4Y2DC

Crystal structure of the mcd1d/7dw8-5/inktcr ternary complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural modifications of alphaGalCer in both lipid and carbohydrate moiety influence activation of murine and human iNKT cells
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 202
sequence length 203
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dC02
2V2WB 3DSNA 1EAPA 2ADFL 1BF8A 4KROC 3GSWA 4GAFB 4P5TD 1DQDL 4EIZC 3RIFK 1NL0L 5B8CA 1MREL 1TQBC 1JE6A 1QSEB 4LSUL 4HFWA 4XMPH 1MIEL 3HAEB 4MMZC 2ESVE 1C5BL 1DBBL 4U6XA 3UAJD 1JPTH 4PJ5D 4EDXA 3SDDD 1UXWA 4YAQB 5C8JB 5I1CH 4CU8A 4KZDL 1T5WA 3UBXI 3HC4H 2OTWA 5D7IE 1RULL 3RVWD 3UTTE 5CEZL 1NDMB 1M7DA 4YO0B 3V4PH 4GRWF 3G6JA 2NY2D 5L9DH 5F9DC 3MBXH 1MRCH 1EO5A 5HI3D 1KENL 4U1HB 3VXPB 4QCIB 5C07B 3C5JB 3IDNA 2UYLA 4JANA 5D72L 5I15H 2VDRH 5DQDH 3P4MB 4LARL 1Y6MR 4U1LA 5DO2D 3VMPA 2AXJA 4WO4B 2I60L 4OZ4A 1I8LA 3REVA 1PZ5A 4ZXBD 2JK5B 1UM4H 3TVMB 2R2BB 3C5ZB 1UB5A 4LSVL 3CUPB 1TFHA 4IMLB 2NY5C 3NPSC 3FMGL 3HMWH 1BZ7B 3NH7H 3GBML 4UZGA 2EKJA 4L4VA 1Q94B 2BK8A 2BERA 4KHXH 3WJLC 5A43C 4C4KT 1NAMB 2DKUA 4PY7B 4LHUG 3P3YA 1A2YA 5IIEB 2HWZL 1R0AH 3OKOA 5IOPA 2P47B 3I6GB 4LKXB 2R29H 5CEXB 5EBGA 5SX5K 4DGIL 2D7TL 5JHLH 3REWB 2XQBL 1OM3H 1HKLH 2EYRB 4Y2DC 4G8GD 4R3SA 4BFIA 2DYPA 4RAVB 4G7YH 3IU4H 3L95A 1JGEA 1MCKA 3O8XA 4LCIL 5L8KB 5DJ0A 1S9XA 4MA3B 1I1AD 3GHBL 2EC9T 5CZKA 3PV6A 2Q20A 3KPOB 1JRHI 3FQXB 1NSNH 4M6OH 1I9RH 1HZHH 4MAUH 1ZVYA 4KVCL 1BEYH 4Y5YC 4MS8C 1H15A 5BOZG 5BXFA 5ICZA 4Z7QE 4PJAB 5I8EA 5BS0E 1QFWM 3KYKL 2CRYA 4PJ5E 3S35L 4XH2B 5FHAH 4NN7B 5I1DA 2AJ3A 4W68A 1OAXL 4PJAF 4P2RD 2Y36H 2JF1A 4ZPVA 5C0JA 3HI1A 3OAYK 5DK0B 3ALPA 4PV9A 1WCQA 2QADC 2W0FB 4J12A 1LNUA 4XC3L 5H35A 3D39E 3QQNA 4OTXH 5DF0A 3R06B 3SGKA 4S1DD 2R69H 3SDXF 4ETQB 3X3GL 2O61A 3IU3B 3BYTA 3MLTA 4ZOBA 1WLHA 3WXWH 3BP6A 1N4XL 5FYLH 4OCRL 5DMKB 1HK6A 5EORH 1L6ZA 1CE1L 3RWDB 4WU7B 4GG6F 5D8JH 2AV1B 3E6FB 4WNQA 1G7QB 4U6HA 1TTUA 3N85H 1NLBL 1T83C 1NFIA 4LHUD 3N50A 3MV01 5DEGB 2NXYC 3HUJA 3VH8G 5DHYA 4Q7DA 4M7LL 2V2TA 3GSOB 1Q9OB 4R7NB 4WENB 1HE7A 1H8OA 4V2CB 4ODVH 3W0WA 4IS6B 3LEXA 5LQBL 3RGVB 1IGIH 1FFPA 1B4JH 1JZ7A 3LMJL 4L3AA 4JFEB 4OD2B 4HF5H 3QXAA 1MFBH 2NY7L 4G8GE 2XZCL 1MRFL 1S7VB 3V7AE 1TJIH 4HBCL 3MSPA 5T1LA 4LVOB 3D1MC 4EN3A 5I1HL 3SGDI 2OSLA 4POZC 3O11A 2X44D 4OZHE 5ESQB 5KSAD 3K2UL 1Q9WB 2Q7YA 1MVUB 3VRLF 4QYOA 2F54A 3ARFB 3AS1A 5I1KL 3NTCL 4H26B 1PYWA 4N1CA 2OL3B 1J8HD 1NMAH 4M61B 3QHZL 4R26L 2XY2A 4M6ML 1MCPH 1A9EA 2IADA 5C0GB 2MCG1 5I1GH 5IW6B 5I1AB 3PDGA 2YD4A 4X5XA 3Q1SH 5LVEA 4HUXB 5HD8C 4WWKA 4PP2A 2YD8A 3IDGB 4HC1H 5HDLA 4F33A 1YMMD 2P5EB 4FTVD 4UT9H 3WIHL 5GS1C 5JQHC 5HDOA 4OCLC 4U6TA 4F9LC 3PGFL 5ERWB 1A47A 2ZUSA 1LK2B 1U92B 4HJ0C 5F89A 1Q9LA 4OCNC 3MROA 5SWZD 4ETYA 2GJ6A 4KRPD 2BNRD 2CRMA 4P2RE 4F7CB 4I2XB 1T66C 4U4BA 5D7JB 1WUNT 2RCSH 2XOTA 1D6VH 4NC1C 5JHDB 4UTBH 4W6XB 4X7DC 4OJFL 3TF7C 1S7UB 4LSSL 2YPKA 3T65B 3MNWA 3V2AR 2YZ1A 4QTIL 2VABA 1KYOK 5DHXB 4NKDA 4HZLB 4G8IB 4N0YH 3QI9A 4OM0L 4E0RA 4ESKA 1KCVL 5I1IL 1JFQL 3QUMH 4QHNB 5D71L 3RY6C 1LEGB 2H9GA 2UWEF 4DK6A 3WLBB 2V5TA 3K1DA 4PS4H 3ETBF 3BJ91 2EDFA 1T0NB 3BE1H 1FFOA 1X44A 4KKCD 5IUSA 3MOBL 2PYEB 2GK0B 4KUCF 3AM8A 4XTRC 5C0IA 2QHLA 1YYML 3EYQD 4P3DB 1FNFA 5DRWA 3RUGB 1RIUL 2VN4A 4RDQG 3E2HB 1SMAA 5DD6A 1AGFA 3IDJA 3U0TB 3MRCB 5JPMB 3CU7A 1C16A 2EDRA 2CDGB 2CKBL 3MUY1 4V1DD 4CADA 4D0BB 2DQJH 2V7NB 5FYJU 1K85A 1X5YA 5BVPL 5D96C 2YN5A 3GMOB 2RBLA 2WBJD 5HYQB 4M7JH 4PJXA 2NY4C 2NPLX 4X9BA 1WTGT 4X80H 1AI1L 3QQ9C 4UOJA 4PV8B 4LK4A 3WN5C 1U95A 3SCMB 4LSTL 1S5HA 4JFFD 3CMGA 4YC2B 1HNGA 1MEXL 2ATPB 3S3SA 4KPHL 3CD4A 5DJ8A 3G5ZB 5IB5A 4O9HH 4OV5A 2XWTB 2G75B 4NQCD 4JCMA 3O3BB 4ZD3H 1F3JA 4HGKC 4H20L 4KK6C 1FBIH 1KTDB 1YMME 3NZ8A 4FTVE 3DUHA 1HXYB 4CN6A 1FSKC 3PGDA 4KJPD 5F8QC 5BRZB 2MWCA 1T89A 2P24A 1DEEA 3JV6A 1OAUL 4JPIB 5FGBA 3DJ9A 4KROB 5HI4D 4NWTL 2CIIB 5I73C 3H7BA 4M1DH 5E2TL 1BVLA 3ZT7A 1MFEL 2A77L 1TQBB 3C8KB 3RVXD 5FO8A 5D70H 3UTSB 2ORBL 3BYYA 1CN4A 4PJIE 3IDMB 3OKEB 2O5XH 5HHXH 3RWGA 4ISVB 1W0WB 3SDYL 1FZMA 5EO1A 1PY4A 2C3WA 1T7YA 2WWMC 3EDFA 3Q6FB 1T1XA 1WIPA 4JM4H 4LCUB 1HOCA 4CVXA 3VFPB 1KEMH 4ONHA 3OQ3B 2CSPA 3WJLA 3MRPB 5GRUH 3NFSL 3WBDA 2C9AA 1NH6A 4QRUA 4K3HA 1T2QH 2DJSA 4QXTA 2CK2A 5LBSH 1V7NL 2Q86A 1NFDB 4Y19E 2HRLA 2VE6B 2Q3ZA 5ICXA 2X6MA 1MJ8H 4JLRB 4P2QB 3AFLA 4QXUH 1UYWH 5C0AA 5ANMB 4GBXA 4ZUUA 4F7MA 1D5ZB 3HG1A 5E8EB 3GJFH 1P2CB 1XH3B 5EZIH 1UZ6E 4EI6B 1T5XA 2VDOH 5FECB 5E6IB 3NPSB 2C7UB 3AREC 1WT5A 1OT2A 1LO3H 3BEVA 2F58H 3TO2A 4GW1B 3BGMA 2YEZA 2AJYH 4ZUSA 2V2XA 4JG0H 4HULB 3PQYA 1YEHH 2BJML 3OJDA 2XG5A 3I9GH 2F74A 4PJHB 1HH6B 4R0LA 5IV2B 3BQUA 1JGVH 1AGDB 3KPRA 4RWHA 1RIVH 4OCXH 4EI5C 3FRPG 4FOMA 4JFFE 2PR4H 1HQ4A 4Y2DB 2AVGA 2A83B 3TYGL 3D2UD 4JAMB 2DTMH 1Q0YL 4NNYB 1RHFA 3DV4A 4PGBB 4O5LH 5DRXA 4Z77A 5IP4A 2ITDB 1A1OB 5F97E 4NQCE 2DIJA 4DVBA 3RGHA 3HZKA 3RTQC 4U2ZA 3LCYA 4QHUA 4GQ9H 4TTDD 4YDIH 2E7CA 2VNCA 2IAMB 3PV7A 4G7VL 4UDTA 1MELA 4PRDB 2EH8H 4ZYKB 4YHZH 2AXFB 2AERT 