4EAEA

The crystal structure of a functionally unknown protein from listeria monocytogenes egd-e
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
187
structure length
184
Chain Sequence
EAFSFSPSGFKVSTVESILGGDVTTTYLSSSKSFQKDFEALTLFINQYKVEHVINPTKEVSASNPESYLANKNGYVITLDISIKNNSKKDKMYKADQISLLGASKSVGGSLDNFIPSGFHLIGSSSDPYNFTAGKTARGLLTFTMDEATYNDLAKDSQIGVPDPSRFDSSGSSQDNVVAPFPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Lmo1068 protein
publication title The crystal structure of a functionally unknown protein from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
total genus 48
structure length 184
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4eaeA00
4EAEA
chains in the Genus database with same CATH superfamily
1UM4L 2NYYD 4LKXA 4HS8L 5PAZA 3B2MA 5E9DD 3V8OA 2HH0L 3KG5A 3P2BA 1XBDA 2FWSA 3HZYB 1SLVA 3SCMB 5I0WA 2WVVA 5KUKA 3BESR 3E8VA 2YD8A 2W0LA 4A6YA 4HK3J 5C0BD 4UQ9A 3ZIMA 1FFQA 1CU4H 5A3IC 3WS6C 1JZ8A 3C12A 2X6CA 1RP9A 1RPKA 1Q4NX 4LHUG 3RGBA 5IFHH 1ORQA 5GGVH 4OIAA 4M1DH 2EXYD 1KWGA 5FYLH 4A6YB 1RVFH 3ZK0A 4DGIL 5F7WC 5AW9B 3EYOA 1ORQB 2YGOA 1UT1A 1J0KA 1OM3H 2J55A 3BSZL 3LD8B 5LAXA 1YPZE 4UQCA 2PO6C 4AZ8A 4K23L 4M7JL 4AKOA 5KVMC 2I69A 4XC1L 1AXSA 2WKOF 4NUJA 2V17H 4HWBA 4QR7A 2X53A 1EHLH 4YDLB 2KPNA 4PY7A 5LAXB 4GT7A 4UU9A 2QDVA 4MQSB 4AZ8B 5AW1B 5C3LD 2EDXA 2QMJA 4PRDA 2WKOA 5C08A 3R7QA 3CSGA 1AXSB 4U49A 2VKWA 4G5ZL 2EINB 4NUJB 2GPZA 1YMMB 1GRWA 3GHBL 4JFEE 3ROLA 5JIQA 4UU9B 3V0IA 4XNUH 3FSZA 4PRDB 4UMSA 5C08B 1CWVA 4R7NA 4AW4A 4PJGF 1CFVL 4HIHA 4JLRA 1YEFH 2UXFA 4OCXH 4YPGA 2VWEC 3ROLB 3U46B 4TSBH 4IK6A 4TULL 3T0VA 2NY7H 4NI6A 3ZE2F 2GTWA 4AUJA 4PJGA 4U0QB 5CEZD 4R7NB 4PRPA 2IAMD 4HIHB 2FBJL 4JLRB 3IDYB 4YPGB 4RISH 2C1OA 2I32A 5F7EL 2XY2A 4LPTA 5JNYA 2HRPL 1U8HA 2WNGA 4PRPB 1W72A 3ETTA 1NMCC 5C0ND 1VGEL 1TZGL 3EFDH 2DDQL 5G4OA 2FHFA 4LGRB 5JNYB 5D96B 3NIDB 3JV5A 5D9SA 1U8HB 5LAPA 1W72B 5DYOA 1MQKL 4ZQKA 4HJJH 4P2YA 4JDEA 4KXZH 3GMRA 1KDIA 5FKAA 4NHUB 3VRJA 2R2HB 4JDTL 3CDFA 2YA0A 5DYOB 4EO5A 3GZKA 4NQCA 1EEZA 4LCIH 4TTDC 1IM3A 1NCCL 1N10A 4POZC 5JOPE 4JDEB 5IOPA 3QNZB 2OW7A 3GMRB 4ZYKA 1P7HL 5FKAB 3VRJB 3QORC 4X6CF 4XAWL 4F2MA 2AP2A 3G04B 1LTXA 4YDKL 1WAPA 1EEZB 4GG8A 4NQCB 4RFOL 3MRPA 4XWGL 5JO5A 1NWOA 3CPLB 1CJYA 1UM5L 2VAJA 4X6CA 4ZYKB 1UD6A 5LBSA 3LNIA 4YAQA 4F2MB 1FL6A 3DYPA 3TH4T 3ZYOA 2EDKA 4GG8B 2H3KA 1IC0A 5JO5B 3MRPB 1DJGA 5IBTH 3T65A 2P48B 2WYTA 3IBEA 2VTFA 4F15C 4F33B 2KLSA 1KCRL 3QR0A 3H54A 5JYLA 4YAQB 1MFCH 1FL6B 3OLDA 1MY5A 2QSVA 4GQQA 3WDHA 1CI3M 1O0VA 3UTSE 5LQBH 3T65B 3AS2A 3GNMH 2HVBA 2AMGA 4EF3A 1FC1A 2NCEA 1ETA1 2B08A 4XNQA 4OF3A 4Z0XB 5DK0A 4LGPB 3FMGL 1ILUA 3FHQA 3NSYA 3QI9D 4HAKA 1IAIH 2DQMA 2X12A 3FT2A 3QO0A 3SBWA 5FGRA 4QHUB 4LGSB 3OJ2C 3RHWK 4FXLA 3DHMA 2YLKA 4DQOL 5E8EA 5ETUB 5DK0B 1FLRH 3B83A 2YR3A 4P9HL 3ARRA 2EIEA 5F6IC 2F7PA 3FT2B 3QO0B 4R7LA 1MCWM 4URTB 3HBQA 2D8KA 4U4IA 4NQDE 5E9DE 4NQUA 2J43A 2VOTA 3ARFC 1BZOA 1EZLA 1W72H 5CXPA 5DGRA 1AGDA 2VZ1A 4CVXA 3TOPA 3TT3L 5DD5L 2BP3A 2WWNA 5F70A 1M7IB 2LU3A 4NUQA 3TLRA 2CJSA 5BO0D 3BCFA 2R69L 4PJ8C 4RMWA 2YAHA 1WV7T 4Y5VC 1KBKA 1DLFH 4OGAD 3V0JA 5IB2A 1AGDB 4KY1H 3DXAA 5D2NC 4CVXB 4YDVA 3O4OC 5BMFL 5DVPA 5CU5A 2GSIA 3RHWF 3AS3A 2ZXDA 2UY6A 4JRFA 4D9LL 4JFPA 2NX5B 4N6RA 1K3ZA 4XTRD 1U58B 4MXWH 1SEBA 5TGBB 5JXEC 3T2NL 3DXAB 3HG0A 4YDVB 5JQIB 4AYSA 3GK8L 1NDTA 1INQA 1THAA 4NHCL 2EZ0C 2CZNA 3B7UX 3ZTJH 2UY6B 4JFPB 1ZVYA 1SEBB 3WFEH 2V4LA 2OV0A 4N0RA 5AQ0A 1INQB 5BOPA 1U8NB 3MJ6A 1SN0A 1BAFH 4Y19D 1T1XA 4YBLB 2FT6A 3EJZD 5EB9A 4A7TA 1D5RA 3QQ9C 3U83A 1KPRA 3MRBA 2ADFL 4N3UA 4U3SA 1YEIL 3NRFA 4WTQA 1T1XB 2VMFA 1CGSH 4G3YL 1KPRB 3MRBB 4FLHA 4UDTB 4ZPVB 1H15B 3MLUH 5HGGS 2O4EA 1DQML 2E7BA 4ODSL 3LQMA 5CEZE 3Q13A 1ZXQA 3GBMH 3KJ4C 5I1AA 4B9JA 4FQIH 1SDAB 1NMBH 1ROCA 4H5SB 1T5KA 3CX2A 4P23A 4K8RH 4W9LC 2Y6SD 4AQ1A 4XC3H 3DV4B 3E38A 4OZHE 3Q9PA 4DN3L 4HG4J 1J12A 3KPLA 2WXGA 5I1AB 1J18A 5JPNC 4L5FL 4NAJA 1RU9L 1F4XL 4P23B 4Z7WA 3V52L 4AQ1B 1OD9A 1CB4A 2CPCA 3E6FA 5DO8A 4HWNA 1L9TA 3UBGA 1KBGL 1FFTB 4YHIA 2DD8L 4Z7WB 3O0LA 1QG3A 2RHEA 4XXWC 1F90H 4FNPA 4LOUD 4HULB 3CU1A 3E6FB 3E1ZA 4F7CA 1CCZA 2ICWA 2JJSC 5TDOA 2CK0H 3D52A 1TCRA 3FHAA 2DEXX 4YHIB 3LEVL 2YD3A 2MFNA 1OAQH 4NC1C 1G94A 1ZHNB 3W5NA 1G87A 3EAKA 4FXKB 4PJ9D 2AEQL 3NMEA 4YFLF 4F7CB 5TDOB 1E0OB 1D7BA 1TCRB 4RAHA 4OGXL 1DVFA 5GGVL 4M1DL 2WKLA 3KLDA 5FYLL 1V54B 5DRXA 1UWXK 1V05A 2K6WA 1G7JA 3EO9L 3UAAA 4QHMA 1DVFB 1CFBA 4IDJH 2UWEE 3VWJD 1D7FA 4ANWA 4XP9L 4OCMC 1CDCA 5DRXB 1QFUH 4PGBB 4HMCA 4J6RH 1G7JB 4HD9A 3STLA 5EF1A 4QHMB 3V6OC 5I8EA 4JO5A 2BRQA 5A2JH 4TSCH 2BOBA 3KM2A 1BM3L 1U6AH 4WLCA 2FUTA 1LGVA 5KYYA 3L16A 4TNEA 1AO7D 3STLB 3ZL2A 1P0SE 1KFAH 1B4LA 3MRDA 5B4MD 3TV3H 1SOKA 3JWNH 3WHXA 3LXAA 3K2UL 3SDYL 3BEWB 2SODB 5LXGH 5KYYB 1QLFA 2GJ6B 1DJSA 2H1LM 3D2UA 1YEFL 2H9GB 3MRDB 3MODL 2WCSA 4IBUA 4ISVA 2Y7LA 4RGOH 2DBLH 3WHXB 1PJ9A 1QEXA 3H42H 1BZQK 4PJCA 4MBOA 2XWEA 1QLFB 3WMSA 3D2UB 3QIWA 2NY2D 4J27A 2D9QB 1PCXA 2YKLL 3ESUF 4PJCB 3F00A 1OD7A 2E4TA 2Z31D 3QIWB 1CICD 2Q20A 1UUNA 4KHTH 4G6JL 4DETA 4Z7NE 1WA1X 