKMH 4OI7A 3A3YB 3QE5A 3IU4L 3ZN6A 2F5BH 1BEXA 1OB0A 1TMQA 3QZNA 3AB0B 4WW2C 1MPAL 4L8CB 1J1PL 3MOBH 3T4AA 3NAAH 3GSQA 4KRMB 4W9GC 2PUQT 4Z7UF 1QR1B 3V8CA 5DVMA 2Z64C 1N12A 1CGWA 1XAUA 4HV8A 2IPTH 2EDNA 3TOPA 4L9DA 5HVHB 2B1OA 3MLPA 1BZ7A 3MJGX 2FB4L 5GRUH 4CC0A 2XSKA 1I82A 1UQSB 3BH8A 2YD9A 3GSNH 3A67L 3FB6B 5C0NC 3KPRE 1EGJL 1MEXH 2CKBB 3UBFA 1OP5K 4ZFQA 4DN3L 2WLMA 3R19A 1AJ7H 1I8KA 3EO9L 3CHXA 4OI9A 1MKFA 1PZCA 3GSWA 3LB6D 2RA1A 5KOVC 4AYGA 1M56B 2QPEB 2FO8A 4ERSH 1O9ZA 4MCZB 4WWKD 4K7PL 1RLBA 2JJVA 4DP0X 3D39A 4GAYA 5IVXB 1RP8A 5FO2A 4ZMWA 3AWGA 4OCXL 4OJYA 3VVVA 2GT9B 4HPYL 2FJFB 2YGVA 2YKLL 3GUFA 2GJ6D 4UQ9A 3UAJC 5M95B 5GS0H 2YC1B 3SDAD 5KEZA 3HG5A 5EA0L 2MEJB 1V7MH 4DO5A 4JN1L 3O0LA 2F08A 4HZ1A 4JFXB 2CA3A 1RHFA 5C3TA 4OZHF 2GTQA 1T7VA 3S96B 3C6LA 3W11D 3UO1L 3E6HA 1ZA6B 2YPLD 2XTSA 3B4NA 2JSFA 1UWYA 2NTFA 5F1KC 3TTSA 2QSTA 3L95B 3OAUH 1QQDA 4LSPH 5DT1H 4WU5A 5A6MA 2B7DT 2K4WA 3RVTD 5L2KB 2E7HA 5EOQL 1E9PA 1ZJBA 2R69A 2XN2A 3DIDA 4YJZL 5CIPA 3HG1E 3NH7H 4JR9L 5B3JF 2GTZA 3UTPE 4M5YH 4QT5A 1N68A 3DRQB 5F9WB 3KWWB 3ESOA 5C0BD 2BMKA 1OLLA 1ECZA 3DX7B 1BZ8A 3TT3L 3F7RA 2YD3A 4BQ6A 3BAJA 2F8XC 1Z3GH 4N8VB 5H2BA 2BY3A 4PG9A 2YQGA 1H6TA 2VLME 1KXVA 1KPVB 2MQCA 4KRPB 7TAAA 1C1EH 5CKGA 1NAKL 1KELH 2OMBA 1OGAA 4OGXH 5E8PA 4OLXH 3TZVC 5FM8A 5HHQA 3O6FD 1J11A 3QG6B 3MLUH 4FHJA 1HCVA 2QHRH 3DBSA 3NP3A 3VXNA 1N2RA 3MNZA 1ML0A 1XGYL 5FW7A 4OSUH 2NY0D 3QYCA 35C8L 5D7JA 3GBNH 5C86A 1ZIBA 5KVEL 3GS4A 4LSSH 2HFFB 3SDXE 1VGKA 3WFDH 1DVUA 4PBVC 4RGNE 5EOCH 2ERJC 4FQHA 5F0PB 1J8HE 4JMNA 1OP4A 3K8KA 2OCJA 1MI5A 1JHKL 4UINH 4KFZC 2X4PB 2X1XR 1XH3B 2C9VA 2K78A 5MI0B 5GRZA 2APTA 15C8L 2XWBB 4EZMA 1DFBL 5KJRH 3CLFH 3DV4A 1X5YA 3ARSA 3NFSL 1LE5A 5E99H 2BVQA 3OKDA 3SYAA 4H2CA 3SZ6A 4BRJA 1PY0A 1QSEA 4GQ9H 4HISA 4L5FE 1RJLA 1N10A 2XQBL 1E8YA 5E6IA 4PRAB 2XPZA 3ZGHA 1XMEB 4N8CL 2E6PA 3U4BH 3UAEA 1OGSA 3H9SD 1J05B 4GSDL 4DP2X 3FQ4A 4OLVL 1T1XB 3HI1A 4UOZA 1Z9NA 5GRVK 4ETQA 4IEFB 4AQAB 3LN4B 3DX6A 3QDMD 2H3XC 5K59F 1G6RH 3MV9D 3KPSB 4K8RH 4KQ0A 2PCPA 2JIXB 2X9YA 1JWSB 3U79A 4L8SC 1OSZB 1O6VA 4L3CB 4RBPK 3NZHH 4OCSH 3O9WC 5SWZB 4L29B 4NRZA 4AGPA 4U0RB 2ICEB 3RVVC 3VSUA 5DHEA 4ANWA 4HWEH 1C12B 1ZT4A 5L88H 1NJ9A 4ZMOA 3LZFH 1CXLA 3MJ7A 5E5UB 2NNXA 3GSNA 4P2OC 2NW2A 1D5MB 3TEWA 3LH2H 3DOHA 1CXFA 4HCRH 4LQFH 4ZS7H 1E8WA 1GPOL 3VRJB 5C0FB 5KVDE 2BS9A 3L4YA 4HFWB 4KI5D 4WWNA 4BXVA 3QXUA 3V6BR 5CD3A 5I0XA 2EXYC 1P69B 3PL6D 3F6JA 4R5XA 1BYNA 4KNQA 4QY8A 3PAVA 4UOJA 2MPVA 5LG1A 3VO0A 1P4BH 4FF9A 1EO7A 1WITA 2D7PA 1JXJA 2AXGB 4PJEE 3V6OE 4PJ8C 1UM6H 2EE6A 1U3HD 2AJUL 4KK9D 3VXMA 4I18B 3JV4A 3RIAK 1NCCH 4NDMB 2ODHA 3ZY7A 2P7TB 3EJUA 5ELIA 5GRXG 1AHWA 5EU4A 1QYGH 1UWFA 4EI6A 5KOMC 3IMVA 3D8MA 4PV9B 2C4FU 3PHQB 2APBA 1CICD 4OUOA 2ED8A 3LEVH 4GFTB 4MB4A 2WLLA 1N7ML 2J2ZA 3CLEH 3GRWH 1S7SA 4PHZA 5IROD 3B7RL 4NCDA 1J0IA 3AM8C 3BD3A 4KRPC 1EAPA 4NNXB 4G5AA 2IV9A 3QWOA 4MMXB 2PXYA 3E3QC 2DLEA 2WQVA 2YQ2A 5JIDA 3W9EB 2H6PB 4FYRA 4OD3H 4A2LA 4QRPA 2L8AA 5HGAB 1HXMA 1NIBA 3DV6B 4ZMYA 3HN5A 4NKMB 4R2GB 5DUMH 4G7VL 3MV11 4OGQC 3VWKC 1J0JA 2DD8L 4AIEA 4LEBA 4KPHH 3QNXA 5TDNA 3FSWA 2HLEB 3LRHA 4D3CL 1ROCA 3ERXA 1VZIA 2P80D 3QORB 4UQEA 3VI3E 2EINB 3LQZB 3FFCD 2VE6A 4G3YL 3MU3A 1PQZB 3T08A 1ED3A 2WVVB 4MJ5B 1J0HA 1SBBA 4CILA 3BGAA 1G4RA 2VSDA 4JHWL 4YHKL 1THAA 1ETB1 4MMZA 2PCYA 3AREC 4PWHA 5EF0A 4N68A 2LE9A 3D25A 4NQTA 3D9AL 4HG4K 4GUQA 4Y4HA 4HJEA 2F53A 2Y25A 3PGCA 1TTUA 4ZMQA 3IBOA 3ARXA 2G60L 4XHQA 3KL5A 4WCYH 2VN3A 3ARQA 5IZ7A 3HZMB 1RU9H 3ZPDA 1MQ8A 2WB1A 1J8KA 4U7MA 5D1QC 1O7VA 2DQGH 4V33A 4K3EL 4FL4C 1TETH 4UB0H 4YDZA 1FL3A 3MYJA 3O3AA 3O8XB 1A25A 1IC0A 1NDMA 3I6GA 1PCXA 4JDEA 3AAZB 4O2EA 4ELDA 1MNNA 1OLZA 4FNQA 3FRUA 3CUPB 4PGCB 2ZUVA 5IVXF 4WTWA 3HBQA 1ZTXL 3TA4D 5JHBA 1DQQA 3PIQA 4U0RC 4G1MA 1I8LA 1KJMB 4UZUA 4DCQB 3PP4H 4FNTA 4HXBL 3T6XA 1CTNA 2FH6A 2XKSA 5CBAB 1EVUA 2VR8A 4PRDB 3K6NA 5CM1A 2VSKB 4FNUA 4K94C 3TBTA 3H7BB 2K9FB 1KTDA 3BZEB 5C0GB 1UD6A 4L1BA 2IAMC 3C5ZA 4ZJ9A 5MHSD 2CLVB 3LSOB 2YQ3A 2VDNB 3L1OL 3B2UD 1ZDSA 4MA7L 3ABGA 2ARJA 3UO8B 2AK4B 2VDLL 2X44D 3MLYH 5EU6A 2IH9A 2WZ0A 1FJ1A 2MSPA 2AQRA 4HIHA 4KQ4H 5DQDL 2WYTA 3CVIH 1XSOA 1Z66A 1G6RA 2TRHA 1NCJA 2UXTA 3FN0H 4N5EC 5DJDB 4LCIL 1OTSD 3ECBA 2A9ML 4YK4C 2FX8H 5DJCB 4E41B 2R83A 2CR6A 4GBXA 