4R96B

Structure of a llama glama fab 48a2 against human cmet
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
213
Chain Sequence
EVQLVQPGVELRNPGASVKVSCKASGYIFTMNSIDWVRQAPGQGLEWMGRIDPEDGGTKYAQKFQGRVTFTADTSTSTAYVELNSLRSEDTAVYYCARVDDYYLGYDYWGQGTQVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Llama glama Fab 48A2 against human cMet L chain
publication title Camelid Ig V genes reveal significant human homology not seen in therapeutic target genes, providing for a powerful therapeutic antibody platform.
pubmed doi rcsb
source organism Llama glama
total genus 37
structure length 213
sequence length 219
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r96B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r96B01
3ZDZF 5I19L 1ZANL 4JRYA 1Q9OA 4IOIA 2BSTA 4XPBH 2IADB 3ECBA 4R26L 3L95A 1OAXL 1AKJB 1LP9F 3GMNB 4X7TB 1WISA 2Q86A 2R2HA 1ONQA 1NLBH 2UYLA 1KCVH 3BN9C 2Z35B 4PJXA 2HJFA 2P5EB 1EH9A 3QYCA 3MQIA 3BSZL 3B2VL 4LASL 5IMLB 3PQYA 4G80A 2ZUVA 2ED7A 1OM3H 1MFAL 1TLKA 3QCVL 4YHZH 5JOFA 5GGUA 4NWTH 3BMVA 5I1DA 3S4SA 1QLRA 1WFUA 3FN9A 3VRIB 3EBAA 4TVPE 4M7KH 3SKOB 3OKNB 5LBSL 5E95B 2OSLB 3MACH 3DMMB 2QR0A 5JORA 4G3YH 4LLYA 2GQHA 4OCXH 2MTPA 5HHXH 3CVHB 1WITA 3T04D 1A6TA 1YEIL 3SQBA 3UO1H 1QHOA 3C60B 3ROLB 4LEOA 1M05A 4JHBA 4LCCB 4KK6D 2E27L 3WDJA 1D6VH 5E8OA 3OZ9H 2IH3A 1A8JH 3B9EA 3RTQD 3HZYA 2C3GA 2XPGA 2Z0BA 3BKJH 3RPIB 1WICA 4HIHA 2UVFA 3P4OB 5GPRA 3C5ZA 3IYLW 2IH1A 3KPSB 2N1KA 4PRNB 1JGUL 4G8IB 4PRBB 1YMMB 1PZ5A 3UBXI 4S2SA 2ITCA 1I8IB 3TIEA 3MLZL 5CJQH 35C8H 3TFKD 1NC4B 2B1AH 5D1XA 4Y88A 4OV5A 3HA0A 1HQRB 3S88H 2VZ3A 4IDLA 5E2WH 3EDJA 3IF1A 3UZVB 3SDXA 3KLAA 4YEEA 4OFVA 5IBUG 4LARH 1FNAA 1I9IH 5IF0B 2EKJA 3CZJA 3BAEL 1CL7H 4TSAH 1KB5B 5TPWH 1NJ9B 1NMBL 4LF3B 1T04B 2NNAB 5DGQA 4P46B 3QWOA 1IBGH 4HIEA 3TBTB 4LHQB 4KUCD 1F11B 5ALBL 3PV7A 3I75A 5J13C 1M7XA 3HZMA 4RFEA 2BNQE 1TJGH 3L1OL 2VDQL 4Y5XA 3MCKA 3T3ME 2H1PL 4HWBH 1UM5H 1P69B 1LEGB 2BOCA 1MIML 3OG6B 3QG6A 1A9EA 5CZKA 4P5TD 5E1AB 4P2RD 4LLMB 1KIRB 4JFHE 5FB8B 3A6OA 1TFHA 4MA1B 3P0VH 3DO7A 5A2KH 4NCDA 4U6TA 5CEZD 3SDCA 2JIXA 4NKDB 4PGDB 1JGDB 2AJYL 4XCFH 3SDXE 4OLYH 1JZ5A 1YEHH 2YUZA 5LWYL 2DICA 3V6ZA 5F44A 4WGVB 4PYGA 3WJJC 1CK0H 3LMJL 1LO3H 2O26U 4ZG1A 1N3NB 1SY6H 2C26A 2R0KH 3ZYOA 4Y7MA 1GZQA 1JNNL 3MBEB 1P7QB 4B5EA 4DGVH 1RUKH 2WUCH 3QWRA 3CMOH 3O11B 2BVUA 3RVTC 5F3BB 1JYXA 4M48H 4XNYH 3TESA 2W59A 5BZWA 4XCYA 3PP4H 4M1CC 1QRND 5FIEA 2FJFB 4JGMA 4LRNH 1KJVA 1N6VA 1F6AA 3K3QA 4JFPB 3O81A 4L29A 3H9SB 5BO1L 2BNRB 5K9OB 1B4JH 3DSNA 5J8OA 3QUKB 5DR5L 1X5JA 2ZOKB 1F42A 5GGSA 3BPLC 3P77A 1FVCB 3REWA 4ELMA 3HFML 1EIBA 3C8KA 1TNNA 5FAAA 5HYIA 1JZ8A 3VI3E 3Q1SL 3S36H 2PXYB 2BVPB 2MMXA 2NY7L 1MCNA 4QRQB 3OJ2C 3RDTB 2ED8A 1ADQH 5E0QA 5CMAA 5FDWA 3SDYH 3DO3A 3LIZL 1A1OB 3LKQA 4NFDA 12E8L 3GZKA 5D6CB 3RWHA 3QSKB 1JUFB 1WWWX 4PJDF 2FECI 5E08L 2AK1L 2QADC 1DBMH 4BSVA 4PB9L 3QDHA 4PP2A 3EO0A 1RIVL 1DCLA 4GFTB 4ETQB 3JWOC 3H7BA 2VQ1A 1PX4A 3TPUA 3SE8L 1TCMA 1YQVH 4B50A 4WO4C 4NBYB 1CDGA 4ZFOB 1K3IA 4L9DA 1QHPA 1YMHB 2PTUA 3KWWB 4JO4L 4K2UL 2D7PA 3JWDC 4PYHA 2O5XH 1T20A 4ZUSA 4R8WL 4GO6B 3S96B 1RZIA 2JJTA 2FJGB 4KKBC 3U1SH 1ZT4A 4HF5H 3RVTD 1KEML 3BPOB 1S7XB 4YE4H 2VDPL 1YPZB 4GG6E 1RQ5A 4M1CD 5HPOA 4G6AD 5GZOC 3RGHA 1QSEB 4TTDD 4WNQA 3TV3L 1IKFL 4HW6A 3HC4L 4BQBA 5C7XH 4WWKA 1E6JH 1U3JA 1PBYA 3DUUA 1J88A 4FXKA 1OAKL 2I5YH 3GMQB 3DYMA 3QEHB 4OZGB 1RU9H 3WN5C 2M2DA 4HGWA 2NLJB 3RKPA 4WJ5B 4QHUA 4JFFE 4MA8H 3W0WE 5MHSD 3L5HA 5JLZB 1BQHA 2P46B 1CFBA 5CLWA 3OX8A 5FECA 1AO7B 3IS1X 2OZ4A 1QZ1A 1JV5A 4JFDD 1UZ8A 1OGAD 2HVJA 2ORBL 2YD6A 4NO0A 4DKFH 4HK0A 3UPRA 3JZ7A 5IM7A 3LQMA 4JAMB 3TN0D 2X7LB 4BQ9A 5J1SC 2QADD 4NRZB 3D39A 5IB5B 2A77H 1KLUB 2D0FA 5I74B 3GI9H 1Y18B 1CTOA 4X0KB 4WI4A 3VA2C 2VWEE 4Y2DB 3MJ7A 3SGDH 4X7EC 2NR6C 1IQWH 4GKNB 3FT3A 2Q76A 2OMNA 4RCAA 2R0WH 4I5BB 2Y1VA 4WO4D 4IIQB 3DWTA 4YFDB 4JPKL 5B38B 4ODWA 3MLTB 3T0EB 1QP1A 2J4WH 1IKNC 3WS6C 1UXSB 2LU4A 4JDZB 2F9BT 3WL9A 4LDEB 1W0VB 1T4KA 5I66A 1T7ZA 3B9KB 2FB4H 4KKBD 4XNZC 4GLRI 2X4UB 3WD5H 5CP3A 4HDIA 4G9DB 4NCC1 1T1WB 4L5FH 5GZOD 5F6IC 4HC1A 4F3FA 3TYGL 1AJ7L 2EDTA 3V6OA 5HHOE 1MAMH 3SGJA 3ARQA 1WIPA 4I9WE 3VXRA 5DLML 4YDLB 3S37L 1M6OB 1A4KB 1AKJA 1CVRA 2D7QA 4Q6YA 4M7JH 2F5AL 1CVSC 3D48R 4F7PB 2QSCH 1FZJB 4S11A 4F7CA 2ARJB 2CDFA 1U95A 4J1UB 1YYMH 5I2IB 1EJOL 2CR6A 1EGJL 5IMLA 5IR1B 3U0TB 5KSBA 1V3KA 3OV6A 2VLJD 3PHOA 3LS5H 4OCRL 5FHAL 5I73B 3QI9C 1CE1L 1J1XL 5E8NB 1F97A 5DURD 1KACB 2X9XA 3GB7B 1QPXA 1OAQL 3GHEL 3D18B 2BVEA 2OSLA 1WCBB 5EZJA 4NQTA 4P2OB 1FBIH 2ZJSH 2NR6D 3SDDC 4FZEL 1TJHH 4RMUA 1T7WA 1D5XA 4LSRL 1MI5E 3C60A 1KFAL 2AP2A 3NCBB 3ROLA 4JHWH 4LCCA 1V3LA 1J5OL 2X9WA 3V52H 1WIOA 3MV9D 3N85H 5JUEL 2EEDA 3IFOB 3MRDA 4KK5C 4M7ZC 5EU4B 5F1KC 2BY2A 1K8DB 5LXGL 1IGML 3KYNB 3MYZA 4PRBA 1U9KA 4PRDA 1I8IA 4DGIH 5JOEA 4JG0H 4UT6L 2P5EE 2W65B 4XMPH 5B39G 3I3DA 3RVUC 2VZUA 4DN4L 4DZ8B 3T1FB 4YXHH 3SBWC 2GK0B 1G9MC 1MCJA 3CSPA 4YIQA 5GQBA 1EMTH 5DD1L 3WXVH 4WVRA 1KB5A 2EEAA 1G7PA 1X5GA 1F58L 1BFSA 4LQFH 1FV1B 5L9DH 2OLDA 2IQ9H 1GPOL 4FQQA 3Q2CA 