3G3LA

Crystal structure of putative membrane-associated protein of unknown function (yp_211325.1) from bacteroides fragilis nctc 9343 at 2.20 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
296
structure length
291
Chain Sequence
PAEAKYYIAGTITDATTGQELTTAKVTLGDKSVTSSFNEQVNYKAEGYALVVSADGYYPVKRQVYLNQVSDGQTSVATVNVALVSVEAAVIPPVVPPTDPETDINEGEATKVADKAVEVAKPSESTVTDMLAGTTATPEEKKALDETLEMAGGMKVGETTPEVLADGSILAITPVKFTNPIQDAPAMVPYFYNEGCELTGDVKEVAAPVAVAADIQKAFLSNAAKALNMNAGFVQKIGYTRISVLNGYSILGYTIKGQLVSKKLTFLISGKYYEGIVSYQKSVMIYPNYYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized membrane-associated protein
publication title Crystal structure of putative membrane-associated protein of unknown function (YP_211325.1) from Bacteroides fragilis NCTC 9343 at 2.20 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
total genus 71
structure length 291
sequence length 296
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 3g3lA00
1QMUA 1UWYA 3NJXA 1H8LA 4YOKA 2XHNA 2NSMA 3HN5A 3NJVA 3G3LA 5K39B 5G5DB 4FL4C 4IYKA 3KCPA 4FXTA 3MN8A 5AQ0A 1NKGA 2B59B 4U3SB 4WI0B 4EIUA 3E8VA
chains in the Genus database with same CATH superfamily
1Z2KA 1JRHH 1YUKB 2YA1A 3NJXA 3D08A 5AOIA 2VDPL 4UTBA 2E8YA 2K3HA 1ZHLB 5AKSA 1J5OH 4NKIH 5E94B 2NY4C 3PLYA 5I6OA 4U0QB 3OAYK 4KO9A 3LB6C 3P4OA 4PY8J 1PFOA 4WJG3 3O2DL 1VFOA 4RGMC 1JYNA 3QEQE 3IDJB 4Q14A 3QCUH 3OPUA 2LLGA 2G75A 3EJSA 4ENEC 1OE3A 1MDTA 2ZXEB 4FOMA 2AMUA 5I1IL 2WXIA 1NBCA 4HS8H 1RIVH 4N0UA 1RIUH 3QUXD 3IMBA 5IW6B 4EIUA 3CE1A 2MQGA 2UZIL 3UPRB 4XHJD 2Z65C 4QXVA 1HS6A 4BZ2H 1J0JA 1N64H 3MCG1 1PD0A 5EIIG 3SGEH 4I3RL 4PS4L 1CUOA 3ESPA 1BQLL 2E6JA 3BCFA 3HE6A 3IFLL 3P11L 3ZL4H 4G1MA 4A37A 2LU4A 1P53A 5LBGA 2ZICA 3C5XA 3VQ1C 1J7VR 2ZUUA 3L2MA 2W38A 3HUJF 2QGDA 2XZQL 4K7PH 4PG2C 4YNYA 2BZDA 2H6UA 3TN0C 1B4TA 1FAIH 5IHZA 3KS0H 4OD2A 3ARBD 2CO6B 3N6YA 2N7AA 5I26A 3FTGB 4YJZL 4D0CA 3QXAA 5FA3A 12E8L 4UBDC 3FSZA 1Q9WA 4OFVA 4RX4A 1YNLL 2WIMA 4H20H 2VXUH 4ZYKA 2HH0L 1FYTD 1ZT4A 5E2JA 5L7XL 5I71C 1QEXA 4X4XB 3W0WA 4CSZA 4WV1B 4R7NB 4NAMA 2CHXA 2EIZB 1RURH 3GIZL 3RWEA 4PRBA 3KLLA 3P9MB 4FC3E 1ZE3C 3OAUH 3WL9B 4MAUL 3SIKA 1UZ6E 3B7RL 1CICA 4KU1A 4ZO6A 4N1CA 3REWA 1N12A 1ZSDA 1QATA 3KPTA 1JCVA 1TZOA 1Z9NA 2CPCA 3BEVA 1YN7B 1FNAA 2MHAA 4NKDB 4NUPA 4LPWA 4YIQA 4MZ3A 2AK1H 4GXUN 4U6HA 4WHDA 3V4VB 4A7VA 4DN4H 4PJ5D 2EEXA 3MRGA 3I6GA 3X17A 2BSSA 1U8KA 1E5UI 3II1A 2VERN 1XGPA 3MRDA 5F9WC 1I8KA 3BJLA 4OLUL 4QGYA 1CE1L 4H8WL 4R26L 4GFTB 3HPJA 2EE0A 1X5AA 5HHXH 1NCCL 5EZOH 1JI1A 4UNVA 1TU2A 2VXVH 3HBZA 1SVBA 4MLIA 1BHGA 1SYVA 2X10A 2JCWA 5E9DB 3L1OL 4X4YB 3DETC 4K3DL 4R9HA 1KB5H 4RGMB 1SY6L 4NX0A 3HB3C 1JGVL 4LF3B 1KCSL 3UAAA 1WGVA 3OX8A 1BSIA 3WDIA 4YX2H 3T0EE 4HWBA 2WCSA 4MCYB 4IJTA 2ZUTA 4C55A 4FEIA 4LNRB 1DDHB 2H3NA 3H42H 1QSFB 4RDQF 2D7PA 5CR1A 1VGKA 4L4TE 5CP3A 1V7ML 3T08A 4GKNA 3FPXA 1IFHL 3IDNB 3VRLE 5BJTB 1HCFX 1PZ5B 1SMAA 5TDNB 2QZ5A 3BI9X 1COBA 1V7NH 1PDKA 2OMTB 1E9OA 4P9ML 3U83A 4X5QA 1XGUB 1FFPA 2F58L 3N9GL 4KVPA 1XMEB 4X5PA 5EZJB 4R4FH 1BOGB 2YPVA 3WKMH 3O8XA 5SWSE 1INDH 1MCQA 2I07B 5IREA 3O9WD 4WWOA 2W07B 4S1DD 4DPRA 3CZJA 4KK8C 5IOPB 2YWZA 4KKBD 3VI3F 5HPMA 3U30B 4O02H 4OH2A 1SYSA 4Q58C 5DFVD 1OTUD 2IWEA 3HAEH 4PY8I 4UU9B 4PJEB 2BSCA 5D70L 5HHOE 2PMZA 4FYTA 4XWOC 2VMFA 3HNSL 1F1AA 4JQXA 5KVGE 4E9SA 5D7SL 1P7KB 1ZVHA 2NR6C 3HR6A 5HYQB 4JFUA 3D9AH 3KBPA 1EJ8A 5TQ2L 5CJBA 2BVEA 4BQCA 3TESA 1J0HA 4KI5D 2GB2A 3DRQA 3OHXC 5E0QA 1BD2A 5AW1B 2PLTA 3NQIA 5C0NC 3OF6D 2OCJA 5L4JA 4URTB 3VVWA 3Q0HA 3N85H 1TCRB 1BQSA 3EAKA 3OC5A 1YEDB 3L5JA 3NMEA 3QDGD 4HXBH 4LBEB 2X0WA 1HCZA 5GISL 4P2OD 3CQQA 2ZNWA 3GI9H 1WBYB 4M43L 4FHBD 1L6ZA 2XWDA 3ZU8A 5SWZB 3MJ7A 4FXGC 2ZJSL 1DBJH 3HRZC 2H41A 2D3NA 4AJVA 5JIMA 5DEFB 4OLWL 1GZPA 3BH8A 4RRPA 4Z7NB 4CKQA 2CBQA 2WW8A 2JKTM 2YHGA 5E70A 2OLDA 5DQDL 2W94A 3BLPX 3E6FB 4C56D 4MJ2A 1CJYA 2Z91B 3TH4T 5FUZH 2NW3B 3KBFA 4HVBA 2C3HA 3MRCA 3MRKA 1UFGA 2W0FB 1CF1A 3RGBA 3WNNA 1UQSB 2WKGA 4XNYL 3H56A 1EDYA 2G2RB 4N2FA 1KJ2H 4PGJA 2O72A 3L5WB 2J1WA 5DHYB 1AHWB 4BK4A 4EVNB 1TEGA 5FPIA 4X7CC 5E24E 5F1OB 3PGDB 2GFBB 1DBBL 3AROA 2PXYD 4RBPK 1J8HD 2FT6A 2QVFB 4M62L 1BAWA 3GMMB 4CVZA 3CQFA 2W88A 3MRFB 4BH7B 5B8CC 4JRXB 1IEAB 3PV7A 4RRPM 2DQUH 2ZYRA 3QHZH 1X5KA 3DECA 4HQQL 3FO1B 1B88A 4YE0A 1RSYA 4Y2LA 4KZ0A 1KEGH 5DMGC 3QH3A 2HVKA 4XPAH 5LGHH 4FNLL 2P5WB 2WUBL 4M61A 4TQHA 1UZ8A 4ZI8A 5I15H 2V17L 2BM3A 2X38A 1SDAB 5EU3A 3RUGE 2NY1D 2BFVH 4KOBA 3VFWA 1UHVA 2Q7YA 4Q56A 5FGSA 5F7KC 1PVHA 2P8MA 3F7QA 3GBMH 4RFNC 1OPGH 4OFIA 4R96A 2VRQA 5CEZE 2GI7A 4DJMA 4A6YL 1N6VA 2C7UA 5F2FA 3OHXB 2VR7A 1YC7A 3FOLA 4RGOL 3U1SL 1D5ZB 4OF0A 3C60A 4XI5D 1FG9C 3LJ3A 3ECQA 3BP7A 1L5GB 2YAOA 5JUEH 4AMKH 1WZLA 5I8EB 4K3EL 3VD7A 4OLZH 1N68A 1MIML 4G8GE 3ABGA 4U6VL 4H7VA 2F19L 3QWOA 4JFDD 2D4FA 1Y07A 5AAWC 2X44D 3B34A 1IL1B 3GMOA 1P4IL 1UA3A 4AVIA 4NBXB 4FXGB 4MMXB 4TQPA 3QJUB 1Q9LA 4TUJA 5JPMB 1U33A 1EFXA 1OAXL 1U91A 1ULVA 1YG9A 1ES0A 1M9WA 4M9PA 4XVUD 3HI1B 4Y4KC 2BHFA 1D9KC 4UT7L 3MGAA 4HLZG 1AVAA 4ES8A 1PS3A 2OI9B 2EACA 4CADA 3TJPA 4A6YA 4RQQB 3FTXA 2NZIA 2JIXD 4TQ8A 5EN2B 2FEEL 