5EUOA 1IKFH 1S5IL 1UWGH 1L0YA 2GSGA 5K59F 2EE3A 3VFOB 4POUB 4YDVA 3IVKB 4G80B 2ICWA 1MOEA 4FXKA 3EJJX 2NY1D 1H3VA 2ARJQ 1BFVL 3K46A 5L2JA 5T33L 4Q2ZA 2XACC 2QQKL 4U0QB 3C5SB 1BQLL 2O26U 3L5WA 4TN9A 3X14B 1VENA 3BOVA 5FYKD 5HPMA 2VLMD 1PAMA 3I75A 3OGCA 2VLKA 1SM3H 2Q6WB 1PVHA 5CP7A 1JYXA 1M7XA 1P53A 4Y5VA 4J4PC 2WLYA 3CX5K 3WKMH 1NMBL 5C0BA 3V6OC 2HVJB 4FNLL 3HRZA 5H2BB 2GITB 1YNTB 3GK8L 4HUVA 5J4MA 5FFLA 1BIIA 1DQJB 4JHZA 1TJHH 3MQIA 4PB0H 4PJEF 2Z31B 1LDPL 4X4ME 4CVWA 4YQXH 1MPAH 3QJHB 4P99A 3QPQC 1E4WH 2JJSC 4KGLA 5DLML 5F3HA 4PD4K 5A2IH 2VH5H 4IBLT 5I8OL 2A2QT 3V4VL 5ITFB 1X5GA 4NC2B 1KB5A 3U9PH 3RWCA 1RV6X 1TENA 3TN0C 1E27A 2Z8RA 5SWQB 2CMRL 4F7TB 3SDAC 5A1AA 2LFGA 3P4NB 3T0EB 5JW5B 5DTFA 1D9KA 3JWOL 3WV0A 3RNQA 4QNPE 3C9NB 1AE6L 3P0GB 4Z7WE 3VXOB 1QHOA 2FR4B 2WWKT 2L7JA 4Y89A 1QRNA 2VDLH 2NX5E 4KDTC 1ZLVK 3KPSD 1UCBL 4Q9RL 3HE6D 5GSVA 1ZLVH 4K71B 4GKSB 3O6FA 1K8IA 3SGEH 1VPOH 4G8FB 3GIZH 4GRLC 1FG2B 1PQZB 2NTFB 4DOHE 5D5MF 2Q8AL 1A6UH 5ADPL 3HC3H 1KJ2L 1NC2B 4UUJB 3SGJA 1WBYB 5EZLB 3IXAA 3SKOA 3VG0H 1EAJA 4HS3B 5B38B 6FABL 3DV6A 3MRLA 3QDHA 1BZ9B 1FLRH 4KTYA 3WUWB 5IVZB 3MACH 5KVMC 1V05A 5KJRH 4IRSD 1MWAH 3IJSB 2LTQB 5DDHA 4LFHD 1YPZF 3KPNB 2BMKB 1GAFL 5FYJL 3VA6A 5EU4A 1G6RH 4QRPB 4N9GA 1RZ7H 2EEAA 1OF2B 1KJ3L 4G6AC 1MHEA 5J3HC 3FOMA 5JOFB 3RY6A 5T5FL 3QAZB 4LLMB 4XPGL 5FO7B 3DROA 3H6JA 4RAHA 3DXAA 2ZUWA 1EFXA 1V7MH 4KTDL 3VFSB 5FYKE 3PWLA 4QF1B 2VLME 1PDKA 4WFFD 5IB1B 4WEMB 3E0GA 5KW9H 1G7HA 2ILLA 1P4IH 3PNWB 1ZKAA 2IGFL 1CTOA 3DOSA 4NZTH 3BP5B 5CCKH 4Y4HD 1OQXA 1SBBA 3WSQL 2L0DA 3QPXL 4PRIB 2P4AB 3WDHA 1F00I 3JV4B 1JYVA 5GGVL 1CDCA 2DS4A 2XZZA 1XGRA 2F5BH 1WFNA 1U6AL 5FK9A 5GSRA 5C0FA 2WIIB 1A5FL 1LD9B 4XCCL 3ULUL 1KPRB 2HYMA 3S34L 3QIUC 4YFEA 3CVIL 1U3HC 4S1SH 1LO4H 3R4DA 4AEHH 4LEOB 5IHZA 2Z8VC 5CEYA 5T1KA 4MJIB 4YGVB 1MIMH 1XF5B 4K8RC 3KXFB 4OBRA 5BOPA 3MREB 2VQTA 1LVEA 2IAND 2A6DA 5GISL 1GRWA 3PE9A 4Y1AD 2LU4A 3OGOE 4ZAKC 2ZUVA 3VXRA 3V6FA 1MFNA 1WWBX 1NCWH 5D96B 2V17H 4MSWB 5IMLA 1M4KA 5DJAA 3O6LL 3TNNA 5FDWB 1FO0L 5CSZB 1S9YB 2J7LA 4UDUB 1KT2B 3ABZA 4M5YL 4NQDD 4WWID 2EZ0D 2FJGA 1KYOJ 5IFAH 3WN5B 3GGWA 4K3JH 1ZMYA 4JPKL 2HFEB 1Q0XL 4ZFGL 2PCPB 3RZWA 3MRQB 2GW5A 3B83A 3MV7D 4C56A 4OI9A 3H9ZA 3LS4L 1CQYA 5IROC 1G0DA 2I9TB 3FB7A 4YDLC 5DZOA 3LKPB 3V7MA 1JV5A 3GMNB 4OZIF 4LP5A 3IFPB 4KI5C 4BQBA 5CINL 1ZHKA 5LAXA 4Q6IC 1FSKB 2FJHA 2GYSA 4ZO7A 5EU7E 5TF1L 1F13A 4FZ8L 4P9MH 1NUDA 5HHQA 2F53A 3TBSB 4OIIL 1AGEA 5ACZB 3K1KC 1H8SA 3ET9F 4OZGF 4AQ1B 4HS6A 2VDQL 3OX8A 5HTSA 5DWUL 4WFFE 3BAEL 2W65B 3QUYB 3CH1B 1HQRA 1IZKA 5F7YC 5TDPA 1IEBA 3VFUA 2A1WL 4M3KB 1F90H 2DBLH 3UDWC 4U1IA 3OV6A 5FV2A 5I2IA 4JPWL 2R2HA 4JZJC 5ILTH 1RZFL 2BY1A 4GUPA 4OT1L 4P5KA 3V52L 2KH2B 1MQ8A 1JPSL 4I13B 4M62L 5BVJA 1C5CL 5HGAA 2W1NA 2GCYB 1A6WL 1FZJB 1YNLH 1ZV5A 5LJYH 3WXVL 1JGUL 5FV1L 5SV4A 1NBYA 3DIFA 4HH8A 4DN4L 5IBLD 5JORA 3T2NL 1VEOA 3K7UA 3BWUC 3RDTC 1HCVA 3BEWA 4M48H 4KK5C 4U1SB 5F7DB 1I7UA 1YEDA 4ZSOB 3CFJA 4N0CD 5CSGA 3UTPD 2IANE 3U7YH 3R0NA 4L4VD 3SOBH 3C60C 2X4UB 4X5LA 4Y1AE 3V5HB 1HHGA 3E3QE 2B8OT 1FQ9C 2BVQA 1OVZA 5FUOL 5D1QC 3FT3B 3QWOB 4KC3B 4PRHE 4I18A 3RWJB 5EBMB 3LKSB 1JHLL 2CIKB 1MFCL 3B5GA 1BOGB 3EYUL 3RWHB 5D7IF 5HVHC 1E6JH 4JY4A 1RUAL 3SJVA 3VI3E 1K4CB 4YHYB 5EU3A 2FO4A 1M6OA 3CX2A 1I1YA 2XI9A 4ODWA 4R4BA 1Z6JT 2AEPH 2AJUH 1A22B 1U93A 5AYUH 3MV7E 1DQMH 5IJKA 3NOIA 1R24A 1IEHA 3LQZB 5E08H 3WLWD 4CMMA 4NKOB 3VGDA 3D69B 5D2NA 4MHHG 3A6BL 3RTQB 3MR9B 4UBDC 4FQIL 1JPFA 1HI6B 4OLYL 3BD5A 3MCLL 4MD4B 3C2SA 2WUCL 1DBKH 3K81A 2VIRB 4ZS6D 1XR9A 2VKXA 1HEZA 4LHJB 1N59A 3V6OA 3NN8B 5I74C 5KVEL 5CHNA 4JREC 1N6QL 4MLSA 3OXSB 4XVTL 1P7QB 2ARJA 2NY3B 3AAZB 4NKIL 5F88B 2VERN 3TT3H 5F7MC 4NIKB 5ABDE 3BW9B 3TFKC 5E2UL 3B9KC 4LNRB 5C6TL 2X4PB 2UZIH 4NQXA 2JJSA 2P8LA 4LCWB 3QNZA 1CWVA 1JGLH 1A0QL 3G6JE 2ADGA 4L1HA 3ARDB 5BW7A 4X0KA 3SKNA 3B43A 3IKCA 3QCUL 3KS0J 3SDAA 4S2SB 1GGIH 1R5IB 2IPKA 1U58A 3MJ9H 1CR9L 3KLHC 1C12B 4JJ5A 4XNYH 1NLDH 4HWEL 1AO7A 4NM8H 2R4RH 2PYFB 4KDTA 3M1BA 2EXYC 3BVNA 3TBWB 3UTPE 2C1OA 1BPVA 1OGAB 4XGZB 3UC0H 4DK3A 2Z4QA 4XP4H 4FQHB 1J05B 3NABH 1INEH 4BQ8A 4WGWB 5IT2L 1NCDH 4JDVB 2FIKB 4X6FA 1CGSH 5IM7A 2D9CA 1UA6L 2LAAA 2HH0H 4YHOH 3T1FB 4OCSL 3W0WD 2R4SL 2CLVA 1U0QA 3ULVF 4L8SA 4U1GC 3OKLA 3L3IA 5E70A 2D03H 4LIQL 4NO2B 1LMKA 3AGVA 5JDSA 1AD0A 4UQ2B 3VDBA 3GKWL 2BNQB 3MJ6A 1IRAY 5FUZH 1QRKA 1CLOH 1KFAH 3T4AB 1HHHB 2JB5L 32C2A 5T3ZL 2I27N 5F7NC 4EN3D 3VJ6A 3WJJC 1J0YA 4TUKH 3THML 3VCLB 1JZ8A 3GMRA 4OFYA 4Y16C 5T5NG 4ERSL 2BNUB 2A9NL 2F54D 1BBJA 3CX5J 1Y6KR 3OJMB 5C0DA 4QT5A 3TCXA 4LAQL 1BQHB 1RIHH 4G9FB 4WFED 1WWCA 1I9JH 1Q1JH 2C1PB 4W4OA 5IESH 5HYSA 4P4KC 2XXMB 1JWSA 4HFUH 3RKDC 2C5DC 4YHLH 2ICEB 1GPOL 3FKUS 4NRZA 4WWKD 3D85A 2DOCA 3A67H 1H3PL 2WZPD 1A7BA 1DUZB 3U7WL 1NAMH 1PJ9A 2HTKD 5I6XC 3OAZK 1CXFA 2VXQH 2JIXA 4FQQB 4OBSA 4PY8J 5CD3A 4PD4J 4X6DA 3VFNA 2GJ6D 5D1ZB 4GH7B 4PG2C 4GFTB 4LEXH 3S5LB 4NKMB 3S37H 2Y25A 3O2VL 2BY3A 4HKXA 1HYSD 5C0RH 4X9GA 3IB4A 5IJVB 4DEPC 5KSVA 1BX2B 1FIGL 1MCOH 4PRBB 