4Y2DC

Crystal structure of the mcd1d/7dw8-5/inktcr ternary complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
202
Chain Sequence
TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural modifications of alphaGalCer in both lipid and carbohydrate moiety influence activation of murine and human iNKT cells
rcsb
source organism Mus musculus
total genus 42
structure length 202
sequence length 203
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dC02
2BHZA 4XWGH 4XXDA 4DKFL 1W72L 4Y16D 3K8MA 5B21A 4WI4A 2J6EL 2XYCA 1A7NH 3T3PE 3MMEB 1NBYB 1K9TA 4LP5A 2V2WA 4PJXA 3MCKA 3CLEL 2IGFH 3GI9L 2VZOA 3MOAH 1DE4A 5JW4N 3CK0L 4GKNB 4GSDH 3ROOB 3WIHL 4HQQL 4IOIA 4JFPA 2UZIL 3WHXB 2V5RA 3HI1B 4HT1H 3KAAA 1FN4A 5DHVH 1BAFL 1EUTA 4NT6A 1JTPA 4ZPTB 4R4ND 3X3GL 4NC0B 2F8OA 4XWOD 5FOJA 2BVPB 4UDUA 4Y19A 3L6FB 4PJ5B 3BKJH 5IMLB 4AIZB 3LCYA 4LCWB 2MCPL 4WW2F 5GS0D 3UTPD 2QQNL 1VFOA 1TITA 4D0BA 1PSKH 3U4BH 5JOPE 1IC7L 3DNKA 3ETBF 5DDHB 4S1SH 1EFXA 3MJ7B 1OAUH 3LRGA 5FO9A 1P7KA 1RZJC 2EIDA 2W0FB 4HWEH 3TBYB 3VWJC 4O51A 5F6IB 1A1MB 3PQYA 1N59A 3QIUB 1DQDH 4YDIL 3O0RL 4MAUL 4ONFH 3HAEA 3QDJA 5GRUL 5TE6L 5C0RL 3FQWB 3SKJL 1UKQA 4PJFB 4KUCD 1MFNA 1CE1H 5A16B 4WCYH 1T6VN 2VXQH 4GBXA 1P84K 4WI3A 5ITBL 1E4XI 4DQOL 5DD3L 4LHUG 1UCBH 4BELD 4LPUA 4BQ6A 4PD4K 3BAEH 3L5HA 4NOFA 5E9DD 2CKBH 5EUOF 1KLGB 3EO9L 3TZVD 2YD8A 5AG8A 2EDFA 5JDSB 3SDDC 5LWYH 1NJ9B 4LLUA 2DQUH 5LGJA 1VDGA 3LKRB 4P3WA 2HG5A 1YA5A 2H26A 5D1XB 4DOHB 2DMBA 3L3KA 3CVHB 3ILQD 2C1PB 3B9AA 1WCQA 3O3BA 4U1HB 3CVIH 3WO3B 3UPCA 4ODBD 4NQXA 1JNHA 4NQEE 3SE3C 1R0AL 5HHOB 1FH5L 2B1HH 5H37G 3RL2B 5I8KH 1H3XA 1H5BC 5DVLA 3L3JB 1T1XB 4WY7L 3BH8B 5SX4I 4I18B 3VFNB 3BI9X 3F7RA 2H8PB 2IG2H 4LAQL 1BEYL 4WEBH 4F7CB 5GRZA 4ZUWB 4M8QA 2X4OB 5D1QB 2BSRB 5IB1A 5DEFA 5EN2A 4XVSL 5K9QG 5DSCA 4S1RH 1ORQB 4QY8B 3MA9L 5EIIB 3WNNA 1XR8B 3QWRD 4R8WH 4WI8A 3NAAL 5J4MA 3VGDA 4PRAA 1F4YL 3D0LB 1M7DA 4KJQC 3T1WA 1ZAGA 3PGFL 4HKXB 5EBWB 4C57C 1N6UA 5C0DB 1MLCA 1T1ZB 3NCCB 2W9LA 5GRXG 3SOBL 4X8JB 3T0EC 5BVPH 2HFGH 2NPLX 2R8SH 1XZ0A 3GHEH 3V4UH 2VYRE 1UACL 3SE9H 1M4KA 1XGPA 5E8EB 1IKFH 2CQVA 5EBLA 1D6EB 5JW4R 2H6PA 3NTCL 1BZQK 1WZ1H 3BGFB 5D72H 4JE4B 4Y5XA 2EDLA 1URLA 3QRFM 5KOVC 4ZXBD 1IILE 3IKCA 2P7TA 4U7MA 3TBWB 5BV7L 1UJTA 2X4SA 2VXVH 1RPQA 1NAMB 1G9MC 5SWSB 2YRLA 1I3UA 2E9JA 2BNRD 4K71B 5ILTL 3UC0H 1OCWL 4OCSH 2Q7YB 3GMOA 4DGIL 1C16A 2X4TB 1FNEA 1QLEL 3WUWG 4U1KB 1KCSL 4N8VA 2P44B 2K7QA 1GJIA 1NCNA 4DEPB 3L7EA 1NUNB 2FO4A 4OSUL 5CUSH 2W9DL 2GITB 1AHWB 3GB7A 2X6MA 4LLQB 3VFWA 1U8KB 1IBGH 3PWPD 2HFFB 4PYHA 5EZIL 3S6CA 2HP4A 4PGBB 5HYSA 2EDTA 3NH7L 4PJDF 3WD5H 4ZPVB 2OMNA 4RGMB 2N7BA 3RY4A 4HULB 1KN4H 1NDGA 1RQ5A 3TT3L 4NQSB 3E8UL 5T3XD 2AERT 3HNSH 1QBLH 3MLYL 5CJQL 5L7XL 4YWGL 4KZDH 1TVHB 3S4SB 4Z0BL 3KLAA 5DGQA 5IOPA 2X4QB 1NCAL 1S7XA 2SEBB 4PG2C 4U2YA 5FM5O 3RVTD 4DK3A 5E9DA 1BF8A 5ESAB 1RZ7L 3GSUB 2PYED 4YBHA 3G6DH 3C9NB 1A64A 2CUIA 5B3JF 1CQKA 1K2DA 2XOTA 1LEIB 3QUYD 3AS2A 3U9UA 1J1OL 4WHYH 2B1AH 5FCUH 1G1CA 4GLRH 1BQHA 3C60C 1XGQA 1CTNA 1SYSB 5J6HB 4UT9L 4DUXA 1FNLA 1KIRB 1MVUA 1RUAL 5L2JB 1NKRA 5I17A 3QJHA 2FB4L 3G5VB 2W65B 3DETD 5E7FA 2RR3A 1J1XH 1NCTA 4V1DE 4XMPL 5B4MC 2P8MA 4LMQI 1NMCC 1KIPA 1NGZA 4LRNL 1X4XA 2A6DB 2HT2C 2B4CC 3GKWH 1GIGL 4Z7UB 4XBEL 3SDAD 1T7WA 5DF0A 2ADGA 2DIAA 2HLFC 4YDJA 1X4YA 4R3SB 4ALAH 3U36A 4ODVH 5GGTA 5FO8A 3VXMB 1A7OL 3QWRA 1FGNL 1QYGH 3QUZA 4XPAL 1QHOA 3ZKMD 3ULSB 1UM6L 3NA9H 1EDQA 3GIVA 3MRIB 3QFJD 2A74B 4HX1A 4U6HA 5LAXA 1UENA 1KJMA 2B8OT 2C3VB 2RCSL 1EO8L 4NKOA 3A6CH 4P59H 2ESVB 5FYKE 1H8OA 4TRPH 3TO4A 4U6VL 5GGQH 2ZOKB 3NMEA 3CFCL 5HHPB 3BPLB 4Z5RB 4DGYL 5DQJA 3TJHC 1MI5E 3GMMA 1MJ7H 2Z4QA 4XP6L 1QZ1A 3SKNA 5C7XH 2YPVH 4RNRB 2AJZA 1HHKB 2WWKT 3BEVA 4LLWA 3FRUB 2ZUSA 1QR1A 3ARGC 3GSWA 1A2YB 5D8JL 4JKWA 4POZC 4OZHA 4A2MA 3QEUA 4PBVC 3D9AH 1PW3A 1DBBL 4QXTB 4RA3A 4R4BB 4YHKL 3EGSA 1AD0A 4ZXBA 4NC2B 2A1WH 2Q8AH 3T0ED 1PBYA 4TQEH 1KGCD 1VKXA 3VXNB 5IHZA 5IVNA 5IB2B 4BM7A 3CMOL 3BEWA 4N9GB 3AXLA 1C08A 2F58H 1JGDB 3W39A 4OAWB 3EYQC 3TN0B 4RQQB 3W11D 1EA9C 1OARL 3P2TA 3UJJL 2Z31D 5A2JH 4I2XA 3FOLA 4TVPE 1WSST 2DM2A 5DYOB 1A4KB 3ARZA 1YEIL 4HIHB 1X5KA 5ICYB 2VRAA 3RP1A 2ZOLA 4IEFB 3HZVA 1FORL 3MUGB 3ARRA 1U2CA 1XF3A 4G5ZL 1QO3B 4GAGH 1EHLL 3O45B 3LIZL 4LSQL 2XZCH 4JFOB 4BFEA 3SDCB 3O4OC 4KGJA 4QGYA 3L3OA 4IS6B 3QXAA 4NO5B 3O4LA 2ZCKL 1BQLH 4BSVA 5H37H 4L8BB 5HGAA 1IGJA 1OAZH 5C3TA 1NGWB 3VFGL 4PTTA 2R2BB 4O5LH 1JMZA 4APQB 3DVGB 4P9ML 3LPWA 3CNKA 2WBJD 4P2OD 1T22A 2PYEA 3QUYA 2VN4A 1IE5A 3I6GA 5CWSA 4EQ3A 3ROLB 4OCLC 1QSZA 3C8HA 1V7NL 4TPRH 1G7QA 2P5WB 3FOMA 4F7MA 4XVJL 5JOFA 4NIKB 2F74A 4JPKH 2BY2A 4O9HH 2CRYA 4NZRH 5ADOL 4AIXA 3SDAA 4FFYL 3OWEA 5L9DH 4GG6A 1S9WA 2V7HA 2XICA 2JELH 1OWRM 4LEOB 5K59F 3EAKA 4Y89A 2LQRA 2AEQL 3HKFA 3VXPA 5FGBA 3O6KH 2PYFB 4PJGA 1NC2B 4L9LB 1VACA 4NJ9H 4BSWB 1AH1A 2F5BL 2JB5L 3LQAC 5F7YC 3UDWC 4C56E 4RAVB 3SE3A 3ULVH 5SWZD 3V5DB 1OWWA 3P4MB 2ITCA 2Y36L 3ZDZE 1H5BA 1BIIA 3TC9A 4HS6A 4LHUB 4XNQA 4QT5A 3D3VB 5DZOA 3KHOA 4NN6B 1OSPH 4X6DF 1HQRB 