4EAEA

The crystal structure of a functionally unknown protein from listeria monocytogenes egd-e
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
187
structure length
184
Chain Sequence
EAFSFSPSGFKVSTVESILGGDVTTTYLSSSKSFQKDFEALTLFINQYKVEHVINPTKEVSASNPESYLANKNGYVITLDISIKNNSKKDKMYKADQISLLGASKSVGGSLDNFIPSGFHLIGSSSDPYNFTAGKTARGLLTFTMDEATYNDLAKDSQIGVPDPSRFDSSGSSQDNVVAPFPIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1068 protein
publication title The crystal structure of a functionally unknown protein from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
total genus 48
structure length 184
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4eaeA00
4EAEA
chains in the Genus database with same CATH superfamily
3JV0A 4R7LA 2FQFA 1B0RB 1UJ3A 2G2PA 2P3YA 2XPZA 4BJLA 1M2OA 3GMPA 4LVNC 1AYOA 4PV1C 1BPVA 3B2VL 4KROC 5F6HJ 4B9FA 2Y6SD 4F20A 1P69B 1QR1A 2MIZA 1Q90A 3FQTB 4I87A 3S4SB 4E9TA 4P46C 4KOBA 5F7AA 2IADA 3PV6B 2BWDA 4J3OH 4PLNC 2IPTL 1VDGA 5HGHA 2NR6D 4OZ4B 1KELH 1MKFA 1UOVA 3ARDC 4Y2DD 5HHME 3UAAA 1NAMA 3P69A 4HIPA 1AHWA 2Y36L 2VLKB 1TJHH 2P5PA 4LGPB 3WS3A 2WBJA 4JKWA 3VXME 4UNVA 1E9QA 5EU6A 1E4HA 2UWEB 5EHFA 2ODHA 3O6MH 1HQ4A 3MROB 3WJLC 4BQ9A 2I9TB 1EDYA 4P9HL 5I6LA 4UMSA 4G9DB 3WNOA 1MFCH 1OARH 5D1XC 4XH2B 2PO6C 1A6TA 4KV5E 1QNZH 3LHAA 2HP4A 2NZIA 2M26A 2M83A 1MJ7L 3AT0A 3PUUA 4DQAA 4Z7OE 4H1LA 4LASL 1ES0B 4RAUA 1XF2B 5HGDA 1BPLB 4HC1H 5I75C 1C5BL 1K4DA 5MENB 4UZGA 5TDOB 1NBYA 1G84A 4LOVA 4L0PB 2ERJB 1X7SA 1Z5YD 2QVIA 3BKYH 4PJCA 4C83A 1AJ7L 1JN6B 5I1GL 2IDSA 4ENEC 1NZRA 3FB6A 3ZDYB 5JYMA 1FNFA 1VSCA 1EDHA 3O81A 1NDTA 1B9ZA 5ETUA 1BLNB 4GIAA 3DKHA 4BK5A 1MHPH 3ISWA 5DWPA 3G5VA 5C9KA 4Z0BH 4WHYG 2Q2LA 3T0EA 3FYIB 2QBWA 1JVLA 1QVOB 1ADQA 4LPUA 1WBYA 4JO3H 5B8CB 1YEJL 1CT8B 1D2OA 5ISZD 3K6NA 4TRPL 2EE2A 4KKLC 4HKZB 3ENEA 2VC2B 4LDLB 3WHE0 3ULVD 3L81A 3P73A 3OX8B 4PJEB 4N2OA 4XNZB 1A7RL 3BIKB 3EBIA 2P8LA 2N56A 4PBVC 2NY6C 4P46A 4LCIH 3ILDA 5E2VL 5J6SA 4F8LA 4OI8A 4KX8A 1FFPA 2WCPA 5HDWA 1XZ0B 1S3RA 4ZFFA 4JJHA 2IG2L 4N0FA 3B34A 3ARFB 4H20H 4MD0A 2B4CH 1J0JA 3ARDA 4FEIA 2CO2A 1L3NA 4FADA 2IC2A 4FZEH 1XH3B 4UNUA 3KW7A 4L4TD 1GH7A 5T33L 1GJIA 4KPHL 2K7QA 5I8OH 3V4VL 4PJAA 4IRZH 4B6ZA 4ZUWB 4AV0A 1J05A 1EZSA 1OLZA 4MNQE 3KL5A 1CBJA 3BE1L 2SODB 3AQZA 1NPJA 1K2DB 4LEXL 1WD9A 4HJTA 1A6VL 3V9CA 1WC7A 4WV1C 3QRLA 2DMKA 1J9TA 4APQC 5KJRH 4Y1AB 4CADA 5D1XA 4JQIL 5K9QI 4I9WE 2DLFH 3DUUA 3O4OC 3AWEA 2V7NA 1AY1H 3WFEH 5CKAA 1IZJA 5HVGB 5F9AC 1THAA 1X6NA 1EWHA 2PPAA 5IMOA 4B9YA 4YK4C 5DRZA 1HNYA 3I9PA 3MLWH 4MB5A 5DUML 4ZSOB 4AITA 4K5PA 4JO1L 3TA3B 3AG2B 3L2NA 4HH9A 4FA8A 1MCFA 4R9HA 4JFFD 2G75B 4UAOC 4I3SH 1P4LB 3G6JB 1OF2A 3KPRE 2BSTA 2FQGA 4CKVX 4WSKA 3VI3A 3NBNA 3BZEA 3L9YA 1NGPL 3TEUA 2XVKA 3HZ3A 4HZLA 3AU0A 5L4MA 1SHWA 2CXGA 4AZ8B 3TU6A 5IOPB 4P3DB 3Q1SH 4MZIA 1DL7L 3HBPA 4X7SL 2CRMA 3S3JA 2JKSA 3A6CL 5BZDA 3WAJA 1A7QH 3B9DA 3VFRA 4XN7A 4TUKL 1E6JH 3ZZSA 1CL7H 1PYWA 3BT0A 4HP5A 4Z95H 4MAUL 3EJYC 4L1TA 1CVRA 4TN9A 4OGAC 4DEWA 1EJ8A 2OS7A 5SWZE 3LXUX 3LVEA 3OL2A 1KBWA 4IOIA 1BD2A 3FB7A 4GKZA 1LNUB 1XTLA 3UBXG 2PWHA 4KK8D 2H32H 4RRPG 4I5BB 3WGUB 4AY0A 4ONGH 2EDOA 3QQNA 4FFWD 2B08A 1X7QB 1Y6MR 3ZYZA 5CGMA 3FO0H 4NZFA 3PHOB 5FM5O 5E0QA 5FM8A 2A4ZA 3WI9A 1DJHA 1MJJA 2BVQA 3QRGH 2O5YH 3W82A 3FTWA 1H9DA 5F7HA 4HIJB 4WV1A 32C2B 4WLCA 1PZDA 1RJZA 3VFVB 4APQA 3EYFA 3KYKH 2ZG2A 1F3DH 5EC2A 4PBDA 3KHOA 4HJSA 3SDXE 2WUBH 1BBJB 1T21B 2LOEA 3MRKB 3S37L 1AOZA 4YUEH 1HQRB 5CINL 5D6CB 1T7VA 2J12B 1AR1C 1T5WB 1YPZF 2L7QA 3MLYH 4HWBA 3VXOB 2ZX8A 4OLZL 2C7UA 1KGJA 4WI9A 3GSRA 4PQXA 2JTYA 2OTUA 5EIQA 3ZGHA 4X9BA 1UM6H 4NSKA 4XCEB 5AW8B 1OAUH 3BH9B 5DZJA 1UB5B 4JG0H 1IAIL 4PJGB 5KW9L 5H4ZA 1Q1JL 1KCLA 2GIXA 5E9DA 1CR9H 2ICEB 2FRGP 4XPTL 2D3LA 2F68X 4R3SB 3N9GH 2WIIB 5F0LB 4BE6A 1IKFL 1CN4A 3G08A 4N2FA 3FCTB 3BP6A 3UIZA 1N7MH 2MWCA 1S9WA 2CR0A 2FWSA 4UZUA 3U36B 2IANE 3D39E 4L4TE 3IMTA 4Z0XA 5GGSY 4WGKA 2MPAL 2B39A 2PW1B 2F58L 3V9FA 1IE5A 3TO4D 4NFDA 4TS6A 2Y72A 3SGEI 1AKJA 4JDEB 4KXZH 1LMKA 2CCLA 3LZOA 3ZO0A 2JB5H 1X5JA 1M1XA 3SE6A 4BRJA 1IM9B 4KMTH 2W0FB 3MRGB 5GRUL 5KVGH 4F2MB 5L2JA 3DGGA 4G8GE 5CJ5A 5LHDA 4NQSA 1SHSA 2BWQA 1B3IA 1KTKE 2NOYA 2BS71 4PWKA 5CU9A 4J3OC 3BP4A 1NMBH 4ZS7L 4GT7A 1XGYH 4WGWB 4HPOH 4LBEA 3WIHH 5E5RB 3V0JA 4F7EA 2WGNB 1QI4A 2N0KA 4KVCH 2GITB 1E3XA 4HJ0C 1LO0L 4YXHH 1FL6A 1JWSB 3AM8C 4HXBH 4X6CF 5F89B 3DO4A 1HHIB 1QBML 4RISH 4J1UB 1FVCB 4UIMB 4UTAA 1KJ2B 1N4XH 3MRFB 3L6FA 5C0AB 4UQEA 2L7EA 1QR1B 3WFDH 2WYHA 2CJSA 3RWEA 5AVTB 2JF1A 2MNWA 5E8NA 5CFAA 3LV3B 3FT1A 2P5WA 4WI7A 3ME0A 2IADB 2YZ1A 1J5OH 1MLBB 1YUHA 3MOQA 4M5YL 3BVTA 3WJMA 1IBBA 2D2CC 4KKBC 2W9EL 2A38A 3VXSA 3JTTA 2XVGA 4LPXA 4ANVA 1R24A 2MOVA 4WO4B 3O9WD 3EOAA 4V2BA 2H1XA 5KSVA 3QJUB 1JXDA 1E9QB 1G43A 4X80H 5EU6B 5FO7B 3EH4B 3ZE2B 4FABH 2EECA 3T65B 3GHPA 3QEHA 3UZVA 3QI9D 3Q2LA 4ZNEE 1FDLL 2AP2A 3KPMA 3AGVA 3SE8L 1DSYA 2DTMH 1A3LL 2OMVA 1CXEA 4EJ1C 3GDBA 1A6TB 4WJ5A 2P5EA 1AR2A 1EUTA 4RCAA 4X5XB 5GGTH 5LBVA 2NUTB 2FJGB 5FYJE 1S7UB 3RDJA 3QDHA 4RAUB 2GJPA 1GC1H 3K4DA 4GQPH 1JZ7A 4FG6C 2N3JA 