4R96B

Structure of a llama glama fab 48a2 against human cmet
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
219
structure length
213
Chain Sequence
EVQLVQPGVELRNPGASVKVSCKASGYIFTMNSIDWVRQAPGQGLEWMGRIDPEDGGTKYAQKFQGRVTFTADTSTSTAYVELNSLRSEDTAVYYCARVDDYYLGYDYWGQGTQVTVSSASTKGPSVFPLAPSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Camelid Ig V genes reveal significant human homology not seen in therapeutic target genes, providing for a powerful therapeutic antibody platform.
pubmed doi rcsb
source organism Llama glama
molecule tags Immune system
molecule keywords Llama glama Fab 48A2 against human cMet L chain
total genus 37
structure length 213
sequence length 219
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2014-09-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r96B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4r96B01
3FT4B 3DO7A 3WS6A 1NBYA 5K9JH 3DMMC 4M6OL 1OD9A 3PV7A 5F7LB 1N2RB 4G6AC 3HPLA 3GSNA 3STLB 3CVHH 2QADB 4WHCA 3ZTNL 3D9AH 3UJJH 5DD0L 3CJJA 3U0TB 4AEHH 4LPWA 4M7KL 5CUSH 3PGFL 1EDQA 1ZKAA 5DJDA 5FCUL 3UDWC 2EDQA 2VDLL 3G5ZB 2C7UB 3ZKXB 1CFNA 5HGGS 2WWMD 4J6RH 3G04A 4OM1L 5GGVY 4XC1L 4XI5C 5I1CL 1P6FA 3SBWA 1G7IA 5KOVC 3MRGB 1C8PA 1MJUL 1WGOA 4ZPVB 4U6VH 1NSNH 3H3PL 5F97E 1NC4D 3RVTC 1I7TB 5I17A 4GRLB 1X3DA 2VMFA 5D4QA 5CCKH 1UXWB 5EIQA 3DHMA 2R0ZL 4NQSA 3QEQD 3QHZH 4W4OC 4P2OA 3V5DB 1QFUH 3AM8A 5DHXB 1UM5H 4NPYB 4JCLA 4ELKA 1NFDA 3CMGA 1KB5B 3QIUA 5BOPA 1J7VR 3K46A 3OZ9H 4N5UA 1MHPH 1DBKH 1V7MH 1U8IA 2A73A 3H0TB 1X5JA 4KKLD 5LGJA 5E2UL 4PRNB 4OV5B 1M6OA 1CLOL 4ODSH 3FB7A 2XN9E 3A6BH 2F53A 4CMHB 5JW4N 2R9HC 1VA9A 2X4RB 3EOYG 1X5IA 4ODBD 4BFIB 2X9YA 2ZG1A 4U1NB 1YPZA 3HZMB 3OR7B 3PABA 4EI6B 5F1IA 1KYOK 4AM0B 3QUMA 4LF3A 3BP7A 5DJ8A 4LPXA 1LGVA 3HI1A 3JTSB 5DWUL 3MNVA 2I26N 3GHBL 3GMNB 1FL3B 4OCNC 4XB8A 1MRCL 5HDLA 3DWTA 3C6SB 4QHMA 5DK0B 4KUCD 1FHGA 4JDTH 5DURD 4P4KD 1NKRA 3VXSE 4F37K 1BQLH 1HIML 1KIRA 3WCYA 4D2NA 3IFPA 3MOBL 1HHGA 4ZD3H 2QTEA 3DX7B 4PFEA 4Y0GA 5SWSB 2DICA 5DQ9A 1ULVA 4LLWB 4NWTL 2F53D 2IQAA 4P99A 3QUZC 3UZVB 1H15B 4JFDA 4ESKA 1WIOA 3D0LB 4HBQA 5D7SL 2EE3A 3IYLW 1WZLA 1DUZB 1WWAX 2A83A 3O6LL 4CBPA 4M4RA 3HAEA 5FA4B 5ANMB 5GHWH 4O58H 3D25B 5IG7B 3T1FA 4HUVB 4PJGE 4Y1AE 1I1AB 2WLZA 5M95B 4XAKD 4CDGC 5T1KB 3S35L 4D9RE 4UT9H 4K3JL 3FQWB 4OGXH 4YNYB 4LVHC 5E8OB 1TVBA 2R1WA 1YYML 4AMKH 3LQAH 1A7PL 3UZEA 3V52H 3LN5B 3QDGB 4P46C 4DCQA 1NC4A 4HMEA 1N59B 1CFSB 4GRMB 2V7HA 2IANB 4DOHE 4HH8A 4NQDD 4XZUA 4MJ5A 4AH2B 2PYED 2VUOA 3NFSH 3FQTA 4F2MA 5IVXB 4HS3A 3FT3A 3DRTB 3HMWH 5CBAA 4PJ7A 1WEJL 1SEQH 2Q86B 5T5NF 1I8IB 3VXMD 4PJ7E 4BSVB 1SVZA 3MJ9H 4GKSA 1NKOA 4M5ZL 1JPFB 3AMLA 4NC0B 3UJIL 5FO8B 4HIHB 3T04D 3MUZ1 2ZG3A 3ALPA 5HGDB 1A4KA 4LQFL 4G80A 1RJCA 3CUPB 3AS2A 4ELMA 1DQMH 3FO0L 5IP4A 4X8JB 4OF5A 4JQVC 1P7QB 5D1XB 1D6VH 4PRDA 3GMPA 5LGKA 1ZT1B 4I0PD 5D7IF 5EIIA 1D9KD 4MNQD 1PFCA 3T3ME 5IK3B 3SGEI 5TGBA 4MA8L 3HI1B 3QXWA 4LHJB 5MENE 2DQGL 4YIQB 1FL3A 4RFNB 3BP6A 2JELH 4GW1B 4GJTB 5F96H 4ZS6C 1RJZA 1ORQB 3HFMH 1VFOA 5L8JB 3GK8H 4LSRL 5CZVH 1FVEA 5DYOA 5KSBA 3PDGA 1CVRA 1NGXA 3BO8B 1G7HB 3UYOD 2CH8A 5KJRH 1K3IA 2GJ6E 3W5MA 4NSKA 1Q72H 3KNBB 1MRDL 3NN8B 4G8GB 2J5LB 5GGVH 2DJUA 1J1PL 3DVNB 4FQLL 4CNIB 3HI6H 4XPHL 3TO4C 1J8KA 5IT2H 4PJ7F 4CN1A 4Q9QH 1CGSH 1UVQA 5EZIL 5KN5A 1CI5A 4X6DB 2GSGB 1BIHA 3LD8C 1U8PA 1FH5H 2AEQL 2DM4A 2W91A 4EI5A 1D9KB 4PLKD 1BVLA 5HY9B 5E8PB 4JG0L 2DOCA 1LK3L 5EOQL 3QXDA 4XNQA 1MI5E 5D8JL 3C5JA 3O6KL 2CDEA 1NMCC 4TPRL 2J4WL 4MZ2A 5F9WC 3MNWB 1DQTA 3Q0HA 3QNYA 4NQTA 1I8MA 1T7YA 3JWOC 1S7TB 5SWQB 5L2JA 3BKCH 1CFSA 4KXZI 4XNYL 3F12B 2I9TB 2DKMA 3Q48A 4HKJB 4GOSA 3E6HB 5KG9B 3E8UH 3GI8H 3KYKL 4UILL 1X5KA 3OKDB 4Y4HA 1XGPA 5DJ6A 2OK0L 4IRJC 4ZDHB 5MEQA 2WBWB 4NCC2 1A7NL 1FZJA 4Q58C 3VI3F 3PJSA 4BSWB 1UFUA 1LO0L 2BNQE 4MD5B 5FUCE 1T83C 3TBVB 1RZGB 5CD5C 2P5WE 4JKKA 4P9HC 3TVMD 1CD8A 4KKLC 1S9WB 5DD1H 3ELAT 3MLPA 3QUKB 2KL6A 4GAGH 2D0HA 2Y36H 1AGDB 1KIPB 1YJDC 1OB1B 4XHQA 5C86A 3D3VA 2ZNWA 3VJ6B 4LPYA 3SKJH 3QSKB 1KELH 2P8LA 2Z31B 5CHNB 4GRLD 1UKTA 3LN9A 5ACZB 1OGTA 3MNZA 2D0FA 5CP3A 3PP4H 2RCSH 1TZIA 2B5IB 3C08L 1HNFA 1H8OA 3L3DA 3O3DB 1H3PH 4NN6B 4BQ6A 2DKUA 5K59F 2HKFH 3W39A 2GUOB 1MWAL 2FL5B 3REWB 5ILTH 1OM3L 1CDBA 3I6GB 5IHZB 4PJXE 3DUUA 2E7BA 1DFBH 1DZBA 1YEDB 3DVFA 3T3MF 4C55A 3CVHA 1NC2D 4PV8B 4MS8C 5D7LB 5GS1C 4MSWA 2IGFH 1VPOH 5J89A 1RZIB 5BQ7A 4P4KB 5SX5K 1RQ5A 1AQKL 4W70A 4HIJB 1ZHNB 3WIFB 1N2RA 4D0DB 3HNTL 4L4VB 3WD5H 3ARUA 4N0YH 3ULUL 1U8MB 4XTRD 5D2NA 2G2RB 3QG7H 3TP4A 3VXRE 3C5SB 1JTOA 3NIGE 3UBXI 2VSCA 3VE0A 2D7OA 5CD3A 4O4YL 5DHVA 3U6RB 2MFNA 5ERWB 2CKBL 1OTUD 4EI5D 3OKYA 1NCUA 5D7JC 5C0CA 2IPUK 3HE6B 4HZLB 1OP5H 5IF0A 2IANE 3S5LG 4PV9B 5I1KH 1U8QA 5L0QB 5E2WH 1HYSC 2HN7A 1FVCB 4G7YH 4U49A 4P5KB 4XCYA 4ZQKB 3CGTA 2XI9A 4PJCA 1UWXH 3QDMD 4YEEA 4YBQD 4NNXA 4Z95L 4R7DB 1U3HA 5GISL 4A6YL 2P4AB 3FHAA 5FOJA 1CIUA 2FBOJ 4JGMA 4F33A 5KTEL 1H3VA 4XNYH 5FYJU 4PJHF 1QRKA 3QXAA 5DVNA 4CDHA 4JQXC 3SE8L 3ULVC 5SX4H 4X7EC 5E2JA 1KTLA 1TZGL 1I9RH 4NKOA 4NBYB 1L7TL 1JFQL 3TJHD 3AREA 4LSDA 4NRZB 3MJ8B 