4OBSA 5BMFH 3U0TB 1UB6A 3RI5K 3S8WA 3ULVD 4P3CH 1CU4H 1S5IL 1OF2B 2VDPL 2G5BA 5D96C 5F7UA 1ES0B 3IU4H 4KK5D 1UXWA 3B83A 5IBUG 4UMGA 1JFQH 1MAKA 3H0TA 4MD0B 3OB0H 3OAZK 4JPWH 4NKIH 1EEYA 2AJSL 1CXLA 1H3UA 1PKQB 4NCC2 1A9BB 3O9WD 4HS8L 3RPKA 3BDBA 4M6NH 2M8XA 3T0EA 2D7TH 2Z92A 5I19H 3MLZL 4IRJD 2P5EB 3H7BA 1UQSB 4CDGC 4P49A 3U46A 5D5MF 3SJVD 3O2VL 5CZVL 2BNUA 1XGUB 4XVUC 2IFFL 5I8EB 4D8PA 1ZA6A 4G80A 3BUYA 3QIBB 3B2VL 3ES6A 1YPZB 4MWFA 3QHZL 1QLRA 5DJ8A 2LU7A 2GSIB 1UJ3A 2P24A 4CVZB 5D7IB 3FB7A 1YYLH 4ORGA 1I8KA 4RGOL 1ZT7A 1CN4A 2VDLH 4QGTA 4MD5B 4RRPG 3V6OA 1GAFL 4HEME 4YDLB 3S37H 4X5XB 3P73A 2NW2A 3GBML 4IRZL 4UZGA 3VXTA 4OZGB 3VGAC 4D0DB 1CFTA 1IQDB 2GAZB 4MNQE 3BKMH 4RWYL 3FONB 1S3KH 4PPTA 4ZNEA 4OCXL 4P46B 2EXWC 1TNMA 3C8KA 3VMPA 5EO0B 2WBJA 4P2OA 4DVRL 1AIFA 2OQJB 3AS1A 1KJ3H 5L88L 2X4RB 3ZHDA 4BA8A 3LS4L 1UWGL 3B6SA 4U1MA 3KYMA 3IU3B 1VPOL 4MLIA 5C6PB 1IEBA 4PJEA 2VL5B 1JV5A 3IETB 3IDIB 4KKCD 4Z78A 2NZ9D 1N4XH 3B9EA 4PYGA 1ZWIB 4L4JA 4JB9H 3P3YA 1K6QL 2IEPA 2VQ1B 4NKDA 2XQYK 3WUWB 1F4WL 1RZFH 1L6XA 1SYVA 2X1QA 3JWOC 4PG2A 5DTFA 3MXWH 4JZOB 4M8VA 5T1KB 3WNPA 4IDJH 1A6AB 4ODTL 1FC2D 3MRNB 3B5GA 3PWVB 3MYZA 4KKNA 1KB9K 4YIQA 3O3DA 2HRPL 4M93B 3C60A 2F53E 1WBZB 1HQ4A 3WS3B 2R39A 1FBIH 3CUPB 5BCAA 3VD9A 1XMWA 5E8NB 2YA1A 2HFEB 4XHJD 5E95B 4XGZA 2F5AH 5SWZA 3QO0B 4YPGA 2CRMA 4YXLH 5GZNC 2HLAA 2HT3C 1I4FA 5BJTA 1Y6KR 2YPLE 1MIML 4OLVH 1IKNA 5DHYB 2WP3O 3GUTA 1JNJA 4U0RC 2ENYA 5EUKB 5JR1H 3Q48A 1F3JB 1BOGA 3GGWA 4JPIA 4TNVK 5EZOH 4ISVB 4NDMA 4Y88A 4YHMH 1Q9OB 4P4RA 3PL6B 2OTPA 1P1ZA 1D5MB 4HK0B 4PY8J 4QRUA 4CVWA 1TMCB 3EYVA 5JDJA 3S34L 4GRMB 3G6JB 5BW7C 3NABL 2EO1A 4K23H 5F97E 3VD7A 3MROA 2QQKH 4UUJB 4PLJD 5F3BA 5E2JA 3O9WA 4ELKA 2DQFA 3VFPA 4CMMA 5IMKA 5TPWL 1ZLVH 4IJ3C 4H5SB 4IRJA 1LHZA 5D71H 1HYSD 1CK0L 2R1YA 5DQ9A 1WBYB 5C0BA 4X9BA 3RNKB 2GJJA 3FT4B 4OM0H 3B9KB 3L9RB 2NX5B 2A2QT 4ZDHA 2FDBP 4K3JL 1OLLA 3GO1H 1KEML 4G6ML 2VDOL 2WIIA 2V2XA 5FXCH 4F7PB 2GJZA 5C08D 5KN5A 4M5YL 3GMPA 4HHAA 4LKCB 3PV6A 1GYAA 4OLUL 5IBLC 5IBTL 4F7TA 4Z7UE 2IBGA 1I8IB 1HHGA 4JRYA 4WU5B 2HN7A 3BPCA 3CIQA 4P3DA 3HC3L 2H2PC 2XQBH 5EC2B 1KBGH 3F8UB 2OR8A 3P11L 1CD0A 2DIBA 4YFEA 5I2IB 3KYNA 3HPJA 4GOSA 5ANMB 3FT3B 1Z6JT 3QUKA 4MQ7A 1DANT 1CDYA 2EDJA 5B8CA 1AR1D 3OB0K 3TNNB 4JFDD 3HMXH 3AY4C 3T1FB 1ZA3B 2ESVE 5EZJB 3S88L 1E4KC 4XCNB 3HTLX 1FCCA 3HE7B 3DX8B 2DQIH 3V52L 4Q97A 4YHIA 2R0ZH 4R2GC 3RWJA 5F93C 5GGVH 1AQDA 1FL6A 3MGAA 5T33L 3VXOB 2DQTL 4M1GL 4PJ7A 5E2UH 3VGFA 4Y4FC 3VXRB 1D3CA 3J8F7 2BC4B 3N9GH 1ZVYA 5DMKA 1LK3H 3LKSB 4H8WC 2EYTA 2FJGB 3O3UN 4KKBC 2PKDA 1X5ZA 4N68A 5JNYA 2VIRA 3ELAT 4KFZC 5I71B 1C5DB 5F9OH 2X7LA 5BXFB 3ULUE 4LSUL 5EU7E 1DVFD 2IH3B 2LU4A 5HGDA 3GBNH 3S96B 1N0XL 2AXGA 2E7BA 4K7FB 5IB5B 4NP4H 1P5VA 3LRHA 3BP6A 4FQXB 4W6YB 1A6WH 4XBGA 5EOTA 1SJEB 2HKHH 1LEKA 4O2EB 4DWHA 1QRNB 4DN4L 5DFVC 9CGTA 1KT2A 1TNNA 3MV7B 1U36A 2BOBB 2EIZA 4Q7DA 3JWDL 1I7UB 5JPNB 4PJXF 2YD7A 4PV9B 8FABB 1IQWH 1PYWA 1MCQA 4UAOB 2RJMA 5CD3B 1LK2B 3LS5H 3EOAB 3BDYL 3O2DL 2H45A 4NNPL 5CBEA 2FO1A 3BP4B 4ZOCA 3QH3A 5JA9A 4X9GA 4JDVA 2XWTB 4QRTB 2UVEA 1L4IA 3B9DA 3GKZA 4O2CB 2C3HA 1EAJA 4XCYA 3CDCA 1UC6A 2MPAL 2QHLA 3UDWA 3TIEB 5EWIL 3MOQA 4ZFOA 1LO0H 5GZND 4RFNC 4E0RA 3HC0B 3OKLA 4JY6A 3VW3L 3EOTH 1S8DB 2Q8BH 1F45A 2UWEE 4LARH 1S7QA 3QNXA 1QSVA 3DECA 4WW2B 5F7FA 2HKFH 5JIPA 3TIDB 4HFUH 3VXUD 1F97A 2OZ4H 5J3HC 3ARPA 5C0AB 2IC2A 3RIFF 5IM7A 1ZLWH 2XWBB 4LVHB 4IDLA 4XP5H 2L7UA 4PR5A 2P5WE 3WS6C 3RY5A 1E0OB 4M43H 4YNYA 2LVCA 2G75A 2PTVA 5CJOH 4NCC1 4ODUA 5EB9A 5C08A 1MRFL 4PJBB 3RY6C 2BJML 3HI6L 4JFHD 4XPTH 1A02N 3DRQA 4FQIH 4CBPA 1MCPL 4F57H 1TCMA 3UTTE 3SE8L 3QWOB 4BH7B 1BOYA 4N0UB 4XPFL 1FO0H 3BKYH 3PV7A 1K4CB 1OY3B 2JJTC 4XPHH 4K3HA 3T2NL 3UO1H 4P57B 5E5MA 2R2HB 3HZYB 2CXGA 5F9DC 2AEPL 3BIKB 4WHTB 4JFDA 3REWB 4F80A 3HRPA 4F2MB 1T1WB 5IBUB 1G9NL 1W0WA 1YNLH 3I75B 3I6KB 2DQJH 4MLSA 1G7LB 1FZJA 1ZLVK 1AGFA 3N1FC 4XP9L 3IT8D 4X5WB 2W9EL 4WFFE 4O4YH 5EULV 4JO3L 2EE9A 5CSZB 5IJKC 3GHBL 3H6JA 2WUCH 3O3EB 5D2NB 3V6FB 2XKUA 2YHGA 1CL7H 4UB0H 5FEBA 2VDQL 4KV5F 4XTRC 2PTTA 1AO7E 3IFLL 3STLA 5DMIL 5FOBA 4UQ2B 4EI5B 2BSSB 1AP2B 1MCBA 4RGND 4XP1L 5HSFA 1PKQE 2ATPA 2FD6L 2PXYB 5D1QC 5SV4A 1DVFA 5FM4A 4ZFFB 1YNTA 2P5EE 3MFFB 4C54A 1JGVH 1BVLA 3PDOB 4U4BA 3BPNB 4PLKD 4RZCB 1QFWI 2PF6A 2X9XA 4K3EL 1YPZE 3IAGC 4BYHA 4ACPA 1RI8A 2FX7H 3P4OA 1BZ7B 1ZK9A 1U8PB 5KG9B 5C0FB 2IANB 2H3NB 4MS8D 4PY7B 2UYLA 1P7QB 1U8MB 4AMKH 1KV3A 5F7EL 4XH2A 3X12B 2E6PA 3NCYP 1Q0YL 3FHAA 5KSUA 5C07B 5BV7B 2AABH 1OHQA 3MRJA 1TPXB 1MWAH 2JJUA 2ZUYA 4MXVF 4AT6B 3W5NA 2QHRH 3MLTB 4ODSH 32C2B 1NGXB 1DQMH 1N8ZB 1DQQB 3BGFC 2VN7A 3HC4L 3G6AA 5FUOH 1H3GA 4U1NB 5JW5B 4XP4L 4CU6A 4F37K 4OGZA 4GW4A 4FXKB 5KSVB 1T04A 4XVTL 3HZKA 2XZZA 1X7QB 2FIKB 4NO3A 4J8RA 3K80A 5HY9A 1I8MA 5FYLD 5JO5B 2AEWA 3PP3H 3BSZH 2FSEB 1B4JH 3GMLA 2MSPA 1IFHH 3K3QA 1MCNA 3MLUH 3V4VH 4OV6F 3S97C 5IMOA 3ECBA 4LNRB 3N1PC 3LAFA 4V1DA 5EOCJ 2CIKA 5BW7A 2E27L 2IQ9H 4JJ5A 3TESA 2VXSL 2CDGA 4PJ5D 1D5IL 5HHMB 3G5XA 3LY6A 3EUUA 4NRZA 2FX8L 