4D9LH 2XV6B 2B1AL 1I7UB 4FQJH 2TAAA 3BSZL 4ZMNA 2FVNA 3UOAB 1LTXA 2HT4C 2JKJA 2YD1A 5M7QA 3WDHA 1U8HA 1UYWH 1RIHL 2PW1A 3QIUD 3CD4A 3VI4E 4MJ6B 3WY4A 3PWUB 1ET7A 2VABA 1HINL 1UJ3A 3IMRA 2WN2A 4O58H 2JJSA 2OMTA 1IEHA 2JKSA 2P8MB 3MRHA 1GMEA 1A21A 1H0DB 4W9FC 5EEXA 3G08A 2VAAB 1PD0A 1MIEH 2VLKE 3H9YA 2AP2A 3O4LD 4RWHA 2E6QA 4GW4B 3V7AG 3ZKND 5I0ZA 3NZSA 1ND0B 1AGFA 2XFXB 4ABWA 3WGVB 2IFFL 4KUZL 1TCMA 4WWKA 1SOQA 1SUHA 4GB9A 2AVGA 4PPTA 2D3JA 4FJZA 3U6RA 2G75B 2R23A 3EUUA 2EKSB 4IRSC 3W2DH 1H3TA 1OK0A 4XP6H 1C9SA 4ZI8A 4NGHH 5JXEC 1Z9PA 1S7VB 1F6AA 3S37L 3VXRB 2GJ6A 1NBVH 3PWPB 1EO8L 5CZXD 5C3LD 4F5CE 1DCLA 2P49B 3WTXA 4O5LH 5KW9L 3SDAA 4QRRD 2IADB 2FR4B 3GRWA 3NJNA 1EANA 4R4BA 3BCFA 3QNFA 2WWKO 3EBHA 3I02A 4BCZA 4KJWD 1YJDH 4LEXL 4XMVA 4JHVA 1L6ZA 3F65A 4DK5A 2A74B 2WSPA 3K6OA 3OR6A 3FO9B 1WBXB 4OGAD 2YPLA 1M7DB 2H0PA 1KWGA 3NOIA 4BFGA 3VD1A 4ODBD 5A2KH 1DJWA 3CCHB 3UBXG 3I9GL 4E5XB 2CPCA 2XA8H 2H9GB 4PCSA 3O8XC 5MP6H 2DM2A 1B2YA 2AV7B 3GYRA 3TBYB 4F91B 3GO1H 1VFMA 4OVUA 1AZRA 3I2CL 2XPYA 3HI6L 5FM5M 4LNRA 3MCYA 4OLZH 4QRSA 5GPRA 2HG5B 4EN3C 4EIUA 3SPVA 1CI5A 4EDWL 4P4KD 4U3HA 2LVCA 2XBTA 2XIDA 5E8NA 4LLWB 3NESA 4UV4L 2YGOA 5HHOD 2NXYB 1INQA 1H3PH 3KBHE 1D7FA 5IR1B 4HS6A 4MS8C 5HHPA 3AQYA 5C0BA 5BRZB 1RZPA 3H3BC 5JPMA 4LSTL 4FNRA 3IS0X 4RMRA 3VFSB 2A9CA 1P9MC 4DN4H 4DP5X 2B14A 1M7XA 1QRNB 3P2BA 1F3JB 1ZDQA 2LFGA 1SBSL 4FQXD 5F89B 5JMRA 1URIA 4WI5A 3MMEB 3HMWL 3NCYS 1MCKA 3CK0H 1F3DJ 4M62L 5K1NA 4J39A 5GQBA 1W8OA 3BVNB 5EN2B 4FLSA 1JUFB 4I1PA 3TO2B 3OPZH 2A9NH 4DUVA 4PJ9B 3UADA 4GMTH 3T6QC 5L4IA 2VLLA 5DD6B 2ATAA 3WYRA 1CFVH 4QHLB 2F7IA 1NM4A 5K1JA 2H1PL 1I85A 4W6YB 1T4KB 5DD0H 3G5XB 5CSGA 1I3UA 4L9LB 2BS8A 4Z3EA 2HKFL 1OP3H 5FGCB 3V0JA 3F7VA 3L3OC 4IIZA 4HC1L 2JJUA 3V0WH 4ZSOB 2VDOB 4JDVB 1KMGA 1AMYA 4OGYH 1XGUB 1WZMA 5I71C 1JF6A 2VDRH 3NSCA 1RUQL 2OAAA 3WO3B 3IETA 4NC0B 1A6WL 3OZ9H 1A7OL 4G8FB 1I1YA 1JPGA 1KIPA 3DO7B 1DLHA 5IJCC 4KVPA 3VG9B 3H9SA 5EEUA 4J1UA 5ICYA 1EBAA 1ETA1 2WV3A 3TURA 3LS5L 1NPNA 2KQMA 4IBUA 1E2ZA 3EBAA 4CUCA 3QDMA 2W60A 1E6OH 3MV9A 2EVHA 3MLTB 4JQXC 1C8PA 1PNDA 1TMCB 2WQWA 4MDJB 1ERNA 4BYHA 3IKCA 5LWYH 3TTYA 3PE9A 1K8IB 4JFOA 2ATKB 2CU9A 4QO1B 1ZK9A 2C3VB 3NN8B 5B1JA 1B3JA 4X4XB 2RAMA 1QNZH 3TT1H 4S1RH 4WU7A 5CZRA 4HLEA 3KNBA 3MRPB 2Y7OA 4CADA 3MRCA 4NNYA 5D93B 5AB2A 2H32H 3LKRB 4J8RB 1LK2A 1R5IA 1KBPA 5GSRA 5K39A 3AXLB 1ZAGA 4NKIL 4G8EB 1ZE3H 5F7UA 4QKXB 3CSBA 2QQNH 1BHGA 5C6TL 1D6EB 1E27B 2L7QA 2ZT9C 3EG9A 3PL6A 4WI8A 3QXTA 4AL8C 2F68X 4NHCL 4XP9H 3C8HA 1KGCD 1QO3B 3V5HA 4XPHL 4FXKA 5JORA 4Y9BA 5D1ZC 3U4EA 2Y72A 4DVRL 1U3HA 4PY7A 4JO2H 3HRZB 2CHNA 3DJ9A 3CZFA 2DMCA 4IMLB 1UA7A 4S1SH 2BY0A 4MA1B 4Y4KC 3VFOA 2AQ1A 1T5XB 3C08L 3LRLA 4DPCX 2CBMA 4UDUA 1SMOA 3MR9A 5KYYA 1KNOA 2B9AA 1CICA 3D05A 3SZKC 1KB5L 3V4PB 1ZHLA 3BZ4A 4HLZH 5IROA 4JKWA 4UZGA 5DJ6B 1MFEL 4OAWA 3EYUL 3FQ1A 3HE6D 3PXLA 4NRYB 4QD2E 1JCVA 1U91A 2XG4B 1ZLWK 4GG6B 3EDFA 1BFVH 1JGDB 3PDOB 3RIKA 3I3BA 3KYOA 2OR9L 1JTOA 3L4TA 4X7TA 3AGWA 4H8PA 4YHLH 3R7QA 5D96C 1HOEA 4PJ7A 2FIKA 2Y7QA 1F5WA 5CUSL 4OQTL 4FOMA 4PTTA 2AKRA 1AGCB 3ATFA 4X5LA 1JXDA 3DVNB 4IOSD 5EO1A 1AC6A 3ZRFC 4JUTA 4TUJA 2A6KB 3O3BB 4Y0GA 1QVOB 3OJMB 4G71B 3MRKB 3FFCA 1M7IB 2ZCHL 5C7ZA 1QBLL 2GC7C 3T65A 3KPRD 3QQ9C 4KZDL 4QTIL 5EV7A 1AGBA 3HA0A 3ABMB 2ZICA 1JYVA 4ZUWA 3PJSB 4XXWC 1BFOB 1BQKA 4M43L 4PU2A 1T66C 1YQVL 3QJFA 1DE4B 1FNGA 3QUXC 3HS8A 1XWVA 4PV8B 5LXVA 5ICXA 1IVTA 2VXTH 2WLZA 1RZGA 3KPLB 2UX6A 3FQTB 5C0EA 1N64H 1Q1JL 1UT2A 2Z1KA 3S34H 5KJ4A 1VEMA 3OAYK 3QQDB 4I2XA 2H2PD 5HYSB 2X0WA 5D4JA 1CFQA 1I1AA 3DYOA 2ADGB 4Y5XB 2NW3A 1ZEAH 1XO8A 3QQXA 5E2WL 5C6PB 3E2HC 5DZAA 5DJZB 2VQ4A 4Z7NE 1PIGA 1INDL 3L5WB 2QZ5A 2DL2A 2PYEB 3B2VL 2IDUA 3ARGC 5IW1B 1OM3H 3NJFA 3SCMB 1E5ZA 1UOVA 1MIMH 1AXTH 5HDOA 1DUYA 3PGDA 1B0IA 3FQWB 2WAQA 4ANVA 5DO2D 4PS4H 3KL3A 5BW7C 3K46A 4FFVC 5FM4A 3W5MA 1CTMA 3PU7A 4Y2LA 2H47C 3NIGB 4NT6A 3HKZA 4WTXA 4LVEA 5CEXA 1AGDA 2DPKA 2LTQC 2CJUH 5F0JB 4UBDD 4B9JA 1JSYA 2H1LM 3NABH 4JRFA 4YUEL 4FNSA 3V4VL 3LVEA 4IU3A 1C5DB 3FCSA 4NQSA 2VAJA 1CL7L 3OMAB 2BSDA 3RJDA 2VWEC 3QDJD 5T5FH 4ZFZB 4FTVE 5AW9B 3HG1D 1CGTA 4HIJA 4PWIA 3UTPD 4YSUA 3SBWA 3NSJA 3OD3A 3ME0B 2A73A 5EU3A 3UC0H 4A6YH 2VGLM 3BDXA 3M1CA 5I24A 4RRPM 2DJSA 1Q1PA 4MDRA 1TEFA 4TL4A 5C08E 4OF0A 