4L3EA 5KVMC 4R4NC 4JRXB 4N9GB 4GW5B 2C5DC 3ULUF 4FTVB 1IAIH 4Z7WB 4XPGH 1K4CB 1R24A 5HHQB 1FYTD 5AD0B 2Y06H 5JIHA 3P77B 2B1AH 1NGYA 2QSCH 5DMJB 4ZG1A 4XCFL 4F58H 4ISVB 4OZIA 3CFBB 2X2YA 3QA3A 1H8SA 4ODXA 1CICC 1QUNA 4OGAC 1BREA 3GO1H 4E5XA 1NBQA 3RUGE 1KCKA 4JFYB 1N3NB 4U0QB 4HJGB 1OM3H 5IKCB 3NGBB 1MIEL 3PHOA 1KJ3H 4IHOB 5HHOB 1XT5A 4OJFL 4X80H 1C08B 2VLKB 2ARJQ 5CEZE 4K8RL 5BZDA 2BSSA 2EIZA 5C0GB 4I2XB 4PY7B 1F4YL 4OFKA 4UT7H 1JUFB 2LV4A 2GEEA 4OQ1A 3ULVD 4LIQL 4RFEA 1A2YB 2OK0H 1GAFL 1YN7A 2E5EA 3ZKSD 2P5WB 5IMMA 1YY8B 1NGZA 4GBXA 3TBVA 1U92B 3MV7A 1D5MB 4D9QD 4LQFH 3LY6A 2IG2H 1YMHB 1LWRA 3IJHA 3AVEA 2GSIB 3IXAB 5HTSA 5DT1L 4M5YH 4B53A 1FZKB 4GMTH 4GBXC 1REIA 2VC2L 3HRZB 1JGLH 1OAZL 2NXZD 3CSBA 4MLSA 3IFOB 5C07E 3D3VD 5A43C 3EJZC 3N1GC 3LRHA 3T2QA 3IDNA 4PPTA 3MCG1 2C26A 3H9SB 2Y5TA 3ARDD 1F6FB 3CSYB 3MLWL 5EO0A 3QCUH 3B5HA 5HI4C 4QNPE 3ZHDA 4OLYL 4OZIF 5I1EL 5JIIA 3SCMB 4WI8A 4LLVB 4LVOC 3AREB 5D1ZC 4DUWA 4LKXA 1WISA 4BKLB 2H9GB 5TJWK 1L4IA 4N0UA 5B39A 4LHQB 3V8CA 1ZT7B 5J11B 1IRAY 1UEYA 4OZGF 1OPGL 3ARBA 1INDH 2ZUWA 1IM3A 4FQJH 2CMRL 2R2CA 3RFZC 2VDPH 3FO9B 2MMXA 2VXSL 4HCRH 4Z7NE 2C1OB 4GSDH 5JXAL 2BFVL 4O02H 4YQXH 1QPXA 4F3FA 4M48H 2XNAA 5DI8B 1SY6A 4XBEL 2YD3A 4JLRA 5FM5O 1OB1A 1A64A 2ARJA 3F58L 3ISWA 4EBQL 3BPOC 4PJCB 4HC1A 4I1NB 5IOPA 3QXDB 4XNQB 1VESA 5HPMB 3OR6B 5C07B 1QR4A 3MRLB 4LMQE 4JDZA 2HKHL 2AXFA 5T1DL 1EXUA 2R56H 2FX8L 1R3LB 2AJVH 1XCQA 4L4TB 3TBSB 2HLAA 3MXWH 4MX7A 2ID5A 2BC4B 3P0VL 1C5CH 1AO7A 4NUGH 5DRXB 4Y4HB 3GSOA 2F54D 1OLZA 3PWPD 4RX4D 4UINL 4R3SA 5FO7B 1OTTD 2OYPA 4MAYD 4PJIF 1XF2B 2BMKB 3CCHB 3QUZA 1KLGA 4Y4FC 4MVBD 4GXUM 4D0DA 2VDOL 2R2EB 4LSVL 5EUOA 5F7YC 2XYCA 4XCEA 1PKQB 5IHUL 4QYOA 2JCCE 5SV4A 2E9JA 3H9ZA 3JSSA 1QA9B 4KI5C 1EV2E 2FGWL 4Z78B 4JFHE 2C1PA 3PF2A 3G04B 4OKDA 5DJCA 4C57C 3ZO0A 3D2UA 4K7PY 4MNHB 3LHPH 3NTCL 4OZHA 3LV3A 1GOFA 1B4JH 2C3VB 3A67L 2CDGB 3CDGA 4U31A 4Y4KB 1UJ3B 3VXNB 2VLME 1NGWA 3MRBA 2BDNL 3B9EA 1UB5A 1BZQK 2Y1VA 4LK4A 1RFDH 5C0IB 4V1DB 3BKYL 1IC5H 3O2DA 3V7AE 1DLFL 4LLVA 1QSED 4KROC 3NFPB 5EB9A 2AQ2A 2FGZA 3ROOA 1S8DB 4X0KA 2E8ZA 2Z93A 3QJFB 4WUUE 1KJ2A 1WITA 2BFVH 5F9JA 5BS0B 5ID0B 3ZKNC 1EO7A 1JF1B 4QHKI 2X4OB 5D72L 3X3GL 1QYGH 5FGCB 4U1JA 1INDL 4FQJL 2IG2L 4J4PC 1XR8B 2APWA 3VXRD 4Z7UB 2XKSA 1T83A 2BVTA 3BD5A 1JGUL 5FECB 2B39A 4EKXA 4JM2A 4N8PA 1JPGA 5EORH 5A16A 1AC0A 5ERWA 1L6XA 2VC2H 4R4FL 2DM7A 1U9KA 4DKDC 2JCCF 2ZNXA 3RWEA 4AQOA 3E3QC 2DS4A 3WE6B 1KJVB 4Y4HC 2VXQH 2BVOB 5C2BH 4PJCF 4DN4L 3QI9D 2GTZB 4KDTA 3MV9A 1PVHA 1TZIB 2EDEA 4HJJL 2FH8A 4XC1H 3VCLA 2APXA 3T4AA 2FECL 4YGVA 4KTYA 5MHSD 2V17L 4QRUA 1UYWH 3BZDA 3MRIA 5ESVB 5IBLD 2AK4D 4PLJC 2IQAB 5FF6A 2AK1L 2PTVA 4KC3B 5SWZA 5JOFA 2CR3A 3BE1L 4OCYL 3H0TA 3AB0C 4U3XA 5E4EB 1T6VN 2ESVD 3MGOB 4POZD 1DJSA 1NMBH 4APQD 1QPPA 4Q6IC 4WFGD 1J1OH 4MJIE 4X6DF 1P7KA 5E00B 5DSCA 3MLYL 2VLRA 3GSWA 5F1IB 1WBXB 5E9DB 3QA3B 3O8XB 1F13A 4K71C 1AHWC 4YK4B 5EBGA 2I60L 4NO5B 2FLRT 4BUHA 3GK8L 5IMOA 1RHFA 1F3JB 3MYJB 2DQDL 5DMYA 4G5ZL 4U1SB 2JB5L 2H32A 5F6HI 5FEBA 3VXQA 2H41A 1BVZA 2K9UA 4KK5D 4PJDB 1I9IL 1EBAA 2D7QA 5E4IA 5L9DL 3ZL4L 1MRFL 4NDMB 5T5FH 8FABB 5HJ3B 5IM7B 2AABL 1KXTB 5SWSA 4YK4C 1PG7X 1WFOA 4NKDA 5GIRA 2UVFA 1M05B 4NHCL 5FO7A 1W72H 5D1ZD 1KBGL 1N7ML 5D1ZA 5I8CB 5KTEH 3MLSL 1N6VA 1DBBL 1YQVL 1OTSD 2WBKA 5AWNL 2R39A 3O9WD 3EUUA 1IQDB 5BS0E 3INUH 4X8XA 1ODAA 1AIFA 4J3WA 3ARFC 3O2VL 2BSTB 5C0BB 4PRPE 3OXRA 5C07D 5IWLA 3W81A 4L8BB 1WJ3A 2ARWA 2VDOH 4P2QA 3SDXE 3QWRD 3BN9C 5I18L 1FDLL 2J4WH 3NACH 5MEOA 4GLRH 1J86A 4XWGH 4S1RH 3QJHB 1GOGA 2ADGB 3MUJA 1E6JL 3JXAA 4YLQT 4KKBD 2Y07H 3GGWA 1HHIB 1QEWB 1TJIL 5EWIH 4YXKL 2FYYA 3JUYA 3HNSH 3FRPG 4XP6H 4XPBL 4DK3A 3C6LC 3FOMA 1SYVA 3SO5A 3MRLA 2CGRH 4EDWH 4WRLA 1ZLWK 5J3HD 2PXYD 1FP5A 1R3HA 1UXWA 3WLBB 2WMPA 5J4MA 2PYFB 3L3OA 4IRZL 5ISZA 5IESL 2HJFA 3MOAL 4L4TD 1JPSL 4UB0L 4PRHD 1BZ7A 4FOMA 1XF1A 1VFAB 4PB9L 3SE9L 3IDYB 4NPYA 4QRSB 2XN9D 4EEEA 5JPNA 4GBXB 4GSDL 3QG7L 4OD2B 3IU3B 1EGJL 4NCC1 1R6VA 2BSED 3UJIH 3FOLB 1SBBA 3GMMB 4LSPH 1CL7I 2YSSA 43CAB 4GQ9H 5MERB 5E99H 4M48L 1MSPA 4HFUL 4F57H 3DYPA 3BQUA 3MLVL 1N6QL 1FFQA 1Z0NA 3O8XC 4K71B 4P0DA 4XP4L 1IMHC 2FNBA 3LZFL 4LPUA 4PS4L 4U1NA 5C0RH 2BVOA 1A3LL 2ZSWB 1Q9WB 4CN6A 2PXYA 1AR2A 2PW2A 4LF3B 4YHLH 5H2BA 3WLWD 3VXSD 2L7JA 2W9DH 4RGMB 3MXWL 5F7DB 1AQDA 1IGFH 1QZ1A 1IKFL 4TUKH 4LPCA 4P3CL 5EU4B 5L6YH 1KENH 1VDGA 1RULL 5DJXB 1LO5A 2EYRB 3FFCA 1FCGA 1RUKL 2OL3A 4MJ5B 2EDKA 1ZLWH 4AH2A 4QGTA 2EO9A 3WIHH 4WIQA 3AROA 1IAMA 3L3JB 4KV5E 4G7VH 3UYPA 2Y36L 4HH9A 1K4DA 1DQJA 3O6LH 1FAIH 3PWPE 2NR6C 1YMMB 5D7SH 1AIFB 1PG7W 1XIWD 2QHRL 5BMFL 1INEH 4I77L 5D70L 4Z7QE 4QNPF 4JHZA 2QKIA 3CSPA 3IJYA 3QUYC 4KY1H 5EZOH 2CR6A 1KCUH 3DV4B 5F7HA 1FNHA 1I8KA 3S97C 1UKQA 3FFCD 3QIUC 1EHLL 4AT6B 5D7IA 3C5JB 5DQDL 3NZ8B 4DW2H 2DM2A 1Y6NR 4QHUB 2YPKA 1ZVSA 3MXVL 4G9FA 3DV6A 2NXYC 1N4XH 3PGDB 5D2LE 5FUZH 2HKHH 2AJ3B 4DZBB 4D8PB 4LSRH 3WNMA 3ETBF 2E9WA 4Y89A 3BZ4B 4CU8A 4B5EA 3Q6GH 1ED3A 4RMWA 3UBXA 1FRGL 1IILE 4EIZC 4APQB 2MCG1 2DLFL 1N0XL 4PBWD 1PJ9A 2W38A 3LRGA 1F5WA 4J3OC 1FGNH 4H20H 1TETL 3WFHB 