2BVQA 4LCWD 1J8KA 4MDJA 4RGMC 1X5XA 4XNUH 3IB4A 5JORB 2OZ4A 2GT9B 3ZE1F 2VKXA 3VJ6A 3QCUL 1R24B 2FATL 4C4KT 1GHFL 4PJDB 5CINL 2MTPA 2DQDH 3FRPA 4LLYB 4YHNB 1P4BL 2ITDA 3O6FB 4R90L 5IT2L 4X80H 1K4DA 2XY1A 3STZA 5MEOA 1NCUA 4LVEA 4CW1A 4WNQA 3SKMB 2B5IB 4JFQB 3LSOB 1KJ2H 3MRFB 4PRIB 3U2SB 4AJ0A 4LCUA 3QIUD 2JF1A 3BPOB 1HIMH 2YPKA 4GKSA 1H15B 1T4KB 1FL3B 2JE8A 1MI5A 1FFNA 1Y6NR 5D2LE 1V3JA 3SPVB 1Y0LB 3MV01 1QFWL 4OD3H 4XCEB 1HCVA 3GJFH 4W4OA 4GO6B 3ME0A 1AFVL 2XA8H 3PHSA 1ZLWK 1C5BH 4LLMB 4K2UL 5E2TL 2AJXH 4MJ6A 4ENEC 1RU9H 4NO2B 1CG9B 1BX2B 4ZS7H 4UT6H 4NWTL 1KLUA 5E4IA 4OV5B 4JKLA 1S9VA 3AY4A 5HJ3A 1CGYA 4KZEH 5AUMB 3IDUA 5IF0A 1JPSL 5D9SA 5D1XD 4X7CC 1YYMH 4WFHD 3VGGA 1E4WH 1FJ1B 4FZ8L 5MP6L 3K2UL 5C9JA 3VI4F 1NC4B 5IQ9B 4UV4H 1JPTH 4URTB 1RZKH 3ZYZA 2NX5E 1OTSD 1BFVL 3D18A 5HHOD 2H1PH 1JHTA 5GGUB 1M6OB 3ZL4H 5GGRB 2IALA 4MZ3A 12E8H 4H0HB 1YEEL 4ONHB 3RVXC 1FZKB 5CKAA 4BFIB 3CFIC 3SHSA 2R0WL 2AS5M 5DJAA 4ZUVB 5DI8B 1DBJH 3AM8A 5D1QD 2CMRH 1NCWH 1DEEB 1U93A 2J88H 2CK0L 1S7VA 3SGJA 1C1EH 1YEKH 1Q9WA 4Y8AA 3LDBC 3GSXB 5FDWB 4K3DL 3BE1L 5ANME 1WJ3A 3DARA 1GOGA 1GGYA 1BBJB 4NGHH 5ALCH 4FQ2H 2AXFB 2E3VA 1I9JL 3MMEA 5I8OL 1NBYA 4QCIB 2XNAB 3ULUC 3PWNB 5EU7C 1EJOH 5KS9F 4PG9B 3OL2A 2OK0L 5GZOC 1MPAH 3ROOA 5I1IH 3PWUB 4IOFD 4WHDA 3WHXA 1YEFH 3HI1A 4NQCE 1ORSB 1L7TL 3WEXB 5HGHB 2XG4A 1U3HD 1YC7A 3CDFA 1RFDH 4KMTL 1KYOJ 1KLFA 3TYGH 5BZWB 2DI8A 4EXPX 1KCRH 1NFIB 3JTTB 3L6FA 1YEJH 4KI5D 4PJ5A 3P30L 5IMLA 3C2SA 4AIZA 1U8HB 4LCWA 1I85C 5FV2A 3SDCC 1G7IB 3LOWA 4QXGH 5SWSD 5I1AB 2CXKA 4U49A 2CO7B 4LSRH 1F4XH 3L1OH 5HPOA 5HDQL 1FP5A 5KSBB 3BN9C 5SWQB 5F1SA 5DDHA 3VFOB 2WAHA 1A22B 3MJ7A 4H1LG 2F19H 3BJ91 3DMMB 3W81A 1IC4H 4S1QL 4AM0B 2W0FA 1RHHB 3TBYA 3MV7E 3QIWB 5M95B 1EVTC 1A1MA 5AWNH 1FQ9C 3K7UA 3QIUA 3DVNB 3OXSB 1AR2A 3RY6A 1GH7A 3V0WL 1JGUH 1AJ7H 3FQWA 4Q0XL 3PP3K 3EW3B 4PJFA 5A16A 5B38B 4KJPC 4N5ED 1Q1JH 2EE6A 2JJTA 1NBZB 1BWMA 1MHPH 4G6AD 3SCMB 1KEGL 2X70B 4BZ2H 1BFSA 1OTTC 3O2WH 2EDKA 1KN2L 1RZJL 2BOCB 2NY5H 3PJSB 4JRXB 1KLGA 3ZT7A 5JDSA 3O41A 3WN5B 4XPBH 4OKDA 2YD5A 1NJ9A 2Q1EA 4XNZB 4HKJB 2YUXA 4DKAA 3VDCA 3LKRA 1MH5B 5HVFB 2B0SL 5D1XA 3CVHA 5GJTL 2C1PA 4U1HA 4N8PA 3ARYA 3B5TA 4L9LC 2HFTA 3VE0B 2CD0A 4M7LL 4L3ED 1ZKAA 3T3ME 4JN1L 3WHE0 5BRZB 2QBWA 3CH8A 5HHOA 3RL2A 1D6VL 1IC5H 5C6WH 3L3JA 4WI5A 1T1XA 1UM5L 4G7VL 4I18A 3LN4B 3VFNA 3U9PH 2H8PA 4K9EH 1H0DB 2C5DC 1N2RA 4A6YL 1KCLA 3KYAA 3QO1B 4ZUWA 3VMNA 2X4OA 3HB3C 3HG1E 4JN2B 5D1QA 2QEJA 3I02B 4GH7B 1I7RB 3AREB 5FGSA 4N0UE 4IMLB 1QSEB 1CZ8L 3CD4A 3MZGB 4JLRB 1ORQA 3X3FH 5EIIA 4X6DB 1XR8A 3GJFK 3VXMD 2LAGB 1RUQH 4MNQA 1UB5B 4JO1L 1QVOB 5HYQB 3MR9B 3D0LA 2XIDA 4AEFA 4AZ8A 5EBWA 4HKXA 2WWMD 5C0DA 4RDQF 5EC1B 1T1ZA 3CSYB 3WFCL 4X8JA 2BVEA 4LSSL 4RIRB 2VUYA 2CK2A 3IJHB 3K46A 4OLXH 2YUWA 1G7PB 2ORBL 5EO9B 4XNXL 1QOKA 2ADIB 2AJUL 1ZOXA 5E8EA 5GGSB 5DD0H 4W6WB 1CGVA 4YDKL 3GIZH 1T03H 4I3RL 1D6EA 4LAJH 5D2NE 2ZUTA 2X1XR 1GZPB 3QEQE 2BFVH 4LSDA 4OCYH 5D5MB 5J13C 3ILPB 4I0PB 1MAJA 1MRDH 1ZLUH 2EC9T 3D48R 3ZTNL 5HI5C 3L5IA 4YHZH 4JFEE 3RX8A 2VDMH 5E8OB 3TBWA 3ULUD 4CDHA 4YDLC 1NAMA 2VQUA 5SWSA 3GRWH 1V8HA 4WTXA 1DANU 1L9MA 4LF3B 2IAMB 3BGMB 2A77L 1CGSH 2Q7YA 4H88L 4WO4B 3TN0D 2X4TA 2VLJB 4U1KA 1NBVL 3QDHA 3VXSE 1WTLA 3CFBB 4HCRA 5J57B 1R3LB 2H32H 1RJCA 1V7ML 3WDIA 3SGDI 3A67H 2KUTA 4ZFGH 2R4RH 2GITA 5IUSA 4ONGH 3OGOE 4N1CA 4KROB 1TZGL 5CEZE 1U8KA 5JHDB 3EJZC 1OLZA 1CE6B 2F8VA 2HFFA 3PDGA 4D9RD 4PGBA 2FL5B 3LKOB 4KDWA 2DIJA 4OFDA 5E1AB 4WGWB 4PV8B 4ZPVA 1G9ML 4TTDD 3WFEL 1I8LA 4FMFA 1LVEA 5CSGA 4NQSA 2N1KA 1PX3A 4Z7NE 2VZSA 2DBJA 2L7JA 3KXFB 2HMIC 1BFTA 1N7MH 3KPPB 1TVHA 2EYSB 3MUY1 3HE6D 3S4SA 5A2IH 2D0HA 4APQD 3GSNH 2X4QA 1SMAA 2SEBA 3TEUA 4DCQB 1N5AB 1LDPL 3C9NA 1YZZA 4JG1H 4GW5B 4HUKB 1LEIA 1VGKB 3QPQC 5IK3B 3U30C 2QQLL 3OZ9H 3PUCA 2FJHB 1JF5A 1SYSA 5J6HA 1I9IL 3TBVB 5DMGC 1KIRA 3SO3B 2NCMA 5I8CB 4GMTL 4MVBC 3SQOH 5L2JA 3ARDB 1XFPA 1YC8A 1JYVA 1YDPB 1CDJA 5IB3B 3G5VA 2W65A 2Q7NA 4ZSOB 4ZUUB 2DWEB 4HXAH 3OF6D 4OUOA 1NLBH 1GGBL 2DLIA 5HHME 1SVZA 1BQSA 1CCZA 2A6DA 3EYUH 4P9HH 3JUYA 5E7BA 1MHCB 2APXA 4Z7UA 1GXEA 1AGEB 5I1KH 1NCBH 4JGJA 3MACH 1A3LL 4R3SA 2VO5A 4R6UA 1NC2D 4HIEA 4M00A 1RUMH 4HKBB 4GRWE 3EOYG 4RAUB 1CR9H 3ULSA 3I9GL 3LN5B 3MRIA 2A74A 4XAKE 4YO0B 2GK0B 2C3VA 1TTUA 4PRHD 3RVVD 2ESVA 4LHUD 3RTQC 1A6TB 2ZOKA 5D4QA 4Z5RA 3EDEA 5HHPA 3KNBB 1FPTH 1NAKL 3D3VD 2ZZUT 1RSFA 5FGCE 4OIIH 4GXVL 3T77A 1JWMB 1CF8L 4RNRA 1HHKA 2R0LL 5FYJH 3FRUA 3IFOB 1BZ9B 4D9QD 5EOCH 1A2YA 3QA3B 1MJJB 4HF5H 4NHCL 4M7ZB 4NZUH 4QXTA 5A2KH 4R4BA 1ZTXL 1VSCA 1ZHNB 3BQUB 1JNLL 1FLRL 4PGEB 1FSKB 2NY3B 3KPSD 4YPJA 5I9QB 4OUUB 5FYJD 2DL2A 3M8OL 3HFMH 3TPKA 1SJVA 2BNQD 4MQXD 5MEPB 4CAGA 5IB2A 4JZNA 5E99H 1B2WH 4N9GA 1FE8H 5AZEH 2XWJA 3S35L 1KENH 4FFWC 5DEZA 3LQZB 1JGDA 4OAWA 4ZUSA 3I50L 4RQQA 3OJ2C 4YXHH 2AGJH 3QIBD 1A4JB 5FK9A 4NKMB 3IFNH 5DYOA 4M1DH 1A0QL 4MSWB 1ZXQA 4HIHA 1OP9A 3T3PF 1KB5L 4EDXB 5ICYA 2LE9A 1IAIH 4J3OC 5J11B 1S7WB 3MUGA 3U0WL 3HE7C 1QO3A 4G6JL 4HUVB 2HTLC 1T20B 3O45A 2VDNH 3MX0A 4R97B 