4EAEA

The crystal structure of a functionally unknown protein from listeria monocytogenes egd-e
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
187
structure length
184
Chain Sequence
b'EAFSFSPSGFKVSTVESILGGDVTTTYLSSSKSFQKDFEALTLFINQYKVEHVINPTKEVSASNPESYLANKNGYVITLDISIKNNSKKDKMYKADQISLLGASKSVGGSLDNFIPSGFHLIGSSSDPYNFTAGKTARGLLTFTMDEATYNDLAKDSQIGVPDPSRFDSSGSSQDNVVAPFPIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lmo1068 protein
publication title The crystal structure of a functionally unknown protein from Listeria monocytogenes EGD-e
rcsb
source organism Listeria monocytogenes
molecule tags Structural genomics, unknown function
total genus 48
structure length 184
sequence length 187
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-03-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.4170 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4eaeA00
4EAEA
chains in the Genus database with same CATH superfamily
3PXHA 1EIBA 2QJDA 1LNUA 4U6YB 5D7JA 3RILA 4P9HC 1GZHA 3TBTB 1KTLA 1T7XA 4OLEA 3QNZA 3KH4A 3GMNB 1NM4A 1SOXA 2F1BA 4J3SA 5DZJA 3EO1B 3N43F 5D1ZD 1ID2A 4YHIB 5JW4R 1R3LB 3V0VA 5I6XB 1CR9H 3TCLB 4TVPE 4XP1L 4ZW3A 3K6NA 1W72L 4HCRA 4M61A 4IMKC 1FYTE 4BKSC 4F7CB 1S8DA 2NX5D 2UZXB 3KWVA 4M3HA 4MJ5B 4F91B 2B1AL 4PJ7A 5FYJU 3IXTA 4ZUUA 5DS8A 4C4KT 1CDYA 1P1ZA 3QI9B 4D9QD 3K8LA 1K4DA 3WKPA 3ARRA 5F72S 1F4WL 1KCRL 3MRRA 3TCXA 1DEEA 1FG2B 4TKWA 5HI4C 1L5GB 1DJXA 3NJMA 5ADOL 3QWNA 2GIYA 1SXZA 4O51B 3AM8A 2DQJL 1KJMB 5ILTH 2G60L 4NENA 4I0CC 3ELQA 1GSKA 4G6MH 3VFPB 1J86A 1SM3H 2E7LA 1YUHA 4TNVK 1TEFA 2J88L 5DHDA 4EQ2A 1NCAL 3TBWA 4N20A 2BSDA 2X1PA 4Z7QB 2W60B 4U1KB 4RA0C 3ULUE 1G7JB 4OCSH 3MBWB 5BW7C 5CCJA 2ZSVB 4IRJB 2KERA 4Q52A 3V6OA 2WXKA 3SOBL 4AGLA 4IKNA 1I7TB 2ZKMX 5E2TL 1ZAGA 3TTSA 1DFBH 4WY7L 4BRJA 4KKCD 2VXQH 4DGYH 3CPLA 3QQ9C 2AJVH 5FA3B 1UM4L 3OKDA 4D94A 3K4DA 2X6VA 2C3WA 1KIRB 5JMOC 3GSQA 1VF5C 4EN3D 1U8LB 4X4YB 2Q7YB 5ISZB 1H3VA 1FP5A 4HU2A 5I1HH 4DJMA 3ULVD 1HXMB 1HJBC 3ZE0B 1W91A 4C83B 3WIFA 2A74A 3HEIB 4GLRH 1K8IA 3VFSB 5C7XH 3P9LA 2ZOLA 2BP0A 4K3JH 4L5FH 4LF3A 4HJTA 5FM8A 1NBZB 3QS3A 5L9DL 2P8PB 4GRLC 3FOLA 1NCIA 1UJTA 1E5ZA 2KZ1B 3HG4A 2Y6SD 3VU2A 1VZGA 1BECA 2IXQA 4PLJD 3VD3A 2XY2A 5J6SA 4YQXH 2X9WA 4R3SB 1QR4A 1QHPA 3P30H 4P9ML 3FQYA 4FA7B 3NFPA 2KUTA 4PJIA 5F7NC 3VI4B 4W9FC 1V3MA 3SKNA 4YHPA 3KPSE 3AWGA 5AB2A 2OL3L 5D7LB 3MV9D 1I9JH 4I48A 4KZCA 3H3BC 2R69H 1AR1D 2ZWNA 3ZIYA 1Y1UA 3K91A 5B3JF 3C60C 4PJCA 1EXHA 4J3VA 1GZPA 1S7QB 1ZPLA 5C0IA 3CZKA 3OKNA 1QNIA 2FWOA 4LPVA 4WW2A 1HHJB 1XF3B 3BDXA 5BQDA 3UYRL 1T22A 5J13C 2RAMA 1L9QA 3V5HA 1NA8A 4GG6F 4Z95L 1ZHLB 3A47A 1DBMH 2WSPA 4GXUM 2CBPA 2BPBA 3GFUA 3DJRA 1GZHC 3CFQA 2ZWSA 3KXFA 5F6HI 4HIXL 5FEBA 1TU2B 4R84A 2F8OA 2C3XA 2IPUG 1S7SA 5EWIH 1ZS2A 4P3CH 2BVUA 4JO4H 5I8EB 4D7PA 3WTSA 3AJ7A 3QEUA 2WQVA 3KPNB 5K9JL 2ZCLL 5I1LA 1YNTB 3DX6A 4TPRL 1BHGA 4JFYA 4MNQD 4RESB 4Z7NB 5FGBA 1E8XA 2R9HD 4JO1H 3P2TA 4GMSH 1A4KB 1CI5A 3FS9A 1AKJA 3WS6C 1QSZA 4N24A 3RJDA 5BRZB 2R23B 5KYNA 5CIPA 2YAQA 3H8NA 3SBWC 2L0DA 5EBMB 4FE9A 3ZL4L 2E8ZA 3OLIA 1F4AA 3RLSA 4AW4A 1BBDH 3DLQR 1U0QA 1TTCA 2IJ0C 4JCLA 2OYMA 5FYLD 1MUJB 5B1BB 3TH3T 1FFOA 2ZCZA 4P5TB 1YMHA 2YMOA 3MLZH 2HG0A 5IBTL 1UOKA 5FPIA 1OT1A 2XA8L 5I2IA 3ARFB 4OFDA 2H3NA 4FYTA 1IGFL 5IFJA 1QATA 3LD8B 1S7UB 3VGAB 1PKQE 2CLRA 4G8FA 5JOEA 1BIIA 4BXSV 1IX2A 3DX7A 3MJ9A 3FB6B 4YLQT 5BMFH 4XE0A 1KPRB 3GMOB 4O02H 3WNOA 4PB0H 5CILH 5EIVA 4JY6A 4XP4H 5SV3A 3D4CA 4BXVA 5AD0A 5JHDD 4ATTA 2GTQA 1R19A 1L7IL 1WFTA 4PJEF 5CP7A 4CVZB 5D7JD 3WHXA 1SGKA 3NSJA 4Z3IA 1FVCA 3O4LE 1BD2B 4O5LH 4EI6B 2JXMA 5TJWK 3AXLB 1D5ZB 1ZHBB 2VLLB 1JN6B 2A83B 2YEZA 4B9CA 3QGVA 3RGVC 1I1YA 5ELIA 3K46A 4MXWH 3BUTA 4KHTH 5CS7A 3VGGA 4NZRL 1MFBL 3D9AL 