3G3LA

Crystal structure of putative membrane-associated protein of unknown function (yp_211325.1) from bacteroides fragilis nctc 9343 at 2.20 a resolution
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
296
structure length
291
Chain Sequence
PAEAKYYIAGTITDATTGQELTTAKVTLGDKSVTSSFNEQVNYKAEGYALVVSADGYYPVKRQVYLNQVSDGQTSVATVNVALVSVEAAVIPPVVPPTDPETDINEGEATKVADKAVEVAKPSESTVTDMLAGTTATPEEKKALDETLEMAGGMKVGETTPEVLADGSILAITPVKFTNPIQDAPAMVPYFYNEGCELTGDVKEVAAPVAVAADIQKAFLSNAAKALNMNAGFVQKIGYTRISVLNGYSILGYTIKGQLVSKKLTFLISGKYYEGIVSYQKSVMIYPNYYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of putative membrane-associated protein of unknown function (YP_211325.1) from Bacteroides fragilis NCTC 9343 at 2.20 A resolution
rcsb
source organism Bacteroides fragilis nctc 9343
molecule tags Structural genomics, unknown function
molecule keywords Putative uncharacterized membrane-associated protein
total genus 71
structure length 291
sequence length 296
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1120 Mainly Beta Sandwich Immunoglobulin-like Carboxypeptidase-like, regulatory domain 3g3lA00
4EIUA 3G3LA 4IYKA 5K39B 2XHNA 3MN8A 4FL4C 1NKGA 1QMUA 3NJXA 5G5DB 2NSMA 2B59B 1H8LA 3E8VA 1UWYA 4WI0B 3NJVA 4U3SB 5AQ0A 3HN5A 4FXTA 4YOKA 3KCPA
chains in the Genus database with same CATH superfamily
2AQ3A 3QQXA 1UA3A 1CFNB 4NUJB 4PRHD 1EHLL 5JOPD 2IOMA 3IKKA 4QHUA 5ETUB 4IOFC 1KBGH 2GSIA 5BOPA 1S7RA 4HIHB 2KZKA 1TZOA 4LMQE 2R0ZH 5KSUB 3D85B 3UPCA 1G7IA 1GAFH 4B53A 5HHOB 3RU8L 3SE8H 3TVMB 1SUHA 4ZFOB 1VGEL 5I71B 1RJLA 1U42A 2BVOB 2EXYC 4JFVA 3ML9A 4RNRA 5DJDA 1IT9H 1UADC 1EGJA 3QUZA 1NLBL 4PVBA 4O02L 4K3JL 2ATPB 3U7YL 1CD1A 1JZ2A 1OAYH 3WY3A 4XBEH 3L5XH 3EDDA 1IEBB 1I1YB 3L1OL 2OAAA 4LDOB 3UABA 2WYTA 4XNUL 3DURB 3OF6A 3N44B 2HN7A 3RWCA 2CLZB 4KMTL 5EORH 1MNUH 3DX7B 1KG0B 3T2OA 4JQIL 1TENA 1N0LA 2DBJA 4NM8H 4HKJB 2FEDC 5EZIL 2CNZA 4Y2DC 5JPMB 3IF1B 4YHOL 2COVD 2VQ4A 5DS1A 2PW2B 4JY6B 4PTUA 5DEFB 2YXFA 3NJFA 1MCOH 2QHRH 2R56L 2QPSA 1NCDH 3CLEH 4KJPC 4E9VA 3HS8A 2Z6FA 3WTVA 3QZBA 4PJHA 4P2QD 2YJLA 4ZMWA 1JK9B 1FZOB 5FKAB 2A0LC 1MCDA 1PD0A 1NMCC 3K8MA 4PJAE 2HLFC 1NC2B 3CFEA 4PJ9D 1PFOA 4W6XB 4UOQA 3ZGHA 3P77A 2WB1A 4AQ1B 2Z35B 3PGFL 1T4WA 3VH8B 1T7XA 4LE8A 4MJ6A 3FPYA 4JZOA 3NCMA 3ATAA 4X6CA 2EIEA 4L3AA 3ARYA 4QRPE 3U0WH 3O3DB 3KJ4B 2VXTH 4EN2A 3IDXH 2N1KA 3QZMA 2P3YA 2NW2A 3ARDB 1M9WA 1XZWA 2XG5A 1D7FA 4I5BA 3S4SA 3RWGA 5TQ2H 3VXTB 1ED3B 3BH4A 5IB5B 5IVOA 3RX9A 2F7QA 5ISZE 4XZUA 3TF7C 3KLAA 3CN4A 3CWGA 1U3JA 1AYRA 4S0HA 2BNQE 1CLZH 3RX8A 4R96B 1BOGA 4YSDA 4FMKA 4YHOH 5DD0H 1CMOA 3W82A 1KEML 4HUWA 3GSWB 1RUQL 2X38A 5BZWB 1U3HB 2O4EA 4U4BA 1IM3D 2F74B 1ZLVK 5CGMA 2K1MA 4ESKA 4TQEL 1GZQB 4YXKH 3CFDB 1E28B 4X8JB 4MJ5B 2WBJC 4UILL 5F8RC 5MENA 5D5ME 1JUFB 4HJEA 1KTRL 3EGXB 4A2LA 4HCGA 1YG9A 5FC9A 3BKMH 1DL7H 1F3DJ 2B5IC 4UQ2B 3MV9D 5IB2B 1KXVA 1R47A 4GJTB 4IRJC 4HUMB 3B2VH 4NUQA 1ZK9A 1HCYA 1ULVA 5JQ6H 2HMIC 3GJEB 4Y2LA 2MSPA 4EIGB 4B95C 4ETQA 4RBPK 5FYKH 4K0OA 2E4TA 1I8IB 4JFYB 3HG1B 2GTZA 2QGBA 3UTTA 1UD4A 3OR7B 1P4LB 1SXSA 5DHMC 5D8JH 4YDIL 2X7LA 4OQ1A 5HDBB 2FECI 4XNAA 3AVEA 3W56A 1FIGL 3L5JA 4KWUA 3LQAL 4YHMH 3VD7A 3MLWH 4P46D 1JPTH 5DDHB 4L0PB 4A66A 4EUPA 4EN3A 2LGNA 2DMBA 2BK8A 4U1GB 1ZTMA 3VXRB 2GW5A 4M93B 4PN6A 1PLGH 2VDOB 1J8HA 1SXZA 1DQLL 1IEHA 5GGQL 3GXUB 4UUJB 3SOBH 5C7XL 4JN1H 3LQMA 1Z66A 4NO5A 1A6VH 3MBEC 4X4MA 2W80C 3F7YB 4CN6A 1THAA 2GJ6B 1GIGH 2DKSA 3N3EA 3INUH 4HSAC 1V7MH 2PPAA 3VG9C 4KK9C 4UM8A 4FXLA 2K7PA 4YDJA 2J8UF 5EDXA 5C0IA 4L3EA 3NPZB 4MCNA 3DHPA 3IFLL 4Y19E 3HG1E 3X12B 2DYSB 2ZT9C 3EYFB 1QZNA 4WTWA 2FJHB 2WXOA 1T89C 1PG7L 3GTNA 5HDOA 2WZ0A 1A2YB 3QQ3B 4PJ5D 1RP8A 3INOA 3MRFB 2CK2A 3LEXA 2NW2B 3QNXB 3ULUC 5D1QD 2EC9U 3BMWA 1E9PB 2E9WA 3PIQB 2ZAIA 5B8CB 5ADOL 4KJWD 4PG9A 2F15A 1MF2H 1BIHA 1L6PA 4ICXA 3RY4A 2ZZUT 4J3TA 5CLYA 4NLAA 5IHUH 3D2UD 1T1WB 1O6SA 2XA8L 4PJCA 5DMIL 3VXME 5DEZA 1Y7VA 3TH3T 1VIWA 2DEYX 4UT9L 4DSYA 4LVEA 4HMCA 1IU1A 3Q44A 4M61A 1ET7A 1I4FB 5DTFA 3QORD 1YNKL 1ASOA 1HHKA 4PH8A 1YA5A 4EXPX 4PGCA 5CZXD 1MHPL 2A73B 4XWGL 2P47B 4G3YH 4P2RB 4OGZA 3TIEB 3BAEL 1RZQA 2UY7B 4UIMB 3ALPA 3NABH 4U6VH 5TDNA 3ZZQA 4P46B 1FL3A 3CAFA 3N1FC 2BP3A 4G7VL 3VJ6A 4PWGA 4TNVF 1R6VA 2DJMA 4Z6AT 2E8YA 4CNIB 5HYQB 5IJVA 1S3RA 1MJUL 3UPRA 4M4RA 4PGDB 5F6HI 4D2NA 2P45B 3P30L 1BD2A 4WW2A 3MYZA 2WO3B 4NHCH 5IGXH 1FNGA 5F1NA 3D2UB 2BSDA 3QIUB 4AVKA 3K6IA 3SQBA 4MXWL 2FL5A 1ZPLA 3B6SB 4L4TA 5FR3A 2DQMA 3NEOA 3EO0B 4U0RC 1W16A 1EHKB 1SQ2N 2P8PB 3K8LA 4K7PX 1Q0XL 5D7LE 3FFCD 3FQNB 2LTQB 3SE4C 3ZRSA 2D2CC 5ADOH 2V9QA 2UZPA 1VCAA 4HIHA 1ZOXA 2ADJA 5CINH 5DUML 3BYYA 1I3RA 3V6OA 1L5GA 4YHKH 2YAFA 5G4NA 1AS6A 4JHBA 2UWEF 4S2SB 4Z7QB 4B60A 4P5KA 5DK0A 1UACL 1CD9B 4AQEA 2HLAA 3VCLA 3DOIA 4JDEB 1OAYL 2BVQB 3GNMH 1KNOB 2J44A 2WLLA 5HGHB 1IIKA 3DX3A 1FYHB 3VTAA 1U3HD 4HQQL 2GBAA 5FDWA 3O6LL 3RVTD 4JDVA 3U30C 1FVEB 2FIRT 3HIZA 5TDPA 5A6MA 3G3LA 4PJBF 3UIZA 1ETZA 4X6FA 4BQ8A 5IB3B 1P2CA 4UM8B 1VFUA 1LK3L 1G4RA 1QEWA 2ICWB 4QHNA 4XAWL 3SOBL 2HT3D 2IDFA 3BKJH 4QMEA 1FYTE 4M7LL 3ZRFC 2CHWA 4K5OA 1F45A 5LN4A 5AZEH 4X9BA 4Z7NF 1G6VK 3SKMB 