3G3LA

Crystal structure of putative membrane-associated protein of unknown function (yp_211325.1) from bacteroides fragilis nctc 9343 at 2.20 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
296
structure length
291
Chain Sequence
b'PAEAKYYIAGTITDATTGQELTTAKVTLGDKSVTSSFNEQVNYKAEGYALVVSADGYYPVKRQVYLNQVSDGQTSVATVNVALVSVEAAVIPPVVPPTDPETDINEGEATKVADKAVEVAKPSESTVTDMLAGTTATPEEKKALDETLEMAGGMKVGETTPEVLADGSILAITPVKFTNPIQDAPAMVPYFYNEGCELTGDVKEVAAPVAVAADIQKAFLSNAAKALNMNAGFVQKIGYTRISVLNGYSILGYTIKGQLVSKKLTFLISGKYYEGIVSYQKSVMIYPNYYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized membrane-associated protein
publication title Crystal structure of putative membrane-associated protein of unknown function (YP_211325.1) from Bacteroides fragilis NCTC 9343 at 2.20 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Structural genomics, unknown function
total genus 71
structure length 291
sequence length 296
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 3g3lA00
1H8LA 3G3LA 4U3SB 1QMUA 3HN5A 4WI0B 5AQ0A 3E8VA 4EIUA 2B59B 1UWYA 3MN8A 5G5DB 2XHNA 3NJXA 4FL4C 4YOKA 5K39B 4FXTA 3KCPA 1NKGA 4IYKA 3NJVA 2NSMA
chains in the Genus database with same CATH superfamily
3PDGA 4ZQKB 2WXJA 3MNZB 3QRLA 3SBWC 4ONHA 3TF7C 4RA0C 4WUUD 4HLZG 1OM3L 2AEQL 1JVKA 5SX5H 3LN4A 4JHWH 4HS6B 1NKRA 5ID0B 1MPAH 4AW7A 4PG2C 2A6KA 1RJYB 2OJEB 4Y4HB 4XXCA 2R0KH 3DTXB 4JG0L 1E6JH 3EJJX 1AD0A 5LG1A 4DP6X 3IKCA 4TSBH 3QULA 3RA7L 1BGXL 4DZ8A 1IQDA 5A6MA 4CMMA 4MA7L 4BUGA 3MBWB 5JW4R 4ZUUA 4RRPG 3KYOB 4IRJC 1OK0A 4AUYA 1AS6A 1M2VB 4QWWD 4IW4C 4GMTH 3ETBF 5C08B 2JXMA 3DX0A 4A2LA 2Y25A 3UPRB 1Y0LB 5D1QA 3SB3A 1KPUB 4YXKH 1I7ZA 4GW4A 3TFKC 2X2YA 2YSSB 3SOBL 1XAKA 3BEVA 4IOIB 3F58L 3VH8B 3LH8A 4BKLA 3OTTA 1JSYA 5C3LD 4JDEB 5JOPE 1AGDA 4WO4B 2WINA 3GHBL 3HEIB 2N1TE 3GZOA 5KBNC 1TZIA 1XB8A 4H1LH 5CCHE 2NY3C 3OC5A 1M7XA 1YNTA 2R4RL 4WTQA 5HY9B 3M8OL 2N4IA 2EDRA 2CLVB 2J20A 4YLCA 3US0A 1YJDL 4Z5RA 1JGDA 2NY6D 4WSGA 2UXFA 4BZ1L 2H1XA 4JKMA 1MRCH 2JKIS 2VM9A 2E9JA 2Q8BL 3BKCH 1H3WM 1WEJH 3DO3A 3TWCH 3FUIA 4RWYH 1LWRA 3HVDA 3QPXL 4UAHA 3H7BA 3IETA 4UM8A 4JN1L 3MZTA 5B1BB 5BPPA 5D7LA 1AYRA 4KHXH 4ZFFB 4L37A 4JM2F 3BW9A 1RZGB 4M8VA 5D2NA 2VR6A 1GPOH 3K2UH 4HJIA 1UB5B 1V3JA 2EIBA 4PJ7B 4MCZB 3SQBB 1CK0H 3TESA 3EOTL 4OZFG 1A3ZA 3QC5X 3P11L 4FABH 3KLHC 4KAQL 4ZXBB 3U82B 1OOWA 1BYNA 2GVYA 4MXQD 1MIEH 1AGEA 3QUZD 1T7WA 5EUOA 4GI6A 1YEWA 2PYEB 1UM4H 5E6IB 1TQTA 1S9VA 2HJKB 1BIHA 4NZRL 1M05B 1I8MA 4H2AA 4G3YL 4RZCA 2LU7A 4N2NA 1FL6A 3HFML 2EACA 3D07A 2D9CA 4MNHB 3UPAA 4XVUC 4W9ZA 3ILDA 2EKJA 2WIMA 2FIKB 2ZUXA 4I0PA 2PF6A 4U6TA 1IVTA 1U6AL 1RZKL 4DP4X 3QUXD 2QLYA 3GZPA 2TSBA 2AAAA 5CP7A 5CP3A 2KBGA 4ZSOA 2XPZA 1H0DB 1V05A 2OSWA 5DRXA 5SX4H 2H0PA 4XX5A 4LHJB 1QHQA 5DMKA 3RZCD 2NXZB 4F2FA 3RGVA 4M48H 1X5YA 3IDMB 2QGBA 3APMA 4QRPA 4WV1B 1MCDA 3LEXA 5DRZB 2HLAA 1SDAB 4YHNB 3H9SB 1X3DA 5E7FA 3QDJB 1RMFL 1TTAA 3IMWA 4JPVL 5AOKA 5LN4A 5KSAC 3QO1A 4N8PA 4HUUB 3QJHB 4PEEA 2ICEA 3DSFH 3FB8B 4JPSA 2YBRB 3TV3H 5F7BA 3G04A 4AL8C 3OHXB 5ACLA 4YHYB 3ULVC 4WFFD 2OZ4A 5IROC 4HDIA 5F9JB 3EJCA 3JQOB 3UG5A 1NLDH 4LLMA 4D7PA 2FDBP 3ZTEA 3HS0B 3KPQB 4PTTA 4B0MB 2D2OA 2ZKWA 4X0KA 4JY6A 1OP5H 1T3FB 4N6RA 5KANI 4MDIA 1DBAH 4IRZH 3VXMB 4RX4A 2F74B 5I26A 3KVQA 4QHMB 4ZMLA 3KPMA 2ENQA 2VR5A 1AANA 4O58L 4O9HL 3GM0A 4JE0A 5CLXA 1OV8A 1U8CB 2B15A 5TGBB 1NGQH 4IU2B 3L2LA 3KXFB 5D55A 5IJCC 4GS7C 1VACB 1L0PA 2VB5A 3L9RA 3QDMA 3VYOA 4LEOB 4MAYB 2JKLA 5D8JH 2FE0A 4RIRA 4UTCA 3IDGB 5FYJH 1B4TA 4AEFA 1TYRA 5F9DC 5EFIA 5J9PA 2FSDA 2X4NA 2GFBB 1BBDL 4IDJL 1UD5A 4F8NA 2VXVL 5ICZA 3GHEH 1AKJA 4EOWL 2B0SH 2RALA 4DGVH 3STZB 2B59B 2X89D 2NR6A 3FW6A 4N85A 3N6YA 4HZAA 1A2YB 4GP8B 1M6UA 4ZS6D 3L48A 3WMQA 4PJBB 4F2MA 4PJIF 1UHVA 1ZHBB 2VERN 4NFDA 3TH4T 5LAXB 3F84A 1C16B 4HCRL 5TPWL 2Z31D 5H37A 1TXKA 2BW5A 5IMLB 4FKKA 4KJWC 4DFHA 3BP6A 2HXAA 4MAZA 1A3LL 5I30H 4CDGC 4E68A 5H35A 4M8RA 2OSLB 5IW6A 1NL0H 4BQBA 2H4EA 5CEZH 4TSAL 1UOWA 2CJUL 4QOKA 4NFBA 1MLBA 3Q44A 3LPWA 2BFVH 1IAKB 4FQIH 5FYLH 5TK4A 4TULH 4LO9A 1S6NA 4BXSV 4OCWH 1U8PB 3QUMA 1M57B 3BMVA 1X7QA 5DO8A 2AQSA 4HLJA 3K72A 2O6PA 4S1SH 2IBZY 4YAQA 3O3EA 2O72A 2WQUA 4XVJL 4BHUA 1QW9A 1JWMB 1H3VA 1AZVA 3VJ6B 4WUUB 5ALBL 5HI4C 3RWIA 3VI4F 1TJXA 5G4MA 1AGFB 5JDJA 2CDGA 2CLZB 2VJXA 1Y1DA 4JFYA 3FDWA 5JHDA 2H3XC 3MODH 3BVNB 2DICA 4NN6C 4ZO9A 3CFCH 4NWTH 4QTFA 2AEPH 3AZUA 3QNXB 3LXUX 2O26U 1N2RB 4FHKA 4S1DC 5F72S 5LBSA 3Q6GL 4ENED 2BHUA 1N3NB 5FK9A 2UXGA 4JCMA 4TQ8A 3MRKA 3VXRD 4NZUL 4FXKA 1WP6A 1SQ2N 4JMXA 3QJXA 1MI5A 3FTYA 4J3OF 4P46C 4G8EA 1PX8A 2TRHA 1BVNP 3HUJF 2ICES 3FL7A 3O2DL 3CN3A 5A2JH 3S35L 1S7VB 3VFPA 3ARPA 4PJ5E 1P1VA 5GRZA 3STLA 5BOJA 4Y0GA 5GGVY 2SODB 3U9PL 3QEGL 2VXTH 4MB1A 4K3DH 5MEPA 2XIDA 1S7XB 3LV3B 3G6JE 3LOWA 2Z92B 3MRLB 5JXAL 5AVVB 3OR7B 3E3QE 2ZX9A 3KNBB 4GIAA 4H40A 4W1TA 3GBEA 5AALA 4EBQL 4F58L 4LBEA 2YQGA 3LZLA 5KANG 2BVOA 3G9VA 4OD2A 1A14L 1FV1A 4WY7L 3GXFA 4RSYA 1HDMA 2ZIDA 3FT2A 3GRWA 5IJVA 2NY6B 3QZBA 2K7QA 4J3WA 2Y36H 4KMTL 5E94A 3G6DH 4UQCA 1EZVY 1WDAA 2BNQA 3GT6A 5MI0B 1NGWA 5GGSA 3VDCA 3S97C 3HIZA 4LVOB 3WIIH 3SPVA 