5IUCA 3AY2A 1YYLL 1H15B 2VLMD 1IGFH 3PQYA 3MO1B 3WFHA 3QCUL 4GT7A 5CZKA 1A3LH 1F02I 2OBGA 1D7DA 1NIFA 4Y1AB 3QIUA 1T80A 1JXGA 2WJ7A 1KXTB 1TVHA 3T0XA 4FNLL 2H32A 2ZCKL 1C08A 1TTRA 4PJDB 4Z18A 3CVHH 1OY3B 1KC5L 5DTFA 5EZOL 3RWHB 4GMSH 1RZKH 2G4GA 5MEPA 3QWRD 4J2QA 1ESOA 2FT6A 5JA8B 1KJ2H 5F71A 4UV7H 3CSYB 5FO7A 3QR2A 4AH2A 1ZD6A 4RGND 2DDQH 4NLHA 4DW2L 4P9HH 3HUJB 2OTPA 3STBA 3O4LA 2NYYC 1J8HD 4QKTA 1D5ZB 5CGBA 3QH3A 2O5ZH 3TEZA 1G7QA 1VCAA 1U8LB 4WUKH 1JZDC 1F86A 5L8LB 1CU4L 1QFUH 2ZJSL 2XZAL 3FTUA 4X7SH 1DVXA 1MFAL 1CLYL 3RNKA 2QQKL 3ILQD 2G2NA 2JI2A 3GZOA 3EXJA 1SJEA 3DVGA 4YVUA 2B3IA 3F58L 3UZQB 1NFIB 3X2QB 2G0KA 4WHYG 3U0PB 4ENED 5K9KA 3CVDA 4QRRA 5GZNC 4WUUD 4B0MB 5E4IA 4N2KA 3CDYA 2FQFA 1E5CA 1WAAE 3H3PL 5FHAH 4L3FA 3CPLA 4OV5B 3MA7B 1OAUL 1EEUA 4Y5VC 2G5BA 3ZDXB 2X2JA 1S7WA 1YEJH 4M4RB 4NEHB 5JIPA 1HNGA 2YUZA 2ZUSA 2I60L 1S7RA 1LEGA 2WCPA 3PPSA 5FUOL 4WSGA 4J3OD 1G1OA 4ZUTB 5MEOA 1S4IA 4MKMA 4HUNB 2WXOA 1PEWA 4K23L 5DEGB 2Z91B 4YQXL 4JM0A 1S7QB 3DC0A 3PGFH 3QT2A 4PB0L 4R0LC 5FYKL 1NGPH 1ID5I 4R7DB 4N0UB 4F15C 3QPKA 4X6CA 2IGLA 4LXFA 3MNVA 2VDPH 3GXPA 4P4KA 5C0RL 5DUBB 3L08A 4PRID 3CU7A 2WZ5A 5HHOA 5CEZL 4JKNA 1FGVL 1YEGH 2RFXB 3KS0J 3O3EA 1KXQE 2Z7ZA 4Y89A 4HVBA 2DQTH 1TTBA 2F6AA 1LNUB 3AU1B 1XD0A 1QFWH 3FB5B 3LD8C 4MCMA 1MQKH 4PI0A 1MCJA 4PWGA 4RGOH 2CRMA 5DDHA 1OAQH 5HGGS 4DPRA 5LKNA 2VKXA 4Z7VA 3J27A 1J12A 2B59B 2DYPD 3V7AE 2DL9A 4X6FB 2X7LB 2WZPD 1QBMH 3QB7C 1ZK5A 2DWXA 1ODUA 4UWQB 1NUNB 5CKAA 3D3VB 4PBDA 3R18A 1LO3L 3NJMA 4FQXA 4GNKB 3W39B 4TTGA 1IZKA 5E23A 2DBLH 3JTSA 1TT6A 2ZCZA 3WNMA 3ILDA 2BZCA 5KVFH 3HE7B 4P23B 4RSYA 3L5XL 5I1KH 2QL1A 5F1NA 3R4RA 1VADA 4ZNEA 4U1JA 1ZS8A 3MTXA 4DEPC 4M8QB 5T3ZD 2UZYB 2FEJA 4HU2A 3SSGA 1CCZA 3G9VA 3SJVE 1GGIL 2GI7A 1XF3B 5EEYA 1AD0B 3SOBL 2AMGA 5E08L 2GJZA 4HIIB 2XWDA 2Z1PA 3ZIYA 2F9BT 2IWKA 3FTXA 1A6VL 4PJAA 4UU9B 3W0WE 3NUKA 3NT0A 3PP3H 3LDBB 4MMYA 3BLKA 5AL0A 2WIMA 1T0OA 1H6UA 5F3BA 5IB1B 1RZ8B 1X5HA 1SXNA 3N1MC 5JO5A 5KYUB 5EF1A 1CQKA 3LHAA 3BKYL 2X4RA 5IW3A 5T5FA 4GXVL 4P5KB 3DJZA 4Q9RH 2I7OA 4GG6F 4BZ2H 3IJYA 4PJFA 1MXGA 4DEUA 5C71A 1IAIL 3QO0A 3QWNA 4RA0C 4BKLB 2ZWLT 3FULA 4BDVA 4P5SA 4CBPA 3CNKA 3ZMEA 4A6YA 2X6BA 4XN1A 4JY4A 1WIUA 2VC2L 1KIUA 3M1OA 2ADFL 1R4XA 1UA6H 2UY6B 4IBLT 4I1NB 1FVCB 1QSVA 4A39A 4B0MM 4EVNB 1V7NH 2ZP0T 2VLRB 3FB8B 5E94A 3MRLA 3US0A 5IK3B 4LL1A 4TQ8A 5IVNA 2Y3NA 4PRNB 1RJZA 4HUWA 3CVHA 4H4NA 3L9EA 3FT4B 1JHTB 4LSVH 5IJBC 3CAFA 4ICXA 1KJ2A 4PJ5E 1T0NA 4LGSB 3UJTL 2H41A 7PCYA 3H54A 3LZRA 5C3IA 4PJIA 2R2EB 4R4NC 3TFBA 2EUWA 4Y19E 4TN9A 1JGEA 3BKCH 2ZWZA 3D51A 4DGYL 1HOCB 4WKXA 1AP2A 2FZ3B 4OCMC 1XGRB 2ZOTA 4GXFA 1ULVA 4UYQA 3SGEI 4XPBL 1DO6A 3QEQE 3TP4A 3CFUA 3PWNB 3LN9A 1E9QA 4BH7B 3CVCA 5CP3H 4J5VA 3KLKA 5F21B 4DTGL 3WTTA 1INEH 4H88H 4Q4EA 5KAQG 2R2CA 5ERWB 3HC0B 1G84A 3O3DB 2J1WA 2GHZA 2W95A 4IGBD 4N28A 4O2CA 4QMEA 3ALWA 4Y2NA 1TVDA 4L5FH 2P47B 4U1NA 4XPGL 2JCCF 5FHBL 3SKOB 3V7MA 5FCUL 3SE9H 5IMLA 3ZHKA 4NXKA 5ITBL 2KH2B 3IRPX 4OT1L 3HE6A 3K72B 2O61B 3LKPB 5JHLL 3NIGF 1CF8L 4NN7C 3WI9A 4NCC2 3I6SA 4CSTA 3IWVA 1JVKA 1KPRB 2VW7A 3CZGA 3TEYA 4BK8A 1WS7A 1A7RH 4YDKL 3HE7C 2R4RL 4X8CA 4J3OH 4KOCA 3TH2T 2VDKH 1XEUA 2VERA 3K5RA 3SPGA 3BT0A 4I1RA 1YMME 5KSAD 3UG3A 4AQ1A 4B7LA 4CVZA 4AM0B 2D7TL 1K2DB 4IOSA 5FA4B 5KVEE 4LOUC 5BRPA 2BOCB 3SQBB 2EIEA 2VM4A 1T5WB 2NY4C 3MBXL 3B2PA 4LRNH 2HX9A 3KPQB 4QXUH 2P8PA 1QEWB 2FWOB 2XU9A 3W56A 1X9UA 4HBCL 1CFTB 1KGWA 2P5WE 5GRJH 3UZEA 1O6SB 5F9JA 4JFFB 5IB5B 2GCYB 1XCWA 3KPRA 4WJKB 4LPTA 2NY5C 3EF7A 5KVDH 4K3JH 2IPUK 3ULVC 1S9XA 2NUPB 2VLKD 2IANB 3K91A 2ICCA 3IJHA 1PMYA 4HUXB 4TTDC 4PJDF 2NY5L 1HN1A 3KPNB 4O51A 1TUPA 2ZWYA 5LCVL 2FBRA 4WI2A 4M9OA 3OMZA 3ULVL 2CUHA 4EKJA 1KXHA 2KZBA 4BQBA 4HIEB 1Y1DA 4P0DA 4G80A 4WHTB 4CMMB 3ATAA 2R7EA 3JT2A 4PIRF 1TTCA 2FATH 2G3MA 3CE1A 3HUJF 3C8DA 3F7QA 4LCYA 5HGBB 4B9PA 3IFPB 2V5YA 5EEZA 3HS9A 1FG2A 4JJ5B 3IN2A 3SDCC 4QOKE 2DH3A 2OW6A 3D0LA 5T3ZH 1AQHA 1I8IB 3HCVB 4Q6YA 4NHUA 2UZIL 2EICA 2NXZB 2AEPH 5SV4A 4OZIB 5T1KA 3S2CA 2G3NA 1AQDB 1M4KA 2PTUA 4JY5H 1BX2B 2W07B 2YO3A 1DZ0A 5AW4B 4PGDB 4MDIB 2E6JA 4Y2OA 3T2NH 2A9BA 1PF3A 5GGRA 1JZIA 4UAHA 4DQAA 1HSAA 2WXLA 2I26N 4MBRA 4NKOB 4B5EA 4Y9EA 3GK8H 3OKMA 4E2OA 2ZAHA 1MWAL 4KKRA 5GSVB 4BZ2A 3I3DA 3VFVA 1RFDL 4ISVA 4YDVB 3BOVA 