2N0MA 5FO8A 2HKFL 4UT6L 4HJGA 4N5UA 1IQDA 1MVFA 1S6NA 3IFPA 1O0VA 4BKSC 3WD5H 2DWDB 3HMXH 2GG1A 1SHWA 1ZDSA 3RTLA 2KT6A 4ODBD 5ELIA 4J3UA 2XRAL 5IESH 5BZDA 3ESPA 3WY2A 4KX8A 3T4AB 4XPBL 2XXFA 2D7PA 5I0WA 3HE6B 1MWAL 4RRPA 4ZMTA 5HHPA 4IKJA 2VW7A 1YEFH 3BCDA 4PCYA 2HPTA 4MMXA 4FA6A 1P4LA 3CUPB 2FSDA 3T0EB 4RFOL 1KZQA 1M57B 4N2BA 3RPIA 4YSEA 4P2QB 3O3DA 3HI6L 3KYOA 4D7PA 2IQ9H 3B2MA 5IROA 3TX4A 2AQTA 2X4QB 3QJZA 4KY1L 1U4FA 5HDBE 5BVPL 3PWLA 3LH8A 2N7AA 2ZYRA 2F0CA 2CLVB 3IMRA 4NKOB 2EVJA 2WWNA 3LRGA 4JAMA 5EIIB 2DQEH 4XH2A 4F5CE 3MFFB 4MJ5A 3UJTL 1KCRL 2WYZA 5CWSB 4QRRA 1D5ZA 1AQ8A 4WQOA 3MKKA 3OMNB 5DJ6B 1YY8A 5JDSB 3L3DB 1F1GA 3PP3K 2WN2A 4N25A 1UZ6E 3DPBA 2ZX5A 5GHWL 4FULA 3Q2NA 3EH2A 5I0XA 3TWYA 1RMFL 4CNIA 5L0QC 3MCKB 2XVGA 1A14L 1M6OA 3ILEA 2AK4E 4Y4HA 4JO1H 1PFCA 1JWMA 3BZFB 2NY2D 2A9BA 5FHBL 1QP1A 5ISZA 3UEZA 5D5MB 4UV7H 1R24B 4MXWH 1HJBC 4QRRD 5D1ZI 1AR1B 2D8KA 4Z7OE 2X41A 3IKCB 4LSVH 4N8PA 3DC0A 5DI8B 1QD0A 5IBUG 4JX0A 3IXAB 4Q8BA 3P30H 3VO0A 2Y6TE 1KLGB 5HPMA 5CJ5A 5G5DB 3P4LA 3LKNB 4OFIA 1CJYA 32C2B 4NN6C 4I4WB 1GGCH 4KI5D 1C8PA 3U7YH 1K6QH 3QDJA 3N9GL 3RWHA 5TH2A 1JI1A 3W11D 1DVUA 2HRGA 4PRNA 3TH2T 2AJVL 1T66C 2BSTB 4L29B 2VR6A 5EO9A 1YEDB 1RSFA 2NZ1A 3CH1A 1YAZA 4ENZA 3QUYA 7PAZA 3BGFC 1R0AL 4OD2B 3Q8FA 1UCBL 3OR6B 4XWGH 3SO3C 1ANUA 1MHCB 3FQRA 4K94C 3U9PL 4UTAH 3UBXG 5EUOB 3R0NA 1F4AA 4B0MB 2I69A 4NQCE 5F1KC 4IEFA 1QI4A 2DQCH 5MERB 4J3BA 4XN4A 3K6SB 4N1EA 3L95A 5CGBA 4HWBL 5DURD 4MYWB 3MAWA 3CBRA 2V8MA 3TWCH 3ZE2B 4B9FA 2FAUA 2HCZX 3DUSA 1OPOA 4HSQA 2WCPA 5T3XL 4PRIA 1DCEA 2Q1EA 1D6VL 1EDYA 2D3JA 1JWUB 3QAQA 4HKBB 3STBA 1A2YA 3O9WD 3QQ3A 1F41A 1DQTA 2APBA 1GHFL 1LYQA 5HPOA 3F7PC 1CF8H 3ULUD 3QPXL 1O9VA 2AMUA 2F5AL 4RDBA 4ZMNA 4K7FB 3CPLA 3LOWA 5DVLA 1JD9A 1OTUC 3BGAA 1WK0A 4NQDE 4CKVX 4XGZA 2WXQA 1J8HE 4JFOA 1ES0B 4XNBA 2DLFL 3L3OC 4Y4HB 3TH4T 1RV6X 4PRPB 1IAIM 5HI4C 1T5WB 4BINA 1KJVB 2HG5B 4PBXA 4TUUA 3HI6H 1BZ7B 1ZK5A 3L3JB 3KLLA 4RFOH 1C5BH 3FRPB 1HWWA 1EEQA 3FW6A 3GSQA 3O2WH 4KJYA 1Y18A 2BMKA 4U1HA 4IIQC 4Y4FD 5F0LB 2VQUA 4GRLD 5E5UB 2O6DA 3IDGB 1M2OA 3EFOB 1TZIA 2BIHA 3OKMB 4GB9A 1BX2A 4XXWA 5IQ7H 3V6ZA 3PXLA 4AQEB 4H25A 3IBEA 3ROLA 4MBOA 4AJYV 3Q8CA 5GGRB 1PDKA 2NOYA 1A1NB 2ZKHL 4CW1A 3NG5A 3GMPA 3HE7C 1VEMA 1OT4A 3QZWA 4XT1C 3TFKD 2WLYA 3PDOB 4ZSOB 2EYSB 2JVUA 4FX5A 3WKNA 4XVTL 4N2GA 1QSEA 2F6AA 2KDYA 1A5FL 2OL3H 2NY2B 3GXNA 2I26N 3V2AR 3S2AA 1WFMA 3JBG7 3MRCB 2NNRA 3N6YA 3QIUA 4XRCA 2V5TA 4JZNA 1QI3A 1RZ7H 1KLFB 2X4PB 4AWJC 2BCKA 3LKPB 2WUBH 3ES6B 3HFMH 5I8OH 2P5EE 4G5ZH 2XICA 5CCJA 2BP8B 5J1AB 4X8JA 5E1QA 4MMYA 4DOHE 1XGQA 3DARA 3DUHA 5F93C 4UIKH 4P46A 1S7SB 2VMCA 4PJDE 3PCYA 3QEHB 4QF1B 4GKZA 1INDH 1AFVL 1JGUH 2AANA 5A2LH 2ZPKH 3HBQA 3UCQA 5DD5H 2YRBA 4TPRL 1OOWA 5HYSG 5K69A 4HKZB 1DVXA 2G60H 2FR4B 4X5XA 4HAGA 3S8WA 4BELD 2GB2A 5AAPA 3IMWA 4XVUC 1VFAA 5DXWA 1SBSL 3QJTB 1QKZL 4QRPA 3AACA 3UC2A 2O5XH 5DEGA 2K4WA 1MI5D 4FG4A 5EH1A 4Z0XA 1A6AA 1U8OB 4DP4X 5F0MB 5I66B 3ECBA 4OZIA 3EG9B 5E2VL 6PCYA 1OQXA 4LLAA 3JWOL 5JLZB 5FHAH 1A0QH 3P3SA 2HX8A 2ROYA 4P4KB 2VUOA 1OOAA 3HRZC 1N59A 3GSQB 5C0AE 4BYHA 4G9DB 2EAEA 1WC7B 1A4JA 2MKLC 4PJ5A 1ID2A 3QHZL 2QKIA 5I1DB 1RU9L 3NAAH 4DGYL 5ESVB 3QCTH 5E9DE 3QYMA 5KVFE 1RIUL 1T0OA 1ZGLP 1A1MB 5I9QB 1YPZB 4M7LT 2V3FA 1MFNA 5ITFA 4IM8A 4OD3L 4ONGH 4M8QA 3QVAA 2HVJA 4BCZA 3B3IB 1Q8MA 4E36A 1BFSA 2GT9B 4Q52A 1G6RA 3EF4A 4AQZA 3WEXB 4JFXA 3C6LB 1BWWA 5FF6A 1M42A 4NI6A 4D0BB 5LAPA 2VLRA 3RTQA 1MRFL 1HZKA 3QR2A 5L88H 3V7AG 3ATEA 3QWRA 4O5LL 3WDJA 5L6YL 3VW3H 3OAZH 3LKSA 4QPEA 4KXZH 5A43C 1PD1A 1A4BA 1E7UA 3R4RA 3K7UA 3QRGH 3HN5A 5DUPL 9CGTA 2EZ0C 1ZAGA 4JKKA 2H6OA 3S34H 3ZDYF 4NQSB 5HHNA 3POHA 1JYXA 2ZOLB 2HZHA 1IEBA 1K2DB 3TWCL 1Q90A 3CHPA 1XEUA 2ENQA 5AVWB 3LRHA 4B0MM 4H4NA 4GPVA 2PUQT 4HUXB 5MERA 2AI0H 5IHZB 5D72H 2WINA 3ABLB 4M02A 1MJ8L 4PJIB 2D0HA 3MRRA 4P2QA 3CCHB 5HDRA 1H8LA 3BH8A 2H32A 4HGWB 3I9GH 3ARFC 3GM0A 1GGIL 3LEXB 4CSZA 3S35X 4K94L 1V7ML 4F9PA 1U2YA 2FO4B 4FS0A 2VL5A 3W38A 3NPSB 5IMKB 4B7LA 5IOPA 4H44C 1H0DA 1QFWL 2OTUA 5L2KE 1RIUH 1OTTC 2JH2A 4U31A 2SODB 1U93B 3WNMA 4ZMOA 3PPSA 5GZOD 1H3XA 3MV01 1T1YA 4FZEL 4OLWH 2XQBL 2BSSB 1MFCL 3WUZA 1J05B 4BFFA 4BKLB 3RWFB 4FC3E 4YPGA 4Q9BA 4OZFH 2C3VB 4QNPE 2W65B 2MNJB 4XHJD 4MNHB 4ODVL 2VERN 2FGWL 5EOTB 4U6YB 3FC8A 4XB7A 1IGML 4MDIA 2BC4B 1A25A 4ELKA 3OJDA 5C0DB 3FU7B 3MRHB 4NKQB 4AL8C 1XDTT 1FUNA 5A2FA 2RMNA 4ABWA 4AGLA 5KG9B 2BWQA 3KBHE 1XCXA 4G72B 4A37A 1BV8A 3RVWD 3VMNA 1RZGA 5HJDA 3JTTB 4HC1A 3MCYA 4GXUN 1G4MA 4IGBC 3NUKA 2I24N 5E8NA 4DEWA 2R1WB 2HTLD 2XLLA 4BHUA 5E4EC 2XWCA 3PJNA 1CF1A 1TJIL 2YWZA 3DIDA 2A6JA 2HVKA 2K6YA 5B7MA 2DYPA 3GHEH 1UKSA 2HKHH 5F3HA 4V2BA 4Y4HD 3VXSB 1I82A 2ORBH 4E0RB 4P5KB 5DK0B 4IS6A 1DBKL 5I6KA 5CD5D 1BAGA 4HULB 2R9HC 4KGJA 5JHDE 1NCTA 3SDCC 1DBKH 4G43A 1V05A 1CFQB 1DDTA 4C54A 1JPGA 5GGVL 1HXKA 1I1RA 1T2QL 4GLRH 2YPLD 3TIDA 5CR8A 4Y5VB 3ABMB 4X7CC 3HC0A 2CO4A 4Q9QL 2CNYA 1XZ0B 3L9RB 3STLB 1Z5HA 2ZNXA 2ZOKA 5C0EB 3TJPA 1RIVH 1U8PB 1Z32X 1QPXA 4ODWB 3WHXB 1KN4L 4LU5H 2ADIA 5D7JB 4JKPH 3CVHA 1JGIA 2IALA 35C8H 4U1IA 4N0CC 1JFQH 2JNZA 4FQXA 2GIMA 3QDGD 4AVJA 2UZIH 1NAMH 