3VWKD 1ZLSH 4HWZA 2XTJB 1YEGL 2EDRA 1FNGB 2AQ3A 2E7CA 2NY4C 1LO4H 2FO1A 1IAOA 3WNNA 5LG1A 3WXWL 1SMAA 2FB4H 1RZ8A 4PRHA 2YSSB 43CAA 2BSRB 4OLZL 4PJFA 3QAZC 1BIIA 4K3DH 2NY0B 4F9LA 1EBPA 3U7WH 5BZWB 4MCZB 5E5MA 3MV8A 1P7KB 2X4SA 1SYSA 2ZSWA 4AL8L 1J1XH 3TLRA 2ATKB 5KS9A 3MRNA 3QIBC 2GJZA 3WS6C 4LLQA 4QHLB 1I7ZA 1ZS8B 1KNOA 4NCDA 4LEOB 4JREB 1X4YA 3B2UD 3SDDA 5AYUH 1HNGA 4MWFB 3RZCA 2CRMA 4WHTA 1NL0H 3TO2A 1YEKL 2XOTA 1HEZB 5B8CA 1MFBL 4GO6B 1N7MH 1KBGH 4EZMA 5BV7L 4Q0XL 1ES0B 2P8PA 3GJFA 3PGCA 4IRJD 2WBJC 2IPUG 1FZMB 4RGND 5DT1H 5BCAA 3N1QC 4ONHB 3HS0B 1N5AA 1AC6A 3ZZ1A 4KZEH 3BFOA 3SY0B 4TOYL 3BSZL 5FYJE 1A1OA 3V5HB 4PJ9C 1KCVH 2Z8VC 5J1SC 4P3DA 3U0TA 4R96B 3MXVH 2Y7QA 5IQ9B 4IDJH 4BZ2H 4PV9A 4JFEB 4UT9L 2VLRB 2Y23A 2FGWH 3F58H 2Y07L 1EFXA 2VR5A 2K7PA 1JV5A 4XXDA 4HJ0D 5D71H 2DQEL 4M03A 4ODUB 3LKQB 1PAMA 2D2OA 4TTDC 1A14H 2AJ3A 4WWKC 1RZKL 3VJ6A 5JMOC 4E0RB 5E2VH 3TN0D 3ILQD 2AKRA 2ZUYA 3QXVA 4K55A 4IDLA 1EFQA 4H1LB 4BELD 4OGYH 3PNWB 1X4ZA 4PJ8D 4LAQH 5IBUB 4X6BB 2P42B 1KPUB 1IGTA 2VUYA 5KVGH 4OLXH 3I6KA 1B2WH 5IESH 2GUOA 2PXYC 1CN4A 3D5OF 3QFJE 3LB6D 1OW0C 2HFFA 32C2B 1EVUA 4X6CE 2BXYA 3PWPB 1I1RA 4LKXB 2H8PA 5ESVA 5EU5B 4ENEC 2NXZB 4LCWA 3BMWA 5JOFB 2DBLL 4XP1H 5CEZH 3OKLA 4O02L 4CW1A 1BZ7B 2ZPKH 4WUUB 4WI9A 5KANG 3O6MH 1V3MA 1RIHH 5IVXF 3VGFA 2EEDA 5FGRA 2FR4A 2HJLA 3HI5L 1Y0LB 5DXWA 3VE0B 3I02A 4S1SL 3OBAA 4LSQL 5D2LB 1AO7D 4P4RA 2D7PA 1IM9B 1PBYA 3QUMB 1HKLL 4NO5A 2DIAA 5DQDH 2RFXA 2J12B 1RMFL 2R0ZH 1NFDF 4LCYB 3QDJB 5C0DB 3DECA 5ADOL 2IQ9H 1URLA 5IEHB 4QHKJ 5EFIA 1X6NA 3HLAB 1LO2L 3KLAB 4OAWA 1SJXA 5J6GA 2DLHA 1KG0B 1I7UB 4KJWD 4YHNA 2J6EL 4L8DA 2B0SL 3RAJH 3IRZA 3QXAB 2R0KL 2VLJE 2X6MA 1YEDA 3CFEA 1UA6L 1X5XA 2ADFH 4MCYA 3WO4C 5I71B 4O51B 1NLBH 3UPCA 2A1WH 5ICXB 1RSFA 5F1NA 2A9NL 4K7FA 4NRZA 4PYGA 3CK0L 4JFDB 2NY5C 1EZVX 2YR3A 3DRQA 3DVGB 1OWWA 1JHTA 1SJHA 3BVNA 5T1MA 1DBJL 1DBKL 4N0RA 3WJJA 4PJFF 1RZKH 5B4MD 1AXTH 5TF1L 5DS8B 2GAZA 5TQ2L 1MIEH 3U79A 3BW9A 3QDMA 4K23H 4KK8D 5BRZD 1I3GL 1OTUC 5I6XB 4MJ6B 5J1AA 5FYKD 1IAII 5M7QA 3U7WL 2PO6C 4FQXA 4HK0B 2F74B 1KN2H 1B2WL 2A6JA 1KIUA 3OX8B 5C7XL 1FGVH 5GJSL 3SPVB 3FB6B 1FGVL 4E42B 1P4LA 3L3KB 4Q9CA 1AQDB 1XCQB 2H26B 4U4BA 2X4TB 4GG6E 2BC4A 4BQ9A 3VFMB 1MWAB 3MRQB 5C70A 3SDXA 2P5WD 1T4KA 3RVVC 5GRVK 4EN3D 1I4FA 5CP3H 1O7VA 1J10A 5EBLA 5BXFA 4F7CA 3O2DH 3I75A 1PLGL 2VNCA 3QG6A 4JFPA 4M7KH 4N9OB 3RWGA 1U8HB 2ZCKH 3HC3L 4Z7WA 2BP3A 4ONOA 4X4ZA 3OXSA 4XCFH 1A4KB 4Y1AD 4MJID 1GYAA 1KB5H 4J1UA 4RRPA 1HH6B 1DANU 4GG6A 4PLOB 5SWSE 3L9RB 4I2XE 1X6LA 4JPKL 1AE6H 4F3FB 4MNQB 3EFDH 2BSRA 4YWGL 1FZKA 1PEZA 3T8XA 3OKNA 3TH3T 1A6WL 5HGAB 5A3ID 5BZWA 3QFDB 3QWOA 7FABL 3S6CA 3L5XL 3BPCB 1CGWA 1DBAH 4LP4A 2D03L 5I1IL 3K3QA 3QWQB 5ADOH 1IGYB 2KH2B 3P0YL 4PY8I 5HYQA 3FQTB 4F2MB 2AK1H 5IVXA 4HKBB 4I18C 2VISB 1YJDH 5JR1H 5F88B 3I50L 4Y19A 1KTKE 2QSQA 1S8DA 3GUTB 1GGCH 5I1LB 2GT9A 4NHCH 4Z18A 1FQ9C 1BEYH 1C1EH 4I3GA 4KI5F 5A1AA 4YDKH 5LVEA 4N0UB 5B39B 4NO0D 1KB5A 2VWEE 3QIUB 5IB1B 4ORGA 1FNGA 4Z7WE 2ZZUT 5FUCC 4WFED 2GJ6D 3SDDC 3JV4B 2VDQL 4QLRA 1IFHL 4WI2A 4JANB 4PRDB 4U6HB 3AFLA 3P73A 4ZYKB 3MYZA 2Z31C 3FB7B 4X4XB 2DQIL 3W0WD 3LKSA 3MLVH 1WTLA 1TZHB 2WWMC 1VFUA 1QBAA 1F42A 2B4CC 3HI5H 4OI8A 3SO3C 1F8TL 4EI6A 3I3DA 3WL9A 1MCWM 4L3CB 4KRLB 4BA8A 1XH3A 3HN3A 4OLWL 3B2UC 4Z0BL 5JHLL 3VWJD 3LEXA 3OR6A 2IPKB 4FRWA 4KMTH 4OLWH 5DJ2B 5DO2C 3SGJC 5KS9F 3F7YA 4XVJL 1JN6B 5I19H 2V7HB 5I1GL 5HI5D 2P24B 2IEPA 1VSCA 1I9JH 3MRFA 4JFOA 4X9GA 3FQRB 5EBLB 3W0WB 3QEQB 1MCCA 1FG2B 2HFFB 3NCBB 4YZFF 1JF1A 2DIJA 4G42A 1X5LA 1CGTA 3VXRA 5IGXL 4C58B 1VKXB 3EYFA 3JWOH 1FL6A 1YYLL 2EYTB 1CDHA 3G08B 3VGAC 5C1MB 3S3JA 1H5BC 1XF2A 3GJEB 3V7MA 5F7EL 4R2GC 3T0XA 4XX1G 1I1FB 4HS6A 3T0EE 3MRHA 1EUTA 1G0YR 1RK0B 3D39A 4KGLA 5BJTA 4ELMB 2A0LD 3EOBA 2I25N 3NZHL 1KFAL 2NX5B 1UM6H 3VXTA 5LKNA 1YA5A 4KPHL 3DHJA 1YJDL 2YBRB 4JQIH 5FYJL 2ICEA 4K3DL 3TPUB 1UXSA 2X40A 5LQBL 3LV3B 4YHPB 3RVTD 5E4EC 4F15B 3OHXA 4TUKL 4Y5VA 4L8SB 5D96C 5GJSH 4JDTL 3WDJA 2XG4A 2OXGA 2JCCB 2D03H 5I1IH 5FM8A 4MWFA 1G7MA 4QRTA 3RNQA 3WKMH 5E8EB 3RDTD 2YXMA 4X7TB 5I66B 3MUHL 4JRYE 4NKDB 1IGTB 4NZRL 4OTXL 2EDTA 3TIEA 1JFQH 4PREA 3MUY1 4HHAA 2LAAA 3AAZA 5IMLA 2HFTA 2OJZH 4PGCB 5C0AA 4NSKB 3ARWA 2J7LA 3U36B 3WXWH 4DUVA 1ZEAH 4V1DE 5JTWA 3JWDL 5TF0A 4CVUA 5LXGH 1BZ9B 1PX4A 4JRYA 4DVBA 3ZDZE 3V6FB 2Q6WB 4X4ME 3MROA 4J3XA 5J8OA 3KLHC 1LE5B 4OKVB 4Y5YC 1IZJA 4BFGA 3LS5H 3LHPL 2DI8A 3NTCH 2X4QB 2DQIH 2EDDA 2DJSA 4H25B 3U0PB 4LLMA 2NTSP 3SN6N 4FG6D 1U6AL 1BBDH 5E2TH 5ENWA 3LS4L 3LKQA 2M1KA 2PYEB 2E9IA 1CG9B 5H37H 3TNMA 2V5YA 4OBSA 3N9GL 4PJ9A 4YXLL 4JHWH 4DAGH 5JORB 3C08H 1CDUA 1FNFA 1I8MB 5CKGA 3VGAB 3MV9B 1GHFH 3LEVL 1A1MA 2JK5B 5DGQA 3VGDA 1NCWH 5L88L 4QO1A 1P7HL 5GS0H 5AUMB 4JFDD 1V3KA 5FYJD 3S3PA 1CBVL 2WUBL 2X70B 2P7TB 2A1WL 3V6OC 2H8PB 4YO0A 2AABH 6FABH 3DGGA 4KTDH 3WFCH 3RZCD 4KZDH 1MNUH 3ZE1E 3LQAC 4HF5L 3GMRA 5CIPA 1JWUA 3PG2A 2YPLB 1FZOA 3MMEB 4HLZH 5IVXE 5IJVA 2WIMA 4YHOL 4U1JB 2QKIB 5B3JE 2NY4B 2BNUA 1AY1L 3CZFB 2EE9A 2GJ6A 5LQBH 4PGEB 3GI9H 4NO0A 2ENSA 2HN7B 3JWDC 1H0DB 3RGVC 1U93A 5KSBE 2NR6D 