1RHHA 4ZDHB 2EXTA 3S4SA 5DTFB 4HKJA 4U3HA 2CNZA 2BY2A 1A9BB 1PX4A 5DC4B 1BVOA 2Y5EA 3MOAL 4P4RA 3ZDXE 5IB3B 1JYXA 1MW0A 2R29H 3WUZA 4JO5A 4ZOCA 3QXUA 1Q72L 1N8OE 2E8YA 4CNIB 5BXFA 1TQCC 3HZYA 5DZPA 5C3IA 1UD8A 4UDTB 2H1LM 4NO0A 2FQGA 4GQPH 4XHJD 1JZ3A 4N20A 3VI3F 3IDXL 1JZ8A 4JDVA 4JRXD 1QI3A 4PMEA 1HZHH 1E6OL 3L5XH 3WKQA 2E27L 5FM4A 4M3JA 4M5ZL 2CBMA 3QUZB 4FI7A 1KIPB 2ITDB 3CHOA 3PIQA 4H8PA 4PRDB 3L3HA 1WD9A 3ZYOA 1HFUA 3WKNA 4RMTA 3E6FA 4KKBC 3BWZA 3OAZH 1A7RL 1JCKA 5IVNA 1DN2A 5DHVH 2YQBA 1ZA6A 5EIIG 4FC3E 5BVJB 2BNUB 2OSXA 1EXUB 1FBIL 3PUUA 3WDJA 1D2PA 3WNNA 1QR1A 1RK1B 1CIDA 4MBOA 3QUXB 4P9MH 4PGCB 5FECA 4F7MB 1T6BX 1G6RH 3TCLA 3VG0L 3I02B 1L6ZA 4DKEH 3KDPB 1KLFA 1E7UA 3HHSA 1CXKA 4KXDA 4I2XE 3RZCB 2AXGB 1TSHA 2DQGL 3QAZB 1T4KB 2ADJA 2J56A 3MDJA 1UURA 4FQQA 4BDVA 1SFHA 3ZZQA 5KSBB 1AHWB 4X6FB 5E08L 4YSUA 2KLTA 2YD0A 3CLEL 3QCTH 5C0CD 2D0GA 1EEQA 1I7RB 4P06A 3RY6C 3BKJL 1M7UA 2Z7UA 1CXEA 3E6HA 1NFDE 1AJ7L 4O51A 4R97B 1U58A 2CU9A 1MG3C 1XT5A 4OIIH 4OLVL 5GRWA 3HNSL 4YN3A 5E1HB 4ZXBC 4XC3H 4MJ5A 5I1KH 3W39A 5EZPA 5EEXA 1LO5A 3I9GL 4BFKA 4X5XB 4A2DA 1YPZF 1DL7L 1GZHA 1CL7H 3QHTC 2OW7A 4NQDA 4P49A 4PBXA 4TNVF 3CVHH 5CUSL 2MTAA 2BP0B 5HHQB 1Q9WA 3TPUB 4PD4K 4MS6A 5IB4B 4ALAL 4AOFA 4LSSH 5FYKL 4K8RH 1TTUA 5I2IA 4GKNB 4JLRB 2RA1A 3ZL4L 2FYVA 2Q7YA 3FB5B 4Y1SA 5FV1L 1A3RL 2IPUG 3KVPA 5CD5C 3RWGB 1CYXA 5E2VL 1KIUA 1I7UA 1B4JH 2EXYC 4AEHL 3KBPA 2VZ3A 3LVTA 4XN2A 3ARBD 4F8QA 1LVEA 1A4KA 3OLGA 4LLUB 1B6UA 1O9ZA 2WTRB 3OG4B 1AIFB 3V4PA 1FAIH 1JPSH 3G3LA 4UOZA 3BC9A 1KB9K 3LVEA 2LW3A 3MGOB 2WB7A 1A0QH 2QGDA 3S2AA 5JNYB 2UZYB 4JHWL 3X17A 1WUNT 3PXLA 2BW4A 4WEMB 1MPAL 3JBG7 3RG1C 3WHE0 1H9DA 4PJEE 2F1EA 2BOBB 2WYZA 1P5UC 4YXLH 2R0KL 1ZSHA 3OHXC 2VN3A 3HNTH 4OIAA 1G7PA 1MY5A 5BRZA 3B6SB 2B7DT 1JNHB 2Z31B 4TNVK 5J1AB 3O0RL 4R7NB 5J5EA 4HOXA 5HVHB 4OFQA 4U1SA 5IVZB 3RI5K 5J6GB 5E24E 4GMTL 3F12A 1X5FA 4NQCD 2I9LA 4X9BA 1G7HB 3FQ4A 2CIKB 1A1MA 2H45A 5EWIH 2CR3A 1BA9A 1PZCA 4YK4B 2G3MA 3MRHB 5ISZD 4EIZC 3QDAA 3KBHE 3N41F 1HYSD 4UQ2B 3PQYD 4X4ME 4ANKA 2SEBB 2VH5L 2ZWYA 5ESQA 1AKPA 4FNPA 3G08B 2O30A 5TD4A 3QYCA 2XZZA 1R9FA 1PDKB 2X9WA 3LY6A 3Q2WA 1VSCA 5FA3B 2EH8H 4K7FA 5KVGE 3W9DA 1PTZA 1ZHNB 1XF3A 4CADA 3CFDB 2B4CL 3D08A 2QFRA 1M3IA 2CO2A 4GUQA 4Q89A 3UZQB 3NACH 1MDTA 3BAEH 4Q9QH 3SCMC 4KGLA 3D7PA 3PAUA 4CUCA 2VITA 3HMWH 4Y1AD 3L3GA 3O2WH 5FUZH 2ZTBA 5DEJA 2J8HA 1HXYA 3IFOA 2DM4A 2ZNWA 5L2JA 2P28B 1KNOA 2VMFA 3ZE1B 3QQ3A 3EYFB 5C0BA 3U7YH 4HH9B 4HXAL 3SGJA 4ATTA 1WEJL 4RWYL 3VXRB 3LD8B 2OXHA 3QNYB 4GMSH 4OZIF 4P5MB 1X5JA 4L23A 4CA4A 5EO9A 4QRFA 5HVWA 3IBEA 3MRCA 2ADFH 2VO5A 4KHXL 3RAJH 3T4AC 4IIQC 2AS5M 1NLBH 4C8XA 2ZYRA 4KQ3L 4NUQA 4PYHA 1W8OA 1I9RH 1GPOL 2XXGA 3K2UL 3CDCA 1W9XA 1UD2A 2XX0A 1AVAA 5IJKA 1NCBL 2YA0A 4KXZH 4PH8A 5C07A 1CK0L 1BXVA 1UXWA 1FNGA 2KPNA 2LLLA 5C0IB 2XLLA 1QASA 5JORA 5JPNC 2X1OA 3NMEA 2V2WA 4WFEE 4FABL 1DVZA 2EDJA 4CU8A 4YDZA 1DSYA 4M7JH 1MIEL 4HIHB 3QFJE 4WW2B 1UM4L 1E5ZA 4MJID 1ZGLA 1TVHB 4G6MH 3H3PH 5I8OH 2I32A 5DD6A 1F11B 1CVRA 2FR4B 4V1DD 5CR8A 2AQRA 1EUUA 5C8JB 1ZS2A 1D9KD 4ZW5A 3IDUA 1DLHA 4O2EB 1OGTA 3B9DA 1PYWA 7TAAA 5ESAA 4HWNA 3KYMA 3A67H 3KPPB 3SO3C 1KBGH 2WLLB 1QVOB 2HAZA 4J3SA 1MZYA 4XGZA 4DUVA 3KPOB 3GTTA 2FO4B 4O2CA 4P57B 3DUSB 3NFPA 2YAFA 1E50A 1R4XA 1E40A 1KPVB 3N3EA 2BSCA 2OK0L 1MXGA 3ASWA 5KS9F 1O7DC 4JRXB 3WTYA 1SYSA 1BAWA 2NQ3A 2FJGB 4Y4FC 3DO7A 3C60D 4QO1A 4XPFH 1P84K 3TV3L 3NDZE 3HZMA 4MWFA 1CTNA 4I4WA 2A83A 5LCVL 1LO4H 3VVVA 5D5MF 5BRPA 2WUCL 1TZHB 3TBYB 5BV7H 1HKFA 2I07A 3MLPA 1UWXH 3MJ6A 1PZ3A 4NZJA 5H2BA 2X1PA 4G1EA 1T0NB 2Y6TE 3MLXH 1DBAL 5BJTA 5DD0H 2CMRH 4AQ1A 4GI9A 3SJVE 3ULUH 1GGCH 1XGTA 3GEFA 5ALCL 3UL4A 3B2DC 3GIVB 5I15L 4CSZA 5IESH 2WLJA 1JV2A 1ZVSB 2X4OB 2ZNXA 1QTYT 2Y23A 2YPKB 3DVNA 1NGQL 3MV9D 3PG2A 5IOPA 1J9RA 5CSZA 4TOYH 4Q9CA 5MI0C 3R1GH 3RKPA 1S7TB 3FT1A 3INOA 1J8HA 2V2TA 1ZOXA 1PAZA 3K6NA 5FCSH 2CHZA 5KSUA 3L13A 4PCTA 3P77B 5I0WA 1TKWA 2EE9A 3L9YA 4TNEA 3UZEA 5E8DL 4PB0H 3HE7C 5C0CB 5MP6H 3B2UC 4X80L 1TF4A 4ZUVB 1ZWIB 2QHLA 4IGBD 3U1QA 2YFNA 2ZXQA 1BD2E 4F24A 3EFOA 3GHEL 4G8GD 5D4QA 3NJFA 1YN7B 3SKOB 5TDNA 2IALB 2VW4A 4K3JH 5IREA 5I73B 4JKPH 4RAHA 4IEFB 2H5UA 3CQPA 4GG6F 1T4WA 4OF0A 1DQQA 1T5WB 2YHGA 1UVQA 4L3CB 1MCNA 3T3MF 3TP4A 3NVQA 1XR9B 4G7YH 1G7IA 4ZFGH 4HMCA 2GTWB 5HGDA 2BIIA 2JCCB 1UADC 2BNRE 3U4BH 1LE5A 2VABB 2UUDK 2F8OA 4XPAL 1FFNA 1LLAA 4FQIL 1ZPLA 1FLRH 2IF7A 4ZAKC 1AZZC 5JHAA 2DJUA 5B38B 3NCXA 3ARBB 4XNUH 4LP8A 4Q0XH 1DBBH 1KLUB 4LCYA 4S1SL 1I8LA 1ITBB 2ADIB 3G5YA 2B4CC 4L18A 4X9FA 2XQBH 2BVEA 2XWZA 5JW4Q 4RA3A 4FNLH 5GRVL 1CD9B 2F7QA 4AYFB 4APQD 2VQ1A 3QIWC 3MODL 2D7MA 3PDOA 4HALA 5DWUH 2VZSA 2OL3H 1BFVH 4BGDA 2AEPL 1BZOA 5EBWA 1G9HA 2IBBA 5AENA 3S5LG 2NX5D 3ZUNC 1KT2B 2BSRB 3L95A 4DUWA 4QYOB 2K9FB 5JQ6L 2E9WA 5FC9A 3WS6C 1MFEH 4ZZKA 1M3JA 2IQAB 2A74A 3VM5A 4G71B 1SN2A 5GZND 3ARUA 1KXVC 1SJVA 3C9NB 4LIQE 4IS6A 4TUOB 4N0YL 4P2QE 1HXKA 3GSVA 4NUJA 2VLKA 1FNEA 3KLDA 4NNPH 4OUUB 4I9WD 4W9DC 1AQKH 5ISZB 2BMKB 3PFUA 1HHIB 1JS4A 4AZ8B 2F7PA 1DQIA 3VMOA 3PQYB 3X11A 2HRLA 1EO5A 4WW1B 5C9JB 5K9KA 1PGRB 2VXTL 3OM3B 5IW3A 3ULVF 5EBMB 