4Y2DC

Crystal structure of the mcd1d/7dw8-5/inktcr ternary complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
203
structure length
202
Chain Sequence
b'TQVEQSPQSLVVRQGENCVLQCNYSVTPDNHLRWFKQDTGKGLVSLTVLVDQKDKTSNGRYSATLDKDAKHSTLHITATLLDDTATYICVVGDRGSALGRLHFGAGTQLIVIPDIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antigen-presenting glycoprotein CD1d1
publication title Structural modifications of alphaGalCer in both lipid and carbohydrate moiety influence activation of murine and human iNKT cells
rcsb
source organism Mus musculus
molecule tags Immune system
total genus 42
structure length 202
sequence length 203
chains with identical sequence G
ec nomenclature
pdb deposition date 2015-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07686 V-set Immunoglobulin V-set domain
C PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dC01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4y2dC02
1WWBX 3DVGB 4HCRL 1A9EB 2K1MA 4WEUD 3OBAA 5B21A 2DJUA 4RX4A 4P4KC 2NW3B 3CDYA 5HY9A 1W72H 3O3BB 3QXWA 3MRDB 1CBVL 2WLZA 2HTKD 1RHHB 4LCWB 5CUSL 2JJTC 1TQCB 3LSOB 3CXHK 4ODXA 1CICB 5TDOA 1TMCB 4GRMA 2I07B 1OCWH 4NKMB 4POYA 2EE9A 4MQTB 2OJZH 3CNKA 2ZPKH 4R3SA 4JO4L 4L3EA 2P8LB 4DUXA 3S5LA 2IH1B 5BOZG 3NIFE 2VDNL 3F6LA 5MERA 5BV7H 4GS7C 5ANMB 2F5BH 4UINH 1S7VA 1SBSL 4OLZL 2FLBT 1EJOH 1OSZA 4G6AD 3T4YA 2DB8A 4U1NB 3DX7A 1KCVL 2WANA 3ESVF 2J8UF 2YD1A 3OPZH 2R56H 3RGVD 3DXAB 5DJYA 1JYWA 3C2AL 4KK9C 4X4XA 2VXSH 2WIIA 3VRIA 3T2NH 4MS8C 1GGUA 5I16A 3O8XB 1WZKA 1ZLWK 4AIZA 15C8L 1U95B 4I9WE 3VWJC 3K74B 4K07A 1IKFH 4LHUB 3BKJH 5I1IH 2C4XA 2C3VA 3OB0K 1T1YB 3IFNH 3QI9A 4IRZH 3FB6B 1ZVYA 4LL9A 4ONHB 1T2JA 1KFAL 3PGDA 4L8SB 3U0TA 3QDHA 4IMLA 1UA6H 3TZVD 4AEEA 3A6OA 1MJ8L 3P4NA 3AM8A 3EO0B 4I2XE 2QLVB 4ORZC 3PXJA 4YHKL 4NC0B 1T7WA 5IB3A 5IVXE 3BD3A 3DWTA 4H0IA 5LKNA 5TE6H 3SY0A 3B2VH 3VFPB 1XCQB 2A9NH 3WIFB 3FQXA 4XVTL 2KQMA 4HK0B 2ZP0T 3DURA 3QUZA 1N0LA 4WEBH 4TUJB 5HI3C 1X5HA 1ZHNA 2X4NA 4E42B 4QWWD 4UI2A 3QEHA 4HIEA 4HGWB 4FQXB 3WXVH 4NQTA 1KB5L 4QXGL 4K71C 4DK6A 3ARFB 4RWYL 1M7DA 2DRUA 5GJSL 4ZG1A 3O45B 5FA3A 3KPSA 1U41A 2YPLD 4MB3A 3L5XL 1KULA 2AERT 2R69H 5D72H 4NUJB 1UM4L 3EZ8A 2E6PA 5DDHB 5BVPL 1YNKL 3GB7A 4PRDB 1BF2A 5IR1B 2BNQE 1WC7A 3OG4B 3O3EB 3LZFH 4HDIA 3TBYA 1OGAE 4GLRI 4JVUA 5K59E 4PJ5A 5INCB 1XCTB 3ILPA 4ZUUA 1A47A 5CD3A 2AV1A 5ESQA 5JORA 1UJ3C 1IM3A 1J7VR 3ARBC 5CJBA 4Y0GA 1EX0A 5FAAA 1DEEB 4YDKH 1F3DJ 1I1FA 1G6RH 1S3KH 5JOFB 1L0YA 4HUWA 3TVMC 4Y5VA 1D6VH 2IQ9H 2ZCHL 5T1KD 3CVHH 4GXVL 4KK6D 3MRQB 5GRXG 3WLBB 4R96B 2IPTH 2EE2A 4EI6B 2X1PA 5FCUL 3WXWL 5DEFB 5C0BE 2YC1A 2AJZB 3I9GL 4JO1H 1MEXH 3QQNA 4E5XB 3TH4T 2QHRH 4O51B 5I8CA 1EH9A 1Y6KR 1NEZG 2HVKB 3TYFB 4HFUH 2X9YA 4G8GB 5J12C 3KDMA 5CZXD 2PNDA 2BSRB 2Q76A 1ZSDA 5CINL 1IL1A 3BPCA 1RJYB 4OGYH 4PTTB 4OM0L 5AAWA 4Y2DC 4RBPK 2ATKA 3AS0A 5LGJB 2MNUA 4YIQA 3FOMB 3PUCA 3T0AA 3QHFL 3ZT5A 4N8VA 1LDSA 4OCWL 3GMRB 5FOJA 5IT2L 1KPVB 1DQLL 5HYEA 2Y6SD 3GMLB 3LEVH 3WIHH 2ADFH 5BXFA 4J6RL 3QWOB 3VG0H 3KPMA 5F1SA 1L7IL 3RTQA 5I1KH 1WF5A 1WBXB 2NY5C 2D4FA 3KPRB 2XWTA 5I0DA 1OTSC 1PLGH 4LMQI 3OKKA 3SPVB 5JNYB 4DK3A 1TZGH 3LN5B 1OTTD 4NO2A 1EMTL 3QDAA 3W0WD 1MHPH 5KJRH 1UACL 5GGVY 1FLRL 4HWZA 4I48A 4JRXA 4CVWA 5C71A 4XNYH 3TNMA 2AJ3B 1JTTA 3NGBB 1K6QL 3FRPG 2VDLH 4P59L 4UTBL 4YHNA 2GUOA 4EBQL 4FQXC 3EYFB 4ODSL 2DJSA 4XB8A 5F7EL 2JF1A 4XVJL 1BFSA 2YBRA 2FR4A 5D1ZB 1EO5A 4GKZB 1S78D 3G6JB 4WEMB 2CUMA 1A9EA 3LS5L 3CVIH 1T5WB 2X1WL 1AQDA 2F19L 5JQ6H 5KSVB 4PJFB 2P5WA 2E27L 3A67L 1Q0XH 4JGJA 1GSMA 1WZMA 4QY8A 5IM7A 5E9DE 4P5KB 1CTOA 3RWEB 5EOQH 4H20H 1CGSH 4M6NL 4U6YA 3VJ6B 4NKMA 4NFBA 5IG7B 5J6GA 1LEIB 4PB0H 5F7HA 5ALBL 3PV7A 4FXKA 1PFCA 1MCHA 4JPVH 4WVRA 1E6OL 4MSWB 3WFCL 2E7LC 5ANMA 4Q6IA 3MLYL 4JFHD 1IC7L 5J13B 3BGFB 1WWWX 3BXNB 2AKRA 5AG9A 3BIBX 1MLCB 1Z3GL 4OFIA 2PO6A 1QBMH 4LCIL 5A2IH 3V4UH 3CPLB 4KVCL 4DUVA 3RIAF 1EGJA 3VXRD 1DSFL 5IB5B 1U93A 1DLFH 4MA1B 4M8QA 1F4WH 5FECB 2NX5B 3B9KD 1FL3A 1S7WB 2EECA 5I9QB 5TDPA 4FP8L 1A3QA 1P5UA 2FX8L 3O8XA 3LDBC 3V6FA 5L2JB 4NSKB 3FAXA 1DL7L 2XZAL 4FQ2L 3BIKB 4XC3H 3HS0B 4GAJL 1YYML 5JPMB 5IBLD 2FGWL 5ACZB 5I1GL 3PV6A 4EQ3A 5CJQH 3VFMB 1X7QA 5GS2D 3QO0B 3X14A 5JXAL 3MRMA 2WK2A 3FHQA 3SDXF 3OJDB 5JA8B 2R2EB 1QNZL 5CD5C 4OAWA 5IV2A 5JHDA 1A4JA 4RMWA 4YX2L 2VDOL 4FNLH 4PGEB 3AMLA 1U8QB 1FL6B 1XF2B 2A77H 3BPOB 4XT1C 4Z0XB 2FEDC 3CFCH 3VA6A 1RUQH 1RUAL 1CYGA 1KN4H 3WIFA 2YD2A 2Z91A 3MBED 3AREA 3HMWL 4PRIA 4QKXB 4F2MA 1P7KB 1IZJA 4LSUH 4BH7A 3PWVA 3T3PF 5D7SH 1M05A 1IEAB 4HWUA 3CXDH 1I7UA 3SKJL 2D0HA 1C08B 1L6XA 3OL2A 5EN2A 4MMXC 4IS6B 3MXVH 3QH3A 3IDYB 5JIKA 2AQ2A 5D70H 3RZCB 3MV7E 3SOBH 3ME0A 3ARFA 4HIXL 4IOIA 3JWDL 4ZFZA 4GRWB 5KANI 5ISZE 4PR5B 3NGBC 2PCPB 2DQJL 4OLUL 1RVFL 4JO3H 4KJQC 2YMXL 3FO1B 3LKQA 3NFPA 3J7HA 1R3IL 4Z7UB 4OM1L 3RNQB 1CD1B 3UZVB 3GSRB 4KHXL 4LLYA 4XPGH 4HQQL 5F44A 3ROLB 3UTTE 2V7NA 1NFDE 5CZKA 2XG5A 3ELAT 3C5SB 35C8H 3BX7C 3O4LE 1KEMH 2GYSA 1AKJA 2WNGA 1YEEH 3UMTA 5T3XE 5C0GB 4O58H 2E3VA 5ITFA 2ESVB 3B83A 3HZKA 1KJ3H 2PW1A 1OAYH 1U8HA 4PY7B 3WLBA 2GK2A 4D9LH 4XP4L 1CK0L 