2NR6A 2YD9A 1RHHB 1NFDF 1NOAA 2IG2H 4GPVA 4K7PX 4N87A 1JGVH 3TIDA 3REVA 1ID2A 1TVDA 4OCLC 1SMAA 1V3JA 1WWBX 4W68A 1JZJA 1NFDA 2ZT9C 5GS0D 4YC2B 3SEPA 2G4EA 3IDJA 5CLTA 3TIDB 5EIQA 1GC1C 2YRBA 1QWNA 4W9KC 3NCCB 1UEMA 1UA3A 4JFQA 1Q1JH 1NFDB 4JY4B 3SO3B 3IDJB 2VH5H 4ETQA 5D7KE 1OM9A 2YEZA 5CLZA 3WNNA 4JFQB 4XRCA 4NIYE 3JWDC 1KPUA 1U8JA 2DI9A 3DTDA 5IJKC 5JR1L 2WBJC 1NFIA 4XH2A 2YBRA 1TKWB 3CZNA 5FHAL 5AAWC 1ZHKA 1PKQB 3H85A 4AGNA 1R3IL 2YEZB 4N1HB 4XRCB 2Q87A 3QPXL 5EV7A 1U8JB 1E30A 3GSQA 4JFFB 5LQBL 1XD1A 4IK7A 1NFIB 4KK6C 4XH2B 1L0XA 3SPJA 2HKHL 3GNML 4WWID 1I1YA 1ZHKB 4HC1A 3IAGC 3HC3L 1YEEL 2ZXCA 5JLZB 2WLLA 5JW3L 3FUNA 2WD0A 1HNGA 4ZAKC 5C1MB 3QHTC 4ZO9A 5DC9B 3GSQB 2NDGA 3MLPA 4UZUA 4O5LH 4FQJH 5GPRA 3FQXB 1I1YB 3ZO9A 1S9KC 4HISA 2PF6A 4I1PA 1TNNA 5C08D 4DWHA 3RB7A 1MKFA 3WS6A 4DW2L 3TL5A 1UWXH 2CRZA 5I9QC 4AIEA 4DKEH 1FLRL 1W9XA 1LO5A 2PW2A 1IJ9A 4TQ8A 5IQMA 4YBQC 4WEMB 3FJTA 4UUJA 5HPMB 5LLIC 5KS9E 4AIXA 4I0KA 1DEDA 1LO5B 4UCFA 2VC2B 3IETB 2PW2B 4C47A 4GBXC 1F42A 1ML0A 4FFWD 5JMRA 3VDAA 4XN5A 2O5XL 2PO6A 1JXDA 4PRPD 2AQSA 4WWKC 1XEDA 1XBRA 1IILE 5B8CA 2XSKA 3NJXA 1VHPA 2DYPA 2PO6B 3H53A 3OPZL 5KBMA 3R8BB 4NCC2 3SDXB 5D7HA 1LM8V 1CF1A 3HZ3A 2VXVL 4KI5F 4MXWL 1DBJL 4PU2A 3SQBA 4HF5H 4ZSOE 4PH8A 3KPRA 4NFBA 2DYPB 4RIRA 5AKVA 4NWTH 2C9PA 1VERA 4PV1C 2OI9C 4W9CC 5IB5B 3WFEL 3FW6A 2QV4A 3KPRB 1F3DH 4ONHA 2P49B 4WY7H 4RIRB 4HUMB 2A2QT 1GGIL 4G59C 3EKCA 4LVOB 3DWTA 5E4EC 2XVBA 4PEEA 1AO7E 4I2XB 3KPTA 4H2AA 4EE2A 3ETSA 4NQCD 2WQVA 1ULVA 2CRIA 2WINA 1IM3D 1SJMA 2F5BH 2G2RA 2P7TA 4QXGL 2WP3O 4ONHB 3UCRA 3A4EA 5I1IL 3FK3A 1WQVT 2NY6D 3RU8L 1COBA 3FZUC 1TETL 2Y72A 5F6HJ 1CGSL 3FF8A 4FI7A 4ZDHA 3V8CA 5LCVA 4CGUB 4ES8A 2B20A 2WINB 3CSBA 3ZXAC 2OZ4H 4RMUA 3S8WA 2P7TB 2G2RB 5CGTA 5ANHA 1MFAH 3FU7A 4OQTH 1ZLUK 2VDML 4NKMA 4HOZA 3ZTDC 4JKPH 3TASA 2EO9A 5BZWB 5C92A 1G6VK 2CO1A 3QWOB 4ZUUA 4ZW7A 5G2NA 2HPTA 4HHGA 4I1NB 3FU7B 1JXGA 2QVKA 5H4ZA 4B97A 1ZTXH 2ZKHH 4F93B 1BYNA 4NENB 4NKMB 2PP9A 1UWGH 1T80A 3RTQC 5EU6E 2K45A 4ZUUB 1YHPA 2AMUA 3D4ZA 3QQXA 1TVBA 2B9AA 3U25A 1QR1A 4LDLB 1XQ4A 1IGFH 2X89A 2VN5A 3QEUA 4LESA 5AG9A 1PNDA 4BCYA 1FNHA 2X6AA 4UNIA 1TVBB 3FUKA 1QR1B 3J2PA 1F90L 3QJXA 4P2QA 3SKMA 3NSCA 4PJHA 5CZRA 1RUAL 5CUSH 4OKDA 5ID0A 4KWUA 3L6FB 2A9MH 3AQYA 4WNQA 4YS4A 3ESOA 3P40A 1R3HA 3OAUH 4P2QB 4FP8L 4YSAA 4PJHB 4RX4A 2YOCA 5ID0B 5FAAA 1OHZA 3BFQG 4WNQB 4XI5C 1CFSA 1R3HB 5KSAC 1V7MH 3H3KA 4WUUA 3NT0A 2B0SH 1KEGH 2DJMA 4H1LH 4ZUWA 1CFSB 4BCXA 1ZLDA 5JTWA 1HCZA 3UO8B 1KMGA 3PWJA 4JHZA 4JY5H 2NY5C 4WUUB 5TE6L 3O2DH 3RBSA 2X44D 4IYKA 3QYMA 4K3DH 4ZUWB 4V1DB 1UG9A 2PR4L 2J88H 1KIRB 4TSCL 1OB0A 5FHBH 3U4BH 1U6AL 2P42B 3LZOA 1D6VL 2AJVH 3I2CL 4KKLC 4NN6C 5LCVH 5F6IB 4DCQA 1TQTA 3OKNA 1SHXA 2CDGB 5DGQA 5C08E 3TWYA 4Y2DA 2XWRA 3D3VA 4PJ8A 4Y5VA 4PV9A 1IZJA 3AXIA 2WLMA 4GKLA 1DN0A 1DBML 4DCQB 3OKNB 5D2NA 3G9VA 2QVIA 5I0ZA 4JRWA 4N68A 2O6EA 4U33A 4XOCA 4XN8A 4PJ8B 4Y5VB 1GGCH 1XD0A 1DN0B 2W38A 4YHLL 5D2NB 4IRJA 4GB9A 1F8TH 4GSDH 1TLMA 2HT3C 5MEOA 1FIEA 4PRPE 4ZX4A 1BWMA 2R29L 5IEHA 1TQBB 1O6VA 3FRPA 3ZE2E 5MP6H 2ZUSA 4IRJB 1E9PA 3K80A 3UC0H 3LRHA 4JKNA 4WEUD 3NIDE 4R26H 5MEOB 3MV8B 4DGVH 3BP6A 1SJXA 5D71H 3FRPB 3V7AG 4NDMB 1E9PB 1WZ1H 1JGVL 3WTTA 2J8UF 4YMPA 1I1FA 5EOQH 5GRZA 1SHMA 5EA0H 3BP6B 1JPST 2RJMA 3V5DA 1ET5A 3I75A 4WSJA 1J1XL 4JKMA 2AEPL 3AVEA 4OSUL 5GZNC 2AGJH 5J12B 3EDEA 3KM1A 2DS4A 2NCMA 1I1FB 4YIQA 4OCSL 5GQBA 3IPEA 3V5DB 5BNXD 3I75B 4NQCE 3AACA 1EDYA 2QPFA 4LQFH 5CJXC 2VW4A 5F21B 4EUPG 5IVNA 1RH8A 1R34A 3GFUA 3PPSA 1MCPH 2X70A 5C7XL 2NNRA 4YIQB 3TCTA 3D07A 4F2ME 1SGKA 5HI3C 4NZFA 4RWYH 1AI1H 1PLGH 5JPNA 4I48A 1DVFD 4M03A 1TQSA 2CH8A 2R0LH 3BDBA 2Q9OA 3FBQA 1A7RH 5L4FA 2EDMA 5D1QC 2AJSH 5H2BA 2QPUA 4GFTB 3FTZA 4I48B 2VR7A 1MRDH 4P2AA 5JPNB 3PGCA 4FKHA 4XXWA 4XN9A 1GYAA 4WJKB 1HHKA 3S36L 2JJSA 2E76C 3A3YB 4LVEA 5H2BB 5TK2A 4QXUH 5IREA 3KPSB 5T1DH 3PGFH 3PGCB 3APMA 1HHJA 3LIZA 4FQLH 4FQXC 4H40A 4A38A 4GQZA 1HHKB 4KKRA 2R0WH 1AJ7L 3CFEA 3F3HA 1HHJB 3CXDL 1ZGLB 2FSEA 2HUEA 4F7EA 4Z95H 4JRYA 1NEPA 2YD1A 3D2UD 3CFEB 5EH1A 4PD4J 4LSRH 3QYNA 2FSEB 3VI4F 4L9LC 4MJHA 4F7EB 4JRYB 4X9GA 3QJHA 1B3IA 3EH4B 3IE9A 4HQQL 4ODUA 1A8ZA 2Y1VA 1IGIH 3UABA 3F5WA 1HAWA 2V5YA 3F83A 1JMZA 1GJUA 1MRCH 1WWWX 2H6OA 3M17A 1D9KC 4E9XA 3DUSA 3QJHB 3FT1A 4ODUB 1MCFA 2IBBA 3DXAE 3KMDA 2ILLA 3F5WB 3NABL 1NBYA 1XIWC 3M17B 1S8DB 1AMXA 4OKVB 1OEZW 5EN2A 4MCNA 2Y23A 2WY3B 4YXKL 4MMYB 1BZ7A 3MBXL 5EZIH 2D7QA 1NBYB 4JG1H 3W11C 1CN4A 2NXYD 1L9OA 1X4ZA 4Q52A 3KPPA 5EN2B 4GQPH 1IB5A 3AG2B 5HHOA 4DPCX 3DROA 2VZVA 1XH2A 1BZ7B 4Z7VB 1LE5A 3IU4L 2F5BL 4RWHA 5B21A 5KWYC 4HUCA 3II1A 5IZ7A 3KPPB 1AY1H 5HYSG 4U1IA 3UBXI 5HHOB 2WQUA 3DROB 3VG9C 4EPSA 5E56A 1LE5B 2OZ4L 2N1TE 2Y7MA 1MFAL 1I9RH 4N4YB 3LQZA 4WHYG 4FYRA 3GGWA 3L4CA 4GMTL 4OFIA 1XCTA 2R7EB 4S1QH 1HTYA 4U1IB 2QVMA 1CLYH 4GW1A 1TMCB 3US9A 2ZE0A 1UACL 4RDBA 6FABH 5I6KA 2XX1A 3L1OH 3LQZB 1CIUA 3GGWB 2X6VA 2CWRA 4A68A 4G71B 2XA8H 5TD4A 2UXGA 4GW1B 4GAGH 5E5LA 3HMXA 3QQDA 5J1TC 4LE8A 1SBSL 5L0QC 3G5XB 4S0TD 1IGFL 4BQ9A 2EIZA 2EVIA 4KQ0A 3IAQA 2BVOB 3N5AA 