3C8DA 3THMH 2KPWA 4FFYL 4JREB 5AZUA 1U3HC 4OFQA 2CJTA 4P5TB 3O4OB 4NKDB 3AUWB 4XVJL 1DSFL 4FP8H 4ZUWA 1OCOB 4I3GA 5B39A 4C57C 2JK5A 1U93A 5D55A 5E56A 3U9PH 2YK1L 3IU4H 4UTAL 1F4XL 1KLUB 2GHZA 2OYPA 1BOGB 2GIXA 2R7EB 3HC2A 4M7JH 4WI4A 4GLRI 1HIMH 2FUQA 2J20A 2N4IA 4FJZA 3HNTL 3Q5TA 4Y16C 3S37X 2AJXH 3PWPD 4AQOA 4F1ZA 4HUVB 3CSPA 4GXVL 4JFSA 3OHXC 3RJQB 1H8NA 3ENEA 1JRHH 3CFUA 5SWZB 4RCAA 5D1QC 1AGEA 1SLWA 4J28A 4XZ4A 4JS7A 5D70L 1FORH 3V0VB 1DJZA 2VL5B 4MJIA 4DP8X 1S78D 2P1YA 3M45A 3G6JB 2V9UA 5AOLA 5ECGA 1MLBA 3GQFA 3QWQB 4JNXA 4YAQA 2ZSWA 2E59A 1JSYA 3FUIA 3ARSA 1OAQH 2WO4A 5DZ9A 5C07E 1MCBA 1GHFH 1UJ3A 1W15A 1SJEA 2QHRL 2R56H 1TSHA 2ICCA 2BS71 5SX4H 2XXMB 4ZO9A 4PP1D 1HS6A 5KYYB 1LQSR 1NCNA 5KEZA 1CD8A 1XIWD 4PJIF 4GP4B 3OHXA 1UENA 2DMGA 2VC2L 4PREA 1CYWA 1DBMH 2KZWA 3KM1A 4IYKA 5IT2H 1B4RA 2IPKB 3MLTB 2YPKA 2Y07L 4AQAB 1IFHL 2NY1C 2VLRB 2XT1B 3N40F 3QEQD 4K5NA 3ZO0A 5J11B 1I8MA 4XE0A 1DLHA 2NUTA 2Z4TA 5JOFA 3L2NA 4LHUA 1PY4A 1OM9A 4DKEH 1JMZA 3JV0A 1HIML 1IC5H 5IVZB 5K9QG 5BV7C 3ZDWA 4DZBB 4F7KA 1KTCA 3FSAA 4M61B 3QJHB 1GS7A 3NCJL 4A6YL 5B4MC 4WKXA 4WUUA 5JW3L 2OXHA 1YNKH 1DQLH 1JZIA 1F5WA 4MAUL 2J21A 4H1LB 5JR1L 4UDUB 4GP5B 3H6JA 4AGMA 1F97A 4L1DA 1E4JA 2A7BA 2ZOKB 4M6AA 3KDMB 1RZKH 1CUOA 2WLHA 4XVTH 4NCC1 4OGQC 1UOVA 4HIEB 3U0TA 4NBZB 3FYEB 3SD5A 5I8EB 2B14A 2WOBA 3LEYL 4O02A 3PL6D 1XVSA 4JCLA 5J57B 4WI8A 1BVZA 3MRBA 3APMA 5B21A 1FPTL 4G6MH 1MNNA 2ZXGA 1KN4H 2VLRD 3K4ZA 3QEQB 1F18A 4LU5L 4M7ZB 4OZHA 2Z1KA 2QT6A 3CTTA 3OQRA 3PIQA 4AGQA 4E5XA 3PWJB 4P2RD 1LEIB 3SDAD 1H3WM 5LBGA 5JIIA 1BA9A 4FYRA 3QRFM 2CDGB 1TT6A 5EU3A 3SQRA 1F3JA 2M1KA 3FUKA 3NEXA 3QHTC 3TTSA 3H9ZA 3K0YA 4XBMA 1NGPL 2OPCA 2OW7A 5FGCB 5J6HA 2X6VA 2LU4A 3HS0C 5GS0L 4DEPB 3AQZA 3VD4A 4NZRL 3IFNH 2GAZB 5M7QA 5CP3H 5K9JL 1KJVA 1FGVL 5L9DH 4AZ8B 3DX8A 4MA7H 1OM3H 4OCXH 1QQDB 2WZ5A 3ZHNA 3WL9B 1WBZB 2IBGA 4NGHH 2A74C 1BBDH 4KRPC 5D1QB 4P05A 4TUOA 3D34A 1A7PH 3GS0A 4NAMA 5C0CE 1I3GL 3N43F 4F8LA 3BJ91 1L9QA 3DV6B 3GLZA 4NQED 4FYTA 3TA3D 1QBAA 2W88A 4H26B 3WO4C 5E6ZA 3GM8A 5C0ND 4OI9A 1VESA 2WY3B 4JRLA 3CVIH 2OZ4L 4J8RA 5JHLA 2ZUYA 1UZ8B 3T3PF 1J9SA 4URKA 5MEOB 2VAAB 1KIQB 1N67A 4LEXL 3BKJL 4Z7VF 3MRRB 3S2CA 4P9HC 4KTDH 2RGSA 5FLUA 3TA3A 3ZLQC 4MD0B 1BGXH 3ULVF 1O9ZA 5EWIL 1Y18B 2BMKB 1OTTD 4U1HB 5F3BA 4J3SA 1X44A 1IUZA 1MWAB 5JOPE 3KCWA 2ENPA 2Y1VA 2HFFB 4HJTA 2EIDA 2X05A 1M71A 1NUNB 2MCMA 5EC2B 1UA6H 2M26A 3IJHB 4HZLA 2FQEA 5F9JA 5TFSH 1IAOA 4F7TB 5D1ZB 4JG1H 2B3RA 5KJ7E 3K6FA 1AD0B 3BVXA 2NXYD 1KELL 2VDOH 3EXJA 1F11B 2YD1A 4N8UA 2R0WH 4FD0A 3PWNA 1GMIA 3IS1X 4XB8A 1N8OE 1F6AB 1XCQA 3RYMA 3IDUA 3BLKA 4MMZA 1SXBA 2ITFA 1CGUA 1HEZA 4MNQA 2WXGA 1GY2A 4MFHA 5D9SB 1CS6A 5DS8A 5LNDA 5CJOL 1KC5L 4GQPH 4J3OC 2CKBL 3BN9C 1AYOA 3K71B 1SMDA 1SJHB 1KBPA 1GJIA 1KG0A 2HT4C 4JM4H 1LP9F 4NN6B 5IW3A 1Z9SB 3TYFA 4YLCA 3X17A 2VQ1A 4ZTOH 3CVHB 3L4TA 4U1IB 4HJ1A 1VACB 3SHSA 1IBGH 3ETSA 1SOQA 1ACYH 3K2KA 3LSOB 4OB5H 4GQ9H 3MLXH 3UTSE 3DXAA 1R3HA 4UDTA 3RWIB 3V0DA 3FFDA 5ESVA 3BIAX 2GUOB 1G7JB 3VI4B 3R1GH 4OD3H 2A4ZA 1BFOA 3OWEA 3HHRB 5A2JH 2R29H 2EQDA 4Y5VA 1HHHA 1QBLL 5FO2A 4DCQA 1O6SB 1USZA 4KI5F 5DFVD 1NCCL 4HCIA 1HJCA 4K3DH 3HLAA 2DS4A 1R3JB 4JL1A 4KJQD 1FSKC 5C0CB 4V11A 1FZMA 2XPZA 1W0WA 3EG9A 3H7BB 3X12A 3A67L 3CV5A 5DHYB 2BNRA 5A2IH 4I4WA 1G7PB 3JWNH 1IM9D 4GAGL 5CR1A 1KPUB 1PX3A 3HVDA 4Q0XL 3IDJB 1REIA 3QISA 3UCRA 3VRIA 5D1QA 2VLKB 2AJSH 3E3QC 1PSKL 4LCIL 4MJJA 2UWEE 2Z31C 1GYUA 3KVPA 1ORQA 3C60B 3DV6A 1DDHB 2AEWA 1GGUA 4U1NA 4YDIH 5BW7A 3VFSA 2OMTB 2ZOUA 4ODSH 2XWZA 4AC4A 3CHRA 1PKQE 1I9JL 3RGVC 3S3DB 2OK0L 4P4KC 1BPLB 2VR9A 1H9VA 3EOBA 4UU9A 2CHXA 2KBGA 1PD6A 5FO9A 2Z92B 1MJ7H 2C7UB 1RZPA 1M6OB 2VDRL 3BMVA 2YMOA 3WO4B 1E8XA 4P2OC 5FPIA 4IOIB 4X6FB 4JZJA 5C9KA 1QFPA 1L7TL 4DK3A 2CIIB 1IILE 2IV9A 3PWVB 1DSYA 5E5RB 3TCLA 3NSFA 2QR0A 1G9NH 1HI6B 1TCMA 3GKZA 4BE6A 5TPWH 3DTXB 3U4KA 3KPMB 1CT8B 4Z7VA 1G84A 4K4KA 3WHE1 1OSYA 1ZT1B 3CG8A 3AG2B 3W37A 1PMYA 4XCFH 3MGTA 1X9UA 2F19L 3A5VA 1NC4B 2OJZL 1AXSA 4PD4J 3ZUCA 4B97A 3X3FL 4QRQB 3ILQD 4XCNB 1FL5A 3BZ5A 3VWKB 3UDWC 5B3NA 3BP7A 2P43B 1OF2B 3FCTB 3LN5A 3VFUB 2E27H 5J12B 1A9EA 2A4CA 4QXGL 1E6JH 3WE6A 4YNYA 1GSMA 1X7QB 3WSQL 1WBXA 4WO4C 4LKXA 3RVXD 3LQAH 4YR6B 5FYLH 4YHML 4CVZB 1PQZA 2WSPA 4YXHH 1BM7A 1J86A 1FO0L 3UACA 4AEHH 1HZLA 2Z4QB 3UO1H 3QBTB 3QDMD 4DNLA 5LKNA 3TN0A 2VT0A 1OAZH 4JO3H 4KFMA 3RX7A 3TCXA 4WK0B 5D6DC 4GRLC 1DP0A 2CAKA 1LEGB 1RZJH 1U2HA 3D0LB 1UM5L 5DD3L 4OCXL 3W0WE 2HTLC 5ACZA 2X89A 1MVUA 2PYED 3IVKB 4FEMA 1PX4A 4OM0L 4XMUA 3GPSA 1I8KB 1QEXA 4CU7A 3U9UB 3HI5H 2ESVB 3K4DA 2AERT 3AQXA 3S5LB 3IDJA 3MNDA 3CU7A 3O45A 4KUZH 1XIWA 5CKGA 1LO5A 2DN7A 3CBKB 5D2LF 3MQIA 1NBYA 1TZ8A 2LABA 2DLHA 2E56A 1XR9B 2GJJA 4KMQA 4KHTH 5EU3B 2VM9A 3M1BB 4YXKL 4B6ZA 5IVNA 3CK0H 1DN0A 3MJWA 4KPHL 2Q6WA 5KOVC 2Y06H 3T2PA 4X9FA 3SGDI 4Z18A 5F88A 1UWXH 3QPXH 4PJFB 5GZOC 1W0WB 3H7BA 4AKOA 4XN7A 1TFPA 3M7OA 4GW5B 1IGCH 3LX9A 4P23C 3HUJB 4GEIA 2J88H 3KYMB 3MRBB 5I6MA 1T5XB 2V2XA 3H2WA 1KCSH 2OZ4A 3SD2A 2PLTA 1HHJB 5I1KH 3FONB 3OKMA 1FO0B 3GRBA 4X9YA 5GJTL 1JCVA 3BPNB 1J48A 4OLVH 1I7TA 2J1WA 1CURA 1X7TA 2XWRA 2XKNB 5FECB 3D48R 