2J88L 4ONFL 4NSKB 5B21A 2W60A 4QKXB 1NOAA 5DZJA 1JK8B 1ZA3B 2VTFA 2XV0A 2WJ5A 4L18A 1FG2A 1ZLVH 3W9DB 1HJBC 1ZS2A 3EKCA 3BDYL 3DSNA 4YHNA 1FPTH 4PS3A 3KAAA 4ODVH 1CYXA 3KPQB 4C4UA 3JSSA 4OLXH 4Z7VB 3SKOA 3FXIC 1AKJA 3FSVA 3BVTA 3W5MA 4IGBB 4YSAA 5GQBA 3FCBA 5D9SB 1S5IH 3BE1H 4N0CC 3SPVB 2E0PA 4KXAA 4X6CE 4Y16D 3EDJA 2FBJH 4M3HA 5KZCD 3S48A 2W65B 1RY7B 3QEGH 5AW6B 1FVDB 4N8PA 4JFQB 1ZLUH 4Y9CA 3SDXF 3TBVB 4Z3GA 1WTLA 4J8QA 3AGWA 5HHQB 4YGVB 1MCWW 3DDGA 3IJHB 4NM4L 4Z7WE 1W72B 2YMOA 1NCBL 2WOYA 3GBNL 5K33A 1G7LB 5KSAA 4PHXA 3CVIL 5C0AE 1RZIA 2C1OB 4U0RC 3W2DL 2FBOJ 4HUCA 3SQRA 4FMKA 4IU3A 4LHUD 5D96C 3DJ9A 1BAFH 3MGOB 4OV6F 5KVDH 4YHOH 2OMYB 4NUQA 4BFIB 4X5WA 4YH6A 1JAEA 1G7MA 1IAOB 1MWAA 5B3JF 4H8QA 1F4YL 2X4PA 5IVXF 5T1LA 1LK3H 3AG1B 3QORD 3TV3H 1EDHA 1IKNA 2CO1A 4JO4H 4HIIB 2QTVA 1M3JA 2V3FA 2WXNA 1LD9B 3ULUE 1P7HL 1EUUA 4GAYB 3BMVA 1BF8A 5GGSB 3QG7L 1ZEAH 3N42B 1YEKL 1P4BH 2VNCA 3FK3A 2ZG3A 4XVSL 4JFFE 3MLWL 3PAZA 5T5NF 5EC1A 4P48A 3RY6C 2OCCB 3GLAA 1RKRA 4ETQB 3TO4C 3Q6GL 3CHPA 2OK0L 2XPGB 3ABLB 1PLAA 4JPIA 3GSUA 3GMLB 4OKDA 3V4VH 1L9QA 2J71A 4YMPA 1G4RA 4IMKA 4XNUH 1BIIA 4HWUA 1E0OB 5AB1A 4QCIB 3ZE1E 2AV1A 4Y4KB 4PIBA 2DI7A 3WDHA 3UTSA 3HC0A 5C8JA 2WKOA 4MNGE 3A21A 4QRQA 5F7WC 2PYFB 1PEWA 1HHGA 5AZEH 4RMUA 1YMHA 2IAMD 2P45B 5DUPH 5E0FA 5IFHH 1J1OH 1AGEA 1G0YR 2J1XA 3IKKA 5IK3B 3C09C 1XMWA 5FYJU 2C9XA 1LO3L 4DQOL 4PJIA 4ALAL 4ICWA 4TNVK 2JB5L 5I1JL 3L17A 4M4RB 4JDTL 1VZIA 3SBRA 3IE9A 4WWKB 4G5ZL 4FFZL 1H3XA 1UEYA 4XCFL 4P5SA 43C9A 4JZJA 2ZXWB 4ZRGA 4NRZA 1QFPA 1YCSA 4XNZB 1PLGL 2DEXX 1GYVA 5FO7B 3NDYE 4F8OA 4PRIB 3ARRA 1HSBA 2WB1A 1K8IA 2WLIA 1DJYA 3MBEC 4LSSH 5F1KC 3N0AA 5DEGA 4EZLA 3CN0A 3C2AL 2DQFB 2ZKXA 5AKTA 1PLBA 2NY2C 5D4HA 4Z3EA 3BOVA 3GSRB 3RVWC 3VNYA 3VTAA 5KS9F 1QFWL 1W0VB 3FTYA 1NBZA 3KYNA 4FS0A 2VXSL 1XDTT 1VKXA 3DJRA 5GZNA 1Y1UA 4I9WD 4AIXA 5E2UH 3PQYA 3CHXA 2B5IB 3DX1A 2OR9H 2VLKA 3F8UB 4UV7L 1UXSB 2DQGL 1O7DC 4EQ2A 1HK6A 1ED3B 2Q6WB 4X5XB 3S6CA 3FUFA 4FFZA 3QUKB 2GJPA 4NPYB 1MREL 2AQNA 2XPZA 3ZDYE 3H55A 5K9KB 1WZ1H 3IPFA 4E5XG 4M7LT 4G8EA 5KTEL 4ZUUA 4M5YL 1HNGA 3FUJA 5FECB 2HRGA 5FYKE 5GS0C 3D4ZA 2AKRB 3ECBB 3ESUF 4UMSA 1NM4A 2WB7A 2AEPL 3L08A 1NKOA 3BUIA 4JVWA 1RV6X 4M3JA 2VDKB 5D4IA 3JV6B 4LASL 3SJVE 2XICA 1DJSA 3VWKD 3TO4B 1YMMD 2PYED 1BVKB 4X6DB 1XEDA 3H8NA 3L3OA 4MMZA 4NNYB 4N2AA 1I3UA 43CAB 3HA0A 4APQC 5IR1B 1OM3L 2EUZA 5IBTL 5GGVL 4BFFA 2JF1A 1GGIH 2ICCA 2ZOKB 4DVRH 3MHZA 1ZV5A 5EU6E 4S2SA 4H0IA 3WY3A 1HINL 1RPKA 4WFED 4DPAX 2EUXA 4QXTA 4D9RE 5DFTA 5TGBB 2HRLA 3LH9A 5DJAB 3HEIB 4YK4B 4Q9RH 3GBLA 2HLAB 4ZMPA 1FDLL 2WBWB 2OYKA 1XZ0A 3SDDD 3N43F 2A99A 4IOFC 2E3VA 4M1DH 4JFWA 3AREC 3IGAA 5DRNA 4EZMA 2OJ1A 2NNCA 5C0GB 2HKFL 2YAQA 1IAKA 4MQ7B 1EAJA 2A73B 5EH1A 4HMEA 2OYPA 3TTYA 4PP1C 3QPKA 3UZVA 3A6CH 3WYRA 1KXQA 3J8F7 5ANHA 3TZVB 5JXED 3F7YA 3PV6A 3QQ9C 4YHKL 1J1XL 2ADGA 2GUYA 4YDKL 4FLQA 1BVOA 1S7WB 5KYXB 3IDYC 1A14H 1BG9A 1Q1JL 1S78D 3TYGH 3TH2T 1SXCA 3DPBB 3UJTL 5FO8B 4AK2A 4Y19E 4P06A 2VC2B 1J0YA 4ZMXA 4JKPH 3DO7A 2R1XB 2GIYA 3C9NB 4X9YA 5E6IC 1KXTB 4FLSA 3R1GL 1EVUA 4RISL 2HRHA 2JJWA 2NY2B 4XHQA 3I6KA 3ES6B 3SGKC 4B9KC 5IMLB 1OSPL 1NCWH 4L3EE 4WFFD 5BRZD 2BNUB 4NO5B 4U3XA 2D7TL 1MFUA 2Y5TA 3ZUNC 3UZEC 5EU7C 3FULA 1IO4C 4EBQH 5ACMA 1FN4B 3Q2WA 4A2HA 5ACLA 4P2RA 3P0GB 3RX9A 3SCMD 3D3VD 3N1MC 3NTCL 5IQ9B 3T1FA 2WWOA 4ZTPH 1MNUL 3ETTA 4G71B 5EOTA 1JN6B 3CBRA 2XFXA 3H85A 5IJCC 4O2CB 4NFDA 5I9QB 3R7QA 3DBXA 4OQTA 1RZGA 2HKAA 1VENA 1IAIH 1UB6A 2BNQD 3W11D 4BJLA 4JDVA 1FFOA 3QEUA 2DRUA 4N2BA 3SYOA 3VUAA 5FO2A 4ELMB 3MGTB 3VWJA 4M8UA 1FJ1B 4NPJA 1R3HA 5A7EA 2NPLX 4MZIA 5IUSA 3WJMB 4QKTA 5HPOA 1OP4A 2IFFH 4G6AD 2I25N 4HBQA 2XG4B 2AJUH 1HOCA 4K5LA 3VAEA 1LEKA 4TULL 4IDLA 1Y6KR 3NIGE 3RZCA 3SOBL 3QCVL 2OMXA 2DBLL 1FNLA 3HI6H 1HXMA 2QKIC 4X83A 1I1AA 3CDGA 4WNQB 4NC1E 3G3LA 3CDZA 3TPKA 2Z4QA 4PJFF 1LE9A 1N2RA 3CPLA 4I4WB 1BLNB 4MAZA 4DZ8B 1OCWH 2PPFA 1TKWB 2WOBA 3RAJL 2QV2A 4PJ9A 1QBMH 4FTVB 5H2BB 3D6GA 1QQDA 4WUUD 4NN7C 3LD8B 1V54B 2WZ5A 3WMSA 2FJGB 3EGDB 1PTZA 2IO5A 3M8OH 3MCKA 4NAQA 1EK3A 4HIEA 3K3QA 2VAAA 4YBQD 1QKZH 2ZWSA 3KXFE 5CCKL 3E2HC 1KENH 1IC7H 2AQPA 1FCCA 4QHUB 3GXPA 5DHDA 3VXME 3EYOB 1QUNA 5E8NA 1CB4A 2BZCA 3FU7A 4G59C 1PY4A 3GD1C 4P46C 4Y5YB 5CIPH 4C58B 2FR4A 1W72H 5EEXA 4N28A 1R33A 3BUTA 4DEUA 2VDOH 4FZ8H 5C9KA 1RZFL 3KDPB 3L7FA 5HGAB 3U0TA 3PWLB 3K80A 1F58H 3AITA 3V4PL 2Z7WA 3B2VH 2XNAA 3RYMA 3S37L 3T65A 1EV2E 2CQVA 1DQDH 4PRPD 3MR9A 2NLJB 3IBOA 4UYQA 5GRVL 4Z3IA 2ITFA 3S88H 4YEEA 2I69A 3IJ8A 5GS1A 4V2BA 3DI2B 1GRWA 2HFGH 4OFPA 2O5NA 3NCXA 2WQVA 4MJ6B 3JXAA 1P5VA 3KPRD 4WO4C 4YHLL 4Y5XB 4NT6A 1UEMA 5FX3A 4MA8H 3GBDA 3M17B 2YQ3A 3HS9A 3MV9A 3PHQB 2RCSH 4HAFA 5J56B 4FLRA 4MVBC 5IKCB 2WVVA 3AZUA 4XCEB 3HS0B 1OB1A 3BYTA 4HMDA 3TA3A 4F7MA 3X12B 1QASA 4B0MB 3LRHA 2PNDA 1JXGA 1BM3H 4YFLI 4X4KA 3B2DC 3IAGC 3QEHB 2WXQA 1KLGB 1E4XL 1N19A 5CLYA 2P8PA 4OM0H 2X4SA 2DV6A 3ATEA 1QFUH 3H6JA 2D7NA 5D2LB 2OV0A 2LLLA 4Q52A 3JWDL 4PJXF 5H37G 1JTPA 1PZBA 4OJCA 2BSRA 4LVHC 5DF0A 3BN9C 5C0FA 1CTMA 1WFUA 2C9QA 2X41A 1R6VA 3WNMA 1I53A 4JZNA 2JKNA 4RFEA 3FTWA 1HQ4A 2VN4A 3GXUB 4PU2A 