1EA9C 2IADA 4CC0A 4WWKD 2GAZB 3UADA 3FFCA 4HUVB 4UINH 1ZRUA 2LFGA 2XNAB 4X6DA 3PGDB 4NCC1 3OKDB 2OR8A 3UTZA 4H0HB 1RZPA 4LLDA 1A1OA 1WS8A 4Y1AB 1BLNB 4L4TD 4TVPL 1NBVH 3D39E 1F1AA 3NYKA 5DYFA 2Y36L 1PPIA 4N3UA 4RLDA 2J2ZA 3FXIC 2RCSL 3G6DL 2FIRT 3IJYA 1TVBB 4M7KL 3TU6A 1JPFB 4L1LA 4MKTA 4U1MA 4G6AD 1MVYA 3B83A 4FFYA 1WA0X 1YQVH 4KK8D 4PJ9D 1JGLH 1FO0A 1L9SA 4H8WL 1BXAA 4X6BB 2R29L 2EH7H 2PP9A 3N43B 2CXKA 1YUHB 2VKXA 3V5KB 5KBKA 3D51A 1E2WA 2OLDA 3BQUA 4MDJA 5K33A 4PCKA 2FLBT 3VD1A 4YK4C 5DDHA 3SDXB 1HZHL 3L5XL 3KE0A 3VSQA 5IY5B 2HKHH 3HBZA 3P9LB 3MRMB 2JJTA 2YPVH 32C2B 3L4WA 4LMQI 3UYRH 3VRLF 3EGDB 1HU8A 1I9IH 4MJIB 2VT0A 3T09A 5JHLL 5FM8A 1RIVH 2FO1A 1SDDB 3PNRB 2ZUVA 3ECBB 2R83A 4HZLB 4PRPE 4M7LH 4ZPTA 4V1DB 2BSED 4HWZB 4FFWD 2JB5H 1W15A 4CJ0A 4M1DH 4NO2B 1D9KB 4I18A 2NY7H 5I8CA 2PKDA 1CD8A 1FVDA 3O41A 4P9ML 3FTZA 4XBEL 5CXPA 1SFDA 5J0BA 2MQ3A 4MD5A 3CZUB 4AMKH 4DKEL 5KBLA 1WWCA 5I75C 3FK3A 4OM1H 1QFUH 2IGLA 1LP9E 3OKEA 3LD8C 5GRUL 1NBYB 1UEMA 4JRLA 4YR6B 1WAPA 4ISVB 2GC4C 3DXAE 1FL5B 2P24B 1T7VA 1XL4A 4MRCA 1U91B 1VFOA 3KLLA 3WMPA 3NUKA 3BZEB 4D94A 3HPLA 3C5ZA 3C60B 4H20L 3QORD 2KKQA 3BAKA 2WNXA 3VD5A 2H9GA 3MLSL 4OIIL 3QIUA 4WUKH 1KUMA 1QACA 4ZMOA 3ABZA 2F08A 3G5ZA 4XZ4A 3RWEA 4LSTH 2OULB 1OT4A 3ATFA 5I1KL 3JWDC 5GZOA 2OMXB 2P5PA 3MX0B 3B9KD 3QH3B 4WW2C 1FJ1B 2NY5L 4U4IA 1ID5I 1Y18B 1CL7L 5DJCB 3MTXA 1H6FA 3CVHL 3UP6A 1IB5A 5DUPH 3LEVH 1U8NB 3NIGE 3RE0A 4Y2OB 4K8RL 1J10A 1W6WA 3MV9B 1PZ2A 1HE7A 2PR4H 3VFMA 1QAWA 3WU1A 1H6UA 1RUQL 1E8XA 4D0BB 2R0LH 2IQ9L 4XH2A 1RUPH 2G9HA 3BH8A 3UTSE 1UCBH 2J5WA 4MNGB 1IGCL 1Q9OB 3FU7B 5EOCH 1KN2L 4X8JB 2E76C 3HC3H 2XG5A 1YNLH 3NJJA 4P3CL 5CLTA 4JFDE 3ES6A 1FAIL 1FVCA 1JPSL 4TL5A 4G5AA 3LS4H 4JW3A 4IGBB 4D8PA 2ZQKA 1GGBH 4EUPB 4PLKD 4G8GB 1CB4A 5C09A 4KRPC 1INDL 1T89C 3NRPA 4U1LA 4BCZA 2DM7A 2XTSA 3BIKA 3ORJA 2CQVA 4LPCA 4S2SB 1IGYB 4N68A 1X5KA 4JQVA 4NAJA 5HJGA 1EZLA 1CLZH 4NBXB 2JFCA 4YXLL 4JNXA 1UFUA 4KQ4H 1DQDH 1GTFA 2AV7B 1GRWA 3UTTD 4FYQA 2UY7A 5CGMA 1E30A 2Z4QB 3C09B 4PRHD 4NKIH 1V10A 1R75A 3GMQB 4GFXA 5IFHH 4YDVA 4G5ZH 2ZXAA 4L9DA 4DGYL 2GK0A 5HJBA 4AYEC 2VLJB 2DIJA 5EWIL 4FG4A 4OZHE 4BCXA 3UAJC 3D09A 3TJEH 2IFFL 3IE4A 2DQHH 4KZ0A 1P4IH 4NENB 3ARGD 4Y88A 1ADQH 1OGAA 1KV3A 3KYKH 2BM3A 3BAJA 4PS3A 5LKNA 3PWLB 3CVBA 1NGYB 4RFEA 2E4TA 3DIDA 1TYJA 4HG4K 2EH8L 5FEBA 3BZ4A 2PTTB 5JYMA 4HWBH 4RQQB 1PFCA 4APQB 1EBPA 1PNCA 2VUYA 5ES4B 3GFUA 1U2YA 3E8VA 1AGCB 4HEMA 4UQ3A 2C1PB 5MERB 3MLZH 4TRPL 2GTZB 3NCWA 4TUUA 3QC6X 2WLIB 2XZAH 4G9FD 4HAGA 2NX5B 3P4MB 4POUB 5FUZL 4WI4A 4NSKB 1KDJA 2R7EB 1U21A 3EOAA 4ORZC 4WJ5B 1QPKA 1RULH 2VN5A 5DQ9B 1KBPA 5I8KH 1THCA 4UQ9A 3FN0H 4IJTA 4GMSL 4NAQA 3OLEA 5K59F 2FT6A 2VW7A 4H8WC 5SWSA 1DE4A 1JPST 4KBPA 1QYGH 2ADFL 1BQRA 2D9QB 3MGTA 2CSPA 1NLBL 3BEWB 1OHZA 3GSQB 3VFRA 3ESPA 4M03A 4R4FH 3EBHA 1BZ7B 1I9RL 3IJEA 3US9A 3X1GA 4G6JL 3M1BA 4NT6A 1JNNH 3QUKA 3FT3A 5D7EA 1S7UA 3GXUB 4RGOH 2OYMA 1KCBA 1FI8C 3H2PA 3NPZB 4WWKB 3ARBC 1ET5A 1CE1L 2IV8A 4M7JL 2K7PA 3ZO9A 2AJVL 3B7UX 1G9NC 2OR9H 3RDTC 5EC1B 4BEIA 1KTDA 3KWWB 5E8EA 3H3PL 5I8OL 3SE9L 3S3DB 2EYSA 1T04A 4L4TB 5EO1A 4NKMB 4WGKA 5JW4N 5MHSE 5H4YA 4YGVB 5IEHB 4DWHA 4ZMYA 3L3KB 4MJ6A 3BH4A 1KTLA 1THAA 1MJUH 2AGJH 3M86A 3M88A 3FBKA 5CZVH 5IHLB 5TDOA 3CVCA 3Q8AA 1BZ9A 2FJFB 5C0RH 1BSIA 3A67L 1SLXA 2XVLA 3WFHB 4PJ9B 4P4KA 1OAXL 3SKMA 5E00B 1WWAX 1HE8A 1JL8A 1OEZW 1UT1A 1S8DB 4A67A 5IOKA 2J1YA 1YMHB 4BFGA 3EYOA 4YSAA 2BP5M 4K9EL 4DVBB 2V9TA 5L9DH 4MB4A 1LWJA 4PLJC 1C1EH 4HS3A 1BQHA 1J05B 4YMPA 1RXLA 2AJSH 2RH0A 3R4RA 4WI9A 1F45A 5HGHA 3WE6A 1EV2E 5KOVC 5G55A 1VPOH 4U6HB 2UZIL 3DVFA 3TNMB 1EFQA 1EAPA 4XPFL 2K70A 1HQ4A 3IFLH 4I3GA 4KX9A 2GEEA 1S5HA 3IS0X 3Q5YA 1PJWA 1HIML 1TLMA 1CLVA 1FFOB 2ED6A 2IBGA 2XV0A 4BH7B 4XCCH 1QA9B 4JRYD 4PGDA 5BV7L 3V6OA 1FYTA 2LV4A 4CSSA 4UQAA 2XFXB 5E9DA 1XGQB 4FHBD 4KTDL 4OGYH 3QI9C 1FNLA 1C7TA 4NPYA 1WA1X 3MLXL 3OKLB 5DURD 4AX3A 3DETC 5DD0L 3ILPA 3ZE2F 1ET7A 2CMRL 4F5CA 3NCFB 4HGWB 4HETA 4V33A 2WJ5A 3VX1A 3V55A 2DQFA 1IAIM 4IHBA 5C7ZA 3B34A 3BVDB 4TOYL 2HRGA 1AI1H 3EXLA 3R1GL 1V27A 3EFFB 3I85A 4HXBL 4DN4H 3D6GA 1G94A 5FO9B 6FABL 1UT2A 1MLCB 4JGNA 5D6CA 3TN0D 1DJSA 3F6IA 1OSYA 5D7LD 1IMHC 4FQPA 4IOSA 3TBCA 2DQDH 4JFFE 3QHFL 2ZONA 3CBRA 1GS8A 4JJ5B 4OJFH 4MQXC 4GSRA 5E4IA 4DCQB 3QORB 3IJ8A 3WV0A 4HMEA 4JZNB 4F9PA 5AW0B 2FEJA 3G5XB 4QIRA 2XKNA 4JO3L 3ROOB 3LKNB 4K3HA 1EHLH 2Q6WA 1DQJA 1QBAA 3MJWA 4K3JL 3UIZA 4L8BA 3KPRE 4JKPL 3B9KB 2CHNA 3L3JA 2AJZB 3LN5B 4Z7UF 3UG4A 4PJAF 2OA9A 3SGEH 3FO0H 3WAJA 3CHXA 1SM3H 2N59A 1RPUA 4G7YL 4NO3B 5F71A 3AXLB 2B9AA 2DWSA 3OLDA 4ZFGL 3TOPA 1MFBL 2X4UB 3VXQA 5BQ7B 1D5XA 3U4BL 3IXAA 4PS4H 1PG7L 3P9MB 5ICYA 1QWUA 3BUTA 3BRFA 1CF1A 4JDZB 1XCQA 4FQHA 3BIAX 3NABH 1FLRL 2DQUH 3VFVA 5DMGD 3D05A 1HOCA 1IEAB 1RUAL 4XNUL 4Q0XL 2YOAA 2OP4H 3BAWA 4WDIB 4X99B 1I9EA 4P05A 2GJ6A 4B5ZA 3PPSA 2XQBL 3MXVH 4GEJA 5AD0B 3RILA 3QIBA 1T80A 4X4YB 1X4XA 3V8CA 1R3LB 1IBYA 4KK5D 3C60C 2IPUK 5DWUL 1K72A 5FYJE 1BFVL 1OPOA 1N59A 3D85A 3VM7A 5EEUA 3QEHA 4WU7A 3T0WA 4JZJB 3RKDD 1YYLH 1FZOB 3UGEA 5IFJB 3A47A 3D2UA 3MJ9H 4JFHE 1VADB 2FX9H 2QT6A 3FOLB 3HC4L 