4KQ3L 4BWWA 2BCMA 3MU3A 1P5VA 1A3ZA 3DRQB 3WEXB 4NRYA 1HWHB 2P80A 1SN2A 4GAAA 3RUGA 2FJGA 4L8BA 4XOAA 2MCG1 5JHLH 1IBHA 5E6SB 1B0RA 2GBVA 3S8WA 3OGCB 4LPXA 4K8RH 3KJ4C 1A6VH 1KJ2L 2N59A 3KJ6L 3QXTA 5CBEA 5H4ZA 4RAVA 3U1PA 3HS0A 1A6ZB 3P9WB 4Z9KB 4BE6A 2SEBB 2Y36H 4NCDA 3VVVA 3QULA 4MNGA 2VXUL 3TCTA 1F4HA 4OFIA 4CU8A 3SQOL 4YXLH 1C8QA 1EJ6A 4IJ3B 3E2HC 1BQUA 3ECBB 3NJHA 3QDMB 1RZQA 5LNEA 1P4LB 3U36A 3RGVB 4JFDB 5F8RC 1UVQB 1NEZG 1K6QH 2IWEA 3BDYL 3MLVL 1IKNA 4AI7A 4R4FL 1BG9A 3D39A 3F00A 4JEGB 2V9RA 2KS0A 2Q86A 4OLVH 5F3FA 3RPIA 3V4VB 4DN4L 3FFDA 4M6ML 4PWFA 4F7EA 4MDJB 4JN2A 2VM9A 1L7TL 2VR9A 1MAMH 5DT1H 2EDHA 4MJIE 4UTAL 5KVFH 3X14A 1KLUA 1SLXA 3DURB 2YPLA 5BQ7A 5GGUA 4TOYH 4QXTB 2R2CA 3GLEA 4DNLA 4NQDA 1S3RA 4GLRI 4TM9A 3G6AB 4PGJA 4YBHA 1PX3A 3MLUL 2MRYA 3BXNA 1NMBL 2PW2A 3MBEC 2J56A 2F7IA 4LVOC 4DIXA 3VCLA 1ZVNA 4LOEA 5C9KA 3FQ1A 3EHBD 4BH8B 2J55A 1NINA 5F89A 3ARDD 1YY8A 3VXNB 1EHNA 4PG9B 4JG0L 2V33A 1E43A 2QEJA 2H1LM 4PRAA 5TDNB 3RNQB 3UZVA 4BSWB 3VXMA 2E6QA 4Y89A 2QKSA 4DKEH 1Z0NA 2NX5E 3BUDA 5GGRA 3KD4A 5DVKA 3TH2T 4FCAA 3RJOA 2BCKB 4D9QE 3O11B 4P5MA 1QVOB 1J0HA 2B1OA 1X44A 2DKSA 1OSPH 1YJDC 3OX8B 4B9PA 2J7LA 4FP8L 1N8OE 3MVSA 4HS8H 3NSFA 1FVEA 1AFVL 3ML8A 2PYEB 3LOWA 1UH2A 3KW8A 1D5MB 3LH8A 4OZHA 1G87A 2OTWB 1XGQB 1E4WL 4JZJB 3IJ9A 1CYWA 4Y19B 1IGCL 2W0KA 3O6FB 4GB9A 3C8KB 4OVVA 3RZWA 1CFTB 4OY9A 4HJUA 3QEGL 2YIHA 4PP1C 1FNSL 3ALPA 4X7FC 3KPOB 1TZGL 2HX9A 3RWFB 1GHFL 4DKTA 3C87A 4PJDE 2CKBL 2YD0A 1ZKAA 3O9WD 1KGUA 3KXFD 1DLHB 1JZ8A 4P3WA 2K6YA 5I6OA 2YFNA 3DGGA 1WS8A 3T3PE 1H8LA 2WVVA 2QADC 1KGCE 3BWSA 3CDGA 1QEWA 5HHME 5ITBH 2FEJA 5KBLA 3DV6B 3L5HA 3QQ4B 3B6SA 1BFTA 3IFOA 1AKJD 4FLHA 4ADIA 4KZEH 3S3PA 3UL4A 4WTQA 3ZDXB 4S0TD 3KPLB 1BQKA 1TZHB 5DHYB 4I7ZC 5TE6L 3AS1A 3UIZA 5B3SB 5IWLC 2AHIA 2VO8A 2C7UB 2JNZA 5I1CH 1SQMA 4N2OA 5MERA 5FDWB 2Y06H 4BRVA 4AUYA 1CQYA 1V8HA 4MD0B 3VFGH 5IB3A 3NJLA 2FK9A 1F45A 4RAHA 4GKNB 4ZO6A 3LDBC 2UXGA 2X70A 2F68X 2BJMH 4PYHA 3NCJH 4MWFB 4D0CA 3SD5A 2AGJH 2AV1B 4ODUA 3QIUB 4KO9A 5KJRH 5TDPA 3ZO9A 1IKNC 4RZKA 1NIFA 3QCUH 5B4MC 5BXFB 3W3BA 3QE5A 3APDA 5TTRA 3SPVA 4Z0BL 2K1MA 4AMWA 4QJ5B 8CGTA 1J5HA 5E23A 2CLZA 2EYTB 1JZHA 3UTTA 2XOTA 3JUZA 3WKNA 2DJMA 2YJQA 1GGBL 2W9DL 3Q9PA 4N25A 3SOTA 4Z76B 2OI9C 5SWZE 2QQLL 3TJPA 1OAXH 1N3NA 3T0EE 1MFDH 2VAAA 3DJSA 5D7IF 2WSDA 2EXYC 4Y2OA 1A47A 2Z35B 5B38B 3WKYA 4X8CA 2P80D 3T5WA 3FDWA 2XETA 4TRPL 4A7TA 4APQD 2QKIA 3KPMB 1L0QA 3V7AG 5JDSA 5JIIA 1M6UA 1DLFH 4JR9H 4ACTA 4DZ8B 2ZX5A 4FFZL 5DVOA 3UCQA 2NY0D 2CZNA 1CFQB 1BA9A 4WUUB 5CCKL 4G7SB 1S3KH 4LSRL 3ME0A 1NLDH 5GS2H 3SGKA 4UQIM 4KUZH 4N2GA 1Y0LB 1IL1B 4QRRB 2ISDA 5L88H 1C1EH 5HDLA 3E38A 2ITCB 4Q58C 3J07A 5ABZA 5KYWA 3FTUA 2FL5A 1UB6B 1PG7L 2AQ1A 3LKNA 1A1OB 1NMAL 3UG3A 1QA9B 2CA4A 2JJVA 4Y1SA 3DBXB 4P57A 3M45A 4WO4D 3UP6A 3G9AB 1ZHNB 4HSQA 2FYVA 5HYJE 2UY6A 5ICXB 4OR1A 5DFWH 3AG1B 4MQSB 2Z93B 3P0YH 5K9OB 4G6FB 4PGEB 2DICA 1YNKL 3CZUB 3BKMH 1X4ZA 5EU6E 2OBGA 3OAYK 5IREA 4WTZG 4F58H 2A1WL 2I9LA 2HJKA 2YPLD 4G5AA 5IB2B 2CHNA 1WS7A 1HWGB 1I1AA 2BVQB 1MWAH 2ZUXA 2WY3B 3DDGA 5T5NG 4KKZA 2EKSA 1WWAX 2ESVA 4DH2A 4RQQB 1IVLA 3IMBA 1PW3A 3QQDB 4KO5A 3GWJA 5LB1A 1MI5A 1JPTL 3D4GA 3H2WA 4LP5A 5E7BA 2HKAA 5C09E 1QEXA 2WK2A 1IGIH 4Z3TA 1LO3L 2VUYA 2NSXA 3RY4A 4JDVB 1WBZB 3L3JA 4JFFB 5C0BE 4BKTC 2Q10A 1MEXH 5L2KE 3TFKD 3VXMD 4NUQA 1INDL 1UUNA 3QUMH 4JHUA 4RRPG 3DYOA 3UX9B 1YEGH 3FRPA 1SMOA 3QH3A 4UAHA 2E7DA 3U1SL 3QAZB 1XD1A 4K4KA 2NW2B 2FHCA 2PWHA 1T83C 2FNWA 3DO7B 4HAFA 3PLYA 5DQDL 4UTCA 1HNGA 5GS0D 2YAMA 4N2BA 4X8JB 1MNNA 1OPGH 4H8WH 3VWJC 4MX7B 3GLZA 3JTSB 3KLHD 1UXSB 1X9QA 3BD3A 3OR6A 4K7FB 2NY2D 5A2AA 4MJ2A 4B60A 2QVFB 2O30A 4C59B 2EC9T 5TQ2H 4AEFA 1KGXA 3NIFF 3V4LA 1OSEA 2YPKB 2IH8A 1T4KA 2UXVA 1KYOK 2J8UF 