5DC0A 3SDCA 1KXVC 3A6BL 2D03L 4IS6A 4BK5A 3RZCD 2DICA 2EZ0C 4NO5A 4DFIA 3C6LB 4FQLH 15C8L 4YH6A 4QRPE 4L8BA 1GGIH 1NGWA 3KPNB 4LFHD 4APQA 3DVGA 4P46D 2EXYD 1ZLUK 1CWVA 4KTEL 1WEJH 5T5NG 3VG9C 2AK4B 2RAMA 4ELME 1HSBB 1TJIH 4FFVC 1CLOH 5I18L 1DL7H 3L5JA 1S9XB 5I66B 4ERSL 3DSFL 1GL4B 1CXKA 4FQXC 5ACLA 4Q9RL 3OHXB 4MDIB 2ZKHH 2P5WA 1F90H 2DQCL 1OPGH 1Z3GL 4L5FH 4FNLL 5T1KD 4LMQE 2J8OA 3EFDH 2EH7L 4H1LB 1MRCH 4UAOC 2J5LC 3CXDH 5GISL 4U3HA 4PJXB 1QBMH 4LASL 2VDRL 4JDZB 1H8NA 1LE9B 4FFZH 3F58H 4LEOA 1I9RH 3U7YL 2PYFA 1SEQL 4L9LA 4MVBD 5CILL 2WINB 1NL0L 1T7VA 2CGRL 2LTQB 3T2QA 4YE4L 3V5DA 4XNMB 1BHGA 3P4MA 1GGCH 1UM4H 5FA3B 1YN6A 1REIA 4LHUA 4LKXB 2AKRB 4WWKB 3D3VA 5MERB 5TE4H 1AXTL 3E6HB 1HQRA 4I77H 3LEYL 1T2QL 3U0TA 5JZ7D 5TE7H 3MBXH 1AGCB 2OI9B 1I1AB 1FNAA 1OF2A 3PL6D 2VLRE 2VSDA 3OR7B 5HBBA 4HFWB 3MXVL 1ES0A 3QRGL 3QHFH 4LVHC 2W0LA 3LQAL 4ODXB 2AJ3B 1EFXB 1IT9L 4MD0A 3UX9B 1QFUH 1DBMH 1M71B 3LRSB 4ZFOL 2P42B 1PKQA 4U0QB 1A9BA 1A14L 1X5HA 4O51B 5DVKA 3WJLC 3PQYB 1UG9A 4QYOB 1KTLB 1FVCA 2P5EA 2AQ2A 1UQSA 2E9IA 3CLFL 1SJXA 5T5FH 5E94A 1XGUA 3B9KD 5I8EA 3QIBA 5IHUH 3T8XB 1YPZA 1IGIH 3SQBA 4WV1B 4LQFL 3C08L 2GSIA 3DX9B 1EEZB 2MKLC 3GSRB 4CVZA 1YQ2A 5D7IA 3LPGA 2YMXH 4UILH 1NCDL 4WUKL 3AB0C 3TFKD 1WWAX 4MD5A 4PUBH 3KR3H 5CZKA 2VZTA 3MRGA 4KMLB 4LLUB 1L0QA 4OF5A 2FCBA 1IGTB 4HK3N 4X5XA 4AEHH 6FABH 4PIRF 5DRWA 4FFWD 5D2NC 3V8OA 1CLZL 4D0DA 3FJTA 1IQDA 2GAZA 2BK8A 1RJYB 3MJGX 1DN0B 1CBVH 3FONA 3NCJL 4OI9A 4P2CG 5TQ2H 1JNNL 4P46A 5JQ6L 5CIPB 4R26L 3ISWA 5EO0A 1JI1A 2OQJA 2PXYC 2VLLB 5A43C 3R06B 2VC2L 2X4RA 1W72H 4QNPF 3MLPA 3NPZB 3IU3A 2IQAB 5DR5L 5EU5A 3BPNC 3QUXB 4PP1D 4U31A 3VXRD 2VL5A 3IETA 3CLEH 4C59B 5F9WC 4YHLL 1ZWIA 3GI9H 3LMJH 2VQ1A 4FQCL 3ZKQD 3CK0H 4L9DA 3WIHH 4N0RA 3WUWA 5HPMB 2ZUUA 4LHJB 4JZOA 5T1KA 2UZIH 3OKEB 1M7DB 3Q5OA 2Y06H 1A6AA 3MRNA 5LXGH 4NQTA 1BAFH 3PWVA 4OFYD 1TPXC 3NPSB 4NHUB 3MCLL 3WS3A 3CUPA 1CD1B 4HD9A 4FQXD 1DFBL 4XC3L 4LGRB 5DMYA 5E8NA 2MCPH 1XGPB 1T89A 2HFEA 1QRND 3IVKB 1F4HA 1KOAA 1TJGL 2QQNH 4KVNL 5F1NB 2YUVA 4YX2H 3ZZ1A 3CPLB 5FCSH 5J1AB 3JWOL 5IFJB 1G7HB 3I3BA 3WKML 5KANG 3CX5J 5DHYA 3GSOB 5EUKA 5H2BB 3N85H 4JJHA 3GK8L 1F3JA 1JF1B 2X9YA 4ISVA 1ZE3C 3TH4T 1Q9OA 1CICB 4OIAA 4JPVL 5J1SC 5L2KB 3O0RH 4MAUH 1D5MA 4OT1L 4J6RL 4HK0A 1C16B 1GGTA 4FN0A 4YJZL 5GRUH 1GPOL 1FFOB 4GRMA 5C0RH 1A1OB 2FEDD 1BD2B 4P5TB 4X5LA 3L7EB 2I26N 4UUJA 3A0OA 4P2QB 3RL1B 5JA8B 1NCCL 4DQOH 4GAJL 5DD3H 4MHHI 4JKPL 2KDGA 1I1FB 4QHMB 4B50A 1DQJB 3OJVC 4H5SA 3QI9D 2ZPKL 3EO9H 2IH1B 4D3CL 3TPUB 1WBYA 3RNKA 4L8DB 3FT4A 3O6FC 1KELH 2FBOJ 3B9KA 5C0AD 3L9RA 2NX5A 3I2CH 4UDTB 1IGCL 2F54B 2Z93B 3FHQA 4BZ1L 3O11B 5DVMA 4F7PA 3DXAE 3WHE1 3D0VB 1S7XB 4LKCA 5CP3H 4KKAC 3HR5B 4XRCB 2ZCHL 4NBXB 1R0AH 5D1ZB 4M4PA 3KLHD 5GS2H 1I8IA 3LZFH 1FH5H 2C4XA 1CIDA 2ZG2A 4WU5A 2FHCA 4AL8H 4X7TB 5FIEA 2X44D 3CFJB 3C6SB 5EC2A 5C0GB 2EDRA 1BQHB 2Z8WC 4RMSA 4LAQH 1BEYH 1JHKL 5I2IA 5ANMA 1U8IB 5D93B 3FT3A 1F5WA 1R3JB 4M61B 5I1HL 4XVSH 5I17B 3TNNA 4P2YA 5FYKL 3TA3D 1OAYH 3T1FA 3IDYB 1ZA3A 3PWJB 2NY2C 5EZJA 3NAAH 4M6OH 3HE7A 5D7LB 3DX8A 5EU3B 5IW1B 1F4YH 3EHBD 2XTJB 3FO0H 3TVMC 4YUEH 5DJ6B 3VXOA 3SOBH 3B8YA 4NQCA 3VXRA 3RVUC 2NTFB 1KG0B 1A6ZB 2BC4A 4LSVL 5GRVK 3LKSA 4P4KB 1UACH 5C0CE 3B3IB 2FJGA 4PJ8B 4CN1A 3QUZB 4EI5D 1KPRB 4JHAL 1R5VB 1DLFL 2J7LA 1RV6X 1Z5LB 4HX1B 2J6EA 1S7RA 1C5DA 3N1QC 4H26B 4ZS6C 4M1CD 3TO4B 2J8HA 3ARFC 4OFYA 4XI5D 3S96A 2ZUXA 1Q94A 3QUML 4K7FA 5IB5A 5JOEA 3EOBA 4F58L 4M7KL 3KPOB 5ACMA 4FQXA 1B6DA 1PEWA 3WIHA 2A6IB 5BV7H 4LLWB 1SJEA 4O2EA 1QRNA 4POUB 1OP3H 3QJFB 4LLDB 3MV7A 3QEUB 4I9WD 2DTML 2BOBA 4H8WL 4WWID 5ILTH 1OCWH 2BCKA 1L0XA 2IAND 3T4YB 2QQQA 1EO5A 1I7UA 1QLEH 5JPNA 1KCSH 4PV9A 8FABA 1R5WB 2EH8H 1P7QD 3L3IB 4KQ4L 2V5YA 1DSFL 5IQ7L 2VH5H 3O8XC 5CD3A 1JHLH 4KDTC 2W9DH 5C09E 3EOAA 5C07D 4UV7L 5HHNA 3MRRB 1QQDB 4XAWL 4TOYL 5LCVL 5KS9B 4QRTA 2P8PB 3V2AR 1X5GA 4L29A 1JYWA 2EC9U 4KDVA 2NY4C 5EZIH 4O2CA 5CD5C 3NH7H 1CGTA 4ZODA 3O3AA 4P23C 2HYMA 2ARJB 3TT3H 3E8UH 4HIXL 3MLYH 5L7XH 1EHNA 5TDPB 3HC0A 1QSFB 4I13B 3QBTB 2IFGA 2ZOLB 4KAQH 5F89B 4E5XB 2AK4E 1MF2L 2J4WL 5TDNB 5LBSL 3S35X 5SX4H 4OBRA 5T3ZH 1AI1L 4KU1A 5DURB 1NCAH 2G5RA 3GEWB 1INDL 3MZTA 3LEXB 1RZ7H 2YEZB 4WW2A 2MNUA 4NWUL 3TIDA 3WXWL 3IJYB 1ND0A 3L3OB 4AK1A 5ESQB 5C0AA 1OD9A 3QXAB 3O4LB 1J1OH 3HNTL 2XWBA 4FTVD 3GM0A 3U82B 5KSAD 3QIWC 1U92B 4EUPG 5DK0B 5EOQL 3ZDZF 4UT9H 4PTTB 5T3ZD 4KHXL 3GJEB 4EQ2A 1J1PH 3MLSL 3G9VA 4PJBA 1EO7A 3SO5A 3VWJB 3QXUA 3WLWC 3D39B 2FB4H 3WJLA 2H9GB 4HEPG 3QWOA 4BH7A 4N0UA 4PJFF 1K4CA 3QAZB 2W0PA 4ZOAA 4EZMA 2IBZY 3SCMC 4LRNH 5IIEB 1SM3H 2D7PA 4CKVX 1VGEH 3I84A 4W70A 4XBEH 4B53A 4S0SD 4XAKD 2R2HA 5I30L 4HW6A 4M5ZL 1T66C 3BIKA 4WHTA 4Z8FH 2YK1L 4PRID 4WENB 4YFDB 5EORL 1JZ5A 3ZTJG 1UZ6E 5CJXA 4F2MA 1T1WA 1QP1A 1A7OH 3NCYS 1FGNH 3I75A 3NGBC 4XPAH 3I6KA 3IDNB 1Q9KB 1G7LA 1UM6H 3MJ8B 3SDDB 1A6PA 3WYRA 1BJ1J 4A6YB 3RKDD 5ID0A 5HDBE 1X9QA 1NGYB 4KPHL 4HIIA 4OFKA 4I4WB 5TF1L 5CSZA 3O3EA 5D2NA 3CFCH 2NR6C 3QEQA 2LAAA 4XMKL 2OJZH 1T0NB 1IARB 3L3HB 2PO6B 5IJVB 