2R0WL 2CRIA 4PJXF 1CDGA 3O2DA 2P7TA 4JFFD 3TNNB 1HYRC 4P9MH 3ECBB 4U1JB 1J11A 2VQ1A 3CLFH 3NH7L 3P0VL 4YBQD 1JCKA 2FDBP 2ZUWA 4JZOA 3JUYA 1KNOA 1RZFH 2PTTA 3GDBA 5I1EL 4OZGE 5IWLA 1U8MB 5CBAB 3IDXH 4P2OD 3B5HA 1J8HE 4JG1H 1FDLH 3KHQA 4P23C 1VCAA 5DTFB 4PJHF 5FUOL 1D9KA 2X4PB 4PRPE 1J1PH 4P46B 1K4DB 5HJ3A 2XT1B 1MFBL 2QJDA 4M6AA 2HTLD 5KOVC 2JE8A 4K8RC 5HVHB 4WUKH 2HKHH 3L3OB 1RJZA 4F7MB 3QUXB 1SM3L 3DHMA 3L3IA 3C8KA 3EJZC 3U7WH 5C7XH 3F5WB 5FYLH 5BJTA 4M3KB 3AAZA 4GRLD 3SDYL 3MRRA 2C3GA 5FEBA 1BX2A 3TN0D 5DA4A 3NN8A 4RNRB 4YDVB 3ZZ1A 3TJEL 1YPZE 4M6OH 3C5JA 1F45A 4XNUH 1K85A 4R9HA 4OCYL 4P9HL 3ZTNH 5HPMA 4ZXBD 1OAZH 1WAAF 2X41A 3LN5A 4ZMAT 4EDWL 4DVBA 2J88H 1BBDL 4HKZB 3RL2B 4W4OA 3GSOA 4PP1C 4NYLA 3V4VH 5I2IB 1N4XL 5I75B 4YBHA 3AS2A 4X8JA 4F7TB 1VGKB 1I9IL 2SEBB 3LMJL 5SWQA 5F3BB 5KSAB 2R0ZH 2XACC 4CRPA 5CS7A 3TH3T 3EYFA 3IDYC 3NCBB 4LF3A 5F1OB 3QDJA 2WINB 3RZCC 3OZ9H 3LQAC 5HHQB 1P5VA 2DL9A 3PWPB 2YOCA 5EPMB 5DHXB 1BIIA 3MO1A 1I1RA 4EXPX 1WVZA 2DQIL 5HGGS 1YEJH 3RPIB 5EBLB 2R9HD 1AE6H 3S34H 4MHHI 1MCFA 5CP3A 3QIBC 4XPTL 1HSBB 1AGDA 1ZXQA 2ORBH 3FB5A 3MRGA 5DJ0B 1MHHA 5E1AA 1MREL 1DVFB 5B3NA 2VN7A 4YDJA 4RGNB 1QYGH 4OI8A 2VDML 1IAIH 2Q86A 5F9OH 2AEQH 3JSSA 1FZMA 3IJHA 3LCYA 5D8JL 1EXUB 5DQ9A 1K4CB 4FQJH 1OSPH 2X10A 4DZBB 2BVQB 4GLRH 3MV7A 1MJ7L 3BXNA 1FYTE 3B2UC 1MLCA 3QDMD 4BH8B 1JYNA 5IIEB 1BFOB 1QFUL 3FQUB 4JG0L 3C5ZA 1INDH 4P5TD 5JMRA 3VXPB 2HFEA 3VXSA 3WFDH 1FFOB 4I4WB 2FZ3B 4PRBA 1H5BA 1SEBA 5AWNH 1D5BA 1FL5B 3TFKC 1YEHL 3T65B 1FH5H 1CD8A 4L29B 5E8PB 4XP1L 1JI1A 3BIKA 4I0KA 3C60A 1ZLWH 4ONGL 4JREC 1BZ7A 5IUSA 5EZJA 4TVPL 4Z7VF 5EUKA 2P5EE 4R2GD 2HAZA 4P46C 2Y25A 1MJJB 3HC0A 3RY6C 1XF3B 2EEDA 3OB0H 2ZOLB 4Y16C 4D94A 4I0PB 5T5FL 4WU5A 1ADQL 1VKXA 2RAMA 2MQCA 3OJ2C 1RZKH 1U8NB 4LCYA 2H32A 1BQHB 3D25B 4XMKH 2OSLA 2DWEA 4LKCB 5GGUB 3HAEG 1E4XI 2VDQH 1Q0YH 4KUCF 3MNVB 3V2AR 3PABB 1ZWIB 5GJTL 2H8PB 3K8MA 4QXWA 5EU6E 1T7XA 3SKMA 1DCLA 5GRUL 4U05A 4QRPA 4GW5B 1J0KA 1BVKA 1ZA3A 4QRUA 2W9DH 3F6IA 4ZQKB 1NGQL 1P7KA 3HC4L 1LDPH 4ZSOB 4JN1L 3TIEA 1LO0H 4G6FD 1J8HA 3W5MA 3T0EC 1HKLH 3M45A 3NCJL 3LOWA 4PRPA 5LGHH 1I1AD 1A0QH 1LE5A 3PHOA 5F89B 3WV0A 4EDXB 1T0PB 4XCCH 1P9MA 1ZLSH 4OQTH 4I8DA 3FO9A 3D18A 3MLXH 1J18A 1T0MB 2Q87A 5KSAC 3PDGA 4HMCA 1R5IB 3UBXB 2BFVH 4HS6A 4XP6L 2EEAA 1NAML 2HT4C 3I75A 3GSUA 3TC9A 1MRCH 4KRNA 5DEGA 2MSPA 4K9EL 5ENWB 3OXSB 5F88B 5CBEB 3V52L 3BQUA 4XVUC 3K2UL 3W2DL 4WUUE 1Z0MA 1YPZA 3ISWA 3ROLA 1TVHB 3V4PH 4D9RD 3KXFA 4P2QB 3VXME 1R5WB 1S7TA 2OI9B 2NY1B 2RIKA 5KTEH 1KN2L 1ZLUH 3DMMA 5DRXB 4UB0L 4FFZH 5ESVA 4ZFOL 4ORGB 3O9WB 1D5ZA 1U8IA 5ESAB 5C09E 2EDTA 3LEXA 1LNUA 1NBZB 3X3GH 3ARGB 4EOWH 5C70A 2HMID 5BZDB 4JQIL 5E2TH 3MZTA 2OTWA 3JTTA 4YZFF 3G04A 3F7QA 1J0IA 4QHNB 4NQEA 3Q2CA 5F97E 2H6PB 4M1DL 2X1XR 3VRJA 5H8DA 1V3JA 2IPUK 1SEQL 4POUB 1Q38A 3T2OA 3S8WA 4PJEB 2G5BA 1UQSB 1IT9L 3MLSH 5D1QA 1MELA 4RAUB 3BZDA 3KLHC 1JL8A 4NZRH 3BE1H 3H7BB 5E00B 5EOTB 3DX8A 2GQHA 3MACH 4KK8C 5IVOA 4UIMA 1UH4A 3MYJB 1XIWD 4LDLB 5J9PB 3O2VH 2FO4B 1Z9MA 1N2RA 2CSPA 4RBPH 4O9HL 4Y4FA 3C6LD 4CUCA 1S8DA 4KJWD 1S7RA 4JFDB 3RWHB 3GSQA 1HHJA 3KVQA 3BN3B 4NKDA 4U6VH 1TTGA 3DX6A 4MQSB 4I0PC 1DE4A 2MPAL 2VISA 3KR3H 5DUBA 5HVGB 1T4KB 1F2XK 2NXZC 3TWCH 3MGTB 4U3CA 5EDXA 2HN7A 1PBYA 1A4KB 4PJGB 4XAWH 5C08B 2PKDA 4L4TB 4DGIH 5DZOA 5C0IB 5I8KH 1JNNH 4XBGB 4OT1H 2AXJA 4KQ4H 4Q9QH 7CGTA 3C2SA 1RZ8A 1FSKC 3GJFH 3F7VB 4KQ3L 1G1YA 1NL0H 4KMTL 1G7QB 1HZHL 2OK0L 1F5WA 4IOFC 3QFDA 1KLGA 3DVNA 2V5MA 3R1GH 4ZUTB 2MWCA 3EYQC 1RZJH 3K4ZA 3OF6D 3B5GA 4APQC 4HK3N 5ELIA 4P2RB 5JLZB 3JWNC 2EIDA 3QEUA 1EUUA 2WUBL 1ZHLA 3HLAB 1N64L 3RWDA 5HHQA 3QZWG 2EDXA 4LSTH 5I6XC 4HPYH 2RQ8A 1HOCB 1XF5A 5EO9A 1M71B 3O6LL 4ERSH 2VZTA 4HH9A 3RVUC 4PJ9A 4LARL 5EUOF 4M4PA 3QIUB 5E2UL 2ZUQC 5KBNC 3QEQD 3RPIA 1MIMH 5C0NC 5EU6A 2BC4B 3PHQA 3WBDA 3C8DA 1N7ML 4GG6F 3DYMA 3ZKXC 5J89A 1IMHC 3DUUA 4ODHL 4RWHA 3QXAA 2CPCA 5HHOA 4JQVC 1T21A 1IQWL 3E3QC 4UQ2A 3CXHJ 4JFEE 4KZDH 2EH7L 1EFXD 1CQYA 1FZJB 3U36B 5ID1A 3WFHB 1MQKL 3NACH 2XZQL 1X4YA 2OI9C 4BELD 3VCLA 1D5IH 4FQLL 2E9IA 4QGTA 1MAJA 2O5XH 4OLYH 1NQBA 1WLHA 3U6RB 2KZ1B 4W4NA 4Y1AB 4NC1C 3O9WC 1XFPA 2GSIA 4JHWH 2BVOB 2DAVA 2DIAA 5DMKB 3WKMH 1BFOA 1FFRA 4GSDH 4OCXL 3RX8A 1UYWL 1PG7W 1NCBH 1MHEB 1B2WL 3IAQA 3QP3A 3MLTB 4F9LC 2EIZA 1EO7A 4C4KT 2UWEA 1GZPB 3MNWB 3VFWB 1TJGL 5D7IA 1ZEAL 1NCNA 1BAFL 4HIHB 1MQ8A 3GSNA 2QADC 2LVCA 2IFGA 4UQ3A 1G7HA 3MRHB 3MNZA 5F9AC 2LU3A 3W5NA 4XCEB 3IKCA 3KGRA 4WUUA 4WW2F 2DLIA 4F8QA 1MCCA 3O2WH 3BYTA 3OAZK 4YNYB 3VXUA 1JNLL 1JK8B 5EOCL 1P4BH 5DWUH 1CLZH 1KGCD 4XPFL 4Z7OF 4B7LA 5FO8B 3MOAH 4P4RA 2Y7QA 4K3DH 5I15L 4QLRA 5L9DH 5DK0A 3ZO0A 3D39B 2W9LA 4I13B 5IJKA 5E94B 1J88A 4MCZB 3D25A 3HNTL 2BRRL 5CILH 5F70A 2G60H 4XX1E 4QYOA 3VI3E 4ZFGL 5I73B 3VXOB 1VEMA 3M17B 3PABA 2JJSA 3IF1A 4CADA 3IVKB 3OKNB 4ZO7A 4U7SA 2XKNA 1XGQA 5IGXH 4Z7WB 4HUVB 4O5LH 4L8CB 5E6IB 5ILTH 2XWJB 4NZUL 4N8CL 3HG1B 1DQMH 4AY0A 1CF8L 3CCHB 1DUZB 1JHTB 1B9ZA 1ONQA 3BD4A 1MLBB 4M61A 5I76B 1CE1L 1A7RH 3MUHL 1AXSB 3ZYIA 4HCRA 3ULVC 2Y23A 1EFQA 1TJHL 4F33A 3S35H 4NM8L 1TETH 3P11L 3GHEL 