5E6IC 2WLLB 4U49A 2CBTA 2MNJB 2A6KA 2D3LA 5IQLA 2C1OB 4UM8A 3MGTB 3WMPA 1IRAY 1XCWA 5B3JE 5DEFA 3Q43A 1XIWB 2LV4A 3GSXA 2QV4A 2RCSH 5ILTL 3RDTB 3FK3A 3I6GA 4DESA 1I7UA 2ZAGA 4ZMPA 4G6ML 1SM3L 4L4JA 1K8DB 3WJMA 1EUUA 1NDMB 1MJUH 3K2UH 5J12C 1ROWA 2VDNH 4N0UE 4N1EA 5DXWA 3VWKB 3FU0A 4CDGC 4Y9FA 2WHVA 5D2LF 2JCCA 3G04B 5M7QA 4X80L 1RP8A 1E3ZA 3TBVB 1CL7H 5BOZG 2CHWA 3OKOB 4E9VA 4P5KB 4LLVB 1DFBL 2AEPH 5GZNC 4DETA 5CEZH 4DGYL 3UTSD 1OL0A 3Q44A 4A68A 1IEHA 4IJTA 2AJVL 1KV3A 1TEGA 1U3YA 1AI1H 4HAKA 4OGAD 3VH8G 3WN5C 4PLOB 4NKOA 5JPNB 3B8SA 3BP6B 1SYSB 2UWEA 5DTFB 1OGAB 5I1HL 3UTTD 4JO8A 2VN4A 1LO0H 3BAKA 2VR5A 1OCZB 4AKQA 4BFKA 4K3JL 3NCCB 4Z77B 4YR6A 4HUXB 2EYRB 4O9HH 3AG2B 4V2CB 5FOBA 5F0JB 1CXHA 3GXFA 4P2QB 3ZRFC 5BV7C 5CEXA 5KZCD 2P42B 1NICA 1EEQA 4XHJC 4PWKA 1YYLH 3J8F7 3GMLB 5FLUA 3A0OA 3X1GA 4YQXL 3D33A 1JAEA 4JRLA 1SY6A 3HE6B 2J12B 1PY9A 1MG2C 2O6CA 3EO0B 3P30L 4Y5YB 2A6IB 4PJEE 3RTQB 5JORA 4HMDA 4X83A 1ZVSA 3QHFL 4NI6A 3VD4A 4PJAA 3V0IA 3BWAA 1I9JL 4X4KA 1JNHB 5E51A 4Y5VB 1H8SA 5L4JA 2R69L 4GFXA 1JK8B 2I24N 2X41A 2ZD0A 4PRPD 4GRMB 5D7EA 3U0TA 2BP5M 4S1DD 3JWDC 2A77H 2GBAA 5EZJA 3LIZL 1DBML 2QVTA 4ORZC 4K2UH 2EDMA 3UEZA 3OJDA 4XNXH 1Y7VA 1Q9LB 4OIBA 4QGTA 4NBXB 3IAQA 4P3CL 4Y16B 4IBWA 4JO4L 1VZHA 5DHVB 3RWEA 2EH8L 3T0AA 3DTDA 3NCYS 5ITFB 4C56E 3HIZA 3AABA 1HFUA 4YK4B 3T6VA 4IGBC 4WNJA 4B96A 4JO1L 4C47A 1ILUA 2YRZA 2XWZA 1G5GA 3FB5A 3CCHB 4GMSL 5E95B 5AEAA 3ZTJH 1NGXA 3AQXA 3FQXB 3QIBB 1I1AD 3FSWA 1XDTT 4U0RC 1JYXA 1BV8A 3DIVA 4IKIA 2CGRH 1ACCA 1OK8A 2ESVD 4G8IA 2LT9A 4HULB 2EVHA 2JK5B 3KLKA 1NCOA 1KLGA 1A1MA 2DMCA 1MI5D 2D73A 1HL8A 2P24A 3AQYA 4YSCA 3TF7C 5B21A 3U4EA 2C5DC 1BCIA 4JRXA 5A3IC 5FF6A 3MLZL 2IC2A 3D30A 1DVQA 1P4IH 2ADIA 3RWDA 5LQBH 1T3FB 1TTUA 3ZYJA 3PQYA 5D1XA 3CH1A 4TLUA 2CLVB 4ADGA 5GXBB 4E42B 3GKWH 2J4WH 2ZXDA 4HKZA 4HPHA 1W0WB 5BMFL 3PWJB 2EC9U 4O02L 4PRIA 5CILL 2LFGA 4FC3E 1KB5B 2X3BA 4XP4L 2DD8H 2JKSA 4LASH 4DZBA 2YXMA 3GIVB 3HB3C 3LX9A 1UJ3A 1JPGB 5IW3A 1SXNA 4O5LL 4UU9B 3U46A 1NDGA 3L3HA 3RKDD 3E80A 2YRBA 3FUEA 2DQFB 1A4BA 4KTGA 4ZSOA 4MXWL 4YHLL 4KHTL 2CBMA 1Q72H 1FLTX 1KEGH 4DPRA 1J0IA 1KUMA 4Y1AB 4X5XA 4F20A 2CH8A 4XMXA 5JHLL 5BJTA 4LLAA 3SQBB 2NW3A 2BS9A 1ZOXA 1XGRA 5EDXA 3HUJA 4HIEA 2WLMA 3LH2L 1WC7A 4ERSL 4K8RL 5AVXB 3DSNA 1A6VL 2LU5A 1IC4L 1WLHA 1THAA 2NY4D 4ESKA 1DVFA 4JREC 4BK5A 4FQXA 4M7KL 4OLWH 1ZV5A 5J3HD 3MLXH 2KKQA 2GC4C 2Y36L 5IMLA 2MOQA 1VSCA 4YXLL 1T21B 4DOHB 3ASWA 4XPFL 2EUVA 4XNZC 4U6XB 1KB9J 4WHDA 3QO0A 1IT9H 1K72A 4XE5B 1U2CA 4OGZA 4U0QB 4W81A 1AXSA 3GJFA 2ZUVA 3SDDC 3QUXD 1ZT1B 1RU9L 4JPQA 4Z3HA 1BBJA 1F3DJ 2CJTA 1O7DC 4OLVL 1A6WH 1QR1B 1WUZA 3OWEA 1UC6A 4X2UA 1BZ8A 3L9RA 5IMMA 2AJ3A 4ZUVB 3T1WA 2DQHH 2AQQA 3U4AA 4HXBH 3C12A 5E4EB 3GRGA 5LBSA 1AS8A 1MAJA 3T2QA 5GRYA 3C2AH 3CN3A 2WXNA 4NLAA 2C9VA 4PCYA 4UNTA 1CU4H 2F53A 5TDOA 4L4TE 4AEHL 3H3KA 3TA3D 4A38A 1DVZA 3TPUA 3BP7A 4M4RA 2P5EA 3BGFB 4L29B 2R56H 1KIPB 1A6UH 3PJSA 3I85A 2VR4A 3T4AC 1NDTA 3I02A 2OP4H 5A1AA 1YMMA 1F3RB 2HJFB 3FTXA 5E0FA 4DEUA 4WDIA 1OCWH 4DKEL 2B5IC 1I9RH 1M3JA 3CXDH 3IJ8A 3BH8A 4JM2A 3F5WA 3KBFA 5H35A 2ZCHL 2UVFA 2CM5A 5HI5C 2YPVA 2VDRL 4YBQD 1NFDF 1MHEA 4OCRH 2V17H 1SF5A 1AH1A 1OSPL 2VJXA 3BVXA 1HX0A 5B3NA 4HS8L 4ZFGH 4KAQH 2VOTA 3VGHA 2AERT 1WSST 4XMTA 1IGYB 4L8SB 1R1CA 1I8IA 2DQCH 2MKWA 4ZMTA 3FT4B 2EYSB 2A4CA 2FR4B 5K9KA 5D7IE 3HC0B 4G70B 1GY2A 3Q6FB 3W82A 1JUFA 1I4FA 3N9GH 3TBCA 4W6YB 5ESAA 3ORJA 1I3RB 2HH0H 4F2FA 1PDKB 5AG9A 4KI5E 5KN5A 1KEMH 1P84J 1UJ3C 2AW2A 2PWGA 4JFTA 2ZWZA 4JPIB 5DK3A 4AUUA 4JE4B 2CDGA 3IVKB 1MRDH 2VXTH 4KGJA 5D1QD 1NJ9A 1PZCA 3UTSE 1SFHA 4KVNH 2OJ1A 5ITBL 3S35X 4POZC 4FRWA 4OZ4B 4B5ZA 1I85A 1S78D 4UT6H 5L2JA 4BZYA 1N5AB 5C3TA 2VT0A 1ZA6A 5MEPB 1SXSA 2J72A 1KJ3L 4WFED 2I25N 3I75A 