2CUAA 5KVDE 2XU9A 4KJQC 1I3VA 4ZOCA 4Z7WE 3NACH 4KO5A 3QQDB 1IC4H 2YFOA 2EVHA 1XWVA 2V3FA 4G9FD 4AV5A 5FFLA 1IBGL 4HBCL 2EIZB 2GC7C 3Q3GA 1Y18B 3ABLB 1WD8A 4HUXA 2Y06H 3C6SA 2QGBA 2Z8VC 4HPYH 1QFWM 4N26A 5FYKU 2XQ0A 5HHMD 3DDGA 3LZRA 1A1MA 2EYRA 4F58H 2WBJA 3ZTNH 2ZUUA 3LCYA 4P48A 3KPOA 3CMOL 1ETZA 3OAUL 3QWRA 4JG9A 1Z9SA 4HUXB 4CILA 1CBJA 4HAGA 1P7QA 4ZS6D 4ES9A 1A1MB 1KTJA 2EYRB 1E9OA 2EICA 2WBJB 4G7YL 3WI9A 1ETZB 5J3HD 2D3JA 1Z9SB 4NB7A 3DX2A 1TOXA 2HUHA 3HJ0A 5F7AA 1P7QB 1F4WL 3CFJA 4KDTC 3HFMH 1E9OB 2FEDC 3T71A 2BVUA 1KEGL 4JFYA 2G75A 3BEVB 1GHFL 2DYPD 3EW3B 1OW0A 2D7MA 3O2WH 4OLYH 3OR6B 1E4WH 3K81A 3CFJB 3O2DL 4UT7H 1B9KA 1AGEB 1J88A 4JFYB 5D7JC 1K72A 2FH6A 4MXVF 1JYVA 2J88L 4I5BA 5FHBL 4KI5D 3U4BL 5I9QB 2VITA 1DCEA 2QTVA 1GJIA 4ACTA 4B9ZA 5CMAA 3TYGH 3EHBC 1TJGL 4L18A 2E74C 3O3BA 4I5BB 3HRPA 5DCCA 1ZAGA 1KIUA 2QPDB 1UATA 4JAMB 3NQKA 1B0GA 5MEQA 5E51A 4G7VL 2VITB 3L4UA 3MLVL 1GY2A 5CMAB 1PZ5A 4FYQA 5D7LA 2GABA 4UOJA 3RWHA 3MCLH 3O3BB 1TJIH 1CLCA 3ELAT 1KIUB 5MEQB 1B0GB 4AYBA 1EAQA 1MHHB 4U7MA 3TJEH 3M45A 3DIVA 2EE6A 1PZ5B 2FYVA 3RWHB 3HMXH 3HR5A 5IBLD 2ZYIA 4W81A 4R7VA 3KWXA 2DRUA 4PJCE 3I50H 3QJQB 5DSCA 1GC1H 2QGEA 4AMKH 1S9VA 1DANU 1Z5LA 2EADA 3KL5A 2WO3B 3IEAA 5MP6L 5JHLA 1F6AA 3HR5B 3N3EA 5E5RB 2QJDA 4X99A 2FHCA 1BXUA 4BJLA 4R26L 2R2EA 1J0HA 3SDAC 4R0LC 3RGHA 1S9VB 3TBBA 2J57A 1Z5LB 2GHZA 1TIUA 4HIXL 4Y16D 3BGFB 3OHXC 1MELA 4HD5A 3DNKA 1CVSC 3JWDH 4W9FC 5E4OA 3PP4L 1F6AB 5I82A 1UTDA 3WTUA 4X99B 1WZ1L 2Y1ZA 3CZUB 2X89D 5AVYB 2R2EB 2A74A 3CVCA 4XBEL 5HD8C 5E4EB 1Z32X 3WD5H 1Q0YL 2CR0A 2JJTA 3JVGC 4MA3B 3P3SA 2WNXA 4P2QD 2D7OA 2A74B 3L7FA 1NFDE 3S2CA 4B9PA 5T1LA 2WWMC 2FB4H 4JRLA 3L4YA 5HI4D 1CL7H 1FNGA 4EZJA 2PPDA 4J3VA 2FWOA 1G7HA 3V0EA 4RX4D 1G43A 3CUPB 3L7FB 1YYCA 1QI5A 4XMKH 4IOSA 3RTQA 5ACMA 5T1LB 4KXDA 4JN2A 4NBXB 3US0A 4MJ6B 3QJTB 3VVVA 2ZF9A 2VLLA 1FNGB 3P69A 1CDYA 5AWNH 1NFAA 2FWOB 2R0LL 3FO1A 3T77A 4KV5F 5KJRL 4AI7A 3RTQB 1TTUA 4WUUD 4JN2B 4JFFE 1GYWA 1Q72L 1FSKC 4AM0A 2VLLB 1MRDL 2HA1A 4HIPA 1EZSA 1ADQA 2DTMH 3VG0H 3FO1B 3RWGA 3T77B 5HSFA 1FRGH 1IBDA 5EORL 1PF3A 5ADOH 3N04A 3N50A 1LK2A 4QXUL 4JPVH 4AM0B 3GDBA 4MS6A 4PP1D 1P4UA 4JS7A 4FQLL 3C9NA 3OAZH 3RWGB 4ENEC 1ZRUA 3AFLA 3VH8G 4H8WL 1JTTA 2WB1A 1CI5A 5FYJU 3QR1A 2WHVA 3D30A 3NJFA 3MNWA 3RX9A 5BW7A 3DUUB 1L0QA 2ZCLH 4OV6F 1A2YA 5FYJH 3C9NB 3O2VH 4Y2DD 2IBGA 3VH8A 5KSAA 2NZIA 1ASOA 3D3VD 2E56A 5DR5L 2YAEA 4TNVF 1UADC 1E28A 1MCIA 1R5VB 2GUOA 3KEDA 3MNWB 4XZUA 1Y6KR 1M7DA 1A2YB 1VCAA 2FGZA 2IDCA 2AW2A 5KSAB 1KEML 4BM7A 2AQNA 3HBPA 3CQPA 3WFHB 5B1CA 3ZMEA 1E28B 2F1BA 2VUYA 5CCKL 4A7UA 2HFFA 1IGIL 4IRJD 1KXVC 4XZUB 1M7DB 3ABMB 3TBWB 2XN1A 4Z77A 3J8F7 1MRCL 4PRHA 1A4AA 2CJUH 1BREA 4IKKA 1BF5A 2HFFB 3K72A 1R6VA 2WYHA 4PRHB 4Q9BA 4QTHA 1AR1C 1NANH 4BUGA 3EADA 1SEQL 2X4RA 4BKTC 5JHDA 3GI9H 2R4SH 3KPRE 3MYJA 2F54D 2VLRA 4UZGA 1MEXH 4QTHB 4YSRA 2NY3C 1SRDA 5TQ0H 5GRVK 2W0PA 4I2XE 3LKNA 2X4RB 1GVIA 4PTUA 5JHDB 3MYJB 2VLRB 1M2OA 1PJWA 3O9WC 1QSEA 2EIBA 3BDXA 1E65A 1SXCA 2H0EA 2FO8A 2L8AA 3MA9H 2L7EA 4OR1A 5TDPA 4HCGA 1NCWH 4XX5A 4I3RH 3NP3A 5GSVA 4C4BA 4PTUB 1T7ZA 3VCLA 4TXVB 4DNLA 2K78A 3WLWD 2GCYA 1ADQH 1QSEB 4NXKA 1BQSA 5L9DL 1XF4A 5TDPB 1JXKA 4U1NA 5E6IC 2E3VA 4QLRA 5DLMH 2Q3ZA 4JZJC 5GSVB 3HPJA 4N9OB 7PCYA 4YHPB 1RI8A 3VCLB 1A4CA 3D05A 2GCYB 2XWJA 6FABL 3U9UA 1XF4B 3VA2C 1H3UA 4HIJA 4OJAA 3S5LA 1Y0LA 3UTPD 4HMDA 3HPJB 3BRDA 2K8QA 3PWLA 4DVBB 3U9UB 4HIJB 1KB9J 1N9PA 2E7MA 3L3GA 1NLDH 3D87B 1Y0LB 3S5LB 2VSKB 1T1ZA 3PWLB 5IQLA 1IC4L 1JYWA 5AW6B 4J4PA 1E5ZA 4MHHG 4E9RA 1J8KA 3D0LA 3NG5A 2FT8A 3L3GB 4EI6A 4QAWA 1F3DJ 2NY5H 1PFCA 1S6NA 3GMQA 1T1ZB 1K9TA 3CC5B 1OARH 5AKRA 3ZTNL 4P2QE 4F58L 5FYKL 5JXAL 2PTVA 4PJHE 3D0LB 1W8NA 4JRYD 3TU6A 4LEEA 1OKEA 4BH7A 4NQEA 4EI6B 5DUJA 5CZXC 5D1QA 3GMQB 1A9BA 2DQFB 4HEPG 3X1EA 3GSNL 4M8QA 1ZXKA 1CD8A 2PMZA 1MJJB 4B6ZA 4DFIA 4LO9A 2ZF8A 1MPAH 4BH7B 4NQEB 1WA2X 3AWGA 4HEPA 5D1QB 2X42A 1A9BB 2EH8H 3EZ8A 3IDNB 3LMJH 3LXBA 3NSFA 4Q97A 1MCNA 2DQDL 4TKWA 4IEFB 3RKPA 4WUUE 3WY4A 2I25N 1ZSDB 2YLHA 2O6DA 3FT4A 3O2WL 4ATTA 4BZ1A 4GP5B 4YSPA 4Y2OA 5F89A 3LPFA 4UT7L 3ASWA 3BFOA 4C4UA 4F91B 2X4OA 2NW2A 3G08A 1ECYA 4IW4C 3QRGL 4AYMC 1OE3A 1KGWA 1KZYA 5DHYA 3DGGA 1CT8A 3IU3A 3NTCH 4QO1A 3ULUF 4FLQA 5EOTA 4Y2OB 5F89B 3H7BA 3O6LH 2I5YL 2LU4A 3LPGA 2X4OB 3EJYC 2NW2B 4MQXD 3G08B 3SJVA 2J5WA 3Q6GL 3ROOA 3F58L 3NQIA 1DQJA 4HEMA 4KKZA 5DC2A 5DHYB 7TAAA 4NBZB 3DGGB 1CT8B 3IU3B 4YHKH 1A02N 4QO1B 5I6XC 2Z7ZA 2EDQA 5EOTB 2ICWI 1E4XI 1N4XL 3H7BB 3HI6L 4Q9QL 4L9DA 1NWPA 3GHEH 1SVZA 3MCLL 3ROOB 4AC4A 2CLVB 4S0SD 1D9KA 2WXNA 3MMEA 2Z9TA 4MJ2A 1LO0H 4DPBX 4KJWD 4FFZL 5D2NE 4D7BA 2YPVA 2M1KA 3PNRB 3RDTD 4LSSH 1TQCC 3N06B 3IMUA 1D9KB 4YFLI 1WITA 4N1EA 2A77L 1GC1L 3MMEB 4U3HA 5M95B 4AMKL 1AC0A 1ZIBA 1PFOA 3WENA 1XIWB 5KYUA 4DERA 1NGZA 1JYXA 2DMGA 5T3ZD 2F7RA 1AYRA 1NCAL 4HWZA 4KPHL 2VXSL 4HJUA 1QW8A 5KYUB 3HLKA 1BQHA 1NGZB 4PCTA 3TIEA 1B4JH 1IC7H 8FABA 3BT0A 5JA8B 3SPIA 5LGHL 5F7LB 1QZNA 1JNHA 3RL2A 1BQHB 3MGTA 1N19A 1TTCA 3V7AE 8FABB 3NIGF 3WY1A 4NRXA 3PDOA 2D2OA 4ATWA 1ZK9A 3VG9B 1BQ5A 1Z9NA 