4KY2A 1JFQH 4FD0A 4HZLB 1T2QH 1QAWA 1WCQA 4HKBB 1UB5A 3QDME 3QDJA 3A4AA 4OIBA 2H5UA 2VW7A 2XWTA 1ADQL 4AJ0A 1IILE 5CP7B 1QA9A 3PJLA 1YEIH 3W39B 3BQUD 4LBAA 1JK9A 4FLOA 4HS6A 4TVPH 4FKEA 2CMRH 1RPQA 2LGNA 3ULVL 5JHDB 4RESB 2DIBA 5FM8A 5E6ZA 2X1XR 3WFDH 5CGMA 4F3FA 2B4CH 2EYTA 2MNJB 5B3NA 3SYAA 4UUJA 4Y4FA 4NI6A 4P46B 4P04A 3WFHA 4KGLA 1C1EH 1ZTXE 2E9BA 3LOWA 4BE6A 1ANUA 4PJBB 2GABA 1CQKA 3ZO0A 4LCYB 1IM3A 1TYEB 4QHPA 4XO8A 5EUOF 1QLEH 3BD3A 4P5TA 3EBGA 1N3NA 1GC1L 4LSRH 3ZL2A 1YYLH 5DT1L 1VESA 1DSWA 3WD5L 3HE6C 2E9GA 5HYSB 3TT1H 2PR9A 3FT2B 4R8WL 3PL6D 4KRLB 1CGSH 1G7PB 1A3LL 4CW1B 1WD9A 3WMQA 1CLOH 5DK2B 5I1CL 2CLRB 4LL1A 4XGZB 3JVFC 4G72B 2JTYA 2EXYD 1AO7D 4MCZB 4MJIB 4TUKL 5JO5A 3LZFL 2F5AL 1HI6B 2P49B 3K8KA 4F7PA 3NGBC 3DIDA 1SDYA 3R0MA 4S0HA 5IHUH 5C0CB 3IDXL 1DE4B 1I1FA 2W8CA 1YHPA 1WS8A 2HJLB 3DMMA 3L1FA 3BUDA 5FGCB 5D1QD 3L81A 3IWUA 1MQ8A 4XP4H 1NC2D 1HE7A 3QFDA 4FNQA 1KWKA 3GIVA 2CR3A 4JHBA 2ZWZA 5GJTL 4DEWA 1B2WL 2ROXA 5C92A 1DO5A 4MDJA 1A25A 4X9FA 4BFBD 3WI9A 4AQZA 1CICC 5DO2D 2GEQA 5FAAA 1J1PH 3HFMH 3F84A 2XRAL 2XN9D 2NNAB 2NY7L 4MQXC 4LLAA 3QZWB 5IM7B 3APMA 3ROLB 2AQ2A 2HTKD 35C8H 5J13B 1AR2A 4ZK8A 5IVNA 4ISVB 1VFUA 3TT3L 2Y06L 3LV3B 4NHUB 2F1AA 4XNMA 4JPQA 1UXLA 5BS0D 1NFKA 2V2WA 1D3CA 1NEZB 1TQWA 2DDQL 3AU1A 1WEJH 5KANG 2GJ6B 1UFUA 4LLDA 4XT1C 2RHEA 2EE9A 1JZEA 3VDCA 4H1LH 3VGBA 2BSEA 2VC2H 2E7HA 2IAND 1H3PL 1Z9LA 3AXIA 3GJFA 5KVGL 1JDAA 5DR5H 2H6PA 3BW9B 3T0EA 4FYSA 3TM6A 3EG9A 2UX7A 3HHRB 2EDTA 3B9KB 2G75B 5D1XA 4AQAB 1KMGA 3PGCA 1JV5B 2J8HA 1KTKE 4PJHE 1OTTC 4N0UB 5DMJB 3SDXE 2EYSB 4IMLB 2JTDA 3GEFA 3N1QC 4JX0A 1D6EA 1QNZH 2ZF8A 1GS7A 5DYFA 2A4CA 2QQLH 1TVBA 3BZFA 3QDAA 4NS0A 5JOPD 4P2QD 3HE6B 4LB8A 5KYYB 1NMCB 3DX3A 4G1MB 1A1OA 4HSCX 5SWSA 2DWEB 1U8NA 1T04A 1UYWH 3O8XC 3QO1B 4AT6B 2VDPB 4MRBA 4CSPA 4XAWL 5B3JE 3U9UA 4DVBB 2CD0A 4QOKB 5IVXE 4HK0B 4AWJC 5IHZB 3GUTA 4OD2B 3X3FL 5HHOA 5BV7H 4GIAA 1F5WA 3ZVVA 1WIOA 5FA3B 1P7QD 3BHBA 1HILA 4JQXC 3F2LA 1CE6A 4LMQI 4JK0D 1ASPA 3TVMB 4U6TA 2C9RA 5HDQL 1HSAA 1VLXA 4ZYKB 1KPRA 2DL2A 3VD4A 4Z7OB 2PCXA 2H1LM 2IH1A 5D6DA 1SHSA 1YY8A 3PXLA 1TO4A 3UIYA 4NQEE 4HH8A 4RBPH 4ZFGH 3NAAL 5D7IE 1VRSA 3NFPB 2BCKA 5K1VA 4PRBB 3W81A 2CO3A 3IKCA 2VGLM 3B7UX 2JKLA 3MREA 4G7RB 3H7BA 1PKQE 1LDPH 1AE6L 1RJZB 1EMTH 1XBDA 3LIZL 5DD3L 3RB5A 3T0XA 1JTOA 1T1ZA 3US9A 5TF1H 5J57B 3SE4A 4NHCH 2EICA 5DJZA 4ZMZA 1EHNA 3BEVB 1EEYB 2RAMA 4ZFQA 2KDYA 4WW2B 5J1TC 4KUZH 5AOKA 3V5KB 3LIUA 4M5ZL 1VGEH 2KI6A 2BSSB 1U8KB 3TA4D 5MENA 1S9KC 4O2EA 1OWWA 5JMOC 1IBHA 1ZTMA 2Q0ZX 3OM3B 3FT0A 4WFHD 5HI4C 4JKKA 1ROWA 3MRDB 4AZ8A 3NIFB 1Q4NX 4JR9H 5AVRB 2YUVA 4XC3L 4NJ9L 3CD4A 2A9MH 4LDLB 4HLEA 4LCIH 5LQBH 1TU2B 2F1BA 2OJZL 1UD3A 3L9EA 2ZWLT 1SYVB 3L5XH 4N85A 5TPWH 3T2OA 2R0KH 2O6EA 5HI5C 4WEBL 5DMYA 1UENA 1IGFH 1GAFL 4Y9FA 5CEZL 3CFKA 2H3NB 2Y07H 1KBGL 5GJSL 2Q5BA 4Z76B 1MFEH 4GKNB 3ZW3A 4P59L 1VACB 5FDYA 3D18A 1OAUH 4UOQA 2XZAL 2VJ8A 2CM6A 4FFYA 2H9GA 1NPUA 3T6XA 1D2PA 3U2SB 3RIFK 1QYGL 1PDKB 3V0DA 4EDXB 3CH1A 1RP8A 4KVCH 1KBWA 4F58L 2DYPB 3TJHC 2WXOA 2F53A 3O8XB 3KGSA 4AGLA 1KCWA 2R2EA 5I8CA 4GUPB 3PY9A 4E9WA 3RUGA 4F7KA 4QXUH 1ZDSA 4AKPA 5HYFA 3KWTA 4PJGE 1RZJL 3L8QA 4KTYA 3P2BA 1FIEA 5EFIB 2NYYC 1XF5B 1RHHB 2X5PA 5E1QA 4ZS7L 5GGQL 1MFVA 1JVOA 2QQKH 4A7SA 1TTAA 5ETUB 4OJFL 5I76A 4XCYB 1G1KA 1R47A 8FABB 1NMBH 4N2GA 3LDBC 5JXAL 2DJ4A 2CUHA 3I9GL 2NTSP 3RGVA 3FB6B 1RUAL 2JKRM 3C60C 3R4RA 4Z7UF 3I75A 1WWBX 3P0VH 4X6EA 5B4MC 1V3JA 2OP4L 1D5MA 3BGMA 4OZFG 1ZANL 1UT9A 3O2WL 5ANMA 3FL7A 2R0ZL 3TFKC 1ZS8B 4JANA 4GBXB 3RI5K 4XVTL 2LTQB 4DZBA 1X7SA 5FYJL 1KYOK 1JZFA 4NWTH 3IE4A 1UKQA 3VFGL 1I1YA 1L4IA 1LO5A 3WHXA 2VLJD 1OQXA 3C5ZA 4F33B 3FSAA 1EEZB 1MVYA 4N2DA 1EEQA 5KUKA 1AGFA 2CGYA 3ILQD 2A0LC 15C8L 1BVLA 3MOBH 4RAUB 4DKAA 1AIZA 3D39A 4J39A 2HRPL 4MXVF 3WO4B 4NNXB 2LE9A 1DQTA 2A83A 4XPGL 1DQLH 1PCXA 3FCUB 3TX4A 3OTTA 1BQUA 1JGLL 3BPLB 4J3OC 1K5NB 4DK3A 3QULA 1J5CA 2VQ1A 3BSZA 5C2BL 4UQEA 1GTNA 2C1PA 4P9HL 2VDML 1OF0A 4QJ3B 1JGUH 4Z7NF 5E08H 1A02N 2XY1A 2FYVA 4KXCA 5AUMA 5TE7L 4B95C 4TTGA 3X13B 1EGJL 1RUPH 4KBPA 2ADIA 3ZT6A 1K3IA 4CJ0A 3GEWB 4LDEB 3D85A 3HG5A 5CGYC 4KJPD 4N2NA 4UCFA 1TIUA 3ARGB 3ULUL 2N59A 3WKYA 2ARJB 5CZXC 5HHMD 5F8RC 4X6BB 4IDJL 3TGXA 2ADJA 2HT3C 3KLAA 4GEJA 1T5XB 1S9WB 2B1AL 3NJNA 2EO1A 2QPUA 3N2JA 5HHNA 2H1XA 4L4VE 1TJHH 1B6UA 2PTUA 3PABB 4JFZH 4J3SA 4QRRD 4GI8A 3FQUB 4ZAKB 3U6XA 4BGLA 1AOZA 3QH3B 4QRPB 2J56A 2WQ8A 3AB0C 5CR8A 4UB0H 1BFSA 2HVKB 4G7VH 5AKRA 4ABUA 5C0RH 5KSAC 4JFHE 2CDFB 3MACH 3N3EA 2NY3D 1NOFA 1FO0A 4OZHE 3O3BA 2QPFA 2J4WH 5EU3B 5L8JB 2PW2A 3G6JE 4ZO9A 5IT2L 2AITA 3VFWB 2VZ3A 2RBLA 1EGJA 2Q76A 4AEFA 4CC1A 4EPSA 4NCC2 3BRGC 2APSA 3VU1A 4OLYL 5I2IA 1UCTA 1URLA 2G2NA 2GYSA 4PJAB 3UZQB 1IKNC 1KCBA 2UXVA 3REVA 3KLHC 4MB3A 4TTDC 1SFHA 2O6CA 2YD1A 2NY4D 4YSQA 2IQ9L 3RB7A 3LB6D 4J1UB 1H3WM 4KKZA 2HVBA 1U8IB 1HE8A 5K69A 1OGTA 2WTRB 1KCUL 5F9DC 3VXSD 5JR1L 4YPGB 1MCBA 5GGUA 4ENED 2OXHA 1AZBA 3QWOB 2MRYA 2B3RA 2HFEB 1XB6A 1GIGH 5EO0A 5I1EL 4U4BA 4LCVA 3GMOB 3B9VA 4TRPL 2K7PA 3B83A 3WKPA 3ZKMC 4MTMA 5JHLL 1IC4L 4MNQB 1XCXA 3QZOA 4JHAL 3EF7A 4IMKC 1JZIA 