3QDJA 3ZDXF 5FPIA 4HWZB 2W9DL 3VD9A 3HG1A 3MV8B 3NVQA 5DMIH 1XZ0A 3BHBB 5IESL 4IS6A 3QUZB 1SHMA 1Y07A 1NICA 2CIKA 4XOEA 3QQ3A 4HJGB 3KG5A 4KO5A 4Q9BA 3CMOH 4Z7QB 1VCBC 1WAEA 3TEUA 2CNYA 4X0KB 4GRLD 2WWMD 3L3HA 1U8KB 2ALWA 3SPHA 5EORL 1JNNH 3QJQB 4LBEB 1ACCA 3TPKA 4WDIB 4P5TA 4JG0H 3C5JB 3TPUA 1W9XA 1YNKH 5I8KH 1M6UA 5JW3L 4KXCA 3DTDA 2I5YH 3HZYB 4HEPA 1AS6A 1UEMA 2EEBA 2KDGA 2YBGA 2X89D 4MJ4A 2ZSVA 2JXMB 4OCLC 2YBRB 3QWRA 1KYDA 4OCYH 1SEBB 3F7YA 2YUWA 1OB1A 3WXVH 3MCKB 2OYKA 3NJGA 2FX9H 4QWWC 5HPMA 2XN0A 4AITA 4B60A 5AW3B 5DK2B 1NAMH 5C0JA 1G7IB 3FCTA 1J8HA 4AMWA 1ZWIA 2WKOF 4ZPTA 4JLRB 4EBQL 5IEKB 1AZUA 2R1XB 3B7SA 2F0CA 2IBGA 1KBGH 3BP5A 2AQ2A 4QYOB 5CGTA 5E9DB 5ILTL 1E4XI 1OTTD 1T6WA 3E3QE 5CP3A 4ONGL 2E7LA 1UXWB 4TOYH 2HSIA 3AS0A 3GM8A 4D94A 1WE5A 1W0VB 1Z7JA 2ENSA 3OF6A 3KE0A 2BZDA 2JI1A 3F2LA 3N55A 4OFYD 2V5TA 4LHUA 3QCTH 1OAZH 2N1TE 4RMUA 4M29A 4XNMA 5JHDB 5HDWA 4Z8FH 3QRGH 4WUUA 2XZCH 3QSKB 1CO1A 1QUNA 4I3GA 2EIBA 5IP4A 1MNUL 1EHLL 3HC4H 1HSBB 3BPCA 3HNVH 1UKQA 4KDWA 4H26B 3MLVH 1A4KA 4OJAA 3ULUC 4NP4L 1SQMA 5FXCH 1KZYA 1BQHA 1I8KB 3ZHLA 4UTAH 1B9ZA 4AYEC 2RHEA 3GXMA 3ULUL 3FHQA 5DMGD 5LAXB 1WG3A 2IQAA 2VDQB 1GGBH 3OKKA 3D39B 1F58H 1G9NH 2ZOLA 2YAQA 4XCNB 3I50L 2D3NA 4NPYA 5BQ7A 4DGIH 1NCOA 1A9EA 4PRIA 2AJVH 3GEWB 4NUGH 1ZTXE 2A38A 1TF4A 1UOLA 2WIIA 3MLRL 5F88B 3WE6A 3GSVB 4JN2A 4MAZA 4N2BA 4NB7A 4R26L 4AQ8C 1GS8A 2LU5A 2R8SL 4W1TA 3U2JA 3VGAB 2WZPA 1J48A 3C6LB 1ADQH 3P11L 2XNAB 3FHEA 2DM7A 5ACLA 1BLIA 2FEEI 3N50A 3CQFA 4KY1L 3WEAA 3NIDF 4RDBA 4XMKL 4YBLC 2HVKB 1EZSA 2NTFB 2GY7B 1FNSH 2R29L 4R7NA 3N0PB 4XBEL 3Q1EA 1DR9A 2KERA 5BCAA 3Q6GL 3BWSA 3LQAH 4FXGC 3ARBC 4ORGA 3VRIA 4JRXE 2X42A 2NDFA 4ABQA 4OJCA 3X1FA 1LMKA 1BBJB 4Y16C 2D4DA 3UIZA 3RHWF 2BVUA 2GTWA 1MW2A 2Z8RA 3L54A 2R15A 1CLOH 4B27A 4XWOD 1JDDA 4QT5B 4EUPH 2Y4SA 4LF3A 3VFTA 2ZSWB 1JGUH 2FHFA 2MPAH 1ANUA 3HNTH 5E8OA 4M1DH 4MRBA 1GYCA 3N85H 3NPSC 2R9HC 1A7BA 2DQJL 4LCUB 3FN9A 1OPGH 4PG9B 2IG2H 5H2BB 4U2ZA 5DHYB 2QVMA 3N9GL 3QZWG 1HHKA 1XSKA 1A3ZA 1USQA 5E8PB 2EEDA 2G2RA 3MRBA 3VXNB 1ET8A 3MNZB 3VI3A 2P9RA 3M86A 2KMWA 2XKUA 3L3JA 1M9WA 3KZ8A 1NANH 5AW7B 4BV1A 3VGBA 5F9AC 4ALAC 3DHPA 1VGKB 4H1LB 2BERA 3GI9H 1RJYA 2XYBA 1AR2A 3CFMA 4NZUH 1BD2B 1KPUB 1DVFD 3WD5H 5KJ7E 5MEQA 1T22B 3T4AC 3K6FA 3C6EA 4KZEH 5AVVB 2FDBP 3ZL2A 1E5AA 1MI5B 3UJJL 2EH8H 4ALAL 1CMOA 2ZXCA 5LDUA 3D6GA 1RHHA 4HKBA 1CI3M 3RVXD 4XPTH 3O2VL 2EIZA 4DZBB 3IK2A 2APXA 1NC2D 3S48A 1LE5B 5TE4H 4GQRA 3OKDB 5CLWA 3QJHA 4YDIL 1MCSA 1E6JH 3PUUA 1QSEB 3S5LB 4UT9H 2DH2A 4U2YA 2PO6D 3UCRA 4XNDA 4Q0XH 3LEXB 1PYWB 3TJHC 3GLEA 4HJ0C 1NAMA 4H8WC 4NCC1 3GF8A 3FU5A 3HI1B 3BWUF 1DSFL 4ETQB 5AW6B 4MD4A 5HGHB 1HAWA 4PMFA 1UM5L 1U8JB 2NSQA 3TYGH 2PCPB 1FFOA 4R4FH 3ZUNC 2OW7A 3AXIA 5J7CC 3ZE2E 3US9A 1XR8A 4D0BA 2EDFA 4MCYA 1GGCL 1UOWA 4XPAL 2VDMH 3QIBB 4ZFGH 1PS3A 1ORSA 3OXRA 4LKXB 2UXFA 4IGBA 5B1AB 3WDIA 2IVFC 2D2CC 1NJ9B 2XXCB 4OZIF 3GSNB 4FTVD 3ZGIA 1DBBH 2NW2B 3BWAB 1YUHB 3VXOA 1J0KA 3MRMA 1AQ8A 1TYEB 1R9FA 1GTNA 4CVWA 1DBJL 3C6LC 1U8IA 4LARH 3RGBA 4IRJB 3F12B 5AOIA 4QHNB 3EDDA 5GJTL 4XN9A 4M48H 4UTAA 1JZ3A 5CJQH 5JOEA 4Z23A 3SE4A 3GSXA 4HH8A 4FYTA 5C08D 3C60D 1DLFL 1MUJB 1NGXB 3B5GA 4MB3A 2HTKD 1C5CL 3BX7C 4G6ML 5JQHC 5KSAA 3ALXA 5IJKC 4G7YH 1P5UB 5C0IB 3FBKA 3MV01 3VXMB 5GGTL 3POCA 4R7VA 2VL5A 1U93A 2JKTM 3WHXB 4AMXA 1OCCB 5FF6A 4KDTA 4Z7QF 5D8JL 4RWYH 2F1EA 4ZUSA 1AHWB 5IQ7L 5CXPA 1FVEB 32C2A 5AB1A 4QJ3B 3VCLA 4P07A 5E1HB 2WLLB 2V2XB 5T1MA 3RUGE 1B2WL 4NN6C 2PWEA 1TQCB 2VLKA 1S7SB 1GH7A 2VQ1A 2PCFA 3FT9A 2PPEA 1ADQA 3V6ZB 4JHAH 3BEWA 3OAZH 2VLJE 1QEXA 1GZHA 3GB7B 1H8NA 1TQBB 1BMGA 1BZDA 1VF5C 3NRQA 3Q8AA 1MJUH 5D7JC 2MNJB 3DETD 4QRPB 1RZ7L 3D0VA 4AGLA 3PP3K 3KWTA 2I24N 4JKKA 2X4OB 3JV5A 4JHZA 4TSBL 2CKBL 1B4TA 1FHNA 1KTKE 4G42A 4L0YA 4K9JA 3P9LA 2BP3A 3S4SA 4Q14A 3QNXB 5TDNB 4HAFA 2ORBL 3BGMB 1TJGL 1QRKA 4JCWA 5D7KD 4JKMA 3KCPA 2BOBA 4EUPA 1KIQB 5DEFA 2XHNA 4Y9FA 1CF1A 4OM1H 3VXQB 1ED3B 3PHSA 1S9YB 2OMYA 5I19H 3G5VB 1GYUA 3AC0A 3L3IB 1S7UA 4RA3A 2ITEA 1T03H 5E6IC 2XA3A 2F53B 3PGCB 4NQVB 1MHPL 3MACH 3UXFA 1A8ZA 2PR4L 5IEHB 3S8WA 1E4KA 3CIAA 2HH0L 2Y23A 2O5XL 1HFUA 4JPIA 5ESQA 2LABA 4N2OA 1R0AH 2XTJB 4WJ5B 1DSYA 3I6GB 4KXZH 3U1QA 4JDEB 2EDRA 3VXSE 3U9PH 3ZDZB 1S5IH 2AQTA 4N0CC 3FRUB 1J88A 3QEGH 1PGRB 