4JO4L 4MZIA 4Z7QF 2C34A 1JNHB 3RL2B 3QWRD 1CGXA 5HYJA 4NJ9L 1TENA 3QZOA 3VB8A 2X7LA 1H3WM 3PDOB 4NRXB 4QNPF 2DKSA 1A4JB 1VJSA 4JX0A 1AFVL 5KEZA 2XV2A 4XP6H 2XVGA 2ISDA 1Q9OB 1AGBA 1FIGL 2KUTA 1PX4A 3DOSA 4QRRA 5HYJB 4OD1H 3P9MA 4E41B 1VF5C 1W16A 2X7LB 3EJSA 5FA3A 3CH1A 3ZHFA 2D7TL 3QJSB 4UBDD 5HGAB 3A6CH 3BI9X 2DTML 4I9WD 1KJ3H 3HI5H 4DOHB 4QRRB 3Q1SH 5L0QB 1X9UA 2VABA 3P9MB 1OT4A 5DFAA 5FA3B 3CH1B 3UTPE 4CVUA 3H9SD 2GSMB 4JPVL 5EU5A 1XO8A 4PV8A 3HN8A 1K8IA 4JHWH 1UFUA 5HDOA 2A1WH 2CCVA 5JPMC 1GAFL 1FH5L 3ZZQA 3OKKA 3WFZA 3K2KA 4PIBA 2EP6A 4NFCA 1L4IA 1Z3RA 3ENEA 3S97C 4F3FA 3BVNB 5EU5B 4PV8B 2OJ1A 1Y6MR 3CLEH 1K8IB 1A6PA 3TFKD 3O2VL 1EHKB 5F7BA 1FNEA 3R19A 3B2XA 5MI0B 3SSGA 2E86A 3C87A 3WTWA 4F3FB 1ECZA 2VSDA 4KMTH 5D7LD 5IQ7L 1LQBC 3KYNA 4EMZA 2X41A 2HFGL 1DHKA 3QNFA 3VACA 3AXLA 5FF6A 4JRYE 2QQNH 2EEXA 4D94A 4KITB 4PP2A 3AT0A 1G9MC 1X4XA 1XVSA 3BAIA 4NKIH 3U82B 5JUEL 1UGNA 3NCXA 5F88B 1LDSA 3L1GA 4PP2B 1WS8A 4CN4A 7FABH 3NEXA 2CJUL 4XOEA 5C2UB 1OPGH 1FN4A 3CHRA 3V6OE 1E4KC 5B39B 3MYZA 4LU5H 1M1XA 3MROA 5CBAA 5DUPH 1XB6A 5GHWL 3MRLA 4FJ6A 4AYDC 5SWQA 2QSQA 1WAEA 1EAPA 1YEWA 5FO2A 1FN4B 1IFHH 1JUFA 1QAWA 2F6AA 3QB7C 4M62H 1R5IA 4QRSA 4ZW5A 3VQMA 3C60C 2R4SL 3LNDA 3BIAX 3EHBB 4W9GC 1M1XB 3SGJC 3MROB 5CBAB 1A9EA 1SXBA 2FSDA 3MRLB 1FCCA 5C0GA 3SD5A 5SWQB 3Q8AA 4JL2A 2XWTA 5D7IB 1A7PH 4AKQA 1JUFB 1GCYA 4QRSB 1R5IB 2BVPA 4TUOA 1A9EB 4X7EC 1CE1H 2MPVA 5J06A 1LO3H 2VSCA 3BWAA 1AZVA 2XWTB 5HHOE 5IVZA 4Z7IA 2WYIA 1I8LC 2IANA 1HZHL 3L9BA 2BVPB 4TUOB 3KJ6H 1IAIM 2C9QA 4IOSD 1YN6A 3BWAB 4JR9L 1SM3H 4W4NA 1SF5A 5CEYA 2EE2A 1S7RA 5E2WH 3TN0D 3TT1H 2IANB 2HLFC 4KFMA 4G8FB 5BPPA 2C9RA 4H88L 3EYUH 4PJDF 1RSFA 3OC8A 2IPUK 3KLLA 3Q43A 4MMXC 1YN6B 4R0LB 2LT9A 3ZQXA 5CEYB 1S7RB 3I3BA 1NBVH 3OHXB 1OCWH 3OMAB 5F7KC 1JTPA 4PJDA 2PR9A 1OLLA 3FQTB 2DMKA 1A1OA 2EIJB 1BEXA 1GJWA 5T3ZE 4H0HB 3TZVD 3CN1A 2DW5A 4XNDA 3OAWA 2VMEA 1F00I 1XGQA 4NPJA 3L2LA 2X40A 1ZE3C 3BC9A 4RRPG 1UZ8B 1QKZH 4TQPA 2MCPH 2ROXA 5SX5H 1A1NA 4AIOA 1XGQB 1MY7A 3HKFA 4IRZH 1ZS2A 3ALPA 4ZW3A 4XB7A 3SD2A 2IPUG 2ZUYA 3BE1L 4LFHD 1UXSA 5EEXA 5GGUA 1YEJH 3ZW3A 1X5ZA 2YD0A 2I60L 4A7GF 2B8OT 4G6AD 2HZHA 1PMYA 5DMGC 3QUKA 2MKLC 5HI5C 1A4KA 3G7TA 1RZGB 1UXSB 3O6ML 5GGUB 1FSKB 4A7GA 4Z7AA 1JHLH 1IAKA 3LMJL 2EO1A 4PRHD 3JV0A 1AS6A 1G7LA 2LGNA 3BIBX 5EIVA 1A4KB 5DMYA 1NOFA 1WFIA 4FI8A 4AJ0A 4BSVA 3B2UC 3QUHA 3MNVA 3TO2A 4BZ2L 2BP0A 1IAKB 2ZXAA 3AWEA 3FHEA 4I9WE 3U2SA 3CZGA 4DK5A 3R0MA 1WUZA 4NERA 4YPJA 1KSRA 1G7LB 5D1XA 2J6EA 5DEGB 4FQQA 4KXBA 4RMBA 5EC2A 3TCLA 4UQ2A 4RQQA 2QADC 4BSVB 3MNVB 3TO2B 1AZBA 3P4OA 3SE9H 2CO6B 2BP0B 5JHDD 3ILDA 2VLRD 3U2SB 3LB6D 3QP3A 4JCLA 3TNMA 1ZSHA 4ETYA 2WGNB 4JVWA 4OFVA 5EC2B 5T8IA 3RQ3A 4DF9A 5AVUB 25C8H 3P4OB 3V4PA 3V6ZB 3C75A 4Y8AA 4OD3H 1AIFA 1NC2A 4WHCA 1QSED 4FFVC 4RGNC 5KYWB 3TNMB 4N2BA 2WBKA 4IBVA 5BUAA 3DIDA 1N6QL 4PSRA 2XICA 1H3PL 1DVQA 2ZCZA 3V4PB 3T08A 2AHIA 1AIFB 2B14A 1NC2B 2FVNA 1JI1A 4LSSL 1XF5A 1V8HA 3P30H 1R0AL 1P4BH 4PLKC 3PDDA 5I76A 2YAPA 4PBVC 1YYLL 2CKBA 1TDQA 3CFBA 1W6LA 5I1HH 4AITA 1M6OB 5HGBA 3I6LE 2ZUTA 4Z8FH 3BHBA 3S6CA 5I2IB 1XF5B 4P4KA 3VFWA 1JVLA 4UYPA 3JT2A 4YUEL 1R47A 5I76B 2WVSA 4LLUA 1AR1B 4F8PA 2HWZH 3CFBB 3D0AA 2QHLA 4WI2A 3A21A 5HGBB 4FFYH 3BHBB 5FX3A 4JFDA 4GG6B 2G5BB 3VFWB 3HNTL 4LLUB 5IUCA 3K3QA 4P2OA 5MEPA 1B4JL 2E9GA 1CXEA 4PI0A 1NGWA 4JFDB 3P3UA 4J4PD 2EEDA 3GTVA 2DY2A 1JZHA 4P2OB 1CFMA 3PV7A 5MEPB 2GI7A 1MWAA 2ESVA 4JZJA 1NGWB 1A6ZA 3WGVB 3VFGH 4F37F 3ALXA 1AZNA 2EC9T 4UOQA 3T0WA 3K0WA 4NO3A 3P73A 4NQED 5IUSA 3UL4A 2ESVB 3IXTB 4JZJB 5GRXG 1A6ZB 4ANUA 4O2CA 3LZFL 4XP6L 4R90L 2XV6B 1HL4A 2ZUWA 2JJVA 3VFPA 1YC7A 2BH0A 1BF8A 4J5VA 2J6EH 4L37A 4NO3B 4KVCH 3BP7B 4CN6A 4MAYA 4P46C 3QEHB 4PRAA 4O2CB 3RVXC 1YCSA 3GSRA 4G42B 2K4WA 4LVHB 3VFPB 1KJ3L 2BDNL 5ID1A 1FNLA 3Q1SL 1BQLH 3BAEL 3W9EA 3U4KA 4PRAB 2O93L 4LASH 4BKSC 2XPGA 2C7UA 3GSRB 4QRFA 1SDYA 5DZ9A 4BFOA 5ID1B 1SDDA 2A1WL 5A6IA 4WRLA 2YFNA 4W1TA 4JKKA 1LEGA 2XZAL 4NS0A 4YDIH 3SJVD 4BGDA 1J9QA 4O00A 4G2AA 3WY3A 1SDDB 3ULUD 2QQQA 2AXGA 1JHKL 3FT0A 1KCVH 1LEGB 1X5HA 5IMOA 4HXAH 5C9KA 4JPKH 1NQBA 1HH9A 1Z9LA 3SE4C 4OBRA 2PXYC 2AXGB 3L5XL 2ZYSA 4AE1A 3LKRA 5T5FA 2JXMA 3V0AC 3CZEA 2PWHA 5GJTL 1T7WA 1UB6A 4O9HL 4DVRH 1NGQH 1XF2A 1IBYA 2F7IA 1OPGL 3W37A 2AJ3A 1NCUA 3LKRB 4GLRH 1BBDH 4PRHE 3UIYA 3WIIL 2XWDA 4LU5L 3SODB 4AEHL 4PJAF 1KF9B 3FU9A 5SWZA 3H2WA 2I26N 1UB6B 2Y07H 5C9JB 1A5FH 1FPTH 1BIIA 2BS71 3BPLC 4ZO8A 3BPNB 3SIKA 1DQDH 4FNRA 1X7QA 4UTAH 1ZJAA 1CFTA 4HJ0C 4PJAA 5GS0L 1QWUA 3BQUA 3CH8A 2LV4A 2P44B 5SWZB 1E5YA 4F9LA 5ILTL 4AM0Q 1E4XH 4OGQC 5I6XB 1KTDA 1YQVH 4TPRL 5JHDE 3WSQH 5HTSA 1IAMA 1QPKA 4KTEL 2VLRE 1Q9WB 1AHWC 3EYFB 3U7YH 5HYIA 4PJAB 2E7DA 3NA9L 4IBTA 3BQUB 1R3LA 2ADJA 2B3IA 2CO3A 2EXTA 1G1CA 1CE1L 3ZTEA 1JPTL 4G6ML 1LO3L 1OTTC 1ZLVK 3EO1A 4CBZA 3GXNA 4ZFQA 3OLGA 1S9XA 3D0VA 2NXZC 1QSEE 4NN5C 1R3LB 2ADJB 2JVUA 1Z0MA 2WTPA 2ZG2A 5HYJD 5CAYB 5H94A 1QNZH 2HRHA 3CTTA 2WW8A 4JGNA 4K2UL 1CZ8H 3D0VB 3V9EA 3GMLA 1P2CA 3ATEA 4OBSA 1CGTA 5HVHC 3EYUL 4QRRD 1A47A 5H94B 1J1PL 4JFSA 3Q2NA 4JDVA 1YAZA 