5A2LH 2J73A 5DVKA 4KY2A 3IDYC 1ZHKB 1FC1A 1TYRA 1YAZA 2F8VA 3BSZH 1TZHB 4X6DB 3WNMA 5B4MC 4PJCB 2IBBA 4H8QA 4LSSL 4O02H 2W0PA 1BGXL 1S4IA 1N6QL 3K3QA 4XCFL 1E43A 3KXFB 5D4HA 3QPXH 4UQDA 1L9PA 2LE9A 3KBEA 1U93A 3C8DA 2JQAA 4OJDH 5ID0B 4WWKC 1CLCA 3RIAK 3QNXA 2ZG1A 4UF7C 3G5VB 2VWEC 4NOBA 3VXTB 2FX9L 2ZE0A 3T0EB 1NLDL 4U33A 5LG1A 1DFBH 1ND0A 2A74C 2WQVA 4J28A 3MRPB 3VFPA 1WBYB 1JPTL 1XF4A 1A7OL 2B4CC 3IJEA 4BCZA 5LO7A 1E3FA 3AM8A 3A21A 4X5WB 2IGLA 4LCCB 2GJ6A 1E8YA 3UTPD 3LKOB 4PI0A 3IAGC 3V7AG 2X09A 5TFSH 2YKLL 4LAJH 5L88H 1E50A 3KYNB 3GMQA 1A6UL 3F05A 4L37A 4IBSA 3FOLA 1FFPB 3NCFB 3ROLA 4X7EC 3ILPB 3ARBD 5CZKA 4PRHB 1D5MA 2H0JA 3JTSB 3B9KD 4GKNB 3QUYC 3VFNA 5KSBE 2Z8VC 2AXWA 1ZHNB 3ARDB 3GXNA 1ITCA 3D39A 4R2GD 2CR6A 4XNAA 4PTUA 2Q8BH 3B4NA 1XGRB 5AVVB 4S0HA 3HVDA 4GXUM 4HC1A 5DZLA 4PHZA 4FG0A 1J05B 3I9AA 4BIKA 2IPKB 2FD6H 1A0QL 5KVMC 2ZXBA 4JM4L 3NIDB 3PIQA 3MHZA 5EBMB 3HN8A 1U95A 5D1XB 1CLVA 1C08A 3OTTA 1C5DB 1RURL 4OFKA 3WGVB 1NC4B 2HFGH 3L2LA 3FU3A 2V7NB 3MCYA 4X4KA 2AKRA 2KL6A 5FC9A 3IFNL 1Y6KR 2DQJL 5I8CA 1ITBB 5FYKU 4RMWA 4WUKL 4WHDA 4NCDA 5HYJB 5I75B 1XT5A 5DUBB 3QCUL 4Q9RL 2XHNA 1DQJB 1QACA 1S7SB 4LLYA 5F6IB 3UP6A 2OMTA 4L8DA 1NAKH 3F7PC 1VGKA 3ULSA 1A8ZA 1I9IH 1USQA 3B3BA 4NO5A 3UJIL 3X3GL 3F7RA 4YSPA 4WWKA 1Z0MA 4G1MA 2HVJA 2BSTB 4RDBA 3G04B 3BZEB 4IU2B 3BXNB 1X4XA 3LYRA 3O3EB 1UXMA 1ZGLP 3F65A 2WXNA 4J3SA 4HZLB 2A74A 2DTSA 3HNSL 4G5ZL 4JRLA 2VRAA 2C1PA 5CZXC 5HHMB 4LT7A 1G1YA 4U1LB 5EBWA 2FSEA 1JNNH 5AEAA 2EVGA 2XN1A 1UD6A 2PCPA 5BVJA 1SOKA 3EJPA 3VXMB 4IRZA 1A7RH 4OZHF 1YMME 4Y9FA 4CSSA 1ZHBA 5CJOH 1FNHA 1I1FA 5EOCL 3U6XS 4ATTA 1I9JH 5CGBA 3OR7A 2OMNA 4IGBC 4ZNEA 1BVKB 1IL1A 1P7BA 4J3UA 4L3CA 4DPCX 2YRPA 1LTXA 1TU2B 3QUYA 3F6IA 1JCVA 2UXGA 5TQ0H 3MA7A 5EWIL 4ZQKA 2KZKA 4Y19D 4WWPA 4Z7OB 1EJFA 2NQCA 4BM7A 4ODBD 3S3DB 2WJ7A 2GUOA 3AB0B 4NQXB 3H9SE 4CNIB 1WAAE 3JWNE 2F8XC 4ZX5A 2XTJE 3RL2B 1HH6B 2WWMC 3BE1H 5I1AA 2IOIA 2B7DT 3RTQC 3V55A 1UENA 4F58L 5AVQB 2OULB 2AEQH 4AL8H 1ZVSB 5DWUH 5I1IL 3OWRA 3L3IA 2CK0H 3ZZ1A 1HCZA 1RJZB 2A9DA 4N2DA 3BGMA 3OXSB 3PQYD 3VH8A 2GSGB 1E5UI 3WDIA 2L7JA 4R90H 4PGDB 3PHSA 4ZMPA 3DC0A 3MV7D 5J6GB 3NAAL 2WBKA 4PY7B 1JGUL 3GS0A 2QLYA 1NBQA 2IIJA 4YK4B 3FB5A 2C7UB 1UXWA 2PR4H 4JFHD 3RWDB 2ILLA 2NY1B 3VD4A 5ICYB 3GSRB 4LKXB 1YNLL 4EE2A 4XRCB 3EXLA 2A6IA 2DQIH 5KSUA 1PVHA 4P48A 4XC1L 4NSKB 1G6RB 4NLHA 3JBG7 5G4MA 5IJCC 1S5IH 3LCYA 1B4JH 3QPQC 1KB9J 4WW1B 1AGEA 2DKMA 2J72A 3T0VA 4WFHE 1NBVL 4JJ5A 3UTSA 3P0VL 1DO6A 3EH2A 1GA2A 4G2AA 3QC6X 1RIHL 4N2LA 4LHUA 3LDBB 5JA9A 1DL7H 2ZTBA 1OP3H 3RZCD 1KEGH 2VZ1A 1MF2L 3P0YH 4Z0XB 2FJFA 3CN0A 4RFNC 4PLKC 4AG4H 3ZKND 1LWRA 1E4KA 1KCSH 2HKFH 4MNQB 3G6DL 4CVZA 2EYTA 3MRMB 1CGSH 2EE6A 1SLUA 2FWLB 3PWJA 5GSVB 2C9QA 1VFBA 2NYKA 1M1XB 3LIZL 3MRJA 2QGBA 4IGBA 4RH4A 4DKDC 2TRYA 4OQTL 4MTMA 4HH8A 5FO8A 5L2JB 3E6HB 4AM0Q 4IBTA 4Y5VC 2AEPL 1M6UA 2X40A 1MG2C 2I26N 3BP4B 1BF5A 3BVWA 3T4AB 2G3MA 1ZA6A 2FB4L 2K9FB 4LBEB 4CDGC 1KCVL 1EMTL 3JWOL 1UH2A 3LS5H 3K4AA 1OSPH 3IS0X 2CJ3A 4MQTB 4PRDA 4LEOB 5T1LD 2DH3A 3RTQA 2APWA 4NP9A 2EUVA 3T77B 3EADA 5AZUA 1WFOA 2EQDA 1B2YA 5D1ZD 4AENA 4TULH 2YFOA 4IRJB 4P5TC 2UZPA 3KPRB 3RWEB 3CXFA 5D72L 4NWUL 2YGVA 4B5EA 2C3XA 1KPVB 2J1YA 3FQUB 5C97A 4JDVA 5CINH 3S34H 1KT2A 1UZ6F 3ZX1A 2ITCB 1YUHB 1J11A 1OSYA 2XXCB 4OCRH 4NAQA 5E6ID 3U0PB 1OCRB 3BUBA 1KB5H 1OB0A 5IB4A 4EIGB 5IWLC 5IQ9B 1MVYA 2EDXA 4HHAB 2R2BA 3GXDA 4FHBD 3I3BA 5I82A 1I7UB 1R24B 3OXRB 4N86A 3IJHA 4Q6YA 5IQNA 1VPOL 4IOSD 4JKNA 1B0GA 4PJDF 4X42A 5TF1H 1KTCA 3OHMB 1YMMA 1Q1JH 3E2HC 1FN4B 2BVOB 2BOBB 2ZUWA 3LEXA 1MW3A 1TTAA 4OF3A 5DMIL 3UZVB 2Y7NA 5I1KL 5SWZB 1UURA 3LB6C 2H9GB 1IKFH 5AW6B 35C8L 2AXJA 3IRCA 4G71B 1GTNA 3F7KA 3AS1A 2OMVB 3WUWA 4Y16B 4WJ5B 4ANKA 4ZO7A 5FYKD 2BRRL 4NJ9L 3OKLA 2Q2EB 4U6VH 3TBSA 4RAHA 5E2WH 3WLBA 2F58H 1OSZA 1YDPB 3RAJH 4LNVA 3HPJA 1HEJC 3H9SA 3NACL 3WIHA 1DTUA 2A0LD 2WCSA 5T8IA 1HVXA 3HB3B 1H3VA 3NGBC 1N70A 1HFUA 2Y7QB 3OC8A 1NMAL 4C4KT 3NFPB 3EKCA 4HK0A 1J7VR 2V17L 5GRUH 2Z0UA 2X2IA 5KBNC 3OB0H 2QELA 4ZT1A 3ET9F 5FCSH 4OLVH 1RZ8A 5HHOA 5IEHA 3TBBA 5ITBH 1V10A 4Y5VA 25C8L 4IOFD 3SDXB 5MI0B 2OI9C 4ZS7H 3BRFA 2FJHB 3UJTL 3LKSA 4OZGA 2UXFA 3T2QA 1ND0B 1D9KB 3H55A 4JCWA 4FN0A 1ZMYA 1DDTA 2HRLA 3DRTB 4PJFE 1XF4B 3VFPB 5HYIA 1P84K 1AHKA 3WE6A 4YGVB 1SHXA 2BVTA 2HT3C 2AJVH 3QIWC 3RKDD 1Q9KA 5BRZD 4Z7IA 3R1GL 5BXFB 3BO8A 3BIBX 1JZ8A 1O7DE 3QFJD 4P5TA 3WV0A 1ZLWK 2OAAA 3PP3K 2DICA 1T1WA 2WPGA 4ALAL 2VAJA 2F74B 3U6XA 3FOLB 2VDLB 3ROLB 1TUPA 5A40E 3D85B 4M5YH 5FYLD 4LHQB 4K55A 3SCMB 1D5MB 4LSRL 5C0NC 3X17A 1SEQL 2R2EB 2E9IA 8CGTA 5JHMA 1Q9WA 1ZT7B 1IKNC 5GGTA 1HZHL 2IANB 3D39B 3H9ZA 4YZWA 4RWYH 4KI5E 4YSTA 3AS2A 1DSFL 4Z8FL 4PVNA 3CZEA 3HEIB 5INCB 3VMNA 1M42A 1F4XL 5AW2B 3BSZA 1I4FB 3WTVA 1TCRB 1FF5A 3PXLA 5E1IA 5CMAA 1BEXA 1JUFA 1EZVX 4PGBA 5ICXB 1N3NB 1WA2X 4NUMA 2XQBH 4O02A 4PJXF 3D87B 1EFQA 4NZRH 3UG4A 3ZRSA 3NJGA 1A3LH 1I8KA 4ILDA 5D5MF 4G8GB 4W9HC 3MX0A 1ORSB 1PD6A 5SWSE 2B2XL 2J8UA 4KKZA 1CFNA 1M56B 1RVFL 2Y0SA 3QVAA 5I0ZA 1UFUA 3H6AA 1PKQE 1TPXC 1PY4A 1U8PB 1YEIL 5H35A 1OW0C 