3QS2A 3UTTB 4NFCA 2FECI 3AQZA 5D96B 1MFEL 2HG0A 5I1DB 3B5TA 4U1IB 3WJLC 4NEHB 2XPGB 3DIFB 2C34A 1S7QB 2IC2A 1OW0A 4HU8A 1B3IA 1I1FA 1HINL 3K6IA 4RRPM 4XWGH 1AAJA 4HC1H 1KEGL 2X4QB 4RX4D 2EVGA 4MCYB 4H88L 4NNPL 5IQ7L 3MVSA 5FFLA 3P69A 5BOPA 3SZ6A 2ZWKA 3DSNB 2R23B 2V6HA 1VRSA 1VJSA 1VFAA 5FDYA 2VGLM 5KG9A 1QQDA 3ARGB 2EO9A 3HJ0A 4NJ9H 4OFYA 1EGJA 1GIGH 3HI6H 3HUJE 1ZJBA 4ZOBA 1A6UH 4JFXA 4YHLL 4Y7MA 5F2FA 2HP4A 3SPJA 1KB5H 4UINL 2ROXA 5CEZE 3GSWA 1A65A 4JJHA 4X6CF 5FX3A 3CAFA 3F7YA 1JPGB 5FYLE 3U48A 1DVQA 3AABA 2CJSA 4QLRA 5D2LB 4D9QE 5INCA 4G9FB 1N8ZA 5I8EB 4BA0A 1NBVL 1TJIH 4IBLT 3NJLA 4RFOH 3FNKA 2VSMB 5DQJA 3LQZB 3CZFB 1NWOA 1S9YB 2AC0A 4ZX4A 1NCAH 3FU8A 1TFPA 5DU7A 3CV5A 3GSOA 1SDYA 1ZE3C 2OXGA 3MA9H 4P59H 1I1CA 5HHPB 5KVFH 2E47A 4X0NA 4OVVA 2Y2TA 5CJOL 3L7EB 4K9EC 4LCWE 5AG9A 1PS3A 2OJ1A 2C7UB 5IT2H 1S7WB 3WS3A 3VFTA 1A8ZA 2YKLL 2F1AA 5LHDA 4KDWA 2V17L 3FF7A 1KJ2B 1ZLVH 3V9FA 1DSFH 1XSIA 4U7MA 3RYMA 3O3BA 3BPLB 2DD8H 5CMAA 1I1AC 3ABGA 2VQ4A 3KW8A 5DHMC 5EBGA 4URKA 3UYRL 3WO3B 1F6AB 2QPSA 3PABA 4L4VE 1I9IL 4ETQA 1GGYA 5CNHA 4YDKL 1UTDA 1WK0A 3W56A 15C8L 4UM9D 5ANMA 4G1MB 3DV4B 1J88A 1JI2A 4J27A 5AB9A 2QKIA 4RCAA 1IBDA 4LGRB 4D0DA 5I6XC 1UZ8A 3LN4B 3P0VH 1BAFH 3CXHK 4M7LL 4MA3A 4CC4A 3Q6FB 4M1DL 2NY7L 2WNKA 2A1WH 4ZT1A 5E9AA 4EPSA 2F8XC 2FWSA 3LZRA 4HBQA 4YDNA 1KCLA 2HN7A 4NUGH 3TPKA 2BWQA 3QULB 2QDVA 1IQDB 1QFUL 2A4EA 2VM4A 5IQLA 2J21A 4LT7A 1WBYA 4G8FA 1AG0A 1FZKA 4PN6A 5FUCE 5GZNC 3EJZC 4Y8AA 2DI8A 1G87A 4X9GA 4QCIA 2EC9U 3T4YB 5JO5A 2PN5A 2DEYX 1N0LA 3VGGA 4L0YA 2A0LD 2FCBA 4ZMNA 4N0RA 1I7ZB 2IWEA 4GW4B 2HJLB 5T33H 3PWUA 5TQ2H 2J57A 4HKZB 3T2LA 5DUBA 2XHNA 2ZCLH 5IEKA 4FOMA 2R0WL 3H9ZA 4WWKC 5I28A 5DRNA 4JRYB 4XO9A 1ZSDB 4LSTL 4PV8A 3CHRA 1TZIB 2X41A 5F0MB 1MH5A 1FPTH 2ZYHA 1QSFA 2J5LB 4JO4L 5DURB 3EG9A 5CLZA 3P30H 3LZNA 3V6BR 3MRBB 4XHQA 3B3IA 1S7SA 2Q3ZA 2OMYA 3BLKA 4GOSA 4AT6A 1JGDB 4XVTH 5FGCB 1OTTD 4UU9B 3S3JA 5ABDE 3A22A 3LYRA 1J1XH 5EU5A 4Y4KC 2EILB 3ME0A 5F7FA 1YPZE 3JV4B 4MXVE 1JD7A 1YLBB 1RUPL 1MHHA 4B9IA 4Y2NA 5EU6E 2E9IA 1HK6A 4GAAA 3TN0B 4UM8B 2UZPA 5D7LB 4L37B 4YVNA 1CDUA 3BW9B 2ITCA 3PDDA 1G6VK 3FQYA 3OV6A 5D2NB 4UZSA 4M7LT 4DERA 3C5XA 4M5YL 4AVKA 3NBNA 3LS4L 3T71A 3CBJB 3K1KC 3HC2A 5T1KD 4D0CA 4LCIH 4ECNA 2X42A 2MH4A 1GGBL 2H8PA 3ALXA 4YSRA 2AF2A 3OZLA 3HRZA 4PHXA 4DF9A 1A6ZA 4Z7QB 2F19L 4MTMA 1NCCH 4DP1X 5I23A 2JK5A 3V4VA 4TPRH 4TTDC 2W92A 4Q9BA 1B0WA 3OB0H 4MZ2A 3M1CA 5TH2B 4S1QL 4DN3H 1P69B 1BPLB 1S9VB 4KQ4L 4UMSA 1NPNA 2G5BA 3ZTJH 4IJ3B 3HHMA 4DQAA 2IH9A 1FL6B 1JV5B 2E0PA 3EH5B 3US1A 3EYVA 1SJHB 3RTQC 3CSYA 4FMVA 4NKIL 2VDOB 1AXSA 5TJWK 5IFHL 4G5ZL 4JUTA 3VRJA 2D4FA 1KIQB 3EDJA 4UNTA 2BVPB 4XNMB 4MVBD 4BELD 1U8OA 2Y7QA 2WGXA 4A04A 1C8PA 3EUDA 4PGEA 2O5XL 4ICWA 5DRXB 3K3QA 1RK0A 4FULA 4PJ5A 5I1AA 3WENA 4EN3C 2DQHL 1Z2KA 1P4IL 4TL4A 2KMWA 4WHYG 1ONQA 3EO1B 1ADQL 4GRLC 3KYKL 1OTSD 1S78D 2BRQA 4PRNA 1F6FB 1JRHI 3BVXA 3G6JA 2VIRB 4ODTH 3CH1A 2FB4L 4HJ0D 1IILE 3LEXB 4QYAA 2Z6FA 1EEYA 3WEXB 4HWBL 2A9BA 1JF1A 2COQA 4X2UA 3P0GB 2MTPA 5AW4B 2PCFB 4U6XB 3QORC 4G42A 3MLZL 3MREB 3TURA 4NIYE 5CINH 2R1YB 2WXIA 1PD6A 4MQTB 2XZAL 3BIBX 2HJFA 4UNVA 2I60H 2BPBA 2X44D 2ZX5A 4KX7A 2H2PC 3FSZA 2VLME 3QEQD 4NKDA 4QRTB 5I8KL 2Z65C 5K39A 1MCIA 1VB9A 2AJUH 3FN0L 7FABH 4JY6B 5EIQA 1AC6A 2WBXA 1A9EA 5CU5A 2N0MA 1QYGL 1ZXQA 2ZWZA 1AQHA 3UABA 3FU6A 1LEGA 5I1GH 3P2BA 1TETL 3DURA 3NIDB 3BGFC 3C6LA 1REIA 3O3DB 4R4FL 4YZFF 4ELDA 1ZMYA 1U8JA 1IC5H 4OZGB 3ZL1A 4MX7B 1MCOL 1JNNL 3VYPA 5F7UA 2KLSA 2DN7A 3FC8A 3NH7H 4R7DA 4FQXC 3GMPB 5E1AA 3O11A 4WF7A 1LO2L 4RGOL 1GMIA 2BXZA 2Z8RA 3ZKMD 5KVEH 4BZ2A 5HI5C 1Y07A 4GY4A 4X7EC 2CRIA 4DKDC 4E36A 3QG6B 3P4OA 4MMZC 2R51A 5EFIB 1OCRB 4KNUA 4WI3A 3RBSA 1N64H 1U36A 2WO3B 1RFDL 4PLKC 1IGML 5J11B 1QWNA 2CR0A 4NQVB 2Y07L 2Z8VC 4NJAH 2ZXCA 5AZ2L 1NAMA 1SF5A 4LHUG 4R0LC 4WKXA 1MJUL 1MZZA 1SJEA 2AGJL 1PX3A 4ZODA 4PHZA 1TU2B 2WQAA 2XIIA 4Y89A 1SOKA 4LF3A 3HAEA 5D96C 2R56H 2YGVA 5J56B 4HJJH 4NOBA 1OSPH 5KN5B 5E8OB 3QFJD 3H4FA 2FBRA 4YSQA 3X1EA 1KG0B 2R59A 5JIMA 2Z7WA 5H35B 1RHFA 3KL0A 2E7LA 3A6BL 4LK4A 4Y16A 3ZHFA 3GMMB 4OF5A 4YIQA 5FLUA 1WGOA 1VPOL 2PUQT 3TYGH 4GG6A 1NFDA 1X7QB 3HE6A 3IFLL 4XTRD 3D0VB 3KGRA 5GS0D 1SBSH 1OOAA 1UJ3A 4BFRA 1E4KC 5KS9E 3BPCB 4Z78A 1U4FA 3U46A 1FZJB 4OGYL 5HYJD 4U1GB 1CFVH 4NYLA 3PV6B 5HHOE 4OGXH 5JHDB 3HCVB 3PXHA 1MHCA 1PY9A 3I3BA 3FQTB 3L2NA 3QXAB 5D5ME 3O8XD 3FONA 4IRSA 3DPDA 4PJXB 4ZD3L 4W81A 4YDIH 5F7NC 1AI1L 3Q2CA 4P07A 2OZ4L 1D5ZA 1QFWH 1XTMA 3UIYA 4DN4L 2RFXA 1ZPUA 1CR9H 3MRKB 5IBUB 2NUTA 1TTRA 4PY8J 4FXKB 2Q86B 4WI7A 1SMAA 4GG8A 2DQDL 4B0MM 5GRVK 1MELA 2VLLB 5HPOA 1BYOA 2VN6A 4OJFL 2G3XA 3K81A 4FA7B 3LKSB 3ZHKA 3VFPB 3O6KH 2VO8A 3STLB 5TFSH 2B16A 1MW2A 5AYUL 2IWKA 2MWCA 3ARFA 3SJVD 5JDSB 1YEKH 4JN2B 3S36H 5SWZE 4GRWB 3H1ZA 1EHLL 2CBPA 1LEIB 4K5OA 2WTOA 4KVNH 4ODUB 1YEJH 4PJEA 3GZKA 3ATAA 1S9WB 1XHHA 4Y5VC 3D3VE 1LM8V 1F41A 2UWEE 2ARJB 3REWA 4LBEB 1OP9A 1V55B 1XF5B 3FO0L 12E8H 1SM3L 5JIDA 3IU3A 1QLRA 4PIRF 3RZWA 1Q0EA 4U6YA 5K1VA 4OJAA 3HLAA 1LXMA 1IEBA 5E94B 2Z8WC 5HTSA 2I7OA 4PS4L 2FX7H 5AKRA 3OKOA 3GSNA 1NGWB 1XB6A 3FAXA 4XXCC 