1T0MA 1DEDA 1YEKL 5C0RL 5I1CH 3I6GB 2R2HA 2V5TA 3UBXA 2MHAA 5FM8A 1YEGL 3UO1L 4N68A 5IHUH 4WW1A 4JY6B 1F11B 1FCGA 3T1FB 2HJLA 2J6EH 3OXSA 3DBXB 3MUGB 5HYJD 5MEPB 4L4VD 2IAMD 5TQ2H 3QQ3A 4OFDA 2G2RB 1MFDL 1IEBA 4NQVB 1AQKH 4YHIB 3F7RA 1X5YA 4RAVA 3BP7A 1OARL 3NAAH 4X7SH 1WZ1L 5I8OL 5T3ZE 5IJVB 5CSZB 3BZEA 2BOBB 3G9AB 4P2CG 3IDNB 4IRJD 3PHSA 4K94L 2J3SA 4NGHH 2D2OA 4OZ4B 1V8HA 1INQB 1CE6A 2O26U 4LPVA 4NJAL 1BM3H 3QUZC 1UM5L 3ARGA 1X6NA 2AJSH 3BN9D 4TUOA 3DROB 1CD9B 2I9TB 2FBJH 1ACYL 5E8DH 5TFSL 4D9QD 1BREA 4IMKC 1FBIH 2AK4E 3MODH 4NKOA 5D2NB 2ILLA 5KVFL 1Z0NA 2GJ6E 4NNPH 1LP9E 1EV2E 1UFUA 4R7NB 5D7JB 4F7EA 3EO1B 2VH5L 3WE6A 4I1NB 2D31B 1NBVH 4I2XB 3OG6B 3P73A 3QR2A 4ODWB 3BZ4B 5B39A 1WICA 2WZPD 3IFOA 1DN0B 5IVXB 2C4FU 2DQUL 2I60H 1KIPB 2CK0H 3BDXA 1YNLH 2OR9H 5DJCA 5DJ6B 4UT7L 2ITDB 1E0OB 1LEGB 4QXUL 5J6HB 3CFDA 3RNKB 1CFVH 4JRYD 4LLVA 5ICYA 1RMFL 2BY1A 5I8EB 1SYVB 3VI4F 3MLZH 2A0LC 1Q9LB 4OKVA 5CJOL 4LSRL 1BBJA 3LKSA 4G9FE 2EIBA 5I73C 4PJCF 2ZG3A 1JZ8A 5SWSD 3OQ3B 4M7LL 1F90L 3QDGE 4X6EB 3LQZA 4NO5A 1KB5A 4UV7L 4X6CE 2CLVA 3UZQA 3CAFA 4OF0A 1I85C 4OIBA 5BRZA 2JB5L 3T0WA 4ZYKB 2F15A 3G5YA 4Y4HD 1AO7D 2BNQB 5E6IC 1OGAB 4HF5H 2BVPB 2XKSA 2VLJD 3UBXI 4CDHA 5AYUH 1YEDB 3FFCA 4R0LB 3G9VA 2ICWB 5JA9A 2A6KA 4NN7C 1A14H 3MGAA 5IOPB 2J1KA 4YK4C 1EZVX 1JWMB 1GIGH 5C6TH 2F53D 3BPNB 1M71A 3V7AE 5EIVA 1L9MA 3HN3A 3F58H 5FOBA 3CD4A 1OCWL 2A83A 1I7ZB 5EBGA 5AZ2H 3BJLA 2OJZL 2DLHA 3Q5TA 1JHKH 4UAOB 1C5BH 1CFBA 3CMGA 1NMBH 4WTZG 1QLFA 3T4AB 4U1KB 3ZDXE 1AGFB 5DFWH 1LD9B 4MAYA 5BV7L 1ORQB 5MI0B 2F5BL 4UINL 2W9EH 5E03A 3F7PC 5C0BB 5A16B 1HHHB 1U8JA 3HE6D 1H8NA 4NKIH 2PYFA 1EJOL 4GH7B 1HQRA 1CIUA 4HLZH 1FZJA 4LVNB 1LILA 5IW6B 3QWQB 3OPZL 2R56L 2BNRD 2W07A 3PF2A 3TLRA 1T1XB 2P48B 2VXSL 1V5JA 3O3AA 2R2CA 3T2NL 2BERA 3L6FA 4RMTA 5F9WB 3O3UN 3CFBA 1MCLA 4YDLB 5DJ8A 1SJEB 1FIEA 1IKFL 2VXUH 3QFJE 3RAJH 3BKJL 5I1IL 4ESKA 2ZJSH 3O6FA 3IFNL 4PYHA 4IRZL 3ULVF 3KJ6H 2VLKD 2XYCA 3NFNA 1VFMA 5FGCE 3CIQA 3N9GL 1UA6L 5JXEC 2G75B 3INUH 4E41A 5C0DA 3VD7A 5AAMA 2DMKA 3I84A 3VXNB 3ARZA 3WCYA 3FFDA 4Z7NF 4AK1A 3BT2H 4NZDA 4LRIA 3D2UD 4LIQH 4YNYA 5GS0C 1VSCA 5TE6L 3B2VL 4LEXH 1TTFA 2VDKH 4MX7B 1MH5A 1RZIA 2A9NL 3CZFA 5DK2B 4HLJA 3TO4D 4CGTA 1ZT7A 3V5KB 1UADC 2W0LA 2Z31A 4H1LA 4WI8A 3D3VD 3BSZH 1JPFB 1HHIB 3TT3H 2WP3O 4WEBL 2X4UB 3M17A 3OR6A 3FZUC 5JIIA 5DD6B 2YPLE 4O2FA 1EEQA 4IOSD 3WXVL 1A6UH 4U7MA 3CSYA 1DDHA 5E0QA 4XGZB 3S4SG 3MRIB 4X7TB 1A1NA 1Q8MA 4Q6IC 4FFYH 4Z7WA 4FFVC 2V2TA 2W60A 4L8CA 4GBXA 3HUJE 1LP9A 4NIKB 3UXFA 1V7NH 5DMYA 2R69L 3JUZA 1ZANH 3HG1A 5D72L 2WM0A 4OZFA 3CCHA 1O7SA 4XNMA 3WN5C 3V6ZB 4GKOA 3SKUD 4PD4K 2VLRD 5I76A 2QHLA 3LZFL 1U36A 4XC1H 4YXHH 4ZOCA 2BY0A 4M00A 1NPUA 4I3GA 3VD5A 2A6DB 3B43A 4NPYA 4C56D 1FN4B 4KI5C 2GTZB 2ICEA 5E9DB 3I6GA 3VFSB 3MOBH 3E6FA 1SYSB 4YDKL 5HHXH 4GRWH 4XH2B 1G6RL 1S3KL 3U83A 1D6VL 1T6VN 2IQ9L 3SJVE 5IEHB 4AEFA 3CVHL 5JDSA 4ZUVB 3V0WH 2R4SH 3Q5YA 1I1YB 4UAOC 4WI3A 2IPTL 2E5EA 1A7PH 4XBPA 4X6CA 1F97A 4E0RB 1OAQH 3PGFH 4QOKB 5F9JB 4XAKE 4JGUA 1NC2D 1MEXL 4JO1L 5GGSA 3IDNA 5GIRA 4BZ2H 4GKSB 5CEXB 3ULUC 3TV3H 5FYLD 4EI5D 2VLLB 4G42B 4OZ4A 4Y4KB 2QHRL 2ZSWA 3ALPA 2RJMA 3AREC 4YC2B 5KVEH 4HFUL 3F12B 5EO0A 4QCIB 1BF8A 2XA8H 1UKQA 3OXRB 5KS9E 1A6PA 4FZ8H 4OGYL 4CVZB 1WFOA 3N0PB 1VDGA 4HS8H 1U8LA 4JAMA 5F9WC 1UB6B 2PYEA 4H5SA 4D8PA 2UUDK 3HR5B 43CAA 3P4OA 4YDLC 43C9B 5KZCD 5JW4N 4P57B 1OF2A 1WISA 1B4JH 3LEVL 1P7HL 3WIHL 2F8VA 2ADFL 4K3JH 3R06B 1QR1B 3VG0L 3W0WE 2R29H 5I1KL 3V6OE 2JELH 1CDBA 4PJ8D 5FA4B 5LBSH 2R1YA 1PLGL 4IM8A 1G7MB 1TZGL 3QCUH 4OLXL 1MHPL 5KJRL 2FJGA 3NIFF 5I8EA 4RCAA 4PG2A 5HDBF 3I2CH 1UC6A 3OKEB 1A7OH 2X5PA 3B5TA 5J0BA 3WLWD 5HI5C 2ERJC 4MD0B 3MRNB 3TZVA 1IGIH 1S7XB 1QSED 2MCG1 4JE4B 1WBYA 2FRGP 2VDLL 3SCMB 5ISZB 1F3RB 4P49A 4TQEH 2YSSB 1WT5A 4G8EA 5T5NG 2VERN 4RX4D 5INDB 1I7TB 2NY3B 4HAGA 4JQXA 5DVNA 5AUMB 4X9FA 5D71H 4NFDA 2J8UE 4D0CB 2NY4B 4DAGH 3GGWA 4HKBA 4HX1A 1R0AH 3ARDD 3OAUH 1NAMB 3CVIL 4FQHB 3E1F1 5BMFH 5IWLC 1A6VH 4R0LA 3MRKB 5JQ6L 4M1CD 1CFTA 1YEFH 2H2SD 3QXDB 5GGTH 1VERA 1Q0XL 3HRPA 3O4LB 4L3ED 2B4CH 3X13B 3NCCB 4PJIE 1FNHA 2R8SH 1S9VB 3W82A 5EOQL 4H20L 1CGSL 4LPTA 4PGDB 2C9AA 1YDPB 1KJMB 2D7NA 4PB0L 3K2MC 2YPLA 5JIHA 1S7QB 4JPVL 2WV3A 1DBMH 3HNSH 1TVDA 4WI6A 4K7FA 2NY2B 4ZFOB 1IAOA 1ORQA 1JZ5A 1UB5B 3TBVB 1BJ8A 4FTVE 2A6JA 3EJYC 2VB5A 3ZSTA 1QBML 3V4UL 1A6AB 1NCUA 3HE7D 2ZKHH 4FFWC 4OZGB 1RV6X 2IF7A 3EHBC 4OGZA 1DLFL 1GC1C 1EPFA 1FYHB 3LKNA 1HIML 1MF2H 1T1XA 1F4WL 5BQ7B 4BSWB 4N5ED 3MMEB 3MR9B 4W4OC 5IF0B 3IYLW 4J3UA 2PR4H 4YC2C 5T1KA 3GBNH 1JV5A 4XC3L 3MFFA 2ATPA 2NNAA 1LO5A 4YPJA 1FFPA 5CJQL 1RHFA 1U2CA 1PSKH 3T77B 5K59F 2KUTA 1G9MC 2AAVA 4KI5F 4V1DD 1YQ2A 2NXYD 4PJ7E 1G7LA 4HUXA 5C2BH 2AV7B 4JZNA 1O0VA 1TIUA 1A6ZB 1F4HA 4N90D 1KPUB 2WBJA 5GHWH 1HILB 5JUEH 4FNLL 2Y06H 3W11C 5D2LE 2EYRA 3OAZH 3CFCL 1IQDB 3LPFA 3MV9E 5IB1B 1RUQL 2GJJA 1JMZA 3KWWA 1KN4L 5DA0B 4EUPB 3MOQA 4LHUG 4JFQA 1XT5A 4WO4B 3GSWA 3VGGA 4UUJA 5DFVD 1NUDA 5CEZH 4MVBC 4LSUL 3TEUA 1I1CA 1HHIA 1FNLA 5D7SL 3SKOA 5E8NB 4U1GB 2DLTA 4OD1H 2MMXA 3CXDL 5DD6A 1MUJA 4R97C 4NO3B 3ULUF 