3UBXB 3PWVA 5CD5D 1KBGH 2BSSB 3BIBX 1JL8A 4YJZL 3HAEA 3JWOC 4D8PA 3B5HA 1AIFA 4FFYL 4S0SD 1FIEA 3IFOB 4L9LB 3QI9D 3HNSH 3OF6A 4YAQA 3QCTH 1I3RB 1CF8L 1JVKA 1ZT7B 1IC4L 3HMXH 3B6SB 4YO0A 3QXTA 1ZK9A 2FWOA 1VFAA 3QRGL 2VDKH 4U1HA 4LSQH 2EKSB 4JKPL 3QIUB 5J11C 3LKRB 4ZTOL 2GSIB 2Q1EA 4K3DL 2Z9TA 4LPTA 1C7SA 1NPUA 1CFQB 1GC1H 2HFGH 3W0WE 3S98A 4NJAL 1DQQB 4WO4A 3V5DB 4KJYA 3UPCA 2R2BA 4FG6D 4O02H 3PABB 4YHNB 5KS9B 3BIKB 2PO6A 4JFXB 4ZAKB 1XCQA 4UNVA 1RUKH 2V9TA 1ONQA 5DURD 4PLNC 5FM4A 1Q94A 4LCCC 3EO1A 4JKKA 1X4YA 3BP4B 5GJTL 4ZFZA 2F54E 1H3TA 3EAKA 5T1DL 4WFEE 3OZ9H 1YEJH 5D7KD 1MFAL 1RVFL 4LKXA 3KWWB 4PGDB 5CEXA 3MO1A 4JHAL 3QIBC 1FL3B 2GTZA 2EYRA 3NAAH 1VGKA 4GXVH 2QQQA 4O58H 4RAVA 3GIVB 1FGNL 1EGJL 4OIAA 1T1YA 1WIOA 4JZJA 2ZUUA 4LRNL 1CLZL 5DD3L 2B1HH 4YDLB 2EDLA 3LQMA 2AJVH 4RNRB 4L3EB 3ES6B 5FUCE 4Q6IB 4YHML 3ULUC 1BMGA 5LGJA 2DDQL 2ZUYA 2EXWC 4OQTL 4RGOH 1OD7A 3IYLW 4LLUB 1MNUL 3X13B 3FQNB 1IL1A 4M9PA 4PRNA 1CT8A 1XCTB 5EFIB 2YXFA 1BP3B 5IBTH 1N8ZB 5DR5H 3ZDZE 1BD2B 4Y4FB 3L3OA 3UPRA 4NJ9H 2E6PA 4JVUA 3RDTA 4QEGA 5EOQH 2FEDC 2Y06H 4PJAA 4U3HA 3LAFA 1T7ZA 4N90D 3TT1L 1UXSA 2OL3H 1DBMH 2CKBB 2BOCB 3RBSA 1ZA3A 3J8F7 1B0RB 3Q5OA 1A4KA 5C0CD 2IH1B 3DO3A 4CMHC 5K9QI 3E6HA 5DK0A 2LU3A 3EDEA 4M8QA 3K4ZA 4O4YH 1JZ3A 4LVHB 3FHQA 3HLAA 1GL4B 1RZGA 3EFDH 1F3RB 5I30H 2IQAB 3SDXA 3IAGC 4C58B 4P57B 4AY0A 2FCBA 2GT9B 2Y6SD 1BVZA 5C0AD 1N7MH 3EO9L 5J13C 3HG1D 2R0ZL 3GM0A 2JJVA 3LEYH 4DUXA 3BKJH 3MRBA 3WNKA 2DI7A 4JRYE 4U1KA 2D7PA 3JWDL 1WTLA 3MBEC 5E8NA 4GG6A 5F7UA 3ULSA 3MRNA 3G5XA 1X5JA 3UX9B 5F7FA 2GEEA 3QHTC 3P4OB 4WI9A 1CK0H 2DMCA 5E2VH 2QSQA 1NAKH 2MOVA 4MYWB 4FZEL 4OB5L 4BYHA 5E6YA 2H2SD 4BSWB 3PQYD 5CZVH 3VD7A 5D1QB 3BUYB 5DEGA 4PJXE 2BDNH 4HWBL 3EZJB 4OFKA 4MS8D 3BQUD 3KPRD 3C6LC 2COQA 4YX2L 4KDVA 3W9DB 1LEKA 1A14H 2FGZA 3AS2A 4IS6A 1JWUA 5D7KE 2G60L 5DMYA 2DMBA 2MPAL 1ZAGA 1I8KA 1MI5E 1MLCB 4RMVA 1CFVL 4XPAL 4JO2H 1G7MA 1S7VA 2VAJA 1G9NL 4G42B 1N6UA 3IDUA 3PXHA 1HINH 1ZTXH 3PUCA 2QADD 2B1AH 1T3FA 5ESQA 3EJZC 4XVSL 5GRVK 2Z0BA 3UYRL 3F65A 1HSBA 1DQLH 4LOUD 1RK1A 3INUH 3CCHB 4K7FB 3V0VB 3ARVA 4M61A 1I4FA 4XX1E 5B39B 1P4BH 2IC2A 5SWSA 2PN5A 4JREB 1R3LA 1NEZA 4HUXA 3MLXL 4NCDA 2R0KH 4JGUA 3BESR 4K7PH 4C55A 5CWSB 5DK3A 4ZFOB 4N90E 2I07A 3B9KB 5L2KB 1U91A 1BECA 2C3XA 2NXYD 1J87A 3SDCA 3H3PH 1A9BB 4OD1L 2M8XA 2VDNL 3QT2A 3OAUH 5D7JA 3SQOL 1KN2L 3VXNB 1W72L 4L4TB 1F02I 5TE7H 3G9VA 4WTXA 4QRRE 3OKKB 4NZUL 2BY0A 1YN7A 3OG4B 3WL9B 3O3AA 1CS6A 2X7LA 1JUFB 1S7UA 5IHBA 1T1WB 2CLRA 1F11B 1LO0L 2FX7L 1T4KA 5C0AE 5JLZB 2OJZL 4IEFB 3HG1E 3L3DB 2ZSWA 4GXUM 3RWFB 5T1MB 3DTXA 4POZD 2L7UA 1X5AA 2UWEA 4MA1C 1S7WA 4E42A 1LEGA 2FD6L 2EIDA 4Q0XH 1ZA6B 7FABH 3WLBA 1CZ8L 3JUZA 2A6KA 4HUKB 1A7OH 3DX9B 5JZ7C 3PQYE 1UWEH 1DFBH 1EEUA 1D9KD 2EDKA 4GRMA 5DEFA 5C2UB 4PY8I 5DYOB 5HD8D 4PGEA 3GBNH 5EC2B 5JUEL 2XRAL 1MAKA 5CIPH 1QLRB 3GNMH 3O6ML 3ZSTA 2XNAB 1QRND 1CLCA 1YUHB 2PETA 5HHVH 2VMFA 4HJ0D 4KHTH 2DWEB 1QA9A 4D0BA 2F19H 1FNSH 1MCFA 3S9DB 3O6FD 2NR6C 1ZVSB 2WLZA 1UACL 4JQIL 4MWFA 1NCUA 5C2BL 4Y16B 3HFMH 3D9AL 5IG7B 3AXLB 5MEOB 5AZEH 5JQ6L 1NCAL 1YDPA 2J1KA 3VWJC 4J8RB 2O5ZL 3NFPB 3TLRA 4TOYH 4E5XB 2C4FT 2EDDA 4PV8A 5DUPL 3ILPB 4WHCA 1S9KC 4Z7UB 5HDBF 3SCMA 3FONB 4P23C 1EEYB 3KAAA 2FL5B 2ATPA 5EUOE 5F1NB 4WHTA 4H1LA 3KYNB 3IJYB 1OP5H 4K23L 3W9EB 2XWTA 5I6XB 2G75A 5GRZA 5FYKU 4XXCC 1QBMH 3BP7B 1P7KB 4BKLA 1PEZA 1R5VA 2XZQL 1P5UA 4RA0C 4AH2A 5DUBA 1HXYA 3TIEA 3DXAD 2WWKO 4B41A 1IT9H 1EFXD 5I9QC 1KGCE 2G5BA 5HGDA 5CILH 1Y18B 3HE7C 2VLKE 4MX7A 4ZDHA 1KJ2A 5SX4I 5E24E 2QLVB 1PG7W 5IF0A 1HIMH 2EDQA 5HY9B 5C0BE 3EYFB 1CTNA 3IDMA 1QSFB 1J86A 1UGNA 5IB3A 3PHOB 2H26A 3NCJH 1CYGA 3HA0A 4DZ8A 1S3KL 2QSCH 1FJ1A 2M1KA 4NKQB 4OFVA 2H32B 1FFNA 3MV9B 1VDGA 3OBAA 5HYJA 4FP8H 1JCKA 4I48B 3VFPA 2VITA 3PP4H 4HX1A 4JGJA 2AK4A 2NY4D 4PLJC 3FOLA 4HDIB 4G6JL 4M03A 4XCNB 4ODBD 5KG9B 3MRPA 3QQ9D 2GHWB 1XAUA 3CAFA 4I3GA 3T0BA 3UP1A 1I7ZB 4FQXC 5T1KD 4LVNC 3HI6H 1FNLA 3BZEB 2OJEA 5TPWL 3QIBA 1BZQK 2H8PB 3FB8B 3ZE1E 2J5LC 3MRKB 1G0YR 4KK6D 1EJ6A 2NY0B 1I3UA 1U8OA 4GMSL 1QRNE 1RUQL 4EI6A 1V5JA 3TYFB 4I77L 3AU1A 5E6IA 1ZLUK 2C7UA 3OJVC 1RHHB 3EKCA 4OLXH 5IQ7L 1ZLUH 4FXGA 1FH5L 4L8CB 3QG6B 4LCCB 4JY5L 2X4SA 3BZ4B 4MD5B 3VD3A 3GSNL 5HVFB 1C08B 3QFJA 2DIAA 2BVYA 4OGXL 2EH7L 1HH6A 2DQUL 2HVKA 3QDMA 4WI3A 2BCKB 4QXWA 4WW2B 2WWMD 5EWIL 3B2VL 2IQ9H 5D7LB 1KCRL 4EBQL 5IQ9A 5A16B 4D3CH 2BZDA 4WW2F 3QZWA 1F58H 2EDWA 4AMKH 4UB0L 5MP6H 4NNYA 4NPYB 5LCVL 5CUSL 1ZHNB 2ITDA 3DI3B 4PRPB 1Q9KA 4YXLH 3BKYL 5L7XL 2WM0A 5HYEA 1AQKH 2DQIH 1PG7H 5IFHH 1FE8H 2F53D 3TO4C 3O4OC 3DXAE 4KVNH 2IAMA 4LSRL 4NT6A 4LCYB 3P9LB 4HXAL 3BKCL 4PIRF 4F15C 3IDYC 3S36X 4IJ3C 4R7DB 1AQDA 4Z95H 3BRFA 3EFFB 4R4FH 4TRPH 5I76B 1EHLL 2VR4A 2AXFA 3P30L 3I50L 5J12C 3OR7B 1U8QB 3PL6B 4AG4H 3VRIB 3IVKA 4RZCB 5TE4L 1W0VA 3MBEA 4QXGL 5ADOH 3ARED 1GGBL 3QEUB 5F7LB 1YECL 5LGHL 4U2YA 3Q2CA 1Q38A 4X6CB 1BQSA 1KSRA 4YK4C 3O2DH 4LP4A 4YHKL 3WFDL 5J6GA 5JA9A 5I8CB 1PG7X 1Z5LA 3QISA 4ZMAT 1OOAA 1YY9C 2HVJA 1AH1A 5H2BA 5ALCL 