4PJDE 5GGSB 3JTBA 3MU3A 4LPWA 5C71A 3UTQA 4FL4C 1BD2D 3HS8A 2DQUL 2F53E 4N0UA 1I8AA 4OCNC 4HKJB 3MJ7A 1HI6B 2CDEB 3S8WA 1F86A 4J8RA 2OP4L 4BHUI 5JXEA 3ULUE 4X4MA 4UILL 2EKSA 1DJWA 1R46A 1BLIA 4DPBX 5A6IA 3VSTA 5T1KB 2H3NA 2B9BA 3GPEA 4WTWA 5JPMA 3AG3B 3LRHA 3MXVL 4AYMC 3UOAB 3MLWH 4NO0B 5D1QC 3EUUA 4QRUA 3ZDYE 2VUKA 1N6VA 1Z7JA 3O9WA 3O3AB 4LLVB 4FS0A 3F6JA 5HDRA 1A6TB 5B3NA 1QFOA 2NUPB 1MJJB 4HWUA 1H9VA 3QUML 4JHZA 2ESVD 4HIJA 2UYLA 1WBXA 3RVVD 1ESOA 4KV5F 2CK2A 3MJ9L 1TYEB 2WBJD 43C9A 2R8SL 2BVYA 2DLEA 2BP3A 1H19A 4PD4J 4ELMF 2ARJQ 5CBAB 1YECH 4JQIH 5DJYA 5INDB 5D4HA 5FF6B 4XWGL 4ABUA 3ML9A 1IJ9A 2RMNA 5IV2A 3Q1SH 1CIUA 4LLWA 2F58H 4TNWF 1M2OA 2P44B 2WZ5A 3TLRA 3NAAH 3O6FD 4M6OH 3WSQH 3PHQA 1CGTA 3VFNA 3BT0A 2EZ0C 5SWQA 2A77H 5GGUA 3HI6L 2IH1A 5L4JA 4FG6C 2RTTA 3UBGA 1KB5L 3DHMA 3V52H 3IRZA 4XN9A 5D2NC 6CGTA 1ZAGA 3WL9B 2O61A 3AADB 1U93A 3SDYH 2YIHA 1I1YA 4OFDA 3LH9A 3UTPE 3S8GB 4Z7VF 4KZCA 5F7YC 5A2LH 3UBXB 4M29A 1WZKA 4N1HB 2D3LA 2P5WE 4FLHA 3QEQB 4MJ5B 5AYQA 3W39B 1T22A 1BQLH 1BQUA 2Z34A 3OX8B 4FP8H 4KKLD 5AUMA 2CO1A 2WWMC 4H25A 1JWUB 5CIPA 1V7NL 3HN8A 4IJ3C 1Z9PA 4ELKA 4FZEL 4P9HH 3CCHB 4YBLB 4TXVB 5AVUB 3HI5H 3X14A 4BZ1A 4I0PC 2W60A 2A5UA 3GRWL 4KKNA 4TNWK 1BM3H 2GSIA 4WTXA 4O5LL 1YMME 1MY7A 1L6XA 5ICXA 2I85A 4BD4A 3K2IA 1N7ML 2N3JA 1WC7A 2W9EH 4Y2DD 5IK3A 3V6FA 1MCQA 4Z77B 1A4KB 5BVPH 3B37A 4XMPH 3RGVC 4Y9BA 1N4XH 1JYVA 2NSMA 5H37G 3V4PB 3QWOB 2Y7MA 3G6AA 3RUGB 3QO0B 1MWAH 1XAUA 1JE6A 2D3NA 4ODWA 2X1WL 3MRFA 3P0VL 2V9QA 4MQ7A 5C6WH 4KK5C 5EUKA 1K5WA 4KI5C 3VRLE 3MNVA 5C70A 1PZUB 2ICEC 3VTAA 2A1WL 3IGAA 5F8RC 1WA2X 3RKDC 5IP4A 3ZN6A 2W8CA 4NUGL 2FX8H 1KIRB 2X7LB 4W70A 1OLZA 4E41E 1ZTXL 3JYBA 3E2HC 4RDBA 5DRWA 2P9RA 3QFJB 2L3BA 4Y5YA 3S36X 3KLAB 3U6RA 4YWGH 1F8TH 3QEUA 5FA4A 4N2BA 4Y19E 1L0XA 3WBDA 3DX7A 1NOLA 4EUPH 1RI8A 5T33L 3UBXI 2LFEA 3E7JA 5TDPA 3WLBB 1UWGH 2ZCLL 4DT2A 4HLEA 2R4SH 1MAML 1YC7A 1ILUA 2IAMA 2X3CA 5IBUG 4MGXA 4YPGB 1X5ZA 2HKFH 5HPMA 1U3HD 3N0AA 5A2FA 3ARWA 5HYJB 4CADB 1FPTL 4OFPA 1BF2A 3NZSA 4AGQA 3IB4A 3K6SA 4UT9A 3I6KA 3MUJA 3O8XB 1TTCA 3CN2A 2V9RA 4ZFZA 1Z9SA 2Y1ZA 3ZE0F 2FAUA 4F57H 3FFDB 4UOW0 5KJ7E 3QR0A 5LGHH 2NR6C 2XX1A 3IFOB 2BNRA 1XL6A 3IN0A 4AYBA 4MA1C 5DR5H 5ID1A 3GXPA 2HT3D 3JV6A 1NCDL 4PJFB 5LQBH 3MRDA 3SIKA 5IHZB 1JGUL 4ODVL 3ATBA 3OGCA 3BN9D 2ISDA 1B3JA 3W0WE 1VERA 3ZYIA 3KPNB 3RWJA 3MV8E 4PREB 2DLGA 3VCLB 2VQTA 3UDWC 3TBBA 2IPTL 4X5RA 4CU7A 1NCCL 1S4IA 2PYFB 3ZRFC 3ZW3A 3DX6A 3ZDZF 3CHQA 2GABA 3S4SG 4TPRL 1RLWA 2HCZX 2XVBA 2Q2LA 2Y7OA 1A4BA 1AGBB 2AZAA 3NCJL 4DN3L 4NN5C 1ZHLA 2ZCZA 4XNYH 2X9XA 3EBAA 5CCGE 3ET9F 4OZ4A 3EDEA 3UFIA 4E9QA 5DD6B 3R4DA 3IRPX 4WI0A 4JFDD 4M61B 2PWDA 5EPMB 1RZJC 4H44C 3SBQA 1CUOA 5GGVH 3MLRH 5IIEA 4BSVA 1OGTB 1BD2B 2J6EA 3H0TB 4XCNB 4HUMB 4OKVB 3BESR 1E5CA 4LDLB 2QVIA 4J3BA 4O2CB 5C08E 1J12A 3TEWA 5EA0H 1L9TA 2O6DA 2UXVA 3HG5A 4FXKC 4BWUA 4ODTL 2YMXH 4QXTB 1XX9C 3I74A 1GZPA 4L1BA 5I74B 5DZ9A 4PJGF 3V0JA 1AOZA 4AGMA 3RNKA 5FWRA 3QDGE 3C5ZD 1CYGA 4AM0B 2WP3T 4U4BA 1EJ8A 1T83A 3HZMB 4I4WB 3MRNB 3RGBA 2ESVB 3D39A 4KK9C 2QSCH 3FT4B 5ILTH 4HGMA 4A2MA 2WBJB 4J8QA 2I07B 1V3MA 2GK2A 3T6QC 3DX4A 2QLVB 7FABL 1RAMA 3K6FA 5BJTB 1F3JB 3TIDB 3FTVA 3RIFF 1XGPA 5I1GL 1A6WL 1XGTB 2ZSWA 3NA9L 3A21A 1W0WA 3OQ3B 3GXMA 2VN7A 5L8LB 1SPDA 4Y1TA 4C56A 1OGPA 1X9LA 3O6FB 1N0XL 1CTMA 3NH7L 2V2TB 1OIOA 1QSED 3SYCA 4QHUB 1DSWA 5C0AD 2HFFA 1UWXK 3PWVB 1QBMH 2OCCB 5I0VA 4L29A 1QATA 2QVMA 4PJ7E 3HR6A 1DFXA 3CIQA 4AGLA 2CO3A 4ELMB 2DLFH 4N2GA 4AH2B 1DQMH 1DZ0A 1WWBX 3AACA 1XGRB 3NFSH 4PRPA 5C09D 1P5VB 5D7KD 3F7QA 1VFBA 1G1YA 1WV7T 1ZKAA 3DHJA 4S0TD 2PYEE 4AM0Q 4QJ5B 3I75B 5L8KB 2DIAA 2YAOA 3S5YA 3KR3H 4GW1B 4Y9FA 4HJ1A 1BJ1J 2GI0A 1DJGA 4JM2D 3KAAA 4NCDA 3GJFA 1WIPA 3OGOE 1LP9A 1I7TB 4HJJL 1G7IB 3BUQA 3T65B 5HJ3A 1OSPL 1FZMB 4JX0A 3RIFK 2AITA 1KCVL 3EJYC 3OMIB 4FXGB 1Q0YH 3SGDI 2OQJA 4HU2A 1K4CB 3GMRA 5DS8B 2P8LA 2DTMH 2CGRL 1V7ML 2ERJB 4JGMA 4F7CA 3L3OA 5MHSD 1U8HA 2J8UB 1WIUA 2X6BA 3TYGL 4RAVA 2W65B 4IQHA 4LCYB 1ZVNA 1TOXA 2W0FA 5CBEB 1F3DH 1OGAD 1SBSL 1G7MB 2WCPA 3FCGA 4OF8A 1W8EA 3Q0HA 1NANH 4HJ0C 3H9SE 1BOGB 4PCYA 4TM9A 3WUWA 2WLZA 1JPTH 1M1XA 1CFVL 4U33A 2VQ1B 4WTZA 5D1XD 1H15B 4L3EA 4X7CC 3GRBA 3IXTA 3FJTA 1ZLUH 3WXWH 1NIAA 4ABQA 4Y5XB 4G9DB 1KWKA 4UOQA 2C8NA 3SY0B 4N8VG 1DUYB 1I3UA 5A2AA 1JZHA 3GSUA 4LLQB 1RZ8A 1QFWL 3RL1B 1CR9L 4EVNA 2BVTA 2O6FA 3UTSA 3VXME 1GZHC 5F7DA 4M8QA 1MFNA 4OJDH 1KDIA 2NW3A 4YDMA 2OYKA 2P8MB 2CLRB 3BXNB 4P2AA 2P5ED 4ETYA 5CGTA 1FNEB 3KXFE 1DVUA 3MLYH 4WKZB 4EF3A 4JK0D 2X2UA 1K85A 1A7BA 1J7VR 3TTYA 1F2QA 2CIIB 3OJDA 3P9WB 5TFSL 2FWUA 3X11B 5J1SC 4KKRA 4N5UA 1QFHA 1YEKL 5IMKA 5EU3B 1R5VA 1LDPL 3CFKA 4QI3A 3S36L 3VD3A 1EHAA 2DKMA 4KVNL 1NJ9B 1U3HB 3FKUS 4RMSA 5DZVA 4KMQA 5T3ZH 2WD0A 3LZOA 4HGKC 1OAQL 2EDBA 4XP6H 4OJEH 12E8L 4KTYA 1O0VA 4DTGL 3VWKA 4ZMWA 2ODIA 1LQBC 1GCFA 4JFFD 5KYWA 1NEZA 1UM6L 3L54A 3SOTA 1HQRA 3KPSA 1EXGA 2QPDB 4BQ6A 4KKAD 1AHMA 4XN4A 1H3UA 3QHZH 2FX7L 4NQEA 4X4XB 4BSWA 3HPJB 1ZCRA 2HVKB 2PR9A 1JFQH 4OZHA 1IGJA 3C5SA 3VACA 3WNJA 4X6CA 4H5SB 5I82A 1EZVX 3LXBA 1FO0B 3HB3D 3VWJA 3VSVA 3IDIA 2J1ZA 2AJXL 4YEFA 