3L6FB 3TBTA 3EOYG 4GAJL 1F11A 2ZSVB 3MJ9A 2FX9H 2JB6A 3STBA 1Y6MR 5E6ZA 1KN2L 3QIBA 4R97C 5IHZB 3UJIL 4NO3B 4WI3A 2AXFB 4J3TA 3QI9D 3IXAB 4JVPA 1KPUA 1SQ2N 3B43A 1F6LL 3BOVA 5GGSY 1LEGA 1M7IB 4X7CC 5D7IB 4I18B 1GOHA 2V7HA 3KPSE 2DWDA 5IVXB 5IHUL 3PJSA 1EFXB 1YMME 3DTXB 1C1EH 1ZHLB 4PJ8C 3LHPL 1REIA 1XGQB 3SEPA 4OGYH 1QLEH 2ZG3A 4HX1A 2IG2L 1UJ3B 4GOSA 1VA9A 1XGPB 4AM0A 1IM9D 2LV4A 1AY1L 3HR6A 3ULUE 3BJLA 4PY8I 3MGAA 3RI5K 5DRZB 4P9HH 4KK5D 4QYOA 4RAUA 4RMVA 1CL7I 4KMLB 4X6BB 3VD3A 4U0QB 3AU1A 2FX8H 1GGCH 5KVDL 3GSXB 5EDXA 5I1IH 1A6PA 1P7QA 2PTVA 3KYKH 5HY9B 1B0GB 3O11A 5TE6L 4N0UA 1UM6H 3MRPB 3G6DH 1A7RL 1MEXH 4UT9H 4DW2H 4K8RC 3FFDB 1MY5A 2FJFA 2BY1A 4HFUH 4XAWH 3V2AR 1OY3B 4YBLB 4C56B 1KCRH 5ESQA 4KTEH 4Y2OA 1DUZB 3PGDA 4UOW1 4R7DB 2EYRA 2ICWB 5TDOA 2DM2A 3GK8H 4PJIA 3VXMD 2V2TA 3RY6A 1KCSL 2PXYA 3PP3H 3PE9A 3C6LC 3QT2A 4DJMA 2YXFA 1SJHB 1T0MB 1OSPL 2W0KA 2OJZL 3B83A 4PJBA 5IK3B 4YNYA 3MRHA 4XNXH 2I27N 1CE6A 2Y25A 1IGJB 4KROC 4F9PC 1A1OA 4UAOB 4R4BA 5DF0A 3ZTNL 1E4WH 3ZMRA 5IESH 5F9WB 5JHDB 5C08A 3F58L 5I17B 5DDHA 3LN9A 4ZXBB 3QAZB 4ETQA 3MMEA 5KS9A 3CU1A 1A6VL 3SOBH 4JO1H 4OZHB 1FL3A 1JWUB 5HBBA 3D87B 3H9SE 3KWWA 2BNRE 3NAAL 3O41B 3AB0B 4P3DB 1ZHBA 1JGLL 4ONFH 3ILPB 4BSWB 2MHAB 4NKQB 4PGBB 2R0LH 3TO4C 2XTLA 3D69B 2DMCA 3ZT5A 1LO0H 4G6FB 5C8JB 2B0SL 5HHPB 5I1GH 3BQUB 5ILTH 1U8JB 4IMKA 1FZMA 5GRWA 4S0TD 5DQJB 2JCCA 3C8DA 1JPGA 1VACB 1IMHC 1N0XH 1BX2A 4W68A 1X44A 1E6OH 2CO6B 4FXGA 5JMRA 4LCYB 4YZFF 2R15A 3QEHA 5DWUL 1S7QA 4C54A 4LSUL 1FH5H 4G8EA 2FGWH 4JQIL 5HGGS 5A2IH 3C6LD 4AIXA 2B39A 4JM2F 4WJ5A 4OZFB 1CWVA 4GKZB 1G6RA 4N1HB 3F5WB 5JLZA 1IT9H 4YEFA 2XV6B 1AO7A 4JVWA 5IW1B 4LCUB 1A5FH 4J6RL 4KROD 5B3JF 3A6BL 3IJHB 5A2LH 3P4NB 1NANH 5C0AD 4U1JB 2CH8A 4FZ8L 2APBA 3B8YA 5FYLD 4LFHG 4IHOB 4O51B 5BZDB 3U36B 3MLXH 4DCQB 1KLUA 1X5FA 4NBZB 1KBGL 4X0KA 4MCZB 4NO5A 4Y2DA 1UQSB 2D7OA 3KJ6L 4LFHD 1YPZE 3ZTJH 3I9GL 2A9NL 4GKNA 4I3SL 4MDIA 1G1YA 1LP9B 2FL5A 3F8UB 4FMKA 4ZSOB 4YDIL 1TZGH 1A21A 1JHLH 5D7JC 1S5IH 5I30H 3T0EA 4CDGC 1V7NL 4JZOB 4CMMB 3MRKA 1JFQL 1IAOA 2GYSA 2UZIH 4JDZA 2X1XR 4G42B 3D0VA 2YEZA 4MA7L 3BPCB 4KKLC 4OZGE 5F7MC 4NQED 2X89A 1CLOL 4L8CB 3B9KA 3RPKA 2FR4A 2VL5A 4IRSA 4EOWH 1OAZL 1D9KA 1HKLH 2AV7A 3QIUC 4G9DA 4HKBA 1XH3B 5FKPA 1QBLL 2F53D 1T1WA 3RL2B 1AO7E 1I3VA 2MPAL 4ELKA 5HVHB 3ARXA 2ATKA 4GRWE 3X13B 1UCBL 3K2UL 3VDBA 3ZZ1A 1FVDA 8CGTA 2PCPA 1A4KA 3T2NH 1IQDA 3SY0B 4HXBL 1YC7A 1QBML 3O2WL 4TQEL 2MJWA 3LKNB 2O5ZL 5GS3A 4XZUB 3LB6D 1LNUA 1YN7A 3KS0H 3SGDI 1LQSR 4C58B 4J1UA 4D8PB 5ID0B 4DQOL 5GGQL 4E9LA 3DETC 3U0TA 5JO5A 4JM4H 1DVFC 2UZXB 3T0EE 1HE7A 3U2SB 15C8L 1SHMA 2R8SL 3BEWB 2YRZA 5DFVC 1I9JH 1A3RH 1UWGH 3B9AA 3GB7A 4I0PC 4Y19D 1DDHB 4Z7VF 1LMKA 4HWZB 1P4IH 4BQ8A 2GFBB 5FHBL 1OAYH 4P2CG 1I8KB 5AUMB 1K4CB 3B5TA 4D9LH 3QO1B 3GBLA 3GSOA 1KJMA 2D31B 3H3KA 3D85B 5HVWA 3TCLB 3T2QA 3VXUB 1Z5LB 1CT8B 3CUPA 5D7JD 3DX6B 4K71B 4PREB 4OCSL 3VFRA 4BFIA 4UV4H 4NDMA 5EU4A 1I7ZA 5CEXB 1HQ4B 1IJ9A 1HSAB 4KKLD 2NY3C 1K8DA 2CLVB 3HZVB 2I9LB 3S98A 1RURH 1DZBA 2V5YA 2Y7QB 5J3HC 2D7NA 5JA8B 4RZCB 2VLRD 3J7HA 1EJ6A 1WWBX 2D0GA 1MCOL 4EBQL 5CJXA 1P4LA 2CKBH 2AABL 2DTML 3QUZB 4H1LG 3T1FA 3UP1A 3W82A 1IFHL 1JK8B 2GK0A 5I1CH 2PTTA 3QNZA 4LSQL 2IANB 2M26A 1JYWA 1L7IL 4LLQA 4WV1B 4G6JH 4LLDA 5AG9A 4U1KB 2FIKB 1PG7X 5DD3L 2VO5A 5CJBA 4FOMA 4MNHB 3O45B 1DQQB 2ZSVA 2XZQL 1JPTL 4CVXB 1ZTXH 5DMKB 1EK3A 5EBGA 3B6SB 3C09B 3O4OB 3ZSTA 1H3PH 4JN2A 5I1KL 4GAFB 5EOQH 1K85A 4R9HA 5IHZA 1CD0A 5JR1H 4X7DC 1DVFD 5DHVA 4GW5B 4JO3H 1PD6A 5DFVD 3O6ML 3LS4H 3NMEA 2Z92A 3SDAB 1T03L 4J7RA 2NZ9C 1I75A 5C0BB 5JQ6H 4I0PD 3K4ZA 4X5WA 1VENA 4Y8AA 1DANT 3QZWB 3AS3A 5IVXA 1EFXA 5C0RH 1ZHLA 2OTPA 5EZIL 3RVWC 4TVPD 1FFOA 1I7RA 1NEZB 2CK2A 2LAGB 3HAEA 3MZTA 5FUZL 4XGZB 2AXGA 1WUNT 4L8SA 1XGTB 1VHPA 5T3XH 5T33H 3G6JA 4QRTA 5EU5A 2YD2A 3HC3H 2A38A 1RIUL 1F8TH 1WCQA 3TA3B 3LSOB 4LHUA 2NY3D 4PG9B 1KXQE 3OKDB 5IFAH 5DTFB 3GSXA 2HFFB 4RSVA 2NX5D 1WZ1H 5HY9A 5D7LD 5J3HD 2B5IB 4HS3B 4P4KC 4PJ9C 3KG5A 1QSFB 1UCTA 2ADFL 1MCHA 4PJDB 4OKDA 3CXHK 2GSGA 1N8ZB 2NY0B 4KGLA 3VWJB 1I1YB 4M4RA 1IAKB 1R24B 3JWDL 1A6WH 5LAXA 1SYSB 3WFCL 3KLHC 4LRIA 2E7LA 5D7IE 3P11L 4GKOA 4R7DA 3FONB 3T77B 5IVXE 3KPRB 4KAQH 4M5ZL 3EOAB 2Q7YB 1HHGB 5C71A 1HIML 2PR4H 1SJHA 1OWWA 1T0MA 4H20H 1F3DH 3IDJB 1MCFA 1EAJA 3BD5A 4KUCF 3NACL 4RGNB 1DQJA 1EVTC 2CJUL 4OM0H 1S9YA 1VFOA 5HYQA 1M71A 3KAAA 1E28A 2CRMA 3ARUA 2IBBA 1DL7L 4OUOA 2VDKH 1J8HA 4GXUM 2BNQD 2R2BB 4EUPH 4HUWA 4OD3L 1FNGA 4GW4A 1WF5A 1CBVL 3GRWH 3ARSA 3MREA 4F58L 1RZ7H 4J3UA 5I17A 4A6YH 5CD3A 4X98A 2XQBL 4ZXBA 1OSZB 3FO2A 1CTNA 2IPUG 3VD5A 1MCBA 1FGNL 3DROB 5L8KB 3FTGB 4OZHA 3P73A 4WCYH 3HR5A 4Y89A 4WRLA 2X4PB 2G60L 3PWNB 3O41A 4C56E 3MUJA 5HGAB 1H5BB 1J0YA 1EO8L 5J57B 4UTAH 4AEIH 2PO6B 3ILPA 4JANA 3TWCH 1MHCB 4XH2B 1PLGL 4YUEH 5KAQG 3TIDA 2PKDA 1ZLWK 1VKXA 3QFJB 4PFEA 4NJAH 4P4KD 4XPTL 3OF6A 4N8VG 2DQHL 4PJ9D 1WWCA 4WUUB 5HHPA 4LU5H 1F00I 4G7VH 4ZFZB 3KXFB 2ITDB 1BQLL 5I75B 4O5LH 5DQJA 4RA0C 5FYKE 5F9JB 4H8WH 2G75A 1RZKC 3ULVE 1J8HE 3KLHD 2YUXA 1NCUA 1XGUB 4RRPA 4DUWA 2BVQB 