2PR4L 3RU8L 1MLCB 1Q0XH 1KC5H 2VLKA 5EZLA 1HOCA 2DYPA 3WXVH 1FYHB 3WSQH 4I2XA 4JN2B 2G60H 5EU4A 1F97A 2FJGB 4HWBH 5AYUL 4U1MB 1FAIL 5HVGB 4KKAD 1C7TA 4PJHB 2UWEF 2W60B 1NMCB 2FEEI 2H6PB 4DUXA 1OGAE 3RGVB 4HDIA 1TZGH 3TF7C 2WUBH 4KK9D 4HIEB 2NX5D 4FQ2H 2EEBA 3TIDB 1F4XL 3CVHB 4PV8A 2P47B 1MOEA 1BM3L 3MV7E 1I9JL 5I73B 5CWSA 4K7FB 5AG9A 3OMZA 3RAJL 2EICA 1T1YA 2DWDB 3QISA 2QV2A 4DN3H 5EU6D 1ERNA 3UTPE 4L4VA 1Q9OA 4S2SA 4ORGB 2R4RH 4DN3L 2VZ1A 2AJXL 1AFVL 4TNVK 4PLNC 3EOBB 4JVWA 3ZSSA 1Q38A 2VIRA 2ZUVA 1K8DB 4ZPTB 2OLDA 4X4XA 1FFNB 3U2SB 1BQUA 1V5JA 5DLML 5GS3A 5JUEH 1E4WL 1KNOB 4OF7A 2AEWA 1WZMA 3QNXA 4KROB 1MUJB 1T7VA 5ESAA 1FVCA 4LAQL 3ARRA 3VRIB 5I30L 5EO0B 4PJEA 4JPIB 3B2VL 4YXLH 3NCEB 1O0VA 2H26A 2OL3B 4IRSA 4IBLT 1I3RB 1YQVH 4LRIA 3STBA 3W9EB 5MHSE 1MH5B 4ZS7L 4NFDA 1F3RB 3GSVA 5L88H 5SWSD 1RY7B 5BXFB 4Z76B 5E6IB 2R1YB 3QQ9D 3QHFH 4JO3H 1DVFA 3WHXB 5K9KA 2ADIA 2QSTA 3GI9L 5EU7E 4CUCA 1LD9B 2CLZB 1I8LC 3QPQD 4JQVA 5EOTB 4Z0XB 3ARQA 3B6SB 3RWFA 3EDJA 3DTXA 3IETB 4XB7A 2DI9A 3TYFA 1CXHA 3HG1A 2X4PB 4I77H 4NC1C 5D70H 1MY7A 3B8YA 3T1FB 4WFGE 4Y7MA 1UM6L 5IBLC 1NCDL 1U3JA 1H0DA 3LKSB 5ABDE 4K2UH 2ADGA 2IBZX 3RPKA 3QQ4B 2VLRD 4AL8H 4MD0B 3UXFA 5DUML 5TPWL 4LHUA 5IFAH 5JW4Q 2HAZA 3QUYB 3G5XB 3ZDYF 4Z7VB 2VL5B 1W0WA 2FYYB 4RA0C 5ESQB 1MJJA 1H3WM 3C2SA 5FUZL 4XNUL 2YN3A 4WHYH 2IANA 2PCPB 3OHXB 4Y5VB 2VXTL 7FABH 5SWZD 4JHWL 5T3ZH 4F37F 5EU7C 5EZJA 5D6DC 1QRNB 1B3JA 3Q3GB 1FJ1A 1NEZG 4IRJB 1ZMYA 2NY0D 4O2FB 1D5IH 5C71A 2H32H 3GB7B 2P5ED 3UMTA 3C5ZA 4JKLA 12E8L 3W0WE 1UH2A 5FGCE 4R7NB 3NFSL 5FCSH 1HHHA 4M7LH 1G6RA 3OKLB 1LO3H 3BX7C 4HH9B 5J06A 3GSNB 4LSPL 3DO3A 2XWTA 1NANI 2VYRE 1QOKA 1RJLA 3CPLB 3IGAA 4HIXL 3RKPA 3MFGB 3KPRE 1DL7L 4PGBB 5E08H 4OJFH 2NLJB 4OIIH 1N4XL 3QCTL 3H7BB 4J3TA 4LCUA 1CWVA 5T3XH 4IIQA 1K85A 3F5WB 3BZFB 2GY5A 4JM2D 1CGXA 1ZXQA 3DMMB 2B0SH 5JOEA 1IGFL 2UY6A 2W0FA 1KJMA 1XEDA 3WKML 4NRXA 5BV7C 4GW1A 3ARFA 3SJVE 3L3HB 4RZCA 5IQ7H 1KT2A 3C8DA 1LP9B 2MTPA 4WO4A 3QIBB 1T2JA 4NP4H 3IDMB 3DX8B 5GPRA 4U2YA 4YZFE 4HX1A 4QHNB 3MGTB 4P2QE 4RQQB 5DC9B 3VFUB 2CLVA 4D3CH 5EZOL 4YHOH 3VG9B 2AJSL 5C6TL 5HGDA 5F7EH 3ESVF 2VDQH 3RVUC 1XGQB 2YZ8A 3E3QE 4PJXF 5DD5H 4BJLA 3GSRA 2E9BA 4NKQB 1ZWIB 4HXBL 1BX2B 4J3VA 2VDRH 3DURA 1P2CB 3QEHB 4FMKA 5DD6B 2XIDA 1T5XB 4AIXA 3QQ4A 3WHE0 3TZVC 3MJGX 3JVGA 1IC5L 5BVPL 2NTFA 3NCMA 4FA8A 3RWIB 5GXBB 3UTQB 3QNYB 1JP5A 4QTIH 4JLRB 4G9FB 4XPBH 3QUXC 2GJZB 3KJ4B 1RJZB 2GK2A 2JIXB 1SY6H 3C8HA 3P0YH 5FV1L 3KYAA 1HHKB 2ORBH 3MA9L 2D31A 5C0IA 4KAQH 4B50A 5GGVL 3EHBC 3U1SH 1YMMD 1E0OB 1OT2A 3B9KA 3EIFA 3CD4A 2PO6A 1T22B 4QRRE 3ROOB 1AGEB 4PG9B 3VG0H 4Z76A 4JY6B 3TIEB 2R29L 1JTPA 2Q3ZA 1YEHH 5DEFB 2OL3H 4LCIL 4LPTA 3PGCB 2GCYB 2H9GA 3CFJA 5E1AA 3BVNB 3DYOA 4PR5A 5KW9L 1CVSC 1EGJH 3BWUC 2O26U 1ROWA 1IFHH 1TQBB 4RFNC 4JZNB 1RJLB 1J0ZA 1JZ5A 5IJVB 1JZ6A 2R0WH 4X5WB 1PSKL 4KRPD 3V6FA 1IM9A 1ZA6A 1X5AA 2EDYA 4XCEB 1A14L 3BAEH 2Z0BA 1CU4H 1IGMH 3LIZH 4P9ML 4HQQH 3DLQR 3ZHLA 3HZMA 4OIIL 1Q8MA 5T3XL 1MCOL 1R5WB 2W07A 3GMOB 1NGPH 1TITA 3IDXL 5JR1L 1FC1A 2ATPA 3VFSB 1A02N 3O6FD 3ALWA 3LN4A 4ETQA 3HNSL 2I9TA 2PYEE 4HWEH 1UWEL 4TVPL 4KTEH 1XGUB 1LP9A 1FIEA 2LTQC 4LSSL 5C3TA 1X5FA 1JYVA 4JN1L 1XZ0A 1QRNA 2Y6SC 5EUOE 5IVZA 3WIHL 1OT1A 5KSAC 3DXAE 5HD8D 5EA0L 2MPAL 4LSUH 4Q97A 5LWYL 4JFQA 3P40A 3SO3B 2NY6C 3P9MB 4MLIA 1OP5K 3JTTB 1QD0A 3M1BA 3X13B 3EFDL 1X9QA 4XX1E 1ZT4B 2VLJB 2LE9A 5FGBA 4FFWD 3L6FB 1YEFL 2R1YA 1KCVL 2VXUH 2BSTA 2B1AL 1S9WA 2ZWLT 4M1GH 4NYLA 4K9EL 1P4IL 3TT3H 4QTHA 2C3GA 2E6PA 5FKAB 1FNLA 3ZKMC 4ACPA 3DTXB 3IETA 2D9QB 2VR4A 3ULUH 3D3VB 1J0KA 3RPIA 1NBVH 2VLMD 4H1LH 4OLUL 4RGNE 1ZSDA 1HINH 5TF1H 2EKSB 4QF1B 4PJAF 1ZV5A 3D2UB 4RRPG 3CXDH 1PZ5B 3ZDXE 4G9FE 3KPRA 1BF8A 5KSUA 4NIKB 4G5ZH 3EYUL 5CJBA 3LKPB 4YJZL 3VFNB 3H42H 3BP6B 3LAFA 5D96B 4PB9H 4XP9L 2F8OA 3LDBB 5TDOA 4I48A 2CUHA 1CXLA 1Q0XL 2Q7YA 3QZWG 2MWCA 1CR9H 1MLBA 3TV3H 1DLHB 1RHHB 3IDGB 2X7LB 4M8QA 2ERJC 1DBML 4QOKE 3MGTA 1V05A 4UT6H 2GFBB 2HTKD 4M9OA 5HHNA 2B1HL 5DMGD 3K2MC 2EKJA 2YD1A 4KDVA 2VZUA 4CJ1A 1TVHB 4S11A 5ICYB 4ZUTB 2HFEA 1B6UA 3FKUS 3VDCA 4I3RH 3N50A 2HMID 4KQ3L 5HI3C 3ALXA 2DM3A 4D0CA 4ZFFA 3C5ZD 3CFKA 3OB8A 2MKWA 3T4YA 3FQUB 4YHYC 2FSEA 4L3CA 5EZIH 3LVEA 4M61A 4PRIA 1P4BH 4GAYB 2G75A 3KPTA 4L8SA 1GZQB 5E8NA 2N1KA 3FN3A 5J57B 1S3KH 4PRAB 1E4JA 2EIEA 1KJMB 3KLAA 2PO6B 2UWEB 3HKFA 3X14B 5GSRA 1IAIL 3ZKMD 2D7MA 1DN0B 4P9HL 3T3PE 2Z4QA 1XF3B 4EVNB 4HJ0C 5JHDA 3BO8A 4HCRA 3Q1SL 3HUJE 3ET9F 4CAGA 4R6UA 1KJ2L 3VXRB 2BY2A 4LFHG 3KWWA 5CINL 4QEGA 1KB5L 1I9IH 3HZVA 1Z5LB 5SWZB 4NBXB 2R2HB 2F19L 5IUSA 5FM4A 1FSKC 5ISZE 3UEZA 2APFA 2A6DB 1JNNH 1XF4B 3HA0A 3J7HA 4ELMF 4M1GL 4TVSa 3HB3D 4LVNB 1A7NH 3L9RA 3MJ9A 5I1HH 5AZ2L 1LE9B 4QWWC 4EI5B 1NAKL 5C0NC 5C0CD 4S10A 3JVGC 3S96B 3PWVA 2YWYA 4BFEA 2VXVH 4D8PA 3ZDYE 1BQSA 2IPKA 5B22A 1U41A 4JM4L 4PG2C 1HYRC 1DSFH 4RWYH 1XGUA 4L4VD 3B2VH 1MJJB 4XT1C 4X99A 4XVTL 3SDAD 3L7EA 4HWEL 1MFEH 2JIXA 2OR9H 3O3DA 1OAXH 4UNUA 3T2NL 5F96L 5JHLH 2Q7YB 1JMZA 3H2WA 2FX9L 5EOCJ 1RZKC 4LASL 1S5HB 4HS8H 1DCLA 2YPLE 1NC2A 1A7RL 3A6CL 1U91B 1Q0YH 1SEBA 1M05A 5FYLD 