4XP6H 3EO0B 1RZIB 5EU6E 2BRRH 5JW3L 4AEIH 1DLHB 1VACB 5BQ7B 2CPCA 4UQ2A 2DJUA 2EO9A 4EI5A 2BSSA 3WIFB 1AP2A 2PUQT 5D8JH 3RAJH 1FYTD 4LRIC 2PXYA 1J0JA 1TQBC 1BIIB 1DBBH 3G9AB 3F7VB 4NM4L 4YHKH 4ZFFA 1MLBB 4XWGL 3CVHL 1RZ8A 3MREB 3PDOA 1XCTB 4RRPA 1NC4D 1U91B 1A7NL 1JRHH 5E6ZA 4J4PD 4J3TA 2Z9TA 5JXEC 1BZ7A 1U8PA 1TTGA 3BIAX 1QD0A 5FYJU 5JMOC 5C0FA 5KG9A 2IANA 2H3NA 3MOAL 2BHYA 4JHZA 4PY7A 2X4UA 5HYIA 1P7QA 1U8MA 2GFBB 4Y7MA 2PCPB 4BFGA 1F42A 3X12A 2EKSB 5C07A 2KL6A 4GMSL 1FGVL 3DX6B 1FORH 4AT6A 3MLTA 3PABB 4G5ZH 1HKLL 32C2A 1Z0NA 1NGXA 1N8ZA 4LVNC 3LIZH 2BNUB 3RWDB 2VISB 4D8PB 4W6XB 4OQTA 3EDJA 4U1NA 5IMMB 5JW5A 3NZ8B 4S1DD 2X2YA 3K1KC 1IGYB 2ZCKH 4FXKA 4MXWL 5KSVA 2I07B 1X7QA 2A83A 2FIKA 3VFGH 4MJ4A 5JO5A 4PJCB 2IAMC 2FSEA 4WO4C 4Q58C 4EI6B 1RMFH 1LO5B 5GGRY 2XZQL 4HWEL 4BKLB 4TN9A 1JMXA 4KI1A 4HV8A 4LOUC 3KPRD 4LNRA 1CFTB 4ONFL 3R8QA 3PGCA 1OP3K 1DP0A 2LVEA 4KROC 3B8SA 5CZXC 2YXMA 3QCVH 5A2FA 1XT5A 1V7NH 4D94A 3C8KB 3HRZB 4HAFA 2AJYL 5JORA 1UCBL 2GT9A 4XVJH 1BBDH 2YZ1A 4RX4A 4LLYA 4YHNA 3O6FA 1CFVL 4MJID 4K9EC 3DMMD 4FFYH 2DQUL 2DLGA 4RMRA 3VFRB 3SKMA 1XGYL 4JFQA 3LSOA 3B2UC 3N1GC 3MRFA 4PRIA 3U2SA 4Z7WB 2P8LB 2F5BH 3RNQB 3W9DB 1UH2A 1H15A 1T4KA 1FL3A 2ERJB 3WL9B 3WLWD 4MQSB 1JGLH 1G9EA 5GS1B 5IW3A 2GJ6E 5F7DB 1Y0LA 3SO3C 4XCEA 3BW9B 4U1JB 4X6CB 3SCMD 4RFOH 5L2KE 4AY0A 2IG2L 4WEBL 2P48B 1N6VA 3FB5B 4LLMA 4NO0B 5KVEL 4JRXD 3IXAB 4NO2A 1CG9A 1BX2A 3JVGA 1HSAB 1S5IH 1VFMA 2D2OA 4OV5A 4P2QE 4KK6D 5F96L 4OFVA 4Z7UF 1GC1C 2EIBA 5I1DB 2Z8RA 5AUMA 1WBXB 4PJHB 1NFDE 1NMCB 3TT1L 1CFSB 1D5ZA 2QSQA 1FJ1A 1LQSR 1ED3B 2E7CA 2LABA 5JTWA 4JQXC 1M1SA 1P7HL 1NC4A 5IQ9A 5BRZD 1F13A 2APBA 3PF2A 1J0HA 3MLZH 4O58L 1U8OB 5E2WH 2AXHA 3PIQB 2ZUVA 5GGUA 1M6OA 5GGRA 2ZWLT 4OZFG 3EYVB 1DUZB 2F54E 4ONHA 4QKXB 1FZKA 1TZHB 5CZVH 4BFIA 3QEHB 1A6VL 1PGRB 2IFFH 3QFDB 3D87B 5IVXB 2DLFL 3B2VH 4ZUVA 5DI8A 3M07A 3V5HB 2GTZB 5F3BB 3ARED 1CT8B 1Q8MA 1QSED 1TVBB 4S2SB 1QRKA 1I75A 5D72L 4R7NA 1NUDA 4M7ZC 4X6BB 4AENB 3GSXA 5FDWA 1NGPL 1GAFH 4QOKB 1BBJA 3ARGB 4XPGH 1VA9A 3UZQA 2AXFA 4OLZH 3UBXI 4NNXB 2EICA 5DT1L 3GBMH 1F3DJ 5D6DC 2V6HA 4QCIA 2XNAA 5KAQG 1KB5B 4OCSL 3PWNA 3UAJD 3WSQL 3ULUF 3QDGB 5D7LE 2V9TA 4PG9A 4JANB 3EJYD 1W8OA 2OJEB 4NQDD 2XTJE 4OCXH 2QADB 5CUSL 5FUZL 3PWUA 4X4ME 4DVRH 2HAZA 1JJUA 3KWWB 1ORSA 1TXKA 3H3KA 5L88H 3S98A 3WEXA 5IESL 5HGHA 3LS4H 4MHHG 2XPGB 4I0PD 1VPOH 2ZJSH 3T2PA 3WD5L 5F6HI 2NW3B 4HJJH 5BZWA 3DX7B 3KGRA 3TJEH 3UTZB 4QRRB 3JTTA 1KN4L 2EEAA 1U8HA 4UIKH 1QBLL 5FKAB 4R97C 1KXQE 1G7IA 5I1AA 1K6QH 3GMQA 3MJ9A 1S7UB 5CEXB 4QXWA 3C5JB 5KSBA 2IAMD 1F4WH 3C6LC 3MV8D 5SWQA 1A6UH 2VLJD 5DD1H 4I1NB 1UZ8B 3VFOA 1AQDB 1FL6B 4KHTH 2GYSA 4Y5VB 3DMMA 1A7QH 4PREB 1Q38A 5KVGL 4AM0A 1RHHA 1VFAB 2HRPH 3QIWA 1DQLL 1A3QA 1E6OL 5J6GB 4KROD 2MJWA 5EO1B 5JHDD 2EYRB 4TUOB 1A8JH 3MV9D 5F3HB 4P48A 3DVNA 5GGSY 2UWEF 3OXSA 4IM8A 3QXWA 1G7JB 4CGTA 5HYFA 3TO2B 1LDSA 5K33A 2R29L 1TETL 1AKJD 5B38A 4C83A 3KXFD 1NBZA 1J1XL 4EXKA 1MCSA 1MIMH 2AXGB 3SCMA 2X70A 2UV3A 4PJAE 2YXFA 4N5UA 3BP6B 3OPZH 1FV1B 2FLBT 2BOCA 35C8H 2K3TA 1OVZA 4JRXA 4O2FB 5I1GH 3WN5A 5K9QI 3VG0L 1EEQA 3DJ9A 1JPGB 4HKJA 1QSFE 2ADFL 1MH5A 4EEEA 5IHBA 3NABH 4UI2A 1MCLA 1QYGL 4G9FB 5L8LB 4PRPE 4UQ3B 3VE0A 3ARDD 5TF0A 3QH3B 2XN9E 3A6CL 1LO3H 4JDVB 4P59L 1EEUA 4E42B 1ULVA 5TPWH 1AD9B 5GGQL 2RFXB 3JV6B 1CK0H 3MO1B 4L4VD 4K7PY 4L4TB 1MJ7L 1MFBL 1JZ7A 3VI3F 4G8FB 3LN4A 4HGWB 5HI4D 3T0AA 5A2LH 4WWKC 1H0DA 1WICA 1KTRL 1D7FA 4MAYD 4QHKI 4UU9B 3QO1A 4K3JH 4Z7OE 3D39E 4PJIB 3RU8L 3OKLB 2O5YL 3I02A 4EVNB 3FT2B 1I7RA 5IROC 1KEMH 3AREA 2IBBA 4IMLA 1QSEA 5KVFL 1U2HA 2OI9C 1I1AC 3QG7H 4EJ1C 3E3QE 4M5YH 4X6DA 2NMSA 4OLUH 4HPYL 3EO1B 1UB5A 2Q8AL 5C2UB 1QVOA 5FECB 1JYXA 5HYQA 3MR9A 4TQEL 4NQEB 2WLZA 3X13B 4WUUD 3ZHLA 3WFBH 5EC1A 3CSYA 3P11H 4RIRA 3IJHA 1QR4A 1G7PA 1WISA 3FTGB 5EO9A 5E6ID 1ROWA 1ODAA 2R0KL 5D7JD 5D7SL 3X14A 3OKNB 5GGSA 4OCRL 3IJSA 3S88H 1IGML 5CP7A 1YPZF 1GZPA 4WV1C 5D5MA 3WJJC 1EBPA 3V52H 2XRAH 4F15B 1ZHLB 3ILPA 3OV6A 4I0PA 3CX5K 5D7IF 2XZCL 3BQUD 4QO1A 1WAAE 2DQTH 4M1GH 1H3PL 5DUBA 2NY3D 4Y4KB 5E8OA 4HGKC 4KTDL 4E9LA 1FG9C 2UZYB 3TP4A 2BMKB 4KVCL 5TDOB 4MA3B 2IAMA 3BGMA 4PS4H 4WO4A 1MFEL 4O5LL 2OTUB 4QHNB 2VLJA 4ZUTB 1AGFB 1DJSA 4KRMB 3UTQB 3CFBA 2V2TB 1WQVT 1R3LA 4KRPB 1U6AL 4LSUH 3NCEB 4EOWL 3P9MB 4HGMA 1N0XH 4GKZB 5HYSG 4QHLB 2RIKA 1EJ6A 1XCQA 4EBQL 3QXDB 4JFFD 3OKMB 1LE5B 1BJ1H 5JHDA 2GY7B 1CE6A 5FHBH 1T5WB 2FL5A 1BVKB 3LKOA 4OB5L 1T0MB 4X6FB 3HA0A 5E1AA 1WIOA 4PV8A 4FQQB 1QFPA 4EN3B 3GBLA 3JWDH 4GQ9L 4XC1L 3QSKB 4FQ1L 3KXFA 4Z77B 4JPKL 1ACYH 3I6LD 4XB8A 5E0QA 1RIHL 2EYSA 3CFKB 2GUOB 5ENWB 3BDYH 2WQ8A 3OX8B 3O2DH 3HNVL 2FECL 3EDFA 4DCQA 4K8RC 5IV2B 3MRKB 2JELL 4GW5A 3VFMB 3K4DA 1TVDA 3RJDA 4DUWA 4ZTOL 2MPAH 1VGKA 2FYYB 5HDOA 5IK3A 1I1YB 3RX5A 5B3JE 4PJCE 1N5YH 5EWIH 2FJHA 2VJXA 5D7KE 5M94B 3DIFB 1BFOB 5I8CA 3ARDA 3P9LB 1S78C 2HJKB 3QNYA 5T1MB 4NN7C 1YDPA 5FV1L 5EBMB 2B2XL 4LBEB 4ZSOA 4ZUUA 2DWEA 2MHAB 4KK9C 1TFHA 5BMFL 3HUJE 4WFGE 3VFVB 2MQ3A 3FFCE 2YBRB 1MHCA 3R4DA 3SDYH 3ZT6A 1AGEA 2VE6B 