3MXVL 3GIVA 3KHOA 3IXTB 1ZV5A 3SOBL 4P4KD 1YMMD 1CXKA 1EEZB 3I50H 2PXYB 3VGDA 3MJ7B 2VE6A 5D7LE 4HEPG 3SCMC 3KYOB 4KKLC 4UBDC 4JO3L 2IADA 2P4AB 2HLAA 4AMKH 4XCNB 2YXFA 3V6ZA 4MD5A 4Y7MA 4NZTH 2VABA 4RDQF 3W0WA 1X4XA 3UYRL 1KJVA 2NY4C 3OKLA 4QF1A 1N26A 1DUYA 1KIQB 4XPGL 5D7KD 3I3EA 3TBTB 4TSBH 1XZ0A 5GRVL 4WGWB 4EN3B 2XIDA 35C8L 3CGTA 3CZJA 1KEML 4UT6H 3H0TB 2E9WA 1VFUA 4JFFE 1YEEL 4RA0C 2NTSP 4E9LA 5IKCA 2WWKT 4O58L 3P30H 1KJ3L 1ITCA 3DYOA 8FABA 4ZUVA 1OAYL 1S9XB 2Y5TA 4D9LL 4YDIL 2CUIA 1YECL 4M48H 5GGRB 2IG2H 1DANU 2NY2C 1CXFA 4P9ML 4QOKA 5F9JA 2HFFA 4YHPB 1BLNB 3CLFL 3K7UA 4LEOB 5DYOA 4GKSA 5EZLB 5CSGA 1KACB 1RZFL 3ZYZA 4MHHG 1T3FA 3IDXL 4JG1L 3UTQB 1FDLL 2B7DT 4KV5F 5I1LB 4HT1H 1J1PL 4FQQB 1CZ8H 2F74B 4CN4A 2X6MA 1N59B 2EDDA 2AXGA 1FPTH 1CFSB 2P5EB 4OI9A 3QQ9D 3VFUB 1OQOA 4PJIA 2XTLA 4WUKL 2HKHL 3TPKA 1P9MC 3U4EB 4NRXA 4RMRA 3RTQD 2X9WA 2R1WB 1P7QB 4LVEA 2C7UA 4Y19D 1JYXA 1Z9LA 4XI5D 3U7WL 5C7XL 5FYLL 3H7LA 4RQQA 3DSFH 5K9JL 1ADQA 2OJEB 3VXRA 1J0JA 2DLGA 5JO5B 1NFIA 3GHBH 5C3TA 3ZT6A 2DQCH 1YYLH 2G5RA 3QQ4A 1RJLB 3C6SB 3TJHC 4M6OL 1OP3K 3BQUC 2DMBA 2ZWLT 4MA8H 4XNUL 5DC0A 3ZTNL 1ZHKB 2DI8A 1OAZL 2O61A 3DVFA 2EYSB 1QRND 2JCCA 3LPGA 3GMMA 4DZ8A 2V5RA 2J88L 4DWHA 4MJ5B 3V4VL 5ADOH 1FNEB 1TCRA 2VO5A 3HI1B 4ZODA 4P5MB 4WO4C 1OM3H 4XTRD 4F7CB 1MCOH 3DMMC 5FKPB 5KSBA 1BECA 1WBZB 2V9QA 3P9WB 1CLOH 1S7UB 4KKCC 5D6CA 4XNXH 2W0FA 4WJ5B 3WUZA 4XP5H 1S9KC 1I8IB 2R0ZL 1YEIH 3QIWB 5F21B 3WHXA 4BK5A 1DBAH 1T5XB 4XWOC 3PWJB 4JFZH 3OZ9L 1I8MB 4YHOH 2W38A 2X4RB 4Q9RH 2PXYC 4LCWD 3MRLB 4LFHG 3MBEA 4NWTH 5EZOH 1CICD 1NAMA 1YEJL 5B38B 5D1QC 5L2KE 2VXQH 4PJAA 1AE6L 3E6HB 3EAKA 3OV6A 5IMOA 4ZS6D 3S34L 3JTSA 4DVRH 2CLRB 4YR6B 4M7KH 5EC1A 1C12A 3VXMB 4LLAA 1AGEB 4UTAH 2ORBL 4OZIA 3GIZH 2HKFH 3U4AA 1QYGL 2D7MA 1IAIL 5D6DC 4Y4FC 1TENA 2QQNH 5F9OL 2AEQL 3QDME 3EYOA 2C1PA 2WLYA 2PO6D 3AFLA 3FCTA 5C09B 4FQJL 1OSPL 4HJJH 4ZFOA 4LPWA 4HK3J 3DXAD 4HLZG 3OR7A 4H8WH 4G5ZH 4MJ6A 1QLRA 1NEZA 2NY6B 3BKCH 1A6AA 4DN3H 2QBWA 3O8XD 3FJTA 1INDL 1RK1B 5HYQB 2Z0BA 3IFLH 4KWUA 4ZDHA 3WFDL 2EYTA 1KOAA 3DVIA 4HS3A 3PGCA 1GGBH 5KG9B 4J3VA 5C0JB 2IJ0C 5JPNA 2Y1VA 5AWNL 3T3PE 4BFEA 3BO8A 1PGRB 2CLZA 4HG4J 3DIFB 4LAJH 5FYJD 3BHBB 1FH5L 1U8PA 1WIOA 4A6YB 5T1LB 3MBXH 4ZS7H 3VWKB 4KC3B 1OTSD 4ZNEE 4JFFA 4DEPC 4JR9H 1EEYA 3RPKA 4XCYA 1RZKL 3SDAB 1YNTB 4XMKL 4D0BB 4X6FB 3FT3A 4RIRB 1A6ZA 1NFDF 4PJ9C 2CH8A 2VDQL 1Q0YL 3WSQH 2GAZB 4X98A 1HILA 2FBOJ 1TZHB 4P2OA 3QRFM 4NDMA 3BH8A 4K2UH 5EO1A 3GMQB 5MEQA 4N9GB 1AGBB 3UDWA 3TA3B 4FQXD 1MVFA 5D5MA 2CD0A 2W9DL 1G6VK 3ARFD 5EG6C 1Q9KA 3O0RH 1LDPL 2JK5A 3BP5A 4LLDB 1LO0L 3FRPA 1HKLL 5F8QC 4PPTA 5KOMC 3QUMB 3QG7H 5LGHL 4GRLA 1A0QL 1MFAH 1HCFX 4CMMB 4A2MA 4XCCL 1C8PA 1ZLSL 3I6KB 1IVLA 3TN0A 4ZFFB 5CAYB 4LKXA 4Z5RB 3MLXL 2CDGA 5ICZB 1CWVA 1R3HA 3MLVH 4XZUA 4POZD 1B3JA 4FABH 5EBWB 3BEWB 1AD0B 2BFVL 3RI5K 1KCLA 4IIQB 4LPCA 1JZ4A 1L0QA 2Y36H 4ZXBA 1WQVT 1MRCL 5AEAA 5C6WH 5KVGH 3M1BB 4M4RA 3N1FC 5EB9A 3FHAA 1AKJD 3S88H 4P3DB 3QJHA 4OCRH 4ODSH 1KIQA 4PJHE 3QXTA 1OL0A 2XY1A 3AUVA 4YXLH 3IJSB 3V4PL 4EN3A 2CR3A 4MCYA 1KBGH 4LP5A 1QEWA 4GFTB 5KTEL 1XH3B 5BS0B 4XB7A 4MDJB 1N5YH 3EOBB 4AL8H 1YPZF 2NW2A 1Q9OB 1AIFA 3S98A 1S9XA 3SN6N 4EOWL 3X3GL 3IFPA 4X8XA 3TT1H 5E2TL 2JJSC 2OL3H 4X99B 4G8GD 1VACB 3PWLA 4MNQE 2KH2B 1NFKA 4LLUA 3FQRB 1PDKA 2EDNA 4ZUWB 2OYPA 1D9KD 5EZLA 5CEYB 2A1WH 3FO2B 2ZNXA 4HC1H 3BP6A 4RZCA 1WAAE 1TXKA 5C0AE 3MLSL 5FGRA 3L3KB 1G9NC 4GG8B 1G7PB 4NZRL 3B6SA 1OHQA 2UYLA 1FZOA 4PBVC 5SWZA 3MACL 1NC4A 2DYPB 5FO7B 4G9DB 4KGJA 2F74A 2NY0C 3FT2B 4IDLA 3O2VL 3RGHA 1IGYB 7FABH 1JPSH 2UUDH 3LS4H 3MREA 4N1HB 3HAEB 3T04D 3KPRD 3R0NA 3SKNA 4U6VL 4AZ8A 3W81A 4EVNA 3KR3L 3W39B 3EYVA 3RWFB 2ZOKA 4ELKB 3TWCL 4U1IB 1N0XH 1KUMA 5GS3A 4XAWL 4N0CC 4DGIL 1P1ZA 5I8KL 1ND0A 1TLKA 4XXDA 1JNNL 4OT1L 4MWFB 2H26A 4KQ4L 1ZHKA 4Q9QL 1YN7B 5E70A 4TNWK 1R3JA 2C1OB 4KUZH 3IGAA 4NQCE 1KIUA 1CGWA 4JLRB 4KKBD 2AW2A 3HI1A 5LAXA 3PP4H 1P53A 3R1GL 2GITB 2BOCB 4LLWA 2GSGB 4DCQB 1JF1B 3EOYG 1X5LA 1KXTB 3QUKA 5D1ZD 4WJ5A 1ZHBA 4HV8B 1NGWA 3QEQE 2PW2B 3O3DA 1B0GB 2NR6D 4JANB 3DO3A 2LTQC 2YA2A 5EA0H 3EYUH 4LSTL 1I8MA 4HPYL 3RX5A 4AENB 3SDDB 3RUGB 4ERSL 1VENA 3P77B 3QJFB 3MRLA 4NNYA 1MIML 3OMZA 5H2BB 2ZUSA 1X5KA 3BWAB 1GYAA 3GKWH 4HULB 3CVHB 5I17B 3SBWA 3Q3GA 4OD2A 1I1AA 2V6HA 1MCPH 4PS4H 4XNQB 5IMKB 4Y5XA 4Z7VE 2ENSA 2I26N 1WCQA 2N4IA 2LVEA 4PJBA 3NACL 1J9CT 3OJMB 4TNWF 5IW1A 1D5IL 5M95B 2GCYA 2O5XL 4OLYL 3V0VA 4HGMA 4MNGA 2NX5D 2VXTH 4JHWL 1XR8B 5F3HB 1R5VA 2AK4B 3CH1B 3MJ9H 4GKNB 3WKML 3QISA 3UAJD 4GSDL 4WWKB 1NCBL 2GJ6B 1CXHA 1MRDH 1C5DB 3C60D 3NPSC 1NBYB 1AR1D 5DUPL 1N5AA 4KZEH 3PNWB 5JMOC 3HZYB 1NMAH 1KGCE 1PVHA 2FNBA 2VR9A 1QLEH 2Z93B 3KAAA 1J05A 2G9HA 5DRZA 4DQOH 1K2DA 3TYGH 1A9BA 2UWEF 3O2WL 2NPLX 5D7IF 4GAYB 1P4BL 3OSKA 1E4WH 3QNZB 5DWUL 1CLZL 5GS1A 3X17A 4LCUB 3MOAL 4K3DL 4X7CC 5L9DL 2YN3A 3IU3A 5BCAA 4PRNB 3FQWB 3SDCB 4QRPD 5CILL 3JV6B 2G60L 1YY8A 5LVEA 2JTDA 1QFWH 4G9FB 1LEKA 2IBGA 2VAAA 1TZHA 1RZGB 3H9HB 3QDGB 1AHWA 4NO0B 3SGJA 2FO1A 4X7EC 5DHYB 3JWOH 4ELMA 5IGXL 4MAYC 3FMGH 4RGOH 3TA3A 1XIWA 3RVWC 3RZCD 