2QKIA 2XTJD 5EH1A 3BKML 3D0LA 5CBEA 1EX0A 3RZCB 4PJEA 3V4UH 3X3FL 2QR0A 3U4EB 5E8PB 2IG2L 3WO3B 5F96H 1RUPL 2MJWA 2Z31A 1QFWI 3S4SA 3VDCA 3UO1H 3VXRE 1YEKH 4YDKL 4JO4L 1DVFC 1VKXB 5IK3B 2IPUK 3SKMB 3FAWA 1FZKA 2XIDA 1ZLSH 1DN0B 1FG9C 4RMQA 5ITFA 1TJGL 5D7SH 1MY7A 4Y5XC 3FT4A 4YFLF 3BDYL 4ZOEA 2XWJA 3P9WB 4MAYC 5DQ9B 3AB0C 3F7PC 3PWJA 3SJVD 5SWQA 1YMHB 3O81A 3C6LB 3P4NA 4OD3H 2QEJA 2BRRH 2JELH 3O45B 1NGQL 2BSRB 3HKFA 4UIKH 3C9NA 2WQ8A 5E56A 4C56E 3VXOA 2VLRA 1XZ0B 2AQ3A 2Z93B 4RGNB 4FABH 1UVQA 1G84A 2XZAL 4ODTL 4S1RH 3S5LG 1D5BB 2CK0L 2F5AL 3WEXB 2DQTL 2GAZB 5D5MA 1I9EA 4I0PA 4N9OB 5J6HA 4GOSA 1EERB 3FTGB 1G9ML 1EVUA 3DYMA 2F53E 2VZUA 2J6EH 2DF3A 1NC2A 3UBXG 3E1F1 4RAUB 4XP5L 5B38A 2FGWH 3ZL4H 2NW3A 4M6NH 3RVWC 3UZVB 1YJDL 2BOBA 3WUWA 1YPZA 1OLZA 1OAKL 1KCLA 2CJUL 1G7LB 2NY2C 3H42L 4UOW1 5E03A 1X7QB 1D5XB 4Z6AT 3JWDC 4XBEL 2BMKA 5KSBF 5HI3C 4QRPA 5DSCA 3QPQD 5E99L 3DYOA 5TDNB 4M1GH 2F9BT 5DHVB 4OZFB 1CFTA 3V6BR 5HGGS 5JOFA 1XF1A 1KCSH 5GGRA 5DUML 1PGRB 1BVKB 1ZANL 4O00A 1JHKH 3MGOA 3ARGA 4F37K 3TN0D 1WZ1L 3FO2A 3QUZA 5ENWA 1EJOH 4ZO8A 3SDAD 4FMFA 4Q9CA 4ZG1A 3CVHL 4LMQE 3UYOD 3MGTB 3FO0L 4L8BA 4Q9QL 3PNWA 4UAOB 1EO8H 3VA2C 3CDGA 3BP5A 1IKNC 4JR9L 4LASL 1AO7D 3NCBB 1C5DA 5FYKL 1J0ZA 2XTJE 1XGYH 3MV11 4Z18A 1G9NC 3JV4A 1DSFL 4PP1C 4DVRH 2B4CL 1RJLA 4APQB 4OCWL 3H9SB 4GRLD 3O2WH 1P1ZB 1QBBA 1N5YL 3JZ7A 1KPUB 2WIIA 1LD9A 2J2ZA 1ZT4B 4LPXA 1KPRA 3SE3A 2CKNA 2W0PA 1WBZB 1QSVA 5DS8A 3MV8B 1AHWC 5MI0B 4M7KH 1D5IL 1DBJH 5E94B 3CSYA 2H1PL 4P23A 3P9MA 1CIDA 5GGTA 3SJVE 4QOKD 4MJIA 1YA5A 2FJFB 1M05A 1XF5A 3KXFA 4G6AD 4Z78B 1KTLB 3ZYIA 5J3HD 2YPLB 4RMRA 1GZQA 3QWRA 4XXCA 1W8OA 4XNZB 2ZSVB 3QFDA 2DICA 2J8UB 5CJ8A 2Z92B 4S1QL 1AY1H 5D2NE 1TCRA 1IEAB 4CKVX 4I3RL 3BZFA 4MZ2A 3HE7A 1BFSA 4FQLL 4BSVB 4KJWD 1IC7H 2OI9C 1R5WB 3TA3A 3TC9A 1KT2A 4TPRL 1E4XI 4G6FD 5JXEC 1F2XK 3V6OE 5IWLA 1QFWL 1OTSD 4KKLC 4RWYH 4WJ5A 5CJBA 1FVEB 2ADFH 1BFOA 3IAPA 2PCPA 1DQDH 1JJUA 3MRQA 4LF3A 2X1XR 4OZIA 2R0LL 2NY6C 4MXWL 4LSUH 1FORL 4M7ZC 1JTPA 5JW4N 4NQSB 3LKPA 3T8XA 1HHJA 1MIEH 4JQXC 3GMNA 4WUUA 3UJIL 3IFPA 5C09A 3ROLA 1NMCB 1DBBH 3F58L 1RZ8B 1IAIH 4I9WD 1NCCL 1U3HD 3MRRB 4KZDH 4OZGA 3QUKA 4GG8A 5L6YH 2Y72A 3EYSH 4HQQL 3FFDB 3QQ4A 1RULH 5CEZH 3BFOA 1TMCB 5DXWA 2W65A 1JNNL 1XF4B 3WFBL 1YEIL 3OF6D 4UINH 4ELKA 3CDCA 3T4YA 1UJ3B 1KENH 4M8VA 4HKJA 3QNYA 3OKMA 4U7SA 2OZ4L 3KPQB 4K94C 3ZHLA 1HHIA 4NNXA 5D72H 1N2RA 1AO7E 4Z8FL 1IAMA 3FFCB 3IRZA 4HS8H 1H0DB 3QDGD 3N0PB 4F7EB 1YY8B 4LU5L 3MA9L 4LVEA 5GS0H 5CJXC 1ADQA 3W39B 2MQCA 2I60H 3DURB 4IOFC 2VDMH 4TQEL 4LSVH 4YNYB 3SE8L 3QDAA 2XY1A 2W9DL 3EYVB 5L88L 4FQXB 1FGVL 3GBMH 2H6PB 4TTGA 3QH3A 1P84K 5FA3A 3UTZB 3KPPB 2LQRA 4JFQB 5GQBA 5KSAC 4GMTL 5F7DA 2AK1L 4QGTA 3I6LD 1WZLA 1A6TA 1FNAA 1I3GH 2J5LB 2PO6D 3F6IA 4ZSOA 3AVEA 4S11A 4BH7A 2HWZH 12E8L 3DUUB 5D2LB 3OTTA 2DKSA 4DGIH 2D7TH 4PJ7F 1DUYB 3V5HA 2XQBH 2EYTA 3BXNB 1FAIH 1S7QA 4PJDB 2D7MA 2NTSP 3DVFA 4JN1L 3QWOA 5KZCB 5D7IA 4PJDF 3LKSA 4Z9KB 4EUPB 3DMMC 4OLZH 3GUTB 3MCKA 2VLLB 5B39G 5F7HA 4A6YL 2XN9D 1GIGL 1MHPL 2RFXB 5DZNA 4KRPC 1N3NB 1EZVY 2N56A 2X70A 2OR7A 4OGZA 5TH2A 2PXYB 1YYLH 5DT1L 2GY5A 4L5FL 2OYPA 4X6DE 4MD0B 2E7BA 2J88L 2ESVB 3BD4A 3GO1H 1QFHA 4NKOA 1F4YL 1HYRC 4ODXB 1UKQA 5GZOC 1ZHLB 2YZ8A 4J3SA 3O4OB 4XC1L 2EDNA 1D6EB 1F4WL 1S7RA 1CICA 1OAXH 1PBYA 1BM3L 3UTTB 4F15B 3NN8A 3RDTD 4QRTA 2OR9L 3QNXB 3NZHH 4PG9B 3AAZA 5J12B 1NEZG 4M93C 5IW1B 1P9MC 3GSXA 2D0GA 1X4XA 3TZVC 4AIZA 1GGCL 3C60D 1EMTL 1WC7A 4CRPA 3JTTB 2XV6B 4KKCC 3VXQA 4GRWE 2ICWJ 1RK0B 1ULVA 1E4XL 1JYWA 3OMZA 1A3LL 1A3RL 4YIQB 4CJ0A 3OXRB 4HIHB 1VACB 3WHXA 3TIDA 4YHIB 3GI9L 3MX0A 1CXHA 4Y5XA 4OUOA 2AEQL 4HIJB 3ARDA 4C83B 4BZYA 5DJ6B 2XPGB 2V7HB 5F71A 2HFTA 1NLBH 5FDYA 5JW3L 1SY6H 3C09C 2V5YA 3WCYA 4M7LH 1OTUD 1OCWH 4ZNEE 2ZCLL 4W4NA 5B21A 3QA3B 4J3OC 1ACYL 2CO6B 3HR5A 1MFDL 3P77B 5LQBH 1HN1A 5IEKB 3MA7A 4XGZA 3F7RA 3LMJH 3CFDB 5HGBB 4HK0B 1FVDB 2GY7B 2NY7H 4X7TA 2FIKA 4GW5B 2XZCH 2E7MA 1MRFH 4RIRA 5F7EH 5I66B 1FYTB 1J0IA 1UKTA 2FHBA 4J1UB 5I1HH 1G7IB 5K9OA 5IMMA 1PFCA 4E41A 4M02A 5E1HB 4UQ2A 3ZYOA 2FEEI 2VSCA 3Q48A 3RU8L 3NTCH 4P5TB 4ENEC 4YPGB 4R26H 4XP6H 1LEIA 3CNKA 1RZJL 1XR8A 2R1WA 3L3GB 4F8QA 3F5WB 4PTUB 2UV3A 4K8RH 3WO4C 1IGYA 1BQHA 1OPGL 4G9FA 4PJ5B 4PYGA 3WIHH 4OAWA 3SDDB 2C1PA 4BZ2H 1GZPA 1REIA 5SWSD 3WIFA 3LN9A 3MOAH 2VXUL 5TDOB 3SQBA 5GGVY 4LKCA 4MCZB 2IF7A 4NZRH 1I9IL 1O7SA 2NY2B 1KN4L 4LSDA 4ODSH 5I1CL 5IMOB 1MF2L 2EXYD 2JKXA 1A1MB 4PJAE 4M4RA 1UC6A 3GEWB 4LSSH 5HHPB 4O2CA 3SDCD 3UPAA 3MOQA 4XP9L 1HWGB 1P6AB 2OTPA 4ONOA 2FZ3B 3MBXL 4NQEA 5JO5B 1JRHH 4OM0H 4X4YB 4ZXBB 1AR2A 4C54A 1KCVH 4Z5RB 1JFQH 3SDXE 5D71H 4RFNB 2Z91B 2X1OA 5LXGL 3V6ZB 5JDJA 5HBBA 2VDRL 4JFDD 4L9LA 5E0QA 3TBTA 2E27L 2FNBA 1QD0A 1UJTA 1UM4L 1MH5B 1I3RA 4GG6E 3O9WC 1W0YT 3RA7H 3EW3B 2VXTL 3HMWL 4BQ9A 1NGWB 3NH7L 4AM0B 1RIUH 1ZVHA 5C08A 1W72A 2VYRE 4KUCD 3LRSA 3OHXB 1G9MC 3RKDD 3BN9C 4X6EB 5TQ0L 2CKBH 4D0DB 2G9HA 3LIZL 2UUDK 5JXEA 3BRDA 1AHWB 4N8PA 3FO9A 2FBJL 3VGHA 2UUDH 1YJDC 5A2JH 4N8CL 5KVFH 5EBLB 