3RGVB 4CBZA 4XX1E 4GRLA 4XP5L 5F7AA 1DQQB 3PIQB 3WJMA 4ES8A 1D9KD 2XN1A 4G1MB 1MCHA 5D4IA 3B1UA 1QLRA 2IQ9H 4I77H 4OIBA 4U1IA 5IM7A 1OTUD 3KDPB 5JOFA 1BQRA 1F90L 3FQNA 4BK5A 4N0FB 4FZEH 4UT9A 2EH7L 2X89A 5B38G 5IT2H 4Y7OC 5GRUL 1S5HA 1KTDB 2H8PA 4PIBA 1AZBA 3C5ZB 3EYVB 4YSPA 4ZAKD 3KCWA 5IGXL 1CDUA 4EOWL 1TG8A 2GB2A 5BVJA 2ARJB 2COQA 1FJ1B 1XXFC 2J72A 4GLRH 4HIHB 3SJVD 3Q8BA 4TLUA 1YPZE 1AJ7L 2Q5BA 2WC7A 4G7RB 3SY6A 1ZT1B 4GRMB 1WFTA 2GITB 3A5VA 4P59H 1QI5A 1JCKA 5M94B 1OPOA 2CO7B 2X5PA 1CE1H 1F8TL 2CGRH 5EDSA 2UY7A 4OZGE 4U6XA 2X4UA 4B9CA 3RKDD 5SX4H 4YHIA 1N3NA 1U8HB 4OFYA 4DKTA 3HLAB 1NSNL 1MH5A 2CSPA 2K4AA 1NMBL 1TQCC 3LKNA 3TS8A 1W0YT 1NOLA 3WIIH 4WK0B 2PXYC 2ADJA 1DQJA 3FUFA 3ARPA 5E24E 2VXQL 5BMFH 3CZNA 5L4MA 2CBQA 1JGVH 1NGWA 1KJVB 3RDJA 1AGFB 2WB7A 1VGEH 1V8HA 3OAUL 4WWKB 5DT1L 3GMPB 3UYPA 4XAWH 3BAYA 4YL9A 4J8QA 5INDA 2ZX6A 1NGYA 2R0WH 4WO4C 3U1SH 5EO0A 4K5PA 1E50A 1FL5A 4PJ5D 2ZX9A 3ESUF 1PDKA 3UAJD 4L1DA 2PWFA 3B56A 4Y19D 4MMZC 1MJ7L 4R4BB 4Z76B 3NK4A 5GS1A 1HWHB 2KQNA 3JZ7A 2EDOA 3WLBA 3A4EA 2Z93B 4Y4HC 4XN2A 3QEQD 4A2DA 4WGKA 1UD4A 1YEWA 3OR6B 4O02B 1EJOH 3TF7C 1I7TA 2NX5A 5B39G 1YECH 4DP9X 5JR1L 3N44B 3TBVB 2CRYA 2EP6A 5B8CA 3BI9X 4OGXL 1PY9A 1ETZA 3PNWB 1Y18A 2VTFA 5DZPA 2OL3H 5F7DA 3FBQA 1JYWA 3FUJA 3FRPA 4RIRB 3KYKH 4JHBA 3WEXA 4DKAA 3GBNL 3QARA 1XGPA 2R4SH 2OULB 1F2QA 3NCEB 4LNRB 3ZYOA 3WFDL 3F05A 1MFCH 5JMOC 1T2JA 3F8UB 1JYNA 2CO3A 4R97C 5EULV 2WLHA 1I8LC 1F11B 2IEPA 3SKNA 5E8NB 4F3FA 3DK2A 2F8IA 1INQB 2PNDA 4ODXA 3B9KB 3I6LD 4DGWC 4E9WA 4IRZA 1TYRA 2XLLA 2VUYA 3NTCH 4M6NL 1BAFL 3OWEA 1Z5YD 4JREB 1DBML 5JPMB 4M8VA 3REVA 3K2UL 5CWSA 4ELME 1CFSB 3AS2A 3KH3A 4FKEA 5E99L 4YWGL 2WO4A 3C5ZC 3TV8A 1HWGB 1YMMD 4XTRC 3BSGA 3U9UA 3ZDYE 3MGAA 1UASA 2YAOA 4EIBA 3TZVD 4LFHD 5L6YH 3O6FB 2WSDA 3D69B 5H37A 2GBUA 1V54B 2NY0B 3TWYA 1B6UA 3II1A 4K8RC 2P5WD 5K9JH 1M2VB 5IJVA 4UILH 4HIXL 4GYBA 3DTUB 4OFKA 4ZZFA 5BZWA 2VLLB 4NENB 2H3KA 2R0ZH 1DVFA 1G6RL 3JQOB 4GBXC 1ZGLM 4PREA 4K8RL 3KDMA 2CCLA 1CLCA 2RQEA 5EUKB 2WUBL 3P4MA 1G7MA 2FH8A 4PR5A 3T8VA 3ZBMA 3DJRA 1HJCA 1BXXA 2ZKXA 4ABVA 1JZ5A 1UJ3C 4RDQG 4W9LC 3ETTA 4HWEL 3WHE0 3BH4A 4A7VA 2E8YA 5L88L 1FE8H 4A7GA 1QSFB 2PO6A 3NACH 1I1YB 1JPGB 4TS6A 2TSAA 5LNGA 1DLHB 3LH2L 3TBWB 2DQCH 4FX5A 4LQFL 3H9SB 3HB3C 1AD9A 4AENB 1KTCA 1WBYA 4QOKD 2R59A 3I6KA 3LB6C 1LK3H 2A4EA 1UWXK 1WYJA 1E4WL 1UZGA 3DXAD 4WWKC 2QR0A 4IBYA 4MQTB 2W60B 1NLBL 1MPAH 1J1PH 3IFLH 1KTLA 1CGYA 3LS4L 5FYKE 2B1HL 1AY1L 3IJEB 1R17A 4OH2A 3C5SB 3FYIB 3SD2A 3WHE1 3WNNA 5I0YA 5GZOC 3J7HA 4TLKA 2FB4H 3N5AA 3ZKSD 4BUGA 3QHZL 3SDAC 3GSRB 4YZFF 2FO4A 3WDJA 5CEZE 5GGUB 3A67H 1LDPL 2JKRM 4H0GA 4WU7B 1QYGL 4OZ4A 2YXMA 4CADB 2MQ3A 4NNYB 1EGJH 1ZGLP 4P2OD 4FTVA 4NKDB 1R5IB 3UYOD 4DN3H 1DHKA 3CLEL 1X7QB 5K39B 5C0AE 1IRAY 4AVHA 3EO9H 4Z7OE 4PJGE 4U6VL 4NUJB 2CBPA 4NO2B 4F80A 3RX5A 3EG9B 4FA7B 2I69A 4OCWL 2E4TA 4K7PH 4P49A 5C08A 3C60A 3TYFA 3R1GL 2Z9TA 3TCLA 4GKNB 4JFVA 4OCXH 3RVTC 3V5HB 4FXKB 4HPYH 5F7NC 1H9VA 4LCWD 1U3HB 2YKLH 1SUJA 3PJNA 4PY7B 2GG1A 3CZFB 4NWTH 3ZDZF 1BA9A 1OP9A 2WHVA 4AJWA 2YEVB 5EA0H 3IDXL 2YXWA 3TV3L 2YD2A 2V7NB 3L7EA 3EO1A 1GZPB 3UC2A 3HN8A 3DO4A 4UDUB 2X09A 4FA6A 5KYYB 3KPPB 4B9GA 1IKNA 4PRBA 3L9YA 1CYGA 5FGRA 2Z0BA 3GMNA 1ZHLB 2FHCA 3BZ4B 3UO1H 3P3YA 5HJGA 3T6WA 4FQCH 4OAWB 5C0CD 3MXWL 3BP7A 4K3HA 1QD0A 1KEGH 1BECA 2WXKA 4N25A 2I07A 4MXVF 4ZDHA 2I25N 1GL4B 1YN6B 4K2UL 4F7PA 5I2IB 1Q0YL 1FA4A 5ENWA 2OL3A 1RU9L 3PHAA 1PNCA 1FHGA 3IE4A 4PTTB 1X4ZA 2AKRB 4ZMLA 4P05A 4GKLA 5IBLD 1ACYH 4UB0L 2XWXA 2OXHB 4IQHA 4JR9H 3VWKD 4LDLB 5C09E 5EO1B 1TZIA 1PX4A 3EFFA 2SEBA 1J9TA 43C9B 1AQMA 1AQKL 1I85C 5JHMA 4HG4J 1F18A 3LH8A 4I48A 3INUL 3TJEL 5EC1A 1TXKA 1VENA 1PG7L 3FFCB 3GMRA 3T65B 5EBLB 4DUWA 1S9VA 4PLOB 3PP4L 5KS9B 1B4LA 2LAAA 3CHOA 4PY8I 1AXIB 3PLYA 3MRDA 3QEUB 5F1IB 3X3GL 1RZGB 3LNDA 2HFGH 1BQSA 2X9ZA 3UEQA 1R3HB 1XGYH 2ZXQA 1GXEA 4J28A 35C8H 1L7IH 4I2XB 2AMUA 2DN7A 4HJUA 5KVEH 1CFQB 4JRYB 4NM8L 4NFDA 2V5SA 2VJ8A 1PKQE 2WTRA 3HG0A 4HEME 3ZO0A 1FG9C 4WEBL 1NGQH 4KQ4L 4YHOL 4JZJA 1KXQA 3TC9A 4Z0BL 3ZE0B 1EDHA 1SYVA 1BAWA 4ECNA 15C8H 1GZQB 1YNTA 1MXDA 1PX8A 2FX8L 3Q9PA 2Y5QA 5B1JC 3U46A 2DIAA 4D9LL 4L2YA 3SDYH 1KV7A 4Q56A 4X9YA 3ZX1A 3WAKA 2BVEA 3QFDB 4PY8J 3BKJL 2V3DA 1JFHA 4F8PA 2EUXA 4I3SL 4N8CH 4NQDE 