5JHDE 1L0QA 3MO1A 4MXWH 3UJTL 2DQDL 3OSKA 3VGAB 5BMFL 4MJIA 5LQBH 3M1BB 4GKZA 3F5WA 1FLTX 1BBJA 5J89A 1MJUL 4Y5VC 4OZHE 1B2WH 4HPYL 4NZRL 7CGTA 5E9DD 5FO9B 1G9NL 5CJOL 4QRUA 4U4BA 4QO1A 4UILH 4P23A 2ED9A 2P8LA 3GO1H 4JJ5B 5F72S 3LEXB 3WIHA 2EIDA 4LGPB 3MRJA 4O51A 3U36A 4XNUH 5BZDA 3QG7H 4Y4FC 3O2DA 4U05A 1NGYA 4PJ5B 1VADA 4XBEL 3TH3T 4UBDC 5J11C 1K2DB 3PWPD 1UQSA 4H5SB 4WFGD 4PRPB 1AP2A 2DQTH 2XWJA 2VE6B 3HRZA 1RIHH 2OL3L 5E6IA 4ZD3H 2HH0L 4I1NB 1AC6A 1AXTH 3O6FB 4G8FA 1FVEA 3RWCB 5EU6B 3U48A 5D1QC 3EDKA 3LKSB 3T0AA 5T5NG 1OB1B 2HRPH 3R0MA 4LMQE 4R4FH 3BPCA 3QO0B 2X6MA 2P49B 4F33B 1WV7T 2DKSA 1YEFH 2JLLA 4L8CA 4OQTA 5DZLA 2VXTL 5HDOA 4X4MA 4BFEA 3L5XH 1I1CA 1XH3A 5E7BA 3RL2A 4FQ1L 3RNQB 2HMIC 1Q9WB 1JWMB 3C08H 3T4YB 4YGAB 5HYJA 3X13A 1LO5A 3CFKB 1NANI 3QIWB 3GSNB 3NIGE 4GUPB 5HHQB 4KDVA 5I8CA 4HKJA 1TCRB 4NZTH 5J56B 3LKNA 1JP5A 3X3FL 4PJGB 1GOFA 4Z0BL 1URLA 3ZDZE 4GMTL 2E9IA 3FO0L 5TFSL 1ZAGA 4ZSOE 5D4QA 3MLUL 3B3IA 4LSDA 2W60A 3R06A 1UYWH 3DX7A 3BEWA 1ND0B 4EDXA 3MFFB 1YN6A 5F7YC 2UY7A 1YDPB 4HLZH 1MJJB 1N26A 5DJDA 1AE6L 5KW9L 4Q2ZA 1FQ9C 3T0BA 3EFFA 5I6XB 4Y4FD 5MI0C 5EU7C 1NSNL 3HUJA 5IB4A 3CFEB 4UBDD 4MJ5A 4X4ME 5DSCA 2GFBA 2L7UA 5AUMA 1I8KA 3GFUA 3FQTB 4QOKA 5A16B 3F12B 3E2HC 3OAUL 3QO1A 1BFOA 3ZDYE 2D31A 3IDXH 5KSVB 3TCLA 4GS7B 1Z5LA 1CT8A 1T1YA 2R69H 4BFGA 5D1QD 5GRJH 1DLFH 5CEXA 1HQ4A 1SJXA 1CFSB 1BVZA 2CLVA 2CDGA 3C6SB 2Y7QA 2W9DH 3EO1A 4X7SH 4ZO6A 3I2CH 2H3NB 1KEGL 2ICWJ 1IGTB 2YD7A 4LAJH 4RZCA 1CGSH 4LLUB 4UDTB 3E8UH 3GBMH 4KDTC 5I1HL 2C3VB 3QUZA 2HMID 5LGJA 1D5MB 3JV4B 1TZIB 1A3LL 4NO2B 4PUBH 4BYHA 2OQJA 4E42B 2IANA 4IDJL 5D8JH 1UWXK 2YD8A 3H7LA 3VFGL 3FB5B 1CDHA 4CU7A 2DL2A 1SJEA 4L8DB 4I77H 1UVQB 4R2GC 2FIKA 5IKCB 5FKAB 1Q94B 5TQ2L 4MNHA 5D70H 2QL1A 3GDBA 3O45A 1HEZA 2DQFA 4XP5L 2H9GB 4YGVB 1Y6KR 1S3KH 4K8RL 2E8ZA 3B6SA 3V6FB 4KZDH 3TVMC 2B4CH 3VXSB 3ARFC 3ROOB 4YDVB 3VXUE 4PGCB 4PJ7A 1JTPA 4TULL 5IMMB 3HMWH 25C8L 1AH1A 2FD6H 4HJJH 2IAMC 2AJ3B 2ZSWB 4HT1L 3SDAA 1MUJB 1BJ1H 1G7JB 4JY6A 1PVHA 2EC9T 2VZSA 4HZLB 5I15L 4X99B 1MFCL 3I02A 4FQLL 4LLWB 4YJZL 1G7HB 1PYWA 1XEDA 1NEZA 1INEH 1HXYB 1SEBB 1EEZA 5GGVY 4XGZA 4Z7WF 4QRPD 3OR6B 4X4YA 4R26H 1DUYB 4BELD 1BBDL 3KHQA 3U7YL 4WHYH 1D5IH 4X9BA 1F3DJ 1F90L 2IANE 3RBSA 4XCCL 5TH2A 1BIIB 1W0WB 3DRTB 4MB3A 3IFNH 3HE6C 1U8LB 2XZAL 4OLXH 1AHWC 3OKDA 1KUMA 2VRAA 5ADPL 2M8XA 2ATPB 1NAMB 5J6HB 1DBAH 4Y4KA 2A6KA 3S9DB 3QUXB 4HS3A 5SWQA 5BVPL 5E70A 5F1OB 3RWEB 4PJDA 4FXLA 2DL9A 5F89A 3GI8H 3MRFB 2PETA 1N8ZA 4F7MB 1FLRL 4LQ1A 1I1YA 1IAKA 1VEPA 1SVCP 5C0EA 2FHFA 4JZNA 1SYSA 2KH2B 1CU4H 2PW1B 5C0BE 4QTIH 3B4NA 4WU7A 4U6YB 1GGBL 5CP7B 3GMOA 3LN4A 3T77A 1ROWA 3D2UD 2IFFL 2J5LB 1NEUA 2Q7YA 1HHGA 2AJSL 4XNQA 5H37H 3MXVH 3JUZA 4P48A 4HPOH 1PAMA 3VRJB 3L3OA 3JWNC 3QBTB 3WFHA 3TVMD 3DMMD 4Z7OF 2GY7B 3ARFD 4G8GB 1JPFA 5K9QG 3RGVA 4OZ4B 1IAMA 2IAMD 4KPHL 4KQ3H 1C16A 2CLRB 4FQHA 1FRGH 2AI0L 4YX2L 3H9HB 2CK0L 1UACH 3UTTD 2OZ4H 4AIZA 4M6OL 2P45B 2FECL 3QNXB 3DVNB 1YECL 2Z91B 3RJQB 1OSZA 1QSFE 3KPSD 4PJDE 1YMMD 3TLRA 3BAEH 1F3JA 3DROA 1VFAA 1EEYB 2B2XL 1TPXC 3DI2B 3BISA 3V8CA 1ZS8B 4JM2B 1I4FB 1QFUH 4PTUA 3FT2A 3OXSB 4TSCH 3DECA 1W72B 2F8XC 3HNTL 1A22B 1NDGB 3MRMB 3HE6D 4Q0XH 3K1KC 5D2LF 1MHCA 3KPRE 4XH2A 1FIEA 4PG2C 3BE1H 2WW8A 5TDPA 5AD0B 3QFJA 3QDJD 4RX4A 2H2PC 3HG1B 3VG0L 4B0MM 2NY4B 2OMBA 2IF7A 3DURA 1FNLA 3FB8B 3ILQC 3HMXL 1I1AA 3KPNB 2LTQC 4RGNE 4ZFZA 4OLWL 3EDEA 3HKFA 1FDLH 1GGIH 1MIMH 2YA2A 3KR3L 4X83A 4QRRA 5C3LD 3OKMA 3P4MB 5J4MA 3PWUA 4QTHA 4M93C 5EOCH 5CP3H 3IJYB 1QSZA 1T1ZA 4U1NB 4JLRA 1MHHB 1OTUC 4I4WB 5TQ0H 1AGEB 4K23L 3BEVA 4XC1H 3SE4C 3U6RA 1EO7A 4IBLT 4D0BB 3M1BA 3SJVB 1T0NB 3E3QC 5JW4Q 1JF6A 2YMXL 4XP4L 2QQKH 1T2JA 3O4LB 2WBJC 5EUKA 5MENB 3CLFH 3LEXA 4U6XA 5DJ2A 3BIBX 2XFXB 4XBPB 4PJ5A 3QFJE 1IC7L 4D3CL 3QEQA 4WUUE 2FEEI 4HHAB 2J8OA 1RUML 1WEJH 4J4PC 4XVTH 5DR5H 4QRRE 3FB7A 1ED3B 1MOEA 1MCWM 2E5EA 4F7TB 4F8TA 3CFBA 3O6FA 3BP7A 5E00B 5DC0A 5FYJL 3PG2A 1OOAA 4JFEA 4LSPH 3RVXC 3QO0A 4DK6A 4YHYB 1MNUH 3DX8B 2C1OA 2DS4A 1FP5A 1XR8A 1NCBH 3QP3A 3STZB 3CFCL 1UZ6F 4XB8A 3KGRA 2H2PD 2FO4A 1C5BL 4AK1A 1L9MA 5KN5A 4DKAA 3ILQD 2EDBA 4X6DF 5FGSA 3CMGA 4Z7VB 3VWKB 4JKPH 5C0JB 3QEUB 3VFNB 5KVGL 1JWMA 1A7QH 2AK1H 3UJJH 4U1IA 2XZCL 3RDTD 4JFYB 2QHRH 4JRXA 4WEBL 5GGTL 4ONGH 3QIWA 2L0DA 5M95B 4LCWD 5DK0B 2EDKA 4U1GC 3SE8H 4PJ5E 5D93C 2AV1A 5HTSA 1IC4L 1OTUD 3BP4B 4PJGA 1C12B 3B9DA 3Q0HA 2WUBL 1RJCA 5B8CB 4PRPE 3OPZH 1KB5H 1IAIH 3BKCH 4P2QB 1R5VB 4KHXL 4UMGA 3IFLL 3MC0A 3FFCA 2FWOB 1WLHA 4Y5YA 5EU6E 1KEMH 3WNMA 4YWGL 1JCKA 2WBJD 1YDPA 3MJ9H 5AAWA 1TETH 2WAHA 3S5LB 4KRPB 4EDWH 2LVEA 4Y4HB 3MV7B 4ZPTB 5DRNB 4L4TA 5IROA 3QUML 3TV3H 2EE3A 4XBGB 5GJTH 3SGKA 5C0FA 1H0DB 5EC2B 4C57C 1MPAH 5A16A 4IRJC 3GMPA 3EIFA 4MMZC 4B7LA 5KSVA 2VAJA 2YWYA 4QT5B 4HS8L 3PP3K 1QSED 3MNZB 2JB5H 2E6PA 3RVXD 3VFPA 2OK0H 2X4TB 4YR6A 1FO0L 3WLWD 5LG1A 3LAFA 1R3IL 3MRRB 4PLJC 3TO2B 4GRLC 4PJGE 4S0SD 4BSJA 4XPBL 3AS0A 3RA7H 2H3NA 5IUSA 3RZCA 3QUYB 2V5MA 3NOIA 2R29H 3SPVA 3BGMB 1T66C 2FHCA 2Z8WC 1MCCA 3MLYH 1KCVL 2C3VA 3JV4A 1U58A 5EO9B 1WZLA 1OF2B 