2ZZUT 4TM9A 3DV6B 5CUSH 4LQFL 3ML8A 3L9RB 2ZYRA 1TZ8A 4LLYB 4LSSH 1A1NA 3RFRA 6CGTA 3SGDH 1KSRA 1E2ZA 2OMTB 1CU4H 2WQUA 5CSBA 3EJTA 3LZRA 3UTTE 5BOZG 1VGKB 3ULSB 3D18A 4W9GC 5D55A 5IROC 4JZOB 4KVPA 2JJUA 2WVTA 1T89C 4V1DE 2HFFA 5E8EB 4KWUA 2XPGA 1S7TB 5C0IA 3TEWA 1IC0A 1Z3RA 2DWEB 1GZPA 2WQ8A 4J6IA 4FFVD 3QFDB 5DJAB 1GGCL 2AK4E 2MQ0A 5EBWB 1JZIA 1WZKA 3FH8A 1EA9C 1RIVL 3O2WL 3QIWA 5FHAH 4WCYL 3B9AA 5LN4A 2ZOTA 1JHTB 1NCCH 4CGUB 1Y1DA 2GSIA 2XLLA 2V9QA 3KR3L 5IF0B 4AJ0A 4AL8C 2GHWB 2LTQB 1QQDB 5DFAA 5DCCA 1G94A 4KY1L 4OUUB 2XZZA 3IMUA 4P3CH 1ASPA 3CZSA 2X42A 3QAZB 4NKIH 3QUYB 4BKLA 3QZNA 4Z7UA 4NQEE 1D6VH 5KTEH 4UZSA 4AVKA 1WWBX 1IKNA 5D8JL 3DX6A 5G5DA 2VDQH 1U4FA 1LLAA 1X5YA 2CIIB 3OKOB 3T8XA 3U82B 3UACA 2GUOB 4OZFG 3WN6A 5GRYA 2VMDA 4NAMA 1AS8A 2UZIL 2P46B 3O4LD 3QULB 4KJYA 4NQCE 5EO0A 1NDMA 5I1AB 3HMXL 1KXQE 2CMRL 3TYFA 1BQHA 4D9RD 1YECL 4OY9A 1LO4L 4PVMA 5K1JA 2JK5A 2MQ3A 2ZXGA 2ZCLH 2WBWB 3HI1A 2I60H 3MO1A 3OZKA 4FNLH 4RMTA 3RWIA 4FFYL 1EEYA 1SXNA 1XF5A 5BQ7B 1J8HD 5EEVA 1L0QA 2XG5B 5IVXF 1D5IH 4YDVA 5DR5H 4HJGA 3APCA 5GGSB 3QCUH 3FB5B 4BBWA 2YEVB 4F3FA 2OBGA 1TOXA 2WTOA 1K8DA 4TLSA 2LU4A 4JGMA 3HJ0A 2CUAA 4XN9A 5F3BA 2YXVA 2A9BA 5D7LE 2A6IB 1SQ2N 5I30L 3ZDXF 1SN5A 4HUWB 3IJ8A 5IROA 2WB7A 4FYSA 3MLPA 1KIRA 3A22A 1T89A 1YYCA 4PUBH 3LRMA 2X4NA 3NSJA 2DWXA 2CLVA 1AGEB 1NCJA 1VERA 4IMLB 4PWEA 3V4UH 5FGSA 4TQHA 3K6DA 4OD1H 4G5ZH 1E9OA 5KSBB 2JKWA 2EEDA 1J86A 4PCKA 5EEWA 3KNBB 3QQ4B 5JMOC 4HIEA 3L95A 2PXYC 4M8QA 1NIEA 3ZKMD 5DJ0A 3F7LA 5D4QA 3HZKA 1KYOJ 3MYZA 1PNDA 2ODIA 3QNYA 4CVZB 2EYTB 2VN6A 2WXHA 1JV5B 4P9MH 1NIFA 3PGDB 5G55A 1VFBB 2OV0A 2H2PD 4IGBB 2IAMC 1DBAL 4ZTPL 2I5YH 1X5HA 1J0KA 2V37A 1X5KA 4XCCL 5I1LB 1LL1A 5DUJA 1NCHA 1KYDA 4WTWA 1YEWA 2Z7UA 3CU7A 5D1ZI 5TPWL 5HYSA 1YY9C 3QEQE 4O51A 1FAIL 2W9DH 2L0DA 3P9WB 5KVDH 4OT1H 1HILA 2D2OA 1S8DA 3QDMD 4OJEH 4F58H 2IDTA 1WUNT 2XQYG 3QJSB 4WEEA 5LXGH 1PBYA 3RTQB 3BJ91 1DN2A 1Y6NR 2WNWA 4LOFA 3EW3B 5AVZB 1LP9E 2GTWA 1QHOA 4AYFB 4K15A 2XKNB 1D5XB 4R7XA 1P4IL 1E3ZA 2DI9A 3L3OB 4JPWH 3LX9A 2F5BH 3KDPB 2X10A 3OMZA 4NRZA 4AI7A 3ZKXC 1KT2B 2D7NA 3SKMA 3PY9A 1EAOA 3ZL1A 3KWWB 5CD3B 4QHNA 1RXLA 1DBMH 1TKWA 2IFFH 1BW8A 3Q43A 4XOAA 3RL1A 3UAFA 2VIRA 4MQ7B 4X5PA 1YSOA 3MU3A 1YNLH 5CZVH 2YSSA 3X14A 2BSRA 4X4YB 4G3YL 4RGND 1P5VA 3VD9A 4L8BA 4NKMA 3GKWL 1YMMB 2NNRA 3C9NA 4ORGA 4UB0H 2DLHA 1OCWL 3NIFE 1I8UA 4JS7A 1Y07A 2E3VA 2EAEA 3P0VH 5LNGA 3QHTC 4EN3D 5FIEA 7FABL 5IB3B 2I32A 1ZT4B 2AQPA 3ARGA 1I8MB 1CLZH 1P2CB 3A4EA 5CD5D 5A2BA 4TSCL 4JFEA 4E9XA 3SQBB 3LS4L 3BDYL 3U6RA 1REIA 4GUCA 5A2KH 2GTZB 2PYFB 3FHEA 3FU0A 1A4JA 2PXYA 1IGCL 1MFDH 2WNKA 4PJHE 1QFPA 1P5UC 3WLBB 4N0CD 4RFNB 3H9SB 1VENA 4B97A 4DTGL 3DI2B 3L7EB 2XTJB 1G7IB 1MHHB 1XGTA 4E41E 3BCDA 5GS1C 4NQCA 4DZ8B 2ZXAA 1AGCA 5AB1A 2EYSB 4HK0B 4N2AA 3FQ2A 2K45A 1JD7A 1F2XK 4MMZC 4OBSA 4OQTH 2IAMA 1AIZA 1HL9A 1JWMA 3GKZA 3IGFA 2VXQH 4C8XA 3QQ9D 4AUJA 4NENA 3VGHA 4RFEB 4MDJB 5CJXC 3LKSB 2A9CA 3CHQA 2ARJB 2NXZD 4RDQF 2GY5A 3E8UH 1KCVH 1TTFA 1KB5A 1NINA 4RIRA 2GK0A 1YQ2A 2FT7A 3RVUD 5I6XC 3QQXA 4JFDD 2MHAA 3I2CH 1OOWA 4H7VA 3ZL4H 3DTUB 3ULUH 3QHFH 2G9KA 1RUQH 3IGAB 1IRAY 5EN2B 4Z5RA 5D72H 4YNYA 4J23A 2BS8A 2E56A 3GSWB 3L5XL 3N1FC 4X99B 3RVXD 3GGWB 1QLFB 3UAJD 3IPFA 3SQOH 2VQ1A 2DL2A 2NUPB 2C4FU 1VFUA 1YY8A 4OM1L 4Y7MA 4MA1C 1HJCA 4R7NA 5F0MB 3FYEB 3GSNH 1EFXD 5H37G 4AC4A 3OAUL 1V05A 1YEKL 4QI3A 3S0PA 5CCJA 1JGEA 1INQA 4KTYA 5A2CA 3Q2NA 1C12A 2PKDA 2Z93A 5T1DL 2YMXL 4EBQL 5F7YC 1JK8B 1JUFB 1GOHA 2JQZA 3GFUA 2AANA 3FH5A 1CF8H 4P2RE 4AQ8A 2YPVL 2CAKA 4APXB 1SHMA 4M6OH 4KKAD 4X5RA 3MJ9L 1OGAE 2NW3B 4ZNCD 3AABA 4Z77A 4MDRA 3HKFA 3KBHE 4X0KB 2EDKA 4ZUTB 4TSBL 1Q9LA 3SBWC 2MKLC 1KBGL 5C2BL 2WN3A 3UYPA 1P5UA 1XB6A 3UX9B 2M1KA 4HMCA 1U8LB 2WKLA 5DC9B 3TBYB 5H4YA 5H35B 2KERA 2VISB 5GS1A 4F57H 4WUUA 5DJZB 3ETSA 4AQAB 2ED8A 1XH0A 1Q72H 4L29A 1DANT 5DRXA 2Q7YA 4HEPG 4IKLA 5B39B 2NX5E 3DX8A 4XCYA 5IK3B 2D03L 4EI0A 2HFFB 4BELD 5EU7E 4R7DB 5EZLA 2JJSC 4GP8B 3NEEA 3UJTH 1NKGA 1L9SA 2BO0A 5CJXA 5J4MA 4M6NH 1JZFA 1ASQA 3ESNA 4PFEA 4XNUL 5GRVK 1IE4A 5KVEH 1GPOH 3PGFL 4I13B 2MCMA 2VSMB 4DKFH 2Q86B 2PCYA 1G7JA 2G0LA 3BAXA 1DVFC 3LEYL 1AZRA 2TSAA 3R1GH 4R4FL 5JA8B 4BD4A 2SEBA 3JWDL 1F41A 1VJSA 1G9NL 4QHPA 3B2XA 4AEFA 3AUVA 1LHZA 2DQ6A 1U8JB 3NFSL 4OB5H 4RQQA 5JTWA 1ZOXA 4Z7WF 5JOFA 2CO6B 2HKHH 3V5HA 3VWKD 4GKOA 4JFVA 4MQXC 1MW0A 3DV4B 4M4RB 3QHZH 5D4IA 1SEQH 2V6HA 4BKLB 1RV6X 3GJFH 5CWSA 1G7MA 3OZ9L 3WKMH 3X3FL 4LMQE 4WI0A 3O6FB 3C6LB 4XZUB 1KJ3H 1MFBH 4OM0L 4D0CA 4QJ5B 1HZLA 5HXMA 3LEVH 4E41A 1RQ5A 4XNYL 3KG5A 5DK0A 2Z31A 1P7KB 1NDMB 2OMYB 1YC7A 3U2IA 1BQHB 1FJ1B 3VAEA 4E36A 5C0EA 1NGYB 2IWKA 3DJRA 3K71A 1RKRA 5EU7C 3LVTA 1WA1X 3FTSA 3HI1B 5AZ2H 4PGJA 5A7BA 4QTIH 3FC8A 1R46A 2ZYHA 3SBWA 1XF5B 4GRWE 2LR4A 1QBAA 3MRBB 4FHJA 1XGUB 4KQ4L 4Z23A 4PJFB 2UZXB 2QVTA 4HHWA 4U1SA 1I9RL 4LVEA 4MAYD 3OQ3B 4N8VA 5FLVA 3VWJD 1JXGA 4YHOL 2JB6B 1B6UA 5F3BB 2XKUA 5F7LB 3KLSA 5C71A 1AYRA 1XIWD 4NCC1 3CTTA 2IDUA 3KM1A 2CLVB 4HISA 2DLEA 2JJSA 5F3HA 4DP0X 4Z7NE 2CG9X 1J1OH 3D06A 2FAUA 1CQYA 3OPUA 4JLRA 2E0PA 4J5VA 