1CFTB 2ZUSA 3L3OB 1Z9SA 3R8QA 4WO4C 1EVTC 2IPTH 3EYVA 2CKBA 3WFEH 1Z3GH 4QKXB 1G7QB 3MV9E 3GSUB 5EUKB 1VPOL 5EH1A 5BVPH 3CFKB 2E7LA 3T0AA 4G8EA 1TJIH 5EO9B 3MODH 3IDJA 4UDTA 1S7WA 1T5XA 1UWGL 4PJEF 2WAHA 2WQ8A 3MODL 1NAKH 5IB3A 3DV6B 3PGDA 4PJCE 4UOW1 2L0DA 4Z7QF 4YHPA 4CMMB 4ZOEA 3HZKA 1D6EB 4ZUVB 3I85A 4TNWF 2BHUA 5AZEL 3TBTA 3SCMC 2E27H 2PXYB 2VDML 3U1SL 1E4KC 1D5BA 5GSVB 2ZKHH 1EEZA 2YOCA 2NXYB 3Q6FA 1CLYH 2EECA 1BFTA 3I6GA 2VQ1B 5E8DH 2H6PA 1IQWL 2P8PB 5BW7C 4Y4HD 3DGGB 1CYGA 5D7JB 4DTGL 4NC1E 3GUTA 3FO1B 3TIDA 2QR0A 1AFVH 1FNAA 3TFKC 1AGBA 4G8FB 4LGSB 1MI5D 2Y9RT 1I1AC 4NZUH 4QXGL 5IB4A 4XH2A 3RZWA 4J4PA 4PR5B 2ZPKL 5GZOD 3QUZB 5FYKE 1DQJB 5IB1A 3UROR 1DQQB 4N5EC 1XGQA 4M93B 4QRPD 5IBUG 2Q6WA 1YNLH 4NJAH 5GRJL 1A6ZA 5H37G 5D6CA 1JNLH 1I1YB 2CIIB 4H88H 4HGWA 3HUJF 5HVHB 1NCAL 1YPZB 2IAMC 4HT1L 3GM0A 5F1KC 5FDWA 3FQWA 2FRGP 4XXDB 5ENWB 5KSAD 1DQDL 3G6JE 1HXYA 3CDYA 3RWDB 3MV01 5FB8B 5IHUH 5H8DA 5CEXA 2BXZA 1RZJH 2PKDA 5HDBF 1MUJA 3MLRH 4DCQB 4JDZB 4KI5E 2XXMB 4ZS6D 3PWLB 4P2RE 5GSRB 3WSQL 5IJKC 5SX4I 5TDPB 1WBYB 4V1DA 1CDGA 3SKMB 4Z7OF 1OAKH 1INQB 1NGQH 1HH9A 4HLZG 4UT6L 1CS6A 4MD4A 1DVFC 3TGXA 3QHZL 4XMPL 3DROB 1IJ9A 1JK8A 3H6JA 1UZ6F 5DFWH 2QQKH 4JJ5A 4MA7H 3FL7A 4Q74A 5F9AC 4M7ZC 3QI9C 3P9MA 3PP3K 1NEZB 1BJ1J 2GTWB 3EOTL 4IRSC 3VFTB 2VE6B 3HC4L 4IJ3B 2EIBA 4TOYH 4J3UA 2W0LA 3QIWD 1G7QA 4KHXH 3T09A 3GIVB 5DDHA 3WFDH 1OSPL 1UCTA 5FK9B 5B38G 2ESVB 4C56B 3LZFH 4GAFB 3IB4A 1E4XI 3CMOH 4PJFB 5INCB 5J13B 1P7QD 4AT6A 5GGTA 1HDMA 3RVXC 2H1PL 4E0RA 2IH3A 2JB6B 5C0EA 3GMOA 1D6VL 3D39D 3LSOA 4YHIA 3S5LA 3HLAA 4P3CH 2SEBA 4K7PH 1RULH 4XP9H 1UADC 4Y4FB 3ZT7A 5D5ME 4APQC 4JO3L 2P48B 3OF6A 1I3RA 2VXQL 5CSGA 1U2CA 3V9FA 4NWUH 5F21B 4JZJB 4LIQE 1ZANH 1Q94B 1QLRA 4QXGH 3NFPA 2IAMD 1W72L 2WK2A 1FJ1B 2A2QT 4N0UE 5DMIL 3OJMB 3DXAD 4HS8L 5F70A 5JNYB 3V5DA 3RDTB 3SGDH 2P5WA 3K81A 4Q6IA 5C0AB 4HUXA 4LLYB 1IEAA 1DQQA 5GGRY 1GGIH 3ILQC 2R8SL 2IALB 4XPGL 3D9AL 5FYKL 1R0AH 1ZE3C 1MCKA 1KXVC 3QDMB 1R5IB 1J05A 4ZFFB 3PL6C 1KC5L 4K3EL 4X9BA 4IIQB 3MQIA 2P44B 4BH8A 4P57A 1T0MA 4YDLC 5MEND 4O00A 4OSUH 4C59B 3BPNB 3MLYH 5KS9E 3QULA 4KHTL 2VL5A 5ESQA 3MTRA 3RKDD 3IDNB 1OTTC 4WUKH 4PJ9D 4RGMC 1YEKH 4LLDA 3WN5C 5HHMD 3A6OA 1PKOA 4I5BA 2QHLA 4EDWL 1P69B 1M7DA 3DYMA 1IT9L 2X1QA 1N59A 1T03L 2H2PD 2XWJB 1R3LA 5ITBL 5K93A 3ES6B 2K3TA 5D1QA 1F3DJ 2FO4A 1MNUL 3VG0L 2O5ZH 4TVPD 2YC1A 3D87B 5KSVB 1HHHB 3U0WH 5C2UB 5DRXA 1NC2B 4BUGA 3QPXH 5IB4B 5HGBB 1FZMA 3TH4T 4PJIA 4IDJL 3L3GB 2O93L 4V2CB 5DJZB 4Z6AT 1BWMA 1R5VB 1QO3B 1CD1B 3HNTH 3D69B 4XBGA 4W81A 3QO0A 1NDGB 3NABL 4KKNA 4P2RB 5F93C 3LEYH 4A6YA 3MLUH 1YDPB 3K2UH 3BAEL 4WW1A 5GJTL 1CTOA 1VADA 4I4WA 4K94C 4MAUH 3HE6D 3BGMB 5LCVH 3RIFK 3UTZB 2PTUA 3I50H 4M61B 5MEPB 4ZODA 3FO2A 2RHEA 1NBZA 2RFXB 4H0IA 3GHBH 5TDPA 4OCSH 3QDGA 4RAVB 5D7IE 4N8CL 4PJGA 4Y1AA 4XVUC 3TVMB 3KPMA 5I1JH 1JRHL 1C5DB 5B39G 5I16B 4OFIA 3W9EA 4GAGL 3WDIA 4U7KA 3GSNH 3QYCA 1U8LB 3QNZA 4HWNA 5TE4L 3ZDZF 2YD4A 1XGRB 3OZ9L 1PZUB 1BJMA 2AV1B 4GH7B 2J5LC 2WUCH 4QTIL 2VDKH 1A7OL 2YPLD 3X3FH 4FHBD 1RMFH 1Q9LA 4X5XB 3GZKA 1RUAH 4KMLB 4JG0H 4PJBE 5CGTA 1Z2KA 2DD8L 3RWHA 3HCVB 1LEKB 3IFNL 4O4YH 4PJ5B 4U1KB 2D9CA 4ZAKA 3ARED 1WT5C 4H26A 3RL1A 1FNSH 1KPVA 5TGBB 4J8RB 4FXGB 1D7FA 1FORH 5CLTA 1WCBA 5HHVL 3TYGL 1FG9C 5TFSL 5JW4M 1JN6A 3VI4F 1GGYA 4ZAKC 1MCEA 3WLBA 1MCPL 4IS6A 4FQXD 4IRSB 1CBVH 3MR9A 3S34L 5C2BL 4NZRH 4XPTL 4LKCA 1MHHB 4RAHA 1K6QH 1L7IH 3QRFM 1T66D 5D7JA 1NUDA 5E6IA 2VLJA 4UQ3A 3D48R 3CU7A 1VGKA 3DVIA 1RVFH 2BJMH 1U8HA 5A40E 5E5RB 1R5IA 3SDDD 3KPQA 1Q72L 3D39B 3NIGF 5DJDB 2YXFA 5AEAA 4Q9RL 1GZPB 2H1PH 4P2CG 3OG6B 1T20B 4JFXB 2GAZB 1CFNB 3CFIC 3NZ8A 2OCFD 5E9DA 4P23D 3CNKA 3TCLB 2UYLA 4O2EA 5J9PB 2VDNH 5C09D 4RMTA 2IAMA 2P8LB 2Z31A 4R4ND 5CHNA 3U7AA 3G5XA 3QQ3A 3LSOB 5E95B 4HAGA 1W0YT 4J2XA 4UZGA 3GIZH 3SPVA 1XFPA 4M9PA 3QDGD 4DGVL 3RL2A 1ND0A 5C09B 5C0CE 1W0VA 4Q9BA 3QEQA 2ZJSH 3L3IB 1IARB 4K9EC 5IROA 3V8OA 3L7FB 3MLTA 3MRIB 3N85L 3P3YA 3RWJA 2GI7A 3HMWL 1K8IA 2KPNA 4RWHA 3CDCA 1SEQL 5CJOH 2XKNB 1YY9C 1D5MA 1MJ8H 2NZ9C 4MA3A 1P53A 3LPWA 5FYKH 2NW2A 1NEZA 3SDYH 3V5KB 1KF9B 4EIGB 2V2XA 1AXSA 4NN6C 3OKEA 5F89A 5FFLA 3RHWF 1U8MA 3WN5A 3S4SG 1FSKB 1YEGH 3PWUA 3FN9A 2NY5L 5D7IB 3R06A 3V6OA 1OAUL 2GW5A 4ZO6A 3TT1L 1WIUA 4PGBA 1V7NH 5AWNH 1VADB 2X4QA 4I4WB 3PABB 1QHOA 1Q9KB 3K2UL 3QJHA 3RJDA 3KXFA 3WNPA 5IIEB 1JZ7A 1AR1C 4QXWA 2YRZA 3O11B 1TTUA 4EN3C 1IGML 4I18A 2AJUL 2JE8A 4K07A 2H3NA 4ZFGH 4UU9A 4HUUA 3FCTB 4U1LB 4NBZB 1I3UA 2NZIA 5EC1A 4PJDA 1CE1L 4HG4J 2XTJC 2FL5A 1INQA 3GBNL 3HMXA 3QH3A 2DQJL 4WO4B 4CKVX 1JZ2A 2WIIA 5E0QA 3IF1B 5F6IB 1XF5B 1YY8A 1A6VH 2HH0L 1A7RH 3A6CH 4Y2DD 4PJAA 4CVZA 1MJ7H 2ICCA 5CSZA 1QBLL 2XZZA 4OLVL 1HIMH 4H1LG 1QFHA 4RQQA 2D7TH 3BH9B 5C08A 4I13B 5L8LB 1MIML 2JJWA 5E7BA 3VI4E 1U3YA 1X7QB 2BNUB 3P2TA 2Q76A 1BIIB 3P4OB 1RVFL 1NMBL 2RAMA 1QO3A 4G43B 3TZVA 3V95A 1DEEA 1YNKH 4ERSL 4HK3J 1LE9A 2FJHB 1U93B 5CLWA 4PJGF 5JA8B 5FHAH 5FUOH 1CFQA 4BH7A 1SM3H 5J13C 1C16A 2N7BA 3DX9A 3G5ZA 1OTSC 1JVKA 2HLFD 3UTQA 4JEGB 1NJ9B 4MXQC 4PJFE 2I9LA 3A67H 1O7SA 3BKCL 4NQEE 5HHVH 