3EJJX 4I13B 5F7EH 3LN5A 4U0RC 1WAAA 2EDRA 1F45A 3VXQB 4RFNC 4L8DA 1OM3L 5EH1A 3VGHA 4XVJH 4H0GA 2HLFC 1UVQA 2NY6C 2XG5A 2I26N 5FKAA 1CLZH 3RY4A 2E9BA 3KYOA 2CRYA 4NWTL 3O9WC 4KJYB 2OTUA 2H9GA 4YGVA 5C86A 3MACL 4Z7UA 4LDLB 3UMTA 1Q9LA 2VNCA 1WZMA 1NDMB 4G3YL 4OCNC 4PGCA 5B38G 5FA4A 5HHXL 1RZ8A 3BXNB 5IMMA 1DBBH 2GW5A 3BO8A 1NBQA 3UO1L 43C9B 2RR3A 3LQZA 2AJ3A 4GRMA 2Z8VC 4F15B 2FX7H 2WLYA 4X99A 1CN4A 3WO4C 5GS2H 3W9EB 1D6VL 5DYOB 2AJXH 4XVSH 32C2A 3OZ9L 4LLWA 3BKJL 1C7SA 4IRJD 3IRZA 4LP5A 3MUGA 4X6CA 2Q8BH 3K74B 3JV5A 4QXGH 4PBWD 3OR6A 2Q6WA 3GJFK 2B1AL 5HI5C 1XR9A 1AR1C 5E2TL 5ICYB 3S88L 1A6AA 1WAAE 3P30H 4KQ4H 5E2WL 1BIIA 1KC5H 1W0WA 3DRTA 4WHTA 4YHKH 3ARPA 1U8LA 4MHHG 1GVIA 4LARL 3AREA 1EJOH 4PLJD 1I9IL 1N2RB 4GRLD 1CL7L 3VH8B 4TSAL 5MEOB 2BDNH 3WMSA 5TPWL 3QUXA 3PGCA 1KB9J 5FHAH 1T66D 5I8EA 1CE1H 2PN5A 4LSSH 3VXNB 5CSZB 2V2XA 3BYYA 3RWEA 3VXSE 4Z7NF 1S8DB 1ITBB 5IV2B 3MRFA 5J12C 1CXLA 3KYMA 1TDQA 1CFNB 1B6DA 1RPQA 4L4VA 4P2RB 5CGYC 5DQDH 1NCTA 4FZEH 4CAGA 1TJGL 4MS8D 2CKNA 2HLFD 3BIAX 3MRQB 3V4VH 1WWAX 4LSRH 3X12B 3EJYC 1UM5L 1RK1B 2NZIA 2CUMA 1A1MB 2R4SH 3O9WD 1J5OH 2P42B 3DV4B 5JUEH 5KANG 1I85A 4M7LH 5M7QA 4HIJB 1U8OB 1R3JB 1CD1B 4GSDH 3P0VL 1CDJA 4OZ4A 1S9WB 9CGTA 4JY4B 4XCFL 3MLVH 2BP3A 4OLYL 1G6RH 1YEHL 4UQ2B 1RV6X 1HOCA 2Y5EA 3RWGB 5BRZD 5DUPH 3EJZC 5GISH 3SCMC 5DZOA 4GRWH 4DGVL 3A67H 5EIIA 2UY6A 1RUKL 2WUCL 3CMOL 5HJ3B 1T5WA 3DXAB 2QQNL 1PG7H 1OGTB 1N4XL 5HI5D 1U8PB 2NW3A 1AR1D 4URTB 4YDKH 4ZUUB 3PP4L 4L4VE 3OXSA 4LL9A 1W72A 1T2QH 3U46B 1NDGA 4LRNL 1IEAB 3UTSD 5J13B 1A0QH 3U83A 1XCQB 1YUHB 2A73B 2H26B 1B4JL 3E6HA 3ES6A 5F7NC 4G6ML 3TNMA 3UJIH 2ARJQ 1DN2A 4LHJB 3ARDC 1M1SA 2AJUL 1FORH 3X14A 1R3KB 1F4AA 3S36L 4G8GE 5JDSB 1QFWH 2BC4B 3P4MA 4HJ0C 4PJAF 1ADQL 5I8OL 5CGYD 5C09D 5BJTB 1JF1B 2X9YA 2WINB 2A83B 4NOFA 2X42A 5T1LD 4EI5A 1MWAB 4AT6B 2BCKA 3EJYD 5I16A 1VFBB 4I4WA 4PJEF 2RBLA 2APVA 4YZFE 3CAFA 3JSSA 4FQJH 4U7KA 3SJVA 2J8UB 2KPNA 1MCQA 3CX5K 4UOJA 1Z6JT 1FNSH 3JV6B 4N5EC 3NCJH 4P57A 3O4LA 4PD4J 1VEOA 3Q6FA 4BH7B 1A7RH 2WMPA 3IDGB 1TENA 5B3JE 2QJDA 2O61B 1CDUA 3U0WH 2O5XL 4XP6H 1VPOH 5EZLB 3HG1E 3EJZD 4PLKC 3HPLA 1JYVA 3SCMD 3CGTA 4FG6C 1HINH 3U1SL 2JJVA 4YE4L 3KPMB 1ED3A 3MCG1 5ACLA 3BPLB 1CDCA 2FNBA 2DWEB 4PRHD 2G9HA 1KCSH 1DANU 1S7RB 2I60L 5L8JB 3QDMD 2OJEB 1A64A 5BS0B 4APQC 5DJCB 5C7XL 1E6JL 2IBZX 3FQXB 1BVLA 1UB5A 2I5YL 3CZFA 4X6EB 5FFLA 4XPFL 3ARDD 2XY2A 4JFDB 3HE7C 1OGAB 3PV6B 4KRLB 3SJVE 1BP3B 5I1EL 4EN3A 2ZUQC 1P84J 4WW2C 3ZTNH 1HXMA 5DHYB 5AZ2H 2QADB 4U1LB 4MA8L 4HJ0D 1BQUA 1MVFA 3MNVB 1PDKA 4D9QE 2K9UA 3O4LE 2X4OB 5MENE 1F4YH 2UV3A 4AQ1B 4JY5H 4ZO9A 5DK0A 5T3XD 4NP4H 3ULVD 3F7PC 1JTOA 4Z7QF 2ZKHH 4WO4B 4JB9H 4QGTA 3BP4A 2OS7A 5T3ZH 5HGDB 4Y0GA 4L1DA 3U0PB 2A77L 4UQ3B 1J0KA 5D5MA 5BCAA 1E4KC 3GI9L 3AGVA 1JGLH 2C7UA 3WE6B 4N5ED 4YHNB 3VXPB 3WFBH 2YA1A 2R0WL 3BP5A 3HI1B 5DZNA 1UKSA 4FA8A 5EA0L 1NCAL 5HGBB 1DN0A 2B0SH 3S5LA 1IL1B 1BOYA 3MRNA 3MX0A 1HHKB 2XA8L 4H8WC 4ZPTA 1IILE 2I24N 4TTGA 1MF2H 5DHVH 4P4RB 4PLKD 5SWZD 4DKEH 2H32B 4FG6D 2FB4L 3BI9X 1BFTA 3WD5L 1BAFL 1QO3A 3OXRB 1AFVH 3OWEA 5DWUH 3IETA 2EH7H 2P8PB 5L6YH 1U8QA 4QT5A 3MA7A 5CIPA 3BQUD 3WN5B 4LSUH 4F80A 4L5FL 4XCEA 1TITA 3RUGF 4Z5RB 2I07B 5HD8D 4APQD 4IEFB 4LPYA 1MAML 3HAEH 1NQBA 3L9RB 1YNKH 4FQCH 1FC2D 1EUTA 1FPTH 3NH7H 3PWLA 4HJGB 4OZFG 3HE7D 3A6BH 3BGMA 3BJ91 5D5ME 1TTUA 4MJ4A 4M7JL 3F7VB 1HZHH 3GSRB 5DURB 1XAUA 4P2QE 1IAII 3MR9B 1Q1JL 4NC0B 1KCLA 3PUCA 2RFXA 3K7UA 1KBGH 1YYML 2VZOA 4N68A 1B0RB 4BZ1H 5HDLA 5KSAA 1LE5B 3VXQA 4Z7WB 3LS5L 4JFXA 4I0KA 3HI6H 1OT2A 1U2HA 1ZVHA 2C5DC 4OZIB 5JPNB 3TYFB 4OCWL 4WIQA 5BXFB 1Q8MA 3IDNB 4MLIA 3MV9B 2OR8A 1JFQH 3RTQA 2A0LC 3FMGL 1FBIL 4MA7H 3WHE0 3KDMA 2ZJSL 4NT6A 1NDMA 4ZUVA 5EUOF 1TJHL 2H8PB 2IJ0C 3QXAB 4NUJB 3KPOA 4XNZB 3UTZB 4IRZH 2H2SC 2IBZY 43C9A 2RAMA 2X4SB 2UWEF 1QKZH 3MOAH 3BUTA 2C1PB 4PRAB 4UB0H 5KSUA 3N85L 4NRYA 2R1YA 5F6IB 3C5ZC 5MEPA 4QHNA 5FYKH 4D0DA 1BZ7B 5B39B 4F8QA 1B0WA 5D1XC 3O0RH 3BYTA 3TNNB 1Q9KA 3MGOB 2OXGA 4DGIL 4B7IA 4JG0L 1ZK9A 5A1AA 3MRGB 3O2WH 4XMPL 3V5HB 4YXHL 2W9EL 4JRYD 4ISVA 1XF4B 2CPCA 6CGTA 4QHKJ 1K9TA 5EOTB 2CIIB 4LAQH 4WHCA 3T2OA 5DJAB 1EMTL 3GBNH 4DQOH 3CH1A 5MEOA 1MJ8H 4JCLA 4WI8A 4YAQB 15C8H 4MLSA 2R8SH 3QI9B 4LQFL 5L9DL 1R5IB 5CSZA 4L1HA 1F2QA 3PHQB 1UXWA 4U3XA 2FX9L 4LCIH 5JW5B 4XMLH 1DSFL 4XCNB 2CLZA 4P5TA 3OQ3B 4Y5XC 4M8QB 1ETZA 4Z76B 3V8OA 4PJCF 3SDDB 3ZKNC 2AKRB 1BM3H 1AGCA 1CFQA 5ABDE 3CJJA 1BLNB 3N0PB 1IM9B 4WFFD 3DV4A 4OCSH 5ACMA 3UTPD 5KG9A 5D2LB 2AK4A 1R3JA 4M7ZB 3TBSB 2A0LD 3WSQL 3ZE1F 4P3WA 3SDCC 2KKQA 4OGYL 2BOBB 1S9WA 2H2SD 4JY4A 4ACPA 5IB1B 2BZDA 1MRDH 1IM3B 5INCA 1I8LA 3UXFA 4X9FA 1MCOH 2FCBA 4UQ2A 4K3DH 2AABH 1QRNA 4P9HL 5DMGC 4HG4K 4X7FC 3WJLA 4EXPX 3TZVA 1GGCL 5FCUH 5I1IL 5D1XD 3KYKL 3DOSA 2DD8H 1KULA 3C87A 2D4FA 1UM6L 1DP0A 1OGTA 4OT1L 3G6DL 1I1FA 3O2DH 3ULSA 1MEXL 3KVQA 4UT9L 1CGTA 3BH9B 4ZUUA 3VXMB 4P2RE 2P47B 4KKAD 2D03L 4XAWL 2B4CC 1EBAA 1IEAA 4XPHL 2A73A 1KCRL 4R97B 3VFUB 5CEZE 5IEKA 4KTEL 2IALB 2BX5A 1IEBB 2FH6A 4P3CH 3EFDH 5CWSB 3O6MH 3DVFA 3GK8L 4ZO7A 2HVKA 1R3KA 