4HX1B 2VDLH 1SVBA 5I1CL 1IBFA 4BK5C 1JGEB 1F00I 2NY3C 2Y06L 3PDOA 2JJTA 3SPGA 4HPOH 3VFGL 5A40E 1C16A 3REWB 2UUDK 4WKZB 2WV3A 3IT8D 4AMKH 4DKFL 4JRXD 1T1YA 1ZV9A 2DL9A 2BJML 2G4EA 3NCJL 4G82A 2YZ1A 4ZW8A 4WQOA 3CFDB 4OUUB 4R4BB 2XYBA 2NY6C 5D1XD 3DUUB 2AGJL 5AENA 5IFAH 1H3TA 3K4AA 4MFHA 1NH6A 3QCUL 1LHZA 3BVNB 2KQNA 4DP6X 3HFFA 5EU3B 2NNXA 2WKOA 1L9MA 2JTYA 3ZKXC 4PRPE 3GSNA 4M43L 3X2QB 4NQED 4TS6A 2NY5H 5KSUA 3T0BA 4Z8FH 3FTGB 2NY3B 1MFDL 4RFEA 5ID1B 2GFBA 4KRPB 2PO6D 3RVVD 3KLSA 2TAAA 3U2SA 1M05B 5BVJB 1PFCA 3RVTC 3DNKA 1JE6A 5IMOB 3T8XB 1D9KC 3IAGC 3AMKA 4EEEA 1MELA 1DSWA 3LNHA 3UTZB 1DQVA 4HPYH 1T0NA 4KQ0A 1EPFA 5FUOH 3MV7E 4QY8A 4BCXA 1FL5A 4L0ZA 2DQUH 2QBWA 5I74B 4H26B 15C8H 1XF4B 2CUIA 2FB4L 4YSRA 4JR9L 4P9HH 3K6SA 3WTVA 1DVFD 1VHPA 4FQXD 1QSFE 2QVKA 4XCNB 2I5YH 3P4LA 1S3KL 3DVGB 4JM2C 4HJ1A 1NLDL 2BH0A 4IHOB 3Q8AA 4JFUA 4K94C 3MRQA 1QHQA 4KUZL 4RMBA 1ZIAA 4AEIH 3NIFE 5L88L 3ULVH 1C1EL 2A6DB 4HP5A 5F3BA 2X40A 4JN1H 2JJWA 5AZ2H 1A02N 3QUYD 2WKOF 4HKJB 2EVGA 3HE7A 2IVFC 4X6BB 5KSVB 3PGDB 2PP9A 1XSKA 3OXRA 3QG7H 1M53A 1F3DH 2EUXA 4PJ5A 2VDQH 1H9DA 3UAAA 2ZUSA 4NC1E 1ONQB 1ZWIA 4QRQB 4IIQC 4G8GB 3IM1A 1W6LA 4MB1A 2VRAA 4AL8C 3PRZA 2K3TA 1Q8MA 2WINA 4R26H 3BKML 2BO0A 3PWVB 1WZLA 1MCCA 2UY7B 1YEHL 1UXLA 1YPZA 4F58L 3ECVA 1UXWB 1K5WA 3JV6B 2CO2A 3KPQA 3MUZ1 4KX8A 4P2RE 1HSAB 2AQPA 3WFEH 3RWJB 1MWAL 2HP4A 3QPQC 4JDZB 4N86A 5D2LE 5G55A 3EYVB 1MNUH 1OSYA 1VADA 4LZKA 1SBSH 2X6UA 1NEUA 2F53D 2FX9H 4XN1A 1JNNH 2EDEA 1J1XH 1UH4A 5DD0H 3WNJA 2W9EH 4ZFOB 1IGIL 1GGCL 4HH9A 1QSEB 4MA7H 1VACA 3LPWA 3RP1A 3S3DB 3VFMA 2AS5M 5HJ3B 1MEXL 1YMMD 1WWCA 2ODIA 3ZN6A 3QUML 5EIIG 1Q38A 4N2LA 4Q9RH 5M95B 3MLSH 4I3GA 1YEGL 1AO7D 5SWSE 4ADJA 4HMCA 4AVJA 4X6DF 3LRHA 3ECUA 2XN9B 3V8OA 3EO1A 4PBWD 4YDZA 4J8RB 4MXQC 4YHIA 1XZWA 5AAPA 3TCLA 4HWBA 4WFHD 1CLYH 1V3LA 2VZUA 2F5AH 5DMGD 2ICWA 4F7CA 4LVHC 4H8WL 4XVJH 1OAQH 5I66B 4Z7VF 2P52A 4C58B 3LB6D 3UC0H 4U1JB 1O5DT 2WOYA 3HZYB 1I82A 5TQ2L 1UWEH 1HYRC 1L5GA 2ICES 2YOAA 5AVUB 2DDQH 1GCFA 3SD2A 2WCSA 1MIMH 2D8KA 4HJSA 4O51A 4FGMA 1EZVX 2F54E 3HBGA 5FYLH 3CG8A 3ZUCA 1KJMA 1TQWA 1G4MA 3DOSA 1MSPA 1NSNH 3H6AA 3VFPA 3AB0C 2BIIA 2G3ZA 4YXHL 2FTAA 5IBUG 5JOFA 2ZXBA 4U1KA 2J6EH 4KRMB 5CSZA 1FSKB 3N42B 4YSDA 3BZEB 2ZSVA 2R1XB 4IRJA 2RBLA 2RCSL 3IGLA 1T6VN 2NXYC 3WIAA 2VIRA 2H47C 5FCUH 4QKTA 1MJUL 4JRYD 5HHXL 3UC2A 3TJHC 1EO8H 1J9RA 4M6NL 1MFAH 4M9PA 2VE6B 3QDAA 3TU6A 1CLVA 1JGVH 1GGUA 1MH5A 2AXWA 5AYQA 1KIRA 3FCGA 1CL7L 3CQFA 1F0LA 1JTOA 4X4YA 3P4OA 5IJKC 2Q7YA 2NYYC 2DI9A 2PW1B 2OMTB 2WZ0A 4HCRH 4HDIB 4N2FA 5ISZA 1TQBC 1WISA 2AEPL 1GMIA 3JT0A 4K07A 5CEZL 3QIWA 2X2IA 3CVIH 2GHWB 4E5XG 1NBZA 2ENJA 2WBJA 2P8PA 3MZTA 1T0MB 1AI1L 1HDMB 4HS6B 2EDJA 4QRBA 3UBHA 4MLSA 1OHQA 5AVYB 3D69B 4A7VA 5DD1H 5DFVD 4ABUA 1D5XA 3IDGB 4R97C 4BD4A 4HJ0D 1LO0L 1S6NA 4Z7QF 4NZFA 2ZUYA 2AXFB 2Z6FA 4O9HL 5JNYB 4I9XA 4AUJA 2VMCA 3DXAE 4LU5H 3F62A 5HJGA 3AY2A 2VWEC 5FUCC 4B3EA 3TEYA 3QB7C 1PY0A 4PJFF 1MDAA 3SYPA 4HGWA 1UT9A 2ADJB 1S4IA 1Z6JT 2E9WA 2NPLX 2IANE 1YYLL 3IDYC 5D7LA 2P44B 4KXZH 1H5BB 5KSBF 4PI2A 2N0KA 3CFMA 5DZLA 3MRGA 1S7QA 4V2BA 1TNMA 1XF3A 2WQSA 1AD0A 4F92B 3NJXA 1ZHLA 4RMQA 2VDKB 4JFVA 4PJ8A 5HI3C 4OZIF 4NN5B 4F37K 7TAAA 3BUIA 3L1OL 4BQ6A 1XGYH 3FQRB 3HAEG 5EBWB 3FPYA 4M7ZB 2VTFA 2XKNB 5I8CA 1QFUH 4NO0B 2PCYA 5I8EA 1JOIA 4YE4H 3KNBB 3KPNA 4P4RB 5EUOA 4M3JA 3N3EA 1YNTA 1PX8A 3HE7D 3NJFA 3QUZA 3O2VH 3BZFA 4K2UL 4NUMA 5DFAA 4XNXL 4PJ5D 4AYEC 1IC5L 1A4KA 3EBGA 2A0LC 5GS3A 2LTQC 3FTSA 1TCRA 2R23A 5BRZA 3D2TA 4LLQB 1CYGA 1KBGH 3VI4F 5BZDB 5D7SH 2EVIA 5AOMA 3S96A 4XX1E 3AITA 3BKYL 1T5WB 3DUSB 4NN6C 2VZ3A 3FT9A 4HWUA 4X6CF 4EI5B 1AXTH 1JNLH 2FBRA 3FFOA 1YO4A 1AZRA 1CIDA 2VLKE 3GZPA 3BUYB 1MUJA 4HV8B 3GUTB 4AIXA 4P5TA 3NPSC 5I73B 3UJIH 5E9DA 