5ESAB 2ENJA 4BZ1H 1WZAA 1Q9KB 5LVEA 1F13A 3WAJA 4PS4L 4PMFA 2Y7MA 3D2UA 4IMKA 5HI3C 4FG0A 5DWUH 4M48H 3T9WA 1W9XA 2XQYA 2L3BA 1KFGA 1SYVA 5GRZA 2ZKXA 4IU3B 2IBZX 1PF3A 3NK3A 4DGIL 1P6AB 4TS6A 4W6YB 2P5WB 3TESA 1AVAA 3IF1A 3IMSA 4TVPD 5HGBA 3TBVB 2A73A 4CN4A 1B4JH 1EH9A 2H1PL 3D3VD 4ZDHB 1G87A 2PCFA 1X3DA 2I32A 2UY7A 1GJWA 3P4NA 3VM5A 3QH3B 3UTQB 4HK0A 3WEOA 5ACZB 4I2XE 3CZSA 3NGBC 2GJZA 4N2CA 4HIXL 4CVXB 1FV1A 4PJCB 2UZIL 5T5NF 3OKOA 5CNHA 1NDTA 3G6AA 3QDMA 4MXQC 1YEEL 4NUMA 1E30A 35C8L 3UERA 1ZHBA 2WQSA 3H9SE 3QUZB 3V0WH 2P44B 1E9OA 3RFZB 4LSUH 3KL0A 4XXWC 3VI3E 3ZTNL 2Z7ZA 5BQDA 1QKZH 5EF1A 1L9SA 4RSVA 2DIEA 2EDLA 4NS0A 2AXJA 4G83A 2WP3O 2FJSA 4V1DA 5F97E 1T03H 4Y5XB 2XUWA 4HWEL 3QP3A 5AUMB 4MA7L 3I85A 5A2CA 3MJ9H 4ANWA 1WTLA 2D9QB 1RUPH 4QO1A 1M3JA 2ITDA 3VVVA 1TZIB 3C75A 1QNIA 1MFAL 3LKNA 4B9IA 3KYNA 3GXIA 5FW8A 5DSCB 3VD2A 4KC3B 3E6HB 1S4IA 4M4PA 4NPKA 4Q4EA 5A6LA 3PQYD 1TEFA 2E7BA 5F9AC 3BW9B 3GRWL 1NOLA 1TJHL 2X6MA 4ZS6D 2YAOA 1ZLUH 1FJ1B 5G2NA 1H15B 1UM5H 3ZYZA 5AG9A 5KS9B 2DYRB 1UD3A 4P3DB 4OZHE 1UGKA 4P8QA 3WS3B 2KZ1B 2DV6A 1U3HA 2X4RA 3V0AC 3OGCB 3CSFA 2B59B 5SWSB 4P57B 4RDQG 4L1BA 4N2LA 3HE6D 1H6UA 3VYPA 1NIDA 1QLRA 3KPLA 2Q8AL 5KBLA 1WICA 2APWA 4Y88A 2VLME 2P5ED 1GYCA 4JPKL 4OAWB 1XSJA 4Q6IC 3LJ3A 3OAUL 4MCMA 1JK8A 4DFIA 2DIJA 4AMKH 5KYWA 2I9LB 3FBQA 1IJNA 2J4WL 1FFRA 2IPTH 3X3FH 4QRQA 1W8EA 2VDLL 1CFSA 5FYJE 4I5BB 4X6CF 1NOAA 4G9FB 4DVBA 4M7ZC 3MPCA 4MB1A 1OK8A 4WIQA 2YZ8A 3KXFD 2YR3A 3B2VL 1ED3A 3PUUA 1QO3B 3CX5J 3IWUA 1NKRA 1MJJB 1T7ZA 2OMWA 3VGEA 4F27A 2F53A 2CKBB 3K72B 2C34A 3S88L 2C9XA 3I75A 1NZRA 1YUHB 4ETYA 2CJUH 2K4AA 3O6ML 4KXAA 3KLKA 5CS7A 2OTPA 2E7DA 3OB8A 2WINB 2HG5A 2NUPB 4DKFH 3BESR 4PW4A 3TCLB 4YDVA 1DQJA 2PO6A 5KANI 1B2WL 2H4EA 4FGMA 1AIFA 3LPPA 4Y4KC 3DXAD 1TTGA 5CEZH 3ARDC 2DQFB 3CLEL 5BO0D 3H53A 1LDPH 3MZGB 3GZKA 4IBUA 3DMMC 4BHUI 1CLYL 4HK0B 3PWPA 1RUAH 1CLOH 1KB5B 2ZP0T 2FWSA 3OPZL 4LSDA 3KCPA 1LL1A 1EMTL 4FYQA 4I18B 3S5YA 3F6IA 1XQ4A 1XT5A 4QGTA 4F2MB 5HVGB 3KM2A 1FVCA 4GUPB 4X99B 1G9HA 4OGAD 4KKAD 4NHCL 5IGXL 4TVUA 4LCVA 1T0MA 1A6WH 4ANKA 3BP5B 1X5GA 3GC3A 3L9EA 4GAYB 3GUFA 3EKCA 4WEMB 4BUHA 2ZUWA 3NZUA 4WY7L 1WIUA 3VU2A 2GT9A 3C60D 1Q9LB 3OG4B 4FTVD 3VQ1C 3FOLA 1ACXA 4GSDL 1KXTB 2QBWA 2VXTL 3Q9PA 4RMWA 2JJVA 4N0UE 1OARL 2N1TE 1HNFA 2HH0H 2Q87A 3ISYA 5GRWA 4NAQA 4X42A 4JFWA 4Z7UB 1VGEH 3BKYH 2MTAA 1F4XH 1U36A 1G7IB 4R0LA 1T7WA 1NANI 1X7SA 1U8LB 3BVNB 3T65B 3FO9B 2BZCA 4YGAB 5IFAL 2AKRA 1FG2B 5TDOA 5IKCB 3SDCB 1YAIA 4J8RB 1HFUA 2OW6A 5B8CC 4TVPH 4PTTB 4KDTA 5K9OB 3K91A 4RFNC 4OV6F 4KVPA 5EU6E 4FQ1L 1DN0B 4Z0XB 4QRBA 2F18A 2WAQA 4R7LA 4TV3A 4QTHB 3V6FB 5BMFH 4B9YA 2UZXB 2Y06L 3D5OF 4X5QA 3HHSA 1U8HA 1EAOA 1PG7H 4KOCA 1OWRM 4RZKA 2YMXH 3UZVB 3MLSL 2ESVA 3UP6A 4EO5A 1MIMH 2R0LH 4I0PC 3O9WA 2O6CA 1RZKC 4K5LA 1FGNH 4Y4KB 2OCFD 2ZWZA 1E4WH 3ECQA 4P5TA 1YY9C 3W3BA 1B0RB 1I1AC 3HC3L 3L4XA 1FH5H 2JSFA 1IGYA 5DRXA 4QRTB 2NY7L 2TAAA 2K0RA 1DYZA 5DJCA 3WJMB 4TL4A 1T1ZA 2NSQA 2VLJB 2PTTA 3SYCA 2DZEA 2JJSA 3OV6A 1S5HB 1DVQA 4OJCA 1GAFL 1G0DA 2HJFB 2J6EA 4JZNB 4YSQA 5BV7H 3ZTCC 1YEGL 1YMHA 2YSTA 4KO7A 5LWYH 1SDAB 4KKQA 1OAKL 3EZJB 3LKRB 3B2XA 1DFBL 3ZE1E 1T3FB 2ICEA 4BWWA 3WTUA 4H7VA 5B1JA 3VXRD 4F7PA 4PGBB 3WIIL 1FIGH 2W60B 2DYPB 3EFOA 3AABA 3D3VA 4UTBL 1BBJB 3NCEB 4WV1C 1ZLVH 5DJAA 4NAJA 4MVBC 5C9JA 3CXDH 5HYFA 3PJLA 2Z7UA 1A7PL 3BC9A 2P7TA 1KPRB 1UA7A 2IAAC 4XNDA 4HPHA 3UBFA 1VFAB 3CHOA 3VFGH 3G6DL 3IJYB 1VADA 3GI8H 5TE7H 3ZMNA 2IGTA 3DVGB 4HS6B 3T6ZA 2JWYA 4QLRA 3VD9A 4YHPB 4QRUB 3C8KB 2H3NB 2NX5A 3NH7H 12E8H 1WD9A 3QIWC 5FGRA 1IAKA 1M05A 4NQEB 1QHPA 2GJRA 4I88A 4HV8B 1WAAE 1KZYA 4Z0BH 5DLML 2WN3A 4ZK8A 1E4WL 4ZD3L 2ZCHH 3MRHA 4PJEE 3L54A 3NJMA 1RI8A 3KPRE 4UOW1 1MIML 2R0LL 1MH5B 4QJ3B 3FZUD 5DC0A 4XP9H 5GGTH 4TQ8A 3DPDA 1ZT7A 3EO1A 4JM2C 1WTGT 5EN2A 2WXNA 4HWEH 1U9KA 2F58H 1FFPB 4LRIC 4PJDA 4U7MA 2OR8A 2I7SA 1DJHA 1R19A 3S35L 1NA8A 4FI7A 2QKSA 1X6LA 1I8LA 3CFMA 2Y2TA 4N2AA 4FLOA 4RAHA 3ZKSD 1OF2A 2XIIA 3FCTA 3LN5B 4JGMA 4YUEL 5FGCE 2WLLB 3F7RA 3KPRA 1KXVC 1XB8A 5EU5B 4PMEA 3SDAB 1TQTA 2KKQA 4W9FC 1RPUA 4ZAKD 4V1DB 2XC8A 1OSZB 1DEEB 2BJML 2PTTB 3RZCD 2M2DA 3WKPA 4C4BA 2JQZA 1OLZA 1YMHB 4PWKA 4NRZA 4HS8H 2LTQC 3QEQE 1FORL 4LLWA 4EI0A 2BP0B 5DWPA 2QSTA 2I7OA 2YD4A 3OKNB 3X14B 3GHBH 4CSPA 3FN9A 1C5DA 1A9BA 3NRQA 1MFUA 1INQB 4U3SA 4HH9A 2QSVA 1S2EA 4YHZL 3NCXA 3ZKXC 2PW2A 1RZFL 1UZGA 3ESUF 2E7LC 2HP4A 1OZUA 3EOTL 1LO5B 4UM9A 1MLCA 1RHHB 5IJCC 3AZUA 3C5SB 5JW5B 4WDIA 5E70A 5G4MA 5C6WH 4KZEH 4JMNA 4O2FA 5J7CC 4XWOC 2EEXA 5KOMC 2IH3A 3T2QA 4DEPC 1M7DB 4HJIA 4DAGL 3U1SH 2WLIB 4PJGF 1KWKA 3C87A 1JDCA 1EFXA 1IGFH 2CDFB 4BFBD 5I5MA 2YZ1A 3AW5A 1F4WL 4XI5D 1VSCA 5ANME 3CZGA 1J9CT 4JANB 4YO0A 2AF2A 1CGYA 2IOIA 2WXKA 4YIQA 1UT1A 4Z8FL 1IEAA 1EEYB 2CLVA 4NKOA 4JFED 4Y4KD 4X4KA 1I1FB 2AKRB 3Q3GA 5TDOB 2CBTA 4XO4A 1IO4C 2UVEA 1UXSA 4FFZA 1DJSA 4K23L 4WF7A 3K72A 2X2UA 1MHCA 4H88L 3KPNB 1MCFA 4F15C 1DJXA 4J3OG 3O41A 3AU0A 1GOGA 2R2BB 2ZTBA 3TP4A 5AVYB 4KVCL 1FN4B 4HKXA 2P24A 5MI0C 4GAYA 4ZNCD 1V5JA 4OCYL 4QHUB 4OJEH 3DX0A 3US1A 1MFDL 5EULV 3DROB 3CX2A 3G5VB 3ARDD 4OY9A 2IEPA 3KBPA 2VDQB 1K5WA 1BEXA 