1JGDA 2R29L 1IGML 4OZHB 1I1AB 1HKLL 1T04B 3QDJA 1CVSC 4G7YL 1ZGLB 4YHNA 3PABA 5IHLB 5ISZD 4LSTH 3LSOB 3MNVB 5L8JB 1MEXH 4KPHH 4WI4A 5BCAA 1A6VL 5IR1A 5CSBA 2YC1B 3C08L 3BP4A 3HPLB 4KRLB 4GKOA 3IAQA 1OLLA 2OI9B 4R9HA 4H20H 1HZHL 1NGXB 3SKJL 2R39A 4XZUB 3V5KA 3DBXB 4JPVH 4XHJD 3L7FB 2I5YL 2NMSA 3KWWA 1JNLL 3B5TA 4P2RB 4XNXL 5SWSE 2UVFA 1WFOA 5C9JB 3AS3A 2W38A 3LD8C 1KUMA 2R1YA 3QZWG 5E2TH 3DGGA 5E5MB 1MFEH 4N5UA 1R3KA 5FHAL 2GQHA 3GSVB 4QGYA 1RZKH 1JMXA 5ELIA 1TVHB 1ODAA 2YA2A 1HDMB 5CJXA 2P42B 2KDGA 5IBUB 3SDYH 4RNRA 3ES6A 3SGDH 4JQVC 4TSAH 1YEFH 2FBOJ 1WFTA 1QTYT 3X13A 1NFKA 3FQNA 2NXZD 2ZG3A 3N1FC 4CNIB 3GMMB 4HGMA 2DQCL 5GJSH 3AY4C 5FCUL 3QXWA 1BD2A 4Y4FA 3BPLB 3IS0X 1CG9B 1I7RA 1YEEL 4LHUB 4DKEL 4AEIH 5HYJD 3HPJB 3WXWL 1YNKL 5C70A 2BOCA 2AK4D 3HRPA 2UWEE 4NOBA 3LV3B 3ECBB 3EGSA 5EUOF 3N85L 2VLJA 3MXWL 4F2MB 5JA8B 2HKHL 4LHQB 5I1LA 1TZIB 4L29B 4ORGA 1MCWM 4JG1H 3JV5A 3FO1A 1T21A 2PYEE 2AJSH 3GB7A 4P57A 3QIBD 4ODVL 3NA4A 4PTTA 1K4DB 3P2TA 4JEGB 4Y4KC 1MCJA 3RUGE 1CXEA 3GSRA 4LLYA 4NQVA 4TVSa 5KSAB 4R4NC 1B9ZA 3LKNA 2J8OA 2B5IC 1IGJB 5E6ID 1JN6B 4KY1L 4UT7H 2IALB 3ARSA 1J8HB 3P4OA 3S4SG 1HSAA 3RVUD 2E9WA 2EXWD 5AD0A 4H0IA 3HS0B 4X7CC 1GHFH 1CDUA 3DX8B 2D31B 3VFWA 3QFJD 3MFFB 3WFHB 3QDMD 1YMMB 4FTVB 1V8HA 1BJ1H 1NMAL 1Z0MA 4F7PB 2X5PA 4NDMB 5EU7C 1X9QA 4WV1B 5DJDB 5F70A 5SWZB 3Q1SL 2ICWI 4KRPB 2BNRB 1A6ZB 3TZVA 4X4XB 4HC1L 4UI2A 3OB8A 2IPTL 4OZFG 1S7XB 3M17B 2R23B 4G42A 3KJ6H 1J0HA 1CBVL 1S5IH 4U6VL 4UIMA 5IMKB 5A40E 1LE5A 1EO7A 1ND0B 3R0MA 1J1OL 4Y4HC 1D6VL 2BSTB 5EIVA 1I1FA 1P84J 1BFVH 3VW3L 3HCVB 3N9GH 4UTBL 5EC1A 5GRXG 1MRDL 4X99A 2QQKH 1BQLH 1FNGB 1U2HA 2CLZB 2AI0H 3MBED 1INQB 4PUBL 5CJQL 5A2KH 3OB0K 2R1XA 3AS0A 1IE5A 3CFBA 4N0YL 1KELL 4J23A 4DZBB 5HYJE 4XCEB 4FNLH 1DE4B 2DAVA 1T20B 3QUML 3P4LA 3NCFB 4HUUB 5F9OL 3ZMRA 3FN0L 5DRNB 2RJMA 1B3JA 2YXMA 3VXTA 3BE1L 4ZO6A 3E3QC 4V1DB 2APXA 5DLMH 2JCCF 1J7VR 2F8VA 2WK2A 1NC4D 5I8OH 3V4VH 1ED3B 2WUBL 2WBJB 3C09B 4CVUA 3TV3L 1XF3B 5BQ7A 2VXSL 2KUTA 2CMRH 4KH2A 1EZVX 3GHEL 9CGTA 1X5IA 4NGHL 3QIWC 2EZ0C 2HT4D 2OTUA 1VFBA 3JWOH 3EOYG 3ILQD 4LPYA 4JFFB 1WVZA 3QEQA 1AE6H 2ED8A 4MZ3A 4TSCL 4WTZG 4M7JL 1B2WL 1JWMB 4JFPB 2YPVH 2H32H 4L8DB 3QFJE 4NQCB 1UCBH 1TQCB 4IHOA 4AL8L 4Q9RH 1XGQB 3GZKA 3KR3L 4V2BA 3LZFH 4ODHL 5DYOA 3QDME 5T3XH 2EDBA 2VLRD 3VFGL 5B8CC 2XNAA 2Q8AH 1XF2B 4PJBF 4LLVB 5KVGL 3NCEB 2UY7A 2YK1L 5ID0A 3O3EA 1FZOB 3D3VD 4JFHE 4R2GC 1A3QA 1P7HL 5I17B 4B50A 4I0PD 2WINA 2YKLH 3CFEB 5KN5A 2B7DT 1AKJA 4A2LA 3PDOA 1ACZA 4YE4L 3VFVA 5FYJH 1ZHBA 3RI5F 2XA8H 1BBDH 1KJ3H 2E7LC 3NIFF 1VSCA 4E5XA 3U6RB 4JVPA 2MKWA 3DHJA 4HAGA 5D70L 4HT1H 1EEYA 3CPLB 4JM2F 1MWAB 4HV8A 1ZWIB 5HHXL 2X1QA 4X8XA 5E7FA 3SY0B 1G6RB 5FOBA 2GIYA 5FB8B 3IJYA 4FHBD 2YD9A 3FQTB 2IBZX 2YR3A 3MUHL 5F6IB 3O9WA 3GMQA 3UROR 4CVZA 2QJDA 4K3EH 4U0RC 5IVOA 4JM4L 1YZZA 2JTDA 3ARGD 3VRJB 2IGFH 4JKLA 2QHRH 2GTWA 1ZXQA 1C1EL 1I8LC 3QUZD 1VESA 4X8JA 3ZDYF 5IGXL 3WSQH 3QPXH 4RDQF 5GRUL 4TUOA 1NCNA 3U2SB 5FM8A 1T2QL 4N0CC 2G2RB 5GGVH 4MDIA 3EO0B 3B2UD 1TZHB 2VQ1A 1U6AH 3EYFA 4IOIB 1QSFA 5BMFH 1MJ8L 1QVOA 4JZNB 3ULUH 3PWUA 2Q76A 1IM3B 3S34H 1UYWL 5H8DA 3CVIH 4GKNA 4PJEE 4URTB 5D6CB 3GI8H 5EOCJ 2DLFL 5EZIL 1RZJC 1QFUL 4XAKD 4OGAD 2F58L 4HDIA 3VWJD 4MNGA 4YH6A 5KG9A 2AJYL 2OK0H 1QPPA 5DJYA 5GISH 4DGYL 4EUPG 1YEHL 3I3EA 3D2UB 3O8XC 1SYSB 4P23D 5EO9B 4HKZA 5BJTA 1QEWB 5MEND 3MLWL 5FGCE 2C3GA 4PB9H 1OSZB 3T0EE 3WLWC 1QBLH 5I19L 4EVNB 3BZEA 4OCXL 3MLVL 2P5WD 3QWRD 3O6LH 4DOHB 1EBAA 1FO0H 3RPIA 1KB5L 1A7QH 1T03L 4NZJA 2VLRE 1U8LB 4M5YH 3CLEL 3L3HA 3ZE0F 2DTML 2GFBB 4TUJB 2VJXA 3EYOB 4JJHA 4O5LL 5MEQB 5L8LB 2GJZB 1G7PB 5DMIH 3VFMB 3HE7D 4ZFGH 5D5ME 3TA3D 2JJUA 3KPMB 3LS4H 4YDIL 3BZ4A 3KHOA 2E5EA 3LVEA 4RBPK 1SEBB 1PD6A 4J3VA 2NY1B 1CD8A 1VA9A 2BCKA 4YHZL 1WV7T 4WW2A 3O6KH 1XIWA 3OR6A 5TF1H 3MRMB 1L9NA 2NLJB 5T3ZD 3ELAT 5CMAA 4B7IA 4KXZI 2HKFH 4QLRA 4OIIH 4P0DA 4WUUD 4QRPE 5C09D 3QJFA 4N8VG 4NZDA 4PLJD 1ZHNA 2R9HD 2VDQH 3BRGC 5DWUH 2Y7QB 4PRPA 5ETUB 3SEPA 2D7NA 4JY6A 4BK5A 4AEEA 3LKOB 1ZOXA 2A1WH 1HHKA 4YLQT 3OKNA 1SM3L 2D4DA 3HC0B 1A64A 3K80A 4JPWH 2BHZA 5AZ2L 5GIRB 4IMKA 1GGYA 4EQ3A 3V52H 2XXCB 3WKML 4XPHL 1JPSH 4M62H 3EFFA 1FDLL 1C5CH 3R8BB 3S96A 1AJ7L 4Y4KA 4NCC2 1LWRA 1A6WH 1UFUA 3DNKA 3PL6A 1SEQL 1PKQA 3C8DA 4Z7OF 4RZCA 3ZE2F 1QOKA 4NUGL 2C3VB 3W82A 2XTLA 1EHXA 4WEUD 1WWWX 1U8IB 4YQXL 2A74B 2ADIA 4M1CC 4OF0A 5EBWA 3LDBC 4WFGE 1E4WL 2EC9U 4XBPB 1IAKB 3L5XH 5IHUH 5DJCA 3IKKA 1MHCB 4YBHA 3NACL 5DHVH 4OZFH 4MNHA 4WUKL 4N0FB 4TSBH 5EU6A 4EN3C 3KPSB 4NQTA 5H37G 3RJDA 4UNTA 3MRJB 4ELMB 5FUOH 3HE6B 4MJIE 2OZ4A 3CFCH 3KXFE 4ELMF 4ONFL 4WFHE 3PWPB 4WCYL 4PJ9C 3U4EA 5E8PA 3EYUH 2UZXB 2B5IB 4DKAA 1RUAH 5B3JF 3TO4D 4Z0XA 1KIPB 5J89A 2X41A 2EECA 2ZPKH 5IK3A 4WWKC 4HUWB 1VPOL 4IRSB 3GIZL 5EZOL 5A3ID 2E3VA 4HIIB 2HTKC 3C6SB 1YN6B 1A6UL 1R3IL 4JFOB 2J8HA 2D2OA 1TXKA 2FX8H 4GW4A 3A6BH 1WISA 3QQ3B 2VB5A 1WZKA 3O45A 3F7VB 3MACL 4FQIH 2BSRA 2FX9L 3DVNB 3EOAB 4IIQC 3U36B 1SJVA 4OLYH 1OAQL 1Z9SA 4QY8B 2WUCH 1XZ0A 4OZIE 3TP4A 2F15A 2PW2A 