4O5LL 4J3OC 5ILTL 1FJ1A 1U3HA 2AK1H 5GSRB 3LIZL 4LCCB 2MJWA 1JMXA 4JM2B 4PG9B 4HWNA 1DQML 1MVUB 5E08L 1BQHG 2DBLH 4V2BA 4OBRA 4XHQA 3UP1A 5HGHB 1FC2D 1A7RL 2NQCA 3G5ZB 1ZVSA 3QZWB 2J5LB 4PLJC 5F7DB 3DTXA 5E8EA 4ZFFA 3S35L 1HHGA 3HZVB 1TETL 2ED8A 1BBDH 3FB8A 1OLZA 4YZFE 5HYJE 4X4ZA 2ED9A 2YRLA 1XGUB 2FATH 4L3CB 1W72A 2BY2A 3VDAA 5I1CL 5DURD 5J1AB 4NQXB 4QRQB 4IIQA 5ETUA 5DD1H 4CJ0A 2OR8A 3O6FC 3AS3A 3MGOA 4TULH 3SDDC 4JDVB 2ARJA 2J6EL 3RGVB 4KMLB 3VH8B 5K33A 5TQ2L 1CT8A 1PZ5A 1I3RB 2ESVD 1S9WB 2AXFB 3QUYB 3ZYJA 4KAQH 4OCSH 4BFGA 3Q6GH 1QP1A 2LE9A 1WCBA 1AQKL 3QAZB 2R1XA 3CMOH 3NAAL 4X7SL 1T66C 4LRIC 1L9NA 4RFEB 2FJFA 1NGYA 4IRSB 4RMSA 2OP4H 1WWAX 3SE8H 1X5GA 4D9QE 3T0DA 4MDJA 4NGHL 4NQED 3Q6FA 4LVOC 2Z8VC 2Z31C 1UVQB 4BSVB 1BM3L 2AJSL 3I85A 4R4FH 1HXMA 1G7IB 2DQGH 2XN9B 3QEQA 3MUZ1 2FBJL 1IAKB 5HGBB 2VITB 1VACA 1JGUH 5E8DL 3QFJB 1PKQB 1FBIL 3MODL 4X6DA 5E6YA 5CEYA 3KLAB 3CSBA 5JW4M 5FGCB 4N0UA 2A6IA 4NNPL 3EDEA 4RGMC 3ZLQC 3FN3A 2CIKA 4H26B 4GBXC 5JW5A 1NBVL 3QUXD 1CDCA 2F5AH 5TF0A 1EFXA 3H9SB 3SEPA 1A8JH 4PV9A 4X5WA 5BZWA 3LB6C 1GZQA 4S1SH 4MQ7B 5DMGC 2DQFB 2I60L 2CK0L 4U0RB 5ABDE 1WZLA 4TNVK 4Q97A 1HSAB 1YNLL 2OR9L 4KTEH 5E4EC 4KXZI 3BD5A 3S6CA 4ENEC 4EEEA 1CFVL 2ADJA 5HD8C 3EFFA 1JUFA 4H25A 3W9DB 3MLZL 3RWFA 5LCVH 5F1IA 4PREB 4LSQH 3WL9B 4ONGH 2VL5A 3PWNB 3NA4A 2ADIB 2EDKA 2WIMA 2V9RA 2VSCA 4GG6E 4WDIA 5IESH 1AGCB 2VLJE 4M5ZH 3PQYB 5KSAD 2B8OT 5K9OA 1HEZB 4I3RH 3IDGA 2IPKB 2BMKA 1T1ZB 4JLRA 2AJUH 3BW9A 1FAKT 3GMOB 1R3LB 2HTKC 1TVBA 2DKSA 4NOFA 1NGZA 4HF5L 4LCCC 5DVLA 5FHBH 5B8CB 3L3JA 1IGTB 1QFHA 1HDMB 3PWPD 1MI5A 4JY4B 1YY9D 4WHTB 5AYUL 4NQDB 3AB0C 2Z4QA 1CU4H 4XNZC 1CTNA 4LSSH 2GK0B 3SE3A 1A14L 4JANA 2FSEB 4O2EA 3HC4H 4N0YH 4NOBA 4YO0B 3UC0H 2WBKA 3C9NB 5C6TL 3ZKSD 4O2CB 1I4FB 3NCJH 4M7ZB 3P77A 3NMEA 3F58L 3SJVB 1JFQH 4LNVA 5AZ2L 5B4MD 1DVFD 1JHKL 3SGDH 4RGND 1G6RA 1MAKA 1C5BL 1NMBL 4G6AC 2JB6A 2BNRE 3CVHA 3L95B 1Q94A 2HRLA 2DQEH 2W9EL 2N7AA 3RGVC 4GMSH 1JPGB 3N85L 4XNQA 1NAMH 2M1KA 3VGEA 1LVEA 4NKIL 3MROA 2D7TH 1W0WB 3I02A 2EE3A 2HT2D 1T1WA 2DIJA 2ZSVB 4Z7OE 4AEIH 4OV5B 1UXSA 3UTPE 5FK9B 4IRSC 1VADB 1TFHA 4WY7H 4OUUB 3DRTB 1WITA 1NUNB 2IBZX 3CUPA 3HZMB 5KS9B 5T3XH 4W6WB 1F6LL 4PG2C 4J8RA 5A40E 5D93B 1BZ9A 1SJXA 4HWEH 3D5OF 1HI6A 1KENH 1XR8A 4KDTA 3VFOA 1T0NA 3RU8H 3TZVC 5A3IC 4L4VA 1B90A 2IAMA 3UPRB 2VXUL 1NDGA 3RAJL 2ZJSL 2GEEA 3CU1A 4HJ0C 4CNIA 3KJ6L 5C0CE 3U2SA 5CEZD 1WT5C 4IHOA 2A73B 3VXUD 3JWDC 2D7PA 4J7RA 4JQIH 4L9LB 1ZS8A 3INUL 4KJYB 4ODTH 4I0PD 2X4OA 5AG8A 2YK1H 1RUKH 1HINH 4ZAKB 1GL4B 3RL1B 3BT2L 1W0VB 3WIHA 1G0XA 3BGAA 4WU7B 4U1LB 3O41B 1HQ4A 3TP4A 4LIQL 1QSFA 4NRYA 4MXVE 1XR9A 4LEXL 2VDKL 2WAHA 1L4IA 3BMWA 3GBMH 3KYNA 4QWWC 5FKAB 5HGDB 1ZAGA 4U0RC 3KPPB 3WS3B 4PRNA 1IARB 3GSVA 3BSZL 3SDCA 4XMLH 4X4MA 4ZTOH 1FQ9C 3AY4C 3TT3L 1JGEA 2RFXB 2H9GA 5I1HH 1CFNB 4LLQB 5CJ5A 2IQAA 5IFJA 1A6UL 3H9HA 4N1EA 5C0EA 5H35A 1T20A 3HPLB 5DC9B 1UENA 4KFZC 3FKUS 4WFHD 4LGPB 4GO6B 4JZJA 2HYMA 2IC2A 4QTHB 4FFYL 2IFFL 3THMH 1P84J 4FXGA 1IM9B 1V7NL 4C56E 1ZANL 2EDWA 2J8UB 4JJ5B 4HXBL 4ISVA 4ZPVA 3RVUD 3WO4B 4EUPH 5GQBA 1JGVH 5CGTA 2ENYA 1AXIB 4JRYA 3VE0A 3HI6L 4LNRA 2CRZA 1FVDB 1ZGLB 3QZWA 4IJ3B 5C0ND 4XC1L 4YXHL 3RDTA 5FDWA 1EA9C 4PJDA 4WFED 4LVHC 3T0VA 1LP9F 5DJ2A 2E9BA 5D1XB 5B8CC 1IGMH 3P9LA 4PRHE 1BFVH 5GZOD 4L3CA 4KK6C 1BIHA 3QRGH 4PLKD 3MOBL 3BZFB 3N1MC 2BXZA 4WI4A 4NQXA 5SWSA 3SE4C 5HHXL 4KROD 4P2QD 5KAQG 1VFBA 1I8KB 3VG9B 5AD0A 4X6BA 6CGTA 5IROA 2V2WB 2NY1D 1DQTA 4WV1B 4Y4HA 3V0WL 2R4SL 3VXTB 1NUFA 1AO7A 3FOLA 1PQZB 4FTVB 3B9KB 1CVSC 4KK5C 4PV8B 3BYYA 4DTGH 1A7PL 2VLJA 2VXVH 3O6LH 4JKPH 4BUHA 1OAQL 3ARGD 3PGFL 3MRBA 5CZXC 5FM5M 3TV3L 4S0TD 2PETA 1AC6A 5KVEL 2F53A 2QEJA 4P9HC 3IJYB 2RGSA 3WNKA 4CW1B 3VI4E 3L3GB 2XA8L 4X6CF 2IANB 1AFVL 2XN9A 5TDNA 5C0FB 3TIDB 5J1TC 3HPJB 2FECL 4O02H 5T1DH 3RKDD 4FZ8L 5HHPB 4PJCE 1PKQA 4MD4B 5E6ZA 4MDIA 2Y6SC 4HS8L 5H94B 1DFBH 3N50A 5HHNB 4LSPH 1E6JH 1K8DB 4FQIH 4YLQT 3KLAA 4G3YH 4NWUH 1H15B 2GHWB 1UKSA 3HE6A 2E6JA 4AG4H 1B4JL 4JFDD 4LP4A 4JVPA 5EC2B 4K3JL 3P2TA 3V5DB 2VYRE 4OGXH 2R29L 3KYMA 1OTTC 4U6HB 3VDBA 2H3NB 3MV9B 4LK4A 2JELL 3RWGB 5LBSL 1QFOA 3V6OC 2V9TA 4LQFH 4D0DB 2BK8A 5C08D 3T0BA 1QSEE 3L5WA 3CK0H 5EFIB 5J7CC 3QCUL 3DUSB 1HXYB 4N0FA 2EKSA 3I2CL 4R7DA 1A6TB 32C2B 1A7OL 2VLKA 1FNSL 4PGBA 4Y5YA 1EBPA 4EXKA 1IGIL 3IS1X 2RBLA 1KJ2B 3STZB 1CR9H 5ERWB 3WUWG 1G84A 5D7LB 4TQEL 5I74C 1ZT4B 3PQYA 4J1UB 3D2UA 2B5IC 3CFKB 5D71L 5I1DB 2OX5A 4L3EE 2FJHA 3LKRB 3GMNB 3TO4A 3KPOA 3QT2A 4DAGL 1MHCB 1R0AL 5J11C 3D9AL 5TE7H 1HDMA 3OAUL 3D3VA 5BMFL 1A6VL 3WO4C 3TCLB 1YEFL 2FIKB 4OI7A 1AC0A 2BSSA 3QIUD 2EXYC 1CFQB 2Y9RT 3LKOB 4Z77B 2B4CL 3NA9H 3C9NA 4L9DA 2R8SL 5D1XC 2P44B 5TGBA 1T2QH 3S7GA 1BEYH 1OTUD 4OF7A 2BNUA 2MOVA 2YD7A 4U6XA 1MCWW 1OPGH 3VDCA 3ZSSA 4C83B 3HNSL 1DBML 5I1JH 2I24N 2KL6A 2YS4A 5DQJA 4Z7NE 2ADGB 1LQSR 2VLRA 3A0OA 1JPGA 4MQXD 1EO8H 3B9KC 4Y1AD 1AI1H 4ZUSA 1FFQA 2ZSVA 3M07A 2ZKHL 5FB8B 4GS7B 1JGDA 3PXHA 1QG3A 3DRTA 4P0DA 1MF2L 4QHMA 1B6UA 3BVNB 3IDMA 1NAKH 4NCC2 1BVLA 4NHUB 2PR4L 3HUJF 4F7PB 3NPZB 3GBNL 2ZCLH 1FZKA 3CLEH 1A3RH 5IB2B 