3B7RL 2L0DA 1CDJA 3PWPB 2NTFA 5H4YA 5C0AA 1EAPB 4MDJB 2MPAL 2DWDA 4E41B 1QATA 4S11A 1FNSL 5DQDH 1ND0A 1TQBB 5IY5B 3C6EA 5MENE 1TZAA 1M7IB 3WG7B 2BH0A 1MW1A 3MACH 4YHIA 4JKPL 4L2LA 3S35H 3OKYA 4QJ5B 4WCYH 4Q2ZA 3PWUA 3VXUE 2NW3B 3P3TA 2QZ5A 1T89A 2HFGH 4GUQA 2RALA 4MNHA 3NA9H 3S97C 5FB8B 2GHWB 4K8RC 3QO0A 4PGEA 3EGSA 2AEQL 3QG7H 1T4KA 3UTTB 5AB1A 2GY7B 3IAQA 3V79C 5C09B 2AITA 2CJUL 2ADYA 3FSVA 4K55A 2C4XA 1J8RA 3I3BA 5D7HA 4XBGB 3GNML 3ULSB 2QGDA 4S1RH 3ZDZF 5A1AA 3CZJA 4JO2L 1DQML 3Q1SL 4L5FH 4OZGF 1DN2A 5IB4B 3GLAA 3OVUB 4XC1L 2YAEA 4K2UL 1E4KA 3I6KA 3J27A 4UDTB 1CPUA 4B3VA 1W72A 1SFDA 4LL9A 4JZJB 4IOSD 5IVXF 2Y5TB 2BM3A 3P11L 3C6LD 3MX0B 2XZQH 3HMXL 3RAJH 1VZGA 4GSQA 3LPOA 3PABB 3AFLA 3HE7D 4PJXB 4U1LA 4XO8A 4XPFL 3VXSE 2B77A 2DB8A 1TVDA 4U7KA 3CFCH 1ZLUK 3EYVB 2XN2A 3RKDD 3EBIA 1M2VB 2CRMA 1UJ3C 4GFTB 2WVTA 3HNVH 2R39A 1JN6B 2ADGA 1ZXQA 1EZSA 5I18H 3VSTA 4DN3H 3D25A 4OSUL 2VSCA 2EH8L 2DM4A 1HC1A 5GGUB 4G7YL 4XZUB 5GS1A 5AFAA 2MOQA 2GI0A 4WJG3 3N1GC 1TMCB 3OKKB 2GBVA 3PQYE 4X7SH 5E2TH 3LIUA 3GDCA 4G7QB 1NSNL 1G7MB 4DKEL 1S7VB 1UQSB 4QXUL 1T5KA 4M5ZL 2NYYC 2ZSVB 4QYOB 2NDGA 4X7TA 3V9FA 1BJMA 2X28A 3ARBA 4NJ9H 1PCXA 3QQ9D 4ADJA 1PBYA 2RQEA 4LQFH 5C71A 5L2JA 1C08B 4MMXC 4A6YB 3MNMA 1MCLA 1WRFA 2KC0A 1GSKA 2WQRA 4OIBA 3ULUH 1E9PA 4S0TD 1TVBB 1AHKA 3OPZH 5ETUA 3HOGA 4HK3N 2X53A 4XP5L 1GA2A 1X5KA 1R3KA 4HIXH 3DK0A 4YDMA 3HKFA 2QV2A 3ELQA 1U8JB 2GJ6E 5CSBA 4KNTA 4JLRA 3ULVL 5C0GA 1L3WA 1HH6A 1WSST 4FKEA 1Z9OA 3TLRA 4X99A 5EO1A 4AGOA 2GPZA 3AJ7A 1NTDA 5IWLA 2G9KA 3PNWA 1N6QL 2ZPKL 3B9KC 2R69H 5C0FA 3LN9A 3L4ZA 4R8WL 1FZKA 4RX4D 5KN5A 4ZPVB 5F9WB 4AG4L 2H3XC 1MHEA 1QZ1A 1LWJA 3WO3B 1QLEB 1VLXA 5F7AA 2XWEA 1KCVL 2HH0L 1JNHB 4BH8A 2VXQH 1XF5A 3QFDB 2ZAGA 2V0AA 3DETD 1H3PL 1OCZB 3QB7C 3GSXB 3NYKA 4PLJC 1CLVA 4GS7B 5F6IC 4FF9A 2ROXA 2YK1H 3IU4L 5HDBF 4KI1A 3UBGA 4NCC2 4BZ1L 2B4CC 5FYJL 1ZS8B 3CLFL 4NWUL 5IZ7A 1WIOA 3HC4L 4LHUG 4WEUD 1S5IH 5JHDA 1GOHA 4U1JA 1JL8A 2NX5D 4ADGA 3LXUX 4J3VA 2OMUA 5A7BA 1UEMA 3KJ4C 1IARB 4YDNA 1TCRB 1AXTH 3IDYB 4WUUD 3B9KB 4FI8A 3KE0A 4ZI8A 2Q6WB 3DSFL 5M95B 4NT6B 4EKXA 2IDQA 4I8DA 3KYOB 2FEEI 3CVCA 1D6EB 5GHWH 5DRNA 3MO1B 2XN0A 1R4XA 5CGYC 5AENA 5BUAA 2JXMA 2JJTC 4ILDA 1GL4B 4IJ3C 1UB5B 5E5MA 1NANH 3EGXA 1DCLA 2NQCA 3CZFA 1GCFA 3QJFA 4ZAKC 2FNBA 4MQXC 3DX6A 3V0FA 3KD4A 3WMQA 2VIRB 1TYEB 3ATDA 1ZVSB 1A6PA 2VABA 3QUGA 1JPEA 5AWNL 2VXQA 3UAEA 4TNEA 5EA0L 5EPMB 2AEQH 2W91A 2YBGA 4L8CA 2EEDA 1NGWA 3UL4A 4OV5A 2Q8BL 2BXZA 1T03L 3EOBB 4UU9B 1ETZB 1AZNA 2IQAB 3K46A 4GSUA 1HE7A 1MXDA 1ORSB 1QWUA 3V6FA 3NFSH 1I9JH 3E1F1 2DIBA 1P7KB 3H42H 2DBLH 4JPVL 1M9SA 3VGFA 4U4IA 5F7NC 5L7XH 3S3SA 3T3ME 4OZIF 5ENWA 3MRQA 3C9NB 3CNKA 4JFPA 4P2QE 3FHQA 4KKCC 1XGPB 3BSGA 4Z7QF 1CD0A 3JWNG 2FO4A 2NT0A 3KS0J 4FQLL 5EUOF 3FK3A 3RDTC 3V4VL 2FQFA 4KOBA 1BBJA 5CEXB 4FRWA 1S9KC 1J0HA 4C4KT 1EO5A 3H55A 3SGKA 3T08A 1SN0A 3ZRCC 4X9GA 4PJAB 3QORA 1AXSB 1A1NA 4GRWF 4CW1B 5KVFL 5TE4H 3OR6A 1UJTA 3LNFA 4QWWD 4J2QA 3GMNB 4RIRB 2VDMH 3MYJB 4YFLI 1GGTA 2EICA 5C0BD 1FE8L 3EYOB 4P99A 1U8KB 2Y69B 3K1DA 4PGZA 1C7SA 2Z0UA 3TO4A 1VJSA 2DQUH 3RDTB 4U1MB 2YGPA 5BOZG 4HFUL 4GIAA 5DJ8B 1H9DA 3QFDA 1FNHA 4C83A 1AMYA 4UT7H 3NCYS 1VACA 2CD0A 2VDQH 4NERA 3VWKD 3EFFA 3GHPA 5DUMH 3SYQA 3U36B 4GUCA 5HPMB 5TJWK 4R5TA 5CSZA 1JWSA 4EIZC 5I1HL 2B1AH 1YRKA 4FQJH 4MZ2A 2W8CA 3O6KH 3GFUA 2O61A 1ZA6A 1AMXA 4GI8A 1X4ZA 3D1MC 2NSXA 2JCCA 3O6KL 5D1XC 1YEKH 4WI5A 4Z7VE 3WFZA 5ID0B 5IFJB 5FO7A 2NR6C 4JO4L 2Y7LA 5AW1B 3VFTA 1RAMA 5DTFB 4KJWC 1RK1A 2ATPA 2CQVA 2EIKB 4WW2F 5KBNC 3V4VB 3VYNA 3RZCC 5I30H 3DO7A 3MX0A 5DHYA 2EDWA 4PCKA 5EZJA 4AKQA 3ZO9A 2QDVA 1HL8A 4FCHA 1S78C 4KHTL 1CZ8L 4Q6IB 5I74C 2FB4H 1U8PA 4KXDA 4ZW3A 4ATTA 2JJSC 2X1QA 4BCXA 4TSBH 4QRAA 3P4OA 2WCGA 2WBKA 4KUZL 3WFEH 1CYXA 3L3HB 2H32H 2COQA 4QRSA 1GIGL 1SN2A 2HG0A 2V2XB 4G9DA 1CR9L 5TK2A 4PP1C 4DP2X 2NY0D 1A22B 4PY7B 2VLKD 2R4SL 1JPSH 1WWCA 4L29A 3VG0L 2ZCLL 2BS9A 5E99H 3GSNB 5FGBA 2R0ZL 3VGAB 2YUVA 5CEZD 1DQIA 1NMAL 2XZCL 4ODHL 4DUXA 1TVHA 5PAZA 4C56D 3OZ9L 2YJQA 4PRDA 3BQUA 4L5FE 4OLVL 2FX8H 1QWNA 3NJIA 4PG2A 1EUTA 5F7DA 5D9SA 2ZX6A 4XMTA 1RIHH 4L1HA 1PY9A 3TT1H 4GAFB 2ZXWB 5C0CD 1AJ7H 1AD9A 5HTSA 5C0NC 4KTEH 5I6NA 3W9EA 5SX5K 4P46C 3IJ7A 3IJEA 3MUUA 5L7XL 1M2VA 2DQIH 4GYBA 1U8QA 3SCMC 5FF6B 5JPMA 3T0AA 1BG1A 4QOKA 3GIVA 1NCAL 1Z1WA 3U2SA 1DVZA 3X3GH 2HJKB 2R4RL 3D12B 1FLTX 3KJ6H 4AYBA 4FXKA 1T7VA 1KCRH 5HHMB 2JCCE 4HPYL 5C2BH 4X5LA 3P0YH 1XGUA 2OJEA 1XGYL 5GS2H 2EE6A 2DJSA 3ARGA 2FBJH 3O6LH 1Z3GH 1HHIB 2Y7OA 1Z9NA 3D39E 2AK4B 1FNFA 2ZCKH 2G5BB 2FBJL 3OAYH 1FE8H 3KWUA 3BT0A 4OW6A 12E8L 1WQVT 5J0BA 4MA8L 3BUDA 3GLDA 1ADQH 2P24B 1H6EA 2VDML 3TPUA 1YLBB 4JB9H 1D5XB 4LAQL 3MRNA 3SKNB 1SJXA 4DZ8A 2NY6C 2EKSB 4TQIA 5B3SB 3H2PA 2FBOJ 4LEXH 2FGZA 4IGBD 2XNAA 4IRSA 4UQEA 5T1MB 1LMKA 3A4DA 5FB8A 5BRZD 3ZKXB 2C1OB 2NXYB 1OD7A 3EGDA 5LGHL 3R4DA 5LGJB 1CGVA 1HNGA 3OAWA 3ROLB 1S7UB 4OFYA 2H2SD 3QI9A 2VH5H 2L7QA 3EJTA 4QRTA 4IBSA 2YUZA 5HD8D 2ZOLA 3T2NL 3PP4L 1EXGA 3CSYA 3TGXA 4OBRA 1WFTA 2PW1B 2CKNA 3KR3L 2EDXA 1DFBH 4GXUM 4WFHD 2A9CA 1TTCA 1X5JA 2ZIDA 4W9CC 4Y2OA 4XAKE 5LWYL 2IQAA 3RVUC 2FRGP 5D7JD 2Y25A 