5DJXB 4YDJA 2CGRL 2FEEL 3TN0B 4ZO9A 3ARFA 3T2OA 5L4FA 4FQ2L 2HKHH 2NY1C 5ACZB 2XTJC 2YK1H 5EHFA 5TE7H 5D7KD 1F90L 4JVPA 5G4OA 4AGNA 1PZAA 2HRGA 4JL1A 3EH5B 4DGVH 5IV2B 2EH7L 1AQHA 1KPRA 2AJXH 4Q0XH 1HI6B 2XQYG 4IBTA 4R2GD 1G1CA 3EF7A 1K4CB 1P4IL 5LQBL 1WO2A 1GVIA 5DJZB 5F1NA 1WD9A 4BKLA 3GKWL 5D9SB 4X9BA 1BD2A 4EDWL 4EI6A 2WPGA 2KT6A 3IDMB 4Y2LA 1B2WH 1D5ZA 1ZHBA 1JN6A 1CF1A 4YH6A 3VG9B 1RY7B 5AL0A 2Q2LA 3VXSB 3GEFA 2GSIB 4LASL 5C07E 1GIGH 4OGXH 3QC5X 3H4HA 3ARWA 4YHNB 3DRQA 2WIMA 3O0RH 3QIWC 5EMYA 1QFWH 3S34H 2WBJC 1KMGA 2NY1B 2XNAB 4XP6H 4BINA 5CIPH 1QUPA 3T1FA 3NBNA 4XTRC 3QI9D 1T7YA 1Q72L 3MC0A 4H25A 1KEGL 4V33A 1A6ZA 3FO9B 3WIHA 1MN4A 3DI2B 2SEBA 1NBYB 3F3HA 5I16A 2ZG2A 1OE2A 1M71A 3SDXB 3DMMB 2YKLH 2YAPA 3HNVH 4YDKH 3ZYIA 1SF3A 2J25A 3UBXA 3ZR5A 1VFMA 3ECBA 3QDMA 4HIIB 3LN5A 2OMBA 4OLWL 4WKXA 4JFDA 3EO9H 4G9FB 4JANA 3MJ9H 3L3KA 1NM9A 4IRJD 3VM7A 3NJKA 2BIOA 5DVMA 2FX8L 3V4VA 2FWSA 1G94A 1J5DA 2E6PA 4PJXF 5EB9A 4C4BA 5ICYA 3PE9A 5JQ6H 5IKCB 1HQRB 1T5KA 5DUMH 3VFUA 2ZYHA 3QEQE 4PJ8C 4EN2A 2EO1A 1IT9L 3G6JE 4CSPA 2EE6A 4PD4K 5LG1A 4D9RD 4X98B 1CYXA 2FJHB 3G6AA 4YAQA 4EAEA 3DX4A 1VCAA 1G5AA 3IPBA 2XWRA 5ISZD 4L4VB 5EF3A 2G5UA 5FB8A 3QUZC 3WS3B 1F97A 1EEZA 1QBMH 4HXBL 4PEEA 4HWZB 4HOMA 3VXNA 3C2AL 3F05A 4NOFA 4XWOD 2ZTBA 5TDNA 1C12B 4GP8B 4HG4J 5E8OB 4EIBA 1CU4L 3ZT5A 4F8QA 4ZJ9A 1WGVA 3CHRA 3KYOB 4J6RH 4XAKE 3FT2A 4CSZA 2UZYB 2BCKA 2AK4A 2VC2B 3WGVB 3O11A 1QVOA 4LLDA 2C9QA 4RMSA 5DO2C 1JPSH 1NTDA 3S5YA 2V37A 4KXZI 2Z8VC 5E8EB 3OX8A 4AQAB 4Z7UB 2ZXGA 5D8JH 4Q74A 2XXCB 4NZDA 1BREA 5AW3B 1A1NB 1I9RL 5D7LD 3CXDL 2PYEA 2Y22A 4J28A 4PWIA 1D5MA 4Y19A 2H0JA 4JZJA 1SEBB 3B9KB 2XN1A 3C8KA 1CFTA 4U7SA 1MVFA 3X1FA 1JV5B 2RHEA 1PD1A 2PCPB 3NTCH 4OCRL 1EZSA 2WKLA 4FD0A 4OB5H 1WIUA 3L5WA 4ZFGL 4KAQL 3CSPA 5I1EH 4JKPH 1QRNB 3S7GA 1L0XA 1DLHA 2X9XA 2GJZA 1RK1A 4FHBD 5MP6H 2EUZA 4M56A 2Q5BA 3HG1E 3N9GL 3CVHB 3T6XA 3VXTB 3ZKNC 4YUEL 1O9VA 5EV7A 1DVUA 2LVEA 3MV8A 1KEML 3T2PA 3DV6A 1EHLH 1ANUA 3LEYH 1A7RH 1U8HB 1K3IA 5C6PB 1GYVA 4FZEH 4OF7A 3N1FC 4JO2H 3KWWB 3P0GB 5BRZD 3H9SA 5DJYB 5G2NA 1TZHA 4Y9GA 4MHHI 2KZKA 3AUVA 2C7UA 1BAGA 5FDWA 3O8XC 2BFGA 2E7BA 3VD2A 2AQRA 1J8SA 2IDCA 3PP4H 3NPZB 1LDSA 3TEZA 4JY4A 2ADGB 4PJ9B 4R4ND 4KQ4H 4P5TD 2X88A 3N91A 2LGNA 3IRPX 5GS0H 2EXWC 4FXKC 3WLWC 2EDDA 4MWFA 2VDLL 4U7KA 1VGKB 1MY7A 2FATH 4G72B 3V7MA 3ARFD 4NZJA 2C8NA 3B3IB 2XZCH 2AV1A 3GBDA 3QIUA 5I30H 3WI9A 2EIZB 3RWCA 3KM1A 5I75B 1FNGB 5BXFA 1G6RA 2Y3NA 4B9KC 4K5NA 1MG3C 3WDIA 1XAUA 3C6LC 4NWTH 4R90L 4N2CA 3A4EA 4DQOH 5C0FA 3K6FA 4BJLA 5IFAL 5EFIA 4PJBB 1BD2D 4BBWA 5DD5H 2XPGB 3FFCB 2B4CH 5HHPB 1PYWB 1SRDA 1QFWI 1FGNH 3ZDYF 3ZDXF 4UQ3B 3U9UA 5B38A 3AT0A 3OJMB 4H88H 2V2WB 2NY5L 4Z8FL 3U83A 3EOBB 3DK0A 5T1LB 1A7QH 1NOLA 3MJ8A 5HGBB 3ULSB 3KPMA 1LO5B 3WEOA 4DZ8A 5BOJA 1AZCA 4PRHA 4BSVA 1SOSA 1ZLUH 4X6DE 2JLPA 4HUWA 1CFQA 4WUUA 2MOGA 1JMXA 4P8QA 4HPYL 5C0CD 1Y0LA 1IL1A 1B6UA 4QRRA 2DQUL 3L3DB 4QRPA 4ORGB 15C8L 2ITCA 1JCKA 3FUDA 5EG6C 3QR1A 5GGRY 3QDMD 4P9HL 4Z7VE 1S7TB 1YCSA 2H3KA 1UB6A 5IQ9B 2RALA 1A1OA 2J5LC 3RGVD 4AK1A 1QA9A 2ZPKL 2F7QA 3PS6A 4JFDD 4G83A 2FLBT 1OP5H 1ADWA 1O9ZA 3ZMRA 3HR6A 3ZQWA 3FC8A 4ODHH 3UJTH 4AEIL 3M1CA 5ICXA 1CDGA 4TQIA 1E8ZA 4JN1L 3ABMB 5AZ2L 1ED3A 3IMSA 3ELAT 4EMZA 1DJWA 3QG7L 2DTMH 4X6FA 1FIGL 2OS7A 1KIQB 4WI2A 1KXQE 4ODXB 3FUMA 1KCKA 4OJFH 3RYMA 5IB2A 1I3GH 1YEEH 3CAFA 1ZT7A 3EGSB 4JO5A 1F2QA 3P2BA 4O58H 4RQQA 4UWQB 4F27A 4F2MB 4OCNC 3QQDA 5I0ZA 1AGEB 4JPVH 4R26L 5LHDA 4PM1A 4TVSa 4M7LH 3U25A 1AP2A 3B7UX 2JB6B 4E0RA 2Y7NA 2BP3A 2HLAB 3EJJX 3MACL 4PWGA 4JFFA 1E5CA 2VN7A 4WLCA 2BW5A 1BVNP 4GY4A 4LHUG 2IQ9L 2FX9L 4KI1A 1BZ7B 2CJ3A 4OU3A 1E8YA 1JNNL 2EILB 1J1XL 2XN0A 3C5JB 1H15B 1AYOA 1HXKA 1JF5A 5DD0L 1N2RB 2ARWA 3ASNB 1T89A 4EZJA 