1RZ7L 2QQLL 2AKRB 4U1JB 2Z35A 5KVEH 5CD5C 3P0VH 1T0MA 5C09E 2DB8A 3RNKA 1FV1B 3WEXA 2NZIA 2V9RA 5ID1A 1AR1C 3BDBA 4NWUL 5E00B 4I0KA 1CICD 4Y4HB 2HN7B 1X5ZA 3T04D 5INDB 1T7VA 4OZGE 1YY9D 2CRZA 5E2UH 1O7VA 1LGVA 4ALAL 5C6TH 4HH9B 5KW9L 3RL2B 5HHOA 3MLUL 3CSPA 3N1MC 1QKZL 4YHPA 1X5XA 1FN4A 4NZTL 5F1IB 3D6GA 5KSBA 1G7LA 4X7SH 1LO2H 4Z7NF 2BX5A 3QCUH 4PJGF 4KFZC 1DVFD 1XT5A 3QIWA 4XNMA 1QO3A 3AM8C 5ICYA 3G08B 2F5BL 2RAMA 5JNYB 1BVKA 1CR9H 4XBGB 4NYLB 3CDYA 4HWEH 4WW1A 4U3XA 1FHGA 3V7AG 5I1EL 1KTKE 4UTAH 2IANB 3F7QA 1LO4L 4OFIA 1HNFA 4Y1AB 4BFEA 4ZUTA 1R3HA 1CDHA 5AUMB 2CR3A 1NBZB 4RRPG 1F6AB 1UA6H 3L6FB 1FYHB 4JZOB 4ZSOE 2A0LC 2R2EA 5IEHB 1KLUB 2X4RB 5MEPA 4L3CB 3QO0A 3MRDB 4NQDB 4XNQB 4LIQH 4APQA 5BS0D 4YR6A 3RX7A 4XMKL 4MDJA 3D87B 3TCLB 1NCWL 2ZNXA 5DEZA 3GKWH 3ULVD 2XYCA 2V17L 1VHPA 2VL4A 2IWGA 3TBYB 5JTWA 2JB5H 3MV7B 2E7LA 4YZFF 5T3ZH 4DFIA 4KAQH 2HAZA 5JR1L 3THMH 5FKAA 1LE9B 5HXMA 3SPVA 4E41D 3B9AA 1L7TH 3U4AA 4ERSH 1T89C 2A9NH 5FGBC 5I0DA 5GS2D 4LAQH 3D39D 3GSWB 1PEWA 4LGRB 4Z78A 1KTLA 4FQCL 2FO1A 4HFWB 5ALBL 1IARB 2UY6A 1GPOH 2ZNWA 2BVPA 1JHTA 5IBUG 4CBPA 4G8EA 3G5YA 3RX5A 2DM7A 2OS7A 3U7WH 1IEAA 3BPNC 5E7BA 4EDXB 4RSVA 5C0ND 2ITCB 2KKQA 2HRPL 1UXWB 3NFNA 1MCDA 4P9ML 1T5WB 2OTWB 2DQDL 1MCSA 2Y5TA 1OAYL 2AGJL 1M7DB 2YMXH 1U8NA 2VSDA 4DWHA 3WFCH 3G6JB 3O2VH 3GSQA 4D9LL 1FVEA 5CGMA 3FRUA 5K9QG 1HILA 1F4AA 1T7WA 1DANT 4PP1D 1W2KT 1F90L 2GUOA 3BPOC 3K3QA 4EUPH 1FIGH 4K3GA 3IDNB 2UYLB 4R90H 3U0PB 4NQSA 1ERNA 3T09A 4U0RB 4WGVB 1RZIA 5SX5H 2ZJSL 4FFYH 4LCWE 4G9DA 4NQED 1IQWL 2Y6SC 2EIEA 4OV6F 3WS3A 4GBXC 4OZ4B 1PZ5B 4D94A 1CXIA 1CF8H 1IC4H 1MJUL 1QPXA 1WT5C 2VZSA 3FZUD 1I8IB 4OKVA 3B3IA 3QXDA 4L4VB 4PJ8A 3IS1X 4H25A 1AC6A 1KF9B 1NCBL 2VISA 1OSPL 1ZE3C 2H2SC 3R8QA 2EIZA 4ZTOH 3BH9B 1J88A 4P49A 1A2YB 4Q9BA 1JP5A 4R0LC 5IOPB 3BQUC 5C08D 1H0DA 4F7EA 2A6JA 5ACMA 3SOBL 3BPCA 5HGHA 4NJAH 3QULB 2PTTA 3W39A 4R3SB 4BFIB 2C3HA 2FSEB 3DURA 4U49A 5EN2A 3MJ8A 4RFEA 5JXED 3ULVE 3TWCL 3CK0L 4MQXD 4PLOB 5MERB 1BREA 5CBAA 3L95B 1S7TA 1JGEB 4KKLD 1JPGA 4JE4B 2EDTA 5DJ0B 2H6PA 1E6JL 1FNHA 3LKQB 3OAYH 3PV6B 3KPPA 3QDJD 4E41E 2NY6D 3W11D 2X40A 2AEPL 2AJUL 1SHMA 4PJ7A 3KLAB 5AYUL 4LOUC 3IGAA 4YDJB 4HGWB 1RVFH 1Y6NR 1SQ2N 4CGTA 5CFHA 4PJDA 1H15B 5ICZB 5I8EB 1EGJH 4G9FE 3MRHA 5SV3A 3P73A 4LRNH 5I1DB 1DBKL 1CLZH 4CN4A 5DD3H 2AJ3B 2ATKA 3NIDF 3GUTA 5KSUA 3T2OA 4ZPVB 1AD9B 2MHAA 5TFSH 5C0JB 4TVPE 1OW0C 1DLFL 1KXVC 3DLQR 4YHMH 2RFXA 1N3NA 4X6BA 4PV9B 4DTGH 2X10A 4OQTH 4P2OA 4CW1A 1MNUH 5I16A 4XVJH 1LNUB 4Y5VC 4GKZA 2PXYA 3TT3L 1TLKA 3SE9H 4JFYA 4XCYA 2VOTA 4MD0A 3HZVA 5H37H 3WHE1 4IOFD 4ODXA 1EHNA 4YUEL 4PBWD 2O61B 2FATH 1JGLL 4QTHB 1H5BB 3MLTB 3AUVA 4TNVK 4UOW0 4NQEE 3TT1H 2IMMA 1KXTB 3BP6B 3I02A 1D6EA 3JVGA 4PJCB 4HUNB 25C8L 4NRYB 5HJ3B 4D0CA 1A6AB 4U6HB 5AG9A 3QNXA 1J1XL 2OXGA 4FQ2L 4PJCF 1NFIB 4Z0BL 3A6CL 4XNYL 5IW1A 3HUJB 5DHYB 4PJ9A 1R3JA 4KKAC 2V2TB 3NPZB 3Q5YA 4NP4H 3K0WA 1CE6A 2R4RL 2HJFB 3MLYH 5KBNC 1JNHA 1D9KC 3W0WB 3MZTA 2E9JA 3LEXB 1IGCL 4PBXA 2VLJD 3EO9H 4UV4H 5C08E 1FFPB 5E2WL 3UC0L 1NUNB 5EOCL 4NO3A 4XP4L 3PHQA 4YHIA 3NABL 3QXAB 1INEL 3RHWF 3DMMD 4HIJA 3JWDH 1CGSL 3MLRH 4PBVC 3JTSA 4YHOL 2HH0L 5DJ6A 5E5UB 2V7HA 2WAHA 4X5WA 3RP1A 1U8MB 1IM9A 3O6FC 2HFFB 4EN3B 4OB5H 2OSLB 2R15A 3O11B 4IIQA 2X4OB 2Q7YB 3UMTA 2F54B 4BFBD 1CQKA 5FUZL 1KNOA 4HWBH 3SGJC 3QDJE 1CL7I 4CDHA 3L3JB 1PYWB 1KFAL 3CFKB 1ORSB 4YX2H 5GZOD 3VWKA 1A9EB 1Z9MA 5GZNC 15C8L 4TUKL 1IGFH 3BH8A 3O3DA 4X5XB 2G60H 5IEKA 2MPAH 1TPXC 2NYYD 5JXAL 4WWKB 1S78D 1NGPL 1VEMA 1CFVH 1RIHL 4XPAH 43CAA 4GW5A 1I9JL 1QNZH 5IESL 1G9NH 2DM3A 3RX8A 4CJ1A 4PREA 1Q9LB 1FYTA 3MROB 4ZPTA 2GJ6B 4EDWL 4GAYA 3TZVD 4Y19D 4F9PA 1NAML 3UYRH 4MJ4A 1PSKL 3HHRB 5DK2A 5TE6L 1UH4A 1YQVH 4KMQA 3O4LA 4AK1A 1U8KB 1Z0NA 4AT6A 1KACB 5EULV 5IKCB 2YPKB 3IRPX 3MNWB 4JFZL 2GI7A 35C8L 3I85A 4JRYA 1MQKL 3T0VA 3NGBC 1FVCA 4HWNA 5DFVD 3RUGF 5F9WC 2ID5A 4NKDB 5ESAA 4I8DA 3QI9B 3L9RA 3VG9B 1WJ3A 4E0RB 4MCZA 3NIGF 4EIGB 4TNWF 1BD2E 2VWEE 4KK8D 5I18H 4R96A 5FM5O 4HC1A 3U4BH 5IFJB 5IMOA 4NZUH 1PX3A 2H3NA 3IFLL 3VD9A 3W2DL 3LN4B 3OJ2C 2MMXA 5C0IB 3WE6A 2MCPH 1LO0H 1MI5A 4EOWL 5DRWB 3HMXL 3CDFA 1U8HA 3DO7A 1RMFH 3MNZB 5DD6B 1AGFB 1DDHA 2APFA 2VLJE 2FZ3A 3IDJB 1SJXA 5I1JH 1C16B 2VDKL 3G04A 4LSQL 4CADB 3KJ4C 2X09A 5J1AA 5D1XA 4Z5RA 3UTQA 4EQ2A 1Q72L 1SYVA 5F9JA 1CDGA 2FD6H 1KV3A 5T5NF 1FNEB 5DURB 2Q3AA 4ENED 4NNPL 1N5AA 3STLA 2BC4A 2QQNH 4NSKB 1U95B 1S5HB 3QUMA 3KG5A 3QEQD 2XRAH 4Q58C 4XWOD 1CDYA 2BVTA 1RUKL 1KLGA 4AM0A 3Q3GB 4FQJL 3PIQA 4I4WA 3DECA 5DJ8B 1ZLWK 1TZGL 5IB5B 3OHXA 5EU5A 4OV5B 3IDIB 5F9AC 4LRIA 4K94H 4LLDA 1ZLWH 4D0DA 1F3JB 4RMWA 5GGQL 5E8DL 3Q6GL 3NZ8B 3TPKA 2Y9RT 4UU9B 4MNQB 5GHWH 2X9XA 3PGDB 4JQIH 3RWEA 5C2BH 5CIPB 1A7PL 3D9AH 3IJHA 1DEEB 3JV6B 5K9KA 1I1AA 4LLWA 4QRRA 5TGBB 1HXMA 1T04A 1NCAH 3BIAX 4GXVL 3H7BB 1U36A 2D0FA 1BVLB 5HHMD 1XGPA 2B1HL 1NFDF 3MNVA 4MCYA 4ZUVB 1AKJD 4MXVF 1T80A 1FZMB 4FFWC 1NDGB 1PY9A 4ZFFA 3RFZC 3BPNB 5INCA 4LLQB 4K23H 2YC1A 4HKBB 1T1XB 4RGOL 1DTUA 1XGTA 1NGXA 2AJZA 3IDXL 