4L3FA 1OIOA 1J88A 4U1KB 5AALA 4YVNA 2X4OA 4MNGA 1QUPA 3ARDB 1ZT1A 3E9TA 2H45A 5HJGA 3S3PA 2YPLD 2OMNA 3KPNA 1M7DA 3EGXB 3TN0D 3WNIA 2YEZA 2W60B 3QUZB 1SUHA 3DYOA 4CDHA 2VDQH 3CXFA 4GSDL 1NDTA 4D8PB 3T77A 4ZMTA 4MX7B 2FBRA 2XZCL 4UV4L 5HDBB 5CCGE 4JM2A 3DVNA 5BZWA 5AB0A 5HYJB 3RL2A 3LPFA 3IDIA 4UBDD 5F88B 3DVFA 4QY8A 3OJMB 4JQIH 4YHNB 1AP2B 1UM5L 1W80A 2QKSA 1G7HA 3NDZE 5C6TH 4LEXH 3U0WH 4JZJC 4JKNA 5L2KE 4YSRA 4U6YA 4YUEH 2DLHA 1AKJB 1PCSA 2ZSWA 3LAFA 5JHLA 4LVOB 3V5HB 3VXUA 5E4OA 3KLSA 4GMTL 2BINA 2HKHH 2XA8H 5FYKL 5TH2A 3VGAC 3WNJA 1GHFH 3EFOB 4JREC 2VRKA 2EKSA 2ZCLH 1F2XK 3ZJAA 4YHPA 3AT0A 3HNVL 1UT1A 3AUWB 3C87A 4Z7VF 4FQLH 5DS2A 1EH9A 4A2FA 4DAGL 4Q2ZA 2WCPA 3Q2NA 4BSWA 4F8NA 5HJ3A 5FWRA 1RSFA 2VLRD 4LQFH 4KUCD 4EAEA 2JB6A 1RZIB 3KLHD 2CWRA 1K4DB 1WWAX 2D0FA 3QG6B 5GZNC 2V9UA 2ZXDA 4ALAC 2BIHA 2O5ZL 4HAKA 2GAZA 1DBMH 4X5WB 2ZOOA 2FQFA 1G7MB 3S3SA 1M4KA 3HI5L 4WU7B 4H4NA 3CFJA 2HX9A 4JZOA 3EHBB 2PPEA 3ZZ1A 1Q9OA 4YSUA 2Z8WC 3AWEA 5T5NG 3HPLA 4R5XA 1G0XA 1KGJA 1K3ZA 1RU9L 1Q90A 4I2XA 1KTDA 3FRPB 4IRZL 3DETD 3BKCL 1BQLH 3F7VB 3IFLH 3OAWA 3HB3D 4NXSA 5DVPA 4K73A 3LKRA 5J9PB 4AV4A 2F7IA 5A2FA 3C6LD 3T0AA 2E46A 4PB9H 3W9EB 2EDDA 3P40A 2CO4A 1P5UB 1WD8A 4QXGL 3IFNL 2VR3A 4DETA 3GLEA 2FSEB 4JPIB 3II2A 2QGBA 3QIWA 3GSUB 4JFEE 1QVOB 2CJUH 3L3OC 4MMZC 3QIBB 2HJFB 4AXWB 5D93C 2Z92B 4RMRA 4Z9KB 2HA1A 4PJXE 4KQ4H 3T04D 5E99H 1F11A 1YEJH 4KVNH 1NCOA 3WUZA 1GMIA 1YNLH 2R51A 1SHMA 2F5BH 2X70A 4HX1B 5HGGS 5CILH 2Q8BH 3UTSB 2DM3A 3T3PE 2E6PA 2A74A 3CV5A 4AW7A 5IWLA 1EXHA 4GW4B 4NZRL 5JORA 4HWEH 3S5LG 2F15A 3GC3A 4LO9A 4N2KA 2W0KA 4KK8D 4GQRA 1LEGB 3V0IA 3EDDA 1OGSA 3FO9A 1GZQB 4FJZA 4IRZA 2XWJA 2EDLA 5F6IB 3GIZH 1LWJA 1PNDA 3B2XA 1NLDL 2BOBB 5C07E 5IY5B 4XWOD 2FEEI 4MAUH 4KV5F 2NR6D 2GSGB 4BFKA 2PWHA 5K39A 1DCLA 2GIMA 1NUNB 3WTUA 2YO3A 43C9B 4HIQA 5EORL 3LHAA 2XTSA 1EAQA 1A6PA 1RUQH 2AJZB 2B1HH 5I1HL 3G5VB 5C0ND 3VGAB 1OT1A 4YPJA 3T2PA 3D4YA 2ADFH 4NQCA 4Y19A 1F90L 3SODB 2MIZA 4IHOB 2E27L 3BO8A 4HF5L 2V5SA 4OTXL 5EUOE 2L04A 2WIIB 3IFPA 3MLTA 1M56B 5I0YA 2E8ZA 3NG5A 5ENWB 3HMXH 1XGTA 3I3DA 3TBWA 1EPFA 4WGKA 3MLYL 5CWSA 3UIZA 4MXQC 1NBZB 3K6FA 3MVSA 4BXVA 5CLXA 1AQDA 5D6CA 3UXFA 4NP4L 2I5YL 1A6AA 1GGBL 1UA6H 4MA3A 3HUJA 5C7XL 4XE0A 1CL7L 4Y89A 4ZMWA 1MCSA 3VFVA 2GVYA 3C5JB 3MNWA 4WDIA 4DP9X 5FO9B 3AS1A 4QYAA 1V7MH 2Y3AA 4G8EB 3SY6A 2WKLA 2NTFA 4ZUUB 3LKQB 4DO4A 4DKEL 2E7MA 3OJVC 1NUGA 4X8GA 3DRTA 3Q3GB 5T1MB 3IJ9A 4X9BA 5ISZD 3V7AE 4TPRH 3LH8A 5BZDA 3A4DA 4AQ1B 2W9DH 4Z78B 4Z7QF 4FNTA 1XF4B 2UUDK 3VWJC 3QT2A 3LH2L 3II3A 4KY1H 1OK0A 1UURA 4GI6A 2DH2A 3MUHL 4KK5C 4QHKJ 4EUPG 3NK3A 4NUMA 2OTWA 3G04B 4HFWA 4X80H 3ZE0F 4HHAA 2E47A 4JPVL 3SQBA 3O4LE 5F6HJ 4XODA 2YD9A 3P4NA 3QFJB 5TQ2H 4A2EA 5HDOA 5DMGD 3L3DB 4X6DF 4NQSA 4W9HC 3RZCC 4QXTB 3ZO9A 1BFOA 4K9JA 1RK0B 1UD6A 3GK8H 4NO3B 4N8UA 1KBVA 5FW6A 5IV2A 1I1AC 5A2JH 3QBTB 1EFQA 1BVZA 3ZDZE 2VE6B 2GPZA 2PPCA 1JZHA 1RH8A 2K3TA 4PJ9C 1NIDA 2D31A 2YAEA 1K8DB 4BKLB 1TR7A 4OLVL 1P84K 1IAKB 3NCFB 4TNEA 3AU0A 3VCLB 4WU5A 1J5DA 2QLVB 3UZVB 4OCXL 4PJ7B 3KR3H 4JO2H 3E3QC 5AQ0A 2QVMA 3KXFA 3JTBA 1UOKA 1XB8A 5IIEA 5L4MA 2YPKA 3VGGA 2XKNB 3OR7B 3H9SB 3IMTA 4OLWH 3WJJA 4ABVA 1RIHH 3ZXAC 1E5ZA 1L0PA 1OAQH 3CFDB 3F58H 4I0PD 2ICWA 3DO7B 2CLZA 4ZOCA 6CGTA 1WRFA 3ILPA 1DQML 3D0VA 2OBGA 1QRNE 1QX1A 1YECH 5B1BB 3LQAL 2MPVA 1B4JH 1UUNA 4TOYL 2APFA 1BZ9A 4LRIA 3DK0A 5HHPB 1UWGH 2B15A 2OJEB 2W59A 1TTFA 1WAAE 2XTLA 1CYGA 4Z1PA 1QFWI 1WPCA 3IVKA 4OZGF 4ORZC 5C0BA 3Q5TA 3VI3A 1D9KD 3P02A 1NC4A 3ISWA 1LTXA 4LCUA 1KTLA 4YXHH 3BEWA 4WQOA 3KPSA 3QXDA 4R4NC 5GS1C 5T1DH 2J2ZB 1NCGA 4E41E 4FQQB 4DT2A 1WZMA 1PBYA 2XFXB 4N0RA 2F7RA 3PP3K 2PABA 4XN9A 2DQJH 1A9EA 1TZGL 3WFZA 5CF3A 3Q6FA 4FE9A 2IOIA 1G87A 3CVCA 1DLHA 4UDTA 2GTWB 5KVDE 3H6AA 2NUPB 4KKCC 1ZHKB 2YRLA 2WUBH 3MXVH 3TA3C 2B14A 4G6JH 4KMTL 4JUTA 4NENA 1IJNA 3VWJB 1TXKA 4WNJA 5TE6L 1R3HB 5J8OA 2F8OA 4NWUH 1FGNH 1OM9A 1U3ZA 4HC1H 1INEH 2F8XC 2MQ3A 4N0CD 1IU1A 1HHJA 4K2UH 5K1NA 2N7BA 2OZ4L 3UYRL 2AEQL 3CZFA 2B16A 3FC8A 1LEKB 4LLMA 5C0DA 4ELMF 5CKGA 2EO9A 1OTSC 1ZTXL 1QPKA 2ORBH 2OMXB 3K1KC 5IW1B 2JK5A 4F2FA 3MA9L 3MRRA 2QGCA 3CDZB 4QGTA 1TQBC 1N2RB 4KTGA 2QQQA 1DCEA 4K3EH 4L8BA 4PJ9B 4Y2OA 4YSPA 1WFMA 1U3HA 1MIMH 3CMOL 3B2PA 4U6VH 1Y18A 2F19H 3AY4A 3U4BH 2PWGA 1T6BX 4KNQA 3LEXA 4HH9B 4WUKL 3NBNA 4FNPA 4GO9A 2ZZUT 4V1DD 1PD1A 4JJ5A 2WNKA 2XTJD 3GDCA 1J48A 2VAAB 5HDRA 4QT5A 1Z5LA 2WUCL 4ZMVA 4Q4IA 2OZ4A 1CMOA 1XF3B 2HTLC 4G43A 4YFLF 4P5KB 2Y1VA 3FQ4A 4QHKI 1TT6A 2IPKB 4H13C 3BGFC 5E8NB 4XXCA 3QUMA 5GRJH 5CXPA 3U7AA 1C08A 4Y4FC 3FU7B 2FR4B 5LUMA 2QGEA 5F6HI 4BZ1L 3ZTCC 2J88H 3FCSA 3L7FB 2NX5A 1SBSL 3U0TB 1NGPL 1F18A 1QHQA 2A6KB 4EKXA 4UTAH 5MEPA 5AKVA 3SDCA 4P5TC 4EI6B 4OGAD 4JRWA 4NNPL 3VYPA 4AG4L 1S4IA 3RJQB 3LCYA 3BAIA 3MR9B 2BP0A 4PJ8D 3KJ6L 3PDOA 3KWXA 4NRYB 4GAFB 1IBDA 2E4TA 2F2HA 4K71C 4JY4A 4QRSA 3HG1D 2R69L 1I9JH 3UEZA 3QQDA 4YBLC 5IBUG 2WWMC 3ULVC 2QMKA 4M02A 4F1SA 2OW7A 1PQZA 4LEOB 3D0LA 3OXSA 4E42A 5HP5A 2BXYA 2BVUA 2ZYIA 4WCYL 2CBPA 3TO2A 2GQHA 4JM4H 2XKSA 4NM4H 3WE6A 3MLUH 4FLHA 3CC5A 3BP5A 4Z7UE 1OB1B 4UT9L 3CVIH 4WI4A 1RVFL 