3TYGH 3T65A 3UX9B 2WV3A 2OL3L 2HT4C 4MX7B 1GGCL 4GMSH 1ACYH 1ES0A 1NAML 3KPPB 4PJBA 2DMBA 5LJYH 3NIDE 4I9WE 1T1ZB 1B0RA 3AU1B 3OPZH 5D1QB 1F4AA 2HT2D 5KZCB 1SBSL 4PBXA 3Q1SH 5EDXA 4BZ2L 5E70A 4MA3B 2CPCA 1F4YH 4HHAB 2AERT 3D0LA 3O9WC 1AXSB 4UAOC 2YK1L 3ARPA 5AD0A 2YK1H 2BOCA 2FIKB 2AI0H 4YXHH 1MCLA 4PGDB 3N1PC 3AY4C 1I1FA 1NDGA 1QNZH 1RIUH 4NGHL 2FEEL 2M8XA 3MLZH 4WENB 2AJZA 2EDNA 4BH8B 1QKZL 3QZWB 4K2UL 1T2QL 4KMQA 3IS1X 3MSPA 4NN5C 4CMMA 2OBGA 1J0YA 2IAMB 4UBDD 4S1QH 3QEUB 4LSQH 4AEHL 4JN2A 1NSNL 3H3PH 4TVPE 4P2RD 5HYIA 3FONB 5C0FB 2BNRA 4YBLC 1U95A 5H35B 4MNQE 4OAWB 2VDNL 3PIQA 1X4XA 2W1NA 3SDCA 3NH7H 3VFOA 3NA4A 2EIZB 3FTGA 2JCCA 3K4DA 5KSBB 5JORA 2BVYA 2NY2D 3L3IA 4J6RL 4RAUA 4X6FB 1MH5A 5B4MC 3GKWL 1OL0A 1RPQA 3R1GH 4QCIB 4X80L 1DR9A 4LLUA 4FQIL 4BSVA 2DAVA 3MRRA 5F9JB 1U8KA 3FFCE 3SDAB 3WLWC 2BJML 1OW0A 1GC1L 1GHFL 3LEVH 3QNZB 3RNKA 3ZYIA 3TT3L 5HBBA 2X41A 1AGCA 1XIWA 1VGKB 4WY7L 3WUWB 2HJLB 4YPGB 3DJ9A 2J8HA 4NRYB 1OSZA 4ZPTA 3DXAB 2VO5A 4P4RB 4KJYA 5HY9A 2LQRA 4UMGA 4MS8D 2UUDH 3BDYL 3RPIB 1QBML 3RWEB 5AYQA 2X4NA 3BD3A 3SHSA 4AY0A 2MOVA 5SV3A 4ZSOA 2ZSVB 4ZXBC 2DQTL 1BQHG 4GMSL 4Z77B 4RMQA 4XBPB 3BP7B 2EH7L 4Y4FD 3PWLA 1I7ZB 4MDIA 2I9LB 1ZHBA 4UIKL 1EEZB 3QP3A 5I75C 1RJYB 1U8JB 1J0HA 1OLLA 2MNUA 2P5EA 4UQ2B 2NY6B 1S9XA 35C8L 4PJ5E 4MZ3A 1BWWA 1BJ1H 2R23A 1G84A 2VOTA 3DETC 2B1HH 1DBMH 1KJ2H 2N7AA 4R26H 4XP5L 4FNLH 2W60A 2NYYD 4X7FC 1SJEA 4LCIH 3BGAA 1A6UL 2WINA 3KHQA 3ZKXC 5BRZB 5MEQB 5K9QG 3RGVA 3E8UL 3GI8L 4P46D 4PJ7B 1M4KA 2AXHA 5FYKU 1ORSA 4HSQA 1RI8A 1ZLUH 3NCYS 4Q2ZB 2I24N 3VFRB 4P5TC 1XGRA 3OJDA 4QRPB 1R0AL 2XACC 3ARDA 5TPWH 5IW1A 3NIDF 4K7PX 2A38A 5TE4H 3O2WL 3FFDB 1Z9MA 3BGFB 4XHJC 2WBJA 1Q9LB 1KUMA 3D0VB 4JFEA 2A6JB 5B8CC 2YA2A 3QWOB 4JFFD 4HWBL 4MQXD 4YFLF 2OI9B 2UV3A 3NFNA 3V0VB 2VN4A 4PGZA 3RKDC 1I75A 4PRBA 3KYOA 3UBXG 2CUIA 5C07A 4WCYH 5AZEH 5ESAB 1X5ZA 4H1LA 3TA3A 5DK3A 1MWAA 3MRQA 1NUGA 2OZ4A 5T3ZD 4G6MH 1WC7A 1T1ZA 2OSLA 4KTDL 5LWYH 5D7LA 1KACB 4OZFH 3RVWD 1JRHI 1GGUA 1HQ4A 32C2A 3KVQA 1AO7B 1YEHL 2A6IB 2YA1A 3AS0A 3RWJB 4BSJA 3CVIL 4HXBH 3UDWA 1OF2A 3CMOL 2IFGA 1OD7A 2UZYB 4OZGA 4DZ8A 5BRZE 2VAJA 1V7ML 4XCNB 4DOHB 1CXKA 2DDQL 3HZYB 5I75B 1UH3A 1DBAL 4NWTH 2DJ4A 2EE2A 1DDHA 2CO7B 1RK1B 3NVQA 5IMOB 1HDMB 3LIZL 3DMMA 4LVOB 4RFOL 1DEEB 2APTA 4M1DH 2B2XH 1LEGA 1Y18B 2VABA 4U6XB 1T03H 1U95B 2B8OT 5KVDL 1F3DH 2VLRE 3BISA 2PNDA 1PQZB 4M1CD 1W8NA 3FQNA 4HKBA 3DIFB 2VLJD 3BOVA 1FLRH 4IOFC 4G7YL 2XN9B 1J87A 1UB5B 3H8NA 5GIRB 4MA8H 4HMCA 3T65B 4Z8FH 2HTLC 3GM8A 5ITFA 4MXVE 5EA0H 3HHRB 1QQDA 4PJDF 2GTWA 4TTDD 4WWKD 4HUXB 4LCWB 4MCYB 2OMNA 2DLIA 5J6HB 4HUWB 2I27N 4L8BA 5T3ZL 5CZKA 4LAJH 3R4DA 4TNVF 4JVUA 2CMRH 1NGYB 2W0PA 4NQEB 1T0NB 5FHBH 3L5WA 5ISZD 2X89D 4X7CC 3JZ7A 1DVFD 4HXAH 5GRVL 1E6OH 1EAPA 5FXCH 1J1PH 1NFKA 1WFUA 1FL5B 1HXMA 1N3NA 5FO9B 1BHGA 1NMAL 4AIOA 2I5YL 4GG6F 1F6AA 1ZAGA 4HD9A 4XCYB 5HHOA 1G7PA 3O8XA 3DX9B 2Z8RA 3N1MC 3BYYA 3G6AA 5GGUA 3MRCB 1EEYB 5IB2B 1RAMA 4OB5L 4Y4FA 1S7UB 3KJ6H 2BSSB 4PIRF 5TFSH 2B4CH 1RV6X 3S36H 3K8MA 3F7YB 3H3KA 5FM5M 1HI6B 5CIPH 1LO5B 4WI4A 1SBSH 5M94B 4Z95H 1JNHA 1MFAH 5ICZB 2A9NH 3KYMA 3OAUL 5IW6A 3FTGB 5FAAA 3G5VA 4DGYL 5TDNB 4OD1L 4XNXL 1G7HA 1AHWB 4G9DA 4OZGE 1HZHL 1WWBX 3CFJB 5E1AB 3S98A 5IMLB 5F7WC 5JXEC 5DR5L 1B0GA 4JQXA 3HR5B 3M07A 3L95A 4XGZA 4OCLC 5F9DC 3CU1A 2OQJA 1SJHB 3SGDI 2CLVB 2FECI 4XH2B 2AV1A 3BN9D 4Y5XA 2BRRH 2OTUB 3C6LA 1U8NA 2WLYA 1I8KB 5IR1A 2IMMA 1L0QA 1KSRA 2FIKA 2XTJD 3ULSA 3AXLB 5GQBA 3MLRL 4YPGA 5EOCL 3VRJB 2F58H 2N56A 4JVPA 1QSEA 2VRAA 3DUSA 3ORJA 1KV3A 4AJ0A 1KCUL 4KJYB 4M6NL 5C09E 5C0CB 5LXGL 5JPMA 4U1IB 1X5YA 5DJYA 1MCPH 2X42A 4KH2A 1CG9A 3T08A 2QQNL 5F7KC 3GBML 3V4UL 1FPTH 3H9HA 1PQZA 2JELL 3D3VE 3TVMA 2E3VA 5JW3H 1LEIB 1MFEL 3O4LE 1KIQB 2GIYA 4YDIH 1E4XL 4ZNCD 3TBWB 1N26A 4OD3L 3SCMA 5HVFB 3B9VA 3WFHA 5F88A 1DANT 1NLDH 2BNQA 1BQLL 1R3HB 4F9LC 2FATH 1BVKA 5FOBA 1JCKA 4G6ML 1TJHL 2HLFC 3C09C 4NZJA 2VLLA 2YPVL 1NQBA 5CIPB 1OGAB 1RZIA 5DEFA 3EDDA 4O58L 3MRPB 1AI1L 1EMTL 3JV6A 5JZ7D 2W9EH 1PW3A 1NUNB 4PRNA 4OV5A 4FFYL 4L4TE 4GKZA 4POYA 1JGEB 3DNKA 3LKRB 2VAAA 1HH6A 3OJDB 3LMJL 3L5XH 3HUJA 1FFOA 4JREC 1J8HA 1QSVA 4WTZA 4JY4A 2Q20A 2PTTA 1V7NL 3WMSA 3C09B 3A6BL 3DX6B 4WDIA 3FN0H 1EEYA 3SEPA 5IFJA 4ZSOB 3FRUB 4U1GC 3X12B 1H3XA 5IKCA 1JZ3A 5TH2A 4EUPB 4HGMA 3D1MC 4NQCB 1H5BB 2OTWA 35C8H 3V52L 1YECH 3UZQA 4PRIE 4LLDB 5KVDH 3S4SB 1P1ZB 5JOPD 4NKMB 5C0GA 3OGCA 4YDKL 3TZVD 2CK0L 1EAJA 1FO0L 3LKOA 2K1MA 5CCKL 4HPOL 3GSOB 4L3ED 2AJVL 4GRWF 1VFBA 4P5MA 4ONFH 1F11B 5I1AA 1OOAA 4FP8L 2RQ8A 1V3LA 2AW2A 4JRYD 1A7QL 4JRXA 4N9GA 4G42B 5JPNB 3BD4A 1I85A 5DD3L 3HNVH 4Q2ZA 1PX3A 2Y7QB 4UTAL 4ZUSA 1CGSL 2X1XR 5IR1B 3SE3C 3C60A 1GZPA 2AK4E 1OPGH 3D25A 1ZVHA 1AQKH 5IG7A 3NGBC 4X9IA 2XNAB 4QOKA 3OR7A 3FFDA 1J11A 4IOIB 4PJHE 4LRNH 1J05B 4YNYA 5B21A 1IC4L 5HDOA 5IBTL 5MENA 5JXAH 4RGOH 4NFBA 4W4NA 1JYNA 1E6OL 4MDJA 5T1LD 4RISL 4LDLB 4D9LH 4OD3H 4P5KA 4KAQL 4F58L 4PRAA 3V0WL 1A5FL 4JM2C 3VD5A 1S78D 3H9SE 4OLYH 3UTZA 2FD6L 1F2XK 3I3BA 1TQCB 5HDQL 1ORQA 1BM3H 3LQAL 3O6FB 2IQ9L 1CE6A 4KZEL 5C9JA 4RMSA 3IVKB 4RMRA 