1S5HA 3MJ9A 3DURA 3TXAA 5A2BA 1OCWL 3GMLB 1P2CB 3LY6A 3QCVL 5EC1A 2YSSA 4ZJ9A 3MC0A 1P9MA 5D93B 4L23A 3GD1C 1YJDL 4JDVB 1IKNA 4YVUA 3FYEB 1S5HB 3DURB 2VL5A 5EC1B 4EXPX 2YSSB 4I87A 1OGSA 1DSYA 4ELDA 3WJMA 4NKQB 1T5WB 1EGJH 2A0LD 3OX8A 2HTLD 2CMRL 2XJLA 2A38A 2ARWA 1QKZL 4LDCA 5FM4A 3RPIA 1U8CA 2VL5B 5KYNA 4N20A 2F18A 3N91A 3HRZC 3ZJAA 5E6SB 4LBAA 3DV6A 4YXHH 3O3AB 3WJMB 3OZ9L 3QUYA 4OQ1A 4LCCA 2ALWA 3DVNA 5I5RA 3RPIB 2H0FA 1U8CB 1E5CA 4D8OA 3RY6C 1YEJL 2XBZA 4K71C 3CBKB 5J8OA 3BT2H 3DV6B 3DYOA 4AL8C 4NQEE 3WS3A 4LRIC 4LCCB 1PSKH 3DVNB 4X6EA 5D1QE 3W9DA 1E3XA 3GBLA 2B9BA 2G3NA 1J10A 3NJNA 4IGBD 4PJEF 1BEYH 3UYRL 5JPMA 3WS3B 5HVGB 4X6EB 3II2A 2ALAA 3RVUD 4PJEA 3EHBD 3EOYG 5HHVL 3FUHA 3QFJA 1BPLB 3WV0A 1VADA 4MWFA 4W9DC 4YHZH 5JPMB 4Z0BL 1E8ZA 2W94A 4XOAA 4FNUA 3OJMB 3APDA 4R7DA 1IQWH 4LHJB 4TLUA 1PLCA 3QFJB 5FV1L 1DJXA 1VADB 5KSBF 3IFOA 3HUJF 4Y1AA 3RIAK 3ZL1A 4R7DB 5DJZB 3SJVE 1YECH 1DQTA 3MA7A 2VJ0A 4R83A 4HEME 3HUJA 1FNSL 1O7VA 3ULUE 3FSWA 4Y1AB 1W6WA 3AMKA 1QBLL 2IAND 2YN5A 4G11A 5A2LH 2ZYRA 2DQUL 1ADWA 3MA7B 5BVJA 1E4KA 5KSUB 3BJLA 1FG9C 3HUJB 3BKYH 2H2PD 2Y7QA 3BWUC 3IJSA 5TE7L 2XA3A 3WNMA 2FD6H 4FMFA 5CN1A 4RVBA 3GMMA 1QTSA 1XZWA 5CZVH 5DEFA 5FCUL 5C6TH 5BVJB 4ADGA 2FJGA 3C60A 1XCXA 2Y7QB 3P54A 3IJSB 4M9PA 1GGBH 4NM4L 4MJIB 4W4OC 4KZEL 3RIAF 1ZLVH 4XMLH 3GMMB 5CGMA 1RXLA 5DEFB 3DMMA 2FJGB 3C60B 1TTAA 4ZFZA 4DKTA 1RZ8A 4L3EB 2B2XL 4JMNA 3FQWA 2BNRA 3BZ4B 1FDLH 2ID5A 3HG1A 2AJXH 4UYQA 1KBPA 2JB6A 1J48A 3ARGA 1RZ8B 3DJSA 3U9PH 2DQGL 4PVMA 2P8MA 2BNRB 1OP3K 5D1ZI 5I19H 3HG1B 1THCA 3FU8A 2CIKA 2JB6B 1UOVA 4ICXA 1LVEA 3ARGB 3ABGA 4KJYA 4UTBH 4L4VA 4JO2L 2P8MB 4MMXA 2MSPA 1AANA 2VM9A 5GGRA 2Y24A 1GMIA 5BZXA 1P6WA 3HBGA 1KTKE 4YFDB 5IW3A 5DMJB 3NIGE 3NCFB 4G1EA 4KJYB 4L4VB 4FRWA 3RB5A 3ZKXC 5HYJE 4MMXB 3BUPA 4I89A 3BISA 1H3VA 3FQYA 5GGRB 1KB3A 1KLFA 5DZNA 3WNOA 3S37H 1FGVL 5IVXB 4DOHE 4QRRE 3WCYA 4G1EB 4NCDA 2AQTA 3QAQA 4DTGL 4QXVA 4B60A 3LJ3A 4BFGA 3QJVB 2KHAA 1NCGA 2YN3A 4Q2ZA 1MOEA 2MIZA 1G9MH 1PEZA 1RUQL 4B41A 4LASL 4A04A 2EUXA 4DZBA 2ODHA 4PGZA 5JIDA 3UYOD 3BZDA 5L2KA 5D1XD 1DYZA 4L4TD 2K4AA 2DL9A 2CALA 3S4SG 4Q2ZB 2R0KL 1KCKA 1ZIAA 2EE3A 5MENA 4XVUD 2ERJB 3VNZA 5L4MA 3GI8L 2WXIA 4DZBB 4XCCL 4LPVA 5L2KB 3W0WA 4AXWA 4E5XA 3GMNA 5E94B 2WB7A 3QUXA 2C3WA 4ONFH 5MENB 4MS8D 5D6CA 1YUKB 3LNFA 1NC2D 3W38A 4I7ZC 3QHZH 5C0DA 1C12A 1WFUA 3W0WB 4D0CB 4E5XB 4AYEC 1PS3A 2VNCA 1I85C 1RZPA 5D6CB 3ZSSA 5K69A 1PL3A 3CAFA 4HJEA 3GIZL 4NJAH 4M6MH 1XTLA 4F7PA 5C0DB 1C12B 4Z3IA 3ME0B 2FBRA 3E9TA 4I88A 2E4FA 4DVRL 3BH8A 1NGQL 4LEXL 4ONGH 5HY9A 4UNVA 1Z0NA 2WM0A 1IC1A 5BUGA 4P4KD 4WTWA 4X98A 1ZDSA 4S2SA 3VQLA 4N86A 2ITEA 2Q76A 2Y07L 3QIBC 4WKZA 3NEOA 3SYAA 3VNYA 2BY1A 3BH8B 2QADB 1NIFA 2CLZA 1NEUA 3ZLQC 1E42A 4UTAL 4XNXL 4JFDD 3F65A 2DIAA 3TH3T 4X98B 3O4LB 1EZVX 4S2SB 2K3TA 1NPJA 2OKMA 4P2OD 2Q76B 5K59E 2P1YA 4B50A 5D7IE 4JCMA 2VCOA 3H4FA 4JPQA 2CLZB 3QPKA 3ZMNA 1JCKA 3T0EC 4XMTA 4AW7A 5C71A 2K6ZA 3X3FL 1QLEB 3MLTA 4RGNB 5B22A 4QHKI 4MA1C 3T2QA 5IIEA 2J4WL 5FUOH 3IJYA 2ESVD 4M7ZB 2BSRA 3AAZA 5D6DC 1VFAA 1RZKL 2DI7A 4FTDA 1ND0A 4KJPC 3MLTB 1LO2L 4BWWA 1FYTA 1P84J 2HMID 5IIEB 4LIQH 1FFRA 1LLAA 1ZE3H 2IANE 3IJYB 1JF6A 2BSRB 2X6UA 3DOIA 5DVOA 3AAZB 1D5MA 1VFAB 1ND0B 1BQRA 1DBKH 1QI3A 1OP3H 3LV3B 4URKA 2IPKB 4M43H 4MAYD 4H8VA 4LPXA 3Q8BA 1XR9A 4X8GA 1D5MB 4CSZA 4AVHA 4HZLA 3SGDI 4UIKL 2ITDB 3EDKA 2H26A 3I02B 2E6JA 4KBPA 3AGWA 4PJDE 4NPYA 4EUPB 2BVTA 3L17A 1XR9B 1Q8MA 1GPOH 3SY0A 1S46A 1RQ5A 1MFBH 1EGJL 4AGOA 3NFSH 1T21A 1I7RA 1RURL 3BUIA 3B8SA 3EH1A 2H26B 1E2WA 2AQQA 4NPYB 2RQ8A 3MHZA 1VPOL 4LZKA 5EDSA 4AV0A 2XC8A 1E2ZA 3SY0B 2DIBA 4ZMOA 5K5YA 1DBAL 1T21B 1I7RB 5F96L 5E8NA 1OCOB 3HI1A 2Z0BA 4RFNB 5AVVB 5E00A 4P46A 2H4EA 2AABH 2D73A 2Q7NA 2X87A 5C0IA 1U92A 1JE6A 3MJGX 4UT9A 2VR6A 2QQLL 4XZ4A 4YHNA 5E8NB 3US1A 1PSKL 1BX2A 2CNZA 5FCSH 1OAJA 4FLSA 4P46B 5DJ2B 3F7PC 4EVNA 3IJ8A 4MA8H 2ORBH 2RFXB 4G7QB 1U92B 1QLEH 3CN3A 4YHNB 3EOTH 5DUBA 3L3DA 4X7SH 1CXHA 4WDIA 2MTPA 3O3EA 4EVNB 4N2MA 2D03H 3MOBH 5SWZD 4YHZL 2APFA 3IYLW 2DQHH 1NAMA 3HC4L 4FNQA 3L3DB 2PUQT 4NKOB 5DUBB 4QRQA 3ZN6A 4G8AC 1IQWL 2JKNA 4WDIB 4NOFA 1KC5H 3BQUD 5DRNA 3RVWD 4P59H 1AXTH 1SUJA 2PXYA 5TF1L 4RZCB 1M53A 4BCZA 3WXWH 2AKRA 1NAMB 1ZGLM 4JFTA 4G6FB 4QRQB 2ZWYA 3GMOA 1T1YA 2FDBP 2JB5H 4L1TA 3VGHA 4MHHI 3DSNA 3KBEA 3ULVF 2PXYB 3WTSA 2L7JA 3P0VH 2AKRB 3QULA 2V7HA 3W81A 3V7MA 3S88L 1OAUH 3GMOB 3KVQA 4YXLH 4EUPH 5D7SL 1CGUA 3VSTA 4QHNB 2ZXBA 5F1NA 1B4RA 4BFRA 5IEKA 3THML 4LAJH 3DSNB 2P45B 1DJZA 3F64A 3IJ9A 3QULB 2V7HB 3EJPA 2BWQA 4R2GB 4E9WA 1C08B 5F1NB 2NY4B 5IEKB 1WCBA 2C4XA 3VTTA 4HC1L 3RWDA 1NA8A 4J3TA 4LVNC 3UAJA 2P43B 4ABWA 3TEUA 4GG6E 3WGUB 2JELH 1AHWA 3BN3B 1TUPA 1V3LA 5I5JA 1CBVH 3VTAA 1LDPH 1WCBB 3ESVF 4JHVA 1HYRC 4O02A 5CLWA 4R9HA 1RZ7H 1FORH 1DQKA 2AJXL 4JFDE 3P77A 3T09A 1AHWB 3OKLA 1KIPA 3QJZA 1LXMA 1MW0A 3C8DA 3ZTCC 1EHNA 2IH8A 5EMYA 4O02B 5DDHA 1OCCB 5I19L 3UJTL 2GK2A 1N5YL 3U7WH 2NZ9D 3P77B 4PLJD 5AKTA 1QBMH 3OKLB 1KIPB 1HCYA 2RAMA 2NXZB 3FH7A 7CGTA 2NNAA 4YDZA 4NN5B 2C4FT 3QUYD 1NUNB 4GUPB 5DDHB 4RMTA 2BINA 