1ZT1A 3FBQA 3OHXC 3P3YA 3RWJA 5E4OA 4JBSA 1IT9H 1J12A 3NT0A 1DVFA 3O2WH 4G6KL 3V4VB 4PJ8D 2ICWI 5E6ZA 5EEXA 5DD5L 3MLVL 4QOKA 4ZBJA 4ZXBD 1PAZA 1BZEA 3WCYA 4GIOA 1UM5H 4IRSD 1K4CB 4DGWC 4IBLT 3LZNA 3QWOA 2HT2D 4Z7VE 5T5NG 3SKJH 3MNDA 3WLWC 1X4YA 4NNXA 5C09E 1Q9OB 4GKSA 2PTVA 2EICA 2ENPA 5SWSB 2Y06L 3Q8EA 3WEMA 1JVKA 4NERA 5D8JH 5AW7B 5AKRA 3E8VA 4P0DA 2XFXA 1SZNA 2XUWA 4KO9A 4UIKL 3RI5F 4D0DA 4G6ML 2HVKA 4PJIE 1PKQB 4XMUA 3CHRA 4FTVD 4JK0D 3LHPL 4NUQA 4C47A 4LSVH 3ULVH 3SPJA 3AROA 4KO7A 4Q56A 2XWDA 3ULUE 5ACZB 3UTTB 3O6LL 1H8SA 3FU8A 1LO4H 3X11A 4LCUA 2GTWB 1VRSA 1YG9A 2FYVA 5IHUL 1FVDA 5IUSA 4V1DB 4PRAA 2KS0A 3PREA 1W0VB 4YBHA 1T2QL 5KEZA 4FFYH 4QLRA 5JHDE 4KAQL 1K9TA 4OIIL 2PTUA 2AJUL 3ZT5A 5IQ7L 1SXCA 2V7HA 4ODHL 4JANB 5FW8A 4D9LL 4QHNB 5FKAA 4MWFA 1JGDB 1YEHH 3D4ZA 3QUZB 3K80A 4ZUVA 4ZK8A 2AK4B 5EFIA 4AIXA 4ZJ9A 1XF3B 5EEUA 2YSSB 3ZTDC 1ID5I 3MMEA 4JKPH 4EDWL 4P05A 3BUIA 2VB5A 3UEZA 4GMTH 4NKMB 5DD1H 1MVUB 3AZUA 1QTYT 3JYBA 3CXHK 3NABH 3RWGB 4XR8C 1PPIA 3D9AH 2XN9D 4BQ8A 2J1XA 4OIBA 1K85A 4XT1C 1BF2A 2X1WL 3ARGB 1J5IA 5FR3A 3NJLA 5F96H 5KYUB 2W0KA 2LV4A 1ZSDA 4XMKH 4NQEB 2EKSB 1NCGA 3OHXA 4G7VL 4ISVB 3C60D 4K94L 5DZOA 2WVUA 1A4JB 1E8WA 3PJNA 4AMKL 4F9LC 3O2VL 2I07A 3TX4A 4YSDA 1A1OB 1S7RA 1AO7E 5KVFL 3BN3B 3MRHA 4NQCB 4P23C 4N8CL 1G4MA 2XV2A 4I48B 3O8XC 3ULUC 4QHLB 1KGYE 3I6SA 3VFTB 1R3JA 5KUMA 3GNML 1PIFA 5FUZH 4JN1L 3BFWA 3U7WH 3WS6C 1U8OB 1JWMB 1N5AB 3VCLA 4KITB 3MCLH 5TPWH 3A47A 3OKNA 4XMTA 2OMBA 3NZ8B 4MS8C 2IQ9H 4OF7A 1FNGA 3PDGA 5AL0A 1M71A 5HHPA 5J12B 2WV3A 2QSCH 3W1ZA 4GAGL 4RIRB 3MV8E 3MUJA 2FNBA 1JRHL 2QSVA 4DVBA 1ZLVH 3T6XA 1UD3A 4L1SA 2AS5M 5DO2D 2WQXA 3MUHL 1TT6A 2MHAB 4K4KA 4P2QA 5D7LB 1ORQA 2AQNA 2ZPKH 2YQBA 1KPUA 2JFCA 3TT1H 4P99A 2XG4B 3RVVD 3RNKB 2FT6A 2VM3A 3D3VD 1FRGL 4DN4H 2H0PA 4KKPA 4Y2OA 5GXBB 4AK2A 5AYQA 3FN9A 5SX5H 3P02A 4XXDA 4AJVA 4EXPX 5CIPH 2BIHA 2VQ1B 3OKYA 2KUTA 3R06A 2HFEB 4KJQD 3JXAA 2OXHA 5D1QE 2AZAA 2WP3T 3HMWL 1QW8A 2DBJA 4HT1H 4G3YH 2DD8L 2HG5B 4NO0B 2X9XA 4NM8L 4RMSA 4W9FC 3A6BL 4N0RA 4B60A 3GKWH 5MEQA 1GHFH 3PHQB 2WVVA 3VM5A 1C12B 4M4PA 1OCWH 4JM2C 2YD5A 3QZWA 1UA3A 1AZZC 4RFOH 3CH1B 3FRPG 2NTFA 3LQZA 4R4BA 7FABH 4FGMA 4YBLC 4QXUH 3VD1A 3SPGA 2JIXA 4EOWH 1FGVL 3FQRA 1SOXA 4OQTA 3TJEL 2I69A 3DI3B 2FYYA 4KJWD 1MW2A 3EJZD 5LGJA 2IV8A 2VXQA 3KDMB 3NFNA 2JV6A 4YDZA 4LRNL 4F9LA 3U4EA 3QEQB 4PJIA 2FIKA 1XXFC 4K7FA 1P5UB 2FCBA 2YAFA 5F71A 4BK4A 3LQAH 2A6JA 2JCWA 5F8RC 2OW7A 4P23A 2QTVA 4YHKL 3EO0A 4YMPA 1C16B 1N0XH 2WIMA 3BUTA 3CVBA 5DRXB 3O8XA 1KCUH 4ECNA 1ZWIB 3IE9A 2EIBA 1LP9B 2UXVA 4Y2LA 2COVD 1R47A 1WBXA 2X4UA 3DX8B 3TPUA 1RI8A 4TKWA 3IEAA 3IE4A 2CO7B 3GTVA 3H42H 4N9GA 3RVTD 3U7AA 4C56D 1PZ3A 3H3KA 4UDUA 3DUSA 5DGRA 4U1MA 1BM3H 1E7UA 4HETA 3UBGA 4GP4B 1A6PA 1XCTB 3Q6GL 1EO5A 3EJSA 4XP4H 1N67A 1PD1A 1DFXA 2K70A 2KH2B 3DSFH 4ODUA 1FGNL 3GSNA 1M3JA 1NGXA 2E9JA 3PAVA 2H8PB 1FLRH 2B1HH 2JMRA 5F9OL 5IV2A 5HDBE 5EOQL 4JRYA 2Y24A 1KYAA 1NEUA 3F12A 3NIFB 4QRFA 3TBTA 4RQQB 5DSCB 2ITDB 5KJ7E 1SLXA 4JNXA 1MFMA 5I0WA 2VDOH 4NN5C 4WW2B 3HC2A 4Q58C 2Y6SC 3QXTA 5HGBB 4FP8H 1OM3H 2YN5A 3T2PA 3N43B 1PU0A 4X7TA 4XC3L 5JORA 5E2UL 2Y3AA 4CKQA 1WTGT 2NR6C 1MAML 4PJHB 5DHVB 4FI8A 4XP9L 3MBEB 5IFAH 3GMOB 3KVPA 2NT1A 4L23A 4D0CB 3JTBA 4FA7B 4Y2DC 5GS0L 1AO7A 4E41B 4S1RL 1T4WA 4RX4A 1RZJL 4JM2A 2LW3A 5JHBA 1I1AD 1KXTA 1M2VA 2Z31B 1NCUA 2BZCA 2I25N 4CSPA 5ID1A 5IT2L 5DA0B 4C57C 3Q6FB 2P24A 2BP0B 4P57A 2ADFH 1KIUA 2JI2A 3WHXA 5IMKA 4OI7A 5F9WC 3T0WA 3QDGE 3SB3A 2FX7L 4F33A 2QVMA 3MZTA 4OVVA 4W1TA 4WEUD 1E5BA 3IDXL 5I19L 3GI8H 4AEHH 4AQ1B 3ARPA 1XCQB 4E0RA 2G4GA 1OOAA 4WU5B 1BV8A 2IH8A 2A9ML 4XO3A 4YDJA 1G0XA 3MLSL 1T5XB 3CMOH 3QRFM 3S9DB 4QF1B 2OMWA 1G9MH 4LSTL 5IVZA 2GSMB 4DNLA 2QKIB 5GSRA 1R3HA 2CXKA 1H6UA 1Z5HA 3I02A 3NG5A 3IN0A 2A83A 1EAPB 3QJVB 3H3BC 4PLOB 2MNUA 5EUKA 2AERT 3GJFA 5C0DA 3BVNA 1MCIA 4YSSA 3RWJB 1UH4A 5DD0H 4ZOEA 3TESA 3JWDH 4X4ME 3D08A 4GG6A 2HLAA 3OKDA 2IBGA 3RZWA 3P9MB 4UT6L 2F54E 3RKPA 5D2LA 2BP8A 3ABZA 4XN4A 3ULVC 3AAZA 1K5NA 2W1NA 3GYRA 4X98A 3I84A 3ULAB 4P2RB 1S3KL 3QWOB 3VB8A 2NW2B 3KWTA 3MBWA 3R19A 3TJHC 1NFDE 4NNXB 1JWUA 2A4EA 2XQ0A 4HLZG 5FECB 4GKSB 4I89A 1EV2E 1OGAB 4PAZA 1IB5A 3OZ9H 4C58B 2EEFA 3SDCD 4EI6A 2PYED 5K9OA 1V7NL 4D0DB 2NR6A 5E99L 4YBQC 4CVXA 3VE0A 1CDHA 4R84A 4Y2DA 4FZ8L 3IFPB 5B3JE 2WLLB 3QR0A 4GLRI 4Q2ZB 4RMVA 4IK7A 4I77H 2FJUB 2WZPD 1WFTA 3AQDA 3KM2A 4F92B 3B2UD 2NX5B 3GSOA 4HIQA 3T04D 1JZ2A 4JRFA 3QXWA 1IC1A 4MFHA 1FVDB 3DGCR 2GVYA 1T7ZA 5EO9A 5T3XL 4XVJL 4W93A 3MOBL 2R1YA 1X9QA 1MEXL 4F2FA 1OTTD 4HWUA 3CUPA 1I9RH 1GR7A 3VU1A 5FKAB 4HF5L 5J57B 4FFZL 5J3HD 4PREA 3MMEB 5EA0H 2NY2C 4KTGA 3VD3A 1MSPA 4G8FB 4ZG1A 3F8UB 4A7VA 4HIIA 5E4AA 3HPLB 2VAAA 1ZK5A 5C0BD 4O4YL 1NGQL 3A67L 3CFBB 1HYSD 5DJXA 3ZUNC 5LCVL 5ICZA 3VMPA 4K8RD 4M62H 1HHHB 4ZFGL 1NIBA 2CLZA 3BP5A 1HL8A 2YLKA 2YGOA 4FQ1L 5HVHB 3MLVH 1QRKA 2R0LH 3G9AB 2R23A 2VSCA 2X88A 5DDHA 3DXAD 5ISZA 4F7KA 5D70H 3MRHB 1SXZA 1CICB 4QRPE 4OLYL 1H3PH 4RGOL 4WZ9A 4ODVL 4FQPA 4QTHA 4ZTEA 3CPLA 5L0QB 2H41A 3GSQA 1B88A 3ILEA 1C9SA 5DO8A 4BFOA 4CN4A 