3KNBB 2HTKC 4QHKI 2EYTB 2Y6SC 2YBRA 3NFSL 5F1SA 4AQOA 4OQTH 1JVKA 3BWAB 4XNMB 4PJ8B 5FEBA 3TH4T 3IU3B 1JF1A 4XNXL 4KJWD 2WINA 2A83A 3QWQB 3ZKND 4X4XB 1DE4A 3QZWG 5FUZH 1MWAA 5C07A 1WFNA 1VFBA 1E4WL 3UBXB 3F7YB 1YEJH 4H26A 2NPLX 5IESL 2J8UA 3D0LB 1I9RH 3WJJA 1WTLA 3DXAE 2G5RA 3SDCD 2JIXD 3WBDA 2ZZUT 3G5ZB 5E6YA 1JN6B 3SOBL 3HPJA 4X6DB 5A2FA 4LSTL 3RWJA 4LVHC 2F74A 2BSRA 3BRDA 5DMGD 2JJTC 3QWRD 1EPFA 3RWIA 4ONFL 5EZLA 5JW3L 1TVDA 3H3PH 1FL6B 3GGWB 3QJHB 4G9FA 2HJLA 3EYOB 3FCTB 5JZ7D 5SWSA 2DYPD 1QFWI 1QSFD 4KTDH 1PFCA 4Q6IC 3VGBA 4HXAH 3OR7A 4M5ZH 5ILTL 4WWKC 5I1GL 1YNTA 4LKCB 3C6LB 4MAYC 2OJEA 4NOBA 4HUVB 1N0XL 4OF7A 5DJCA 1U8KA 5FOBB 5EBWA 2CJUH 1RHHB 3L7EA 5DHXB 3JTSA 4HUMB 4EI6A 4KROB 1U93B 3LRHA 2J8UE 4DKDC 3D5OF 1WBXB 1FH5L 5C0AB 2FGWL 4I3RL 3TN0A 4F58H 2Y6SD 4J3WA 4RGND 2VH5H 4WU5A 2XQBH 2X4OA 5ESAA 2WP3O 3WIIH 1OARH 4O2EB 4MNQA 3EOBB 1A5FL 2D0HA 1J0JA 4O02H 5CS7A 4QXUH 3NZ8A 2HTLC 4X5XB 2C9AA 1A7BA 1FYHB 2VABB 4JPVL 4X5LA 2HN7B 3MLXL 4NKMA 3IDMA 5I76B 1SMAA 1UC6A 4PB0H 1R3HB 4HH9B 4LK4A 3VXPA 4NQEB 3GM0A 3TO4B 3TF7C 1AXSA 3MRIB 5IHLB 4XPTH 3VJ6A 5I8KH 1TZGL 2DQHH 2A6DB 1JHLL 4NHUB 3ZLQC 5H35B 2F53B 1I3RA 4GBXA 2UZIL 5MEQA 4NZDA 1TVBA 4P4RA 2OP4L 4JFDE 1OGAE 5K9KB 1IE5A 1N59B 3MGTA 1J11A 2VTFA 1YEEH 1EVUA 1K8IB 4ODTH 4EOWL 1HKLL 3V6OC 3ZYZA 3WN5A 1Z0NA 2OTWA 4WWKD 3KXFD 1IZJA 3OKEB 1Z9MA 3UJTH 3ETBF 4WUKH 4QRSB 4UNTA 4MAYD 2P8MB 1NGZA 5GS0L 1ZXQA 3LV3A 1JWSB 1I3GH 4XAKD 1G0XA 5F9DC 1G9NH 2VLJA 2YRPA 3BDBA 1ZT1A 3T2NL 1G7IA 1M7DA 4ZDHB 2IPKA 2Z93A 3F7VA 1T6WA 3OKOA 4Y19B 2ADJB 1INQA 3QQ4B 4XTRD 5TDNA 3PWVB 4N9GA 3LCYA 4NO0D 3W9DB 5DK2B 3I84A 4JM4L 2XWBA 4L9LA 4GW1A 1P9MA 2ZWLT 1A7OH 4PJFB 1AC0A 2HTLD 1I9JL 1A3RL 2DB8A 2J2ZA 1UWGL 3D39D 3V7AE 4OZIA 1KPVB 3T09A 1S7WA 1T22A 5HPMB 3MROB 4CVZB 4NNYB 2XKUA 3IDNA 1CICC 3NFNA 5D7JB 1SM3L 1FJ1B 3MV9A 3WS6A 5BQ7B 1P4IL 5I1AA 1FFNB 3Q5YA 1U8IB 2EIBA 2W0FB 4PTTA 5DUBA 4XXDA 1XIWC 5E56A 4D9LL 1ZGLM 4EVNA 3LQAL 3K0WA 5F93C 3QIUB 4MQTB 2C1PA 2VLRB 4PRAA 2XWTB 4RNRB 4UV4L 2O93L 4WFED 4H88H 2ZG2A 1GYAA 4MDJB 2V9RA 3C5JA 4JDTH 5B39A 5DQ9A 2Y07L 1RURL 3TNNA 4ZOEA 4N0RA 3MRGA 4RMQA 3P9LB 4Z0BH 2CKBL 3WNLA 1MLBA 4PJHA 4CUCA 1XF4A 2DJ4A 4R4ND 3VXRD 5H2BB 5DJAA 4TUJB 4OV6F 4OQ1A 4JQXC 4BH8B 4OZIE 4WY7H 1FL5B 5DA4A 3ISWA 3HZKA 4BKLB 3GIZH 1DVFB 3D3VD 1YEDB 3QI9A 3MV9E 3L3IA 3PHQA 3I6LE 2A6IB 3RU8H 3QIBC 3UPCA 1ZTXL 4I0PB 5K93A 2VLKB 4JREC 3PWJA 1UKTA 1H3PL 3L7FB 4XCNA 2B20A 2NTFA 5EOQL 1T21A 4W6YB 4M8QA 4QY8A 1J05A 2BSED 4JO3L 1VGKB 2DQUH 3LS4L 3OAZK 1CI5A 4PLNC 2VISB 2DIBA 5JQ6L 4UIMA 4ZPVA 4OUUA 1CICD 1UB6B 4KJPD 2DTSA 7FABL 5CAYB 4KWUA 1KNOB 2DBLH 1NUDA 5I0DA 5K9JH 2NY3B 4ODXA 1XIWD 1CD8A 3I6KA 2NX5B 5D7LB 5BV7L 2G5BB 5IB1A 4Z7OE 4PJHE 1IM3A 5T33L 2V17H 1TIUA 3HC3L 1F8TL 1WBYB 1RUAH 3BUYB 5I1HH 5E8PB 1BECA 3BHBA 1P6FA 3TBYB 3DUSA 1KENL 5IMKB 4UT7H 4XRCB 3V0AC 3BH9A 3VXMA 5TQ2H 3G08A 1BMGA 3ZT6A 2X4NA 4NQCB 1NUNB 3QUMB 2W1NA 4NN7C 1FG9C 1A6WL 5C0DA 4C4KO 1UH3A 4ZUWB 1INDL 2H6PB 2I9TB 3S34L 2V2WB 3RY6C 4MXVF 4KAQL 5D2LE 1CXKA 3DVIA 4JZJA 4JDVB 4AG4L 3KNBA 5I15H 2FLRT 3K4AA 5IEHB 1QFPA 3O6LH 4LMQI 2PR4L 1YY9C 3IXTB 4XC3L 4H20L 2EYTA 5J9PB 3H3BC 3VD9A 3G5YB 3OKLB 1FO0B 1E27B 1OW0A 3BWAA 5HGHA 3BIKA 5E5RB 3Q3GB 4NJ9H 3GIVB 4OM0L 5E4EC 2HFEB 3AMKA 1LK2B 3LEVL 2VDKL 2ZUTA 4MJ6B 4X9GA 4W81A 4W4NA 3F7YA 3WXWL 3U7YH 3AFLA 4QHLB 3GRWL 3IT8D 5HHNB 1RZ7L 1A4JB 4OFPA 3D0LA 4ONOA 4A6YL 4X6FA 4IMLA 5GS1A 1MAJA 4F37F 1HILB 4IOSD 5SV4A 3VXME 3WDHA 1R3LB 3LKPA 4P4KB 4WCYL 1ZA6B 4PJ9B 3M17A 3EGSB 2JK5B 1KTLB 2E9JA 5ENWB 4UTAL 4AEIL 3JBG7 3AS1A 3TWCL 3QJHA 1CFVL 4A2MA 4YUEL 3EYOA 3ZE0E 2YRLA 4NJAL 4IMKC 5IVOA 2MQ3A 1LDSA 1I7TB 1XF3B 3UTQA 3BZEB 2IFFH 4NN6C 4G7VL 1RK0B 2AJSH 2YPKB 1WJ3A 4LKCA 3C6LA 1NCDH 4O5LL 5FOBA 1GGUA 3QXWA 2A74B 5E9DB 4E5XB 2AAVA 3FB6B 2M1KA 3Q5TA 5EULV 1FSKC 5F88A 1BD2B 4EIGB 1WBXA 4MXWL 1SVZA 5C0AA 2H41A 2GT9B 1UKQA 1KIUA 5LQBL 1I8MA 2CK0H 1FG2B 2WQRA 4X6DE 2DI9A 1BVKB 3I50H 3NIDF 3PWPB 1YECH 1B2WL 5L0QC 4UILL 1A6UL 1LK3L 3GSUB 3S3PA 4X5XA 5C08D 5FK9B 2B2XH 5IOPA 2VABA 1T6VN 3RUGB 1FIGL 3R1GH 1MCIA 4XNUL 3QG7L 3MYJB 5FO7B 5KOVC 4MWFA 4NQDA 3UDWA 1P4BH 3DGCR 3HNTH 3CPLB 2P7TB 3ARZA 3HCVB 4BK5A 5FUOL 4OF3A 5AG8A 1FYTA 1R3HA 1H15B 1TVHB 1NCCL 2DQTL 2DN7A 2J1KA 1S9VB 5HI4C 3MRIA 1RIHL 1R6VA 5FA3B 4ZD3L 1AXTL 2JF1A 4NHUA 2BFVL 4WI9A 1GHFH 5CBEA 3SKNB 1LHZA 2F53A 4OLWH 2X44D 1KXVC 2EKSB 1NFDF 2HRPL 1HCVA 2HT2C 3QPXH 5E2UH 4JVUA 4IRSC 3UYOD 4L3CA 1YEFL 5HDQH 1D9KC 1KPRB 3VDAA 5C0AE 3HG1D 2DQCH 3L5XL 2XQYG 4M1GH 3QH3A 1ZWIB 4M03A 2VAAB 1XCTB 3IAPA 4JEGB 5J6GA 4QRSA 1IEHA 1PY9A 4Y5VB 1J8KA 2WK2A 2RQ8A 2YZ8A 4OFYA 4ZNEA 1WT5A 2UWEB 5JPMB 4ZDHA 2VITB 4NZTL 5EORH 3BMWA 5D71H 5IT2L 3QQ3B 1HYRC 4JKMA 3VI4E 4Y19A 4NQEE 4Y4FB 1DBJH 3BFOA 4ORGA 2BMKA 3WFZA 4AZ8A 1MFNA 1FN4B 5J11B 5GSRA 3W9DA 5DK2A 1P5VA 1RUMH 1UYWL 3EKCA 3GM8A 4PJFA 1ORSB 2F53E 1V7MH 1N7MH 5MEND 2LFGA 5HPMA 3P9MA 5D7JA 1C5DA 5D1QB 3MA9L 4Y1AD 1FFNA 3CXDH 1T1XB 1C08B 4FRWA 3FN0H 3BD4A 4NQSB 1QYGH 5HI4D 3IDXL 2BNUA 1C5BH 2GJZA 2GCYA 5E03A 2QSQA 3RWFB 2VXVH 3GJEB 