4AQZA 2ESVE 2Z93A 3HS0A 3T6VA 1S7WB 4RBPK 4XXDA 3CHQA 1QO3A 2NNAB 3IDUA 5FLUA 1LO4H 5CJQL 4RAUB 4PR5A 5PCYA 3TJPA 4HPOH 2Z93B 4KKAD 3IDGA 4PJFF 4DP1X 4L05A 4XXDB 1NAMH 1C1EH 4DEUA 2E7LA 4MAUL 1QO3B 3EJJX 3TFBA 1RZFH 2GBVA 5DHMC 2OX5A 4PR5B 4PJFA 2EACA 4JFHE 5D72L 1GKEA 3IDGB 4BHUI 1G9ML 1DEEA 3QFJD 3MUJA 3N6YA 3HG3A 4WGKA 2Y36L 2OX5B 2X9YA 4JZOB 3KYMA 2VDKB 1SOXA 1DEEB 1NCIA 4ZD3H 4OGYL 3HRZB 3M8OL 3N1GC 4WKXA 1GSKA 2CD0A 5CD5D 1XGPA 3KYMB 4HU2A 4EN3C 4M5SA 4CC4C 2FX9H 1PPIA 1BVZA 2CIIA 4N2CA 4Q9RL 3LPPA 3QHZL 2F1AA 1KB5A 1WZLA 2DWEA 4NPKA 1U4FA 3OL2A 3QXWA 3WNKA 3KZ8A 1KBVA 1XGPB 1J8RA 2ZOOA 2CIIB 4NJAL 4C56A 4F8OA 4L1BA 4LBEB 4XBMA 4AG4L 4PUBL 1KB5B 2DWEB 2XQYK 1CFQA 4O02H 4XMWA 3V5KA 3IMBA 2HJLA 2WLIA 2IQAA 3WMPA 4C56B 5EEYA 1ZEAH 3G6AA 4PIRF 1WISA 4XPHL 2JE8A 3O41A 4TUKH 2BIQA 1CFQB 3WO4B 4BUHA 2CHXA 1UURA 2HJLB 4JJOA 3RI5K 4FG2A 2IQAB 2MH4A 3DMMD 1X5AA 4JM2C 3DYMA 5DI8A 5SWZE 3O41B 1T5XA 2G30A 3V4LA 1G6RB 2BNRD 4HFUH 2YD2A 4PFEA 5BOZG 5C0RL 3FU3A 3HG1D 4F5CA 3QR2A 2ZAIA 1YDPA 4PJAE 1N67A 2J72A 3TS8A 3ARGD 1WVZA 2EDEA 2Z65C 3BUYB 5DI8B 6CGTA 1MREL 3DI3B 4XB8A 1T5XB 1JGUH 2GFBA 1YEDA 1KLUA 1KUMA 3MOAH 4OCRL 1HOCA 3VXUB 5HDWA 3FO9A 1HESA 4I9XA 4N1CA 3NJJA 3MBWA 5DZOA 5DHVA 4HSQA 1DCLA 2XQYA 2VRQA 2QVTA 1YEDB 1KLUB 1HOCB 1X5MA 3G6DH 4F2FA 3FO9B 2LOEA 3RI5F 4KVNH 1KBWA 3MBWB 1NLBH 5DHVB 3ZUCA 2CSPA 2XN2A 4Q8BA 4M43L 1F86A 1EHAA 1QABA 4OLXH 4QXWA 4HOXA 5JIKA 1BOGA 1FZOA 4F8TA 4Y9GA 4GUOA 2BY0A 3OB8A 2W88A 5E1AA 3JXAA 3PLYA 4AL8H 5I1CL 1AG6A 2JI2A 4RBPH 1JWSA 1HKLH 4AT6A 3B9KA 1BOGB 1FZOB 2F08A 4LLAA 5E2VH 3FB6A 4BWUA 3Q5OA 3NN8B 2TSAA 3AY4A 5E1AB 5H37G 5LXVA 4WO4C 3BUBA 1JWSB 3T8MA 4HOWA 3B9KB 1JFQH 2CM5A 2ZXWB 3QVAA 3FB6B 3W0WD 4ZS7H 3MLXH 1SLXA 3QUXD 2IPTL 3DX8A 3CHSA 4S1SH 2VN7A 2ZCKL 2PN5A 1I3RA 2P47B 5LG1A 4K73A 3VGGA 4EZLA 2Z4QA 5EZLA 1U3HC 3ZKXB 4WI0A 2GAZB 4M3JA 1AR2A 1G6RH 3DX8B 2CJ3A 2R56L 2WMPA 2Y22A 5E2UL 2IQ9H 2EEAA 1JZGA 1N0XL 3BZ5A 2Z4QB 4I77H 4LLQA 5EZLB 4BQ6A 4WI0B 3LQAL 3L3IA 5SX4I 3RX7A 4E9QA 3CXHK 4U1JA 2DH3A 3UTQA 2WMPB 3B56A 1A6UH 3BN9D 3C6EA 2YPLA 2B1AL 3N43B 4LLQB 1WA0X 1MHEB 4MXQC 2X2HA 2D03L 2JTYA 5JW4N 4U1JB 5CM1A 3GIVA 3WDJA 2DQHL 3UTQB 3CNKA 2YK1H 4PVLA 4PJEE 5KVEH 3HAEG 4LKCA 1A6AA 3QFJE 4APQC 1QA9B 2VE6A 1KC5L 3CVHH 3UDWC 3RZCA 3FCSB 1BIHA 4DT2A 3BKCL 3FONA 4QY8A 1OTUC 1RUKH 4HJTA 1I85A 3IVKA 4JM4L 4LKCB 1A6AB 1JPGB 4MAZA 4KNUA 4Y1AE 4YE4H 2JFCA 1W0VA 3QDMA 2R0ZH 3IVKB 3P0VL 1ID5I 3UZVA 3VX0A 1EO8H 4FOMA 1OAUL 3HUJE 2O5ZH 1Z1WA 1CS6A 2G4GA 1FYTD 1QNIA 3ARZA 1W0VB 3NJGA 3QIBA 4DO6A 5ABZA 4BSWA 1X5YA 2HP4A 3L2MA 3GBEA 1JGLL 5HYEA 2VLMD 4W9JC 2OMNA 3FTYA 4MJIE 2DLEA 2WIMA 3VXSB 3KLQA 3QIBB 1I9IL 1KN4L 3D4GA 3MRFA 4UINH 4BSWB 2QHRL 4NLAA 4AIZA 2E27L 3T0EA 5C0CA 2EDJA 3LIZL 1LDPL 1S5IH 1T83C 3GHPA 1T89C 2UXVA 4X0KA 4YR6A 1H19A 1QRNA 3MRFB 4X80H 3ZYZA 3NCJH 2CA4A 2XDHA 5FB8A 4IMKC 1ZGLP 5DWPA 4AIZB 1NAKH 3KWVA 4M48H 1X5XA 3EGXA 4LK4A 1SPDA 5C0CB 3T0EB 1OGAA 4IKLA 4U1LA 5D6DA 3SDDC 5DQDH 2BNRE 3LH2H 5BS0B 3AB0C 3HG1E 4X0KB 4YR6B 1QRNB 4QWWD 2AK4A 3ZYIA 5ADPL 5FS5A 5H4YA 3WN5C 3EGXB 4P3DA 3ATBA 1OGAB 1KCBA 4KDVA 3R1GL 4OFDA 4U1LB 4TVPD 4HUNB 4U2ZA 1URLA 2KPWA 4LCYB 3WIFB 2AK4B 2LR4A 2OR7A 3NA4A 1NMAL 4DP9X 3I9GH 4ZFFA 4O4YH 1F45A 3NJKA 1KNOA 4P3DB 4WEBH 4KRPD 3UFIA 4L4VE 4KY2A 1LO4L 2ITFA 3BDYH 3FULA 1EJOH 4UM8A 1ZLSL 5AUMA 1V10A 1QUPA 1ACYL 4AQAA 2AEIT 4N3TA 1KNOB 1U36A 2RGSA 4GEIA 3SYOA 3DX0A 2DQCH 5L4JA 3BP4A 4DH2A 1NCJA 4UM8B 2O5YH 1Q0XL 5AUMB 4BDVB 2BHUA 4A2DA 1EWHA 2Y2TA 4AQAB 4L3CA 1CPUA 3KW8A 4M1GL 4PW9A 3U0TB 5I0VA 4LIQE 5F3BA 3BP4B 3E8UH 3ZT5A 1KY7A 5EIIG 4XWOD 3NSJA 2J73A 3OKMA 4J8RB 1A22B 3WG7B 3TURA 4G6FD 4L3CB 5L2KE 2F8IA 2E47A 3RLSA 3BKMH 4I18C 5ICZA 5MENE 2G5UA 4Y1TA 3SBRA 5TDNB 3VX1A 4RNRA 2DQ6A 2EDHA 2YXWA 1TFPA 2IWEA 1XXDC 4U1SA 5LNEA 3W0WE 5E24E 5I16A 3B7RL 3FB7B 5DFVC 5F3FA 5ICZB 4GP4B 4XR8C 5FUCC 2DWSA 4R2GD 1G7PA 4RNRB 2Q8AL 1I1CA 4HUKB 4U1SB 3RKDD 2OSLA 2NY4D 5I16B 3ULVD 3BJ91 3F8UB 2RTTA 4M7LH 2SEBA 3HE7A 3BVTA 5T33H 3H6JA 2HSIA 3FXIC 4OJFL 1RJCA 5TQ2H 2DN7A 4GXVL 5T3ZL 5CINL 3VFRA 2GG1A 5KVFE 2HKFH 4G8GA 2OSLB 3OGCA 4HIIA 2SEBB 4K5LA 1MH5A 4EAEA 3UAJD 4FN0A 3F7LA 5K9OA 2DYSB 4G80A 4JPSA 3VFRB 4G8GB 2LAGB 4X6DA 3S0PA 3OGCB 4HIIB 3L48A 2J21A 1N68A 4U6VL 3KLSA 3DX3A 1MH5B 4Y0GA 5K9OB 4G80B 4GKSB 1P4IH 5F3HA 4OCWH 4U3XA 2NXZD 4X6DB 5DWUL 4CMHC 2ZKMX 3Q6FB 1PZ3A 1IT9H 1GIGH 2CUMA 2IO5A 1BG9A 4YEEA 1BWWA 5IROA 2WZPA 3W2DH 4QF1B 5B3JF 2DIEA 3OZLA 2ZWKA 4N5EC 5F3HB 1DQVA 4KRLB 2A9DA 3B1TA 2VW7A 3IGAA 3JTSA 2FJSA 1TNMA 2IXQA 3FU5A 3ZRFC 2R9HC 3SPVA 1ROWA 4N0CC 1X9QA 3G6DL 1X9RA 4L1DA 1XF3A 2VLJA 4OLEA 1DQLL 4YL9A 2IXQB 3VGAC 2WWOA 5GRYA 5HDBF 1OP5K 3BVXA 4X8CA 2C9SA 2X4NA 2E9BA 5DHXB 5IWLC 1JXJA 2NSQA 5E1QA 1WK0A 1XF3B 2VLME 2VLJB 5AD0A 3IFLH 3EYVA 3QXAA 2UXTA 3OAYH 3FFOA 1JGEA 1WFOA 4N2NA 5AYUH 1QSFA 3AM8C 2X4NB 4LSTL 3OG6B 2EH7H 9CGTA 2K7QA 1HKLL 1TTFA 2DL2A 3HNVH 1N7MH 5EF0A 5AD0B 3QRFM 2JQMA 3EYVB 1KYFA 3QXAB 4LCWA 4WU5A 3WEAA 1JGEB 4PG2A 1QSFB 2KYIA 1C5BH 1JFQL 4LARH 4LCWB 4P9HC 4WFHD 4WU5B 1ZVSA 2F53A 