4X4MA 3WNPA 4N85A 4MA7L 4X9GA 5CD5D 1TVHB 4LNRB 4QWWC 2OM5A 4LLUB 3W9EA 2ZKXA 3LQZB 2HPTA 3STLA 1HH6B 4JHWH 5IBUB 4DTGH 2PYED 4Q9RL 5DJ2A 3ZTDC 2D7QA 2OXHB 3MLSL 1OLLA 4MX7A 1PAMA 4Y19D 5KVEL 5E5MA 2WXPA 3O6FD 3FSZA 3U0WH 1S5IH 1U2HA 4GIPD 4Z7QE 5AKRA 3PFUA 1IC1A 1OAZH 4Y4FA 1FYTB 1A25A 4HW6A 1CLYL 3OZ9H 2OXGA 3QSKB 1EAPB 4AENB 2YPKA 1A7OH 2EE9A 5J57B 3AACA 5EOCJ 5CJBA 2XXMB 4PJFE 4BFEA 1IBDA 3QXUA 3UC0L 4BUGA 5BV7H 1CT8B 2C1OA 5IHZB 4QR7A 3ESOA 4ZG1A 3I9IA 2R83A 5KSBE 3WAKA 4GAGH 1UWEL 2ITDB 1U8CB 5DRWB 2DDQL 1XIWA 4LEXH 1MIML 1ADQA 2AJUL 5AW2B 2X4TB 3PAYA 1NSNL 1L3NA 4OQTA 4HZLA 4OZIE 2D03H 1K8DA 3HKZA 2P3YA 3P3RA 4NZTH 2HTKC 3NCYP 2G3NA 2G30A 2J6EL 3VWKA 4I88A 4QXWA 3GUFA 3JQOB 3HLAA 3P02A 5EU5A 2CJUL 3G04A 4I1RA 3VQ1C 1NCJA 2OCJA 1EAJA 5CSBA 3TBVA 3Q6GH 4PW9A 4WI5A 1HSBB 5T33H 3OKOA 3M8OH 4N0FB 4P5KA 5FCUL 5L6YH 4LLVA 3PV7A 1N10A 2AABH 3CZJA 1CVRA 2C3HA 1EO8L 3K5RA 1MFAL 2KPWA 4MVBC 2E9GA 4L2LA 3SDCB 3QIUD 2DJ4A 2DEYX 2FYYA 5GQBA 1FNEB 5F44A 4BQ8A 4FG6D 2XV3A 3MNZB 4X6CE 3RVWC 5JPNA 5KVEE 3BP6A 3QEHA 4YE0A 1OGAA 3EAKA 4HCRL 3HBZA 4FYQA 3ZXAC 1FORH 3BCDA 2VDOB 1LD9B 5DWUL 5D71L 1RZGA 3CVIL 5DK0B 3R8QA 4Z77A 2AKRB 4U6TA 3EUDA 4RAUB 1WDAA 3HAEB 4OF0A 5AW9B 4AC2A 4P2QA 2GYSA 3CDZA 3QZPA 3UTQB 3BSHA 4QRUB 2BM3A 1TO5A 1X9RA 2WN3A 3DYPA 3Q2WA 1BEYH 5BRQA 3MRDB 3GMLA 3OC8A 4XNMB 2H4EA 3HE6A 2XPZA 3P4MB 1L0PA 2K9UA 1PG7W 2QPSA 3GPEA 3L7FB 4XMKH 3OWRA 3EO0A 4Y5YA 5FYKH 5LXVA 1D5IH 2A6IA 3ULAB 3RTQA 1PG7X 4LU5L 4GIOA 4MAYB 4AZUA 4JKMA 2CHZA 1NBQA 1AGCB 4LCUB 4KK6C 3QZWG 5FW8A 1JNHA 3P3YA 4Y5VA 5HPOA 1JK8A 4WUUD 4GRMA 4AM0Q 1FN4B 3L3OC 2PN5A 3JZYA 2OYPA 1KCSL 1R5VB 1T89C 2JIXB 3H6JA 3I9AA 3L08A 4N3TA 3RVUC 3CZSA 3NIDF 5GRVL 3BX7C 5EZLB 4QRRD 1T04B 2DKUA 1DUYB 2J1XA 2DQMA 2GSGA 2X4QB 4P06A 5H4YA 1TSRA 5GSRA 3OMZA 1XGYL 3TASA 2BOCB 1Q9LA 5I15H 3AU0A 4Y2DC 1QFUL 1JWMB 5GGVY 4LSUL 2A4ZA 3IBOA 5DHVA 2E9BA 2KZBA 3HN3A 4HIPA 4I4WA 4DK6A 4ATWA 4YE4L 2B3RA 1ZE3H 4LT7A 4Y4FC 1DUZB 2B1HH 3C9NB 2ZP8A 2YBGA 3RZCC 1XMWA 2ZOKA 4G6FD 3RE0A 4QRAA 6FABL 2KMWA 1MVYA 3O6KH 4J3OC 4M1GH 4GKZB 4LIQE 3CCHA 4WFFD 2NT0A 3FQXA 3QIBA 3HI6H 4U1SB 1TXKA 3NCBB 3L5XL 5D7SL 3QRLA 3GM8A 5IB5B 1HILA 4U1LB 3II1A 3RG1C 1SY6H 3X1EA 3CBKB 3UTOA 1AXTL 1JNLL 3EYSL 4PJXE 2VJ0A 4L23A 1KBPA 4IS6B 1UQSB 2OZ4A 5CM1A 4NC2B 2FLRT 4RBPH 4WFGD 4JFFD 2VM4A 1PKQB 1UZGA 1T3FA 2OL3B 3KDMA 1I8AA 1UWGH 2CLVA 2YK1L 5TE7L 5CKGA 4CN6A 4E42A 1N5YH 2AC0A 4UNUA 3VUAA 2EIDA 1MLBB 2D0GA 1W0WA 4XVTH 5T1MB 4Q0XL 1UZ6F 2BVOA 1KY7A 1KB5A 3NZHH 4RIRB 4N0RA 2IWGA 4NNXA 4X99B 1YEDB 1MJ7H 3GIVA 3MLTB 1XB6A 1I8MB 3O4LB 4N6RA 4MJJA 2EDOA 3RJQB 2XXGA 1S7WB 1FVDB 5I24A 1JPGA 5C0CE 3S5LB 4OJYA 4N90D 4UU9A 4MJ4A 1L6XA 1NLBL 1B2WL 3WTWA 2Z92A 3V0GA 4OW6A 3MA9H 3A22A 5E2WH 4ZQKB 3IXAA 4Y1AA 5AB1A 4OGXL 5EOCH 3VRIA 2YFOA 5CJ8A 3TV3H 5EEUA 1YEIH 3CFCL 3O0RL 3QYMA 1KLFB 5EUKA 3GSRB 4U1GB 3S34L 5T1KB 3GGWB 3SQBA 3RGHA 3R0NA 1IE5A 4XP6L 1INQA 1RMFH 3GDCA 3MBXL 4GEJA 2Z31B 3QAQA 1AHKA 2V8MA 4XR8C 4LVEA 4XO8A 4NEHB 4ZMOA 4CC4A 1MF2H 5IESH 4PRBB 2HRPH 2W95A 1XIWD 3FCTA 1WEJH 4MNHB 5BZZA 2C4FT 4LGRB 1MRCH 4ZD3H 3RDTD 1KG0B 2DQTH 2YKLL 3HNVL 1T21A 3CVBA 1S7RB 3LEXA 1JZJA 1OT2A 2ATPA 4U6XA 4KK8C 2NNAB 4KROB 1M7IB 3DVIA 4UCFA 2HFFB 2FBJH 1MCWW 3VWKD 2UZIL 4FNSA 2XT1B 1MHCB 4PUBH 3MFFB 3NDZE 1C9SA 1XGZA 2E4TA 3FU3A 1JP5A 3TIEB 1DQQB 4ZX6A 3NQKA 4N87A 2I69A 4OF5A 4PJCE 3AZUA 4Z7WA 1RJYB 3KHQA 2K7QA 3S6CA 4AITA 1D2PA 4MJIB 5DUML 2GBTA 3RB7A 2XZZA 1BQSA 4P46B 4I18C 4ZUVA 1G7IB 3EGDB 1XSJA 3SGDH 4W9CC 5C2BH 2ZKWA 4WEEA 1PAZA 3V52L 4BQBA 5AAWA 4HC1A 4XPGH 3DARA 4XNYL 4N2MA 2WLYA 2WXMA 2IFFH 3NSDA 4LBEB 4YDLB 4J5VA 3DX8B 4OAWB 5FYJH 2IGLA 3MRJB 3NSXA 4WJG3 5DHEA 1P5UC 3RL2B 1OGAD 2CUAA 3B3BA 4KKBC 1QBML 1KIPA 4ZMVA 1MIEH 3GO1H 