4F1SA 4Z6AT 5A2JH 4FFYA 4UIKH 4XE5B 3NPZB 2WLJA 1FNGB 3IKKA 4GRWB 3SDYL 3KLLA 5AOLA 4KK8C 4ODSL 4KNQA 5BVPH 1DQQA 2QZ5A 1XDTT 3F64A 1HEZA 1XGQB 3DX3A 5MHSD 2OR9H 4FFWC 3KPLB 1KEML 2UZYA 3LZLA 4LCWD 1ORQB 4KTEL 2LQRA 4L3EE 3VVWA 3MNWB 2X4TB 3CXDL 1QWNA 4KRNA 5DEFB 1U3HA 4X7FC 3SDAD 4PWGA 4FYTA 1T2QH 4X50A 5I0YA 5J0BA 4W9CC 2EILB 4LLWA 3ARRA 4U31A 5CJBA 5F7DA 4U1JB 3CU1A 4AEIH 4Z7NB 1NFAA 1NWPA 3W2DL 3L4CA 1MW1A 4XXDB 5JW5B 3KL3A 5HHNB 5F1IA 4I1RA 4P5RA 1WD8A 3SD5A 2XWJB 4HX1B 5I8KH 1FL5A 3I74A 3RPIB 3VO0A 3LQAC 2WINA 2WVVB 4XNDA 2F54A 2I7OA 3QZWB 1OVZA 1F3RB 2NTFB 2YZ8A 4J8QA 3K6OA 3L8QA 4JFFA 1QKZL 2JIXB 4YHYC 3FO1A 3LPFA 4YR6B 1CLOH 5B7EA 4Z7QF 2P7TB 3MUGB 5KS9E 3BKJL 5C09B 5DQ9B 1AQMA 2YUWA 1B9KA 2FYYB 5AWNL 1F3JA 2ZWNA 1OAXL 3O2VH 5D96C 3HC0B 4CC0A 3QUXD 4LAQL 3U4EB 5CBEB 2J8UF 5KSAD 4PJIB 3UG3A 3GI9H 3WE1A 3GSXB 3TNMA 4HJJH 4AXWA 5JUEH 5JW3L 2FX8H 4GW4A 5ADOL 4ZFOL 2K1MA 1QO3B 4FQHA 4MCZA 2PUQT 5LG6A 4POZD 2F19H 2XBDA 3GNMH 1U8HA 3DK0A 3HLAA 3TO4C 4F15B 4KKNA 2X4UB 4R0LC 4ENZA 1LK2B 3VGAC 4FQXD 2IEPA 4M5ZH 3GWJA 4MA8H 4KHTH 4N9GB 1FWXA 4G6FD 1D6EB 5JHDB 1JNLL 4OJCA 3I6KB 2FBJL 2AQ2A 1U3ZA 2Y3NA 1OP3K 5CIPA 1VACA 4GT0A 1QD0A 3LKQA 3NCJL 3QSKB 4NBZB 3BMWA 4Y0GA 4TNGA 3T3ME 1G7LB 1CZ8L 1R5IA 2AABH 2AJ3A 2IDCA 2ZYSA 5KANI 5A6LA 7TAAA 2DYPD 3RY5A 5IV2B 1NKRA 2X1QA 1CXLA 4FXLA 4PPTA 1FRGH 1MCCA 5HI5D 1T22A 2E47A 5MEOA 2X1XR 4NZTL 3II2A 3MRCA 3R8QA 1IMHC 2IALA 2VDML 1KB9K 2JLLA 2HSIA 3S4SG 1UZGA 3PRZA 3FQ1A 4ZPVB 3HMWH 5JORB 1BIHA 2RGSA 3BFOA 3BPNC 4AMWA 4L0YA 3G5XA 4QNPF 1CXFA 5D7IF 5IBTH 1WDAA 3UO8B 5CZRA 1F4WL 3HZYB 2F53D 1AO7B 1UA6L 4X9FA 1T80A 3PL6D 5IESL 4QRPA 2R59A 1NKOA 3O9WC 4NKDB 4XPFL 2E74C 4YBLB 3TJEH 3I6LD 5BZWB 2V9UA 4RESB 3BAIA 3EG9B 4MNGE 1G9MC 2HJFB 1Z9OA 4O58H 3HFFA 4P57B 3RPKA 3VFOB 3SPVB 3QI9C 3GHEH 3MLTA 4LRNH 3WFCL 2NCEA 3B7YA 1GAFL 3HHRB 4LLUA 3WY1A 1Q94B 4PJ9D 3SD2A 4P2YA 3MV8B 5EF2A 2OYKA 5CEYA 3S8GB 4ZODA 2ZIDA 1N12A 1HOEA 4A2GA 5FUCE 1HHKB 1RHFA 1RUKL 3DMMD 1AGDB 5AYUH 1WHOA 4E5XA 3ARYA 3BAEH 4JFZH 4X6EA 5IQMA 1MAJA 5CP7B 3FCUB 3LN5A 3TO4A 2B1AH 3PLYA 4R0LA 4KRPD 4G70B 3WTSA 3C2SA 1OP5H 3ECBA 4RRPM 3SY0A 2FLBT 1PDKB 1FG9C 3L3DB 4PRNA 5DJ8B 2LAAA 5DS8B 3MQIA 3L4ZA 5D1QB 43CAA 1LO3H 1AMYA 1XCWA 5EUKB 1WFIA 5TK4A 5HPMA 5FYKH 4F7CA 1KTLA 2VZ3A 3D48R 4IS6B 4MXVF 5GHWH 4GSXA 3LKPA 5F7KC 3SYOA 3LNFA 3Q8FA 3CIQA 3RX9A 4YIQA 2YAQA 1NCAH 1ZLSH 1TTUA 1FZOB 2DYRB 3M88A 5BO1H 2DI7A 4PJ7A 3BPLC 2BP8B 1MFEH 4U6YA 3OB0K 1K5NB 4L9LC 3B2PA 1UUSA 4XMWA 5KS9A 5FX3A 4AVJA 1NUFA 1GMEA 1IC7H 1WO2A 3GXIA 3N1PC 4W9EC 4XC3H 4ZOAA 2YKKA 3OC5A 3X13B 3L9EA 2JI3A 1FNEA 2ZOUA 1JD9A 4IKIA 1H0DA 4NJAL 5E7FA 3BIAX 3WNNA 3ARBC 2HB0A 3QUMH 4BINA 1IQWL 4ETYA 3B9KC 4CVXB 3QWNA 2R4SH 3BLPX 3SDDD 3P11L 3EYUL 3FUEA 1BOYA 5HD8D 2QGEA 4HV8A 4R2GC 4W68A 3PFUA 4CW1A 3K72A 3IMSA 1PLBA 3O9WA 4NPJA 1MCEA 1G9EA 5IQOA 2V5YA 1XH1A 2E9GA 1NPNA 5DUPL 3HI6H 3V4PH 3QI9A 2Z4QA 4U0QB 4GUOA 4QRTA 1A4CA 2R1YB 3NSXA 4EUPH 5JXAH 3OKEA 2EXYD 1I3GH 1MI5D 3IKCA 4J8RB 2NY5H 2Y7MA 4IJ3B 5F88B 2GW5A 4TQIA 4U6XA 5K59E 3PAZA 1MJUL 1JGVL 4BSJA 2YN3A 4Y5YB 3P3TA 3ARUA 2YPKA 1AZUA 1AXSA 3V5DA 5DZAA 4Y9GA 4U0RC 5EIVA 5HDBB 5J1AB 4OCXH 2OQJA 4G6AD 4YDNA 3IDIB 3NJKA 1DO5A 1QI5A 2ATPB 3MZGB 5JW4N 2YWZA 1WE5A 1NEZG 3V5KB 1BEYH 3QIUD 4HCGA 2VCOA 1A14H 2QV2A 5IB5A 4F8NA 4UAHA 1CI5A 2OMZB 5DJXB 3BVXA 3IJYB 1FPTL 3S2CA 4G9FA 2DH2A 2E7MA 3FQNA 1QW9A 2EIZA 1MWAH 2V5RA 2XU9A 2F7RA 3BP5B 5FW7A 3MGOB 4WNQA 2XRAL 4N6QA 3NMEA 2QR0A 4Y4KD 2Q8AL 4UINL 1RK0A 1F6AA 5KVFE 4UT6H 1FYTD 4MXQD 4QT5A 5DDHB 1F8TL 2XZCH 5C0FB 4KO5A 3VI4E 4JGNA 1YHPA 4L9LA 5DC2A 3MI6A 1WV7T 4LLMA 2R2HA 3G5ZA 5KYWA 3TIEA 1SN2A 2EIDA 4XMPH 2XJKA 2I27N 1L0PA 3NTCL 4WTZG 1TIUA 2PW2A 1V7NH 3PWVB 2J56A 5E99H 5DQDL 3QDGB 4WI6A 3ARBA 4ODXA 2JNZA 2CLRA 1EEUA 3B9KA 4QO1A 3VFMB 5I16B 4C4KO 2XWTA 2HWZL 3FW6A 3L48A 2DI8A 2DW5A 4HWZB 1HOCA 2Y2TA 1DVSA 1CJYA 2Y1YA 4MJID 4PHXA 3GZPA 3L16A 1KV3A 5EU5A 4OD3H 3UIYA 4HJUA 4NNYA 3JQOB 1U3HB 2YD2A 3LN4A 8FABB 4J2XA 1JF1A 3QR2A 1TJGH 4H88L 5CEZD 3MOAL 5FCUL 2NYYC 2BCKA 3K91A 2F7OA 5CGYD 1YA5A 3KGSA 4B0MM 1SN0A 2WXFA 2WLYA 2VZVA 3GO1L 3DTDA 5F0PB 4GXVL 3FQ4A 4OD2A 3RHWK 2BJMH 5LGHH 5I5IA 3D4CA 3LN9A 3WYRA 2NY2B 3LNHA 4GBXD 3SOTA 1ET8A 2F54B 2P28B 3T4YA 2KLRA 2Y25A 1T03H 3EYVA 2CE6A 4O4YH 4FE9A 1FG2A 4OFIA 4UYQA 1A7PL 5L8KB 1NFDB 2NLJB 3FU9A 4ZFGH 5DJ6B 2WXLA 1R0AH 1KACB 3G6JF 3S3PA 3VXRD 2ZSWA 2EYRB 4FQ1H 4EDXA 1F3JB 4LZKA 3ZHDA 1VADA 2RACA 1B3JA 4FMKA 4M7LH 3QS3A 3MNZA 3TNMB 2D7TL 3RZCC 5JHLL 1JPSL 2DEXX 1T20B 1UOLA 3GB7A 1NM4A 4MCZB 5CAYB 4UCFA 4PRPD 1YNTA 4YXKH 4J6RH 1CDCA 1GKOA 3Q5OA 3ZKNC 3BRDA 1W2KT 3MDJA 2K6WA 1D5BB 4XAWL 1KLFA 5GIRB 5E2TH 5EUOF 5EOTB 2FQDA 4Q0XL 4GO6B 2EH7H 3BD5A 5GGRY 2G60H 1YEEL 2ETWA 2QGCA 2XT1B 1YN7A 3TIDA 1NCBL 1ZS8A 5CM1A 4BDVA 1VACB 4GI9A 4Y19A 5GRJL 4XVTL 3QRBA 4HDIA 2GEEA 3OJDA 2APTA 1KXVC 4DERA 3W56A 3MBXH 1ZA3A 2ADJB 1WA0X 2XVLA 3CXDH 1KULA 1JAEA 4JMNA 3KPNB 1KLUA 4KH9A 4L4JA 3N0PB 2YUVA 3GSVA 4XN2A 2DMCA 4O2CA 4PU2A 1SBBA 5D1ZC 2B0SL 4PRIE 4QHMB 3PQYA 5CJQH 5EN3A 3DOSB 4TQPA 2ZAGA 