3K6NA 4K7PH 4ZTEA 5TGBA 3SDAC 2MNWA 4HFWA 3EDFA 2QFPA 1QSFB 3OGCA 3FU7A 4WUUE 2BOLA 3MZTA 3C2AL 3QXDA 3O8XC 2UY6A 1UGNA 1XMEB 2LV4A 4FQCH 4OUUB 5DVOA 1JGEA 1HXYA 1NBZA 2A3TA 1H8OA 2ICWA 5I0VA 5I1LB 1BVKB 1OHQA 1TDQA 1XFPA 4XPHH 2YARA 5CLZA 1JNLH 3GMOB 5HYSA 4U0RB 2FB4L 4NM4H 3VXTA 1EK3A 3TOPA 4PJGA 1ONQB 4AJVA 1NGXB 1GMEA 4ZUSA 3MCLL 5FA3B 3NJXA 1MCKA 4ELMA 1XGRA 2B1HL 2BOCB 2A0LD 3QEGH 4M6NH 3PWJA 5JA9A 4QJ4B 3WBDA 4JN2A 3PE9A 5IT2L 3OD3A 5BXFB 4NO3A 5ID1B 3EADA 3VACA 2BW4A 3VGHA 5IHZA 4FQ2H 1RZ8A 3GIZH 4TSCH 3G08B 5T1LA 4F15B 1AJ7L 4B5EA 4HJSA 1MI5A 4ZUVB 3QUKB 4ZOCA 4DN4H 4ZW7A 2FT6A 4X8XA 2FYVA 2ZKMX 4WEBH 3U1SL 3UROR 1Q9OB 4BWUA 3MOAH 3NFNB 4OLEA 3HRPA 5E2WL 3P4NB 4LNRB 2DWXA 3HR6A 1OP9A 4E9YA 3AU1A 4UT7L 5HHXL 3DRTA 4I3SL 3D07A 4OGYL 4TN9A 5TH2B 5TE6H 3DDGA 2XYCA 3T1WA 5HSFA 5IEHB 2Q3AA 4M7KL 4DKAA 4DGVL 2CM6A 4YHYC 3O2DH 5I6XC 1JYWA 4AL8H 1EJOH 4HHWA 4MMZB 4U3HA 2J7LA 3A4FA 3T3MB 4ONFH 2XV2A 4Y2NA 4TTGA 1ET5A 3HE7B 3FT2A 3NIGF 1CZ8H 5ICXB 3U4AA 3ZL1A 3H7LA 1S3KL 2Q3XA 2ZF8A 1ZLSL 3L7FA 3WJLC 2WBJA 5D2NB 2H3NA 1J1OL 5GGSB 3NJLA 5C0BA 3R7RA 3U4BH 4OLZL 4YC2B 2ERJC 4JM4L 4RWYH 4OTXH 4PRIB 4OCWH 4D8PA 4JPQA 3K1KC 4GXFA 4FQPA 2XTLA 1K4CB 5BJTB 1UB6B 2I07B 5I73C 3GMLB 1HHGB 1PYWB 1H6TA 1TVBA 1KYDA 2JI3A 4BK8A 5EG6C 4EVNB 1TO5A 1IGCL 3G6JA 1X9QA 4GW4A 4KFZC 3WDHA 3UH8A 3JQOB 1T1WA 5DA4A 3MV8B 3IFOA 4M8UA 5FYKL 4RIRA 1UXWB 2ZWKA 1Z7JA 4L1LA 2NLJB 2G60L 3AXLB 5D7IF 2NY4D 3NQIA 1JG9A 1FGVH 1R17A 3GJFB 1AFVH 1JGUL 3VXMB 2A77H 2DF3A 4Q56A 5DU7A 4JVUA 1NBVH 5I73B 4MS6A 5EOCJ 4JZJC 2OKMA 2I9TB 4LLMA 4ZO6A 5D4QA 3PHOB 1V3MA 3EFDH 3EYFA 4BH7A 1G1CA 1S9VA 2KLRA 3QUXA 1DANU 2ZUQB 1LE5A 4ERSH 4QWWC 1FFOB 3ATBA 3GHEL 3LRSB 4YHNA 1V3KA 3UO8B 4C8XA 3WL9A 4XP4H 1NOFA 5FFGA 4DUWA 4WU5B 3MLRH 1ZGLA 5E1AB 2CXKA 4PJ8C 2EDQA 3TEXA 3UZEC 1P5UA 4BRJA 2D4FA 4F7EA 1KEMH 4U3XA 3TEZA 4LCCB 1RUKL 1J7VR 2VISA 2R2CA 2WXLA 2IG2H 4NNPH 3TO4D 3ETBF 5KS9A 3GSWA 4XPAH 2HKFH 4UT6H 1QSFE 3RIFK 4P2OD 5KYXB 5EEXA 2QQKH 4PRDB 1R3LA 5BS0D 3HC0B 2X9YA 2XQBH 3RUGB 1RJYA 1H3VA 2F19H 5C0CA 4CMHC 3MLVL 4ZQKA 3UG5A 5JQ6L 1EQWA 2FH8A 4H40A 1HEJC 2GK0B 3GINA 2R1XB 2Z31D 4UTAA 3OJVC 4XTRC 4C4KO 5ACLA 2J25A 3RWJA 3IDMA 4L4VD 2VXQL 3IMBA 2YPVL 1BQSA 1MREL 1CDCA 2IANA 3QHFH 1KCBA 5FOJA 5LHDA 2HWZL 1PYWA 2HX9A 5LCVL 3LDBC 4IS6B 3UZQB 3DLQR 2GFBB 3SPVB 4JPSA 1D9KC 3LD8C 5CBEA 1U8CA 3O4LE 1AO7D 5IBUB 1OP5K 2I5YH 1T1ZB 2H6PB 3MLUH 5CLXA 1Q9LA 1QLFA 3C5ZA 5KBDA 3W57A 2F74A 2OS7A 1V7NL 2KS0A 1J9RA 4JO4H 4ZRGA 1J5DA 4P3CH 2QDWA 4WWOA 4M5TA 1D5BA 3O3AA 5CJBA 1CLZL 5F7BA 3K8KA 1T22A 1MFVA 3WIFA 3N41B 1DHKA 3P9MB 5T3XD 3ARFB 5DO2C 3HZMA 3RA7H 1XO8A 3D52A 2DDQL 1RZKL 1UVQB 4HA1A 4YEEA 3VFWA 5GRJH 2J6EL 1FZJA 2XYBA 4MJ4A 1J0JA 1NFAA 4H0GA 3U79A 3U9WA 3VXSD 3OKDB 4FCAA 2BSSA 4EDXA 2ZG1A 4X6DB 2HT4D 4OD1L 4WUKL 4YBLC 3RHWF 4NO2B 1CVRA 3AY4C 5EN3A 3GO1L 1YPZA 3D85D 4OT1L 4K3DL 4OLUL 2D7MA 3LKQA 4UAHA 3WYRA 5AKSA 1TITA 4M8QB 1QBLH 4K3EL 4P4RA 4EN3C 4G5AA 4P23D 3R1GL 2AGJH 3D3VE 3V7AE 4APQD 4AG4H 1RK0B 3SYPA 3MKGA 2F61A 4LCWB 5EZLA 4IK6A 3MNVA 3TO4B 1FVDA 5DGRA 3FJTA 1TR7A 3HFFA 4YL4A 4Z76B 1SVCP 5JXED 2XTJB 3G5ZB 3WU1A 4YO0B 5CZVH 4Z95H 1HX0A 3FRUA 4MNGE 1DSFH 1LILA 5FW7A 3TU6A 5I66A 3GZPA 4U6XB 2VR8A 1IX2A 2DQGH 5EC1A 1FL6B 3DGGB 2Q7YB 2PPFA 3LXAA 4NQSA 1OSPL 4BSVB 4AGPA 1DVYA 2LE9A 5E1HB 3X1BA 3U2JA 4P5RA 2X1OA 1I3GH 3CDFA 1DO5A 4IQHA 4TULH 1G1OA 4D8OA 2OQJB 3H2QA 3QIWA 3AWEA 4ZXBA 1BBDL 1F6AA 4HIQA 5D1XB 2CLZA 3ZTJG 4HFWB 4RFEA 3RY5A 2PP8A 1KCUL 3EYSL 1KTDB 3ISRA 4AZ8A 4W9KC 4BQCA 2W0KA 4CGUB 2YAPA 4U1LB 1TLMA 5I17B 4D7BA 5KVEH 1KENL 3ARTA 2WXPA 43C9A 1T7YA 2VM4A 1FNLA 1JZJA 2BP0A 4UIKL 5AQ0A 5AAMC 4G8FB 5IREA 3UC0H 1TQWA 2DWSA 4XH2B 1N0XH 1DQDL 5F9JB 4PB0L 5AOZA 5I0ZA 3O81A 4WO4A 3U4EB 5JORA 4PGJA 5MEPA 3PWPE 1F3DH 4WHTA 1TOXA 1BGXL 2J1ZA 1U30A 3VWKA 3NA9L 1KNOA 1AE6H 1NWOA 2BVOA 4O9HL 2P8LB 4OIFA 1SPDA 4WCYL 4YNYB 1SRDA 3KG5A 3T6QC 4AEHL 4IJTA 5I2IA 4NNXB 5F1OB 4F80A 3HZKA 3HG1A 3OXRA 4YBQD 4L8BA 1X6NA 3BE1H 1KBWA 4MCZA 4ZPTA 5DJXA 1IM9B 3NN8B 1OB0A 2C3GA 3AQYA 2B5IB 2PR4L 1U8OA 4AQ1C 1P6FA 4AT6A 4WNJA 2BHYA 4O02B 3FT9A 2NYKA 5AW0B 2ICES 5I5IA 3WNKA 2W9EH 2FHCA 1NMCB 2NZ9C 4V1DD 4ZAKB 4UNVA 2OJ1A 5DFWH 4WWKD 4H0LC 1VFBB 3Q1SH 3W81A 3U1PA 3MJGX 1NGZB 3OMAB 3APNA 4TUOB 5DQ9A 1MCIA 5IJVB 1BM3H 3WXVH 5GGVY 2ZCKL 4NQDD 5BO1L 2OX5A 4MTMA 2EACA 3M17A 4OIAA 2B59A 4LCUA 1GGIH 2WXMA 5E94B 2Q76A 4PV9B 5JO5A 2ITCB 3S8FB 4OQTL 2BLFA 3H9SD 4DO6A 1LK2B 2AXFA 4PI2A 2W65A 2ZWSA 1HK6A 1QSEB 3IJEB 1FNEA 4M5SA 1QFWI 3FTVA 3I84A 4PJ8D 2XETA 2IMMA 3RKPA 2MNUA 3T0ED 1W0VA 1P4IL 3MDJA 4LSUL 2WTRA 1IGTB 3E8VA 3PGDB 3JSSA 4WJ5B 1TMQA 1EGJH 1GY1A 2VMJA 3KDPB 5C09E 2VUYA 3VG9B 4ZYKB 4QGYA 3JUYA 2CALA 4Q58C 1CE1L 3C08H 1ZVHA 1NDGA 1HOCA 3GSOA 5JNYA 1E7VA 1JF6A 4Z77B 4AYFB 4ACPA 4YDLB 5JW4Q 5J89A 2NY4C 5CLTA 5ALBL 1U92A 4NIYE 3BVTA 1EX0A 4NJ9L 5JPNC 5KJRH 4NYLB 3PWVA 1HCFX 3T0DA 2J5WA 2FATH 4DGIH 2YXWA 1JVOA 5LDUA 4LHUD 1AANA 1ZV2A 1JZHA 5C0JB 2VMFA 4R7XA 2B4CL 5EF0A 1JZDC 3N41F 5I75C 5I1LA 1KLGA 1WBYA 1P5VA 2YMXL 3WFHB 1DTUA 3RGHA 2FYYA 4XMWA 1XTMA 4YE4H 1JN6A 4U1NB 4L4VE 1A6WL 4KK8C 1VHPA 