1CL7L 2XZQH 5KAQG 3DBXA 4DQOL 3GSUA 5DC4B 2HLAA 3L7FA 4ONHB 5IBTL 3VGAC 3C2AL 3ESUF 4NJ9L 3C87A 5C0CB 5C9JA 1FRGL 1MJ7L 3O9WD 4QRUB 3WIIL 3NVQA 2UZYB 2Y06L 4U33A 3UXFA 4QXTB 2OL3L 3ARRA 3GSVA 4PLKD 4PJHF 5F93C 1HDMA 3KVQA 3X11A 2NX5D 3BN9D 2AV7A 4GT7A 2XTJC 5C0AB 3KS0H 4ZUUB 3HG1B 2CGRH 5FOJA 4O4YL 1T5XB 4CNIA 1RSFA 3BEVB 5FF6A 3BGMB 2YEZB 1FPTL 1I85A 4I18C 1A1NA 4XAWL 2V2XB 3LEYL 4LHUA 3BKJL 3PQYB 2EE2A 1PKOA 5D9SA 2LVEA 3LHPH 1TVBA 3OJDB 3HPJA 3SKUD 3VXUA 4KZEL 4R0LB 4Y5YB 2PTVA 2C4XA 3BQUB 4HPYL 2E8YA 3KPRB 5E2VL 3LV3A 1NAKL 4OM1H 4P5MA 5TPWH 4G6KH 3QEQE 1CFNA 4RGMC 1HQ4B 2HJLA 4F2MA 5CZVL 1ETZA 1A02N 1KPVB 4WDIB 4GMSH 4LFHG 1TZIA 5IJKC 4Z77B 4I77H 4KQ3L 2R2CA 4JB9L 5KOVC 4AENA 1MUJA 2W0KA 5D2NC 5EUKA 4DVBB 3ARBC 3HZKB 1OW0A 1QLEL 1A7NL 4HWZA 3T3MF 3S7GA 1FH5H 4QHUB 4HJJL 2VO5A 1S9VA 2QADB 4U3CA 4JY5H 5CLWA 3GJFA 3GSNH 4OGXH 1IGJA 2EH7H 4UDTB 4JO2L 2DQUH 1T1ZB 3N1GC 1GGTA 4U31A 4PRAA 3BT2L 3B2VH 1HINL 1UZ8A 5HHME 1ZTXL 1KCRH 1MLBA 4EBQH 1QR1B 5E9DA 4PR5A 4YBLC 5BO1L 1WEJL 1AXSA 3DX8A 4YDVB 3SBWA 4JRXB 4UB0H 2R8SL 3WFHA 5LCVH 5HDBE 2KBGA 4XHQA 1DQLL 5L2JB 3INUL 2KZ1B 3BKYH 5L7XH 1CGTA 1EIBA 1XIWD 1KIRB 5CGYC 5F3BB 3H3BC 3GKZA 3DRTA 4Z7UE 3L5WB 1K2DA 4PJFB 5DJDA 3I75B 5HPMB 5SWZA 2NXYB 3U7AA 2W0LA 1LQSR 4G43A 5BW7C 3VXMA 5CP7B 2NW2A 1E0OB 4HXAH 4PJFF 3DUSA 3L3KB 3BKCH 1J5OH 3QR2A 1S7XA 3TGXA 4D2NA 3P30H 3VFTA 4HUVB 3I50H 4NHUB 1BJ8A 5HHNA 5F7KC 1BIIB 4FFVC 1ND0A 3HNVH 4QXGH 2BSTA 5TE7L 3CLFL 1GGBH 4PPTA 3HCVA 4Y4KD 3KNBA 1FNGA 5F3HB 4CDGC 1QSFE 2DLGA 5FEBA 4R4ND 3RAJH 1INQA 3VH8A 3WFDH 4AQOA 2Z8WC 3NCMA 1E27B 4L8SC 2R56H 2R0WH 1I8MA 2X4QA 3MRGB 1DE4A 2VQUA 3PF2A 5DTFB 1D9KB 2D4FA 1NBVH 4U05A 3H9HA 3U46A 2FYYB 1LILA 4U6YA 1BF2A 4H8WL 3X3FH 4MNGE 2H2PD 3WD5H 5GS1B 5DRNA 3LS5H 1QRNB 2OX5A 4N0UA 5EU6D 2WV3A 2JCCA 3KYOA 1KJVA 1UWEL 5SX4H 1N26A 2ZUQC 1DFBL 4YDKH 4JO4H 4FFZL 4WHYG 1DP0A 1M7IB 4MVBD 4LAJH 4V1DA 4GXUN 3TJHC 3O6FB 3SHSA 1FP5A 1K8IB 4YXHL 2VRAA 5CJOL 3GNML 1ED3A 1TJGH 2X42A 4W4OC 3BDYH 5HHVL 1LO5A 2B2XH 4KJWC 1I7TA 2DQHL 4KHTL 4KU1A 2VUOA 3IXAB 3FN3A 3DV6B 1V3KA 3MRLB 1DN2A 5LWYH 2ERJC 1NGQH 1OTSC 1VADB 3L5HA 5IB2A 1TPXB 4NO0A 2P1YA 3EHBD 4PGCA 1JWMA 5AZEL 3KLSA 2XZAH 1ZEAL 4E9LA 1MHEB 4ODTH 4TOYL 3T2PA 2CK0H 1OP3K 2DQTH 4BZ1L 3DETC 4PJBA 1OP3H 3VD4A 3DXAB 1EFXB 1E28A 1G9MH 3PWLB 2DQFB 1GJIA 2HT3C 2VDPL 4HJGA 3PJSB 1YJDH 5IVNA 4PRPE 5I17A 1BOYA 3UZQA 2CJUH 3CFEA 3H42H 1IT9L 4TYUA 4GLRI 3DVGB 5F9WB 4NCC1 5D6DA 1XEDA 5HHOD 1HCFX 4JM2A 4PRHD 5FCSH 3CC5A 8FABA 4OLVL 1ZANH 4P46A 3EDKA 5HYFA 4HEME 1FL5A 2WW8A 1MWAA 1ZWIA 5C0FB 3KPLB 2NY4B 3QIWD 4KMTL 1G6RA 1PKQE 2YBRA 4ONGH 1IVLA 3CVHH 3LH2H 1RJZA 2HG5A 5JPNA 4BELD 1AFVL 4Q9QH 5CEYB 5T1KB 4HIXL 4OCYH 4JR9H 3FB6B 4WO4C 1JI2A 2V5RA 4X6CE 5FYKH 3RVVC 1X5HA 4Q6YA 4ODUB 2A9ML 5FO9A 2PO6C 4F37F 3KJ4B 3DX7B 3V6FB 5F44A 1JI1A 4HXBL 2JJTA 3LEVL 5EU6E 4HAFA 5FGSA 3HI6L 3TNMB 2CDEA 1NGZA 3QCVL 3LRHA 4MJ5A 3GRWH 5DJAB 5DJ2A 3TNNB 1IM3A 5I73B 1UCTA 4R2GD 1B0GB 5D6CA 2JLLA 5EG6C 3VMOA 4HK3J 2FJGB 1MHHB 2H1PH 2WIMA 3GGWB 4XNUL 6CGTA 4HCRH 4OLXL 3S36L 2K3TA 2BVOA 5DRZA 5EO0B 3FL7A 3FQUA 3FB7B 3BWAA 4OF6A 5IVXB 5E1AA 1JV5B 2A6IA 5EO9A 3BSZL 3SE4A 4AZ8A 5IVXF 5LAXB 1OSZA 4I3RH 4EVNA 3KHQA 4FQ1H 4FQLH 5JW4M 1KG0A 4D3CL 5HHQB 1F58L 3ALXA 1U8LA 4AMKL 4AYFA 2X4TB 1ZT1B 4JDZB 3FQWA 3FAXA 4HS6B 3OX8B 4YWGH 1TTGA 1QFWH 1RPQA 4MQSB 3PWNA 1HQRB 4NO5A 3D18B 5TDPB 1PG7L 3CH8A 3TPUB 5IFHL 3VFUB 2SEBA 1B6DA 4PGJA 3KPMA 4U1IB 2R0LH 4KVNL 4MXWH 4JKWA 5I2IB 4IRZH 2R2HB 2CUIA 1WFUA 3D25A 3UJIH 4HZAA 4GUPB 4BH8A 3CIQA 3AREB 4Z95L 1D5MA 3FN9A 5HHOE 4WY7H 3VI4F 1SBSH 3MODH 4R4FL 1UH3A 4TRPL 4HHAA 3GMLA 4TULL 5HGAB 5BVJB 1QACA 2DWDB 3MTRA 3H9YA 5KSBE 5DD5L 4AG4L 2Y07H 4HQQH 5ADOL 4XCFH 1E6OL 3DIFB 2DYPD 3DWTA 5JORB 4MQ7A 1JNNH 4EI5B 3WFBH 4RFOL 2DTSA 3BEWB 3ROOB 3LQAL 2DM2A 1I7UB 3JSSA 1EEQA 2XTJB 3O8XD 1YEDB 2O5YL 3MYZA 4K7PY 3H7LA 2ZCKL 4LPWA 3VGBA 5BZDA 1OTUC 2WMPA 1S7SB 4LU5H 4PJ8D 3ARBA 2AXHA 4P3CH 1GOGA 1HHGB 1OL0A 4R8WH 2BVQB 4JRWA 5KVDH 4I18B 5DVLA 1K8DB 2C3VA 3BO8B 2BXYA 2W9DH 3FJTA 1B0WA 4OF7A 4QHMA 1J9CT 4UILL 3SJVB 5CGTA 3RWIB 4KV5E 3HZYB 5EU3B 3FRPA 1M6OB 4GS7C 3T3PF 2ZZUT 4ODWB 3IXTA 4R4BB 43C9A 1F3DJ 1IAKA 3X12A 2AK1H 4MMXC 4OUUA 4RGMB 1U93B 1MHCA 2APBA 12E8H 5J8OA 5D2NB 2W91A 4IRJA 1EXUA 3I6KB 4ELMA 3MRJA 2JELL 3HE6A 2BP3A 4JN1H 1JPFB 1RU9H 4UIKL 1KJMA 3VGGA 2MTPA 3PWPA 1S9WB 3QHFH 1XR9B 4ZS7H 1HEZB 1SJHA 4FABL 1N59B 1NBQA 2ED9A 3RL1A 4S1RL 5CHNB 5CP3H 1UEMA 4A6YH 5GGTL 1GIGH 1KIPA 1VFMA 4Y7MA 3VXSB 3JV0A 4DFHA 2ARJB 3KYMA 4HUWA 1ES0A 2CUMA 3MUZ1 3EOTL 4YBLB 3T2QA 5DT1H 4L5FH 4D9QD 1UB6A 2J6EL 4NM4L 3DRQA 4O51B 4M5ZL 2J88H 4NQXB 2FGWL 3ZL4L 3SDCC 4M6NL 3QNZB 4P2OD 5D7JC 2YOCA 3QEHA 1RJYA 1MAMH 2ADGB 5EOTB 3U36A 5EIIA 2Y4SA 4IDLA 4XC1H 2NCMA 4QY8A 3TN0B 3WYRA 4X0KB 1EDQA 3DSFL 3QYCA 3SKNB 1BM3H 4M1CD 3SDAB 4M1GL 3ZTNH 4WHYH 2IPKB 1U58B 1RQ5A 3PGCA 4DN3L 5F72S 2XKNB 3UJTL 3L7EA 1AO7B 3TBVA 5T1LD 3QUXA 1EMTH 1KXQE 3M1BB 1L7IL 2DM4A 2DD8L 3MUGA 3BVNB 3EJYD 1E4XH 3B8YA 2OQJB 