1I7RB 3QIBD 3MV7A 1DQLL 1A21A 2N0MA 4BQ6A 1BAFL 4JN2A 4ZZKA 1JZGA 1WZLA 1TQSA 3LMJH 4QCIA 3EO9H 2KBGA 4ZW8A 1YNKH 4XXWC 1E28A 3BPCA 4GW1A 4YDIH 5GGVL 3K6SB 1OPGH 4E9SA 4QRPB 3ZTNH 1R5WA 1TZIA 4PJ5E 4M8RA 4Y1SA 3C5ZD 3SJVD 3V0VA 1KYOK 4RSVA 4E68A 2XA8L 1UG9A 1IFHL 4DGIH 2B8OT 3DIDA 5B7FA 5BRQA 2H45A 5L7XH 4Y5XB 1SY6L 4FQQB 4TOYL 1Q0XL 2XWXA 5TE6H 2E6JA 3BZFB 1FO0L 2EADA 3MFGB 4LAQH 4O2EA 5FUOH 3U2JA 2BH0A 5DJDB 2GTQA 3EBHA 4HOXA 4LLUB 3JYCA 5DEGB 5JOPE 3G6AA 3RZCA 3BQUC 1SQMA 2E5EA 1OO2A 4K73A 4A67A 4OJYA 4CC4C 1KTBA 1CE6A 3S36H 2CA4A 1ACYH 2V2XA 4RGMB 5E8PA 3EOBB 4W81A 2JELH 4H1LG 2A0LC 5FGCE 4L3EB 4PI2A 5HI3D 3TPKA 3KYAA 2BVYA 4J4PD 3LN5B 1AQHA 5C0CE 2Q7NA 4JY4A 3GUTB 4OCSH 1ZTXH 4N5ED 5DK3A 3VG9C 2FBJH 1DLFL 2YHGA 2VDOB 4H2AA 3T9WA 4PRNB 2X6MA 2A6DA 5ANMA 4IOFC 43CAB 5KAQG 3B3IB 5HPMB 3CBJB 3Q8AA 4ODWA 3QFGA 1WRFA 1KXVA 1PG7H 4EZKA 2WD0A 1MH5B 4JFYB 2B5IC 1XHHA 4CN6A 5T3ZD 2AI0H 3BD4A 1MCOH 2CDEA 3N5AA 1HSBA 5BMFH 5J6HA 5T1LA 2WLIA 4NAJA 1ZSHA 4LU5H 3VACA 2JKRM 2FO8A 4N0YH 3NJNA 3RKDC 5D1ZA 1USZA 5JDJA 1ZHLA 5KS9B 1J8RA 1DCLA 3OLGA 1RUPH 4NO3A 5CKGA 3U46A 2YD9A 3RX7A 4KMLB 1J1XL 1FNEB 1LVEA 5C08D 4BE5A 1H0DB 4HPYL 3RJQB 3FTGB 3A5VA 4HCRH 3WKQA 4HBCL 1F97A 3P4LA 4ZW3A 1M7UA 1G7PA 4O00A 5L2KE 1F4WH 3MTXA 4EZMA 5HYQB 1E67A 2VN7A 1FYHB 3T08A 4XXWA 1IU1A 2NY5C 3K2KA 3BH8B 3K72B 4XWOD 2VLLB 4XVUD 4CW1B 3WD5L 3X12A 4IOSA 4ZOCA 1RIUL 1CD1A 2BOCA 3AREB 2Y22A 2BY1A 4PCSA 2H1PH 5T3XE 4NN6C 4NPKA 3OAWA 4UOQA 3D2UA 2IBZX 1UKTA 1J0IA 1LE9A 4ZQTA 3M8OH 4XMLL 3RE0A 3CBRA 2YBRA 4ZTOL 1S78D 3N3EA 4MYPA 3AXLA 2UY6A 1Q0YH 3UFIA 4A7SA 5AKTA 3BQUA 2BPBA 4CC4A 3EDEA 3DARA 1OL0A 3CCHB 3QZOA 3ESUF 1TTGA 1ADWA 2HX9A 3QORD 3T3MB 3BKML 3X1NA 1CFVL 3F6LA 5DMGD 3T2NH 1OAYL 3VFGL 1T04A 2NNAB 4X6DF 3HHMA 3MUZ1 1J5CA 5ALCL 4S11A 3ASNB 2BY2A 4G9FB 1U3JA 3SPCA 2EIZB 1V3LA 3QUMA 4X8JA 1P9MC 2J71A 4LO9A 5DHEA 2QHRH 2ZX6A 4FFVC 4NO2B 1X5XA 4XNXH 1F6AB 2ZJSL 3O0RL 2ZUSA 1KJVB 2NNXA 4GRMA 4GRLD 1TQCC 1TQTA 4JFWA 1LEIA 3E7JA 4YE4L 5BRZA 2CKNA 4MVBC 5J7CC 2ED9A 4L9LB 1LQSR 3R7RA 5I9QB 4MNGB 3G5ZB 1TEFA 2ZKYA 3DVNA 3II3A 3WXVH 4C4BA 5LDSA 4XVSH 1XO8A 1GJWA 2EDHA 3PF2A 4YHLL 4W4OC 1IQWH 1DVZA 3KVQA 3CE1A 2R4RL 3K74B 3F6JA 4H2CA 5ECGA 2VLRD 1BZOA 2PWFA 4MCYA 3U7YL 4EUPA 3O6KH 2X41A 3ZR6A 4A39A 3EYUH 4B53A 2MCPH 4P4RA 1ESOA 3D0LA 4KHXL 4WIQA 3RWFB 2HMIC 1PLGH 4PWIA 2DMGA 5K93A 5CBAB 2W60A 1C1EH 4FQJL 3PWPD 1HOCB 1LEKB 2I9LB 3QZMA 4KO6A 2NXYC 4UDTA 5C0RH 3W37A 4K71B 5C0CA 2VXTH 1WK0A 5B1AB 4BV1A 5EF0A 3QP3A 4HIHB 5F6HI 1UXLA 3BJLA 2V8MA 5A6MA 4HFUH 1H8OA 2BCKB 5HHXH 1QFOA 1LXMA 3GJFK 2RR3A 2BVUA 3P3SA 4OV6F 1CVSC 4WK4B 4F7PA 1M6OA 3AVEA 5D7JC 1MIML 3NJXA 1MWAA 1MJUH 1CGTA 1EGJH 2D3NA 5D2NC 3BAKA 3K81A 4H40A 4AM0B 1RSFA 4UT6A 1U9KA 4U0RB 4DP2X 4I3RH 4YFEA 2G3ZA 3O11A 2HLFD 3FT3B 5INDA 3U1SH 1Z5LB 3KAAA 4LVOC 2K0RA 4QRUA 2R7EB 1O6TA 1TZOA 2VMJA 3LRGA 3RWCA 3V6FA 3V6OE 3FUHA 1EXGA 2NY4B 3MXVH 3UZEC 4D8PA 4MCNA 4TTGA 3WTYA 1L5GA 4M5SA 5IKCB 1JNHB 4EDXB 4GQ9H 1P9MA 1VADB 3F7QA 1QBLH 5FLUA 1CK0H 3IVKB 2B77A 1F8TH 4NWTL 1JS4A 5FA3A 1SDDA 2AJSL 2NTSP 4NYLB 3TV3H 5L4IA 1OAQH 1YNTB 4LLQA 5J56B 1F45A 3U0TB 3ISYA 1JZ6A 3NJFA 1NAML 1J48A 3V2AR 2VDRL 3NTCH 4FQCH 2BDNH 2QVFB 5ESQB 4LARH 3PU7A 2H2PC 1A4KB 1QZNA 2ZD0A 3IXTB 3MKKA 1JL8A 5LWYL 4W4OA 4XP5H 4A37A 3CHOA 2EDLA 3MLRL 5IB1B 1EJOH 2CDGA 1YN7B 1DE4A 1M05A 3LOWA 3GF8A 3KGTA 3QEUB 5IW3A 4DN3H 1QR4A 3IBEA 4F37F 4KV5F 1CGUA 2HT4D 4TNVK 2EH8H 3OJDB 1XSIA 2CJTA 5GZND 1U6AH 4HULB 4Z7OF 2O61A 3ZHKA 2JCCE 3O4LA 3NN8B 3FNKA 3K6FA 3VXUD 4OSUH 4LF3A 1F90H 1YN6A 4DK6A 4YEEA 2X6UA 4U3SA 4QWWD 1IQDB 4PGZA 2E6PA 1E4XH 2ENQA 1BXVA 1F1AA 1MHEB 5LCVA 3TBWA 1G4RA 3ARXA 2X05A 1H8LA 1E5AA 1DLHA 2EKJA 2GYSA 2EDEA 5EF1A 3QEGL 5D7JA 3NIGB 2ZUYA 1J8HA 3N85L 1AC6A 2QKSA 5BCAA 5FHBH 1I85A 3DDGA 4D9QD 1KBPA 5D2NA 4Z76A 1W91A 4QCIB 1HH9B 2X9YA 3P2DA 1YPZA 4GAJH 1HZKA 5CR1A 1YQVL 4NEHB 1E28B 2GBTA 3NA4A 2FL5A 3PNWA 5FM5M 4N8PA 3EYQD 4RGNC 4EI5D 1PZSA 4A66A 1ADQL 1R5WB 1GYCA 3VI4B 4JM2F 5J9PB 2NY0D 1A7PH 5EZIH 3L3JA 5E8OA 4TSAL 2OCJA 4YDKL 3IPEA 1D7DA 2DLGA 1E27B 4LNRA 4NKOA 3UZEA 5LNEA 3OMNB 4KMQA 4EN3C 1U91A 2BVEA 4GLRH 4O2EB 5CD5C 3IDMB 3ARTA 5JHLH 1EO8L 1JPSH 5SWQB 2Z92A 1DVUA 5EZJA 4ZW5A 4WFFE 4X9HA 5DJCA 3RJDA 3QCVH 5ELIA 3MRRB 3BX7C 3VXNA 3GTNA 4N0CC 3QUGA 1X5LA 4Y4FD 1BIIB 2G5BA 2FLMA 2Z7WA 3UPRB 2RQEA 2X0UA 5H94A 2ATAA 4JY4B 1KBBA 1DVTA 4F7TB 4HHGA 4P4KC 3MV9E 3NCWA 4PMFA 4HU8A 2MTAA 4S2SA 2PPFA 3ABGA 1ZTMA 4DEUA 4KKCD 3QQ9C 3I50L 1JDCA 4I0PC 1EEZA 1KNOA 1KTDB 4YX2L 2KPNA 4XBEH 3TN0B 4QRRD 2K8QA 3UBXA 4J3OG 4ONHA 1E42A 2NXZC 4OZIA 4HUXA 5FKPA 1U4EA 2BNRD 3L54A 3QDMA 1B2WL 4QYOB 2W59A 1JIBA 1JGIA 4Q9QL 4BXVA 4NDMB 2XICA 3BI9X 4JFTA 4GG6F 4EMZA 2ZAIA 4IK6A 3NPSB 4G5AA 1PQZB 1U30A 4X6CA 4BSVA 3MRNB 3MNMA 4A7UA 5D2LF 3Q7JA 5CILH 2WXMA 3IU3A 5JIQA 1C5CL 2J2ZA 2HJLB 3U46B 2QQNL 3RVXC 1A3ZA 1OKEA 3UAJC 3D0VB 3HE6B 4JZNB 4WY7H 4JHWL 1SMOA 3DIFB 2RA1A 5DRWA 3HE7B 4I0CC 2EDRA 3K46A 1JFQH 2AQRA 1B90A 5E4IA 1ZLVK 4ZFOA 5E08L 3DO7B 1F42A 1TJIH 5CP3H 1TDQA 2F8OA 4NNPH 3CH8A 5EDXA 2VLKD 3RGVC 