3RDTC 3WBDA 5K9JL 3FQXB 3MZGB 3BQUC 1S9YA 3C5ZC 4FQHA 3PV6A 2YMXH 1B0GB 3UTTA 2KBGA 2XZAL 3OB0H 1JPFA 5CSZB 4PREB 4JHBA 2YHGA 5JIKA 4KRPB 4KKBC 4XMKL 3IFLL 3PWNB 3SKNB 3KLSA 3SDCC 5JW4R 4Y5XB 1K2DA 3KPQB 4KK5C 1AI1H 3ARBB 5EUKA 2DLGA 1I1AA 3QO1A 5CEZL 5FECA 4WI5A 4NQEA 1NDMB 3MLXL 1YEJL 1G9NL 3KYNB 5I9QC 4Z7VE 3MLXH 4ODVL 1T2XA 4KVCH 1LE5A 1A3RH 4XC3L 2VQUA 4I18B 2NX5A 4IMLA 4MB3A 1T0PB 4KY1L 4X98B 4U6YB 2C3HA 3F6IA 3W9DA 3FO2B 2Z8SA 3O3UN 1VB9A 2WWKT 1NH6A 4OBRA 4UIMA 4LARH 4DZBA 3KPRB 3ARXA 4O5LH 3T4AB 5CKAA 3VWJA 3V4VL 5GS0D 4YBLB 4P23A 2QQNH 2VH5H 3TA3B 3TCXA 2ITCB 2MSPA 5HHPB 3QI9B 4NO2B 5I9QB 1WC7B 5DRNB 3TO2B 5HSFA 5HYSG 4JG1L 3PHSA 1B0RB 4LDEB 4RBPH 4ODTL 1H3GA 4UT7L 5IHLB 1D5ZB 4KQ3H 1S78C 3PJSB 4E41B 5HYSB 2IADB 4G8IA 4K9EH 3HG1D 3CLEH 1Q1JH 3NA9L 3CVHL 5FHBL 3HI6L 2J8OA 1FYTA 3TYFB 1HWGB 3UO1H 4M62H 4XPHH 1UZ8B 5GS2D 5HYFA 1JPGB 4NZDA 3HZYA 1KPRB 3LS4H 4U7SA 4NHUA 4ZFZA 1MCWW 1J5OH 5IIEA 5GZND 3CX5J 5D71L 3HZKB 1GGBH 4N1CA 1T20A 1CTNA 2HT3D 5I74C 1OQXA 3TJEH 2LU3A 4TSCH 5GSVA 1J8HD 4YGAB 1JTTA 1JWSB 4R8WL 2VDMH 5GISH 4ODWA 4A6YH 3E6HA 1A3QA 4FABH 2F53E 4Y4KA 1LO3L 3VXNA 3RZCB 5EZJB 4KVNH 5GRUL 2EXWD 3B9DA 3P9WB 3OKDA 1WZ1L 1N64L 4MNGB 1FIGL 3DROA 4OFVA 2CDFA 3VXUD 4Y8DC 2MHAB 4MAYC 5T1MB 4UILH 2R56L 4FFVC 3SDAA 4WTZG 4JPVH 5J6HA 1K9TA 2Z92B 3MRJA 3MV7D 1BFVL 3U30C 3MBEC 5HVHC 3A0OA 1HHJB 5F44A 3FO9A 1CGUA 3W82A 3C87A 1A4JB 3BIAX 3EDKA 3OKEB 1S5IL 2IJ0C 2A6DA 4Y16B 3SQOL 2OTUA 2AJSH 4XMLH 4I8DA 1PKQA 3SQBA 1CFVL 5BOZG 4NUJA 4E9LA 3UTTD 1I9EA 1FFOB 2VIRB 3MYJA 1JV5B 4LBEB 4QT5B 4W6YB 5HHXH 4LSVH 4YWGH 3OKMA 3BP5A 3KPNB 5GGSY 3SJVA 3MRDB 3QUXB 4DEPB 1BGXH 3QUML 2C3WA 2EC9U 4DGIL 3EJYD 4YIQA 2HRPL 2YD6A 2K7QA 5IEHA 5FYLE 4ZOBA 2EXWC 4ALAH 4UV7H 3FQXA 4HPYL 3FJTA 4WFHD 1H3UA 5DZLA 3TBSA 1MCDA 5DF0A 1IC1A 3VXPA 4NM8L 1NLDL 3G9AB 2R69L 3UTSB 4B0MM 2R69H 5BRZA 1U3ZA 4H8WH 1FGNL 4HWUA 1D5ZA 2V7NA 4N0FB 2JJTA 1VGEL 5I15H 5E94B 4TUOB 4GKSB 1YMME 3OAUH 4E41E 3IU3A 5CBEB 5IEKA 3BRGC 4PGDA 3I6LE 1QFWL 2VXSH 2EDHA 2R9HD 1OSZB 2FWOA 2NY3B 3OKKA 3QXUA 5D7LE 3B5TA 3CUPA 3ULUC 4ZTPH 3INUL 3MJ9L 4QYOB 1CGYA 5D1QD 1F90L 3BN3B 4OFDA 1K5NA 2NY7H 4XBEH 2F5BL 3IFNH 1Y6MR 1MCRA 4XNMB 4KVCL 2AV7A 3PL6A 1BVLB 2ZUQB 1YEJH 4OZHB 3DX6A 4QGYA 2ATPB 3VFSA 4XAWH 4Y16C 3QRGL 4LCYA 3CLFL 4HKXB 1U8JA 5TE6L 5EBWA 1R3JB 3WXVL 2ITCA 2Q8AL 4P5TD 5EFIB 4RAUB 4X6FA 3MBEB 1OCWH 1D5XB 3GHEL 4H8WC 3NCFB 1KG0A 1FE8L 3TBWA 4OD1H 5IFAL 1ETZA 1U8KB 1MFBH 1WEJH 4OZ4A 1FIGH 3WNLA 1RUKH 3KGRA 3Q3GA 3CFEB 2Z93B 2OZ4H 2QR0B 2O5YL 1OHQA 4YFEA 5HHMB 1AGBB 2NY4D 1C12B 3PWNA 3QCVH 2Y5EA 5MP6L 1OARL 4MD5A 2X4UA 4FFZH 2FZ3A 5FKAA 1YEFH 5FGBC 2EYSB 2QQLH 4RISH 2G5BA 4AENB 1IGCL 4PRID 2R4SL 1RZ7H 3BHBA 3WL9B 4CU7A 1AGFA 5I1GH 3SCMD 5DJ0B 2NX5E 4RNRA 1UJTA 4KDWA 2P45B 2BVPA 4WU7B 2GTZA 5E08L 4ZSOE 4RCAA 4Z7VA 5JMRA 4ELME 4UTBH 3VFNA 5I1CH 4X98A 3JWNC 5ANME 3W2DH 1XZ0B 4YGVB 3CH8A 1M7IA 3S36L 4KJPC 5I2IA 2E8YA 2HTLD 3CXDL 1SYVB 1WTGT 2R1XB 3ZE2E 4NQSB 1T7ZA 3B3IB 1OQOA 4X6DE 2ILLA 5KSVA 2ERJB 2XICA 3SE8H 4JRWA 1A1NA 1UA6H 1P5VA 3AU1A 1KYOJ 3LKNB 2FHBA 4WO4D 1VFBB 4P5MB 2DI7A 4X6CB 1TVHA 3QBTB 5IVNA 3CX2A 3MBXL 3CFDA 1GIGL 4QTHB 3SKNA 1RZ8B 4MA1C 5E7FA 4JR9L 4XBGB 4LNRB 3WUWG 1JE6A 4Y16A 1FV1B 1JHLL 2WBJB 3MA7A 1F6LL 3MROB 3GSRB 4N0CC 5I8EB 1MCNA 3CLFH 1QKZH 3BESR 1ZSDB 5AAWA 1MY5A 1KN4H 5CJQL 4XC3H 1QR1A 1I3GH 3VRLF 2ZUUA 1LNUA 3EFFB 1F4HA 2P8MB 2Q7NA 1ZTXH 4OF0A 5HYEA 3LDBC 1CFVH 1G7IB 2UWEE 4PGJA 1X44A 3V7AG 4LEOA 3RUGB 2G75B 2HRLA 4LRIC 1A9BB 4PJGB 4Y1AB 5DO2D 1R3JA 2HVJB 3NCCB 3SDDB 2YUXA 4QRTB 3RNQB 4NQVA 1JHKL 2RJMA 3L3DB 3ZYOA 3FB5A 2OZ4L 2C4FT 5AUMA 4FS0A 5HGHA 3KPLB 1T3FB 5IM7A 2Y6SD 3AAZB 3O41A 4HPOH 1VENA 1JPSH 4UB0H 1KTLB 2DKSA 3B9KD 2RIKA 2ED8A 1OAQH 2HKFL 1IAOB 3T77B 3MCKA 5DMGC 3RGHA 3ZL4H 3BKML 1BOGA 4NQDB 1RZJC 3UJJL 4QOKD 3VXSA 4FTVA 4PY8J 3LPGA 2DTML 5EUOB 1MEXH 2F53B 4LHUD 4H5SB 4NKIH 4XHJD 5KSAB 4XP4H 4JRXD 4O2CA 1EFXB 3U0PA 1ZA6B 2I60H 5GGRA 4HZLA 5KS9B 3T0DA 4YQXL 2R0LH 5DURB 5EIVA 5D1XD 5KAQF 4FXGA 5DA0B 1HOCB 1UQSB 1ZHLB 4MQ7B 1ACZA 3LN5A 3S37X 1PYWB 3KPSE 1A6PA 4LBEA 4QT5A 1QACA 4ZQKA 3MBEA 1GRWA 4YAQB 2DQDH 2BX5A 1J8HE 1TQBC 4ZFOA 1CXFA 1RIVL 1BFSA 3M45A 5DWUH 1ZHKA 2YPVH 3EO1B 1QLEL 3WFZA 4DVRL 1XR9A 2KQMA 3F7PC 5DMIH 3BDXA 2XRAL 3PXJA 5T5NG 1PD6A 2XZQL 2BNQB 1YC8A 2HJKB 2XZQH 1ONQA 1QP1A 1IEHA 3U7YH 2X1WL 4CVXA 4LVNC 1OAUH 2R0WL 5AZ2H 5C08E 4M62L 2FEDC 1TMCB 1U8LA 1KLGB 2YS4A 3L5IA 1P6AB 2V7NB 3QIWC 4HBCL 4PBVC 3C6LB 2WP3T 2EYSA 2UVEA 3QIUD 3BIKB 4N8VG 4YPJA 1QA9A 3IJYB 3CFBA 4OCRH 1RK0A 3TWCH 3TJHC 4FQXC 2OJZL 4P2RA 3I6LD 3D0VA 5DJ0A 3ZMRA 3PQYE 3QEGH 3MRCA 5IB2A 2HT3C 3CC5A 2D3VA 5F72S 4HJGA 2CKNA 2EKSA 1IGCH 2H3NB 1HSAB 2PW2B 3JBG7 5TQ0L 4LFHD 2VDKL 4M1CC 4YBQC 4W6WB 3BZ4A 3TO4B 3OGOE 3NAAL 4S1DC 3FQNB 1JBJA 1S5HA 5EC2B 4HDIB 4RGNB 3L7FA 3MLTB 4Y5YB 3OTTA 3V6BR 1U91A 1GAFH 3P9LB 4ZFOL 3C8KB 3HE6C 3T0EA 5I16A 4DGYH 4LKCB 4OFYD 3CFDB 1QQDB 1CLOH 1EPFA 5L7XL 4ELKB 2B5IC 2HFGH 2FDBP 2IMNA 5K9OA 3MV7B 1XGTB 4LLAA 3U36A 2HFGL 3C6LD 4IMKA 1ZA3B 3C60B 3IJHB 4EOWL 4OF6A 5D1XA 1I8LA 3BP4B 3RVUD 