2EDYA 3TOPA 1XH0A 3DMMC 4NQDB 1M1XA 4HPYH 4NIYE 5IB5A 5C09B 3V4PB 3MBED 1GC1C 2KZ1B 4MD4B 4IKJA 4P23A 4ZO7A 1NBYB 3KPLA 4BDVA 3U25A 1A6WL 1TZHA 2CZNA 3KCPB 3FFDB 4KHTH 2P8PB 4JKWA 5I5JA 3GHEL 1MH5B 3RVWD 4HMCA 4XP5L 1BQHG 5E8EA 4Y5VA 4DUVA 5FM5M 4RA3A 3DTXA 5DZNA 5L0QB 1EAPA 4JO3H 2BSRB 5E8OA 3AMKA 3RY5A 1M7IA 3O6KL 4ZFZA 5C0FB 1O6TA 4XR8C 1SZNA 4PRNB 2MCMA 2ZXGA 4XVSH 3KEHA 5KVFH 4JRYD 3NJLA 3MLWH 3G5YA 5B39G 1K6QH 5D2LF 4AX3A 1FNFA 4NGHH 1UB5B 5BUAA 5G4MA 1H8LA 1Q72L 1A7NH 1M3IA 1XCTA 1QR4A 3F65A 1QA9B 4YDJB 2DI9A 3OMIB 5DMKA 5F9JA 1JK9B 3PWPD 1KCLA 4HS6B 5D4QA 4ZW8A 5I0XA 4HJTA 5GS0D 5ID0A 1NAML 1XXFC 5K1JA 3GFUA 5DJ6A 3TONA 3QEQB 1BWMA 5DDHB 2BPBA 3DUSB 3WFHB 3GSVA 3LN4A 3S2CA 2IH8A 4HBCL 4RGNC 5D1XC 4FQXB 2JXMB 3APDA 3SDXA 3CSYA 2NSQA 1BQRA 3GSXA 3T2QA 4OSUH 3GMNA 1ORSA 4APQD 2RFXB 1FYTE 3BWAA 1Z1WA 4FQPA 5I6XC 2BCMA 4I3SH 4FERA 1OVZA 2EC9T 3PDDA 3SO3C 2FE0A 3WHE1 1F3JA 3DHJA 4I0CC 4DO5A 5DS1A 2VH5L 1HH6A 4XCFH 4XMKH 5J12C 3NEXA 2WBXA 1PLGH 4UINL 2EXTA 4RSYA 4BINA 1BBJA 4G7QB 4WGWB 2WCGA 4IRJB 5IVXA 3SE8H 5A6LA 1NAMA 2ZKWA 3MTXA 3ARED 5FUOH 5AYUH 1CF8H 1HNYA 3PJSA 4PJ5E 5EOCJ 1UGNA 3EYVA 2VLMD 3H9HA 3UMNA 1URIA 4F7PB 3P4MA 3DHPA 4PP1D 2HLEB 1OEZW 1QFWH 3OKYA 4DGVL 2KZKA 3KL5A 1Q9KB 3QQ9D 3IDMB 2OS7A 3ARFA 3L4WA 3GM0A 3FKUS 5ABDE 2W5PA 1G9ML 3SZKC 1AG0A 3OZLA 4D9LL 3AS0A 3D25B 3LMJH 1S5HA 3ELAT 2Q8AL 1KGIA 3SDYL 2LR4A 5JA8B 5D6DC 2FEDC 1MXGA 1ZE3H 3KHQA 5EWIL 3CVHA 3MODL 1G7IB 4J8RA 5E6ID 1MPAL 4J27A 4I48B 2IFGA 1PKQA 2V33A 5TE4L 4MDIA 1MZYA 2OL3H 1GA2A 2FYYB 4MDJB 4UQ3A 1F6LL 3T2LA 3FHEA 5DWPA 5J3HD 1E4XI 3A0OA 3FZUC 2RJMA 3L13A 4GOSA 3SE4C 3WIFA 4U1HA 2Y7QA 5F96L 3TF4A 4FI6A 4WEEA 1V27A 3GSWB 4WI7A 4GKSA 1YA5A 4EI5A 2N4IA 5GRUL 3IETB 1P84J 5PCYA 1NLBL 2F7PA 1T4KB 2H0FA 4XO5A 3GM8A 7PCYA 2F7OA 4HIHB 2O4EA 2JCCF 5TFSL 4XNMB 3S5LA 3WTWA 2EC9U 2V2WB 2CAKA 3S5YA 5T3ZD 1BPVA 1ZGLA 3S3DB 1G9HA 4MJ4A 5ECJE 3GI8L 3P77B 3I6LD 3QXVA 1J9SA 4GO8A 5AVVB 2AQ1A 3PPSA 5I1DA 1LO4L 4IJ3C 3H54A 2EDWA 1E40A 3RTQC 3T0EB 2DI8A 1ONQB 4XMVA 3MV7D 3V6FB 2IBGA 4QRRA 4L4TB 4QTHA 2FGWH 4KI5E 4ZOEA 4G9FD 5E1HB 2KQMA 5KS9A 3ROOA 5HSFA 4OUUA 5IGXH 1YC8A 3SO3B 4XMXA 1J5IA 3K6OA 5IFJA 2A9BA 1KG0A 3C8DA 4MNHA 2PO6A 3RNQB 1H19A 5SWSB 2I9LA 3QDGE 1U8NB 5MEOB 4YDKH 1SXSA 2YKLH 1ZGLM 1WFOA 3E8UH 2LHAA 3GS0A 3ARWA 1QTPA 3MBWA 1ID5I 4WI5A 2A9NH 4FQIL 3LS4H 3UJTH 1S9VB 1JPGB 1EANA 1PG7L 2FX8H 3QUYA 5TQ0H 4B96A 5HHOB 3UG4A 3R1GH 4PJCE 4E9YA 4CU7A 4MD5A 4FJYA 3HZ3A 3CIQA 3QB7C 5J6HA 2NY0B 4GAJH 1OSPH 4OV5B 3MJ8B 1CE6B 1XGYL 4ODXB 3DOHA 4HCRL 1EWHA 1CQYA 3SYPA 5IUCA 1ERNA 3TPUA 3X1NA 1KPRB 4C56E 2ERJC 3RGVC 3E1F1 4JFSA 4AEIH 2NXZD 1P6AB 4JDZA 4X0NA 5FC9A 3ULSB 4HJEA 5EEZA 1IC1A 4KTEL 4PS8A 1J87A 3ORJA 1MVFA 4NC2B 2N1TE 1VFBB 4U3HA 2RD0A 3UABA 3NA9L 4HG4J 3NCCB 3BMWA 3IMWA 3V8CA 4Z7OF 1PMYA 1Q94A 2AABL 4X4ME 1OAKL 3CK0H 3VI4E 1J8HE 2K6ZA 1T89A 4XBMA 3RVVC 5DJZB 3ARZA 5HVFB 1HL8A 3C5ZC 1JRHL 1RZJC 4MCMA 4EUPA 1ZHNA 4LFHD 1KCVH 5I0WA 1CXKA 1KEMH 2PR4H 3VFSA 4TM9A 4DFIA 1J5OL 4S1RH 4GW5A 4EMZA 3DUUA 5K9QI 1FVCB 2XQYK 4NKIL 3LXAA 3ME0B 3BUYB 2ZCKH 4H8HA 1F4WH 2NSXA 3LRGA 3DV6A 1TQUA 3FT9A 3RKDD 3EO1B 3I2CL 3DV4A 3QCUL 4WO4D 4D0DB 5FOBB 4WW2F 3DROB 5D4JA 1H5BB 4ZW3A 4K8RC 1NANH 5GGVY 4HS8L 4TULH 5D7JA 1RIVL 2YJQA 1RIUL 4KPHH 1M6OB 4RVBA 1D5BA 3QCVH 4BZ2L 3NIFF 3BH9B 3HZVB 3P3UA 2GW5A 3G5WA 2JJUA 3ZL4L 3FOMA 4KROB 5EBLA 4LP5A 2P80D 4NO0B 1AGDB 3ZIMA 4LPUA 5FA4A 2Z0UA 4KNSA 3D18B 4K7PL 5I1LA 4UAOC 2H9GB 3IPEA 4UT6H 4F2ME 4AKOA 4QNPF 4L4VA 1E2VA 3THMH 1DZ0A 3O3EA 1DVSA 4ZSOE 5B7FA 3CH1B 2WZ0A 32C2A 2UVFA 1QWNA 1K4CA 4JY6A 4GKZA 3MRMA 4JFDE 3CQPA 5CCKH 2AK4A 3BN9D 3RUGB 4H20L 4NOBA 2OTUB 4YDVA 7PAZA 1YEGH 2VXUL 1E28B 3ZR6A 3SPGA 1IKFH 5L8KB 2VKWA 2BWIA 4M48H 3FN0L 3DX2A 4CMHC 3I6SA 2D9QB 2VCOA 1NOLA 2A4ZA 1RURL 2YQBA 5F7MC 1XB3A 4BRJA 2F0CA 3V55A 5EUKA 2CUAA 1KIUA 3EDFA 3GRWA 1JMXA 1ZCRA 2FB4H 3STLA 4JO1L 3D07A 3NFNA 4Z7QE 4A2GA 2A6JA 1H6EA 4U2ZA 2DKSA 3BGMB 5FLUA 4M6AA 4DN4L 2AK1L 4CGTA 4G8GB 5GIRB 1T0MA 3MV7B 4NN6B 2KLRA 4U1MA 2H3XC 4DZBB 5KYWA 3GNMH 2BSTA 3S5ZA 3P1VA 3WFBH 3ZE0E 3VXQA 3K6DA 2VDRH 1U8QA 4F5CE 1MCKA 1I7ZA 1N5AB 4N0FB 5GGTH 5IHBA 1WJ3A 3DGGA 3HBQA 4LCWB 4OD3H 4GP4B 4GRLA 1W6LA 3MN8A 1LO5B 3WHXB 4RSVA 1AXSA 1MJUH 1E4WH 5L88L 4EN3A 5HHXL 4PJFA 5EZOL 3M7FB 3D2TA 4Y2DB 3IDUA 2VXVL 1BVLB 3VH8B 1IRAY 3QS3A 2IBZY 3K6SB 1YEFL 1H3UA 2A83B 1UADC 2IGFH 1G7JA 5DJYA 4PB0L 3QO0A 3IMUA 1U3JA 2EDOA 2PWDA 3QULB 2VQ1B 5I66A 1DL7H 2C1PB 3AG3B 3CX5K 3H42L 4OGZA 4TVSa 2VISA 5CEYB 5KYUA 3RWIA 4CVXB 1QO3B 3Q1EA 2IGLA 5C3LD 4JM2C 1QWUA 3CVDA 2XKUA 1NKGA 2KDGA 1CT8A 5E2TH 2CLVA 3JWDH 3LRLA 2E74C 2Y36H 1X3DA 2N1KA 4EIGB 1V7NL 4HUWB 4YC2C 4Y88A 2K78A 4P4KA 2JKJA 2PPAA 3DX7A 3L3HB 2HB0A 3L9RB 4HETA 2WLLB 2K6WA 4R4FL 5D1ZD 3W0WD 4V33A 3WKML 1INDL 2K4WA 4X6CB 4W4NA 2VERA 2ADJB 5AOZA 4IRSA 4HUNB 5IEHB 1QSED 2BERA 3W3BA 5HHNB 3R0NA 4O02L 1KB5A 1CICD 4Z7WB 3OR6A 3LXCA 4OZGE 4DTGH 3FNKA 5C0AB 4MQXD 4JGNA 4YSTA 2MCG1 3D9AL 4HKXB 1JOIA 2LLNA 4KZDH 4LGRB 4XP6H 5I1KH 2AAVA 2ITCA 1HHIB 2PW2B 4ZXBD 5DEZA 5I23A 3CFEA 4PRAA 5C71A 2IBZX 1PX4A 2Q76B 3DJSA 5ITFA 