2EDWA 3CUPA 3II1A 2XRAL 1Z66A 1WF5A 1S9XB 2VDLB 5GGRY 3KS0H 4OUOA 3MLWL 4WU5A 5CEXA 1W0VA 3QQDA 3L6FB 1UM5H 3QZWB 5F1NB 1M71A 1AH1A 8CGTA 4LEBA 1NH6A 4BA8A 3MV7D 4UZUA 2Q10A 4W93A 2Q20A 5D7IF 4ZW3A 2IWGA 2WZ0A 4WUUE 4W9KC 3PLYA 4FEIA 4TUJA 4Z7WF 1J0YA 3ARVA 1FYTD 4LKCB 1HHJA 4RWHA 3WEOA 1YECL 5E9DD 5GJTH 4JFDB 3WD5H 2YEVB 3MCKB 3LHPH 4B3VA 1L7TH 3FZUD 2EJ1A 4QTHB 3HI1A 4TQEH 4U0RB 5JMOC 5FHBL 4I18B 5E4EB 5EZJB 3QCUL 3FQRB 4J28A 3WFDL 1JF5A 3Q1SL 1ZK9A 4UUJA 3NEEA 4Z7OF 3TO2A 1Q94A 1LHZA 4MD5B 1QEWB 1X44A 1KJ2H 3NAAL 3OKEB 3SGJC 1B4LA 3QQ9C 4HAFA 3BE1H 2MMXA 3HG4A 4R84A 3WTWA 1BWWA 5C6PB 3ZMRA 2MPAH 2K4AA 3UXFA 5HYQA 1O7DE 3WI9A 4QJ4B 1F4XH 1OAKH 2XACC 1AXTH 3SDYL 4OF3A 5IJKC 2IOOA 3HPLB 3QCVH 3C5ZB 5KYXA 2CKBH 1NDGB 5JUEH 4OM0L 3FQ1A 1JVLA 4YH6A 1I3RA 2K8QA 4TLSA 2HLFC 1UZ6F 3DMMD 3CQQA 1G7QB 2X9ZA 4L9LB 1OSZB 1EEZA 2AI0H 2PO6D 3N50A 1LO3H 1BQLL 1SF3A 4KPHL 2K45A 4FP8L 4H1LA 4M7ZC 4PVBA 2V3FA 2NY4D 2X88A 4AVJA 5CN3A 3AAZB 3BUDA 1TG8A 2CBOA 4J3OD 4H26A 3SEPA 4JVPA 3ZX1A 3U4EA 3MRRA 4JHUA 5KEZA 2KYIA 1F58H 1PZBA 5GQBA 3X13B 1WICA 1H8SA 1CLCA 3GBNH 3TL5A 2EVHA 3HI5L 3W11C 3NCMA 2WVSA 1BM3L 2WXGA 3U25A 1NGPL 2F5BL 4QXUH 5DYOA 2J73A 2K6WA 2BHZA 2EIKB 6PCYA 1QSEB 4OLYL 3L1EA 5DEFA 5C0AB 2W9EL 5AW6B 5LGJA 1NCNA 4HG4J 4K5PA 3RU8H 2XG5B 4KUZL 5EC2B 3WIHH 4FFYL 3ES6B 5IHUH 3RWHB 1BBJB 4OSUH 5DJAA 1FVCB 3WJMB 1YEEH 1MWAL 1CO1A 3JV5A 3BGMA 5I74C 1BW8A 3U4AA 5C09B 4EQ2A 4U1LB 3IDYB 1DBMH 4I5BA 3MRQB 4LLYB 5CJQH 4XN7A 5ESVA 2G5UA 2APXA 4J4PA 5G5DA 4BH8A 3ZYJA 3D0LA 3OAYH 2NLJB 2V0AA 4UQDA 2WBJC 3D2UD 4RNRB 4U1JA 3SE8H 3SYPA 4E9TA 5H94B 2Y2YA 2A6JA 3BSZH 3MUY1 5GRJL 2PW2B 1CFBA 3R18A 5D7JD 3RVTC 2GPZA 4OGAD 4ZTPH 3VQ1C 3DOSA 4AQ1C 4LEEA 4YWGL 1F8TL 1T7XA 3CN0A 1HEHC 1A5FL 5G2NA 4XCYB 5FPIA 4KTEL 5KVFE 4LOFA 2NPLX 3MACL 4GYBA 4OVUA 1MFUA 3BP5B 1E4XI 3NIFF 5CZKA 1OGAB 2R4SL 3BDYH 4HD9A 2XTJD 1PKQB 3T0BA 3UZEC 4OV5A 4FYTA 1LD9A 2HKFL 3KPRA 1JUFA 1I8IA 4EI5D 2H41A 5GHWH 1YNTF 3GSXA 5D1XB 3PE9A 3CFJA 4UQ3B 1PLAA 4OAWA 5PAZA 4B9PA 4C54A 4ILDA 3GGWB 4WFFE 2OX5A 4F57L 1BWMA 5LGHL 4HV8B 4XNQB 3WIFB 5T1LA 3NDYE 2Y22A 4MSWB 3MCLH 2LABA 4RBPH 1JTPA 2A38A 1OCZB 2JJWA 1AHKA 1FHGA 1PVHA 3ML8A 1HH6A 5TE7H 3IMSA 1HTYA 4KO6A 5T3XL 1DE4B 2AV1A 4IRZA 1NSNH 3T3PF 3WHXB 3QG7H 2P5EB 3O4LA 4Q7DA 4QF1B 4YEEA 4AXWA 4P5TA 3IJEB 4HKBB 4HFUL 2HVJB 2V2XA 3M1BB 4NT6B 4QY8A 4GQ9L 3V5DA 3I2CH 4YUEH 1ZK5A 4JFWA 3CZSA 4IM8A 1HC1A 4BINA 2DQTH 5EZIH 4XB8A 1OY3B 3RJDA 1UKTA 3OJVC 1AMYA 3BKYH 1I8LC 2AQ3A 4LGSB 2H2SC 5EUOF 4OCSH 2FNWA 1CF8L 1OB1B 5EU6D 3WIAA 1KJ3L 1RUMH 1NUGA 2LTQB 4QRQA 3KMDA 2LR4A 2NZIA 4P23A 3L1FA 4MD4A 3EGXB 4ZO6A 4NP4H 3PJSA 1K4DB 4MJ6B 2R27A 3PL6D 4XP1L 3QRGH 5A2BA 1TJMA 4ANUA 2Y5TB 1L0YA 4P2YA 1T0MB 2G4GA 2Y24A 3BVTA 2B39A 3FUDA 3OMZA 4M6NL 3TONA 2GCYB 3APDA 4PJ8A 2GBTA 1C5BH 2EEAA 2XWXA 4GLRH 4NZ8A 1SEBA 3SKMB 3HB3B 2A74C 5D4IA 2DY2A 1DCEA 1AC0A 2PPAA 4P99A 4RGND 3LPOA 3NGBB 4XRCB 1E9OB 5IB5A 1CU4L 4R96B 3ARYA 1TCMA 4KRNA 2W07B 2O5ZH 2BDNH 2CPUA 2CALA 2VRQA 3WNLA 2A7BA 4QHNB 3D69A 5HDQH 1IE4A 3IPFA 3VXPA 4KI5F 1UA7A 3FB7B 4PJIB 3GXTA 4LASH 4O4YL 2NXYD 1EAPB 3QUHA 3V6ZA 3PYCA 3MV7B 5I1LB 2C3VA 1FVEA 1TUPA 2R2HA 4JQXA 5EU4A 1HH9A 2VMDA 5LDSA 1A6VH 5ILTL 3O3UN 4LPXA 4NRXB 3E1F1 2G3NA 2V4LA 1FYTB 3GBMH 3TO4A 1XMWA 2XWTB 1X5GA 1PLBA 3JWOC 5E9DB 5F1OB 5BZDA 4FYRA 5F96L 1K2DA 1QSFD 1BEYL 3AB0C 5HGAA 4ZW7A 2N7SA 3ILPB 3V0WH 5D70H 3ZR6A 4LCWA 1F4WH 1J8KA 5GSVA 4KKCD 3EH1A 2ZYSA 3K8MA 2APWA 1J5CA 1HSAB 3ZE1E 4F37F 4LARH 2BIMA 3AS3A 2W95A 3VXRE 2WXFA 2XZCH 3MNDA 5ETUA 4HSCX 2OTWA 1WZ1L 3MV01 4QMEA 1RIHH 3ATDA 3CX2A 3FS9A 4AIOA 4L8CB 5F9OL 1DVFA 3DRQA 3LKRA 2GITA 1IQWH 4YHIA 3VI4B 3I9AA 4YZFE 1QBML 3IFPA 4L4VA 3UBHA 3WYRA 5GIRA 1PIGA 4YHKL 2J88H 2WVVA 4ADJA 2DLFL 4GKSB 3BQUC 1DQML 1ICTA 1JP5A 2AQNA 5KBDA 1TO5A 4D8OA 2XKSA 1FORH 4U1KA 3L7FB 2LU3A 2FL5B 1MJ8H 3DMMB 1XH3A 2ZF8A 2Q6WB 4KNSA 1NC2D 2PO6B 3RPIB 3SDAD 2I25N 2JJTC 2EDXA 1TPXB 2PXYA 3K5SA 2NY4B 3KR3L 2DWYA 4OD3L 3BKMH 5SV4A 1FFTB 3PWJB 5HSFA 3HUJB 1RUKH 1W0YT 2H1PH 2WLYA 1HJBC 5C0EA 4XP9L 4Z18A 1FC1A 4QR7A 4QTIL 5B4MD 1NMBH 3CXFA 4M93B 4W6WB 2WWOA 4M1CD 1CD1A 1Q0YL 1YYMH 3SHSA 4I18C 1C08A 5CJ8A 3TA3D 1HCVA 4F37K 4ZG1A 5F7LB 3TJHC 5ICYB 3FUNA 1R5IB 3H56A 3P3SA 4GKZB 1MAKA 1G9MH 2JNZA 4MMXA 1ID2A 4GRWH 2YUVA 4XMKL 3SPHA 2R29A 3MUGA 3WEMA 3HKZA 2XQYK 5CJ5A 3QT2A 3K7UA 4CVUA 3QWQB 1A1NA 5KJRH 1NDTA 4JRXE 2ZX7A 3X3GH 3BCDA 3Q5TA 1E28A 1UZGA 5KVEE 1U30A 4N6QA 2QSQA 2Z93B 3C5ZC 1IL1B 4DOHB 2WN2A 3FCSB 5I9QC 3D85B 3WXWL 1A4JA 1WH0A 3MMEA 1MQ8A 5DHYA 3QEHB 1VKXA 2Q5BA 4HUWA 2DH3A 4JRWA 5M95B 3D2UB 2AJYH 2YAHA 1UB6A 3ZLQC 1O6SA 3WN5A 3SPCA 4X4KA 5FO7A 5DHVA 2GG1A 1KCKA 1MFCH 2VXSH 4XPGL 3OXSA 1UYWH 5D7JB 1NTDA 2DIBA 3A6OA 1IM3A 3KLQA 5LG6A 1L6PA 2YEQA 2DDQL 3OPUA 3BH9A 4GQZA 3VI3B 2XC8A 5HYFA 1DBKH 2NNCA 1LEKA 4L5FH 4J7RA 5B1AB 3ZK0A 4HUKB 1G6RA 5C0DA 3DJSA 2GHZA 1PY0A 5HHOD 3FRUB 3M17A 3P1VA 3RWDA 3VXNB 4NGHH 4K2UH 4QNPE 3OSVA 2XTJB 4AJVA 1K8DB 2RQ8A 4NO5B 1QABA 4OB5H 4MYWB 5C0CE 3EAKA 3O45B 1Q1PA 5AVYB 1QBLH 4IRJD 4PY8I 1SEQH 2B5IB 4EI5B 5T3ZL 3K4DA 1OHQA 4NB7A 5FCUH 2XU9A 3LKPA 4YFLI 