4NBXB 1CGYA 2C1OB 1A3LH 5CS7A 5E95B 2AQ1A 4ZTPH 2YSSA 4JDTL 3ZZ1A 4GRLB 2Z4QB 4PJ9D 4PJGA 4D9RD 1EEZA 2AEQH 4X6FB 2AJXH 1F4XL 5IM7B 4Y88A 1XGYL 3O41A 3F7YB 2ZKHL 3ZT5A 3OKLB 3L3IB 5JNYA 5JDSB 5KANI 3E2HC 4BUHA 1AGCA 4NYLA 2RIKA 4QOKB 2FHFA 1JNJA 1DR9A 4ZUWA 3OAZH 5JW4R 4KTEL 2X89A 3VU2A 1IM9D 5DVNA 3VJ6B 4ZOAA 2ZUQB 2V2WA 3GMRB 3MJ9A 3PHSA 3CXDL 1ADQL 1BBJB 5C3TA 1EA9C 4QT5B 1F97A 3RRQA 4MA7H 5DQJB 1F6AA 3L6FA 1FC1A 1QSEA 1KC5L 3VWKD 2VR9A 1JWSB 4FA8A 4PJ7E 4XX1G 2X4RA 3SCMC 4L3CA 3T77B 1RFDH 4YC2C 4U1NB 4XHJC 2Q8BL 3HNTL 4NQDA 4XNQA 1AR1D 4G6FB 4NRZB 4F58L 2ERJB 3DARA 5C8JA 3RU8H 5K9JL 4PJDE 1MCBA 4UT6H 4HPOH 5CD3B 5ITBH 4WEBL 3H8NA 4X6DB 3MCG1 1IC7L 4U1MB 1NDMA 3V0AC 1RZJH 4D9QE 1LE9A 2I24N 1J10A 4Y2OA 3PP3K 1JZ4A 4RWYL 4S10A 3KYAA 5EA0L 3O4LD 1OPGH 3PP3H 2YD2A 4HKXB 4QCIA 3VXPA 1U3HB 5C07A 3C5JA 3P0YL 5KSVB 3S37X 4FRWA 3PWVB 2NXZC 1WK0A 1DBAH 2VXUH 4JRYD 1BAFH 5EDXA 3P4MA 4D8PB 1I9IH 1AIFB 4OFPA 1IAIL 2A73B 4H8WC 1KN4H 2ITCA 2JK5A 3TVMA 4ZNEA 4LQ1A 1MF2H 3C5ZA 3CUPA 4IMLA 1H3WM 5L6YL 1BZ7A 4GRWB 3EYSL 5KS9F 3QDGB 4XP9H 4GSDL 1NAMA 2FWOB 4PY7A 4UINL 3TJEH 2A0LD 1KEGH 1VFAB 4OF8A 5IIEA 3D0VB 5K93A 4M4PA 4D9RE 3U0PA 3I6GA 1MI5D 3B9EA 4HS8L 5LXGH 4DAGH 3REWA 2AP2A 5H94B 5GS0L 2D3VA 2D0HA 3RVTC 2E27H 1BGXL 2EYSB 4KJYB 3LPGA 5GS3A 2J3SA 2VDML 5D1XD 5LG1A 2C4FU 2PO6B 5E6IC 2VXTH 4MA3A 1XCQB 4WVRA 1I8IA 2FLBT 1PLGL 1ONQB 1TCMA 3RVUC 4KI5F 3KPOA 3FQXA 4FQPA 3EO1B 3CSGA 3ZKMD 4X9IA 4ZFZB 5TQ0H 3LIZH 3IT8D 1I3GL 3BH9A 5ECJE 5FYLE 2ED7A 3G6DL 2O93L 2FBJH 4N8CH 3QEGL 3HMXA 5MHSD 2VZOA 1IGMH 3HB3D 3MO1B 3V79C 2MQ0A 3QULA 1FAIL 2GTZB 3I3DA 2XN9B 2FSEA 1VGKB 4XH2A 5K33A 1T1YB 4JZJB 2XG4A 5MERA 4OLUL 1U3ZA 3BHBB 4XPTH 4OLZL 2N1KA 1FYTE 3DI2B 4QRRD 1TIUA 3CFIC 3LKQA 1A6VH 1QQDB 3P11L 2IAMC 2W0FA 5LGJB 1CGWA 3C08H 3SN6N 3ULVL 3ZKNC 1IBGH 1IL1B 4PRNB 1CT8B 1YYLL 3SKJH 3O4LE 1J8KA 5DVKA 3KLAA 4YDJA 3R06A 4HGWA 2I5YH 1F8TL 1JNLH 4GBXD 4ETQA 4XNXH 2D7QA 3GO1L 3L3OB 3UPRB 3IU3A 3RDTB 4G6ML 2DLTA 4A2MA 5DMKA 1UXSB 4M7LT 3K4DA 1ZA3B 3RWDA 4CU7A 4WU7A 2KL6A 2OM5A 5GPRA 4DGVL 3C60B 1DL7H 2AV1A 3E6FA 1G7QA 3RJQB 1A4KB 1AD9A 5DD0H 3VDAA 1TETL 3E6HB 3NZHL 4M8QB 3GSOA 1Q9OA 1L6XA 4R7NA 3HLAB 4LSPL 1RZGB 1CDJA 2DQCH 5HVHB 5DGRA 4P9HL 3SDXB 3RGVA 5FCUH 4TVPL 4RISH 4O2EB 2HP4A 4JFEA 4OD2A 1R6VA 1YEEH 5JIIA 3MRBB 4DKEH 4QTHA 1H5BA 1FLTX 4U1KB 5E8NB 1YNKH 4GG6B 2Z31C 1QR4A 3ULSB 3G5XB 3MRNB 4PJCA 4YGAB 4NRYA 5HJ3A 1A6AA 2HT4C 4LPUA 1Q9WA 3ILQC 1MVUA 3MXWH 2HKHH 1U41A 1SY6L 3ARFA 4LBEB 2QSVA 4H26A 3VXUD 2OL3A 1J11A 1ITBB 3BJLA 2OR8A 1OCWL 5C0GA 5I74B 1CLYH 2HJFA 5IW6A 3T0EC 5I1AA 3TH2T 1LEKB 1JWUB 4P2CG 5LKNA 2IPUG 4GS7B 3IDGA 5MHSE 1I8KB 4DKFL 4HG4K 2P5EA 4JHWL 4XPFL 5HDQL 5ERWA 1KGCD 1G7MB 1LK2A 1U92A 2EDYA 4KY1H 1QYGH 5F7EL 2VLKD 4K71C 4I5BB 1U8MA 3SO3C 1CI5A 4F7CA 4I2XA 2HFFA 2MKLC 1AXTL 4I0PC 1T3FB 2X4OA 4JO3L 3ZDXF 3U48A 3O3UN 5JHDA 5C0BD 4KUZH 1HSBB 1RK1B 3L3JA 3DYPA 3CFKA 1ORSA 5DD1H 3T65A 2L4OA 1I4FB 1IGTB 5E9DD 4XP6L 5SWSB 4M00A 1UG9A 1R3LB 2VC2L 1NEZB 2ICCA 2LTQC 3LQAC 4HZLA 4G8IA 4K8RL 4Y8DC 4WI8A 1X6NA 2IPTH 3HTLX 1UM6H 4BZ2L 3NA9L 4CUCA 4UQ3B 2DBJA 4QHNA 2IFGA 2I07B 3QAZC 1U91B 1CBVH 3MOAL 4U6VH 4G3YL 4K7PX 3ARGC 4J6RL 3SDCB 4NHCL 4NN6C 3VXMD 4NZRL 4KKAD 1OAZH 1J0JA 1J1OH 2DLEA 1T0NA 3QUZC 3N1PC 4ODSL 1OGTB 2PYEA 2GK0A 3IFNL 1OARH 3F12B 3VW3H 1U8KA 1YN7B 1E4JA 4U1GB 3O3AB 1MRDH 2X7LB 2VXVH 5IKCA 2W9LA 4P3DA 4K2UL 2CLRB 2B0SH 3B2UC 3RUGA 2DMKA 4QHKJ 4P59H 4I1NB 1T4KB 4PUBH 5CJQH 1F42A 3U0TA 3MRCA 1A7RL 4HIEB 5JPMA 3S88H 4JFDB 2CDGA 4IDJH 2HTLC 2V7NA 3BDXA 1JRHL 2ZSWB 1KELH 4OFDA 4U7KA 2P44B 3DTXB 5C3LD 2UWEB 1S7WB 3GMOA 2PW1B 2GK2A 5HYQA 1EPFA 4E42B 4L1DA 1NGYB 3QG7L 4OGAC 5F9OH 2A6KB 3EUUA 3SE3C 3FN0H 3WFEL 4P4KB 2NY5H 5IFJA 5GZND 2OBGA 1XFPA 1FC2D 3G5VB 3VXUE 4GRMB 5DEFB 3LN4A 3RA7L 4PGEB 4Y0GA 3MXVL 2XKSA 4Z7UF 3G5ZA 2WUBH 1INDL 3MNZA 2OXHA 3TV3H 1Z9OA 3O3BA 2VXSH 1QA9B 3GHEH 4NGHH 1KTDA 4BUGA 1G7JB 4QHLB 3IETB 5BRZA 3I2CH 5ISZB 5KVFL 4HSQA 4MWFB 4JPIA 5AWNH 4TSCH 3GJEB 3ORJA 2CIIA 1FNEA 1B2WH 5HI5C 5DMGC 3N06B 3TA3C 4DEPB 2X1PA 1YDPB 3C8KA 2E6JA 4LGPB 3UTSA 4AL8H 5IWLC 4NSKA 3OKEA 3KR3H 4ODHH 4ISVA 1W0WA 1J8HE 4NO0D 1H3XA 3VFGH 3Q3GA 4WHTB 3Q6FA 5E9DE 5I71C 4H1LB 1IJ9A 1N64L 5KVGH 4MGXA 3IDIA 3V8OA 4LCUA 3RIAK 2BSED 2YK1H 4BKLB 4I0CC 5AAWA 1R5VB 1B6UA 4JPVL 2R9HC 4UU9A 4AH2B 5DUBB 4MNQA 4F3FB 3TIEB 3DGCR 1IC5L 2HT2C 5CIPA 3EOBB 1ZSDB 4DJMA 2G5BB 1CCZA 1AGBB 5HGDB 3AC0A 4YE4H 5SWZE 3S3PA 2BHUA 4MX7B 2BNRE 3EDJA 1KJ2B 4ZDHB 5TGBA 3VXME 5J11B 2WP3O 1NFDA 1QG3A 2VE6A 2JB6B 5IF0B 5B22A 2NXZB 3QUYC 1RZKL 4JLRA 4P2QA 4ZUVA 5ANMA 5IB3B 5ESVB 1D5ZA 1NDGA 3VXRD 1E4KC 5E8EA 4TSAL 4LLQA 2H26B 1G6VK 1P2CA 1YEFL 1XH3A 4HKBA 4JM2D 4DZ8B 1FJ1B 5FHBL 4GAJL 1BHGA 1FFNB 3ZHDA 5FECA 5HYJB 4P46D 1KOAA 5JIPA 2VITB 5GJSL 4HX1B 4GW1A 1H3GA 2AK4B 5JIHA 1UEYA 3FOLB 1C1EH 4KQ4H 5IGXH 1VGEL 3WHE0 5C0CA 3JXAA 3OSKA 2DI8A 4AEFA 3I3BA 4AEIL 4PJHA 2X05A 3R1GL 5I8KH 4OIBA 1X5FA 2RQ8A 4GQPH 5IV2A 3S8WA 4C56D 1AGDA 1NANI 4G5ZH 3NMEA 2OJEB 3QIBB 4Y2DA