5I5RA 4QYAA 1GKOA 2EO9A 4U49A 1NCGA 1AGDB 1ZVSA 4GSDH 1FNLA 4OLVH 4O58L 4KI5C 4K71C 1GHFL 3WG7B 4ZAKA 2XWJA 1YLBB 4NOFA 4NQSB 5EU5A 3PL6C 4AVJA 2J8OA 3L5IA 2MWCA 3SJVA 3N44F 1QLEB 1J9QA 5I76B 1QOKA 4TKWA 1A3QA 1NIAA 1WWBX 5D5ME 1U3HC 2Z7UA 3PNRB 4CU7A 5FW8A 4KK9C 3VE0A 5EU3B 3RI5K 2O4EA 2BHYA 4HUVA 2CA4A 5DJAA 3W2DL 4JE4B 2HT4D 1A6TB 1RPQA 3BAKA 4KTEH 3IDIB 4L8DA 3UGXA 2F54B 1RV6X 2VUKA 5TQ0L 4IIQA 2FGWL 1OOWA 1CICC 2VW4A 1QHQA 2HKAA 1EGJA 1TVHB 1YEKL 2WMPA 3ZL1A 4YMPA 1YJDC 1GPOH 3DGDA 3ZTNL 1C08B 4PLNC 1DJZA 1G6VK 3BXNA 4HKXA 5DTFB 3KXFB 5B1BB 5CBEB 4IU2B 1Z5LB 5MEPB 1NEUA 3EFOB 3D2UB 2Q3ZA 1P4UA 2O6EA 2HT2D 5FO7B 1X9RA 1GOGA 1Y6KR 1PSKL 4NUMA 5EZPA 3ZKXB 4AH2B 1MFNA 3IXTA 3ULVE 1ZV9A 5HDBE 5CFAA 1TLKA 3O4LB 3L3KA 4WF7A 1G43A 2AJUH 1IILE 4WI0A 1G7QB 3GHBL 4YXHL 4PRPB 2OMUA 4IRSD 5BOJA 4IKIA 3RNKB 4J23A 3FSAA 1LQBC 2Q8BL 1PD6A 3EFDH 3FMGL 4QRUB 1T6VN 4OLZL 4U7SA 3T1FB 3DVGB 4PJ5A 1HKFA 1N7MH 3UAJA 4LEEA 3SGJA 5K9KB 1OWWA 4FP8L 1JZ6A 4QRRB 4EE2A 4Y19A 2WNWA 4OLWH 3GPEA 4MTMA 4F9PA 2EDEA 3RWCA 1Q9OB 1ZSHA 5FO9A 2XV2A 5KVGL 1COBA 1Z1WA 4BUQA 2Z35A 4CNIB 3QEQA 1XCTA 3MLXL 4JVUA 4M1CC 4R83A 3DKHA 5IB2B 2G5BB 1NCIA 3MODL 1VFUA 1WAPA 4W4OA 4DKEL 4DN4L 3QJVB 5DD5L 3N06B 4X7CC 5TGBA 2BRQA 5ES4B 2WQRA 4HS3A 1LEGB 2WXRA 3MV7E 2UZXB 1I1AC 3W9DA 1NWOA 2BX5A 3GJEA 1CD9B 4CMHC 4G7VH 5DMJB 5MEOB 2FEEL 2DD8H 4FNPA 1NOFA 1LO0L 1TO5A 1T89A 4FN0A 4GI9A 5FO8B 4OFVA 4D3CH 3IFOB 4O00A 2DLGA 3F3HA 1IGYA 2BDNL 2DM3A 4EN3D 5HYJE 3OPZL 2BZ7A 4G3YH 3RPIB 3MNVB 2HT3D 3BH9B 4ONHA 3QUML 4M9PA 4JHWH 5B1KA 5HHOB 3LQMA 4YHKH 1BCIA 1UH4A 2MKLC 5DEZA 4M93B 3H0TA 4J3BA 2HUHA 5C0DA 2CLZA 5ALBH 3TIDA 3K6SB 3QJZA 2OCFD 1AOHA 1KIRA 1WK0A 5DDHB 4F2FA 4JZOB 1L3NA 2G60H 3V0WL 5H35B 2VNCA 2QGEA 2VZ1A 4Z7UE 4OJFH 5EIIB 4JG1H 3GZQA 5JW5B 1YMMA 2EZ0C 2VDRL 4K3EH 4M7ZB 3I74A 3TZVA 1ZLEA 3B2UC 3DRTA 1ZANH 1T2QL 2KKQA 1ZJAA 4TVPD 4UQBA 1B6DA 1R3KA 2N4IA 3W82A 3AUWB 5AG8A 4XCYB 5ANMA 2P5WA 2RALA 5F1NB 2ESVB 1HEJC 4EAEA 1VADB 2ZXGA 4Z0XA 4U1JB 5F1SA 1ZS8B 1ZTXH 1OTSC 4YGVA 4XNYL 1QTSA 1H3WM 4JO5A 4QXTA 5AZEL 3F7PC 3HIZA 4FXTA 3Q9QA 3EGXB 4HXBH 5KBNC 3QJTB 3CFQA 3GXDA 5LWYL 4NO0D 3QIUC 4M3JA 4XVOA 5E51A 3MKKA 1FF5A 2HPTA 2OR7A 1W6LA 4MMYB 3I84A 2P48B 4HOXA 1A2YA 3O6LL 4S1RL 5E7FA 4WFFE 4D7PA 1G9MC 1GIGL 5JO5B 2K3HA 2YEQA 3DBXA 4MA7H 3RNQA 2VDLH 4PJBE 5DQDH 2BSTA 2X4RB 3KYAA 4OI8A 4WHYH 1G9ML 2QQNL 3IJYB 4MAUL 4QOKA 3ZKNC 3QO0B 1XCQB 4LCIH 3DXAA 2A9MH 5DRWA 5C2BH 3DX9A 3V0VA 4BDVB 2B1AH 3ULUE 3MRGA 4A6YB 1ZPUA 2Q6WA 5CAYB 1CD0A 2ZYRA 1ZPLA 3OKNA 4OJEH 2YWYA 4A66A 1RIHH 4LDEB 4GAFB 5CZXC 2VZSA 3FQRA 1HINH 4QXWA 4S1SL 2EXTA 3AZUA 4ANKA 1HEZB 3V95A 2PLTA 3SDDD 2EE2A 1RJZB 4HUWB 3T6ZA 3CVHB 5DEJA 1VZGA 2OMZA 1TPXB 3QUGA 3L5HA 4P2OA 3GMQA 5BO0D 4IBSA 1OD7A 4KJWC 3TLRA 5KS9F 4H5SB 3LKSA 1ZXQA 3KJ6H 2PYFB 1T0NB 2ROYA 2HA1A 5IBUG 3ARFD 4HSAC 4OGAC 4EDXA 2AQSA 3BE1H 4HCIA 4MA3A 4UT6L 2CLRB 2IFFH 4KUZH 1KCVL 3F5WB 1ZRUA 2BVOA 3GIZL 8FABA 1LL1A 1JPFB 2VQUA 4IKJA 1URZA 2C1PA 4F8NA 4FLHA 2QVIA 2IPKB 5D2LB 1MRFL 2XXGA 4S0SD 4LCWA 1E9QB 3S37H 3CN3A 1TZGL 4NKQB 1EO8H 4AY0A 1F13A 4I9XA 4P4KC 3WKYA 3VD4A 2XPGA 4LSQH 3F6LA 1RK0B 4KVCL 4Y4KD 5KW9H 3H7LA 3ZE0F 3EJPA 2Z0UA 1KULA 2EDHA 1FO0B 3WN5C 4O2CB 4YIQA 1O9WA 2JQZA 1SJMA 3LOWA 3GSOB 2ZAGA 3KBPA 5IMLB 2EYRB 3VFMA 3AM8A 5C0CA 5DXWA 3HE6B 3CQQA 4BHUA 2JWYA 4JM2B 3EH2A 4FQXC 2MOGA 1RZJL 4I13B 1YY9D 4UM9D 4PLJC 2PMZA 2R1YB 3TWCH 5LXGH 1NBYB 5I1AA 2AJZA 1FFNB 3I2CH 1DQLH 4LMQI 4X98A 3HI6H 4WFHD 5FWQA 3K80A 4PP2B 2HJFA 2IBZY 3DPDA 3O2DL 2EILB 3KR3L 4AQ1B 3HMXL 4MJIE 4RCAA 4EDWH 4ZFOL 5IVZB 4UV4H 3VD0A 3MBWA 4JJHA 2J5WA 5T1LD 3RA7L 3H85A 1UACL 2ZOKA 1AS7A 5ID1A 1PLCA 4N86A 1RZIB 1YC7A 4NQCE 5F9JB 5EEWA 1LM8V 1AGEA 3QZBA 2B16A 3QQ9D 3KPRB 3MLZL 3MFFB 1D7CA 4A04A 1MIML 1AXTL 4JHUA 3AG1B 4FC3E 4FQLL 4KJPD 3PREA 4JFDA 1BGXL 4BFIB 1S9XB 3QUXD 1SBSH 3VXPB 1EHKB 3ARTA 3HC2A 1I9RH 3CFDA 3GBDA 1ACZA 3FK3A 1W6WA 3HMWH 4O51B 4NFCA 4G43B 2OSYA 1OWRM 1HH9B 2HJLA 4BK4A 2EYSA 3FUEA 4OD1H 4JVWA 4NQUA 5LBGA 3Q48A 1E8XA 4R90L 4XCCL 4TVPH 3QUKA 4LPWA 2K7PA 3HEIB 3M88A 4FULA 5FS5A 4LLMB 3UMTA 3ARUA 2RR3A 2HKFH 1AG6A 1FG2B 3H6JA 3ARGD 4RAUB 2UUDH 1CD8A 2Y5EA 4RGMB 4X6DE 4HC1H 2NYKA 1ZHNA 4ODTL 4YVNA 2YAFA 4YR6A 2OJEB 2FLRT 1IBDA 4MB5A 1RUQH 1IGFL 2CHWA 2OMXA 