1RL1A 2VXSH 3BAYA 3FPYA 4KVNL 2X2YA 3AU1B 4OZHE 4OCLC 3L13A 3KYOB 2CO1A 2HRPL 1P4BL 2R9HD 3D2UB 3M17A 3OG6B 3QZPA 4I2XE 1LE9B 5SX5K 2Z65C 5JQ6H 5EZOL 3RUGA 1UWYA 2YO3A 3BQUB 3C75A 1EBAA 2ADGB 1KIPB 2Y5QA 5ECJE 5GISL 3S98A 2VO8A 3H2QA 3QUHA 4KXZI 4LCYA 2CRYA 2O5XL 3FSWA 3MODL 1G1KA 3UTQB 1PSKH 4OCWH 1I1YA 1OZUA 3OSKA 4NFBA 3M1BA 3VGFA 2JI1A 2XWBA 3H7BB 2HXAA 4E9YA 4P4KA 3UOAB 5MEND 1CDBA 1EANA 4JY5L 4PRIB 4GUQA 5BJTB 4AGQA 4HUUA 1AZCA 4ZUSA 4I0PA 2XZQL 3TWCH 2Q20A 1YJDH 5AUMB 2WQRA 1KPRB 4HCRA 5JIIA 2EEXA 2B5IB 2V8LA 5D9SB 4LSPL 1URZA 4X9IA 3VFSB 4ZMVA 5I74B 3INOA 4HWBL 4PJ5B 4B9ZA 2ZUXA 3MUY1 1ETZB 1QSFE 4JZJB 3KLAB 2FUTA 4UI2A 3P3RA 4HK3J 1P7HL 2W95A 3CLFH 4ZO8A 3C8KA 5DQJA 5LBSH 3F84A 3VWKC 1M9SA 2IOOA 1RPUA 3UAJA 4KUCF 4GQRA 4M7JL 1IGFL 4DVRL 1A2YB 1LM8V 5C70A 2AV1A 2BHFA 4U3XA 2HJKA 3QCTL 1FZJA 5AENA 4OQ1A 1EFXA 4XP6L 3OAZH 4XPAH 5D93B 3SIKA 1RIUH 1OGSA 5MP6H 4DP6X 3ARFD 3CFKB 4RMBA 2VDPH 5FGCB 5GGVY 4BWWA 2JKJA 4DKEL 3RGVA 4I18C 5C0CB 3EYSL 2IH3B 2IGFL 6FABL 3QWQB 2VZSA 5C8JA 1L0YA 2PTTB 3QUKA 4HQQH 2XIBA 1TSRA 3MV9A 5FOBB 1KN4L 2WB1A 3EGDA 3MLXL 4YHZH 5JNYB 1KENL 1NFIB 2VITB 5I18H 1OV8A 2HFTA 4FQ2L 1PZCA 3RX8A 4GG8B 3K8LA 4Y1AD 4U49A 2LAGB 2WNGA 4E2OA 5E4EB 2N4IA 3TA4D 4H25B 3GXUB 1FL3A 4JR9L 4MAYC 3OM3B 3FUKA 3VWJC 4ETQB 2EVFA 1GZQA 2CHXA 2J6EH 3HNVL 5FGRA 5INDB 4DP8X 3TJPA 1E65A 2DPKA 1GW6A 4QRUB 3WNLA 2WP3O 3TA3D 1XIWC 1Z9SA 1B0WA 4MJ5B 3GBML 3QXAB 3GEWB 4TUOB 1L5GB 5IJVA 4UTAL 3DX7A 1U3NA 1E2VA 1HXYB 2ESVE 5L2KB 1XGPA 1KN2L 3O0RH 1F0LA 4Q4IA 2Z35B 4LHUG 1NDGB 4PS4H 3CVIH 3IJ7A 1AXTH 5DFVD 2N7BA 5LQBL 2J25A 4LLQB 3ZL2A 5KBLA 4RNRB 4QGYA 4ZXBC 1HT6A 5GRVL 3N0AA 4PJDE 3FKUS 4X8CA 3VG0H 4UOJA 5FDYA 1UWXH 4IRSC 3QNZA 2WQAA 4BA8A 4ZZFA 4I2XA 3VWKA 1KLGB 5B1JC 1ZGLB 1FIEA 2EACA 1WYJA 1X9RA 1S7VA 2CDGB 3TEXA 1DE4B 1M05B 1MELA 1W0WA 2GIYA 1UXSB 5EIIA 3H85A 1WJ3A 3KBFA 1EGJA 3EBAA 4AGPA 3PNRB 5T1MB 1O7VA 2NXYB 1Y18A 2IWGA 3GDCA 3NSCA 1A3RH 1M7DB 2EXSA 3LH2L 1AD9B 4PRBA 4FLRA 4YLCA 1F1DA 4I18A 3RDTB 1BWWA 1J1PL 4HGWA 3JV6A 2R69H 1TENA 3Q2CA 4JO4H 5IM7B 4AQEB 1OTSD 4U6TA 1MIEH 1T66D 2AEWA 4KXBA 5K9JH 5D7JB 3L7FB 2FWOA 1AKPA 2D0GA 4XO4A 3WFHA 3ESOA 1BHGA 4MKTA 1DQTA 3DK2A 3QC5X 3ZMEA 3TVMC 1RAMA 3HUJE 4MAYA 4U1HB 5ABZA 3VWJA 1AAJA 2FL5B 1V3JA 1MFUA 4HCFA 2DBLH 5ESVA 4OGYH 1KELL 3DGDA 5MERB 2AAAA 2GJZA 1MCBA 3FRPB 2P45B 2LFEA 1XIWA 1KGUA 1S9YA 3UCRA 5F7NC 3ZKSD 4G8IB 4LNRB 2X4QA 1I8LC 1C7TA 5DLMH 4CAGA 3OPZH 4DO5A 5F97E 4HUMB 3ZR5A 2XTSA 4NWTH 3ETBJ 3O6ML 3WUWG 5BPPA 5KSBF 3Q1EA 3C60C 5JXED 5DJCB 4WRLA 3BESR 2X3AA 2VXVH 1MFCL 1OARL 3SYAA 3U9WA 4AV4A 2BSSA 4G8AC 2F0CA 4FKHA 4MZRA 7PAZA 1QNZL 3JWNG 2EP6A 2PWDA 1GZHC 4HKJB 2G5BB 4PW9A 2YEZB 4ZXBA 5JIDA 3OMAB 1A22B 3O41A 2DQGH 3LD8C 4H26A 4HXAH 1VCAA 4OR1A 4FYRA 4Y4HC 4IRSA 3ARWA 1ETB1 5B1JA 4HC1L 2WKOF 4PJXE 2PP8A 4LOEA 1BF8A 2FLRT 4S2SB 4Q6IC 4K8RH 5IFJB 4JPVH 3EDJA 3FOMB 3H54A 3BKYL 2ICWB 3TZVB 3O3DB 1IM9D 5D5ME 3L17A 2NRDA 3TTSA 3QO0B 2B3RA 3WO4C 4N90E 1SDYA 2CD0A 1MHPL 4FTVA 5FKPB 4OVUA 1BOGA 4Z0BL 2O5NA 4LRIC 4M1GH 3T3PE 3X1BA 2ZWYA 5DO2C 3P4OB 2KT6A 4JO3L 4BSVB 5BUAA 5DMKB 2CO4A 4DZBB 3SYCA 2VL4A 3RVVC 4WFEE 4GS7C 1UT1A 3C08L 3UJJH 2E27H 3ATBA 2DOCA 3A0OA 5E5MA 3QXVA 1T6VN 3N85H 5C0AD 2BERA 1FZKB 2XCMC 5DVOA 2UX7A 3EYOB 1FLTX 3F7YA 3BWSA 4KJQC 3VGDA 5JHLA 4LCIL 1NC2B 1DBBH 1AD0B 3TVMA 5BS0A 4ZFOB 2Q76A 1OIOA 3P9LA 2OSLB 3LIUA 4M7ZB 2GB2A 5D7KE 3GK8H 2Y9RT 4X5LA 3TO2A 5CHNB 5AZEH 1KWGA 5DJYA 4H20L 1MRCL 1FIGH 2B4CL 3GRBA 2E7HA 4WO4D 4FZEL 3E1ZA 4L1HA 1X5IA 2J88H 2R1WA 1ED3B 1LD9A 3G5YA 2XN9A 1I8LA 4Y9EA 3EFOB 5I8OL 4PJ6A 4IRZL 5EU6D 2WXRA 3TBCA 1UTDA 4ACPA 3M17B 1G9HA 4MHHG 4NS0A 4PBXA 4KJWC 1DUZB 3EJZC 3HG4A 3MCKA 5LN8A 1AP2B 4YHIA 3ZU8A 3FO2B 2WQWA 1PY9A 1T4KA 3PWNB 3C60A 4AEEA 2YD8A 3HS9A 5KJRL 1YJDC 1NCTA 3OJVC 4MJ6B 2YEQA 2DLFL 1UZ8A 4PN6A 1GZHA 2JCCB 3IDUA 1AY1L 1QRNE 3P1VA 4IMKC 1EO7A 1WAAF 2NZ9D 4H5SA 1I1YB 3UDWC 4Y4HA 4M61A 3WFEL 3FSOA 2W0LA 1WPCA 3M1BB 3U79A 4D8OA 2XWBB 1U8QB 1KTJA 1SYVA 4P4KB 2ENJA 2GAZB 3MLWL 3EOTL 2VDMB 4MXWH 4Q6IA 1SJHA 2Z1PA 3O3BA 3RLSA 3CZJA 3RVTC 5IJBC 3KXFD 4J2QA 4F7MA 3QDJE 1VCBC 4MQSB 1Z9NA 3ZHNA 4XHJD 4I3SL 2UX6A 3AG3B 3TASA 4JO8A 1ROCA 4ES8A 3BEWB 3MAWA 2HN7A 1IC5H 3D69A 1FVEA 4UM8B 4XBGA 5AAPA 4Z78A 3W0WE 4LRIA 3T0ED 5TDPA 3CFCL 3H1ZA 4L1DA 3HZVA 5CP3A 5D71H 3R0NA 3BKCH 2X70B 5C07E 1E5YA 3WELA 1DN0B 2OMUA 3Q1SL 5C3LD 3MJ8B 1OGTB 4OCNC 5LXVA 3D3VA 3KPPB 2OP4H 4AQZA 1A7QL 2AK1H 2K4AA 3BZ4B 2EE0A 3EGSB 1E6JL 3S36X 3RNQA 5C9JA 1IEBA 2EVJA 3B1TA 3B37A 5CLTA 3ERXA 3V52H 2WUCH 4FX5A 4Z7AA 2F7PA 2K78A 1FUNA 4PRHD 3MJ6A 3W81A 4F5CA 5JOEA 4JAMA 3FQYA 4N3TA 2XC8A 3ARDD 3TV8A 3F00A 2ZUTA 3ZO9A 4D3CL 2ZSVA 4G1EA 2V2TB 5B3NA 3UBFA 1KCRL 4OLUH 1I1AC 3AUWB 4ONGL 2K6YA 1UATA 5C8JB 1SYSA 1BZ7B 1ETJA 3FO0L 1BQHG 3MV9B 2ZUUA 3O45A 4KKQA 5D7SH 1NCWH 2G2RA 3EGDB 3KCWA 3M6DA 2CGRH 4A2LA 1PG7X 5AB2A 1JK9A 3QRGL 2O5YL 3E1F1 3MNVB 5BUPA 4MD5A 3VQLA 5D1XD 2VDNH 2P43B 3KYKL 1NC4D 3TEZA 5HHQB 4QXTB 1BZ9A 4KXAA 3MKGA 2WUBL 5H37H 4IMKA 3CN2A 4MLSA 3UDWA 2WYTA 4K9JA 4LLVA 4YUEL 1ZGLM 3DROA 