4V2CB 3PDOB 2R69L 3H42H 2XWTA 4RNRA 4HWUA 5GRJL 1UEMA 5KVGH 4NZUL 3IJSB 1DLFL 4U3CA 4ZNEE 1CXIA 2HT2D 4I48A 3AVEA 1D9KD 3BDYH 4X7SL 3BH8A 3BZ4A 4H1LA 3VXOA 3I2CL 5CJXC 5J7CC 1RJLA 4Y19E 4TNWK 3WFEL 1KTDB 3WUZA 1CGSL 1ZGLA 4OD1L 1IC4H 3F62A 4KFZC 2NY1C 4QCIA 5K59E 3E8UL 2NQCA 3GBML 2XN9B 4UUJA 3BKMH 4PJFE 4YXKH 1AGDA 4BH8A 4P59H 5DMIH 5D8JL 4UDUB 1VSCA 3IFLH 4FNLL 1DVFA 3QCTH 1H3VA 4I77L 4WI2A 3ZO0A 1W72H 4WI6A 4MMXC 3M8OH 2A6IA 4TRPH 4BUGA 1MFBH 4I0PA 1S3KL 4WW2F 5MI0B 4B53A 4KZDL 4U33A 1MHEB 3L7FA 4P2QD 3PF2A 3UC0H 3TGXA 3QXDA 2VLRE 2XG4A 3HMWL 1VGKA 3E2HB 2MQCA 4QF1A 2FD6L 4HJJL 4QRPB 2VISA 2HLAB 1NLDH 2X4QB 3Q5OA 4HS8H 5EBMA 3P0YH 3MV7D 5DFTA 4FFYH 2XNAA 5J06A 2HFGL 1L9NA 4QKXB 4L8SC 1T3FB 1R3IH 1T5XA 1UADC 4JKWA 4ZOCA 1INEL 4F2MB 3GHBL 3WO3B 3H9YA 1TZHA 2G5BA 4U1MB 3N9GH 3RIFK 4N1EA 4X80H 4KHTH 2DQIL 5ESVB 1D5IL 2YSSB 2X09A 3GUTA 3KYAA 3BUYA 1MSPA 5E8PA 3IFNL 4OLXL 4MYWB 3G6AB 5INDA 2V7NA 4AJ0A 4DN3L 1F4HA 3CNKA 3V0WL 1ZLWH 1DBAL 1U91A 3QUYD 1CQYA 3PABB 4R2GB 3D2UB 2NY1D 3DVGB 4NQVB 3BW9B 3FQRA 3GI8L 2Z8SA 2GHWB 3PXHA 4LRIC 2E7LC 2ZCHL 5JXEC 4HWEH 3TVMB 2X1QA 4K7FB 1KJ2B 3ARFB 5ICZB 4Q58C 1CU4L 4PV8A 4QTIL 5FO8B 2IAMB 1IGYA 3WKMH 5IQ9B 3GMRB 2BNQA 1MAKA 2HWZL 3MXVL 4PJXF 1EEUA 2GTZA 1JHTB 4HPOL 3DNKA 1P2CB 1H8NA 2NX5E 5D7LE 3MLSH 3UTTB 3WCYA 3GIVA 4HBCH 3IGAA 1S78C 1IAIM 3ZE2F 3W5NA 3QDGB 4KQ3L 5LGHH 5E2TH 1NFIB 1FRGL 1A1NB 3CLEL 1YEGH 1QQDB 1U8NA 3QA3B 1UACL 1QEWB 1RJZB 2F19H 2OZ4L 3CIQA 1D6EA 2RCSL 3HE6B 3HS0B 4AEFA 5IB2A 1AHWB 4U6VH 2LU7A 3FRUB 3VXTB 1DBKH 1T7XA 2Y36H 2X5PA 3QDJB 4P4KA 4YHPB 4NQCE 5TF1H 3V5DA 3KPPB 3U82B 1QFUL 1Z9LA 2V6HA 4TSCL 4MQSB 1KTLA 3VH8G 3BN9D 4Q0XL 4X8JB 4N8VA 4RAVB 1SYVB 3BE1L 3B5GA 1HHIB 3NPSC 3QQNA 1JIBA 2MFNA 1AGFA 2WANA 4GKSA 1A9BB 1XF3A 2IWGA 5ECJE 1R0AL 3FQNB 3U9UB 3OJMB 4OM1L 1P1ZB 3X3GL 2HJKB 5CJ8A 1GGIL 1FDLL 4UU9B 1V8HA 5JXED 2Y9RT 3CFDB 3C5SA 5EO1B 1CDBA 1UT9A 5EOCL 1Q0XL 4YDJB 5E9DA 4HAGA 5CIPH 2XKNA 3ZHKA 3L3HA 3FB6A 2PYFA 4NFBA 4HC1L 2ZP0T 5TQ0L 1PSKH 1N5AB 2N56A 4XC1L 2EIZB 1CGWA 2UUDK 1FG2A 3BPNC 5E8DH 3LDBC 4P23C 4JKKA 3BVNB 5MP6H 5C1MB 1OPGH 3WIFB 3OJDA 4G43B 4AENB 2QQKL 2QQNH 5EPMA 1N4XH 1TPXB 3CLFL 2NY5H 5FO7A 2VXQH 2AEQH 3GSVB 1N0LA 4L8BA 2JELH 5EIQA 4Z7QE 5CINH 5F3HB 5E6IC 2OI9C 3BZFA 1H15A 1TVHA 4G6MH 1NMCC 1WEJL 4EJ1C 3KHOA 4XVTL 4RMWA 3DXAD 5FA3A 4Q74A 4HQQH 2AJUH 5KJRH 3QJFB 4RMRA 4HZAA 4KKCC 3VFOB 2LTQB 4HUXA 4X9HA 1AIFB 1OP9A 4LSPL 1NBZA 4W4OA 5L2KB 5E9DE 1CXFA 4GG6A 1MNUL 3ARTA 3HTLX 3GSQB 5CZVH 3WUWB 3RKDC 5I8OH 1PY4A 2EICA 5D9SA 2EXWC 1NCBL 4M93B 3WLBB 1OLLA 4LNRB 4LCWB 3K8KA 3KLDA 1ZWIA 2DI7A 8FABB 4KI5C 4DEPC 4JKPL 1VCAA 5D6DC 3PWPE 3O3EB 2L7JA 5IWLA 1A7QL 4PV9B 5DRWB 3UJJL 3RFZC 3D1MC 5FYJU 4WFGE 4M61A 1SY6A 2QHRL 3JUYA 5I71C 4ONGL 1UWXH 3QHZH 1X5XA 4JFFA 3RUGE 3W0WA 4NYLB 2UWEA 4ELMF 1KLGA 3CCHA 4O2FA 5LCVH 1JNLL 2WBJB 4Z0XA 1ZVYA 4NRXA 1S7SA 3VG9C 4Y4FA 3OPZL 3LRSB 4P23D 1KB5L 4RISH 1IAIL 3BKCL 4UTBH 4OKVA 4WDIB 1WFOA 1GZPA 3WFDH 2AERT 3T3PF 4ZTPH 3U4BH 4CGTA 5IFJB 3MJ9L 4CNIA 1TETL 1LDPL 43CAB 3CXHJ 1MY7A 1PQZA 4Q9QL 4EDWL 5DUML 5CUSL 2I60H 3L5WA 2YC1B 3IVKB 1KIPA 4FTVD 5GJTL 1CDYA 3VFVB 5E6ID 2ZCLL 1MPAL 1MVUB 2ZCKH 3CSGA 4NQSA 5DD6B 4X9IA 2D9CA 1EAPB 3ARRA 5DI8A 4XPFH 4DUXA 1GRWA 5FM8A 5I1EH 3DBXB 4KKCD 5ITFA 1AQDB 2JB5L 5ETUB 5BS0D 1JL8A 2OK0L 3IJSA 2DDQL 5T1DH 1H3GA 5C9JA 3K2MC 2UWEE 3GKZA 3LKRA 4JFOB 3RKDD 1RJYB 3EYSL 3FOLB 4YHIB 3TT3H 1IGIH 3RA7L 1L6ZA 5HHOA 2R29L 3QUZC 4U1GB 1KTDA 2JE8A 1UEYA 3RHWK 4KI5D 2CDEB 5D93B 3UAJC 5HYJD 3MLYL 1QFWM 2CGRH 4NNPH 2FYYB 5CZXC 1GGYA 5F7EL 2ZUWA 3UZEA 1ZLSL 1DQMH 1U3HA 5T1MB 4WW1B 3MUY1 5DRXB 3BX7C 4XVJL 2AJVH 4LIQE 3NGBC 4GAYB 3ZYJA 5IBTH 5EA0H 3O4OC 1CLZL 3LEYL 1JJUA 1NCAH 1FNEB 4O2CB 4GG8A 4OF8A 4ZOBA 2XA8H 1JGEB 1UA6L 1ODAA 1MHEA 4RIRB 5C0CB 2GITA 2ZNWA 4R0LA 4IRJB 5ANMB 2J6EA 1DBBL 5ADOL 1BAFH 3L3JA 3V7AG 3AAZB 4QRPA 3C9NA 2HLAA 2FX7L 3DGGB 5IW6A 2X4QA 5E2VH 1RMFL 1EFQA 4XMKH 1ACZA 4QOKD 2AJXL 1MI5A 3HNVH 4XVSL 5DJ0B 2UZYB 1RZGB 1T3FA 4J2XA 4K3EH 5EU3B 1G9NC 1ZOXA 2Q8BL 4GRLB 4UIKH 3DYPA 4QXGL 2IADA 2ZUUA 3O3BB 2XN9E 5E8EB 3ZE1E 3GMNA 4X7TA 4WI5A 4J3XA 3EZ8A 5F96L 1NC2D 1U6AH 3GSWB 3P30L 4HK3N 4KDTA 4KQ4L 4OSUH 1KC5L 1U2CA 4YHKL 1W8OA 2Z35A 2A6JB 1Q1JH 4OCYH 2P5EA 4Y4KC 1A6ZB 4IJ3C 3NTCH 4U31A 4U0RB 2FEDC 4JFZH 4FQXC 4RFNB 2BDNL 4ZFOL 4OLZL 4MQXC 3N1GC 4O9HH 4M1DH 2VUOA 4BFBD 1X7QB 4HGMA 3PABA 2NY6B 4LSSL 2HKHH 3D2UA 2QBWA 4OCWH 3BW9A 4MZ2A 1MH5B 2VERN 4HMDA 3O9WB 3VRIA 3PL6C 3H0TB 3SKOA 3OKNA 3LOWA 1W2KT 4PY8J 5CZXD 3ME0A 3TVMA 3DMMA 1ZVSB 3FMGH 1KJ2A 4QRPE 5ICZA 1K4DB 5DQDL 1JF5A 4OIBA 1NGPH 1ZT7B 4V1DD 5AZEH 2YPVH 4BJLA 3CVHA 3V4VL 5A43C 2IAMA 3GMRA 2R4SL 4UV7H 3EYVB 1VEMA 2C3HA 1GAFH 1JHTA 3WO4B 5JOPD 2D4DA 3RGVC 5CBAB 4M7LL 1J7VR 3I6LD 5KSBF 4F9LA 3UTTA 5BRZB 3RPIA 3QCUL 4K94H 3BD3A 3P4OA 4GSDL 3KPSA 4PRNA 4G8IA 1YMMA 2GJ6D 5F21B 1GIGH 3MLVL 1NC4A 4S1DC 2YWZA 3VFSB 2DLFH 1G6RL 1JZ6A 4J23A 3INUL 1HQRA 3N1FC 2R2EB 4UOW0 1U42A 2W9EH 2ENSA 2PW2B 3JWOH 5DUPL 2VZ1A 1G7LB 3BP6B 4R6UA 3HE6A 3HS0A 3UTSB 5GISL 4HUUB 3A67L 5IF0A 3K4DA 