4NO3B 1ZMYA 3NACH 3UTOA 2HTKD 4JPWL 4M48H 5GHWH 3FMGL 4JQXA 4XMLH 4HKBA 5AZ2H 3CX2A 5E1HB 4HH8A 1S7SB 4OF3A 5L0QB 3Q5TA 1MCPH 4I48B 1J86A 1MJ8L 3NFPB 3SE8H 4P5TC 1MCIA 4OKVB 4M6NL 3RX7A 3LN5A 1B6UA 2GI7A 4YO0A 4HZAA 1HHIB 2GK0A 1KPUB 4E41B 4Z7WE 1A6TA 1AC0A 5ESVB 3KNBA 1LD9B 2W91A 4HIJA 4X0KA 2AEPH 2E9WA 1JWMA 3WFHB 5HTSA 3TF7C 2NXYC 4PBWD 1I1AD 2VL4A 3IFOA 1MREL 4QF1B 5ETUB 1BZ9A 4IJ3B 3QA3A 1MJJA 1G9NH 2VSCA 3HAEH 3VXQB 2VNCA 4OGAD 1JZ4A 1EFXD 3AUVA 4R7DB 4HDIB 4XP9H 2DJSA 3AMKA 1EZVY 4LCCB 2W9EH 1IAOB 2N7AA 3CZFB 3BQUA 2PR4L 5MEOB 4JO3H 3ZKND 4PGEA 3GHBH 1FNSH 1OGAB 1FHGA 4CU8A 5KVMC 4OUUA 5D1ZC 3CGTA 1J8HE 1DBKL 3PQYD 5MEPA 5TFSH 3KJ4B 1Z9LA 4IHOB 4OZFB 4PJHE 3IFLH 5T1DL 5DMIH 2P47B 3BKML 2C4FT 2H2SD 3LQZA 1S3KL 3INUL 3ALXA 2APTA 5D93C 2GCYB 4GBXD 4Z95L 1RUPH 1KJ3L 4MSWA 3LQMA 4EDXA 3HLAB 1RURL 3IDYC 1S7WA 4EIGB 5AAMA 4MCZB 3MC0A 2MFNA 2Y1VA 4HUVA 5IVXE 1D5XA 1T20A 4K3EH 4LIQE 1QPXA 4NM8H 5C09A 2XTJC 3WIIL 1WF5A 3H9YA 1U9KA 4R4FH 4DW2L 3C6LA 2I5YL 5DS8B 3UJIH 5DJYB 3QUMB 4R2GB 2YWZA 3MXWL 1YNKH 4P4KC 2HT4C 5C9JB 3KPNA 1Q0YH 5CGTA 4PJ8C 4Y4FB 2JJWA 1K85A 4NCDA 3W0WB 1B0WA 3DUUA 2E9BA 2AK4A 5DO2C 1HSBA 4X9FA 2NY0D 4XP4H 4XBPB 5I66A 3QUXD 3IGAB 1U93B 4C4KO 3MLXH 4JR9H 2BVUA 1MFDL 3ORJA 1EXUB 2D31B 2GSGB 2GW5A 5E8DH 3V95A 4YXLL 2HWZL 4X4ZA 4WHYG 3OHXA 3RUGB 4MDIA 1OQXA 5HYEA 1FIGH 4FS0A 1ZLSL 5JR1L 5GXBB 2O5XL 3MBEB 4QRRE 3C5ZB 4H1LA 5F1IB 3GSQB 4Y2OA 5CKGA 4JDZA 1LE9A 4AQ1B 2DKMA 4X9HA 3DRTB 4ZO8A 2E27H 1KXTB 2QQKL 4YHPB 1RZGB 1F3DH 3P77B 1A7RL 2WINA 1OSZB 4ZAKC 2D9QB 5GS0H 4XNMA 4Y4HB 1GHFH 4NUJB 1OTUC 5FA3A 3OAUL 5D71L 5CGYC 1D9KB 1P4BH 4LKXA 1DCLA 5IT2H 2AKRA 2X1PA 4WWKA 4G7YL 4KRNA 2V5TA 2XKSA 4OM0L 4RFNB 5MERA 2QSVA 2WP3T 3E6HA 5IROA 3GO1L 3LKQB 3UBXG 1AGCA 1I1AA 1CICD 2E7LC 3T3MF 3OR7A 4OGXH 1Z9SA 4HFWA 1YN7B 3FZUC 1KFAH 4IRSC 1BQUA 4ODXA 3ZSSA 1BD2D 2AJ3A 3VH8B 4P5TD 3WNKA 4C56B 5HHQB 1NEZB 1M71A 3LRSA 1XH3B 2G9HA 4F9LC 4PJBF 4MA8H 4MNGE 4X7FC 3HMWL 1KBGL 5A3IC 1DZBA 1AFVH 3D2UA 4JY5L 3BRDA 4OF6A 4QYOA 5E2TH 1KTLA 3QAZC 5CMAA 4G9FE 2GTWB 1VEOA 3E3QC 4HG4J 4GRLC 4NWTH 5IW6B 1JPST 5BO1H 3T8XA 4JZJC 4KC3B 5DWUL 1JPSH 2WIMA 4WV1A 3WJJA 2QR0B 2F54D 3DX9A 3JXAA 5ID1B 1EEZA 4FZ8H 3GSRA 4Y16B 1DTUA 4Z0XB 4L4TE 4OLYH 4Y1AB 2VLME 4MA1B 5GGVL 1WLHA 3RRQA 1NH6A 4X98B 4YQXH 3O41B 4H0GA 3QCTL 3RIFK 2X1OA 4PJIE 1IGTA 3TM6A 4CVXA 2XQYG 1HHHB 2IPTH 3N9GL 4X7DC 2FGWL 1YEEH 1IM3B 2NXZD 3SN6N 5C0IB 1RJYA 2PO6C 4UBDD 3VD4A 1DN0A 1RULH 3QNZA 5K93A 5HI3D 5SX5H 5EBGA 4BJLA 2BX5A 4HJ0C 5CIPA 5J56B 3BZFB 3GBNL 2I60L 2VLLA 5GGTH 3EYSH 3R06A 2JK5B 4K3DH 3F6IA 5D7LD 1KCVL 5ISZE 1A6WL 5GSVB 1N2RB 1OW0A 3EKCA 2IQAA 2CJUH 1I9JH 5LGHL 3MLVH 5I8OH 3QUXA 5KW9L 1MHHB 4U2ZA 5AYUH 5DHVB 1CL7I 4GUPB 2X4NB 1U3JA 4G8GB 1IQWL 3P40A 1AE6L 1WFNA 2NYYC 3VDAA 2OK0H 4FG6D 3ZDYF 4PJ8D 3QUZD 4MNQB 4K55A 5DC9B 5HPMA 1MCOL 5C0NC 2V17H 4UT7L 3RBGA 5EFIB 3TH3T 3OKEA 4QRQB 1YY9C 2E6QA 3IDGB 3KPLB 1DQTA 3BO8A 3TO4D 3KDMB 4BQ8A 2VLKE 4X99B 3RFZC 4KMTH 3RVWC 4OFIA 4Z7NF 4Q9CA 4NHUA 1EHAA 2P45B 2Y07L 3QDME 2Y7QB 1CD1A 4OCMC 3IVKA 1F2QA 3UTSE 5F1NA 1EVUA 3MYJB 3CPLA 3PNWB 5CEZL 5J1AA 5IFJA 1G7HA 2VERN 4NZTH 1NQBA 1FFRA 3TZVB 4HFUL 1X5FA 3GSOA 5ERWB 1B90A 4S1QH 5H2BA 2VWEE 4HUWA 1JF1A 2ICEB 5JW4Q 4XP5L 2DAVA 4P99A 3J7HA 1CICA 4MNHB 5L2KA 5J1TC 1E4XL 2F53B 4Y5YB 2XFXB 5DFTA 1FFOA 2CKBB 1A1OA 1BD2A 4OQTL 4P5TA 1PX4A 1EPFA 5T3XH 1QEWB 1OTUD 4P2QA 2XACC 3RL1A 1RY7B 3BKYL 1DBAH 5FKPB 3RBSA 1KEGH 4POYA 2AV1B 3QB7C 3UO1L 2YPLB 5C71A 1I1FA 4QHMA 1DQJA 1GVIA 2E8ZA 2VZVA 1KN2H 5DURD 1RUKL 1S7TB 4MXQC 2I9LB 2IH1A 1UGNA 3TPUA 4L3CB 5DJZB 4L8DA 4GRWF 3NBNA 3O4LD 4NKQB 3FZUD 4UDTA 2B0SH 2DQHL 1YMME 4XHQA 2F54A 2Z93A 5GJTH 1XIWB 3O11A 3LH2H 4XXCC 3D0VA 3VWJD 2ERJC 4JN1H 5CAYB 5DVNA 3HR5A 4XRCA 4N90E 5GS1C 5D1ZA 3BDXA 1ADQA 1J18A 3BN3B 5EPMB 1CL7L 2BDNL 4X7TA 3T04D 2EDYA 1UM5H 4L3AA 3CFJA 3C6SA 3FFDB 1KUMA 5C0GA 1U58B 2HRLA 2VKWA 5EH1A 3WXVL 4Q6YA 1U8IA 2C26A 1C7SA 1R3JA 1XF2B 5MHSD 4V2BA 1F00I 4M61A 3H3PH 1CZ8H 3DI3B 2EC8A 3OAZH 2ICWI 3PWJA 3ZYIA 4E41E 1WCBA 5D7LA 3Q3GB 3SDDD 5EU3A 5IW1A 5C0JB 4X4MA 2D7OA 5DJ6A 3WFCH 3MLRL 1N3NB 4LSSH 2NTFA 1H3TA 3GMNB 3DPBA 1F11B 3MGOA 1KG0A 5C92A 3WE6B 1A6ZA 1INQB 2D0FA 2ORBH 4HIEB 3DV6B 4JG0H 4XNXH 4P4KA 4Y2DC 4AMKL 5FHAL 3B3IA 4M7JL 4PJ8A 1KPRA 4HKZB 2Z35B 2ZUQB 1R5VA 2AJUH 1Z5LA 2AABL 4I3RH 1OGAE 1MWAL 4H26A 1B88A 2QHRL 3L5XH 4ODSL 1J0KA 1DQML 5FFLA 1HYRC 1ZGLP 3ZTNH 1A9EB 3HI5H 4CRPA 5FUOL 3VFTB 3T77B 4HXBL 4Z7QE 2V5MA 3KPOA 2A6IA 5I73C 1TENA 3DROB 2CIIB 2UVFA 3JTSB 4U1SB 1P9MA 3QJFA 4LLDA 3QHTC 3LDBB 5SX5K 4G43B 3T4YA 2A77H 4H88H 2EDNA 5C0ND 1FC1A 1R5WA 4KJQD 4ELMF 3L3IA 1TQCC 3DHJA 4M62L 1V7MH 4HC1A 1HILB 3MLUL 3HN3A 5IB4B 7FABH 3V4VL 2QADC 1UKTA 5I74B 5IVZA 4JM4L 1EGJA 2AVGA 3EDDA 3MRRA 1QQDA 5KS9A 2P8PA 4JZNB 2XWJB 4U6XB 5L8KB 4ZUSB 3V79C 2CRIA 1HH6B 3QT2A 2D0GA 3QQ9C 1G9MH 1OD7A 2ARJA 4JCMA 3WFEH 5ALBL 5FGRA 5FK9B 1S5HB 3V6BR 3W0WE 5TDPA 1QSFA 5F89A 1YY8A 4E5XA 3NZHH 5TDNA 3V4PH 4X80L 3RA7L 5KSBF 1RHFA 3P4LA 3LEXA 4GS7C 2YEZA 1LDPH 