5A1AA 3BRGC 1ZXKA 4E5XB 1IT9H 1ETJA 1XIWA 4EZKA 3DYOA 5F44A 3ZSSA 4XXDA 1I8KA 4G6KL 1BP3B 1RL1A 4AQ8A 2YA1A 4NNYB 1WIOA 5GS1B 1GC1H 2XN9D 1OTUC 4JQVC 5DQJB 4UIMB 3WGUB 2ATPB 5LNDA 5I19H 3AUVA 4L48A 4ZS7H 4RAUA 1JFQL 3U7AA 2ZWNA 1VAHA 3ARQA 1SBBA 5SWZD 3MUUA 3CVHA 4UIKH 4LEXL 4HOWA 4OCXL 2JCCE 3EYUH 1JPEA 4R4BA 3WKML 1JZ6A 3CC5B 2C3XA 3WS3B 2IEPA 1AZRA 3FTWA 4I13B 4R4NC 1T66C 3P0YH 5HHVH 1B2YA 1O75A 3H7LA 2EIZB 1TEFA 1TQWA 1UM5L 3VFGL 4UOJA 4NN7C 4CVWA 3S0PA 5KTEH 1TMCB 1WTLA 5EOTA 1YPZB 3F5WA 1ZEAH 5EU6B 3QR2A 2JB6B 3ESNA 4U31A 2E7DA 3FF8A 3MV11 3TYFA 2R2BA 4PP2B 3EDKA 5ANMB 2ZD0A 5F93C 3C8KB 1U3ZA 2BXYA 2LVCA 5GJTL 3WD5L 5KYUB 3AXHA 1P2CB 1BQHG 1L7TL 4TQEL 4CBZA 1T1YB 3PL6B 3MKGA 2Z35A 3I6GB 5L4IA 3F85A 5I1EH 3U0TB 2QFPA 3L5JA 2DWDA 3KLHD 2R1WA 4BFFA 4XE5B 4NRYB 5K69A 2GBUA 5DJ6A 1KJ2L 4CVZB 1EX0A 4H7VA 5AOIA 1FFPA 3VXTB 4RGNB 1JMXA 3BE1L 5ITFB 1NUDA 2ATAA 1UACH 2A9AA 1M7DA 4IHOA 4PVMA 3SDDA 4I48A 2ARWA 4FTVA 3GO1H 4JS7A 2CO6A 3BPNC 4K23H 4LSVH 5CILH 2MPAL 4Q6IB 4ZUSB 5J3HC 4WEBH 5ISZE 4YHMH 4X5WA 4XVUD 1KJVA 3V9CA 2VDML 1P7KB 5TE6L 5DC9B 3NCBB 3QWNA 4PRAA 2CCLA 1HS6A 1OAKL 1AP2A 1AXTL 5DO2C 3MBEA 4E9YA 2CO7A 2H26A 2GB2A 2YGPA 1SXZA 4X9YA 2OMVB 3V9EA 1DJYA 1MUJA 2CKBL 3CBKB 5CN1A 3P02A 3SQRA 5IEKB 1Z5HA 1WAAE 4KUCF 1J8RA 5JUEL 5EG6C 3VYNA 2VXQH 5B22A 4AG4L 4JFZL 4JO1H 1EGJL 1GYWA 3BP4A 4PV8B 2HPTA 1OM9A 1OT1A 1LO3L 2C4FU 1BG9A 4Q14A 5IKCB 4QGYA 3TBVB 4Z7VE 4FD0A 4IK6A 1QSFB 2ZPKH 4MS8C 4Y1AE 4GXVH 3W5MA 2ICCA 1QLEB 2CR6A 3GBNL 2OMYB 4K94H 1KY7A 4AT6B 4AC4A 3N41B 4I8DA 5CS7A 1G7JA 2X2JA 3MC0A 5D9SB 5F88B 3TT3L 2EC9T 4LSQL 5EU5B 3ME0B 2YRBA 3UTPD 1XF4A 2VC2L 3ULVD 1D6EA 2IPKA 1MJ7H 4KTGA 1DQTA 3N2JA 2QHRH 3KZ8A 4GUPA 4JO2H 2DF3A 2ENSA 5GS0H 3NJHA 4D3CL 2RACA 2ZG1A 3BUIA 4ZW6A 3ZRSA 3RU8L 1FC2D 2ITCB 4IBSA 3T6XA 2FWLB 4HA1A 3WIHL 4ADIA 5B8CB 3TZVD 4MZ3A 5IHUL 5HYSB 2YN5A 1N5AA 1X5XA 1XBDA 3Q13A 3CVIH 3HC0B 2UV3A 4NDMA 1HILA 1EZUA 1J1OH 2DJ4A 5DD3H 1QSVA 3SDXE 3SKNA 3X12A 3CWGA 1IC4L 1WWWX 1R19A 3D30A 1DVTA 3E38A 2D31A 3ZSTA 3QXWA 1GA2A 1NC2B 1OO2A 5CJQL 3SDAB 4OZIB 4MJIE 1ML0A 1Z1WA 1HN1A 2QQQA 1NDMB 4M43H 4A6YB 2AAVA 1PL3A 1II4E 2FATL 5EEZA 1HHKA 2G2PA 4ZNEA 3V6OC 2WWKT 4KHTH 5B7EA 4V1DE 1OAJA 1F4AA 4XC1H 4NZDA 3C5JA 4L4JA 4KO7A 1S3KL 2JJSA 1XF1A 4N0FA 4QXVA 1TTGA 3TA3B 3JZYA 1AQDB 3GLDA 5KYNA 3DTDA 1E9QB 4XOAA 2Y7QB 2ENPA 3C2AH 3S3CB 4QF1A 3CLFH 4XBPB 3MRGA 4PIBA 3PGFL 4Z0BH 5LB1A 4W9EC 3ZHDA 3MLVH 1JZJA 1T7ZA 3IJSA 3OB0K 4WNSA 4LRIA 3BDYL 1YN6A 4PRNB 4FA8A 1PQZB 2VKWA 1K6QH 4TQHA 3L3IB 2ZXEB 3H6JA 2VXUL 2V3DA 4G80B 4KJWD 1QMUA 4J3TA 3D3VA 5DMYA 3CPLA 1JF1B 2E6PA 2ZAGA 3N55A 3B2VH 1FIEA 1PJ9A 2AFNA 4H2CA 5AW5B 3D9AL 4DQOH 3LPPA 4F9PC 1CICD 4KVPA 2GW5A 4ZTOH 2J71A 4G43A 4AQEB 2HJFB 3HR5A 3EZ8A 4L1TA 3AJ7A 1RPKA 5I17A 1M7IA 4JFTA 1CDJA 3MCLL 5LJYH 1SHWA 5FO8A 2HMID 3NZUA 4LKXA 4PJDA 4NKOA 2WSDA 3F04A 5J7CC 3T0EA 5TE7L 2F53A 3BPOB 1X7SA 1OLLA 4CMHB 5KS9B 1D5IH 3MLUH 1BVLB 5HI4D 3MV9E 3QG7L 1LEGB 4MHHI 5IF0A 4FEMA 1JHTA 2CDFB 2BCKA 4HVBA 2UY6A 2XOTA 3T6VA 2EAEA 1UJTA 5HHOB 1U8JB 4NC1C 4JZOB 5FWQA 2WXLA 5CWSA 3UTOA 4YUEL 1HXMA 2ADGA 1IAOA 4GP4B 3LQAC 4MNGE 1CFSA 2ZP0T 2DQTL 2WV3A 3KHOA 3K74B 3O11B 4FKHA 3L1OH 2XETA 5EZIL 1NFAA 1U4EA 4AY0A 2G75B 3FU9A 2ZJSH 2L7EA 4IRJB 1KXQE 3BKYL 2N7AA 4OCSL 3DX9B 3WE1A 4Z23A 4P46D 2X4RB 2XYBA 4A68A 3EKCA 4N90D 4G8GE 2Z91B 2FSEB 3INUH 3QIBC 3QSKB 1YEDA 2PWEA 1X6LA 3W0WD 3DJ9A 4W9GC 2XN9B 4NP4L 3VFUB 1DEEB 3QRGL 1LE9A 2XVKA 4KROC 4JREB 1BCIA 3AT9A 1AR2A 2OMZB 3J8F7 5DMIH 5SV3A 5T5NG 4DKFL 4NPJA 3QRBA 3V4VL 1LYQA 2HT2C 3TEUA 3RFZC 2W9DL 3MROA 3HAEB 2CE6A 1JK9B 2FHBA 3CN4A 3EJSA 1WZMA 4HIPA 4OBRA 5GGRB 4LGPB 2OW6A 4QD2E 5LO7A 3MTRA 2VLJE 3PWNA 2L8AA 2WXOA 2O5ZL 2CRZA 1UT9A 4LIQH 3WFCH 3CDFA 1MXDA 3FQNB 4JR9H 4CU6A 4YIQB 5F7HA 2ZYIA 2HFEA 4LASL 4GG6B 5C0GB 2VERA 5IROA 2FBOJ 3T2OA 4ZUTB 2UX7A 3FQWB 4X98B 3T3MB 1SZNA 4YO0A 4U3CA 3LMJH 2P5WA 2Y9RT 3GBML 2VDNB 1U8LB 1E27A 4LSRH 3MJ8A 4APXA 1HZLA 1BDYA 4OGQC 1ES0B 2HTKC 2ORBH 3BFQG 3VXOB 4M00A 1P7HL 2DMHA 2NX5E 3Q1EA 2OL3A 1F4WL 3H9HB 3FONB 3K6OA 1MW1A 2FQFA 1ZLSL 1OQXA 1ZGLP 2QADC 3L17A 5E70A 2XZCL 3QDGD 1B2WH 2E9BA 2RFXB 2N56A 1YMMA 3KCPA 4AITA 1RIHL 2GC7C 3MRPA 3MBXH 2HZHA 1F00I 5IMMA 4ODSH 2AXFA 4I9WE 4Y2LA 3WEBA 4LRNH 3SDCA 2WP3O 4X50A 1GGTA 4XP4L 2HWZH 3GPSA 1NCJA 5F6HI 4JPKH 4P5RA 1ZVYA 1KF9B 3AU0A 5IQ9A 2BS8A 2LAGB 5E4AA 1IGTA 1ECZA 1MJ8L 2BERA 4E42A 4NM8H 2MHAA 1X9UA 2D8KA 1CYWA 4NQXA 5I1JL 1M9SA 1XQ4A 4LOUD 3BKML 2IMNA 2D0FA 4ABVA 3FRPA 4J2QA 1RUKL 2H1PL 4L4TE 2HYMA 4U1HA 5AAWA 5EULV 4MHHG 1D5BA 4JG5A 2QKIC 4OIBA 1ZY9A 4CC4C 3GUTA 3G5VA 1IEBB 2OMNA 3PL6C 4Z95H 4FFVC 3GSNB 3ZBMA 4U7KA 4GBXA 1CN4A 4LOEA 4X7TA 2BCMA 2H47C 3ZZSA 1FYHB 5HHXH 4N0UB 1CMOA 2VWEC 2C9UA 1G9ML 2DMBA 1Q9LA 1A25A 3MRIB 2OMTB 5JR1H 1EDQA 3TZVB 3QUYA 3GLAA 2BOCB 2GSGA 4NNXB 3VXUD 2A6IA 5I1CL 2H3NB 3QJFA 2L7UA 2UZXA 3FT9A 4G70B 3L16A 2A4CA 1SXSA 3BWAA 5FDWA 4NHUA 3GK8L 3RWCB 4OZFB 5CD5D 1WT5A 2VOTA 1MCPH 1P4BL 1SLUA 3OKKB 4GS7B 5DVOA 3K2KA 5CEYA 2YPVA 2EXYD 2IMMA 2KH2B 5E9NA 2JKWA 3HG3A 4Z0XB 2WM0A 3PAZA 5CHNA 3E1ZA 4O02B 1ORQA 1S7RA 2DI9A 