4S2SA 3WNNA 1PW3A 3ZKNC 3GUTB 1MCNA 1OAXH 3N06B 2A73A 2X1OA 1PSKL 3RHWK 3VWJB 4G43A 2XKUA 4F3FB 1G7JA 4MB5A 1NC2A 2IBBA 3WNOA 5DJDB 1G9NH 4I0CC 4JFPA 3D39D 4F37F 3LKPB 3PL6B 5JUEL 1DQJB 2Y06L 3LRSA 2EDOA 1MSPA 5LG1A 4QRTA 2VIRB 4ZTPL 3JV4B 3KPSE 1SVZA 5CLTA 1IAMA 5JHLH 3G5XA 1YN6B 4HIIA 4U7KA 3MLRH 5GXBB 2BCKA 4A6YH 3VFNA 2QR0B 4X5XB 1BWMA 2WWMD 5CEZL 4LGRB 2ZG2A 3RQ3A 3MTRA 2K7QA 1ZLVH 3L7EA 4OD1L 1KIRB 4JFYB 3RBGA 5E5MB 3OKOB 5E6ID 5FGBA 3HG1D 1XGPA 1QQDB 2OQJB 4X83A 4WWID 2YN5A 3I50L 2UV3A 4JDZA 4AM0A 1U2HA 3IKKA 4KXZH 1RUPH 2QSTA 4K71B 1XGTB 4O4YH 5D7KE 1MPAH 1T22B 4X4YB 4AJ0A 4AMKL 1EZVY 4GW1A 3RWCB 1QO3A 1Y0LB 5L2KB 4NZTL 2E7BA 1DLHA 3RHWF 1U58A 2EICA 3ESUF 3LEYH 3U9UB 3NOIA 3HI5H 1CDHA 4HUNB 5DD0H 3FTGB 2NY7H 2GFBA 3T3ME 1S7SB 4TSBL 3LY6A 2H45A 2XXCB 1VFOA 3QUMH 5F6HI 1QSEA 1TJIH 5T1MA 4UT6L 5MEOB 3QDMB 3S3SA 1HE7A 1KC5H 4WTZA 3OX8A 3SDXB 5EBMB 1KG0A 3P30L 5DHVB 1DN2A 3U4BH 1U92A 4P5TB 3REVB 1UJ3B 3ARBB 3DRQA 4NQSA 1QVOA 5ID0B 2FWOB 1RU9H 3GI8H 1PY4A 3PWUB 4YFEA 1JZ2A 4YBQC 1O7VA 1ODAA 4M48L 1QD0A 3TVMB 3OHXB 2IG2L 3ARDA 2VJXA 2XICA 5BVJB 3DV4B 4LU5H 4P2OC 4I5BA 3UTSA 5I71C 1U8OB 3BIAX 2EC9U 2NTFB 5GSVA 2P8PB 3KPTA 1RQ5A 4Z95H 4EQ2A 1UWEH 5ALCH 2NLJA 5DJXA 3NABH 2HTLC 1C7TA 2D7QA 1I7RB 1WFUA 2PYED 2XFXB 5HDBE 5C07A 5JXED 1DP0A 1IILE 4Y19E 3MQIA 4G6MH 5D7JD 4ETQB 1NLBH 1IFHH 4HT1L 1OW0C 4YWGH 3S35X 1CZ8L 2GW5A 1FPTL 5HHNA 4GRLC 3S96B 4ODVH 5J12B 4LPYA 4WNQB 3K1DA 2JIXB 2YHGA 5CIPB 3HMXH 3CFJB 3KPNB 5BOPA 1JJUA 4Y2DB 1MY5A 1ROWA 4JRXE 5D9SB 3U0PA 3DSFL 3HE7A 5JQHC 1EHLH 2CXGA 1A1MB 1ZA6A 1QRNE 4PJIF 4ZXBC 3ETBF 1T83A 3GHBL 2DQCL 2UY6A 2DDQH 1PD6A 1YYLL 1XEDA 4MNHB 3PL6C 4MA8L 4K7PL 1PKOA 4CVUA 3N9GH 1IGJB 2H41A 1QBLH 1S9YA 1ZKAA 2FHCA 3H8NA 3L3HB 2V17H 2APXA 4U1HB 3TCXA 1A7BA 3V5HA 5ADOL 3EGSA 1OM3L 5EZIH 3S4SA 1MCOL 2P5WE 3HAEH 1QKZH 5EOCJ 1CLOL 1H3GA 1BZQK 2AGJH 4HHAA 5DI8B 4V1DA 4XNXL 4X9GA 4UDUB 4XP5L 2BNQD 4PJXB 1NANH 2APTA 2JCCF 3MV8B 3TH2T 1YEIL 4GW4B 1K8IB 4Z0BH 2QTEA 3D0LB 1DBAL 3DNKA 4LASH 2CDFA 4JFZL 5FIEA 4AQOA 1K9TA 2R9HC 4OQTA 5DR5H 4YHOL 5KSBF 2P43B 4AH2B 3X11A 2XWBB 4Q9RL 3UJTH 1CXLA 5BW7C 1JNHB 3GMNA 5IK3B 3MRCA 3GRWH 5F96H 3VFRB 4NWTL 5EZOL 5ANME 1SJVA 2VXQL 4PJHB 4GQPH 4ODUA 3WJLC 4OZHA 3U9PH 1YMHB 2ED7A 4DVRL 3MA7B 1KLUA 1JGLH 3CFEA 4M7KL 3ULVL 1JWSB 5L0QB 2DMCA 1IAII 4UTAL 1Y18A 4WCYH 5DRNB 3GK8H 5DVKA 1HNFA 1BMGA 3GIZL 4PJ7F 2HKFL 1EVTC 1ZTXH 3EO9H 5TH2B 3T08A 4P4KA 1RAMA 1KF9B 3DXAE 1YMMA 2VQUA 2P46B 1SJHA 4D3CH 3B9VA 2QQNL 1F4YH 5C0BD 1RPQA 4PJAF 3DETD 2HJFA 1N8ZA 2DS4A 4KTYA 4MZ2A 5TPWH 3WKNA 3UEZA 5D2LF 3CX5K 5CJ8A 4HBCH 4KI5E 2Y72A 1WJ3A 3L9RA 1F58H 4OZIF 4NFCA 3MRFB 4HJJL 4ACPA 4P5TC 4Q7DA 4MNQB 5F7LB 3KNBB 4H8WL 3SGKA 4G5ZL 5A2FA 1K5NB 3BKCL 5FYJE 1ORSB 2AVGA 4AQ1B 4DN3L 3PIQB 2CIIA 5C0AB 4OFPA 1WWCA 3IFLL 3ULSB 4BZYA 5IB4B 5T3ZH 4QHLB 5JHDE 1GGBL 4G6JH 1JWUB 1LHZA 3EOAB 1EEUA 1D6EA 4R2GC 4OF6A 4OV6F 1BD2A 5J3HD 2XPGB 5GISH 4F7PA 3ULUE 2W0KA 1YJDC 2LFGA 1EAPB 4ALAH 3RWJB 4Q2ZA 3MBXL 3QEGH 1LE9B 4ZS7L 4KDVA 1J87A 4PRIE 1OWWA 1AP2A 4U1MB 4G80B 1FO0H 1MWAB 3BGMA 2WBJD 1J0YA 1NGXB 3LDBB 4X5LA 3WJJC 4JR9L 3RP1A 1YQVH 2D03H 3VWJA 5FDYA 5IVZB 4LLMA 1Z5LB 3H42H 3WSQL 4BKLA 2DWDA 4ZPTB 4P3WA 4GAFB 3JV4A 4K2UL 2EC8A 3D48R 2KKQA 1UXWA 4S1RH 3MJGX 4NQCB 3VU2A 2OLDA 1S5IH 3SBWC 2QR0A 3RWIA 1I1AC 3VGBA 4KI1A 3O0RL 1FFNA 3WFBH 4Q0XH 3VRLE 3GJFA 1KIRA 1SMAA 3P4MA 3HC3H 1T7ZA 4JFYA 4Y19A 1GRWA 5F1NB 1NGPH 4QRSB 3QG7L 5DMIH 1MFAL 3QNXB 1CG9A 3QULA 4K94C 5D5MF 4GUPB 3Q1SH 4OLXH 3KS0J 4Z8FH 2B1AH 3MLVL 4EUPG 4G8FB 4FABL 5JW3H 4BFIA 4MJIB 4NNXA 2VOTA 1MCJA 5E9DD 3RWCA 2W65B 2Y36L 3WMSA 4HWBH 1FORH 1E28B 2NZ9D 1QRNA 5KVGL 3RIAK 2GKIA 1PEWA 3FRUB 4WIQA 3S88L 4KV5E 3FTGA 4OCRL 1B0RB 2UZIH 5DS8A 2Y4SA 4YXLL 2CDEB 1BJ1H 4XHJD 4S1QH 3MC0A 4I18A 4Z7VB 1KBGL 3EJYD 4EIZC 3DVGA 5TE4H 2HMIC 3QNYB 5L0QC 1XMWA 3SDXA 4QOKD 1N5YL 4JPIB 2NW3A 3ARBA 4AL8L 1D5MB 2IH3B 3O3BA 3MJ6A 3MRDA 3PWUA 3V8OA 3MUY1 1RHHA 3VXQB 4LCWA 1P4LB 3D85B 4Y4KD 3TT1L 3B8YA 3TVMA 3LSOA 1CICA 2OL3L 1OP5H 4JN2B 2I9LB 2HG5B 2I07A 5E2WH 2O5ZH 2Z35B 3T2QA 1AHWC 2HLFD 1LWRA 2NTFA 3SGJC 2A1WL 4HC1L 2P8LA 1XIWC 3EW3B 2X4TB 3ARUA 1RSFA 1AXTH 2IH1A 1X5XA 1I7RA 1OT2A 4OTXH 3W9EB 3C6LC 1U8KB 2O5YH 4TVPD 4KJWC 3O11B 1FVEB 3U46B 3WFZA 3QA3B 5EU5B 5I1AB 4KRPB 4U1NA 4YAQB 5I30H 4WNQA 2QQKL 4HKJB 4P23B 7FABL 3DXAA 3OKYA 1JPSL 2JIXA 4ZD3L 1HIMH 3LS4L 3EJJX 2Q6WB 3JXAA 3NZ8B 2BX5A 4UU9B 1HWGB 1F42A 5E56A 3BWUC 1U95A 1N0XL 1U9KA 4LHUA 1G9EA 1T1YA 3K80A 3QDJE 3FB6A 3OGCB 1IGFH 4ONHA 4L8SA 3DGGB 4LBEB 5K9KB 4UV4H 2FD6H 3BH9B 3EO0A 4KUZL 2HA1A 5ISZD 3SCMD 4JO2H 5BV7C 4R4ND 4UBDD 4MXQD 4NBXB 4R26H 1WIUA 4M43H 4PJFE 3PP4L 1KB9J 2NY3D 2A9MH 4X80H 2HVJB 4V2CB 3VFPA 1XCQA 1R6VA 2BVEA 4PJXA 4RFOH 1KPRB 3TBWB 5MP6L 2F54B 3MV8A 2NY4D 5HYJB 1N6QH 1NKOA 4HK0A 5LWYH 4KPHH 1LO3H 5EA0L 3EYUL 5HTSA 1JZ3A 4TUJA 3D69B 3T2PA 5HDQH 4E42A 1FC1A 3TO2B 3KPLB 3O4LD 2VLMD 4HGWA 4FQXA 1NDMB 3S37L 2B2XH 4W70A 3O6MH 2YEZB 1PG7H 3O45A 4HH8A 3GKWL 4NQUA 2J6EA 5DO2C 5DRNA 4G8IB 2C3WA 4RMVA 4NUJA 1MCPL 4PS4L 5DDHA 5TH2A 3VXSE 2WMPA 3LVEA 4PRDA 