4KQ0A 3LXUX 4GXUM 4MAYA 3BKMH 4EXPX 2VJXA 3QCTL 3RWJA 3N85L 3U48A 1ZGLP 3BVXA 3POHA 4CN1A 2XWZA 1OP9A 4OGXL 4HXBL 4QEGA 3CHRA 4N2CA 3ABZA 1HYRC 1N10A 1UH4A 1P4LB 3GI9L 4AJYV 1OQOA 3SDAA 3EJJX 4HT1L 4L9DA 1DBJL 2HVJA 3QNZA 4JFFB 2ZTBA 4W6WB 4O02A 3NRFA 4PJAF 3HAEA 2BWDA 3O3UN 4PGDA 5CZKA 1HHHA 4L1TA 3TNMA 3D2UD 4U3SA 1CDYA 1D6VH 1J05B 3OC8A 3QIWC 5JDJA 4BQ9A 2VR8A 1NMAH 4PJXA 5JA9A 3VB8A 2LVEA 4NERA 4BHUA 4D9QD 5FUZL 3ZE1B 3H1ZA 3V0VB 2VYRE 3O6MH 2X4OB 2K45A 3IDXH 4HJIA 1ZVSA 2FJFA 4JO5A 1ZT1B 1KJ2L 3A24A 1FLRH 1MCLA 1U9KA 2KERA 3NSFA 4ZPTB 4GG6F 1EHAA 2A74C 2A6IB 4IKIA 4AOFA 5AENA 5IWLC 4URKA 3KPNB 1ZDQA 2IPUK 1TVHA 3HZKA 4RA0C 3TFBA 3CCHA 1WG3A 2E9IA 5BVPH 5B39A 2AQSA 3CFMA 4AYID 2ZUXA 3MRLA 1CGXA 2P48B 4QY8B 1XIWA 3D69B 3HNTH 2IQAB 4YC2B 5MEQA 3TH3T 4X0KB 2NY7H 3MRJA 4Q0XH 5EOCH 1BD2D 4F15C 1TFPA 3HE7B 5F3FA 3S37X 1KEGL 5HDBF 2BHZA 3LKSB 3EFFB 5TH2B 4XPAL 5LGHL 2UUDH 1RZ7H 4Z5RB 5I15L 4KFZC 5EUOA 1BAGA 4NKMB 3N41B 4YHPB 1P1ZA 2Y06H 1BMGA 3VXOA 1S8DB 3QIUD 2BFVL 2D73A 3D34A 4Q2ZB 5BXFB 1AD9A 1E3XA 3GBML 1YMME 2BOCA 2PYEE 1OPGL 5TDPA 2X28A 2JB6B 1BMZA 1IGCL 3S35H 3R19A 1E3ZA 3QI9B 5KVGH 1JYWA 2F74B 4HUMB 4NUJB 4YDLC 2GAZB 2Q87A 4XXDA 5HI4D 3ZDYB 3OB8A 5IB1B 1J9QA 3BAWA 3ZMRA 5JUEL 4AMKL 4WFEE 1A9BA 2ESVA 4KJWC 3UP1A 5D2NE 3OJ2C 1JJUA 4OLZL 1Q9OB 2B1OA 3LSOB 2IDQA 4YZFF 2E7LA 4YAQA 1KTDB 2KT6A 4N2MA 3APFA 3V9FA 2VB5A 3OXRA 5LN4A 1U8OB 2GJZB 5JOFA 5HI5D 2V2TB 2G4EA 3KYMA 4XNBA 3IXAB 3SJVB 4Y9EA 2BY3A 2MSPA 3NCYP 2VN7A 5F1IA 2BNRD 4PRDB 4R5VA 3BVNA 4XO9A 3UBXA 3FFCA 1QABA 2XHNA 1FVEB 2KL6A 4FG2A 2XXGA 4TSBH 4UIKH 4Q9QH 5BVJB 4XX1E 5L9DH 1FH5H 5CUSL 4XRCB 5EU6B 1F11B 3KNBA 3TBYB 2NDFA 1XL6A 3BYYA 5DYOB 1FPTL 1WT5A 1ZJBA 2A74B 4NC1C 4TSAH 1OCCB 4ODVL 1G6RL 3H2PA 2A4EA 3OKOA 4OLXL 4WI8A 2IIJA 3MV8A 3OQ3B 3PCYA 3C6SA 4G42A 2E9JA 4WFFE 2Q7AA 5BRZE 5TK4A 4MB4A 4N3UA 3TEXA 3IRZA 2NYYD 3FUMA 4W9DC 3DPDA 4MS6A 4XMWA 2CRMA 1PSKL 1S5IL 3BE1L 1WDAA 3FDWA 3LIZH 4OCYL 3PWVA 2FBJL 3JTTA 1JV2A 3D3VE 3W1ZA 3GF8A 4U1LB 3E6HA 3LQZB 5I30L 1WFNA 2P3YA 3C60D 4M5ZH 5E03A 5B4MD 3WJJC 1MAMH 2Q2LA 4Y19B 4RCAA 5E94A 1DLFL 5JW3H 1PLCA 3H3PH 3BO8B 3JTSB 3K2IA 4TUUA 4LLQA 2Q10A 5KVDL 2YQ2A 2LVCA 3JBG7 3LHPH 3IDJA 3T6QC 2BNQE 3D2UB 2VMDA 5DJDB 2XUWA 3TBWB 1XGTB 4L3EB 4AI7A 5IJKA 5DWUH 3T9WA 2WK2A 4IIZA 5E6YA 4LRIC 5E56A 1I7RB 2OJZH 1LK3L 1EZSA 3RGHA 4KFMA 5IB4A 3TV3L 5AOMA 3W38A 5IW6A 3HRPA 1ZJAA 1EFXD 1A6AB 3O0LA 3EGSB 3UPRA 4JO4L 1AY1L 4YDLB 1IVLA 2DY2A 4IU2B 3B5HA 3EZJB 2Y5EA 1JUFB 1TG8A 1ZEAL 5T3ZH 4JGJA 1P4BL 4E41A 1FH2A 3CFTA 4J3OD 4MKMA 2ICWJ 1Y6NR 2VW4A 5BRQA 1ZRUA 2X40A 1XSOA 4R2GC 3T0VA 3U4AA 4EF3A 4Z0XB 3BRDA 3WKNA 3RBSA 2CO6A 1Y1DA 4O51B 3QUHA 5BZDB 3FTGA 3VXTB 2CG9X 2AP2A 2OXGA 3ZDWA 4XNUL 4DKDC 2VSCA 5CGYD 5I6PA 5BQDA 5LN8A 4N4YB 2NY6C 4DW2H 5CZXD 2MNUA 2ZXAA 4PGCB 2ATKB 4W4OA 5AZEL 4AE0A 4X4XA 5DUPL 5IFHL 1FI8C 1J1OL 5JW4Q 3CN1A 4HHAB 4R7NA 4NJAH 3WUWG 3NIGB 2EIZA 2XG5A 3OLEA 3P9MA 4XCCH 4NQSB 1AACA 1BFOB 2FD6H 1YPZE 2QHLA 1TETL 2X88A 1D5IL 1VADA 4M9OA 3CX5J 1KOAA 1UVQB 1YN7A 4N1EA 4NKDA 4NN5B 4OLEA 2JCCE 3UG3A 3V4VA 2R0ZH 5IB3A 2VXTH 2ZX7A 1U3HC 2XZZA 4PW4A 4H8UA 4PRPE 4MS8D 2Z31D 4TV3A 3AY4C 5T1LD 3ZT7A 4LSSL 1ILUA 3GXDA 3RIFF 2CE6A 2Y72A 4TTDD 1HL4A 4LOUC 1BEYH 3KXFB 4QHNB 3ZZLA 1MVUA 3U1QA 3KPRE 3VXMB 4E2OA 4I5BA 2YPKB 4N1HB 5A1AA 4UM8B 3VFMB 3FT1A 5E9DA 2HRPH 1TTBA 5HGHB 3DOSA 2ICWB 4XXCC 4PJ7F 5E2UL 4LF3A 3ILPB 4N6RB 1HQRB 1G6VK 4W9LC 3D0VB 4X7SH 4WWNA 2EXSA 1BREA 1DJWA 2X1OA 5FCUH 1QTSA 3RLSA 4MCYA 2QSQA 2LU5A 4LNRA 1DDHA 1QSFA 1X9QA 4LLWA 3LZQA 1MW0A 2EDBA 3ZKMD 3ARPA 4ZQKB 1WZ1L 5DQ9A 3G5ZB 4W9CC 5CN1A 3IDNA 2YSSB 3ZZSA 3QJZA 4P4RA 5TE7H 2IH3A 1PZ5A 3SDCC 2LU7A 1CIDA 1EXUA 1JWUA 2IWFA 3IVKB 2A7BA 5TDNA 2R8SH 2E4FA 2ENSA 4M5SA 5DJCB 1KTLB 3BEWB 1XGUA 1CL7I 2TSBA 5EZJA 1CXLA 1T22B 3QXDB 3VQMA 5F7UA 4PWKA 1BOGA 3ULUH 3WEXB 2I60H 2I07A 3RI5F 1SF5A 3LNEA 4R2GB 4ZG1A 4I1NB 2W07A 5IOPA 1DN0B 5GSVB 2NNXA 3O4OC 5AW2B 3VGDA 4F7EB 1A9EB 1L3WA 4CU8A 2ARWA 4QAWA 5LCVA 3B2UC 4AEEA 4UU9A 5T1KB 1S9YB 1TENA 4PJEA 3VG9B 4Z7UA 1I3VA 1DBAH 4UDTB 1P7KA 3FO0H 1GGIL 2MKLC 3AGVA 5CZRA 1E5AA 4NENB 3KM1A 3RY4A 2NXYB 1RAMA 1IV8A 3LQMA 3MZTA 1A3RH 1DFBL 1RZQA 1L9PA 2AJXH 4P23C 1CGYA 2PKDA 4E9VA 4LLMB 4OJYA 5C0DB 4M1DL 1JYXA 1TCRA 1AR1B 3NCWA 1YEDA 2YQGA 4Y5VC 4LBEA 1WCBB 4F9PA 2ICEB 2JK5B 1X5IA 5MI0C 3QUXA 2P52A 1WBYA 2L7EA 1NZRA 2ICWI 3MRRB 4H26B 3A6CL 5SWZA 4ANUA 3PQYD 5IEKB 2JMRA 2VLKD 3FTSA 5GRXG 4A66A 3P54A 1A14L 5DEFA 3SGJA 3QDMB 1MHPH 3TYGL 2Z64C 3F6LA 2WMPB 3P2TA 1FUNA 5KSVA 3MOQA 4JJ5B 4YDMA 3K4ZA 3A4EA 2PCPB 3NPSC 3E6FA 4QT5B 3EJPA 2Z91A 4N3TA 5E4AA 2NW3A 2YR3A 1MRFH 1Z5LB 2VZUA 1NCWL 3ABKB 2W0FA 5EV7A 3ZKQD 1AO7E 2G2RA 2Y7LA 3L5WA 1AHWA 1R3KB 4EVNA 1QW9A 2E76C 4K94H 1AD0A 5FYLD 1JSYA 3PGDA 2GFBA 1TZAA 2VXQH 4KQ3H 1HU8A 4GYBA 3VTMA 3U0PB 2NNFA 4UV4H 2XZCH 5D1QE 4R90H 3GMMA 4PBVC 4NM8H 4XNAA 4ZTPL 3SDCB 2F8VA 2VO5A 3DHUA 3IMSA 3K1DA 2MPAL 1UM5H 3MRFA 4BH7A 4JRXA 1KBBA 4KHXL 5JTWA 5I5RA 1IEAA 2A77H 2OZNA 5DA4A 2F54D 2VQ4A 4JFTA 3FO1A 5DHVB 2N56A 5E5RB 4CL7A 2C4FU 1BFTA 2Y6SC 4XP9H 4WHYG 4JY4B 4QRSB 2KMWA 5D2LE 