3FO9A 3C5SA 3WXWH 5CJ8A 5HYJD 3MLYL 3X2QB 1TFPA 4JY5H 5CFHA 2I85A 5I73C 1IC4L 3UROR 3EJUA 4I85A 1NGZA 4GSRA 2E46A 2OL3H 4MKMA 5J5EA 4C56A 5LBSA 4XMZA 2XZQH 2D0HA 1IM3A 1UM6L 2H0EA 3ASOB 3C09C 3MREB 1L6PA 1HIMH 1OAUL 4P3WA 4KZDH 2C1OA 4JG0L 3BWAA 2QQLH 4JJOA 4KDTC 3DJZA 2F5AL 4ZDHB 3F58H 5GJSL 1XGPB 3H9HB 1CDGA 1CR9L 4MYWB 1OM9A 3CZLA 3K5RA 3MRDA 3SGKA 5FA4A 2J1KA 3QG6A 4M00A 1JYWA 3N9GL 2UXTA 1UC6A 2VL5A 2ID5A 5DC0A 5HHMD 1N7ML 2XXGA 4G8EA 1WBZA 4ZX3A 5EU4A 2IPUK 5IZ7A 1CUOA 4OZHB 4KK9D 1OP5K 3LZFH 3QNZB 3VXMD 5B22A 2P52A 4I2XB 4DIXA 3BZ5A 5I71C 4XAKE 4JRXE 1LILA 4GAFB 3MRIB 1P6AB 3L1EA 3Q9QA 2JB5L 1S7VB 3BW9A 2DQTH 3QCTH 3AY4C 4OIAA 3HBGA 3SDCC 2D73A 4KMTL 2E7LC 1JPEA 5EIIB 2BZ7A 4N2CA 1ZEAH 4MRCA 3BHBB 4JFPA 5KVGL 3US0A 4Q7DA 3O3AA 3D8MA 3W57A 3PABA 1Y18B 3DJSA 3UTZA 1CFTB 1QRNA 3ATEA 3EYSH 4RVBA 1NMBL 4DGYH 2J6EA 4HGWB 1KN4H 1XGYL 4XPGL 5CSGA 4HPOL 3WIHL 2X7LB 1QLRA 3B2UC 1R3LA 4KVCL 3FB8A 3CDFA 4YXHL 4Z3IA 1G5GA 4FQ2H 2GUYA 4HXBL 5C0JA 1DR9A 2OA9A 4RISL 4MJHA 4Y9CA 3CSYB 3BGFC 3PJSB 4CU8A 4AQOA 4AJWA 1N4XL 3L3KA 4MLIA 4KQ0A 5IB2B 4TUJA 3B8SA 4HALA 2AXFB 1HDMB 2FWOB 3DPBA 3HBQA 5ENWA 2HPTA 3WFDL 3CK0H 3SGDI 5IVXA 3WFHB 1CCZA 4MASA 4WSGA 2QFPA 3T0EE 1A5FL 2XVBA 3HNVH 4IBUA 4FXGC 4PJFF 5J3HC 1J5OL 1JCKA 4F8PA 5ESVB 2VR7A 4TQEH 1DVQA 1MFAH 1QPPA 1QSFB 1RZPA 5EG6C 1U3YA 2NY1D 4DCQA 3AITA 4HSCX 4I9XA 1FHNA 2MCAA 1S9YB 1AGBA 1A64A 4FQIH 3B6SA 2WWOA 1U33A 2G9HA 4FERA 5GJTL 2CH8A 4X80L 1HYSC 5DS2A 2EIMB 4HD9A 1NMCB 4LHJB 4FABL 4KDTA 1SEBB 4K8RC 1L7IH 1EJ6A 2F2HA 1U8CA 4G7YH 1SUHA 5JO5A 1XSJA 4HUVA 3LKRB 3KJ4B 3L4VA 3EZJB 4XBPB 2DTML 3KL0A 2CKBL 3VD2A 3KH4A 1I7TA 3WIIH 2W8CA 1IJNA 4YAQA 1S7XA 2DQCL 1D7FA 3KPTA 3O41B 3E80A 1OT2A 5GGTL 4H26B 3SBRA 4AYEC 1SF5A 1XSKA 2V3DA 3ES6A 4PJAE 2O30A 3ESMA 2R69A 4MNQD 2M2DA 2A1WH 1HESA 4DO4A 3BSZL 2R1XA 5DTFA 1JVOA 1FBIH 1UKQA 4O02L 2AHIA 3AY4A 2IWFA 2EUXA 2YD1A 2E7LA 1GIGH 2LU5A 3QPXL 4K3HA 3IFLL 1NCDH 3KYMA 4I9WD 4YWGH 4IKNA 2Q6WB 3DX9B 3ZMNA 1QZ1A 5IG7A 1PEZA 1QFWM 3KCPB 2H26A 1MCKA 3Q3GA 1DJXA 1RJYA 3L3HA 1CFQA 3ZPDA 4IBWA 1FH5H 1A6ZB 2WZPA 1DFBL 2H1LM 3OKKA 5FYJU 2MSPA 1UEMA 3FN0L 1BMZA 2BIOA 4HZ1A 3DBXB 1Z7JA 1YVLA 2YRBA 4G59C 4JO2H 3L2MA 3IJSB 3EGXA 4OKVB 1MCJA 1ODAA 1DEEA 4IRJD 5TFSL 3KPRD 5L88L 2ESVB 1G5AA 2E9BA 2FNWA 3RJOA 3VI3E 4NXSA 2CIKA 5IW1B 3TVMB 4DK3A 5BS0B 1Z9MA 2Q76B 1U8NA 3HFMH 4FXGA 4XB3A 5EO1A 3TO2B 1RD6A 3W11D 5IGXH 1QNIA 5DJYB 2YA0A 1EHXA 4DPRA 4PJDB 4A04A 5BW7C 4LGRB 4BFGA 3SYPA 2Q8BL 2R1WB 1KZQA 1LD9B 5CEZH 2YPLE 4JRXA 2DDQH 1N19A 4HOWA 2KZBA 1F6FB 2FD6L 2PNDA 5KYXA 3C6SA 1FZMA 3N6YA 5SWZD 2EE3A 2JWYA 1KFAL 1BD2E 3QUXC 1PZ5A 1KXHA 1OK8A 1CFMA 4AW4A 3MRLB 1RZIB 4Y16D 2EIEA 3DXAA 2HFGL 2O6CA 2WTPA 4PV9A 3S5YA 2C9RA 4POZC 4Y4HB 3PCYA 4JDZA 5ALBH 1Z3GL 2BNQE 3HB3D 1SYVB 2X1PA 1BX2A 1N0LB 1VFOA 3CFEA 2IH1B 4NPYB 4PGCA 3CZFA 4Q6IB 3V0IA 2WTRA 3VA2C 4G43B 4FQXC 5D6DC 1NAKL 1CTNA 2AF2A 2CNYA 1TITA 4K23L 4EF3A 1I9IL 3ZQXA 2DJ4A 2O6DA 3WO4B 1U0QA 4YHML 2CGYA 1S7WA 4KFMA 2KDYA 2HRGA 2VR3A 4FNPA 1W9XA 3OLDA 2HN7B 3VXQB 1YYMH 3D69B 5FV1L 3HUJB 3T8VA 4Z1PA 1K6QH 2UVFA 3REWA 1EZVY 1HWWA 1HI6B 1QWUA 3IN2A 1E0OB 1D9KD 1ZE3H 3T6WA 4FYQA 4HJ0D 2ATKA 4ZAKB 2OMUB 2IMNA 1JE6A 3C08H 1JNNL 1TVBB 1E6OH 2CHNA 3PDOA 2YA1A 3V0AC 3F04A 4IDJH 4LDOB 1FO0B 3K4ZA 3CBKB 1H6EA 4JY6A 2LLGA 1CXHA 4KUCD 1DJGA 5C9JB 1IEBB 5CJOL 5E9DE 1AZVA 3T0DA 4XGZB 4AIEA 1I9JL 4G80A 3FT9A 1KC5H 3W5MA 1L9OA 2H3NB 3D85D 2BFVH 5EBLA 1BXUA 2YQ3A 3ZDZE 2DEWX 3SCMD 1F6LL 1OQXA 2VW6A 1MRCH 3DURA 5TQ0L 4AOFA 2V5MA 4WEBH 2IAND 3D39D 1LWJA 3PL6C 5BW7A 2BINA 2WZ5A 3RU8H 1M57B 1SYSB 2RMNA 3GRWH 4NT6A 1TVHB 3TF7C 1JGLH 4PV8A 2G2RB 4PJXB 1H3UA 1NOFA 1M7XA 5HY9A 4K0OA 2FGWH 2ZCKH 3KLHD 3HVNA 4WDIA 5D5MB 2AEQL 3VFWB 3WJLA 4AL8L 1OPOA 3C5XA 2JXMB 5DWUL 5HJDA 3PWLB 4FLSA 2VMCA 2BOLA 2CK0L 3QUXA 4OKDA 4G8GD 4W9ZA 2GCYB 2PO6A 5J13C 5KN5B 1ROWA 2V2WB 3V0GA 4M5TA 4GAAA 4JB9H 4PJ9C 5GGQH 4R90L 4TQ8A 5IW6A 4YHPB 2ZF9A 2WYIA 3T3PB 3U4BH 5DK2A 4N8VG 3DYOA 4NHUA 3KJ6H 2Y1AA 3DMMC 3EOTH 4IIQB 4UM9A 5DJ2A 4MBRA 2PR4L 2QT6A 3GIZH 4MMXB 4KRPC 4BFKA 1NEZB 3F7VA 4FQXA 2R15A 4LFHG 4IM8A 3UZQA 2DQIL 5AW3B 1OK0A 1IM3B 1G6VK 1FI8C 3INUH 2C1OB 4H8WH 1S5IL 4KZ0A 3OAYH 4PP2B 1B4JL 1JI1A 5FO9A 2Y69B 5LAXA 1P4UA 4YDLC 2P5WE 3LRSA 2DWDB 3CHXA 1V54B 1A9EA 1NGWB 3CFCH 3QG6B 2D4FA 4A2EA 1GYUA 3U9PH 3T1WA 4WHTA 2IXQB 3IU4L 4W4NA 3VXSE 5DMJB 1N59B 1KEGL 5CEXA 2DYPA 5E1AA 3EZ8A 4G8EB 1NUDA 3ALWA 3P0YL 1WH0A 5DYOB 2YPLA 4AG4L 5DD6A 2BSCA 4Z7WA 2NY3B 1A65A 3PWUA 3TNNA 3QH3B 3TONA 1KCSL 3MLZH 2HKFL 1E8XA 4FEMA 4GYBA 4JRWA 3O3UN 1CGSL 1P7QA 3VJ6A 3MFFA 2F1AA 3NCBB 4NZUH 1BG9A 4RAVB 4EO5A 3OKMA 4RETB 3BW9B 5BOJA 3M7FB 1UCTA 1R19A 4HS8L 4YC2B 1R75A 4U1NA 3FBKA 5GS2D 3DSNA 3O3AB 3QUYD 4D3CH 2ZICA 2P5EE 5T3ZH 2ARWA 2AGJH 2F53A 3PABB 1UWGL 3IDGB 1KCRH 1R1CA 3PUCA 1QRNB 5H37A 4YSQA 5HD8C 4EKJA 3PL6A 4FMFA 5FYJD 1JPGB 3TCTA 4DEPB 5HSFA 2BNQA 2BWIA 1RULH 2DQHH 2DQEH 4LP4A 4QGTA 4R4ND 5IHWA 3QJFB 1LE5B 1M7IA 2BC4B 1TR7A 2WWKO 5ESAA 3DX2A 3LS5L 2NSMA 1OSPL 1KGCE 3O2DH 2OL3A 5C0JB 5J11B 4PB0H 3QDJB 3APDA 4TULL