4UB0H 4B50A 4KZDH 3WMSA 3P9MB 1EQWA 2VNCA 3S8FB 4P2QD 5EEYA 1CF8H 2HJFA 3IMUA 3SDAC 2UYLB 3WCYA 3NK4A 1KJ2B 4KK5C 3UACA 2WBWB 4X4ZA 4WZ9A 2FX7H 3UDWC 4J6RL 2NZ9C 3IDNB 4HCGA 1EA9C 2OMYB 5GGQH 3HHSB 4Q2ZB 3ESNA 5DQJA 2ZG3A 1WHPA 5I5RA 1CFNB 1FE8L 3HE6D 4RFNC 4MXVE 1BX2A 2IAAC 4Z7AA 4YL4A 4LESA 1KTJA 1N4XH 3RTQD 3BQUB 3V4UH 2X4RB 1L9OA 5D8JL 1WA0X 5INCA 1DHKA 1JK9B 4L8SA 4AYBA 1P7KB 1GS6X 2HX7A 3TWCH 3GJFH 1OV8A 3NRFA 4PTUB 2EYSA 3KG5A 2FR4A 1KCUH 2NYZA 3HC0A 1F6LL 3ZDYE 3ZDXE 3K72B 4H2AA 5FIEA 3ZHKA 5EOTB 3FRUB 1M4KA 4GKSB 4PLKC 4KVPA 4PJDB 1NCBH 2KL6A 1WBXB 2K6ZA 1OO2A 2PPFA 4JKPL 5LBSH 1NBVH 5B1KA 1JDCA 1AYRA 4HCFA 3T3PB 3BEVB 3U7AA 5MP6L 4JPIA 3L16A 4Y16D 1I53A 3ZTEA 5HHMB 1CZ8H 1MVUB 2WGXA 5KOMC 3FBQA 3X1BA 5FR3A 2EO7A 3DK2A 4WHYH 4UQ9A 3PJLA 3GMRB 3LEYL 1YDPB 2IGFH 3RA7H 3ZVVA 4LAJH 1BW8A 2RA1A 5AALA 3RUGE 3D2UB 5BUAA 4IRSA 4FZEL 4KMLB 1TITA 3FT3B 2HMID 4NKIH 4TNFA 4JO2L 4QYAA 5E94A 3QIBD 1RIHH 3MUY1 3PHSA 5A2IH 4HX1A 4XNUH 4F80A 2Q9OA 1DQDH 4L9LC 3KGTA 4HIJB 5IVZB 3WKQA 4KJPD 5BRPA 1JGEA 3ESUF 3W56A 3N41B 1ZD6A 2YPVH 1XB3A 3RWIA 3F6JA 2ZONA 3PP4L 1UD2A 4NNPH 5J4MA 4F7PB 4A55A 3SODB 1LEGA 2F19H 5AFAA 4LPUA 1DCLA 4ZAKA 1FC2D 5F6IB 1J05A 2FATL 3T4YB 1B0GA 3CFDA 4KKPA 1WAPA 2BY1A 2XZCL 4MBRA 4OUUA 4G6AD 1AG6A 3IAPA 4XPHL 2P1YA 1CFSB 1PEZA 2ICWJ 4GUOA 3EDEA 5MEQB 3V2AR 4GNKB 1CDIA 4MRCA 2DLEA 3BVNA 3LN9A 2ORBH 4TMPA 4Y4HC 3JUYA 1X5HA 3U9PH 5EU3A 3II2A 2JI2A 3D39E 2WWMD 3ZMEA 3AREA 5DD3H 1DSYA 2AAAA 3A6CL 3PNRB 4NPJA 1U91B 5SWZB 3FAXA 1SJXA 3K4ZA 1JGLH 4NWTL 3T0EB 4DQOL 2P4AB 1IE4A 3FU6A 4GAJL 5DVNA 1E50A 2ILLA 4MCYB 5AAWC 3OKKB 2AQ2A 2IAMC 3BPOB 5ID1A 4A39A 1SOKA 1MW2A 2B4CL 5FKPB 5ALCH 1M05A 1F42A 3QZBA 4NQDE 3UGEA 2RIKA 5HVHC 4Y1AD 4WNQB 5AOJA 3PP3H 4E68A 4H88L 4OM1H 2QZQA 3UTZA 1KELH 1KNOA 2EDNA 3THMH 3BKJH 4CN4A 1A6PA 1N6VA 3U30B 4NKMB 2Y7MA 3MNMA 1A7QL 4V1DB 3VDAA 2F2HA 5DD6B 4J3WA 4ELMB 3TO4A 4H26A 4WI0B 4ONGH 1XF4A 2BERA 3GBNH 5IK3B 1IEBB 1KENL 4EN3B 3MTXA 2JMRA 2MKLC 3DVGA 3US9A 1RUPH 4IHOA 3P73A 4OD2B 2NTFB 3O3AB 5ESVB 4APXB 4BWTA 4KNQA 2A6DA 4R0LB 4HKJA 2DM3A 5CGYC 4ZW7A 4CU7A 1QWHA 4FEIA 2XJLA 4LHUB 1NCDH 3NFNB 3DROB 3SY0B 4LVNB 2CK2A 4TSAH 4UILH 3SPIA 5HYJB 4TNVF 1RFDL 1ONQA 4WU5A 4ODHL 4QRQA 3UJTL 3ZGHA 4HA1A 3RVXD 3SGDI 5EU6B 1PSKH 1U3HA 2F8IA 3GSNH 3UO1H 4ZT1A 2BVEA 4YSUA 2R27A 3EOAA 4D0DB 2M2DA 2IG2L 1HHGB 4O00A 2DTML 3JV6A 4H20H 4AQ8C 3QJXA 2X4SA 4OJFL 4QHMB 1HSAA 4NUJB 1YEEL 3AU1A 3OQRA 5D96B 5AW4B 1R24B 2XDHA 3EYVA 4O58L 2OR7A 2XPYA 4JPVL 5C09B 3ZJAA 3N06B 4ZFZA 4RDQG 3T6WA 4MQ7B 4M7LL 4ZFOA 1ZK9A 5C0BB 1NPUA 4IRSC 4YO0B 5ID0A 1BYOA 5L2KB 1U8PB 2BRQA 4U1MA 2XWBB 5JO5B 5C70A 4TUOB 5HJ3A 4Q56A 3KBPA 4BFIB 5SV4A 5EEVA 4FI6A 3HOGA 4G1MB 4L0PB 3TA4D 1ET8A 3DETC 2CO1A 3LNEA 4ZDHB 5E4OA 1FYHB 2XN9A 1E27B 4HUUA 4RH4A 3AXIA 3L4XA 4Z0XB 5GRUH 1YY9C 1J88A 4F8NA 2BDNH 4XBPB 5HPMB 4ZAKC 3Q8CA 3B43A 4JHWL 3ARZA 4A7UA 2CXGA 2X2YA 4Y0GA 4DTGL 2QSVA 5I66A 2W1NA 3OJ2C 2V2TA 1X5MA 4A7SA 1S5IL 1RZKC 5B22A 5F9OH 4EZLA 1EHKB 1OAZL 3BP4A 3AREC 3HZYA 3NP3A 3AGWA 1BIHA 3NAAH 3ARPA 5E6RB 2DAVA 3OZ9L 3NA9H 5AYTA 5HDWA 2RR3A 4WJKB 4NLHA 4I2XE 4XCYA 3MMEB 1VFOA 3VQMA 3QYNA 3F7KA 3FTYA 4JRFA 4JHBA 4R9HA 4UOW1 5B8CB 4ZXBC 5BV7L 1IC7L 2H2PC 2OTUA 3IFPA 4GAGL 1JSYA 1VA9A 3FSVA 5IQMA 3EJSA 1C5CH 3F04A 3Q5OA 1JGIA 4HK3N 4KK9D 2C9XA 1KJVA 3NIDE 4LEXL 3V9EA 3UPRB 3BZEA 2R1XA 2DLTA 1MFUA 3O4OB 4K3DH 1FPTH 4YZFF 3LKOB 3MRPA 5IJCC 1P53A 2CDEB 4N0UB 3VYNA 3US0A 3TO4C 1QASA 2WO4A 4NC0B 4NZTL 2NLJB 4JCMA 2G4GA 2R7EB 3X13B 1J0KA 2YUWA 2ZWYA 4L1HA 4MA1C 1TENA 2VE6A 5DC9B 3ABGA 1U6AL 2O6EA 4XN9A 5GGVL 2BP8B 3LEVH 3Q6GL 2JQMA 3KYAA 5T33L 1LLAA 3C08H 3M8OL 3HTLX 2PABA 4ZXBB 3UOAB 2AABL 3GHPA 5JW5B 3BPLC 3ATDA 4LBAA 5JIDA 2ZCKH 1IB5A 5F7BA 1T03L 5D55A 