1NLDH 5IR1A 2NX5E 3QIBB 3O3EA 1ULVA 4ONOA 3UYRH 1UWXH 5INCA 5DRWB 1XCTA 3MRFA 5B38G 2YA0A 1F3JB 3HCVB 2HFTA 2M26A 4YFLF 5EWIH 2VXTL 1DEEA 3MJ9L 3A6CH 5JOFA 4PJBF 3UTZB 4HFWB 1MRDL 4HZLB 3MRQA 5SX5K 3PP3K 1FVCB 4YDIH 4XBEH 4KZEL 1MRFH 1NMAL 2FHFA 2BHYA 1YECH 2OMNA 4R96A 2YRPA 5DJZB 1QLEL 4Z6AT 4EI6A 1C7SA 5DEFA 1YA5A 1QPPA 4RRPG 1HK6A 4DQOL 2AJZA 2CR6A 4QRPE 1MCEA 3TYGL 2YUVA 4BA8A 4E5XA 3GM0A 2D0GA 2XNAB 2P45B 4O51A 1E4WL 1NGXA 3BOVA 2HVKA 4KRPC 3TYFA 4G8GA 4JREB 2QV2A 4QT5B 2BSRA 5EUOB 3G6AB 1U0QA 1MNUH 1RJYA 4YHZH 1Z5LA 4Y16B 4PTTA 5F7KC 4WO4D 1QFWL 1C16B 3NTCH 2KBGA 4GG6B 2CKBB 5LGJA 2BSTB 3FOMA 2HWZH 3GMRA 4HZAA 3R8BB 3JWOL 2V2XB 4RGOL 1KPVA 3FMGL 1H3VA 3GMLA 1MCSA 5IMMB 5K9JH 5SX4H 2AK1L 3QWOA 4HJGB 1WBXA 2DBLL 1PZUB 3KPRA 4ELMF 1QTYT 3G5VB 3KXFE 3QNXA 3OKDB 3SPVA 5JNYA 1PYWB 3T0EB 1AD9B 3VFTB 4WFGE 3V6BR 4G6KH 3WS6C 1OQXA 4KDTC 2FATL 1GGIH 1X3DA 3BFOA 4MJIA 4S1DD 1F02I 4YGAB 3UJJH 4M5YH 3TPUB 5DD1L 4EN3D 1A1OB 3DYPA 5HDOA 1CVRA 2ZUTA 4TULL 1ZMYA 2AJ3A 4YHYC 3FRUA 1BQSA 2BNRB 4AEHH 3PE9A 1Z9OA 4WW2B 3QHZH 4NQEE 1NCCH 4IRJC 1BJ1J 1QHPA 1BOGB 1XGRB 2JLLA 3ES6B 4KAQL 3HB3D 3Q6GL 4OCSL 4JFXB 3BP4B 2C4FT 5D1ZA 3CMOL 3E0GA 2JJVA 4GKZA 4CVXB 3G6JA 5L8KB 1DQQB 3FO0H 3BN9C 2PUQT 2OP4L 3AXLB 2DF3A 3SE8L 1T5WA 2W91A 3AC0A 5KSVA 3E2HC 4PJFA 1HKFA 1PJ9A 4OD3H 3VXQA 4R4FL 3B3IB 2DQGL 1UZ8B 3N1QC 1A5FH 3EDDA 1A7QH 4P5KA 3RWEA 3PJSB 3VJ6A 1HN1A 2HG5A 5IVNA 1JGUL 3LQMA 5SWZD 5IG7A 1H0DB 2XA3A 1LEIA 1NC4D 3ARXA 1A2YB 5C0CB 4JM4H 3VD4A 2X4TA 1YUHB 2R2BB 2P5ED 2GT9B 4MSWA 2APFA 2X7LB 5DUMH 4QXTB 1PY9A 3W9EA 2F5AL 4CMHC 4YGVB 5IEKB 2QSVA 4X6DF 1INEH 2COQA 3CPLA 1R3KB 4S1SL 4TN9A 5IB5A 1FG2B 3D1MC 4EJ1C 3ZDZF 3BJ91 5MENB 2WBWB 4UDTB 5FF6B 4KTEL 3AROA 2NX5A 5FECA 1O5DT 1KTKE 1S7WA 3EOTH 1L0XA 2L7UA 4QRRB 3QXVA 4TVSa 5L2JA 4NSKA 2VDPH 5LCVL 1ES0B 2A74B 4LSQL 4NJ9H 4WHCA 3HS0A 1NUGA 3BEVB 5JPMA 3F7YB 5A2JH 3S9DB 5IROC 2FH6A 3VMNA 5ACZA 1RI8A 4Y4HC 1WGOA 2YA1A 3VFMA 5IESL 2NXZB 3O4OC 3QO0A 4L5FH 5K9KA 3OJDA 4M5ZL 2R2EA 4X9IA 4C56B 1EHAA 4I3RL 3QIWD 2AJUL 4XX1G 4PGEA 1QFPA 1U8QA 4GQ9H 1FL6A 1XF2A 1M6OB 1NEUA 1FSKB 2BJMH 5FHBL 4Z0XA 4Z78B 2NYYD 2H1PH 1OAKH 1KPRA 5HHOE 4NN6C 4PRHB 3MJ8B 1CU4L 2O93L 1H3UA 4Z18A 1UJTA 4LSSL 4RAHA 5KN5B 4MA3B 4N0YL 3UC0L 4XVSH 1IEAA 4APQB 4JPWH 4BZ1H 1KJ2H 2X4SB 1C08A 3VXMD 4IS6A 1JFQL 2YPVH 3D87B 4YFDB 4OLWH 3RZCA 2XRAH 1E27B 4PUBH 4XXCA 5I6XB 4EI5B 2GY7B 3HE6C 3NFSH 2Q8BH 4WI7A 1QSVA 4PR5A 1MFCH 3H9ZA 4C4KO 2PCPA 1I9RH 1F00I 3V0AC 5CMAB 2IALB 4PBXA 3FQTB 2ZUQB 2DQEL 4K7PX 5IHZB 2NMSA 2UWEE 4G7YH 4GMSL 5LQBH 3FO1A 4WW2C 5D7IE 3WHE0 2FEEL 3WDIA 5HHME 2D7TL 3ZKXB 4TSAH 4Z7UA 3RNQA 1CD1A 4TYUA 2M8XA 1JTPA 4AEIL 4BFBD 1JRHH 3NCMA 2NY6D 3CDGB 3GSRA 3OKMB 4WY7L 5K9QG 4OSUH 5CKGA 5DRWA 1HH6B 5CZVL 5GGVH 5T3XL 3C5SA 3VXUE 4PJCB 5GPRA 4HWEL 2YZ1A 4Y5YC 3I6LE 1KENL 3E8UH 3RU8L 5F6HJ 5GRJL 2FH8A 5C0GA 3IU4H 1NJ9B 2ESVA 3UYPA 4PJ8B 3IDJB 4HZLA 5T1LD 4PY7A 3VWKD 4ODTL 1M7IB 3TNNA 2YK1L 2R0KH 2Z8WC 1NBQA 1RUKL 4J3WA 4YHMH 3ECBA 3TO4C 1HINL 4H0HB 3SDAD 4DOHE 4U1JA 1UKTA 5EU4B 1PX3A 3BDYH 1OGTB 2HH0H 4JHZA 2QADB 1CGVA 3GBML 5HHVH 1U8MA 5CBAA 3RVTD 3SE9H 2CQVA 1RZ7H 5I19H 5DTFA 2X4PA 3G6AA 4XMLL 4P46A 3TA3D 4ZTOL 1K4DA 5I1HL 5HXMA 3RY6A 5HY9B 2VSDA 2NZIA 2YWZA 1U3HD 3L3OA 4F7MA 3QUXA 1HYSD 4ODXB 3LN9A 5TDOB 4GRMB 3F5WA 4BSJA 2ICES 4LQ1A 4YUEH 4WFEE 5IMMA 4UNVA 3THML 4R3SB 5TJWK 4FRWA 3S5LB 4UZGA 5MERB 4RNRA 4YDVA 1JGVL 2DJ4A 1S7VB 1KCKA 1IAIM 3OKDA 1OSZB 2X2YA 3T4YB 3T0EA 4DGYH 1IGML 3VFTA 1CGTA 4HKZA 1BFVL 3RL2A 4FA8A 2P1YA 5GGTA 5I2IA 3BKMH 3QRGL 3R4DA 5DJYB 4TTDC 1EUTA 4X4XB 3VGAC 1DBKH 2KDGA 2WIIB 3VRIB 4F7TA 1OAUL 1VGKA 4PJDF 5I16B 2SEBA 5F3BA 5KSAA 4AIZB 1FGNH 4HUUB 5D96C 3H9YA 4HEME 5BS0D 2WINA 5IEKA 2C3VB 3ES6A 25C8H 1IBGH 3QI9B 4EI5C 4DTGL 5I18L 3U0TB 2VXVL 3PWPA 4JKPL 4N8PA 4PJEE 5EPMA 5F93C 4GMTH 1J12A 3P4NB 1FE8L 5EBLA 3MV01 2OTUB 3VW3H 1HSBA 1J10A 2FECI 4NBYB 3U7YH 5IB3B 4OGAD 5DJ0A 4MLIA 1FAIH 3B3IA 1CDYA 3SY0B 1DVFA 3VH8G 4O02L 3FQXB 5DHVH 5T1DL 4XWGH 3DURB 2DYPD 1DFBL 2OZ4H 3QUZB 1EXUA 4LSPL 1E6JL 4FQIL 4G3YL 3IAGC 1K4CA 2EXWC 2X4NB 4NWUL 5E7BA 2GT9A 4DZBA 3WFEH 2BVQA 4HIEB 1J5OH 1Z2KA 4PJ8C 4PJGE 3MCKB 4AG4L 3NCEB 2R4RH 5C08E 2VZ1A 1KTDB 1M7DB 4BH8A 5IIEA 2Z92B 1Q9WB 2RCSH 4OGXL 1CDIA 4PBWD 5FA3B 3FQUA 4WI2A 5DZNA 3KPSB 1QUNA 4H88H 1YJDH 2BY3A 2N7BA 3VXPA 5BRZE 5IMLB 1FFOA 4I4WA 5DUPH 1NH6A 1J1XH 1RY7B 2FZ3A 2D3VA 4LQFL 4R6UA 4UDTA 2QSCH 3GB7B 3WLWC 1WC7B 1FL5A 3CK0L 1T03H 3HFMH 4QRRA 4HDIB 5M7QA 3T65A 1VESA 4L29A 5E8PA 4PJ5B 4U3HA 3HNVH 3FFCE 3ILPB 4ZUUB 5CIPH 5CD3B 4AIXA 4IDJH 5ESQB 1CD0A 5JORB 1MJJA 1IM3B 4ONFH 5E5RB 1XF3A 2ZOLA 1VFAB 1CR9L 4I0PA 3JVGA 1I1FB 1T89A 4HUWB 1U8NA 2YD6A 1B6DA 1MI5D 1BQHA 4Y5VB 3ARDC 4LKCA 4RMQA 5GGUA 4KJPD 3QWRA 4F9PA 4M1CC 2H2SC 3MNVA 2XZZA 4U0QB 1ZWIA 2H8PA 4MZ3A 5TE7L 1U6AH 2NY5H 4GW5A 5E1HB 2YC1B 2D4DA 4ZQKA 4HBQA 3LIZH 4ZSOA 2F58H 3AS1A 4APQA 5I8CB 3NA9L 5F7NC 2W92A 5HYIA 5E08H 1T2QL 4KKAD 3KDMB 4NN7B 3V79C 2BXYA 1M4KA 1BEYL 2Q76B 1ZSDB 2MQ0A 1IL1B 5F89A 4Y1AE 4EDXA 5HI4D 4YK4B 2FL5B 3H3BC 1OPGL 4MXVF 4A2LA 5I1JL 2ATKB 