2AJYL 4N2MA 3FT0A 4AENA 2YKKA 43C9B 3ROLA 1TTBA 1J0KA 3CFNA 3H42H 2DW5A 2VXSL 2JQZA 3OJ2C 2BP8B 1YEHH 2V5RA 1KCUH 1JERA 5MEND 4F7EA 2XZQH 3DBXA 1XZ0A 4P3DA 4Q8BA 4L5FL 4X5PA 1I31A 4R26H 5CAYB 5LBGA 2Z7ZA 2VDLH 5GSRA 1ZLWH 2Q2EB 2NY2C 3MV8A 1R24A 1UA3A 3GYRA 3WFBH 4QJ3B 1OL0A 1WLHA 1QHOA 2ITFA 2VDQL 2JCWA 2OYPA 5SWQB 3BD4A 4LL4A 5GGUB 1W80A 4OB5L 3CPUA 2IH1B 4UYQA 5IVXF 3F00A 2FH6A 4NOFA 2V37A 3MNZA 2O61B 2DV6A 4X6DF 1EO8H 2QR0B 5FCUL 1F0LA 2YD6A 5JW3L 5ELIA 3KCWA 4M62H 2D2CC 3ESVF 1CICB 4N26A 1T2JA 2OTPA 3H9YA 2Z9TA 3LZFL 2FHFA 3H85A 4GIPD 4FNRA 3GI8L 4L1HA 4U2YA 2OM5A 1RJYA 1L7IH 1GC1L 2IDSA 2OJEA 4Y4HA 5IB2A 3UJJL 1FE8H 1T22B 5I19L 5B1JA 1NUFA 4LP4A 1E4JA 1QUPA 4GSXA 4WI8A 5AOZA 1K5NB 2F54D 4RESB 3DPBA 5AUMB 1J5IA 3KYOA 5DJXB 4Z76A 1OARL 4AE0A 2ICWJ 1M2VA 3EYUL 1DLFH 4ZYKB 3U9UB 1KLGB 4NN6B 4KXAA 1U8MB 4WHCA 3X14B 3SCMD 5BUGA 2YUXA 4MCMA 3CSTA 1CBVL 4JBSA 3UPRA 2VCOA 4LESA 4GSDL 2JLPA 1KPUA 2ZCKH 3P0YL 5HHVL 2YSTA 2F61A 1G1CA 3FPXA 4IOIA 3VH8A 4TLKA 3UO1H 3AGVA 1YNKH 3O2VH 3V6FB 4Q9RL 1E67A 4FXTA 4WO4A 1LNUA 3HAEG 4A2GA 4P46B 1BF8A 1KZYA 3G6AB 4WCYL 1CQKA 1U8IA 4QKTA 4LFHG 4ODWB 2RR3A 3W0WB 3MRFB 4Z9KB 4UNUA 5HY9A 1H8NA 5TE4L 2CLVA 3FMGL 2B1HH 5EUKB 3UJTH 4P5KB 4ZNCD 5KVGL 4AGNA 4L3ED 4Z7IA 1XSOA 4JGUA 2W88A 1GHFL 4LHUA 3MLTB 4CJ1A 3E9UA 1PZ5B 3UTTE 2XXFA 5EN2B 2QVFB 4Y9GA 1KENH 1UD3A 4K55A 2QGEA 1J9QA 2QQLH 3QQXA 5F7EL 4DEPB 5EDSA 4UT7H 1R47A 1EFXD 3AY2A 4YHZL 5DRWB 4XN1A 3S8FB 4XMLH 2KQMA 4ZFFA 3BPOC 3BZ5A 4CMHC 1KXTB 5C0ND 1RZGA 2OAAA 1AO7A 3NTCH 4K23L 2HA1A 2VL5B 1NBQA 3F7VB 4LSVL 4MASA 4PRBB 4YHML 1GYAA 3RY6A 3BZFA 1UB5A 4PJ7A 2Y7NA 3P3YA 1ZV9A 3DX7B 3SQBA 3OZKA 2DQCH 4Z6AT 2MRYA 2Y3NA 2C5DC 5TDPB 5DJDB 4ZXBA 3RURA 2RQEA 1ADQA 1DO6A 2P80D 2OV0A 2VXQL 3RTLA 4XO8A 2VDRH 4JY5L 5L2KA 1BQSA 2DWXA 1P6AB 3MFGB 2PYEA 2CCVA 4JPIB 1IC7H 1UD4A 5DJ8B 4I3SL 5E6IA 2HJKA 4HT1L 2NT1A 4QHKI 4HWBA 1M05A 2AKRA 2EDKA 1TQCB 5D2LE 1I1RA 2VSDA 4G9FE 4MNHA 1FIGH 3VWKD 2NNAB 4HK3N 4K94L 4E0RA 1T6WA 2FIKA 4DPAX 4PS8A 3DYPA 3RVWD 4B9FA 4Y4FD 4EQ3A 3IF1B 3ABKB 3AFLA 2HG5B 3QDGB 1JGIA 3IU4L 1H0DA 4TUKH 4QHLB 4JREC 1MJ7L 3JV6B 4FLQA 4YOKA 2W0KA 3B7RL 1TEGA 1H8OA 4JO2L 4MLSA 3VDAA 1KGJA 4F33A 4ZFOL 4ZJ9A 4JHVA 2B2XH 3IDMA 4HYTB 4WV1A 5I5JA 4HIXH 3SD2A 4U2ZA 5CFAA 1RKRA 1MVUA 2C1OA 3CVIL 4XNZB 5DRZA 2E7LC 1IM9A 4YHNA 1J1OL 3H9SA 5DD3L 2CWRA 4FMFA 3QDJA 4HCGA 4IMKA 1QSZA 4Y16C 4YSCA 1VGEH 3FB8A 4M1GH 2YBRA 1Q0XH 1B0IA 3HE6C 4FFZH 1UD6A 4QRSB 2Q8AL 4M43L 1QOKA 1A7QH 4QAWA 4GW5B 5F9JA 1FFQA 1QHPA 1ZHLB 5E2WL 5FB8B 1UJ3C 3HS0A 1ORSA 1HCZA 3HE7D 3KPQA 5TF1L 3B2UD 4EN2A 1EHKB 4PWGA 1T3FA 4N8UA 4KJYB 2XWCA 3MNWB 4XC1L 4WI0B 3VXMA 3ZKND 1FLTX 5HYEA 3F7KA 4HEPA 5I6KA 2AANA 1G1KA 2F74A 4QHMA 3RHWK 5TGBA 1U8CA 1UWYA 4U6VL 1VHPA 2A2QT 3QJVB 3ZZ1A 4IU2A 4BSVB 1JOIA 3KXFA 5FHAL 2PLTA 4K0OA 3NCYP 4PJHF 4HP5A 3T1WA 1PZSA 1U3NA 4N2AA 2J12B 1QTSA 2PCPB 1HEZB 4LEOA 4MAYA 1E4WH 1QKZH 3VXUB 3IDGA 4OI8A 2QKSA 3IFNH 4P2OD 1K6QL 4I0CC 5DA4A 1FA4A 1T20B 3MO1B 2V9UA 1GZPB 1F1DA 3FFOA 3WGVB 2GFBA 4EKXA 1R0AH 5T1DH 3CSPA 1ZIAA 3EZJB 4UYPA 2GBVA 3L5WB 3RNKB 5E2UH 1TQSA 1JFHA 2BLFA 4PRID 3HG1D 1IBZA 3FTSA 4YX2H 3STZA 3ARFC 4AK1A 2B59A 3JUZA 4JRYE 3D4ZA 3EBIA 4ZAKD 1DQLH 1KGCD 5CJXC 1A2YA 3VVWA 1CE6B 5JTWA 4PJBA 4WGVB 3NSJA 4PR5B 3ZT5A 3F6LA 2JKNA 2FYYB 5GJSL 1C16A 5IMLA 5EIIB 5MENB 2QPFA 5FGCE 3MLUL 4YS4A 3FO9A 4PW9A 5K93A 2ZSWB 3CDZB 2WZPA 1FWXA 3QIWD 4AIXA 2F1BA 2VRAA 4LSUH 5ENWB 1R3HB 1ZDSA 3BZDA 4UT9L 1XF2B 2O93L 4C56B 1DANU 5DUML 1GXEA 1P5UB 1DBJH 4DKAA 2BSTA 4JPQA 1KC5L 4OCRH 5EZLB 5D7LE 4F8TA 5JOFA 1U8PA 1WZAA 2BVQB 3L1OL 3W2DH 2JJUA 1Z3GH 2XWBA 2CRMA 5D2NE 2ZJSL 1WAEA 3U1SH 4AUJA 5JXEC 4L29B 4MNQD 5EDXA 3TZVC 3FHQA 1JWMA 2WIIB 3ZE2B 4U3SB 2MKWA 1M6OB 4HWEH 4WUUA 5F9WC 4D9RD 2YPLA 3TM6A 1AGFA 5DK3A 4Z7QE 4JFED 5I1HH 2YD2A 2NTFB 3BVNA 5IGXL 2I5YL 4N22A 3IWUA 3SYQA 3O9WC 2JIXD 1AFVL 1VFBB 4C58B 2HTLC 4BUHA 3QNXA 5EUOE 2MCPL 3N85L 4FQJH 5JW5A 5DMIL 4AYGA 1T1ZB 4UV7L 2F54B 1CLYH 4KX8A 1N3NA 3I84A 2R69H 2XQYA 4HK0B 5E2TL 4MRBA 4C57C 5DSCB 1F90H 2P1YA 2DS4A 3B1UA 1OANA 1ZGLM 1C8QA 4P2RD 1L9NA 2UX6A 3K5RA 3SCMB 2D03H 4MA8L 1A6PA 4YHPB 3FTXA 4KNTA 4LIQL 5F1KC 1JXGA 4FLSA 4JHAH 1NGXA 4C4BA 3V7AE 3JTTA 1U8HB 4JR9L 2W5PA 4PG9B 4BCYA 4JPWL 2J6EL 4UQIM 2V5SA 5PCYA 4Z7UB 3QWRD 2W38A 3W38A 3LV3A 1S7XA 4PJAB 2Z92A 3OR7A 4QXGH 1TDQA 3LMJL 3KNBA 3T4AB 4IIQB 2HH0L 4LNRA 3APNA 4J3OH 2EDOA 2ZOKB 2G60H 3NSYA 2CD0A 4LSRL 3WUWB 5IHWA 3RIKA 2HB0A 1ULVA 4MLIA 5T1MB 3FYIB 1P7QD 3ULSB 1XR8B 4FQ1L 1LO0H 4J3VA 1U95A 4QRRD 4TVSa 3TVMA 4DP9X 2JLLA 4HPYL 4YLBA 2FWOB 3LEYH 4L3EB 1CICC 4ATWA 3VW3H 5JPNB 1CCZA 5I1IH 4TKWA 2ZKYA 4PPTA 1GY2A 2BSSA 3MJ9A 2CBTA 2HMIC 4X7SH 4C83B 1B2WL 4X42A 4ZDHA 3B56A 1EFXB 3T77B 5EF2A 3D48R 5DTFA 3NA4A 4EVNB 3S7GA 3B9VA 4BFIB 4E9RA 3MBXL 1OPGH 5F89B 1A9BA 4LP5A 4X8CA 4M8QB 4GQRA 3ZT7A 3NIDE 4ODSL 4HC1A 3BLPX 2YFOA 3LSOB 2FTAA 3C87A 1YJDC 3O4LD 3UX9B 4OZGE 4CNIA 2EO1A 2HWZL 1CFNB 4UDTA 1OD7A 4U49A 3KM2A 1X6NA 2LE9A 1SY6H 1ZLUK 1BG1A 2WYHA 4UBDC 1EAOA 1HHHA 3GNML 4WJG3 3U7WL 1UGKA 3SO3B 3FTGB 5IMKB 4M6AA 3U6XA 5DGRA 1L9MA 3QUZA 4NM8L 3B2PA