3JV6A 4FFVD 5JOPE 3KYMB 1A6WH 2BVPB 3S36H 1RZKC 4Y2OB 3JUYA 4AXWB 4W9HC 5GGRB 3U25A 1HSAB 3A47A 4L48A 5IVOA 3ZYZA 5D72H 2JK5A 5IHZA 3LS5H 3M6DA 4LE8A 4GMSL 1RZKL 2ZF9A 3WMQA 4MNHA 3ILPA 1MF2L 4ISVB 4G6FB 5CGYD 5DD1H 4LU5L 1M9SA 2FQGA 5SWSD 2JQAA 4IBZA 2O5ZL 3V4UL 3KM2A 3IDNB 3QQ3B 4KQ3H 2B4CH 5EZLB 5IG7A 5I73B 1U92A 3N42B 3OLGA 3AG4B 5JYMA 4C4KO 1QFUL 4QTHB 2D7QA 2HJKA 4O4YL 5E2TH 5IMOA 5I75B 3L3HB 3G5YB 4MSWA 5T1DL 3WY2A 4YPGA 5KUKA 1U6AL 1JHLL 3MX0A 2J1KA 1Q94B 3WL9B 3TPUB 1A3RL 3B7UX 3Q1SL 2J6EL 2IALA 4M61A 2F19H 4A67A 3HE6C 2DQUL 3KLDA 5C6TH 3F6IA 2HLFC 2ZSVB 1P7KA 5DVPA 4UNUA 4IBWA 2FJGA 4PW9A 2BO0A 3OZLA 5FHAL 3SDXB 3QUYA 1P6WA 4NHCH 4RGNB 3QG7L 5HPMB 1OO2A 2L7EA 4XOAA 1Z9SA 1USZA 4TNFA 2NYYD 2Q7AA 2BNRE 4R96A 1J8HB 4DVRH 4Z77A 5KSUB 2WLJA 2OV0A 4JGMA 4ZPTB 2YS4A 5FKAA 3EXLA 1OGAE 1NBQA 1WT5A 2Y1VA 3GT6A 3TIEA 3UERA 1CYXA 1MSPA 1WBZA 3CBKB 4IRSA 2ZXAA 3PHOA 2JJTA 4ZYKA 4P2RA 4IHBA 2KHAA 4I7ZC 4PWFA 3H8NA 4TUKH 3HPLA 1S7TB 3UZEC 4A2EA 3OXSA 4AIXA 1GA2A 1KB5H 5E1AB 4N9GA 2VDPL 3H2WA 2P42B 4JKLA 2ED6A 5TDOA 4X4YA 4XNMB 5I6MA 6FABL 2V5MA 3MJ9L 1MFEH 2WBJB 3EYUH 3MDJA 1AC0A 3DX8A 2ICWI 5DF0A 5GZND 1G1YA 1UD2A 1QUNB 4JRLA 1QFWL 2DMHA 3QIWB 4GAGL 1LLAA 5HP5A 1XIWD 5DC2A 2OR9H 1O0VA 3BPCB 3FT2B 2XN9B 4P5MA 2FECI 4P2QA 1QBML 4OQTH 1YC8A 1U42A 2VIRB 2XV0A 4UYPA 5FYKD 1UGNA 5DD3H 3IPEA 2VDKB 2DBLL 1H5BA 3V0AC 3MRIA 3OJDA 2QVFB 5EO9A 1DN0A 4WJG3 5KVFL 2IQAB 4OZFH 5IHHA 4JKPL 3TJPA 3E6FA 3OKKB 5FA3B 5CEZD 4FGMA 4DT2A 3GUTA 4Z3GA 1YDPA 4LAQL 2WQUA 2IGFL 2ZCHH 4EN3A 2X0UA 1QBLH 4FI7A 4KZDH 3H9HA 1EZUA 4U1HB 2H0FA 2YK1L 4U1MB 3GXFA 3KM1A 4MRCA 2D9CA 1Z2KA 4M43H 5C0AD 3FOLB 2ICWJ 1HK6A 1D3CA 1P2CB 1X9LA 1KGJA 1EEZB 2VMEA 3UAAA 1OQXA 1QWHA 3VNZA 1WZ1L 1Q1JH 3LHPL 2MCAA 2DYPB 4BA8A 5AD0B 4GS7B 4S1QL 5E00B 2PWGA 3WUWA 3JYBA 3KYNB 3HAEG 3EDEA 4PJEB 5E2WH 2RQ8A 5JDSA 2W65B 4FKHA 1XEDA 4NRXB 3ARVA 4KDVA 2Y5TB 1GCFA 4R7NB 4Q9RL 3CN0A 1INDH 3GXIA 1EPFA 2QQQA 4Q9CA 1DEEA 1JZHA 3B2VH 4ORGB 2ZOWA 3LIZL 3EJTA 2D7MA 4PI2A 3U6XA 4G5ZH 4G1EB 3QJSB 4L1TA 1XTLA 5D2LF 3SPCA 5IB3A 1JN6A 1KY7A 1I75A 4F1ZA 4BKSC 2YOCA 4NNPL 5I1EL 4P5TC 4NO0A 1CWVA 5I17A 4YXKL 2OA9A 1V7NL 4Z7AA 3LV3A 1HZHH 4YUEH 1SDDB 3Q13A 5HJDA 2FJHB 3QJXA 5D7IA 2OK0L 1CL7H 4ILDA 4AW7A 5JA9A 1J1OH 1TLMA 4OIAA 5GJSL 3CN4A 3RPKA 4LSVL 1N19A 2FK9A 3GKWH 5C09D 4HPOL 4E42A 4JM2F 2LGNA 4YGAB 2G2RB 4LLVA 5AWNH 3X1BA 1WRFA 1RKRA 2FSEA 3VI3B 1EIBA 3L3JB 5AQ0A 1WSST 2Z31D 5K9QG 4EF3A 1SN5A 4PUBH 1MELA 3G6JA 1P1ZA 3UYRL 2X3CA 1FVDA 2E7LC 4I5BA 5E5MA 2XZQL 4WKZA 1DDTA 1RJYB 1YYLH 3B8SA 3VVWA 3TF4A 3CN2A 4KITB 4Z5RB 3ILQC 1PAMA 3QCUH 1KWKA 4NIKB 4NYLA 5E95B 5E1GA 3X12A 4B50A 3HBZA 1TIUA 1E9OB 2E76C 4ENZA 1TNNA 2IO5A 2WINB 2WVUA 1RHHB 3QZLA 5FDWB 3U82B 4ENEC 1NCUA 5JNYB 1EZVX 2EIZB 5EZOH 1KC5H 3EYQD 3O0RL 5CSZB 3SDDA 2A6JA 4FMVA 1UM4L 4ATTA 5T5NG 2W0PA 2W92A 5K9OA 4YDMA 2OSLA 1G5GA 3R06B 2BP0B 3SE9L 2HRGA 3HPJB 3ARFA 2G9HB 3G5ZA 4IMKA 4R4ND 4J3OC 2OMVA 4UQ3A 5HHNB 1VKXA 3NA9H 1DQML 1RK1A 5F7KC 3V9CA 1JK9B 2G30A 4P46D 1CU4H 2ZJSH 4MD4B 3OC8A 5EG6C 4MX7A 1MFAH 1CLYH 4L18A 2BSSA 1EBPA 2QQKH 3ET9F 3T6VA 2V9UA 3KLSA 1SXBA 1FFOB 5BOZG 4GEIA 4LOFA 1PL3A 3QS2A 1XR8B 2WWOA 4D0BB 4MCYB 5LBVA 3H9ZA 2DYSB 4NQDD 2O93L 5DJ2A 3IDJA 1IGIH 1ORSB 1GJWA 4IGBB 4KBPA 5GRJL 1UB5B 2Q86A 1OAUH 4OF8A 1BM3H 4V1DE 1TQWA 2EE3A 3VA6A 1FV1A 4JB9L 3MRMB 3V5DA 1PAZA 3AQZA 5AAWA 3TFKD 1YPZA 4RQQA 4J7RA 4OQTA 4JX0A 4UM9A 1AO7B 4K23H 5J9PB 2UVEA 3MUUA 4GINA 3VWJD 4YQXH 1QKZL 4TNGA 4AZ8A 3MXVL 1BZ9A 3NDYE 1N70A 4DVBA 1OZTG 5J0BA 4PB0H 4NWUH 2C3HA 3L4VA 4OZGA 5EZIL 5FYKH 5AENA 4OZFA 3HZKB 4UIMB 3V6FA 2XX1A 2YWZA 1HHIB 4NZRH 5KSAB 1E3XA 2N59A 5FYLL 5JPNA 4LOUD 1T7XA 3P1VA 2NY4D 5EU6E 3VI4B 5CEZH 1FGVH 1R5WA 2EXWC 3P3UA 5CD5D 2VL5B 2G3XA 5T1LA 4BSWA 4X6BA 1K72A 2PETA 2ZUYA 3LPWA 4M6ML 4EPSA 5JDJA 3N42F 4AVIA 1EFXD 4XZ4A 4ZUSB 5T3ZL 1P7QB 3V4LA 4X80H 3HS0A 4Y2DD 2AXFB 5FV2A 32C2B 1NGZA 1VERA 3HZVA 3VCLB 3FHAA 2AEPL 5T1MB 5ITFA 3HHSA 3ULVD 2IWGA 2VLKB 1LO3H 2AQ3A 3QUXA 4HUKB 1R3JB 5DWUH 4PW3A 4XODA 5DHXB 5DHVH 3FAXA 4GFXA 3T2NL 1DANT 3L5XH 3NJVA 2YRZA 4G72B 4S0HA 4NPKA 5LGHL 1YUKB 3SDXF 1Z6JT 3U30B 2P3YA 3D0VB 1BOGB 3VH8A 1N67A 2APVA 5KWYC 1CXHA 1Q90A 4ABUA 4G42B 3AWFA 1GGIH 1SHXA 2GSGA 2HLAA 3BVXA 4YDLB 3SDCD 3PDDA 3ARGA 3SOBH 