3VXTA 4NKOB 4AMKH 5DJ6B 3DIFB 3KJ4C 1A3QA 1PG7L 3FAXA 3QDJA 1RVFH 4MX7B 1NJ9A 3MLWL 4MCYB 4LF3A 1T04A 2NNAA 4P46A 2K7QA 4YDKL 4TUOB 1BREA 1UG9A 2DQEL 5DVLA 1T2QL 5J12B 1BZ9B 3V4PH 1ZLUH 2BY3A 5HXMA 3UZQA 4X8JA 4Y4KD 1DSFH 1NCWH 1A0QL 2P24B 5I9QC 5CKGA 2FEDD 3CH8A 1FFRA 4FQXD 5C09B 3MLPA 1I1AC 1Q72H 4MQXD 5T1LB 3ARVA 4KV5F 2ZUYA 1A9BA 2MCPH 1FORL 4Y16C 3U9UA 4NZJA 3UTTE 5AWNH 1P1ZA 5E4IA 1PZUB 2HJKA 1DEEB 1DFBH 1QFWL 3PIQB 4UU9A 3PL6D 3EYFB 2FO1A 5IJKC 5E1AA 3WSQH 4LLMA 2MQ0A 1KIRA 5FB8A 2VDRH 3SDDD 4NSKB 4C55A 2Q87A 1QD0A 5F7LB 1P5UA 4NKDA 4MB5A 1JGDA 4PGDA 2Y5TB 5C9KA 4YHML 1C7TA 1YJDH 3AC0A 2CKBB 2EIZA 1NFDB 5HDBE 5F71A 4FQJL 4W70A 5IVZB 4BZ2H 1U8MB 3QDJE 1FNSL 1N3NA 3WIFA 4NM4H 4J12A 3O2VH 3MBEA 3NCJL 3SCMB 4HK3J 4LEXH 3VRLF 2EDHA 5JW4N 4AENA 1LE9B 2CR3A 5FGRA 5F3BA 4OT1H 4S1DD 3BKYH 4PRHB 1KF9B 3RVUD 3GSVA 1OTTC 2D03H 1XGYL 3QDMB 3U0WL 2PNDA 4XP6L 2EYSB 5IVNA 1VPOL 4JFPA 1LD9B 4KKNA 4O58H 4ZQKB 4XPHH 5F1NB 5IB3B 3H9SA 2BNRA 3JTTB 5K9OA 1HINL 3OB0K 1XF5B 3QUKA 5A40E 2ZOKA 2ZPKH 3ARDB 1FVCA 3CFIC 5JNYB 5KVFH 4ZOAA 3LH2H 3VFOA 4HIXL 1XMWA 2BVPA 2C4FT 3NFSH 4QRQA 4RX4D 3FAWA 3RDTA 2VDLL 2VXSH 3WLBA 1I1AD 1N6QH 1HHHB 1BWMA 4XP9H 1MRFH 2HYMA 3FQUB 3FT4B 4Y16D 4CW1B 1OAUH 2CRIA 4K3GA 2YXMA 3NA9L 5D6CA 1JUFA 2BHZA 5AZ2L 3W11C 4AL8H 5D1ZC 2EDQA 3SE4A 4DAGL 1BPVA 4PJ8D 2DM4A 1NCNA 4JPWH 3UBXG 1F4YL 1DLHB 1MFEH 2G2RB 4JY5L 2DIAA 1OCWH 2ESVD 4K55A 3NZHH 3QDAA 4NP4L 4PJIF 2ZKHL 1PKQB 4JB9L 4LSTH 4ZFOA 5T3ZL 4NPYB 2BVOB 1YMHA 3I3BA 5AYQA 3HC0B 4PJBF 5FV1L 2ADGB 3W39B 1ZLVK 4Y5YC 3FKUS 5JW3H 5L7XH 5SWZB 3S96A 3RNKB 3C2AH 3WFBL 2FJGA 5DJZB 2AEPH 5DA0B 5L88H 4PR5B 1S7XA 5IFJA 5L2KE 1YPZA 4JJHA 4RGOH 5IROC 4ESKA 5ITBH 3SGKC 3QEQD 5E24E 4K8RD 3IAQA 1QSEA 2YC1A 5GHWH 1ORQB 1MF2L 4APQB 2XTJC 5KS9F 1U92B 4LCWE 4QNPE 4DKEL 1WIUA 3GMQA 2W38A 1AFVL 1KG0B 1V5JA 4GJTB 4JFED 4OZGA 2GY5A 2EH7L 2HRLA 3GJFH 3HE7B 5L6YL 1QSVA 4ZYKB 3DBXA 4EUPB 1S7VB 2NLJA 2ZUQB 4XXCC 4ZFFB 4WW2B 3E3QE 4I3RH 3TM6A 4NHCL 3K8MA 1Z9SA 3RZCC 1YNKL 4JFOA 1ZA3B 1FPTL 3NH7L 1RJYA 4FQCL 4M6MH 2EIEA 3L3DB 2IFGA 1R5WB 2NYYC 1HZHL 1Q0YL 4JPVH 2JCCF 4JAMA 4JRXD 2DLTA 3W11D 1G7MB 5E94B 2X7LA 5D1ZD 4NRZA 1T89C 5IB5A 2AEIT 1LEKB 4MA3B 1Y18A 2FYYA 4PGJA 4BZ1L 1CF8H 5ISZD 2YA0A 4MAUH 5F1IB 3HI6L 4G7YH 3R0NA 1QSEE 4GAYA 4I5BA 5DK3A 4IIQA 1KIQB 4MB4A 4R90H 5B38A 3MLTA 5DC4B 2BHYA 2V9QA 2HT4C 1UXSA 3VMOA 3FFCD 4TYUA 3TJEH 3JV0A 1TJIH 1W0VA 2OP4H 4ZUTB 2CQVA 3PXJA 5IJVB 4IRJA 3TO4D 3M07A 4GRWF 5C0GB 2X4UA 4IRZL 1FZOB 4QHMB 2E7HA 3IKCB 1QKZL 2FJHB 3MOAL 4L4TD 5IQ7H 4D9RD 4AEEA 4UB0L 1U0QA 5DJ0A 3NFPB 3THML 4JRYB 1G9EA 1Q9OB 5FYKL 1MQKH 2YS4A 1RZGA 2BSTB 5GS0H 3C2SA 2VDNH 2XT1B 3ECBB 5EU3A 3L95B 1X4XA 3O0RL 3LRGA 2E7BA 1GC1H 4PD4K 1BFVH 1X5LA 3OMZA 2R2HB 1ONQB 1M6OA 2XICA 4PJXB 2O5YH 2HJFB 1HDMB 3AREC 4F7PA 1FZJA 3PQYB 2ARJA 4G80B 1A6ZA 4LAQL 3RZCD 5I2IA 3GBNL 5IR1A 4I2XB 1PEWA 5GGUB 1MJ8L 1G7QB 3IDIB 5I1DB 1QLRB 2QV2A 2QQQA 4TNWF 2NYYD 5E8NA 3RL1B 2YD9A 5A2JH 3QISA 4K9EL 2OR7A 4UNVA 3SKMB 5FM5O 1P6AB 1C8PA 4JFQB 4MD4B 5JORB 4LCIL 1SM3H 1TQBC 3D18A 4XMLL 1WCBA 5E2JA 1ZVSA 4P2OA 1A6TB 2FRGP 4LEOB 1ZT7A 4PGEB 4P9MH 1BM3L 1BJMA 2NMSA 1X5AA 3LQAH 5E8OB 2IH3B 4I8DA 2VLLB 1EHNA 4DK3A 3HZYB 3EYVA 3IFOA 2X4RB 3C5ZB 3VGGA 2IH1B 3BRGC 1ZSDB 2ITCB 3TIEB 2Y07H 2VOTA 5D1XB 3KYNA 5JA9A 4OV5B 1MRDL 5FYLH 5CGTA 2WZPD 3QIUD 2W65A 3VFSA 1WBZB 3KLAB 3ZKMC 4DZ8A 4K3DL 4J8RB 4R96B 2APWA 1G7LA 4MSWB 5F7KC 1X6NA 4BM7A 3UTSA 4HUUA 5FCUL 1XF2B 2DD8L 4NKOA 1MCSA 3QWOB 4H25B 3WIHL 4MCYA 3T8XB 1FV1A 3O2DL 5IGXL 3I75B 4TUOA 3ARED 3L6FA 4KY1H 1NL0H 4JQVA 2BVTA 2YN5A 1FE8H 1XFPA 4I0CC 3DETD 4Y5XB 3MCKB 4NO3A 4P3CL 3EFDL 2AXFA 5T1LA 2BOCB 3IXAA 2ICCA 4Q9RH 5BRZE 5FYJD 1M7IA 5D7IA 3PIQA 4S1SL 4I18A 2OYPA 1FNFA 3EYFA 2KQMA 2VLKD 7FABH 1JGVH 4OQTL 3DTXA 3DO7B 4EI5C 2X1OA 1XGQA 1MIEH 3SDCB 2JIXB 3VGFA 3REVB 5BV7H 1UJ3A 2NXYC 5AAMA 1XGPA 3U7WH 4QXTB 3B9VA 4H0HB 1YEJL 3UTSE 4FS0A 2APTA 5DRZA 1I9RL 3S6CA 5IVZA 4X6BA 4RGMC 4DGYH 3SCMA 1OP3H 1S7UB 1CGXA 5BZWB 1B0GA 1E4XH 4XCYB 1KENH 1Y6NR 2DYPB 2R39A 3MRPA 4RQQB 1L6XA 1G6VK 2H45A 1JPSH 2VXUH 5IVXF 4R7NB 1GL4B 3FFDA 5C09E 4FFZH 1LD9A 5F1NA 3H3PL 5GGSB 4C56A 3JTTA 5L2JB 1QG3A 3P77B 3REWB 4ELMB 1BF2A 1HWHB 4ZAKC 1INDH 4N9OB 3S34H 3FO1B 1DUZA 3G6JF 3ZSSA 3NA4A 3ARDA 2ICWA 2D7MA 4KTDL 5JNYA 2GKIA 4HXAL 4PY7B 1RUPL 1FAIH 2ARWA 4AG4H 4NQCD 4XC3H 5FDWB 3RWDB 5IK3A 2VMFA 5KOMC 2GSIB 3LKQB 4EN3C 1ULVA 4OJFH 3STLB 1J9CT 1IGJA 1NFDE 4KU1A 1HHHA 3LEVH 4PRID 4EQ2A 4HEPG 3ELAT 2NZ9D 4PP2B 2XQYK 3ARGC 3WXWH 5JHDA 5F6HI 2VH5L 4XPGH 5TGBB 4EI5D 4H1LH 3RVWD 3WIIL 1CS6A 2QSTA 3ORJA 1OARL 4ZTOH 1KTKE 5IP4A 3MV8D 4PRHE 3LZFH 3ARBC 4O02L 4QXUL 1KGCD 2NXYD 4A2LA 3QDME 1JWUA 5JIKA 4LVHB 2QQLH 1T20B 2EO1A 4AYFA 2ADGA 3IDYC 1RZIB 2F5BH 4P3DA 3UYRH 1ZT4B 4PB0L 5SWZA 4OD2B 4BSWA 2MHAA 1CFVH 4PGBA 3RNKA 5I18H 1NGQH 1N64H 3D69A 4PR5A 4ZFGH 5I8KL 1JRHH 2OBGA 5C8JA 4WNQB 4Q6IB 3BQUA 1K3ZA 4WWKB 1U8JA 4NQXB 3DUUB 4FXKB 1B3JA 4MAYB 1PEZA 1VACA 4TVPH 2PF6A 4APQA 3MLRL 5T3XE 3WKNA 4LCYA 3GMMB 2L4OA 3EYQC 4ZAKD 4OZHF 2AW2A 1YEEL 4ODTL 1RUQL 4QHUB 