1IAIL 3QQDB 2WZ6A 4JLRA 5F8QC 5FYKH 5T1JA 4LHJB 4E9XA 2CKBL 2P5WA 1NGZB 3ZTNL 4BGDA 2XN9E 1PQZB 2VR6A 1LO2L 5EBMA 2RGSA 1M7UA 3EYSH 5CHNB 4ONOA 5ERWB 4E42B 3O4OB 4NOFA 4PD4K 3QJRB 2Z31B 2IFFL 4DAGH 5IF0B 2R2HA 4KRPB 4UQDA 3WE6B 4EE2A 2AQ3A 4D3CH 3ARFC 5AAMA 1JL8A 4ACPA 1V3KA 2NT1A 5BS0E 1N26A 1VEOA 3S3CB 3VMOA 3HI6L 1BQ5A 5IB5B 2AS5M 5LVEA 3NFSH 1E8ZA 4HGWB 2O5ZH 4U31A 3S8WA 1CK0L 4FQ2L 2IANE 2R59A 3Q2CA 1OCWL 3QW9A 5I8EA 4KXZI 2KPNA 5EHFA 3WIIH 1QBML 2GHZA 3COOA 1BJMA 1A65A 1XFPA 4Y5VB 4MXQD 2X12A 2VM4A 3BD4A 3S8FB 3TYFB 4G7YH 5MI0B 3QA3A 1OHZA 1EAPB 1GH7A 1V3MA 2IH9A 3M8OL 4MMXA 4YDIH 3GTTA 3MLZH 2IC2A 5JPMA 1QKZL 2Q86B 4QRUA 1FL3B 4EI5C 1KENL 1SLVA 1IC7L 3G5YB 1C9SA 5E6UB 4P2RD 3HI1A 4P2QE 2APTA 2FSDA 5JOPE 2Y1ZA 2EIEA 1JZ4A 1TTRA 1XGRA 1A64A 1JI2A 4ERSH 3RNKB 1G9MC 1PZ2A 4A55A 1U4EA 5J89A 4RQQA 5DMKB 5F9JB 2X9YA 1UACH 5DGQA 5ID0B 2VDOL 4FZ8L 3DURA 3M7OA 1JK8A 1OSZB 1ZA3A 2MOGA 5DVLA 4WWID 4ZNEE 1WBZA 3W9DA 4C83A 3NZSA 1F58L 1IGJB 4HUXA 1FZKB 3B2VL 1IAIM 4NZRH 4G8FB 3LN4B 1HH9A 4XTRD 2AAAA 3KPQA 3ZRCC 4UM9B 3EBIA 4BUHA 4Z7VA 4PJHB 3SDXB 1TQCC 4F20A 5IJDC 3O0RH 3GSXB 4P8QA 2RB8A 2I24N 3GMNB 4KK5D 4IGBA 1A6VH 2HFGL 3SPVA 2YPVH 4PCYA 1AQMA 1F3JB 4LSVH 2QVTA 2W65A 1ETB1 3RZCD 1FVDA 3QDGA 1F6AB 2PO6C 4MA8L 2HT4C 3P3SA 5HYSG 5ILTH 4P2OA 2DQEH 5I0ZA 1HDMB 1I1AD 3SBQA 4GLRH 5HHQA 4GRMB 3V79C 5CEXA 3EJZC 3IJHA 1BZOA 1ZXQA 1BBJB 1W72A 5FKAA 2G0KA 5IVXB 3ECVA 2BOLA 1G7LA 5EIIB 1F90H 1NAMB 2C1OA 5C97A 3VD2A 1MCCA 3OHMB 3LYRA 2P26A 2WO3B 1ACXA 4X99B 1Q0XH 3B1UA 3QUYC 1V55B 3DKHA 4Y1TA 3FBQA 2ITDB 3EYVB 1SLWA 2IG2H 1DUZB 1IAOA 2J8UF 3DX0A 3GJFK 2MCAA 4BSVA 3MLYH 1GXEA 2XPYA 2J5WA 4U33A 2NY5C 4WFHE 4OM0L 1U93B 1BG1A 4NZTH 4C56A 3HBPA 1PD6A 1WFTA 4AM0Q 2JSFA 1QFUL 2M8XA 1RFDH 4HIIA 3KH3A 3W5NA 3P69A 4HJJH 4NQEB 4FNRA 3ZZQA 4GAYA 3STZB 5D7IB 3TF7C 5JIPA 5GGSA 3NOIA 5E95B 4ZX3A 2WBKA 4G6KH 1G5AA 4E9LA 2PP8A 4CNIB 3EIFA 3Q2LA 4ELKB 1PKQB 2WJ7A 4MDIB 4UQ3B 4ZO8A 4FNUA 5JNYA 4ETQA 1JFQL 5D5ME 1T2QL 2OSXA 4DKEH 1Z9OA 1T89C 2WXGA 2Y7QB 2BDNH 2H47C 2IV8A 1YEIL 3LRSB 3VX1A 4F1ZA 5GZOA 4GG6E 1MXDA 1UZ6F 3PXHA 3QZWG 3EJYC 4TVPL 5KBKA 4L5FE 3OZ9H 4QCIA 4GINA 3WFDL 2B4CL 3L4XA 4APXB 4PAZA 1I9IH 1HKLL 4J23A 1YO4A 1C1EL 2PPDA 1NEZG 4XVOA 4X7TB 5CMAA 4CJ1A 2QTEA 1OP3K 3OKNB 4HUUB 5IK3A 5KWYC 4TQIA 5D7JC 1IVTA 3MV9D 4GY4A 2P9RA 1MJ7H 1WC7B 1QLEL 2LW3A 3WTTA 4U3CA 4M4RA 5IP4A 1R3LA 3FUDA 4LSRL 5FO8A 2DD8H 3CHSA 4WWKA 1SGKA 4M7KL 2ATPA 3JYBA 3KYKH 2Y9RT 4J12A 3U6XS 1CGSL 4TNGA 2FH8A 5FO7A 3V5DB 3US0A 4WKXA 1N0XH 3BVWA 4IW4C 1F86A 5G5DB 1CLOL 1JZ8A 4WHTB 4GQ9L 5ALBL 1GOFA 4ZSOA 3H4HA 1F13A 4MNHB 1M2VB 3HMWH 4OCXH 5LAPA 2WLKA 2DQFA 2I9LB 3GSRA 1X5XA 1HWWA 2QSCL 1UA7A 4LLVB 1MEXH 3UG5A 4PJGB 1ROCA 2VLJE 4JPKL 1B4RA 4N5UA 2OW6A 2HG5B 3MRQB 4UZSA 1UXSA 1MHEA 4GXVH 4YZFE 2WBJD 3ELQA 4XP4L 3QDJD 2QADC 1ED3A 2Q6WA 4HIXH 4XPHH 1KFGA 5F1NB 3QUKA 5K9KA 2JIXA 2QBWA 2I85A 2XX0A 5C70A 3MDJA 4DEPC 1ORQB 3ARTA 4R3SA 3Q01A 1J1PL 4JDZB 5FECA 3GMPB 3HFML 2AC0A 3ECBA 4GP8B 4Y4FD 3AT9A 3F7RA 3PDGA 1KWGA 3OKDB 3JV6A 1RMFH 2CK0H 4GIPD 4PMEA 4F5CA 1OW0A 3DK2A 3EXLA 1IM3D 2P43B 4G11A 4LKXB 5ICXB 4X6DA 4YSEA 4WO0A 4YQXH 3BP6A 4GRLC 4RWHA 3WN6A 1TZGH 2B2XL 2DMBA 2WLMA 4P5TD 2JJTA 2FIRT 3OD3A 5HHME 5IR1A 1ZHNB 1DVUA 4EN3C 1MCOH 1VFAB 2IGTA 2ZOKA 3OMNB 1WO2A 1NTDA 4N90D 1KV3A 2V3DA 2VC2L 1WLHA 1UGKA 4QRRE 5DR5L 1OE2A 2ZCHL 3DV6B 1OGAD 2WWMD 3ULVD 4P0DA 3AQZA 3DV4B 1F3RB 4KXZH 4XVJL 5DJAA 4MDRA 4JVUA 1YEHH 4LHUA 1CURA 5D7JB 4MFHA 1ZTXH 2HCZX 1LWRA 1ZWIA 5HDWA 4MQ7A 2YD6A 1UTDA 2OMVA 2A73A 3ZKSD 3MA9H 2QQLL 4FI8A 5KVFE 1LEIB 3ZHLA 3DMMD 4FEMA 2J1KA 1PL3A 5D7LD 1NCAH 4P4KC 3TZVA 2A6DA 3V0GA 2O61A 3FOMB 3DVGB 5GGRB 1R17A 1UYWL 2Y2YA 3FU6A 1S7WA 2X9WA 4UNIA 2OKMA 3CMOH 4N22A 5FA4B 4DP8X 3RE0A 3QGVA 5I1LB 5JZ7C 2FAUA 3DPBA 5FUCC 1G1CA 1LK2B 4X8JB 1X5MA 4L4VB 2XV6B 4IRSC 4WUKH 1QNIA 5DHVH 3VXSE 3NJIA 3O3EB 2R1XA 3ZSTA 5H94B 5BV7L 1KXTA 2RA1A 32C2B 1K4CB 1KPVB 4JY6B 3ES6A 1MFNA 4NZ8A 4F7TB 3NABL 3WIHA 5IMLA 2NZ1A 4PWFA 2WUCH 2YS4A 4OZHB 1RK1B 1QZ1A 4LAQL 4HJUA 3VD9A 3G6JB 1MWAH 2RALA 3OSKA 4BCYA 1AJ7H 3CFCH 5MHSD 4CRPA 4PTTB 3AC0A 1FN4A 2JFCA 4H5SA 2UWEF 3N40P 4MAYC 4XN8A 3UC0H 3TS8A 2YPLE 4YR6A 2EP6A 3RILA 4A7TA 5IQ9A 1LYQA 3PNRB 4M6ML 4RMWA 2WYZA 2PF6A 1KIUB 4DEPB 1LDPL 3STLB 1EMTL 1IKOP 3CSTA 3NFNB 4NNPH 1JN6A 2V8MA 2WLYA 1JNHB 4NHCL 3SDAC 4MSWA 5E2VH 1EX0A 5KOVC 5AG8A 4O2CA 1SLUA 4KUZL 4JW3A 1MJ8H 4RGND 2R69H 5D1XD 3FMGH 1VGEL 3KEDA 2AANA 2YBRA 4NCC1 2GITB 1AAJA 4ZFOL 3VXQB 3MGTA 4G3YH 4ELMA 1FJ1A 5EULV 4XPFH 1I7ZB 2ITEA 6FABH 1B4LA 7FABH 3DGGB 3GGWB 4GRLB 1I9EA 2QSTA 3WJMA 1J0IA 2ZUSA 2A9ML 3AVEA 1CO1A 4EN3B 1I85A 4LU5L 4LCIL 5LQBL 2BRQA 2UXTA 4UT9H 3L5XL 2XIBA 1JRHI 4XWGH 2R0KL 3TEYA 1EO5A 2F61A 3ML8A 4LCCC 2AI0H 4LSPH 4K15A 1KELH 1WUZA 4WNQA 2VLRE 1IGFL 5B38B 3WNOA 1FSKC 4HJGB 5I66B 4I4WA 1BLNA 3FONB 3IMVA 4DZ8A 1KN4H 1W8NA 1T1YB 3IN0A 1TKWA 2Y07L 4JE4B 4UDUB 3RWIB 3V0WH 1MFEL 2WQAA 3GHEH 1DQJB 4FTVA 5H2BA 1JGDA 4YXLL 1OAUL 1XIWC 2CLVB 1I82A 3HW7A 1RQ5A 2FJGA 3M1CA 3EGDA 4G5AA 4UQAA 2C9VA 3CFBA 5L2KB 5B7MA 3ZTJG 2VJ0A 3SYQA 2V5RA 3KHOA 3QJXA 