2RB8A 1BXAA 1H0DA 3MLXL 3MUGA 4QRAA 4KQ4H 1FCGA 1CF8H 4S1SL 1MFDH 5DHDA 1HDMA 4FMVA 1RK0A 4TVPE 2EDOA 5IW6B 2OBGA 2DMBA 1WS7A 4ZFOL 2F53B 1W8EA 3B9EA 2RCSH 4DKFH 5IB3A 4M3KB 1EXGA 1UM6H 3ZYJA 3BWZA 3RX5A 3U4EA 1HDMB 5ICYA 4C56D 1RK0B 1YNKH 3QUGA 4GAAA 4I77L 5B7EA 3RWIA 4OLWL 1DFXA 5DJCA 4J3UA 5BQ7A 4WQOA 5IB3B 5AOZA 4TLSA 1CXFA 4PBXA 1WE5A 1JZ6A 3U4EB 5ICYB 2R4RH 4GRWB 4MASA 4JFXA 4XPBH 3RVTC 1NIDA 1WP6A 2ZX7A 3RWIB 5DJCB 4ZNCD 5BQ7B 3GDCA 3SYQA 4JANA 4EN3A 3ARDD 4CC4A 4JFXB 1USQA 3CVHL 2H8PA 3H9HA 4NZTH 1BZ9A 1TTGA 3QQ4A 4B53A 4Y2LA 1E6JL 4XX1E 3ZE0F 5DF0A 4JANB 1LL1A 4EN3B 3RGVC 4XVSL 1SVBA 4BK4A 4NNXA 2AV1A 3DHUA 2H8PB 3H9HB 5EOCH 3QQ4B 4UT6H 2VB5A 3NZUA 4JY6A 2R0ZL 1FO0H 1UB5A 3WNIA 3RDJA 4PSPA 1HNFA 4NNXB 2AV1B 2BCKA 4B7LA 1HEZA 2UZYB 4FL4C 3WIHA 1T6VN 2OP4H 4QYOA 2R2CA 1WG3A 3DGCR 2HJFA 3QO1A 3QA3B 4MX7A 1QW9A 4BRVA 4YN3A 4JY6B 4QT5B 1UB5B 3G5YA 4GKZA 2BCKB 2VXQL 1HEZB 3ULVE 3CMGA 4TTGA 3BAWA 4QYOB 2HJFB 4MX7B 1MCDA 5FWQA 1SUHA 2H41A 1BZDA 4TNWK 2FYYA 3DBSA 2R23A 3G5YB 4X4XA 1H8NA 1IGYB 4GKZB 3WJJA 1MI5D 5AZEH 4JM2B 5E1HB 2JNZA 5BXFA 5EHFA 4X80L 3NCJL 2R23B 3BSHA 4X4XB 4KZ0A 1NAKL 3B9KD 3QPQD 1UA6L 3L9EA 5JOFB 2GEEA 1JJUA 2ZG1A 1X7SA 4PJ5A 4G43A 1HILA 3RURA 1KYDA 1SY6A 1OP5H 4NYLB 5AW0B 5BXFB 1SXSA 5KZCB 3NCYS 5IQOA 2LABA 4MCZA 4HA1A 4MKMA 1YY9D 3QH3A 4PGEA 2XXGA 3SYPA 4QIRA 4GRWH 4KO7A 4O2EB 2HN7A 4PJ5B 1G0DA 4HGWA 1HILB 5GJSL 1OTSC 3VSQA 4KKCC 4XGZB 5E99H 4MCZB 1INDH 4TNWF 3QH3B 4PGEB 1ITBB 2QT6A 2RBLA 3P11H 4K5NA 2A6JA 4DK3A 5CKAA 2HN7B 2VXUH 4HCRA 4HGWB 1O5DT 1BSIA 1SLWA 3JUYA 4HG4K 1KENL 3F62A 3OPUA 2KBGA 4FZEH 5E8PA 1IZKA 1P1ZA 2X9ZA 1JBJA 2OULB 2A6JB 5J1SC 1PGRB 1AS7A 1AD0A 4R5XA 3HZKA 3DO7A 2OR9H 4IMLB 3LEYH 4XPAL 5E8PB 2O5YL 3Q9QA 1QFOA 4WO4A 3MACH 1P1ZB 4K15A 2YPLD 4BE5A 5FECA 1OE2A 2VKXA 2AZUA 1AD0B 1R5WA 4MLIA 3HZKB 3VE0A 4E9TA 3VAEA 3UJJH 1OF2A 1UJ3C 3TVMD 2K3HA 1CTOA 4WO4B 2OK0H 5FECB 1RJZA 1R5WB 3RZCD 2O61A 4EI0A 3WIHH 4BE6A 2MQ0A 1U3HA 2NSMA 2XNAA 2YS4A 1EXUA 1VFUA 4K7PH 3ECBA 2YHGA 4RMRA 1RJZB 4DO5A 4WFHE 1DVTA 1U3HB 4XO8A 1NDMA 3QDMD 1V7NL 1JCVA 2X2IA 1CLZH 5GS3A 4OCYH 1I8KA 4TN9A 4EDXA 3QE5A 4ZMLA 1KYAA 1S4IA 3ECBB 3PJLA 1N8OE 2ZAGA 4DP5X 4JQIH 5ITFA 5SX4H 1NDMB 3C09C 1MIEH 3IM1A 1A7OH 5A7BA 3SKJH 1DDHB 1I8KB 1CDGA 1OQXA 4EDXB 4HWEH 2X9XA 4C56E 3GXIA 3MNMA 2XKUA 3O8XC 5AW4B 3X1NA 5DVKA 2HKFL 2A99A 1NEZA 2FEEL 4BKLB 2ZOUA 1J9TA 4Y5XA 2H32H 1YNLL 3RJDA 1FL5A 2CRYA 5GRVL 2QPSA 3SQOL 1SY6H 43C9A 5IG7A 2VLKA 2WUBH 3GJEB 3CIQA 3GSXA 4NZRH 2AJUH 5C0CD 4OZGA 4APQB 1NEZB 1A6WH 3TF4A 4L2YA 4J3OF 3QDJA 4Y5XB 2HPOA 4I0PC 1FL5B 5I18H 5IG7B 43C9B 4NSKA 2VLKB 4N9GA 4JUTA 1IUZA 3P4MA 3QJFA 5C2BL 3GSXB 2NY0C 1U2HA 3T6QC 4OZGB 1OGAD 3ESPA 5EEVA 4WFED 5E6ZA 4KGJA 3CK0L 4JKLA 3QDJB 4FZ8H 3BGMA 5IV2A 1IT9L 1GIGL 4EEEA 4F5CE 3NOIA 1T66D 2AK4D 3KDMA 1RV6X 1A7QH 3IJEA 4GY4A 4MGXA 3GKWH 3P4MB 4N9GB 3QJFB 3ZDWA 4CU8A 4QPEA 1ZDQA 2C9UA 2WPGA 5CSGA 2N01B 5E1GA 1KV7A 3SKUD 5IV2B 3BGMB 5KVEE 3KDMB 4Z3GA 3IJEB 5AZUA 1FGNH 2CGRH 3VFTA 3I6KA 5B38A 1A66A 3QCUL 4K94C 4G8IA 1JPEA 2E9JA 4JJHA 3IB4A 3K2IA 1T83A 3ZIYA 5ALBH 2ZJSH 4KTDH 4RZKA 4QYAA 3VFTB 3IPBA 4EN2A 3I6KB 4EKXA 5B38B 2DLGA 2JKWA 4G8IB 3OBAA 4MD0A 1D5ZB 1IMHC 3PP3H 5IFAH 4Z7OF 2EH7L 1V3MA 5D8JL 2UZIH 1CBVL 4HH8A 1KELH 4MD0B 4LSPL 2P3YA 5CJOH 5ANMA 3DBXB 3ULUL 4GW4A 1AKJA 1C5BL 1UH2A 3TTSA 2Z64C 4BZYA 3UERA 1S7QA 3QIUC 4R4FL 1SN2A 4G9DB 2OJZL 4AQ8C 2XV3A 4MYWB 5ANMB 2CQVA 2X4SA 2DH2A 5DD6A 4CMMA 4Z7OB 1TU2A 1EK3A 1XEUA 1AKJB 1CF8L 1MFDL 1RPQA 1XHHA 5IVOA 1S7QB 5E95B 5J7CC 3L3KA 3AGVA 2RCSL 2X4SB 4XHJD 5DD6B 3UTTA 1TU2B 2V7NB 2YIHA 2FWLB 3A4FA 3MLRH 1BFOA 3HE7D 3L3KB 5F9JB 1KCLA 4JE0A 4P5KA 3UTTB 3QUMA 3RL1B 4YSCA 2JKIS 1TTBA 2LTQC 3B8YA 4WWOA 4G8GD 4HPHA 5KJ7E 3IDXH 4Q7DA 1BFOB 3PL6D 1ZS8A 4OD2A 4OZHF 1MHPL 4P5KB 2GW5A 2WZAA 3H7LA 3WNPA 1NH6A 4LRNH 1G7MB 5CLXA 3UPRA 1SOSA 4B9YA 3DETC 4JRXA 3I9AA 1ZS8B 3F84A 4OD2B 1Z5YD 1RFDL 1NL0H 5IW1A 1UZ6F 5C6WH 1K8DA 1K6QH 2HVJA 1S2EA 3FTVA 3KYKH 3EYSH 2WUCH 3MZTA 5DC0A 4B3VA 3UPRB 1EDQA 3OSKA 3PHQA 4IJ3C 3MDJA 3STBA 4JRXB 2PNDA 2WZPD 3NUKA 5IROD 5IW1B 4ZFGH 1K8DB 4GS7C 3ILQD 2HVJB 1FO0L 3FB8A 4H0LC 3RYMA 3PWPA 2Q2LA 4AC2A 1JWMA 1K2DA 4DGYH 1R1CA 1TQUA 5AG8A 5GGTA 3GF8A 2IH1B 2MQ3A 1WT5C 4PJIB 5TTRA 4YSQA 2YXVA 15C8L 3ZHLA 1ICTA 2OL3A 3UEZA 3L2NA 3FB8B 2XRAH 3PWPB 4NUPA 1JWMB 4XVOA 1UM4H 2VLJD 1K2DB 4HS8H 5DO2C 1KGYE 1MJUL 5E08H 1NUGA 2HH0H 3VW3H 5AEAA 2ENQA 1NBQA 3P3RA 4LXFA 2OMVB 2OL3B 3H1ZA 2Z35A 3H3PH 3R8QA 2F15A 1F1AA 5AZEL 4WU7B 4U4BA 1QSFD 4H7VA 3S48A 3T0EE 5C0CE 3D39A 4ACPA 2Z35B 4QCIA 3ULSA 4DGIH 4N6QA 1S7UA 3RWJA 4LCWD 1FAKT 1QRNE 2Z34A 1NCNA 5HHXL 1EH9A 3LHPH 3BSZH 3D39B 5CP3A 4DGWC 1OGAE 4QCIB 3ULSB 4WFEE 4H8PA 3V4UL 3WKPA 4K23H 1OP4A 4M7JH 3RWJB 3LZPA 4XC1H 1CYGA 2F53D 5DJXA 1RUMH 5I8OH 2AK4E 4Q0XL 4QTFA 3QJUB 2H3XC 2V9UA 1MW3A 2H0PA 1UD5A 4HKJA 5DJXB 4TV3A 4G5ZH 3TX4A 3VGAB 3B3IA 1EBPA 3TGXA 3GHBH 4FZEL 1AD9A 2AXFA 3AM8A 3A47A 5HBBA 35C8H 4P06A 5EU7C 5ACZA 1A3ZA 5EZJB 2E0PA 2BJML 1DJWA 1T2QL 3V55A 2B59A 2GY7B 4HKJB 4P5MA 1KCWA 5T1KB 2XTJD 4Y89A 2W5PA 