5F70A 1B4RA 3AM8A 4WUKL 3OX8B 4OZFA 5FECB 2N7BA 1JV5B 2Z9TA 1I3UA 5IG7B 1I3GL 2HVJB 1PKQE 3L3DA 4PBXA 1AXIB 4LCUA 4HK0B 4NO0B 5IW1A 3GEWB 5IM7B 1P7HL 2R4RL 1A6UH 1JI2A 1LK3H 3IJHA 5D96C 1BD2D 3P4NA 3D39B 4OFIA 2NY5C 4N0YH 4U1JA 3ARGD 1S9KC 1OLZA 3VCLB 1FIGH 4IHOA 5SWZE 5KSAC 3MJ7B 4DCQA 5T1KD 1NMAL 4MA3A 4N0CC 3FT3B 2Q76B 4MCZA 5DMJB 4M7LT 5FUOH 5AEAA 3I85A 2BY0A 4KRNA 3GKWL 1NCCH 3QNYB 1A7OL 3ARBD 4ODWB 1LP9A 4ZSOA 1WGOA 2R2CA 2OM5A 3D25B 1IC5H 2FBOJ 2GI7A 3WL9B 3E0GA 3RTQC 3ALPA 2BFVH 2ZOLB 3KS0J 1T4KB 4JZOA 4CMMA 5GIRB 4G42A 4RFOH 4HAFA 5IIEB 4QLRA 4QHMA 3NIGF 1ZV5A 4F3FB 3FJTA 3QXUA 2VLME 4H88L 3NFPA 3MSPA 3VXRB 4JDTL 3O3DB 3EYQD 2GIYA 5FF6B 3V5KB 3WV0A 2XKSA 3D3VB 3SY0A 1FAKT 4F7CB 2CDFB 1HDMA 1U95B 5IT2H 2MKWA 4XZUA 1JMZA 5KSBB 3CX5J 3PHOB 1YC8A 4D8PA 5ID0A 1LP9E 5CKAA 2ZUXA 4WY7L 4PGZA 4I2XA 1QLFB 3GIZL 1G7QA 3U2SA 3IDIA 2CSPA 5C6PB 1II4E 3RL1A 3L5IA 3ZDYF 3ZHDA 3RHWF 1YNLH 4K07A 4Z8FH 2IPTL 5EZJB 4P5TC 1KCUH 3RU8L 3SKMA 4JFQA 1DDHA 3HN3A 4KI5F 5KSAD 1CICB 4MD4A 2RIKA 3MA9H 4HWZA 4N0CD 2RGSA 1D5XB 1KTRL 5HHMD 1K4CA 1XIWB 4PGEA 4GQ9L 2DQUL 4NM8H 3D85A 3MRDB 4JRYE 3QEGH 3VXUA 2VLLA 3DX6A 4PREA 1VDGA 4PP1C 2BSSB 2X4RA 4NZUH 4QWWC 5GRVK 2DBLL 2EC8A 1HSAA 2R23B 5K9JL 4PRDB 4XWGH 1ZSDA 3HZVA 1I8LC 4IS6B 2I9LA 4PJXE 4WTZG 1FCCA 2Y4SA 2XRAH 4K3JH 1AI1H 1HYSC 3PQYE 2V17L 1RZFH 3WJLC 4UZGA 1WBZA 4C83B 4OD1H 3HUJF 4YIQB 1RUAL 3TZVC 4I2XE 2XI9A 4J8RA 4R96A 1JK8A 3ZE2E 2R1WB 4DOHB 4MSWA 1G7PB 4XP1H 5BVJB 1XF2A 3R8BB 1AQKH 4WV1A 4FQQB 4FNLH 4H25A 2BRQA 1FZKB 4WFFE 5TE4H 2B1HH 4UT7L 3T8XA 3UTPE 4FFWC 4U1KA 3DHJA 1HKFA 2JB6B 1DQQA 4CVXA 3QIBB 2XN9D 5DMKA 4P5KB 5DVKA 4JREB 4HGKC 2EDDA 1KPUB 1W8NA 4KUZH 4GW5A 2P5WD 1YEKH 4M9PA 4D94A 5TF0A 2V7HB 4M00A 2DWDB 3PJSB 5C0BA 1MRCH 2EE6A 3O6LL 3QZWA 1RZKH 4EKXA 1HWGB 1O5DT 4NJ9L 2HFGH 4HX1B 4AM0B 1J12A 3GHBH 4JN1H 3REVA 4M62H 1XGTA 2AK4D 1U3ZA 4QXTA 4QYOB 4RAUB 2DQIH 3ZL4L 3AXLB 3TA3A 3TCXA 3CC5B 4PP1D 4V2BA 3TEUA 3LSOA 3AU1B 3U9PL 4E41D 4QWWD 3GSNL 4PJ7F 1MREH 4N0UB 4PG9A 5DTFA 2HFFA 4OFDA 4DN3H 1S7UA 3V0WH 5M94B 4BUHA 1E0OB 1HNFA 2DYPA 4G6AC 1HYSD 4RQQA 4TTDC 1DQLH 1QSFA 5EWIH 2XOTA 3TZVD 4R7NA 1EZVX 5ESQB 3VWJA 5DMYA 1R24A 2ZCHH 3PGDB 4NN7B 2WWMC 4G5ZH 3O8XC 5L2JA 2EYRB 5TDOB 4FP8H 2DIJA 1KELH 5DVMA 1LILA 4PJIB 3FO1A 4HCRL 2V2TB 4U6HB 4TPRH 3FONA 4FFWD 2P44B 4R2GD 4CJ0A 4LIQH 3KPRA 4PY7A 3EOAA 4NKIL 2J12B 4PJBB 1SJVA 3W2DL 2HWZH 5I1JH 1NCDL 4YNYB 3MRHB 2OXHA 3IDJA 4OGXL 3RWDA 1CE6B 4K94C 3TBVB 2GSIA 1PX3A 1ZHNB 2FHBA 5E4EB 3UEZA 3STLA 4R4BB 3ALWA 5IFHH 3TN0C 1MHPH 5JDJA 4TN9A 2X05A 5C08B 2R2BA 1A02N 3SE3C 5DDHB 2YHGA 3CLEH 3MMEB 4L3AA 5KS9B 1HH9B 4HS6B 5TGBA 3TT1H 5C07D 2RCSH 3I50L 1E4XI 4OLVH 3RAJL 4LGSB 3KPLB 1FL3B 2VR9A 5HVGB 1XF1A 3OTTA 3FTGA 3WEXB 1QNZL 3QDGD 1A7NH 1ZHBB 2BERA 2X4PA 3R1GL 3PWNA 3UPAA 5HGAA 5J1AB 4ELME 2DLGA 5HSFA 1H5BA 5JTWA 3RI5F 4GAGL 1P4BL 2PO6A 4ENEC 5F97E 4OD2A 2BRRH 1GH7A 1VFUA 4GBXC 1FZMB 3U30C 5T5FH 4WUUA 1R0AH 2JCCB 3ZKXC 1JPGB 4Q6IA 3B2UC 1BX2B 1GHFL 4NN6B 3KXFA 2BXZA 2ITDA 4NQXA 4OM1H 4FXGB 3RBGA 1YZZA 1MFDL 4G9FD 1CQKA 3X3GH 3FOMB 4MAYA 3T3PE 5F9JA 1L4IA 5SWSD 2J6EH 3QPXL 2WWMD 5E2UL 3O8XD 2P4AB 2Y06L 3GMMA 5HDQL 3T0VA 1Q0XH 1OT1A 1S7QB 1DTUA 1XGUA 5DFWH 1HK6A 4G8EB 2DQCL 2BVQA 4M5YL 3P40A 4M1GL 4ZO8A 4HC1H 3MOBL 1YJDC 1FSKB 5KZCD 4S1QH 1G6RB 3EYUH 3D6GA 4LVOC 1F13A 4P9HC 2DI8A 4M6NH 4RWYH 2AQ1A 5IG7A 1NBYB 2LABA 4GRWB 5HI3C 5FO9A 5EBLB 5L0QB 4LLAA 4ERSH 3S35X 5EORL 5D71L 4JJ5A 2DJSA 2EEBA 3VCLA 4NO5B 4HG4J 4MNQD 1DBJL 4L9LC 4K7PX 1P9MC 1NAML 3X11B 4Y1AB 4MDIB 1K2DA 2P1YA 2FL5B 1EZVY 4H5SA 1JRHI 1MCDA 4PRPA 3QXTA 3QNYA 3KXFE 2VE6A 1V7ML 2VDOH 1N7ML 3OAZH 3D25A 5D2NB 3MRKB 1IAOB 2F8OA 1E4JA 3D0VB 3LPWA 2YEZB 2ZOLA 3RWCA 1MCEA 5EU6A 1KJ2H 5GIRA 3LKSA 4XAKE 4HH8A 1ZLUK 1MCLA 1OB1A 3CXDL 4ENED 3UROR 3CVHH 3BGFC 2FR4B 2VL5B 4F33A 4IRSB 3FN0L 3G9VA 4YHLH 1QYGL 1D9KB 5IIEA 2AV7B 5FKPB 4HKBB 2WIMA 2ERJC 4GBXD 3FZUC 3MJ8B 5D7KD 4RBPH 2VXVL 3B2UD 3MV01 5FUCE 3WUWG 4ELKB 3H42L 2ATKB 5L2KD 3RNQA 1Q9WA 5SX5H 1CR9H 4YPJA 3T4YA 2A1WL 1QFHA 5B21A 3CK0L 2VZVA 1FVDB 3O3DA 2PCPB 3D39E 3CFKA 1IQDB 3BDYL 3V5KA 5FF6A 3BESR 3GSNA 5C6TL 3OAYK 3RZWA 2KUTA 4HIIB 1LNUB 1YN7B 3D3VA 4GUPA 4LBEB 5DT1L 4OI7A 5HHQA 2AJZB 3A6CH 3G5XB 1QFOA 1TCRA 1JNLH 1G1CA 4HKZB 3SQOL 3SKJH 2VR4A 3ULUH 5JO5B 1WZKA 3BKML 4TOYH 1X6LA 4YXKL 4P59L 5DMIL 1SEQH 1QLFA 5HI3D 1CLCA 5IBLC 5CLTA 1JZ7A 4O4YH 3QCTL 2CIKB 1ND0A 2Y72A 3MFFA 3C8HA 4WFEE 1W72L 3M8OL 1MJJA 1LDPH 4HCRA 4TRPL 4Q9QH 1MFBL 1CICA 3NVQA 5DUMH 5CUSH 2C4FU 3CFEA 5GSVB 5JXAH 2KBGA 3GSOB 1KJMB 3IRPX 3FQTA 3UC0L 2ZCLH 1DQTA 3F12A 1IGFH 1XIWA 2IMMA 3V6OE 5FDYA 4J4PD 3CUPB 3UX9B 1QVOB 4BFIB 3VFRB 2OR9L 4PJGF 3DSFH 4NDMB 1J0ZA 3CDYA 3VXRE 1NLDL 1I7ZB 3TH2T 3P0YL 2BSSA 4FFYL 5BW7C 2DDQH 2JJSA 4U1HB 2R23A 1CFSA 3D3VE 1HH6B 4IS6A 3EYSH 3F6LA 3C6SA 2XACC 5DEZA 5ELIA 1CZ8H 3VDCA 3N9GL 1P4LB 1IGTA 3FZUD 1BJ1J 5EO0B 5KSBE 2WP3T 4X80L 4KHTL 4LLUA 4C83A 4H0IA 4UNUA 4UDTA 2DKMA 2PTTB 1MCPH 2NY1B 3QNZB 1NAKL 1D5MA 4CL7A 2VJXA 2R1WA 4LLQB 1TZIA 5I0ZA 2XYCA 4NO2A 4LLDB 4KVCH 4E42A 5BVJ