4Z7NF 4TPRH 2DQUL 3VRJA 2GSGA 2A6KB 4JY4B 4UNTA 4P46A 1A21A 2DQEH 3EHBD 3EO0B 5E8PA 2BY3A 1K5NB 4JPWL 1GXEA 4MCZA 5MENB 3EYSL 4GUPA 2JKXA 3EYQC 4Y2DB 4ZO7A 4PP1C 4H88L 4HC1L 3W11C 2HVJA 3GHEH 1LK2B 3O3AA 4NM4H 4JFFE 5DQJA 4Y5XC 3VXQB 4PJ9B 1H8NA 4ZFOB 3NH7L 1BMGA 1NEUA 1FYTE 3U83A 2XZCL 1JIBA 4OM1H 1EXUB 2CIKB 3REVA 1C5BL 5DR5H 4F15C 5JXEA 3FO1A 3MR9B 3VA6A 4WW2A 3MCKB 1BQHB 2CK0H 2V17H 2DLEA 4IRZH 2APVA 1FRGH 3ARVA 2PO6D 1U58A 1QNZL 4NGHH 4NM8H 3KR3L 3QIWB 1CT8B 1ZEAL 3H3BC 4MA1B 5C0BA 2QSCL 3P0GB 1MCSA 2OXHA 4I3SL 3NMEA 3S3SA 2NW2B 3GIVA 2Y06L 4G6JL 4N68A 3K4ZA 1CFQB 4QRRB 4BH7B 5HI5C 2J8UF 4MQSB 4WDIB 4EBQH 4HEPG 4Y19E 5DTFB 5HGAA 4HUVA 4H0HB 1EHLH 4CJ0A 5JW5B 1MHEB 3C60C 3BPCA 3TA3D 1MCBA 4Y16D 1W0WB 4G3YL 4ZXBD 4MNHA 3KPRD 4BZ1L 4MMZC 4MHHG 2Q87A 1I7RA 3BWAB 3CDGB 3QQ3B 1G0XA 4QRUB 1MFDL 1P84K 2V2WB 3VFWA 4NDMA 1WBZB 1II4E 3TN0A 4KI5D 3IU4H 4E41D 3ULUD 1TVDA 4GKNB 5ICZA 4TTGA 2DF3A 1MJ8L 1I7UA 4Z7VF 1F11A 4JZOB 2Y4SA 5CGMA 5I1LA 4ZOAA 4MQXC 3F7RA 2XRAH 5T1KD 2AEPH 3ZYJA 1KTRL 3SGKA 2OR9L 4NO3A 4G6FD 3P4NA 4F7PA 3ILPA 1GH7A 1IAKB 3E2HC 1TCRA 2AAVA 4OQTA 5FK9A 4JAMB 4OUOA 4KRPC 3BEVA 1NCBH 3HC3H 1BD2E 3IDYC 3HAEB 5FA4A 4TSCL 3EJZD 1PGRB 3MJ7B 3BQUB 2MKLC 4GUPB 3O0RH 2IH3B 5D93C 5E99L 3O81A 4HFUH 4O2CB 4UUJB 3BW9B 1FC2D 3STZA 1C16B 2X1OA 4XWGL 4ENED 4FQCL 1TJGL 4MDIB 1CL7H 3O6FA 4TUJA 4R7DA 3GBNH 4JFEE 4UDUA 3VXME 1N5YH 1PYWA 2G60L 5IMKB 4LARL 3RRQA 4JZJA 3QIBA 5HHPA 3G6DL 1S7RA 4XZUB 4HLJA 2PYFA 3VD7A 4H8WL 1IM9D 1C5CL 3T0EB 3BE1H 4OCYH 2O5XH 3BXNB 4LGPB 4YDVB 4YHML 3VMPA 4O51A 2VLLB 5L8KB 2Z92A 1AGCB 1KJ2B 1RURH 2D4FA 2G2RA 4A2MA 3JV4A 3BSZH 3BH9A 2IALA 5DVOA 4M3KB 1CD1A 3JV6B 3NA9H 5CJXC 1WK0A 5IB5B 2QHRH 2XT1B 3NPZB 6CGTA 1RZGA 4NQXB 3SDAC 1NAMB 1XR8A 4L9LB 1TZHA 3RTQB 1C7SA 2X4PA 5GRYA 2FR4B 12E8H 3QCTH 4G8EB 2DYPD 3CK0H 3S37H 1FNEA 1AD0A 3KPSD 5CAYB 3O4OC 1AKJD 1JGVH 3U9UA 4F57L 4RDQF 3P4MA 5D5MB 4RGNC 5IK3A 3V4PH 1BFOA 1D6EA 4ZUVA 4OFPA 5IFJB 3ARBD 2EDOA 3QFDA 3QUYA 4M43H 3ZT5A 1GGTA 2ZUTA 3SGKC 2XFXB 4RWYL 5BV7B 5D2LF 1WBZA 3TN0B 3F12A 3L3HA 2B7DT 3S4SA 2OSLB 4X4MA 1KEML 5KVEH 1NBYB 1MRDH 2BOBB 4X83A 3MJ8A 4JFQB 4L3EB 4XP5H 4QRSA 2MCPL 3ARSA 1CR9L 3E6FA 4LIQH 3UTTB 5CZVL 4YHKH 1JRHH 4JO1L 5KBNC 2NY7L 2DWEA 1YNTA 3QCVL 1RU9H 4OIBA 2X10A 1FBIH 1OGAD 1Z9LA 1TLKA 1KLUB 4NQCD 4EDXB 3ZTNH 1NLBL 4S1DD 5D6CB 4NNYA 4KDTC 4OUUB 1QSFA 4X4YB 2J1KA 5C0ND 4MJ4A 2BHZA 4S1QL 1LK3H 3S36X 1NCDH 4WU5A 4HC1H 1NDMA 5GGRB 2AJZB 3T0EC 3G6JA 1A7OH 3HE6A 3NFNB 4JKMA 1QSEE 5IF0B 5IFHL 2F5AH 2VKWA 1CD9B 2GK0A 5LGHH 1MWAH 1NGQL 1U8QB 4P23C 2CGRL 4PY7A 5HDQH 1H3PL 1HHIA 1QEWA 4MB5A 5FIEA 3FB6A 1LMKA 3HFML 3IXTA 5I30H 4EQ3A 5IV2B 4MNGA 2ED9A 2XTLA 4HFWA 5HI3D 1MLBB 5L2KB 4KJPD 5DJ2A 2FHCA 3UJTH 5GS2H 3N0PB 2R23B 1S9YB 3GJFB 5GGSB 3VGEA 4WEBL 2HJKA 4YDVA 4M7JH 2NY1C 3O4LD 4PG9A 2FCBA 5D6DA 5C3LD 1RUAL 1JI2A 3HR6A 5JA9A 4AEEA 2ZCLL 3RDTA 5HYSA 2FWOB 3OKKB 1WICA 4HAFA 4WHYG 1M71B 2EZ0C 1DUZA 1W8OA 1UM4L 1WVZA 3EYFB 3OQ3B 1B9ZA 1A7PH 1DBBH 3T4YB 4OT1L 4UV4H 1AD0B 2WP3O 2Z35A 1G6VK 4XNMA 4P9MH 5E6ZA 4FQQB 3FMGL 1J0JA 3GNMH 4X7SL 4M1DL 5B38A 5D1XC 4GAYA 1KCRL 4DKFH 1IKFH 1HSAA 2Q1EA 2GHWB 4OCRL 3DIFA 2YRLA 4U6YA 3PHOB 4KMTL 3BDBA 2YBRA 3O2WH 2AXFB 1A9EB 2CK2A 4QHMB 1N5YL 1JHKH 3FOMB 3TH2T 3I3EA 2P5EB 4UQ2A 1RHHA 4NJ9L 1L0XA 4F7TA 4PYHA 3SE4C 1PY4A 3MOAH 4U7MA 3ES6A 3VWKB 2EYRA 2FATL 3FFCB 3MOBH 4MSWB 3RIAK 3HE7D 3B9KC 3KDMB 1WQVT 2YPLA 3MMEA 5HHME 4GW5A 5DVMA 1A1OB 1CDYA 3V5KA 2A9MH 4XRCB 1KLUA 5HYJB 4XP1L 5IT2L 2IBGA 2ZOKA 5DD5L 3WN5B 2IPTL 2EDLA 4BFBD 1T1WB 1QSFB 3T1WA 4GBXD 1C1EL 3B83A 4AENA 4PJDE 2CSPA 3GBMH 4JM2F 3V4UH 4PS4H 4AM0A 4PJBF 3HTLX 5IBTH 5EOQH 2XV6B 4QRRA 2DQTH 3D18B 3QEGL 1LNUB 3EFFA 4A6YB 1OVZA 4Y2DA 2XQYG 4NQCE 2NY5H 2KKQA 4FABL 4M4PA 3UJTL 4OI7A 4ZMAT 4YEFA 4R8WH 4HUUB 2VABB 1CQYA 1N0XH 5D7KD 1G0DA 3IXTB 4LCCA 4TNWK 5BZDB 1JL8A 1A7BA 5TE7H 3O3EB 5IQ7L 2VB5A 5L2KA 4DFHA 4PRPB 4XPAH 3FT3B 3QPXL 3QH3B 1AHWA 1QFUL 4G9DB 3H9YA 4EQ2A 1U8OB 5CILL 1FO0H 3O45B 2Y72A 1HZHH 3SY0A 2X7LA 4M8QB 4ONGH 4TRPH 3F7VA 4Q0XH 4RBPK 2V2TA 2V2XB 1OF2B 3KJ4C 2A9ML 3MRJB 4PP2A 1CT8A 3X3GH 1FBIL 4HULB 1RU9L 3QO0B 3L5WB 3LS5L 1GOHA 3W5NA 4FQQA 1AGFB 2QQQA 3KPOA 3WKNA 2F15A 4S1RL 2C7UA 3FZUC 4KFZC 1PY9A 1V3JA 1HKFA 3RVWC 3VXTB 1IGIL 1A9BA 3S88L 3U9UB 1AH1A 1G9MC 3JV0A 3HPJA 4WNQB 5E9DE 1T1XA 5IJKA 3L7EB 3MRGA 3EJYC 3T0WA 3NAAH 1P4LB 3L3KA 3KHOA 3I6KB 5C7XH 4TYUA 2LVEA 3DSFH 4ZAKD 1KJ3L 3F8UB 4HKZB 4F7TB 1UM5L 2MCPH 4JQIL 4WWKB 4J4PD 4EUPH 4OF8A 3RI5F 3K7UA 1DN0A 3D6GA 5F7FA 2MPAH 4LSUL 1ZLSL 4F7CB 5ID0A 4LVEA 4ZTOH 5FO8A 5C6PB 5KJRL 3EO9L 1UKSA 1YC7A 1IQWH 3SKOA 4BSWA 1CXEA 4JFPB 3RWGB 3MGOA 1I1CA 1ZT7A 4J7RA 5J12C 1HCFX 3H9SD 1FO0B 2YD8A 3BPNC 4D9QE 4JY5H 5CD5D 5JHDE 5DRWB 6FABL 5HD8C 5ACMA 3HMXL 4JRYB 2ADJB 2C1OA 2DMCA 3CZFA 4AMKL 2YZ1A 3OKNB 1FNEB 2DMKA 4R4FH 1CU4L 4DK6A 2F9BT 1OCWL 2EIDA 2DL9A 1CICA 5GGUB 3R0NA 1MRCH 2EDJA 4HKXA 3OSKA 5IHBA 5H94A 3ECBA 5FA3A 1NCNA 1U6AH 1HH9B 4PB0L 2EDBA 3BH8B 4I0PC 3IDMA 4M00A 1KIQA 3O9WB 4HFWB 3SJVD 3MACL 2BY1A 2QEJA 4FXKB 2CJUL 5DEGB 2X70A 1Q0YL 5GZNC 1HHGB