1LQBC 3SPHA 5GGUA 5C0GB 4PHZA 4X98A 1DBML 4LVOC 4ZO7A 4LLVA 2EDDA 3QNZB 1G9NC 4PBDA 1KCSL 3OHXB 4HDIA 2FX7L 4WFHE 1BOYA 3FFCB 1WD8A 1S7XB 2OMNA 5DMJB 2EDMA 4GS7C 2K9UA 5F6IB 4LO9A 1K8DA 1R33A 1ZCRA 3MR9A 3FTGB 3H4HA 4QRFA 4M9OA 1R3JA 3MJ9A 3LZLA 1BYPA 1XGTA 2RACA 3FRUB 4XHQA 2CJ3A 2F9BT 1UURA 3B9DA 3AAZA 1NM9A 2JQMA 3NDYE 5BRZE 2ATKA 4JAMB 5EIIA 3IDMB 3REVB 4R0LB 4J7RA 3VMPA 1WFNA 3V5DA 4UQ3B 3T8MA 1J9TA 1NC4A 2DL2A 2FUTA 1GGBH 3LIZH 2IANB 4HIIB 4LAJH 5KANG 4BSJA 2IOOA 6FABL 2BSTA 5BVPH 2P5EA 1X5IA 3D9AH 4GMSH 1ROWA 3RY6C 4YVNA 1CG9A 3VXSA 4R26L 4X6DA 4XMKH 4LP4A 1JK9A 3PV6B 4AM0A 3TNNA 1WWWX 2B20A 3O6FD 2EKJA 2H47C 2FJUB 3DVFA 4WUKH 3SPIA 3GMMA 2DM2A 3VQLA 1RY7B 4BZ2A 4BXVA 1E42A 4L9LA 1BEYL 2BY3A 5I16B 3P9WB 1T0MB 4EZKA 2BVPB 2PP7A 3F83A 1M4KA 1T83A 1UUNA 4HJUA 3O3AB 5DF0A 1E6OL 1EMTH 4JJOA 3PP3H 4OI7A 3OMZA 3IU3B 1NAML 2P4AB 1XD0A 3PQYB 1SFHA 3MV7B 4HW6A 3P0GB 4JCWA 1X5AA 3NJGA 5INCB 4CL7A 5KSAB 4DTGL 4G42B 4U2YA 5LLIC 1AE6L 3MBED 4FZEH 4K5MA 1DBBL 1W72B 4KVNL 3EUUA 4LBEB 1ZIAA 2DI7A 5BPPA 3AROA 3AT0A 1BDYA 1MUJA 4OCSH 2VO8A 5F7DB 2YUWA 3HLKA 4TPRH 2FVNA 1SXAA 4LLDA 4YH6A 3CC5A 5F7LB 2C9QA 3VCLB 5K1VA 1TEYA 1S7QB 1JXJA 1TTFA 2CCLA 3H9SB 4BD4A 3WE6B 2B9AA 4Z3TA 3TJEH 3SDYH 5KSBA 2MIZA 2YN3A 2WVSA 1NM4A 1AKJB 2A38A 3S88H 1X5YA 2OTWA 1NJ9B 3MRPB 3TA3C 2BSBA 2AHIA 4HPYH 4NT6A 2GJPA 4UT9A 4I2XB 3H85A 4FXGA 2AI0L 4KO9A 5CO1A 3ABZA 3MUZ1 3BVWA 4C58B 3CLWA 3I9AA 3WNPA 4O51A 2OJEB 2ATKB 2RB8A 3KWVA 2ZWNA 1E5UI 3DHUA 3I9PA 3OX8A 2CWRA 1CXLA 3H6AA 4LPWA 4MKMA 2V2TA 3PRZA 2VXVL 4AJWA 2XY2A 5JORB 2Z65C 1C12A 2I25N 1URZA 1V8HA 4LIQL 4RMQA 1K2DA 4I0PB 4LLVB 3Q0HA 4KROC 4C56B 3VFNA 3ZN6A 1N5AA 1GYVA 3SPCA 1TYJA 4CU6A 4LEOA 5HDWA 3RFRA 1P84K 3LQZA 1DO6A 1NMAH 1CDHA 5AOMA 4BH7B 4KZEL 4MGXA 1OGAD 1AH1A 1NCBL 1FAKT 1WUZA 1JPSL 4W9GC 2MEJB 4H0HB 1KJ3H 3GXDA 3HAEG 1PU0A 2RFXA 3VRJB 2O5NA 5ICZA 3M8OH 1H3PH 5GSVB 4G8EB 1E43A 2JKJA 5DSCA 2AXGB 3SZKC 1ILSA 4HZLB 2A83A 4HEPG 3N9GH 4BGLA 4RGOH 3ZDXF 1L5GB 1FBIL 1MHHB 2MOVA 1FO0A 3DBSA 2NCMA 4IRZA 1L6ZA 2JE8A 3GXFA 4FQIH 1H3GA 4HEMA 3V4PB 5D7EA 2R8SH 1PLAA 3UADA 4EEEA 1KCKA 4YHLL 2HX7A 2DM7A 2M83A 2H9GB 4ONHA 1CGWA 1ZWIA 3RA7L 1UWYA 4X5PA 1NCOA 1VGKA 4G7RB 1HE8A 2XJLA 1GRWA 4XOBA 5JYLA 5H8DA 3VH8A 2YGVA 3VVWA 1NEUA 2JKSA 3MXVL 2Z34A 4YZFF 3LY6A 5G55A 4Q6IA 1OKEA 3HUJA 2AQPA 5KTEL 2D7OA 1OGPA 3IJ9A 2BDNL 2EO7A 4NSKB 4HXAH 3C9NA 4AYMC 4ZMQA 3QNXA 3U7AA 4H8WL 4POUB 5HI5C 2A5UA 3ASNB 5AAWA 3E8UH 5GS1B 4PG2C 4WVRA 2JELH 4P9ML 3B5HA 4BJLA 2F54B 2WTOA 3EOYG 4H1LG 4HFUH 4EDXB 5IF0B 1WGVA 3T2LA 4GKSA 5T1DL 4Z7AA 4APQC 5TDNB 5E2JA 3BZFA 1CICD 3M17B 3F5WA 2G4GA 3GXMA 4NZFA 2YPVH 4JO8A 3NIFF 2GITA 4D9RD 5E8OA 2BZ7A 4Y4FA 3HCVA 1OE3A 5FCUL 4Y2OB 4LDLB 3UZEA 4PWFA 4ORGA 1PZCA 1KBBA 2Z4QA 1B4TA 3T6VA 1BZOA 3NZ8B 3E7JA 1XH2A 2J71A 2LAAA 4XPTH 5SWSE 3T71A 5D4IA 1R9FA 4E9LA 2CCWA 3LPGA 5E1IA 5TF0A 2ZXEB 4W6WB 3WHXA 4XN2A 4Q14A 1CICA 1AOZA 1AQKH 1LD9B 3D87B 4JEGB 1SQMA 3PDGA 3MV7D 5AB9A 5DK2B 3CXDL 1KWGA 1SZNA 3JWOH 5DMIH 3MBWA 5L4IA 4ZYKA 1JYVA 4N68A 4U1KB 1NPUA 1CIUA 4CKQA 4QT5A 1CLYH 1E0OB 3Q8BA 4F9LA 1TPXB 1EIBA 4P3CL 3L1FA 1Y6KR 2R59A 4KZ0A 2EDRA 4ZUSB 3QDGB 4KKLC 3X1EA 2AJ3A 4APXB 5AD0A 2XZAH 1P84J 1B2WH 1DQKA 1AACA 1T21A 5T33H 3MCLH 3VUAA 1VEOA 1SVZA 1BMZA 2JKWA 3CK0L 1HWGB 2NNCA 2OMYA 2CIIA 1KIPA 4AQ8A 4UDUA 5LAXB 4BFRA 3ZL4H 1R3IL 2HRPL 1E90A 3ML8A 4QTFA 2XWDA 4Q9RL 5KG9A 4LLUA 1U0QA 3MRIA 5A2KH 4FHJA 3BUYB 4Q9RH 1RFDL 4ODTH 2YD9A 4PJCE 1LLAA 3KMDA 2DH2A 3RL2A 1EHXA 3DJ9A 3OB0H 5JUEH 4AK1A 1MFEL 1W2KT 3DX6B 3RWFA 3N40P 5CGYD 3V4LA 5CGTA 2EYRA 2EYTA 1AIZA 2XV6B 3PHQB 1J0KA 3ZYJA 4ZX4A 4JRYE 2EIZB 5IV2A 5K59F 1NAMA 4ODSL 3ILPA 3PP4H 1Q0XH 1CDGA 1EAQA 3PV6A 1BQLH 1ZANH 4YBQC 5GS0C 4L2YA 2PYEB 1PZUB 4QHKI 4L8BB 5D7IB 4P49A 3DOSB 4AIOA 2X7LB 1PZ5A 4FADA 3CE1A 4MQXD 4G9FE 4MJHA 3K6SA 2JKLA 4KJPD 5EFIA 2J3SA 1FDLL 3NCJH 1AQDA 3SO5A 2K78A 2GABA 4A6YH 1WDAA 4HIIA 2ITEA 2Z91B 1Q9WA 1HHGA 2OULB 4DQOH 3ZE0E 4EUPG 1YQ2A 2GEQA 1KGCE 5TPWL 4CDHA 2H0PA 4N24A 3GBDA 2JJUA 1HSAB 3BXNA 7FABH 4G6FB 4XMLL 3NGBB 3FFDB 4GKLA 1O5DT 5H37G 4NHUA 5D6CB 1TQCC 1J1PL 1EVUA 4LBEA 1H8SA 4BDVA 2ATAA 5EU7C 1NPJA 5FUCE 3RB5A 4W4NA 4NQUA 4K8RH 2XBZA 4WHYH 3VD1A 2LW3A 3HCVB 1BLNB 3ZDZE 4KUCD 5LN8A 3LVTA 5DJ0B 2EDBA 1Q4NX 2AJYL 4OLXH 4PJBE 4LSVL 3IGUA 3RILA 1KN2L 3C6LA 1IKNA 3PNRB 3LEVH 4DN4L 5IQOA 5LNEA 2XA8H 5HYJA 3X1GA 3E3QE 5DI8A 2MPVA 3AADB 4M6MH 3LNIA 3BIBX 3FB8B 1D7DA 4JRXB 4LASL 2WZPD 1CL7I 1EHNA 3I02A 1LJMA 5BZZA 4UANA 3MMEB 4J6RH 4DEUA 5J3HD 2Q7NA 1AAJA 1KB5A 1JHLH 4JKMA 2GIYA 4JY4B 3G04B 3Q13A 4HWBH 1BVNP 4OZ4B 5JXEA 1KUMA 2FZ3B 1M53A 1TVHB 3QIBC 4MXVE 1J0ZA 2CBOA 4ONHB 3HZYA 1T0NB 3JZ7A 3BLPX 1I4FA 4JZOB 4ONFL 1WH0A 2AEPH 5C0EA 2YLKA 2CU9A 2YIHA 1OGAE 3BP6B 4JFQA 5DQJB 5ID1A 4MD0A 3LRKA 1NJ9A 3MLZL 3RPIB 1E5AA 1NGYA 3KLDA 3WLWD 2EIBA 3W0WA 1S8DB 5HI3D 1D2PA 2ARWA 2XIDA 1ZSHA 5IVXA 1IFRA 3GO1H 1RU9H 2G2RB 1CFSB 3VMOA 1DEDA 1TJGL 5GJSL 4FG2A 5C07A 5CKAA 3D69A 2P5WE 4GSXA 1K8IA 3PGCA 3QQ9C 4RA0C 4BZYA 3TT3H 2EYTB 5I1CL 4OF5A 5FYLL 1JPST 3J2PA 3I6LE 4G70B 1LWRA 1NFKA 4JHZA 3KW8A 2O5XL 2DI9A 4O2FB 4Z23A 5C0RL 4ELKB 1G6RB 