3IJYA 4Y5VC 2E7LA 5ESQA 3TGXA 4HWBA 4MGXA 1HIML 3RUGE 3LB6C 4IRSA 1U92A 4GAYB 2QQLH 5DK0A 4AYFA 4FXGA 3THML 3N1MC 4PGCB 3GJEA 3QFJB 4GMTH 5GRYA 1PDKA 4KJWC 4OD3L 3RGHA 1U41A 3VWJA 4O02H 3D39A 3JBG7 2H9GA 5DZLA 3RJQB 3MJ9L 2UWEB 4HWZB 1FNGB 3FQXB 3QDJE 4LHQB 2AJXL 1U3ZA 4WHCA 5ICXB 1GGBH 1II4E 2WMPA 5IIEA 1AY1L 5E56A 5I16B 4JZJA 3VWKB 3SGKC 3MRDB 3UBXB 1A3LH 4LU5L 2IJ0C 5SV3A 5E2VL 1E4WL 3MV11 3QP3A 4U05A 5J9PA 4EIZC 3IDNA 1Q9KA 5C3LD 3MJ8A 3SDDA 1JPTL 4A6YA 2H1PL 3UTTB 1NGYA 4I4WA 4Q9QL 4LCYB 5INDB 3K74B 3IRPX 2X9WA 12E8L 3C60D 1NAKH 2B4CH 1T0NA 3L3HA 2PO6A 5IJVA 2J1KA 3EO0A 1RZIA 1KSRA 4NO0D 2Z31B 4GXVH 1DLHA 4TSBH 1V05A 4RA0C 1DBJL 2AV7B 2Q20A 1E28B 2CMRL 1GSMA 5BQ7A 3R8BB 3I85A 3MRPB 3WIFA 3MNZA 4KV5E 1P84J 3SGDH 1TZIB 2PETA 4NHCH 1YEKL 1N0LA 1MQ8A 1YN6B 5GIRB 5B4MD 4PD4J 1PY4A 3F7VA 1UYWL 1MLBA 1ZTXH 1MQKL 2HT2D 3S3SA 5TQ0L 3MREA 4JFXB 3KYKL 1CLYL 3EYOB 1XCTA 4FQ2L 2XKNB 1FLRH 1G6RL 4WEUD 1JN6A 1RJLB 1U91A 4YBQC 2HLFD 3M8OH 1KCUL 1EJOL 3LKNB 4YEEA 3S35H 4B7IA 1FVEB 3SE4C 1AO7B 3I50H 1V3KA 1MPAL 4Y1AE 2VABB 5CJBA 5I1IL 2GFBA 2PN5A 1B4RA 2PCPA 1A0QH 1V5JA 2PTUA 3DVFA 2EKSA 1QG3A 1A7PH 1YJDC 3RGVB 4G8IB 4RMUA 3DX6A 3NVQA 3TJHD 2VR5A 4ZNCD 1FVCB 3PABA 4WFED 3U0WH 1M7IB 1KCRL 3QXVA 5C0BD 3TBSA 4F15C 1YEJL 4QOKD 5E94B 3RWDA 2VISA 3ARGD 3DOSA 4POZD 5F70A 5IMMA 4BUHA 1T6WA 1Q9LA 2D03H 3NZ8A 1HNFA 1IGYA 1F4XL 3L1OL 4Y4KC 2A0LC 2C4FU 5J13B 2I07A 3ZE0E 4QHUA 4DN3L 2NY6C 4JM2B 3QDGD 4M3KB 2A9MH 1M7XA 4HLZH 3MRBB 1E6JH 4PJCA 2F19L 1PFCA 1P6FA 5GS3A 3G5ZB 3MRGB 4QWWC 2CO6B 4EI6A 3D85B 4JRYD 1LO5A 3UTPE 4KTEH 4BKLA 3MTRA 3NA4A 4KRPC 4R0LB 5DRWB 4W68A 1SHMA 5AWNL 4MQTB 5I18H 3EYQD 4G8GE 4JY4B 1B0RB 1ZT1A 4C55A 2W38A 2HVJB 1JGUL 3ARSA 4PJ9C 4ERSH 3DSFH 3AS0A 3CSPA 2R23B 3RPIB 1RIUL 4Q9RH 4ZYKB 3HRZA 2VWEC 1MHPL 4HBCL 2X4PB 3T0WA 4EN3C 3FRPG 2GEEA 2DQCH 3L5WB 4Q6IC 4RFEA 1BGXL 5EU5B 4XPBL 3RDTC 4F9PC 1QLFB 2VDRH 3VFRA 3V0VB 4LDEB 4LDOB 5DJXB 1S9YB 4Z7WA 1SEQH 4QTHB 2P8LA 5E9DE 4JRWA 1H9VA 3RNQA 3W9DA 3WL9A 1NL0H 3LVEA 2CGRH 4K7PL 5GS1A 5F7DA 4DZBB 2DF3A 3BW9A 5JOPD 4U1JA 3U30B 4X6CA 1WFTA 2DQEH 4K9EL 3FB5A 4NO0A 3ZKXB 3LEYH 3IXAA 1NKOA 1WTGT 2HJFB 1HSAA 4XNYH 2Y5TB 3MXVH 3QRGH 5I1DA 1WBXA 3LQAH 4PJHA 3CZJA 4G9FD 1RUQL 1CFSA 1I3GL 3Q0HA 4KJYB 3EYFB 1ED3A 1ZGLM 3NN8B 5D2LB 1A14H 8CGTA 3GSVB 5L0QC 2D3VA 3FQUB 5GSRB 3V7MA 1U8OA 3PIQA 4Y2DA 3CLFH 4AG4L 1DUZA 1TZHA 3QEHA 1Q0XL 3QFDA 5IVXA 5DD0L 3V5HA 1KC5L 2GTZA 1GC1L 3GIZL 3C08H 4RSVA 1CT8A 1TVBA 4OCYL 4S2SA 2BFVL 3RTQB 4I3GA 4WUKH 1FDLH 4X6BA 4AENA 4GG8B 1VHPA 1RVFL 1HINH 2IBZX 5IGXH 4QTIL 2VDML 4QOKA 4NQED 4OZHE 3ARGA 3V7AE 3OG4B 4LCCC 3HZMB 3E1F1 4NNXA 1FLTX 3U79A 3CCHB 1CLZH 2WANA 1KB5A 5IEKB 3KJ4C 3QDGA 1NANH 1F6FB 5IG7B 3NCJH 4JANA 2OJEA 1JNNH 2DBLL 3A67L 4X8XA 2R4RL 4R26H 4RMTA 1FRGL 1L6ZA 2BY0A 3KWWA 2BNRE 2JIXB 4J3SA 1CGWA 2XPGA 1F6LL 4I2XE 4XVUD 3IXTB 5HVHC 5DQDH 5DR5H 2NW3A 3DX7A 1B0GB 4TUKL 3RQ3A 3UTZA 4QRRA 2W0KA 1NGQL 2XG5A 4NUGL 1Y6MR 4YHLH 5FKAA 1ZGLB 3PWPE 3DGGB 4FQCH 5E03A 1N7ML 1S7UA 5DD5L 5CEXA 3C5JA 3FN0H 3IRZA 3GSNL 1UZ8A 4OZ4B 3O6MH 1OAQL 4NN5C 4WTZG 3E2HB 5T3XE 3WBDA 4Y5VA 1KULA 2KZ1B 4NQCB 4PREA 1VFAA 4LPYA 2YRPA 5J6GA 3FO2B 5EO1A 3MCLH 2EYRA 3OZ9L 3CFEB 4TUOA 3ZSTA 5F3HA 4KK8C 4TULH 1MSPA 4MJ5B 2EXWD 4MX7B 1G7JA 2PYEE 3W5MA 2GHWB 1TJGH 4KVNH 3TO2A 1K3ZA 1S7RB 1A5FH 4YXKH 2YSSB 43C9A 1L0YA 3VG9B 3JWOH 3NFNB 1EMTH 1Q94B 5ITFB 1NLBL 2WNGA 1SY6L 1Q72H 4OZIB 1WZLA 3EOBB 4H0IA 5B39G 3EYUL 4LEXL 1FV1A 3BMWA 3GK8H 3SGKA 3MBEC 4O2FA 4Q9BA 3H9HB 5I1KL 1U0QA 3E6FB 4ZO9A 3C5ZC 3A6OA 4JPVH 4JVUA 1JPGA 1UCTA 2A73B 3MJ6A 2BCKB 3KVQA 1JYNA 4FP8H 4EUPA 4MYWB 1GPOH 4AH2B 1CR9L 5BS0B 4G9FA 3F7PC 2XXMB 3CAFA 2J5LB 1G0YR 4GG6E 4UQ3A 4M03A 1NCCH 2R9HC 1YECL 4GAJH 5HHNB 1X6LA 3R1GL 4E42A 4L29B 4PJGE 1AD9A 2GK2A 2RFXA 4Y4HC 3JV6A 1FPTL 3MO1A 5JIIA 3O3AB 4L4TA 1D9KC 1UZ6F 4G8FA 4HGWA 3QFJE 4U1GB 1HKFA 4UU9A 1MIEH 4PJIA 4I0KA 2BSTA 2HT3D 4HF5L 4EVNA 3FT2A 1IGCH 5HDBF 3B4NA 5TH2B 4BZ1H 1J0IA 3MRCB 1IVLA 3JV5A 4WI6A 2ZCHH 5KTEH 3FQRB 3EO1A 1ND0B 5FECA 4NQEA 4OGYL 3X13A 4OTXL 2O61B 2YD3A 4YAQB 3EJJX 4NSKB 4V1DD 1JHKH 4YEFA 1KENL 3GNML 1AQKL 3FTGA 4YHYB 5I1HH 3WMSA 3HG1B 4M1DL 1KGCE 5HHXL 5FYKH 3OKNA 1MFCH 1MAMH 3BD3A 4TVSa 5C8JB 2NY7L 1FAKT 1ZHLA 4J3VA 5CLWA 4Y16C 3BVNB 2UY7A 5J06A 2VDNL 4XB7A 4MA1C 2VXTL 4RMVA 2AXJA 4Y4KA 5K9JH 5FYKD 1AGDB 2B7DT 2X1WL 4F33B 5I1JL 2DS4A 2BMKA 3V6OE 3AB0B 1U8JB 5TDOA 1MI5D 3U1SL 1HI6B 4MA3A 4JHAH 5IBLD 1DLFH 4QHNA 2OTUA 2YC1B 4NJAL 4R9HA 4ZUTA 1ACZA 5DMJB 5ID0B 3UTQA 4HIIB 2V2TA 2H2PD 4WU7B 3MPCA 3P9MA 1CIUA 3QEQB 4GKZA 3QUMH 4QHLA 1DL7L 3PE9A 4PJ9A 3NIFF 2LU3A 3ET9F 3OKMA 3QXDA 4R4NC 1LE5A 4M7KH 4XWOC 2M26A 4ZNEE 4TVPH 1T5WA 1BVKA 4JFEB 4N0CC 1T0MA 4X6FA 4X7SL 4FQQA 5GS0C 2DTMH 4H8WH 4EN3A 2YD2A 4UNUA 4Z76B 1F90L 3BKCH 4AQOA 5JHLL 1OPGL 4R2GD 4Z77A 4X4YB 1RZ8B 1DSFH 2BY1A 2IADB 3QQ4B 4PJEE 3VXUB 3EFDL 3CFKA 3RWEB 3KPMB 3VXSB 1MRCL 2GUOA 3DYOA 5ENWA 4F9PA 3KYOB 4OI7A 4TVPD 3OX8A 3PP4L 4Y4FD 3CXDL 4UV7H 4ODHL 3FO1B 4XAWH 5BOZG 5LCVH 5IV2A 3UPRB 5F9WB 