1MJ7L 1AD9B 5EZOH 2WO2B 2FO4A 5ACZB 1T7YA 4TULH 4DN4L 3CDGB 1IIKA 1IM9D 3IRCA 1DJIA 5GRUL 2B59B 4BV1A 2HCZX 3BLBA 3QQNA 2FBJH 3UJJL 3IKKA 3WE1A 2FO4B 4Y4KA 4LF3A 1JERA 4PS3A 5F7EH 3PNWA 1Q9LA 2WLYA 4AJYV 2HRPH 5I30L 1DN2A 2WIIA 5AVTB 5T3XD 1IE4A 1TZGH 1MAJA 3ZKQD 4Y4KB 4LF3B 4OUUA 1O9WA 1Q9LB 3PG2A 3VXNA 1LD9B 2R69A 2QKIC 2IFFH 1U4EA 2F74A 4P04A 2APTA 4I8DA 5DA0B 4DEPC 2X4PA 2GT9A 1ZA3A 5IQ9B 3DJTA 4C58B 1CLZL 2WNKA 3H6AA 3Q8EA 4M93B 2WTOA 2CXKA 3AITA 3V9FA 1MQKH 5ESVA 2WXFA 4OUUB 2YMTA 3P3TA 2BSCA 4JQIL 5H35A 2F74B 4JDTH 2X4PB 4KOBA 1ZA3B 3BPOC 1A7OL 2Z92A 3SKJL 1G9HA 4HS3A 1NCCH 5ESVB 1IFGA 1VA9A 4YWGH 3WUWG 1F6FB 3GLDA 3L13A 4QXTA 4TL4A 4XAWH 3E3QE 1W91A 1JPFB 4YDKH 3QZWG 4RFOH 4GRLA 4XWGH 4HS3B 4U6TA 4MKTA 1ZPLA 4G8GE 4NZRL 1UM5H 2AJUL 2X4TB 3RGVA 3PJSA 4QXTB 1ZT7A 3QZWA 3KCPA 1EJ6A 1V27A 4ZMAT 4GRLB 2PP8A 2V5TA 4XPFL 5DD0L 5EDXA 3VFSA 5GZOD 3RGVB 3B5HA 3H0TB 4X6DE 4ZUSB 1BHGA 2GIMA 2P4AB 1KCRH 3PJSB 2YWZA 1ZT7B 4H0IA 4FZ8L 2D3VA 3KCPB 1YN7A 1GR7A 4X6BA 4FG6C 5F2FA 3VFSB 3GKWL 4OU3A 1FFOA 1EJ8A 3MV7A 3E1F1 3PFQA 4FL4B 4YGVA 5E70A 3GRWA 3FMGH 1L9MA 4X9IA 3NPSC 4X6BB 3BVVA 1O7SA 2UYLA 1GW0A 2Y0SA 3P2TA 3B1UA 4HOMA 1JF5A 1GW6A 2APVA 3MV7B 5I1KL 1OANA 3ECQA 3OQ3B 5I6PA 4YGVB 3PGDA 4DQOH 3IDMA 4FQ2L 1B6UA 2COQA 2X2YA 4P9HH 4IS6A 2UYLB 4KTDL 2GITA 3CFKA 3UYPB 2FLBT 2VLJE 2K9UA 4OM1H 3PGDB 4TUUA 2OSXA 3IDMB 4AV4A 3UAEA 4HSCX 4IS6B 2L4OA 3QARA 4RFEA 3SGKC 5ABAA 2KC0A 1EFXB 5HDLA 2GITB 2WQ8A 1AXIB 3CFKB 4U6YA 4CUCA 1M9WA 4GAJL 5DD5H 3K6SA 1O6TA 1KELL 3N42F 2R69H 3OKOA 5DRZA 1QSFE 1BAWA 1E27A 2HT4C 2ZUXA 4RFEB 3L7EB 4U6YB 5BMFH 3VSUA 1AQHA 2G2PA 4KQ3L 3IRPX 3W5MA 3K6SB 4J2QA 4LCWE 1U3HD 4FQHA 3OKOB 4D9LH 2VDQH 3KHQA 2Q3XA 1E27B 1ZLEA 3HZMA 3T2NH 4YSEA 3BKJL 4KK8C 3SPGA 3GK8H 3DHJA 3N42B 4NHCH 4LLMB 4FQHB 2F53E 4Q4IA 5KOVC 2UZPA 2XXCB 3V0GA 3N1QC 4OCNC 3HZMB 3MCG1 2BS9A 2CKBL 1A4BA 4NAMA 2I9LA 1PQZA 3D85A 5JOPD 2N4IA 1EMTL 4GO8A 4ZOAA 1R3KA 1E43A 3WUZA 3ARQA 3GC3A 2EIDA 1RUPH 1UJ3A 2I9LB 1G5AA 1H6TA 4GRWE 1PQZB 3D85B 5EUOA 1YEIH 3HE6C 3SGEI 1TF4A 5CD3A 5DURB 5E8DH 1OTUD 4G3YH 5IJVA 2VLKD 1VFBA 2J25A 1UJ3B 1YNTA 4E0RB 4M5TA 1MCBA 3OXRA 3PWUA 4M7LT 5EUOB 4ZW8A 3NRPA 4XMUA 3QDJD 3Q05A 2UZXA 1CFNA 4UQ3A 2GY5A 2V5SA 3LDBC 5TK4A 4Y4HD 4EJ1C 4IKJA 5I26A 1VFBB 2P5EA 5IJVB 1NL0L 1YNTB 1MWAL 3U6XS 1K6QL 3OXRB 3PWUB 3B4NA 4J3OD 3HMWL 2WUCL 4DN3H 3QUZA 4PD4K 4KKBD 4PWFA 4ZO7A 1CFNB 4UQ3B 5T3XE 1HZKA 1VZGA 3B2DC 3L95A 1CLOL 1RMFL 3L3JA 4MDJA 1RU9H 1F4XH 5CGYD 2OTUA 3PY9A 3V52H 2Q1EA 4IRSA 4LLDB 3UG5A 1HIMH 3QUZB 3E0GA 1BQUA 1U93A 2MEJB 4MVBC 3L95B 4IIQC 3HZYA 4MDJB 1KBGH 5J6GB 3SCMA 2OTUB 1F56A 3UG4A 1JMXA 2IVFC 2XRAL 2BVYA 3CWGA 3VXTA 4NQDD 5E08L 3KXFA 3GRGA 1U93B 3VW3L 4I0PA 3TEXA 2OTWA 4GJTB 1M7UA 3LEVH 3POHA 5F9WC 1XR8A 5GS2D 3MJ8A 3H3PL 3TBCA 3VXTB 4PPTA 1BLNA 1YYML 2AEQH 2VQTA 3KXFB 4WV1C 2IH3A 4D9RE 3TPUB 2XPZA 2HB0A 4I0PB 2OTWB 5CNHA 2H1PL 3CFTA 1XR8B 4OGXH 3T6XA 2DBJA 5IHHA 3DDFA 3MJ8B 1BLNB 1K4DA 2IH3B 1GL4B 3EO9H 1H6FA 3KBPA 3KE0A 1K5WA 3LHPL 4TVSa 4UQAA 4XP9H 5IK3A 3ARYA 4Y9EA 2XT1B 5ICXA 5BQDA 1K4DB 4PJ5E 4NUGH 4QHPA 5CS7A 2FGWL 1XV8A 1RUML 1YMMA 1U2YA 5F44A 2IDFA 2W81C 5EOCJ 4OIIL 5IK3B 5ICXB 4ZTEA 1BM3H 2H2SD 5T5FL 2R59A 4NBYB 3UTTD 1ZV5A 2APWA 35C8L 3U46A 3O6FC 4A1RA 3K2UH 1RZJL 3IWUA 1F97A 3SDYH 4TUJA 3CVBA 3QXTA 1I82A 2BY2A 3NFNA 2XETA 4E9VA 4J12A 5DQ9B 4KVPA 3ZKSD 1YEGL 3D34A 3MODH 3D33A 5EZOL 1AQKH 4AMXA 4N2OA 4TUJB 2J6WA 4LP8A 3NFNB 1J9SA 1QBBA 3QIUA 2ENJA 1UEYA 4KOCA 4RDQF 3NIDF 5C3TA 4AQ8A 2JI3A 2W9DL 2YKLH 1HEJC 4YDMA 2ZD0A 2CUIA 1ZMYA 3QIUB 4JRXD 1J0JA 2XZCL 4Q56A 1R46A 2ITCA 2Y4SA 4TLTA 4G6JH 3EFFB 3JZYA 4JHAL 4M8UA 4NHUA 2IFFL 1WAAA 5I0DA 2R2HA 1JZ5A 2ITCB 2X3AA 5AZ2H 4APXA 2OMZA 4NZDA 1H8SA 1OWWA 2YAOA 3PWPD 4FXTA 2NY1C 1NJ9A 4MB5A 5DJ0A 3QNZA 1I8MA 4KKNA 2XZZA 1OB1A 1M56B 2N0MA 3FT9A 3G04A 3C6LA 3H4HA 2OMZB 4TOYL 4APXB 2ZUQC 4N85A 2ZWLT 3CPLA 2LTQB 1NJ9B 5DJ0B 1FYHB 4P5TD 4YZWA 5DMIL 1I4FA 3VU1A 4YWGL 1I8MB 2QV2A 4YSUA 1OB1B 1U8MA 1U2CA 5I17A 1NINA 1FL3A 3C6LB 4MB3A 2AC0A 1A6TA 2L7QA 1S9WA 4F57L 5HPOA 4OLZL 3V0WL 3CU7A 5CZKA 3MPCA 1I4FB 1WYJA 3F01A 4F33A 4IBWA 4K94H 3JZ7A 1U8MB 3L3OC 5I17B 1GA2A 2VLKE 1FL3B 1RIVL 3WKNA 5JR1H 1KN2L 4YFEA 1A6TB 4PTTB 3D39D 1S9WB 4N5ED 4OZGE 3WMQA 5FHAH 1QEWA 3U79A 1MHCB 1R3IH 2EQDA 3QDJE 4AQOA 4HHAA 4IJ3B 4Z0XA 3TJHC 3QPXH 2UVEA 4I4WA 3II3A 3VD7A 4BFEA 4FNLL 3CXFA 4OZFA 2HKHH 4WFGD 1IO4C 1QEWB 4QHUA 2EUWA 3HC3H 1YEEH 4DAGL 5JW3H 4HHAB 3ZHKA 3ZKNC 5ETUA 5BJTA 2RQEA 3GXUB 1VFMA 3L4XA 4I4WB 3X14A 3NRQA 4OZFB 5IESL 2VDMB 1SHSA 4XMZA 1Z5HA 2WXJA 5C7ZA 4DW2H 5BJTB 3TO4C 3ZO0A 3X14B 1URIA 2ZOTA 1NM9A 1T03L 3X2QB 3IDIA 2IIJA 4BFIB 1M7IA 3HB3B 4KAQL 4OM1L 2B5IC 1XGUB 5DUML 1PTZA 2O5NA 4PY8I 3IDIB 4Y4FC 3SY6A 1D5BA 2O5XH 1N12A 5J5EA 3GXMA 1UFGA 3GM8A 4XMVA 3RFZA 2Q3AA 2NX5A 4UM9A 5TGBA 1U58A 3GBNL 4HT1L 4Y4KD 1GZHC 1AVAA 4JG5A 3KLHC 4GNKB 1D5BB 2GQHA 3CDZA 3OPZH 2MKWA 4H8WC 4XOBA 2GTQA 4XB3A 5ANME 3B3BA 2HXAA 2VDQL 2Y1YA 4Z7OE 3RFZB 4UM9B 2VXVH 4B9FA 1DBJH 2YAMA 2VM4A 2IGLA 2VSMB 3LS4L 3P9LB 3WFDL 3CDZB 3QZLA 3QDGB 3AU0