5E08H 2EIKB 2B8OT 1A6VH 4EUPB 1XVSA 4LDOB 1F2XK 4FQQA 2ZKHL 1A8JH 1FZMB 1OHQA 3IF1B 1JNNL 2OMYB 3K0YA 4Z3TA 1EQWA 4M8RA 2GJ6E 5I8KL 5I1IH 3A22A 5TFSL 3RVUC 4QGTA 1IAIH 1Z9MA 3JSSA 4J12A 1WF5A 4F24A 3B2MA 1L5GA 5FUZL 3DOSA 1GTFA 1HVXA 5FKPA 4JPIB 4HX1B 5ESQB 3BO8B 4JFYB 3S0PA 2JJWA 2D03H 1DDHA 2FX9L 3LRGA 4AC2A 3HTLX 3B2XA 3IS1X 3FN3A 1MAML 3Q2VA 4J3OF 1NAML 4JL2A 4LSRH 4GW1B 4RZCA 2ADFH 1AR1C 2YPLE 5GGVY 1FYTE 1H3UA 1IBYA 4BD4A 1ZOXA 1PW3A 3GXTA 3K2IA 4FQ2L 1DUZB 1U2CA 1DJYA 2XIBA 3CFCL 2WXMA 3P2TA 4MAYD 4WI9A 4ELMA 5DI8A 3WJMB 4IGBC 2WYHA 5KN5B 3FOMB 4U1IB 2B5IC 2B39A 1FFRA 1WA1X 3H4HA 5JOFB 5KTEL 1OAZL 3UJTH 3FQNB 5I74B 1P6AB 5ID0A 3QRGL 2Q3XA 2XZCL 1O5PA 4YXLL 4DGYH 1KT2A 1S5HB 5J12B 5C0BE 1MW1A 1QSZA 1WFIA 5A2IH 4G2AA 4K5OA 4JFQA 2BIMA 4XPBH 1L9SA 4QWWD 1YO4A 3SE4C 4V11A 1E7UA 2BM3A 4PJEF 1W2KT 1EEYA 5ESVA 1IBHA 4WY7L 5CLTA 3RKPA 2E9IA 1K3IA 1G9NC 3EAKA 4DTGH 1T3FA 3UPRA 3HR5A 5I16A 2WKGA 4LVHB 4MZRA 1GGBL 1I7RA 4YE4L 2VDMB 1KLFA 4KDTC 4Y4FC 4U6XB 5FHBH 4XPGH 4UM8A 4WFFD 1ZLUK 2C1OB 4YHIB 1N3NB 3FTGB 5ITBH 2AW2A 4A7TA 1IJNA 4TLSA 1MH5B 1KEML 4JAMB 5GZNA 3BPLC 3U0WH 5JHLH 3MRJA 1CF8H 1WH0A 4NBZB 4L05A 3LKNB 4U1SA 3W81A 1GAFL 1XIWA 2I9TA 5FGSA 5C07E 3VSVA 1FFTB 4YDKH 5EUOF 1GZHC 2ADJB 1DQJB 5DC9B 4PM1A 4IBTA 1B0GA 3BVTA 4LKCA 4X8JB 4LHJB 4U1KB 2MHAA 1XT5A 3LQAC 2Z92A 1NGWB 4PJCA 1KJ3H 5FECB 5L0QC 3CDZB 3MBXH 1FNSL 1I1RA 3DX1A 1Z5HA 1J5IA 3RWGA 3D06A 4HBCH 4YDLC 4QJ5B 3S8GB 2GBTA 2H0EA 3P30L 5AKSA 3ZT5A 3KPTA 4S2SA 5INDB 2PP9A 5AG9A 1EO5A 2A6DA 2Q8AL 3VB9A 3FC8A 3MUY1 3RU8L 1IAOB 3MV9E 2OTWB 4LBAA 2IWFA 5C0AA 3QXWA 5K69A 1JRHI 3QW9A 4AIZB 1YEDA 4OIIL 2C9XA 4PYHA 3N40F 5EEVA 1EXHA 4N26A 5GS1B 1DJSA 2CGZA 2ITDB 3HNTL 4FFTA 5DHVA 2WW8A 3D85B 3QI9A 3ULVH 2DLFH 2XVBA 5I5JA 3ZMNA 2F1AA 3N85L 1EV2E 4XRCA 3QULA 4KUCD 5LGJA 2NNAA 1E4KC 4XNZC 3SGKA 3DDGA 4HKZB 3BYYA 5B8CB 3V55A 4LPYA 3TBSA 2NUTB 3VMPA 3IM1A 3I3EA 4PQXA 1ETZB 3MUHL 2FO1A 2XCMC 2AXHA 4BFEA 2H26A 2CDEA 3FRPB 4Y16D 2KLRA 3WEXB 3FCBA 4EJ1C 4QHUB 1D7BA 2UZIH 5I1JH 5DS1A 4GRLC 3L4CA 3UBGA 2WWMC 3NMEA 3UEZA 4NZUL 4AE0A 4AOFA 1N59B 2VMFA 3RTLA 1LO5B 4I0KA 2BSED 3EW3B 1VB9A 1QNIA 2IAAC 4BK5C 3CSTA 3X11A 1MLBB 1P1VA 5CWSB 3RZCC 3F83A 4YLBA 1MWAH 2J5LC 1A6ZA 1RFDH 1CD1A 2W0FA 4PG2C 3EF4A 3QNYA 4MQ7A 3U9UB 4FHKA 2BCKB 3ZTEA 4O2FA 5C09A 1KCSH 1K5NA 5AVZB 3NGBC 4NS0A 4ZSOE 3KWUA 1ORQA 3VU2A 3MROA 2AJ3A 2H2SC 2Z31A 2CDGA 2C34A 4NQCD 1F4XL 1OTTC 2J56A 3CFJA 2X70A 3NJJA 4OFQA 5BZWB 4PJ7E 1HILA 2NQ3A 4PREB 1JF1A 1MVUA 2OXGA 4Q6KA 1NCHA 1EAJA 2OP4H 3B3BA 4H20L 1W72L 3VI4F 1LO4L 3BLBA 3P4MB 4J6RL 3UGEA 5JW3H 4PR5B 3L9RA 1KSRA 5C97A 1FH5L 1M05A 2VCOA 1NC2B 3U0TB 2O1AA 4YOKA 1FSKB 1LD9B 4HEMA 4HS8L 1LP9F 1DL7L 1DBBL 4YSSA 1PY4A 5KVGE 2HFTA 4TQEH 3PWVA 2EABA 5L4FA 1LEIB 4AUYA 1YY8A 4Z7NB 3TJHD 3VFGL 4HJ0D 4EBQH 3EYSL 1WIOA 1U2HA 5ILTH 2HX7A 4ORZC 1WBYB 3SO3C 3E38A 3I6KB 1FP5A 1EDQA 4P46A 1KACB 5CJQL 1JNHA 1B0RA 4RMBA 1ZY9A 2E75C 3Q8FA 4H7VA 5A6IA 1ZLVH 1MY7A 1N8ZA 1WWWX 5JOPD 1UXSA 2J73A 3WOVA 5DJYA 5K5YA 3ROLB 1NC4A 4NQDA 1WPCA 3QFJE 4N2HA 3DHMA 5AW2B 4NLAA 1TITA 4KROB 5ABZA 2FO4B 5DK0A 3MVSA 4RWYL 2C3WA 2DI9A 1RIUL 4LOEA 5HY9A 5JHLA 1MNUH 2AAVA 1EHLH 1GVIA 4G59C 5GS1C 5JQIB 4EMZA 1A1NA 4FTVB 3IGUA 2QQLL 3B5HA 4CAGA 3FU0A 3MBED 3RWDA 3DROA 2NR6C 1TZHA 5D5MA 5HHVL 3BQVA 3OB0K 4RH4A 1B3IA 5BQDA 3MGTA 5B8CC 1KBWA 4YZWA 3KW7A 5FOJA 3VWJA 4YHYB 1M1XA 3CFNA 4V2BA 2H7WA 3MREA 4AQOA 4K7PX 5C08B 3TYFB 3C60B 4LHUG 1MZZA 1T04A 3TCLB 2QLYA 3I50H 4NJ9L 5G5DA 5CF3A 2P8LB 4KK8D 1D2PA 4NFBA 3K6IA 5BV7C 4D9QE 4XWOC 3MLRH 5FYKU 3CDGA 1RK7A 2VN4A 1YVLA 1A6UL 2OI9B 3VDBA 1U8NA 1NCNA 2ZX5A 2Q10A 2Q1EA 4R26H 2OQJA 3FXIC 1BQHG 4UDTA 4Y2DA 1TJHL 2DRUA 5BV7L 4J3OG 2R8SH 4PRBB 4FABL 4WI6A 3CH1B 1K6QL 3GMNB 2X1QA 5A7BA 1OQOA 3P11H 2R0LH 4PW4A 5KBPA 2BNRD 4AK1A 4KY1H 3PQYE 1TVBB 3DARA 4F9LC 1HZKA 4IRZL 4XMKH 3NJKA 2UV3A 3BP7B 4YLQT 4X0NA 1OHZA 2R29H 2XQYA 2I07B 3NCCB 4S0TD 1T03L 4ZDHB 4ELKB 3Q6GH 3ESMA 1S9WB 2JQMA 3MACL 3N1GC 2J20A 1N26A 1XF4B 3VTAA 3ZR5A 4UOW0 3R8BB 5IFAL 2HP4A 3KHOA 1DVFC 3EFFB 3FQUA 1JNLL 2XQ0A 2G9KA 1PZSA 3APDA 4Z7WE 3SDCA 4FYQA 4N2AA 4NUPA 1KG0A 4WNJA 3K6SA 4AV0A 3QEGL 3RVXC 5EZJA 4ZW7A 1NCWL 3EDJA 3GBLA 5HYQA 2DQJH 4OY9A 1IO4C 5E1QA 3PWLA 2VZTA 2FD6L 3N41B 1FZKA 3LKQA 1MWAA 1T20A