3W0WD 3MRKA 4FFZL 3F58L 1CFQB 2ARWA 2A9NL 3HCVB 3VFMA 4KKBD 4XCFL 5L6YL 2FYYA 1I1YA 2XZAL 2X4UB 1T1YB 4GQPH 3DYPA 5F7NC 5FF6B 1UWXH 2ADJB 4RBPH 1LP9E 3UYPA 5C70A 4HIXH 5DC4B 4FQJL 1TDQA 3DIFA 2OLDA 1BFOA 1JGEB 1NLDH 1GGCL 3P9LA 2HJKA 5T1MA 1MF2H 3C09C 3OJMB 5GRJL 5FYLH 5LBSH 5EBMA 4LBEA 2COQA 1AI1H 3NCMA 1PZ5B 4FHBD 5E4EB 1INDH 2MHAA 3MLWH 5TE4L 5SWZE 5DFVD 4K8RL 5D6CB 3TZVC 3VFVA 5TE7L 2YBRA 1G7MA 2A83B 2VE6A 2FEEI 3MGTB 5EOQH 5E08H 1JF6A 5DFWH 3Q6FB 3ARUA 1HOCB 4Y5YC 5DUPL 3MUHL 1S7SA 5IVOA 3ULVE 4I48A 3NFPA 4L8SB 4OKVA 3DV4B 4UINL 2DQGL 4YZFE 4HV8B 4ZQKB 2Z91B 2AJVL 1HHIA 4HPOH 2D4DA 1WVZA 1DDHB 1D9KD 3C2AL 3PGCB 1KPUA 3V6ZB 4E41A 2AEIT 5ESVA 5T5FL 4CN6A 4OLWL 1LD9A 1NFDF 1A21A 2BVTA 5LQBL 3HS0A 5DK2B 5IHUL 3WFHA 5GRVL 1LEGB 3RWHB 2FRGP 2R4SL 2YK1H 4FABH 4QF1A 5ETUA 2R69H 4XCCL 2YMXL 4UILL 3VXQA 3SJVE 4GRWB 2PNDA 3KR3L 3GM8A 3FO9B 4R7DA 3RIAF 4HDIA 5J3HD 4C56D 1JTTA 4OD1L 1XIWC 3NIDE 4LCCA 2OP4L 3CZFA 1IAOA 4KPHH 4M4RA 4AEHL 3U0PB 1OGAA 1K5NB 1I7TB 4XMKH 3OR6B 1OAXH 5JW3H 4IHOA 4OZFA 1J12A 1FNFA 4L8CB 5FGCB 1R3KB 1MNUL 5TQ2L 4NZDA 2GCYA 1A3RL 1IC1A 5DJ2B 2J8UB 1IAKA 4PP2B 3CVHH 1PVHA 1JVKA 3HLAA 1VENA 4Y1AD 2Y72A 4ZXBC 4MCZA 5E6YA 4K7PX 4QXUH 1ADQL 1MWAB 2NY2B 5EDXA 1E4KA 3LMJL 4DGVL 1IAMA 4FQHA 1YEHH 5DS8A 1D5ZB 2VAAB 3MNVB 5DJYA 3QUMA 3KLSA 3EZJB 3TVMB 4PJ7E 2Y06L 5LXGL 3FB8B 2FBJH 4Y4FA 4I0CC 1YQVH 2C3WA 2ZUQC 4GMSH 1FGVH 5FB8B 1QKZL 3W0WA 4V2CB 1GOHA 1ZHKB 1HKLH 4XTRD 2FEEL 1I1CA 1O7SA 1T83C 3L3DB 4N0CD 5DJCB 1QHPA 4FOMA 1KJVB 4XBPA 1NDMB 3IGAA 4JO4L 2YOCA 4MXWH 4YX2L 5AYQA 1EXUA 2D31A 2GSGA 3ARFB 2R56L 4QLRA 5F7WC 1JTOA 4G8GD 4R7NB 5F7KC 3RUGA 4QRPB 1PZUB 3FCTB 3P0VH 4MNQD 5FDYA 4BH8A 3AVEA 3G08B 3MBEA 2XZQH 3N85L 3RVTC 3CSGA 2FR4A 2ZSVB 5HHVL 3C5ZA 3PXJA 4G8EB 1J11A 1RIVH 3SEPA 2QSCL 5F1IA 2EE3A 3GSQA 5I74C 3QUYC 1M05B 4ELMB 5AAWA 1N26A 3DRTA 5H94B 5T5NF 1GRWA 3O8XB 3S9DB 4YHPA 3VRJB 1MUJB 1RZGA 1F6AA 3P77A 4PJAF 4TSCL 2AJYH 1NAMH 1OSZA 1BWWA 1KJ2B 3N06B 2NY4B 1OAKL 2EDOA 3DETC 4NUJA 4Y4HA 1U8QA 5T1LB 2ICWB 3S5LG 4P23B 1D9KA 2FX9L 3BZ4A 1FIEA 1CFVH 4HCRH 5B39B 2O5ZH 2A6KA 4HC1L 3UZVB 1PG7W 1KELL 3SDAC 1N6QH 4D9LH 5MENB 1B9ZA 3I2CL 1EGJL 1QFOA 1UWXK 1XGYH 3GJFB 3BISA 2NTSP 3ZHKA 1SMOA 4RBPK 3LKQA 1TCRB 3GMQB 1P4IH 5FGBC 5F7HA 2F53D 4OD2B 1YN7A 1NMAH 1UKSA 4OZIE 2DD8L 2W59A 3VH8A 3MODH 3OKYA 3RHWF 3ZKMC 4ODWB 4I3SH 4C56A 2VDKL 5HHQA 3LZFL 1NEZA 2W60B 3O6LH 3R0MA 4AL8L 1UEYA 5FUCE 1JZ8A 1XH3A 4N0YL 2AP2A 2DWDB 4MA7L 3WS6A 5E00B 4Z7OF 4OJFL 4FZEL 2YPLD 5C08E 3F12B 4KKLC 4X7EC 3VD5A 1CD8A 4JQVC 3BRFA 5KVEH 5BS0E 1VEMA 2GTWA 1R3IH 5IW6A 3REVB 2OR9L 4G6KL 5CLTA 4DFHA 4LNVA 5F96H 1TJHL 5HD8C 3F65A 1OAYL 5FM8A 3VWKC 2VLRB 4G3YL 4HWBL 4C83B 3L7FB 3K8KA 1HK6A 3TT1H 4M6OL 1NUGA 2K1MA 2QR0A 2RBLA 2NQCA 1I9EA 1MCWW 2BVYA 4TNWF 5ID1A 4Y16A 1XIWD 4Z0XA 4Y1AA 4M6MH 3FO0L 4CJ1A 2W92A 4YUEL 4DZ8B 1PAMA 1B3JA 4JFDE 5DRNB 4HWUA 4X98A 4O58H 2Q86B 1E4JA 1OT2A 1CYGA 1HHHA 5CS7A 1IM3A 3NGBB 2ZNXA 1A6VH 4LFHG 5J12C 4WI2A 1A1NB 2DLFH 5C0IA 3W11C 3V5KB 1G6RB 2Z31C 4JGUA 5IJKA 2AQ3A 1WAAF 1UJ3C 1U3HB 4LSPL 3VU2A 3BZFA 4ENED 4S10A 3F7YA 4HS3B 2JK5A 1MELA 4GT7A 1NGPH 1HDMB 3V6OC 4PRBB 5E24E 3WO4C 5GSVA 2KQMA 5DT1H 4TTGA 1TQBB 4QNPE 1EHXA 5IFHL 1MHHA 3U48A 2QL1A 5DHVA 4GUPA 3OGCB 3WSQH 1JWSB 2X4NA 4G8GA 2EH8L 3U7WH 5KANI 2VH5L 1HXYB 1NSNH 2QV2A 1JHLL 5FUZH 1U95B 4ZG1A 4IBLT 1WV7T 5EFIA 3NIGE 4QRQA 2WBJC 4P2OC 1IMHC 1EZVX 3IDGA 3KPLA 5IESH 2ESVD 2Y6SC 4HMCA 3RVXD 1SBSH 4OLEA 3JSSA 3KDMA 2OTWB 4KXZH 4X99A 5KVDL 3RGVC 4PB0H 3SY0B 1JRHI 5HYJB 2Y7QA 3AMLA 5F21B 4C58B 3X14B 3ULUH 5BZDA 5JQHC 3IJSB 4KAQL 3MYJA 1VB9A 5BVJA 5CP7B 1T7YA 5IEHB 3O81A 5T3ZL 3PNWA 4LVNB 4JM2C 4KQ3L 2P49B 3TZVA 1TTFA 5DUBB 5ERWA 5KVGH 4PJCF 1PLGL 3LV3B 1DQLH 1E6OH 2ICEA 4HH9B 1QTYT 3ZDXE 1WT5C 5I6XB 4MNHA 4R0LC 5GZOD 1EX0A 2F53A 5F72S 4Y5YA 1J1PL 3TWCH 3VXUE 1RK0B 2XFXA 1R3HB 1ZEAL 2GIYA 2CKBA 4L3EB 1ZV5A 4YC2C 3DTXB 4WJ5B 2R29H 1TETH 1QEWA 3HUJF 1RK1A 2DYPB 4RISL 1KIUA 5FKPA 1XCQB 2AV1A 3BMVA 2CLRB 1CVSC 1IKNC 1SM3L 2YPLA 1VGEL 4JFHE 3UPAA 1S7TA 2I9LA 3SDCD 4L3CA 3VG0H 1OGTB 5DJZA 3ULVC 4Z8FL 4XX1G 5DLMH 3BN9D 2ADFH 4KK5C 3CXHJ 5JXAH 1KNOB 5I75B 1XIWA 2GQHA 5I15L 2JKXA 1ONQB 3BP7B 3UROR 4Z7WF 3VGBA 4G9DB 1SEBB 4EDWL 3MNWB 3O9WC 1T21B 2DRUA 2IMMA 4KKLD 4WEMB 2OJZL 5EPMA 4ZTPL 1C5CL 3QG6B 4IRJC 1MFBH 2BRRL 4AEIL 3FFDA 1U58A 4X6CF 4P2RB 4K94H 3F5WA 5HD8D 4KJPD 5ICZB 3RAJL 3RU8H 5IFAL 3VWKD 2O5YH 3ZKXC 1XF2A 3QNYB 5KVFH 2P5WD 3KJ6L 1OTTD 4HUNB 1X44A 3IDJB 4HPYH 1XR9B 3DXAB 3Q3GA 4RGNE 1JRHL 3D25B 4PJHF 1CGUA 4X4XB 3ARTA 5C0JA 3UTTD 4BK4A 4YHOL 5CEYB 5J89A 3LEVH 1N3NA 3JZ7A 2BNRA 2HH0L 2VOTA 4JFZL 1NPUA 3GMNA 1F11A 3WE6A 4X6EB 1INQA 1LO2L 1YUHA 3DV6A 4F8TA 3I3DA 4KUZL 5ADPH 1UXSB 1JI2A 3IDXL 2R0KH 5D7SH 5B8CC 4JQIL 4HKZA 2BHUA 4MB5A 3TH2T 1HHJB 2Z35A 2JJSC 4IOSD 2Y5EA 4OCRH 4WW1B 4M9OA 1IGMH 1UVQB 5IVXF 4U1LB 1K3IA 3BP5B 3ALPA 3PWPA 3SDXE 1T83A 3C5SB 2IPUK 3GMRB 3AFLA 5LJYH 3PG2A 2OMBA 1A9EA 4U7KA 1H3PH 4HIJB 3HB3D 4X0KB 3VFTA 3VFUB 3WNOA 2H32B 4WFFD 1HH9B 3GI8H 2PW1B <