2R69A 4GRLB 4AH2A 4HUNB 4ES9A 5LGKA 2I5YL 4R7NA 4WWPA 2FEJA 3WGUB 5DHXB 5DJ0A 1NKOA 1G0XA 4EZMA 4DESA 2KQNA 3GRWH 3KPSB 1C5DB 3U0PB 1S7UA 5DZVA 1DVFD 4PAZA 3I6GA 5D2LE 2V6HA 1BM3L 3F7QA 5CEYB 3UBXI 2NY2C 5CMAB 5AD0B 3FUHA 1D3CA 4ZX3A 4MZIA 1OAUL 3DYMA 1X5LA 3QZLA 5TE4L 2X40A 2OXGA 1MJ7L 2VDRH 4L3CB 4P3WA 5BS0B 3LS4H 3IFOB 4BV1A 4YLBA 4GO9A 3QNYB 3CCHA 2EC9T 4M8VA 4YSPA 4Z7WA 1B0WA 4HEME 1K4DA 3KWWB 3H3PL 4G8GB 4XODA 4AMKL 3FT4A 4G6ML 3B9AA 3LZQA 5C8JB 3G9AB 2GYSA 3LZFH 4B9GA 4CJ1A 3LKRA 3Q06A 4OAWA 1PJ9A 1H5BB 3T3PB 5DHVH 2WQWA 1IGMH 2P80D 3UAAA 1CGXA 1RSYA 2IWGA 3TT3L 1W6WA 1ZHKA 5LGHH 2K6ZA 1QWHA 1RIHL 2EIMB 3HBGA 4FN0A 5KSBE 4LBAA 3S5ZA 2KLTA 5CILL 3RIAK 3ILQC 1F58L 2APXA 2IADB 4NKMA 3JTTA 4PBWD 5J13C 4GUOA 1IL1B 2Q8BH 2QSCL 4MDJA 4U1SB 2YFOA 3QUMA 1PLBA 4OFYD 5CUSH 3O2WL 4NCDA 3JWNE 4FTVA 4WGWB 2DMKA 2X5PA 4Y4FB 2F2HA 3VI3A 4L9LB 3T3PE 4ZMAT 4PRHB 1K3IA 4AL8L 3ELAT 3V5HA 1P2CB 1GGBL 3LIZL 4A67A 1XSOA 4JREC 1B6DA 1B4LA 3RBGA 1QACA 4XWOD 4NBXB 1GVIA 4B9CA 3QUXD 2ZG3A 4L4JA 4FDWA 2SEBB 4TKWA 3KPOB 4RAVB 1S9WB 3FAXA 4N2IA 5DEJA 4EQ2A 5C0AD 1AZUA 4WO0A 1L4IA 3BIKB 2YQGA 3P2DA 1FPTH 1O7VA 4GW1A 3FU3A 4N6RA 4N9GB 4O2CB 4OCRL 3RE0A 5IB1B 1Y0LB 3T09A 1FRGH 3QR0A 3ZXAC 3KPSE 3V7MA 1QG3A 3O0RH 3Q01A 4OUOA 1CTMA 1KN2H 3K5RA 2IMNA 1LDSA 1MRFH 2XWBB 1KIRA 4Z7UF 2AAVA 1QLEL 2HYMA 1ZSDA 4RISL 3IN0A 2V2WA 3MRKA 3ZMRA 1YEJH 4JG1L 5H94A 2N7BA 4GMTH 4R7DB 4NC1C 2E9GA 3NJNA 1JRHI 5DT1L 1NLBH 4BQ6A 2W59A 2XV0A 2AJXL 1MWOA 2VZSA 3MRMB 4UOW0 3W2DH 2EDYA 5DT1H 4HBCH 3MBXL 2OV0A 1FL3B 2BVUA 4I48B 3T8XA 2K7QA 1PZ2A 4PCTA 3TBWB 4WSKA 3GSUB 4OM0H 1HSBB 3H4FA 2WAHA 2UXVA 5B39B 5C7XH 5E00B 2XXGA 4I0PA 5DQ9B 1RHHA 5I30L 5JW5A 4AEEA 5EBMB 1AHWC 5ESAA 3ARUA 4OJDH 4U1SA 1JMXA 4I9WD 1OF0A 2EXWD 4POZD 5ITFB 2FQDA 2HRHA 2V4LA 1MFMA 4X6CE 2OL3A 3C5ZB 3FN0H 3MXVH 4LIQH 4PLOB 3ULVC 1K5NB 3VXUD 4QKXB 5FHBH 3ZTEA 1E2VA 1YJDC 2PYFA 3LZFL 3STLA 3K5SA 4B7IA 2OMVB 5ALCH 3FQUA 3JVFC 4Y9EA 2QPFA 4NC1E 2XVLA 1XMWA 4CADA 4MRCA 1DE4A 5HYJD 4E42B 3S3PA 2G3MA 1MFEH 5AW8B 2PNDA 4YE0A 5HY9B 2B0SH 4M93C 2V9RA 4CGTA 3N50A 5ACMA 4MAYC 5LCVH 1T0PB 4PBVC 3FUEA 1VPOL 1I75A 2FWOB 1NGQL 3CVHL 4TNFA 5ESQB 3VH8G 1MQ8A 1ZE3H 3HE6C 4KV5E 3FB7B 5DVPA 3H1ZA 3DHJA 2UWEA 1E27A 4KNQA 2DQJL 3BH9B 5DD1L 1N64H 4PRPA 4MA1C 1TJIH 4JDZB 4DGWC 4NJAH 3X1FA 3VYOA 2BNRD 2VW6A 1QNZH 2O6PA 2Y6SC 3QPQD 5GRVK 1U95B 3EJRA 3FSOA 2Q9OA 3O6FA 1OP4A 1RUQH 1XR8A 2WD0A 4GNKB 5DZOA 2CUMA 4XPGL 5I75B 1Y1UA 1QUNA 1ZD6A 3CSTA 2VUKA 3FB5B 3LN4A 1AXTL 3LRSA 4MBRA 2JKNA 3TZVC 2JIXB 2BP8A 4GBXA 2IG2L 2X4TB 1SNRA 2OMTA 1G7QA 2X3BA 3L2LA 1AR2A 4A2EA 5EF2A 1T2XA 5DR5H 1PG7X 2HSIA 4AM0B 1QFUH 1TEGA 5C3IA 5IHHA 2YQ3A 3C6SA 4BE5A 1BQUA 1I8AA 5IG7B 4APXA 5IBLC 1JPFB 4MNGA 2AFNA 3HLAB 3GJEA 4Q9QH 1IKFH 4ZXBD 1TTRA 3ZKNC 4ELME 4JQXC 3E80A 3PPEA 5E08H 3IGFA 3TIDB 1YQVL 4LVHB 1CGSH 2CO1A 2G3ZA 4PJIA 5IROC 4ABUA 1F00I 4UWQB 3DTXA 1PZ3A 4B9JA 4POZC 5FM5M 2LLLA 4F57H 3QQ4B 5DK2A 1Y6NR 4K71B 4IBZA 2A77L 3AC0A 3FXIC 1IEAB 2D2OA 2H41A 2H7WA 4FFTA 4XNQA 3LS5H 3F04A 4N8VA 4D3CL 1BWMA 5K5YA 1E28A 3CFTA 3BPLB 1NBQA 4XMPH 3MOBL 2ZUSA 2HJKA 1KIUA 4IW4C 4M3KB 3WLWC 2VRKA 3HZVB 4XN8A 4U6HB 5C0RH 5HYEA 1U2CA 1PCSA 4N2OA 2FIKA 4HJ0C 1G9MH 3TBSB 5SWZE 1IC7H 3QDJE 3Q43A 5CJOH 2X4RB 5AYQA 3MLYL 1V10A 1CVSC 4N9OB 2NZIA 4U6YA 3GMMB 2CXGA 1WF5A 2ZOOA 4F33B 3WMPA 2DOCA 5DJ2B 2PXYB 2FNWA 3SGEH 3BH9A 4WHYG 3GMRB 3SBPA 5C0JA 4OJAA 4L8SB 2G75B 3KXFB 4KHXL 3A4EA 2XVBA 3ZZ1A 5CZKA 3MNZB 4YSRA 5EC1B 1KGUA 1N3NA 3AREC 1YC8A 3DHMA 3FUNA 1D5ZB 4R4FH 2Z64C 3H9HB 2XWTB 2A74B 4FI6A 4J39A 4N2DA 7FABL 2J5LB 5HY9A 2DI8A 2ZJSH 4ZFGH 2XCMC 4JG0L 4YBHA 2X1PA 2YOAA 2GUOA 3VI4A 3RWDB 4P59H 4I0CC 2FWLB 2KZBA 3FF8A 3N0AA 1LXMA 1YN7A 4PQXA 2CK0L 4MA3A 4W1TA 4F2EA 1BAFL 5T1LB 5AKRA 1S7XA 4P4RB 5F88B 1LO3L 2NPLX 3KPPA 1I9RL 2GKIA 3WJLA 3FTGA 4A2FA 4UAOB 4N6QA 5DC2A 4W9IC 4J6RL 4G6JH 1XIWC 4I1RA 5FYKE 5DO2D 1HL5A 4PY8J 1W0VB 3MRQB 4JFPB 3BWUF 2JI1A 4IIQB 4JG5A 4LOUC 4M56A 3LH2H 4AXWA 2VB5A 1XB6A 2XG4A 2WSKA 3GRWA 4JJ5A 1HXYB 4G82A 1HH9A 1SJHA 4K9EL 2QADB 2WNKA 1C1EH 1ZIBA 3FL7A 3ZY7A 4DH2A 1QRNE 1BJ1J 3B1TA 3PWNB 2PN5A 4NKDA 4PB9L 3P73B 1A6TA 2BNUA 1D2OA 2KPNA 3OZKA 1FFNA 1RKRA 3RBSA 3Q2LA 3SDDA 1A4AA 5KZCB 3T04D 1G7LA 1CI3M 3GKWH 3F6LA 4JY5L 4XCYB 1QR1A 3O3EA 5DD6B 2Y36H 1HKLH 5EEWA 1DVTA 4XPHL 4FE9A 2HVJB 2FIKB 1N5AB 5DLMH 4NYLA 5DVNA 2IH1A 4Z3GA 4HSCX 5DVMA 5B1CA 1I1AA 1KF9B 1HILA 1R3IH 4AZUA 2EUXA 4UAOC 2QSQA 4BXSV 4M03A 2G2PA 1XF4B 2RD0A 2BCKB 3PREA 2C9RA 2FEDD 3QULB 4NRXA 1SDDA 4YMPA 3WTYA 4XNQB 4YK4B 4X4XA 3V95A 4XPBH 3HNVL 3K2MC 3UJIL 2HVBA 4UNIA 5HHOA 3RGVA 5EMYA 1TSRA 1OGAA 1YO4A 4JFHD 2B16A 5GQBA 1JZ6A 1E2ZA 1W8NA 3TO4C 3UTSA 1IKOP 3JV6B 4P9HL 4QXGH 5A2AA 3LKOB 1GCYA 2VAJA 1BZEA 1AGFB 2IANE 4F58H 2J8HA 4HLEA 3ARQA 4Y5YC 5E8DL 1QNZL 3L6FB 1IC4L 1KB5L 2DD8L 1BZ9A 4M3JA 3KDMA 1UXLA 1YCSA 2X09A 2Z92A 2YQ2A 3FRPA 3L3KA 2V7HB 4HISA 5F3FA 2WLMA 4OUUA 3O2VH 1MOEA 4XNZC 3ZHFA 2QGCA 4JG9A 3NQKA 1SOXA 2QLVB 1OPGL 2O5ZH 5AOIA 2R9HD 3CDZA 5FM4A 1DVFC 1I85C 1I7UA 2BS8A 2WXJA 1NQBA 2X6BA 1P5UB 2VCOA 3RI5F 5JOFB 5FK9A 3VNYA 3O9WB 3IXTB 3J8F7 3MV9B 3I9GL 1XGYH 2JKTM