4IBLT 1WHOA 2G30A 4KVCL 1U30A 3DX7B 4XN1A 2QR0B 1KGYE 1WH0A 5F9OH 3TBBA 5JIHA 4BFEA 2ZWKA 4ODWB 4EEEA 1J8KA 4QHUA 3MRBB 2CUMA 4QXUL 4TKWA 3EYOA 5ICYB 4IRSB 3CN3A 2HP4A 3K2UH 4WI3A 1BPLB 4HD9A 4X6FB 4Y5YA 4AQOA 3OR6B 1YMMA 2PYEA 3FZUD 1ZVYA 4PWGA 4QWWC 4X6CF 3VJ6A 3O6LL 1ET7A 5HGAA 3V8OA 3PWLA 2YGVA 4ZW6A 3CFEB 5MEND 4Z7WF 1IARB 2NLJA 4KKNA 1TJMA 3P0VL 3T8XB 5D2NA 4ZPVA 5FKPB 4MAYB 4OZIF 3C08H 2EDJA 3ASWA 4KK9C 4PY7A 5CAYB 1SN5A 1H6UA 2OMWB 4ZT1A 4LHQB 5E6SB 3O6FD 2K70A 4HYTB 3SDDA 4EN2A 2E7LC 3HCVB 2BIIA 4NWTL 1RK7A 2ODHA 4Y5XA 1LNUB 2Z1PA 3SDAB 2YXFA 3M17A 5FYLH 2HVJB 4G2AA 4JFVA 3RTQD 3EOTH 1Z6JT 3PHQA 4PREB 2FIKB 4O02B 5IKCA 3ULUF 2V7HB 4HOWA 1YNTF 3HS0A 1KGXA 4JFEB 3U4EB 4HUVB 1DVFD 3VE0B 2WINB 2H0JA 1BXXA 3DWTA 3HN3A 4QF1A 5BQ7B 3RDTB 4AUUA 1DQLL 3O3AB 1M9SA 2J44A 4KKLC 4PJXB 4BH8A 1RULH 3QEHA 2WVUA 3HZYB 3U7YH 1UC6A 3QHTC 1QOKA 5C08D 1U36A 2L8AA 3MLRH 2DBJA 3F05A 3T3PB 1JGUL 2FJFB 3CSFA 5E08L 1OKEA 2F53D 1HT6A 5AB9A 2Z35A 2Q8AH 1WT5C 5D2LA 3TASA 3SD5A 1RUPL 4J3OG 3ZE1F 3WTSA 5LGYA 2NW2A 1DQQA 2KQNA 5C07B 1MPAH 3QPQC 1MDAA 2FTAA 4J7RA 4D7BA 2BWQA 2IALB 3IU4H 5A2AA 3MRLB 4HFUH 1XIWB 4HZLA 3D3VA 1DEEB 4M93C 4HKBA 4AY0A 5BW7A 2X6VA 4B0MM 4AVKA 3P3YA 5CP7A 2HMIC 1TJHL 4JFZL 4N24A 2DKMA 1Y0LB 3RGVD 4I1PA 1Q8MA 2DIJA 1XCQB 5JHDA 2DYSB 3CNKA 4UB0L 5C0RL 4G7VL 4ECNA 1NLBH 4WGVB 5ID1B 5BRPA 3MACL 5ISZE 1RL1A 5EUOB 2AHIA 2J4WL 4M1CC 3FUIA 1FC2D 1KB9K 1KJ2B 2AMGA 5EO9B 5J6SA 2XBZA 5IJKC 1R5VA 1T1WA 2L7QA 3GI8H 4PJBA 1R3IH 4LCYA 4L1HA 3C5ZD 4BQBA 4GUQA 2K8QA 5CJQH 5EC2B 2FLRT 3T8MA 2ZOUA 3N41F 4PJDF 1JXFA 5A16A 4P3WA 5DC2A 1E4KA 3ALXA 2YZ1A 3D39D 4PRHD 3MMEB 1G7QA 2ZE0A 3PFQA 2D3VA 1JZDC 5HYSA 4PWJA 3FT2A 3MA7B 2P8LA 3ML9A 5T5FH 1G7PA 5F0MB 2IPUG 6PCYA 4K8RD 2ZT9C 3T4YB 4CW1A 4P5MA 1QLRA 1A7QL 4YZWA 1C12B 2MQ0A 5DK2A 1N0LB 2CLRA 1GVIA 4YAQB 1GIGL 2K9FB 1HCYA 1IGIH 2NYZA 3FRPG 4Q4EA 3ZDYF 3OXRB 1S7QA 3VSVA 1ICTA 1O0VA 1FL5B 1L9TA 1SHWA 5FYJD 3EJQA 3WMPA 3EOAB 5EF2A 3CVBA 1XSKA 1CFSA 3D85D 5T33H 2IWGA 3QYNA 4IS6A 2C3VB 5F1IB 4GQQA 5CLTA 1DE4A 3FU8A 5C0JB 3UBXB 2YD7A 4PG9B 4R0LA 4N8VA 1PG7H 5I75C 4W4OC 4K07A 3TCLA 3O4LB 3BZ4A 1C5DB 4WI0B 2VDQL 3FAXA 2BVQB 4H88H 1CDHA 3BIKB 2P47B 3JWNG 4UQ2B 1HTYA 3DXAB 3ZE2E 4XCNA 4JQIL 1PZDA 3V10A 2X2HA 3AXLB 3ZDZB 2R0WH 3OKOB 5A2IH 5C6TL 1L0XA 2J1ZA 4G42B 4WNSA 4LEXL 2NNAA 3U0WL 2JCCA 3F7KA 2OM5A 1QFHA 4YUEL 4TUOA 2KLSA 3DO3A 3QZWA 1B90A 2YBGA 5IM7A 2GCYB 4OY9A 1X9RA 4BQ6A 5KEZA 1NAKH 2XA8L 5I5MA 2G9HB 1GHFL 2XVGA 5CJXA 4AMXA 3PWVB 4KKPA 4M93B 1CYWA 2F18A 2K9UA 3E1ZA 3JTTB 1OAKH 4Y7MA 1OP5K 1RZPA 5E7FA 4NHUA 2NUTA 2B0SH 4OF6A 3ZR5A 3KPRA 2FX9H 4FQLL 1NEZA 2EC8A 4BELD 3E6HB 2ETWA 5DHEA 1UD8A 2GJ6A 2D2CC 4FN0A 4LQFL 4B6ZA 2EAEA 3MJ6A 5A43C 3D8MA 2HAZA 4LLQB 1QRNB 3BW9A 1IX2A 3KWWB 3ZQXA 3I2CH 4HKJB 1DBML 1UD2A 4JQIA 3B9KA 4L37A 3QXUA 4AQAA 1JXKA 1G6RB 1X5YA 1JV5A 2EDKA 2DOCA 2WWKO 1N6QH 4I3GA 5IB4B 4YL4A 2EYSA 2J5LC 4IMLA 2C34A 1SOKA 1VFMA 3F85A 3UBXI 3AWGA 3FO2A 5KAQF 3SQOH 4ODTH 4H44C 5E4IA 5KYYA 3L5IA 4PVMA 4YHMH 2NOYA 5JYMA 2DWEA 4E41B 3FTZA 1CGUA 4W9IC 1NCDL 3QO1A 4AT6A 2XSKA 4PB9L 4LPTA 1JS4A 4I85A 4KOCA 2J8UE 1ZLWK 4DVBA 4QOKA 4HK0A 1U58B 4JM2D 2L7UA 4DNLA 2CJUL 3F64A 3ET9F 3U30C 2X4RB 4X9IA 1W9XA 3O2DA 1G9NH 4JMXA 4XPBH 2DH3A 2OXGB 1WSST 4KQ4L 3VFPA 5E99L 4PPTA 1YEJL 4KVNL 3TVMA 4V1DE 2F5BL 4EO5A 2Q8BL 5CILL 3VXUD 2XTJE 4XNXH 2BP8B 2ZP9A 4Y2NA 1PW3A 4HWEL 4RMSA 5I75B 5JW5B 3FN0H 1AQ8A 1EO7A 1F1GA 1BJ1J 4ZS6D 3NFPA 3WLWC 2PP9A 5IG7B 2XG5B 5KJRH 1O7SA 4QHMB 4F9PC 1RJZA 2FRGP 4JO1H 3QUXC 4TQEH 1BXUA 5F89B 3L3GA 1VADB 2CGRH 3G9VA 4ANVA 4HLZH 3NIGF 1EEYA 1RUQL 4WW2A 4FA8A 2B1HL 5IB3B 4AH2A 3V5KA 5HI3C 2WTPA 3QQ4B 3SGJC 3ZKND 2ADFL 1LQSR 1VEMA 1E90A 3Q8CA 2Y3NA 3AABA 1UCBH 1LP9E 3GO1H 4I77H 1GGYA 4K9EH 3HG1E 4PCKA 3HMXL 1MVUB 4HOZA 5L88H 3TEUA 4I5BB 1AYOA 4GXFA 4N6QA 5CGBA 3G08B 3DOSB 1JPEA 1UA6L 1RUKH 1YEFH 1ACYH 1FNEA 4Y4HD 1R1CA 1AHWC 3QQ3A 4PB0H 5DJXB 3V6OA 3RWFB 2UY7B 3QIWD 5D1QA 4LLWB 3MYJB 2J5LB 3BKJH 4Z76A 3K8MA 3Q13A 5DQ9B 1N4XL 1VACA 4P4RB 4Y7OC 2IH3B 3O81A 4QI3A 1EXUB 1JWUB 2LV4A 5DZ9A 3HZMB 4PHZA 3U2SA 2R2BB 3V4UH 4EDXA 4TPRL 3EYUH 2DYPA 2W9DL 3QJFB 4HIJB 4A67A 4LPXA 1NH6A 3MV11 2RACA 3DBSA 4GUPA 2K0RA 4K7PY 4UMGA 2P24B 2VL4A 3VFRA 1DBKH 4KY1L 4O58H 1I75A 1O7DE 2CKNA 4JRYE 5EFIA 1SY6A 1RHHA 1XF5A 3BCDA 4Z7UB 4X80L 4ZTEA 5ETUA 2ZIDA 5AAMC 4XCYA 3CXHJ 4YSOA 3VRIB 1FFQA 8FABA 3CFNA 1QR1A 3PWPE 3GK8L 4AGMA 4NQCD 3FB6A 1INQB 2ENYA 2IDTA 1CTNA 2YAMA 2EE2A 3J7HA 3WBDA 3QCTH 1SRDA 1ZS8A 5FFOA 4GBXA 2VQUA 4OGXH 1S9XB 5HVGB 4L0PB 1GCFA 1CFVH 4HKZB 4RZCB 1BXAA 3QUXB 4N9GA 1JPFB 3MAWA 1V8HA 5ICZA 2YIHA 2C3GA 5IQMA 3C75A 4HT1H 4MMXC 3KR3L 4JO2L 4F33A 5I19H 1QBLH 5AVTB 5JPMC 1EEZA 1D5XA 2L4OA 4RAUA 5IMKB 1RIHL 3H3KA 4KJWD 4BKSC 4FL4B 2VITA 4DGIH 1OAQL 2XWBA 3F58L 4NNXA 3BDBA 1FRGL 2OI9C 1NJ9A 3QUGA 1RCYA 2D0GA 5KSVB 4K7PX 2EKJA 3BFOA 3GJFH 4UIMB 5HHVH 2SEBB 1YECL 2H2SD 1K5NA 4KKBC 2DQHH 3WN5B 1B4JL 3ARBB 2ZAIA 4Z7IA 2BRRL 2A2QT 3F83A 2XACC 5DFVC 1BFVH 5K9JH 1B9KA 1UWGL 3OPZH 3TXAA 1OAZH 5EEYA 4MD0B 2XY2A 4HWNA 2VLME 1MCNA 1OO2A 3X13A 3KVPA 1AD0B 2YMXL 4Q6KA 3WTYA