3DUHA 5DMJB 4F15C 4UILH 4YIQB 4OCMC 2IALA 1RZKC 4N8VB 5IHZA 1R5IA 2L4OA 1H3WM 2QKIB 1IC1A 2DLFH 1EO8L 2AEPH 4N5EC 3QI9C 4GXUN 1AI1L 3ARWA 5DZLA 2OL3B 1T80A 2RR3A 1PAMA 5ENWA 5F88A 3KPMB 5CBEA 4E41E 4UNUA 3CX5J 3RTQB 4TPRH 4WWKD 4KY1H 3AM8C 2GJ6D 1TVHA 1NAKL 4KVNH 2XWTB 4P2QA 4H0GA 5F6IB 1J1OH 2UVFA 1R5WA 3OKKB 4FZEH 4FN0A 5IBTH 4U31A 4NO2B 2NXYC 2ZCLL 5DRXA 3CLEL 3F62A 1A3RL 3DPBA 4ORGA 3O9WA 4HWZB 5ESAA 3LRGA 4J3XA 1OAXL 4I48B 5SX5H 1NBZA 3PP3H 4JRXB 5F1KC 1QSFD 4UIKH 5BZDA 5JTWA 3TNMB 3U1SL 4J4PD 4K3EH 1G9NL 4YHNB 4QHNA 2GUOB 1HH9B 2L7JA 2H6PA 4Y8DC 4C57C 5KVMC 2OMBA 3SDCD 5DFVC 4Z7WE 2QQQA 3U0WH 1P6FA 5A2LH 2R15A 2YBRB 2FR4B 4PJEA 4G9FD 1UQSA 5JHLL 4RAUA 3HG1E 3H7BA 5EOTA 3MLRL 3QDGD 5E00A 1IJ9A 2DQDH 4NO0D 4A6YL 4LOUD 1AQDB 4B7IA 3MYJA 2V7HB 2D0FA 2K7PA 2P5WB 5J9PA 1MWAH 1ACZA 2FO4A 4MJ2A 3IRZA 1A6WH 3WUWB 1A02N 4JM2D 3LN4B 4XPHH 4QY8B 5IM7B 5FHAH 3U30C 4JFDA 3RWHA 4U6YB 2CMRH 5T33H 5J6GB 5IFAH 1DANT 4KGLA 4FXKB 3RDTD 3SGKC 1T4KA 1RUPL 1ETZB 4O4YL 3MGTA 1MPAL 1A4KA 4PJGA 4Y5VC 5C08A 4L4TA 4Q6IB 3ILQD 5C0IA 2AKRB 4OCNC 3VFGH 4XBGA 1CLYH 1UWGH 3LEYL 2PO6B 2ARJQ 2MCPH 3HI5L 5DD0L 2NY7L 4JKKA 1QOKA 3RA7H 3F7VA 3WN5B 4OFYD 4Y8AA 1U93B 5D4QA 4CBPA 1G7QA 3QUML 4M8QB 1TJIL 3I3DA 4F8TA 3QUYD 5JOPD 4ZUTA 4LPXA 1KC5L 1FL3B 5TDPB 1FNFA 5F7WC 4P2RA 5JLZA 3V6FB 3U4BL 4IRSD 5TF1H 2Q3ZA 3MLPA 5GGQH 4HUUA 3C08H 1RU9L 3GI8L 3HLAA 4WI5A 2IBZY 1HOCA 3PV6B 5D2NE 3QPQD 2PYEE 4NZJA 4OQ1A 1X7QB 5M94B 3X14B 1UEMA 3MRMB 4LU5L 5A3ID 3GSXB 3QIUA 2AXHA 2XN9D 3X12B 4OAWB 5IV2B 5JHDB 1A4JB 4HJ0D 3QFJD 2BC4A 4Z95L 2OTUA 1UWEL 3DARA 5ALCL 3EDJA 5I66B 3QQ9C 2X44D 5JZ7D 1X5ZA 3NABL 2VZVA 4WRLA 2VAJA 4HMEA 4G6ML 1NLBL 1IFHL 3RTQC 3N85H 2HJKB 1C1EH 3LV3B 3GNMH 4YWGL 2V5YA 1SY6H 2Z91B 4XI5C 2WUCH 3AREB 5MHSD 4PRIB 4X7FC 3U36A 3H9SD 3WFHA 5F6IC 4F2MB 4TTGA 3UPCA 4ODVL 4BH7B 3PWVB 3VFVB 1M05B 1G1CA 2DN7A 1RZJC 2DBJA 1I7UB 3HMXL 1JF5A 4W6XB 5EN2B 3QH3B 3U6RA 4IMKA 4Y1AA 3MCKA 4S11A 1KTDA 1EHLL 4IOIB 4ZFZB 4OBSA 2BVOA 1SBBA 1TITA 2Z92A 5DMKA 1Q9WA 1AJ7L 4QNPE 1MHEA 3IS0X 3MLTA 3NZHH 2DDQL 3V8CA 1GZPA 3MNWA 3VFWA 5IMLA 4HIHA 5C9JB 4XTRC 2JKXA 1P4IH 3LKQB 3NFPB 4K23H 4I18C 3X3FH 1QBLL 3MRHA 4JCLA 2OTPA 2YD5A 2V17L 4XCEA 4ZO9A 2IGFH 1FRGH 4LLYB 1F13A 6FABH 3PQYD 2V7NB 5EZIL 1QKZL 1JK8A 2AGJL 3U48A 4ETYA 4M6MH 1VFAA 4K8RH 4L3AA 5FO8A 1AKJB 3D39A 1LGVA 1ZLUK 4Z0BL 1H3PH 4PLNC 1TQCC 5E94A 3RVXD 4MCZA 5ITFB 2ERJB 4LASL 3HZKB 4NQDD 1CICC 3VXOA 2PW1B 3QCVH 2X4QB 5DR5L 1U8HB 4ZS6C 5EH1A 3WDHA 4RA3A 3UJTL 3IVKA 3GRWL 5F96L 2P7TB 1I85A 5F8RC 3OKNA 2GIYA 1E4KA 3SJVD 5IW3A 4D2NA 2VQ1B 3U9PL 4HUVA 2IFFH 1JGLL 2EO1A 5E6IA 3BISA 4KK5D 2XWJA 2PO6C 4JZOB 4WCYL 1KNOB 1EJ6A 3GK8L 2PTTB 4HXBH 1DUZA 1VEPA 1ZTXL 3EO9L 1JHTA 4D3CL 1U42A 1F4YL 1MLBA 3HI6H 1D9KB 1AXSA 4OZHF 4XAKD 5TPWL 1V3LA 5EIIB 5HJ3B 2FL5A 4HBCL 4HMDA 5LXGH 4U2ZA 1IEHA 1F58L 1UZ6E 1RJZB 3O8XC 2W59A 2QKIA 3L3IB 3LQAH 3C8KB 5BJTB 3AAZB 4JY6A 1F11A 3MRRB 1MFEH 2OL3A 4L8SC 2QQLH 2UZYB 3T1FA 1BX2B 3O6KH 3DBXA 3ARTA 3MUGA 3NN8B 5MEPA 5T3ZL 3ZTJH 4G6JL 2DKMA 2G2RA 4YEEA 4HC1A 4NQVA 2XTJD 4YHIA 3C5JB 4OCLC 2YD3A 2ZZUT 5IHLB 3GJFK 5GISL 5HPMB 5IJVA 5CSZA 3QO1B 4ALAL 2BOBA 3QEGL 4RISH 4DVBB 1ERNA 3GSOB 4OJFH 4NYLB 1FO0L 4ZAKD 2IMMA 2X05A 1INQA 5DGRA 1YQVL 4X8JB 2D03L 1IZKA 2AABH 4HSQA 4JB9H 3DROA 1AFVH 5SWQB 3T3MF 2I9TA 3WDJA 2PTUA 3ZDYF 1HH9A 3H42L 1CS6A 4LF3B 3K1KC 4ZOAA 4DGVH 3QDJB 3ARFC 5D2NA 4DKEH 5JXEA 1Y6NR 4M62H 4R7NA 5D7JA 4P3CH 2VZSA 3EO1A 4S1RL 1TZIB 4OB5H 1BIIB 2D31A 4I2XA 1S5IL 3MO1B 4ODWA 3RY4A 3BZ4A 2V7HA 3WFBL 4Q0XL 3P40A 4M8VA 5IVXA 1DN0A 3HC3L 4X9HA 5E5UB 1AGDB 3WUWA 1KIPA 3MRGB 1IM9D 3FB5B 1MHHB 1NGPL 4XPAH 3LN4A 5DMIL 4POZC 5E1AB 1CCZA 4YDJB 4HPOH 4S0SD 5DJ6A 2EH8H 2ITDA 1LEGA 2Q86B 3IETB 5J6HA 3N1PC 3Q1SL 5CHNB 2EXYD 2D7OA 3RNKA 2WWKO 3MLWH 1TCMA 3SGEH 1FZMB 3IJHB 4R97B 1SYVA 4Z8FL 2CKBH 5DQ9B 2B1AL 3QXUA 1ETZA 1Q9LA 5D1XD 5JW3L 1FNSH 1QBAA 1UGNA 5T5NF 3MV7B 4HWBL 1FORL 2B0SH 3QBTB 5EU7E 4X6EA 3NCYS 4N5UA 4WFFD 2FX9H 4QOKE 3C5ZB 2UZIL 3CH8A 3WN5A 5CJXA 4S1QL 2HFEB 3VXSB 4ZYKA 3H3KA 5FO9B 4PRBB 1H5BB 1SEBB 2BNQA 3FB7B 4FTVD 5TE4L 1QZ1A 1D5BB 4YQXH 1OGAA 2BVPA 3BUYB 3D9AH 3U79A 3WO3B 1YEDA 1Z6JT 2ICWA 3UTTB 3UTSD 3C60B 1NFDB 5C1MB 1BZ7B 5EZJB 1ZT1B 5EUKB 1D9KC 5IOPA 2LU7A 3HC0B 2ZUUA 4KRMB 4U2YA 5FYKH 1JWMA 1D5XB 1VGEH 4WU5B 4JFHE 1VKXB 5C07D 3LRHA 5E2WL 4TVPE 1I7ZA 2O5ZL 5SV4A 3GSXA 4LCYB 2H32B 4F57H 2IAND 2OSLB 1JHLH 2DWEB 3X12A 1GGCH 4FHBD 3V9FA 3MJ9A 3ZKND 1BGXH 4FG6D 2AS5M 4KKNA 3VXRE 3T4AA 5I66A 1AXTL 4U1KA 1KSRA 1AGFA 1LD9A 3SKMB 4W6YB 4OTXL 3KYKH 3TESA 5C0BA 2VC2H 2O5YL 1HHHA 3SQOH 5A16A 5CGYD 4QRPB 2HJKA 2HRPH 1Y6MR 3LV3A 3KYAA 1BVKB 3RBSA 4UOW0 2FHBA 1ZA3B 2H2PD 3FN9A 5IQ7H 4QRUB 5I30L 3VFVA 2EO9A 2JCCE 3PDDA 5IW6A 2I5YH 3TIEB 1J8HB 4LGSB 1F2QA 2Z9TA 3MV9D 4PRPB 5GZNC 4MXWH 5KSBE 1LE5B 1EVUA 3PHOB 5TQ0H 1CL7I 4W68A 1MJUH 2GJZB 3IXAB 4OFKA 4TUKH 3FO9B 3D18B 1SJEA 1KCRH 2Q20A 1F6FB 1V7MH 2ZCKH 4KKBC 1IGFL 4HS6B 2OS7A 5C9JA 3I75B 4M1GH 2PN5A 2G75A 3GSUB 3MXWH 4UV4L 2FD6L 5DEGB 1B4RA 5D1ZC 3HHRB 2FYYB 3DOSA 1FNGB 3EKCA 4JO2L 3VXNA 4OUOA 1CQKA 3BQUB