3IDJB 3KPRE 3QZWB 2PUQT 3QG6B 5J6HB 4NQUA 1WUNT 4XMLL 3QYCA 1HDMA 4HS6A 2WYHA 3ZKSD 2VH5H 4IK6A 1UKSA 2AP2A 3NYKA 3O6LH 1FZOB 1FL3B 3DGDA 4UBDD 1DBAH 1KYOJ 2D31B 1KXVA 3QORA 3IDGA 1U3HC 5KS9B 3T04D 1FORL 2R0KH 5GRJL 3CVCA 1CFVH 2BY3A 1WYJA 2PYFA 4WWNA 2AXFA 1HHHA 4GUCA 5JNYA 5DYOA 3HNTL 2OYKA 4ZUWB 2NY3D 4GINA 4YC2B 4BEIA 4KRPD 4P48A 1QQDB 3X3GH 3RL1B 4D7BA 2MIZA 2HTLC 3D08A 4ZNEA 3FN3A 2BIMA 4ZS7H 4NGHH 3CBJB 4PJEB 1UZ6E 1T0PB 4OM0H 1G7LB 2FEDC 5FYKL 4R7XA 4CMMA 1D5IL 2ZYSA 4FA8A 3DVNB 2ZSWA 1M7DA 1JF6A 1KFAH 4M6AA 2NRDA 1UD5A 4UOQA 2AQNA 2D7OA 4S1SH 3U9WA 2NQDA 1ZEAH 3NJGA 2GPZA 1V3JA 3FQRA 1MCRA 3R19A 3CFKA 2OPCA 3U6XA 1ZJBA 2XWJB 2XKNA 1VFAB 1FGVL 4NO0A 5B1JC 4JB9H 1NGYA 1XVSA 2BSTB 3KNBA 4P4RA 1J87A 1LK3H 3MODL 4L8DA 3WXVH 4FXGC 4XXDB 3QXWA 3TEXA 5I6PA 1PX4A 5JIQA 4WI9A 1PNCA 2XBDA 2K4WA 1J12A 1E90A 4QTHA 4C56B 1I8KB 2XQBL 2Y72A 4LLQA 1BDYA 4DPAX 3V0WH 2FO8A 2JJSA 4FTVE 4G8GD 5TPWH 2NUTB 2C34A 1KB9K 3KVDD 3PREA 3BFQG 2J21A 1T5WA 3DUSA 4EI5A 1M1XB 4CNIA 3O6KL 2Y2TA 4BE5A 4M1GL 1SXCA 2ZUQC 2DY2A 3F6LA 5KYUB 4TLKA 4AC4A 3GUTA 4RFOL 2OW6A 3FPXA 1CBJA 3HI6L 5JZ7C 3I9GH 4N26A 5SX5H 3RNKB 2QT6A 5I9QC 5IEHA 4HETA 3V0JA 2WNGA 3HG2A 3TN0A 1NQBA 5E03A 4F3FB 3GTVA 4N4YB 1KN4H 1IFRA 1PEWA 1ZPUA 3VXPA 2GUOB 3RFZC 1SY6L 3D07A 4ANWA 4G7QB 3L7EB 5I1IL 5IV2A 1I9IH 3WIIH 4QTFA 1QSED 1BQHG 3RB5A 1K4CA 1BZ9A 4TXVB 3CFEB 5DQ9B 5F7HA 3D0AA 5LAPA 4X6EB 5DJZA 4U3HA 4CMHC 2K70A 2F1AA 1UWGL 1BG1A 3CLFH 1N5YL 1ACZA 4GG8B 4UI2A 5D9SA 4I5BA 2JCCE 4XVTL 2CIKB 4XX1G 1JPFB 2XN9D 5CD3B 1G9NC 2GSIA 4NBYB 3C6EA 4PVNA 1WZAA 5CCHE 35C8H 3L3GA 1J11A 1MJ7L 1XCQA 3SKMB 4OV5B 4YHNA 3U6XS 3M7OA 3MCLL 4UIMB 3OAYH 2EZ0C 3KEHA 2XNAA 4XP9H 1IQWH 4TF4A 2WNXA 4U3XA 3MA9L 1P69B 5TGBB 3B2UD 2D4DA 3QWRD 3QORC 2F74B 1WZ1H 4QO1A 3MXVH 5EOCL 4BQ9A 3INUH 2UWEE 1GRWA 3FO9A 5AW7B 3TV3L 1KSRA 1YEIL 3F7QA 1UZ8B 1WFIA 3O2DA 4W9ZA 2VZSA 3S36H 2R59A 3PABB 5DEGB 3TL5A 5HDBE 3ZUNC 4FAAB 1H6FA 1WK0A 3RHWK 1RV6X 1RMFL 3JBG7 4HIIA 4G5ZH 3HS8A 1TJMA 1MF2L 1WE5A 2HRPL 1SXBA 3OPUA 3S4SG 4E9SA 1P84K 4G9FA 4L0YA 1U3JA 2V7NB 1MRCL 4ZD3L 2DQTL 2AANA 4DN3H 1HKFA 1WTGT 1V55B 4Q4IA 1HQRA 5E6YA 4WU7B 4HK0B 3CFJB 2FIRT 3IKKA 4IOFD 1R3HB 4DGIL 4FA6A 5A6LA 1IVTA 4IOIB 4F24A 1DDHB 4K8RC 3H53A 4GW5B 3QHZH 3AS3A 2XIDA 3PWUA 4HHAB 4X98A 2ICWI 2FJHA 2DIJA 4O02B 5F9WC 4NM8H 4UV4H 4RZCA 4ZUSB 1O7DE 2A9NH 4J39A 2H6OA 4L4VA 1RZ8A 2KBGA 3CUPA 2I85A 4LSQL 4EF3A 2HUHA 5F7KC 4Q6IB 2H1XA 4BZ2L 3ZTJG 4KY2A 1T66D 5E5LA 4XI5C 3QRBA 4HWZA 4F33A 3LRMA 2I27N 1GJUA 4XPGL 5CBAA 1TTGA 3SDXF 2FHFA 4KKLC 4L4TB 4S1RH 4DKDC 2GIXA 1C12A 4HD9A 5FYJL 3MUHL 4X4XA 2X0UA 3WIHH 5DSCB 1DBBH 3KYOA 2EDYA 5I1GH 4IKJA 2UZYA 4ENEC 2EDQA 4UT9L 3RIAF 1E28B 1MIEL 3GO1L 1OPOA 5DGRA 3ZDWA 4CUCA 2M8XA 4KZDL 4DW2H 5K39A 4Z7UA 1CF8L 1NKGA 2G5BA 1CGYA 2N1TE 3HI5L 1A1NA 2FX7L 4D3CH 4ETQA 1PTZA 2HJLA 3MUGB 5GGQL 4HLZG 1X7TA 3ZKMC 4KFZC 4XB8A 1TYJA 2I07B 5GZOC 3MLPA 1SEBA 3B9KA 3QZOA 4FG4A 4XPBL 2EDTA 3V4VH 2H2SC 3HRZB 4QTIH 4M8UA 1JV5A 1N4XL 2PCPA 2YSTA 1CLZH 3F64A 1RHFA 3G5YB 4YJZL 4QXUH 5KBMA 5D7IB 1AIFB 1FC1A 3TWCL 4JFZH 1NC4B 4AJYV 1E7UA 3FTWA 1KCUL 1NFKA 1ULVA 4NO0D 3OR7B 3VGBA 4N0CD 1WBYB 3CVHA 3PL6B 3VXTA 4AVKA 2ZNXA 4EZKA 3QJZA 4PRIE 1NCBL 1JPST 4K55A 2X10A 1DE4B 3BZDA 4IKLA 1ZJAA 4W6WB 1G9MH 2DS4A 4OZFA 2E7CA 4LARH 4I3SH 5LBSL 2B16A 1D7CA 6CGTA 1NBVL 3EJYD 3VYPA 1HZKA 1DQJB 3F7VB 2VO5A 3CJJA 3GMMB 3JWNC 4HF5L 4HFWB 2GSMB 1LO2H 1CZ8L 3V7AE 2N1KA 4QHLB 4M8VA 2VMFA 2BVPB 1NC2B 2OQJB 4Z7UF 4BH7B 5D93C 3OVUB 2HZHA 3GNMH 5I71C 5KVDE 4Y9CA 2PPDA 4JKNA 1U2YA 5FYJE 4EI5D 2IGFL 3MRBA 4RMVA 3RA7L 2YARA 3RY6A 1RIVH 4JFOB 4GBXA 3ZR6A 3BFOA 2ADGA 4NKIL 4PJ9A 1RIHL 3HUJE 3I3EA 1TFPA 3WSQH 1KGJA 1P7BA 1FZJB 4FG2A 5D4HA 1II4E 1DQDL 2P7TA 4L1SA 3TN0D 2GB2A 4OD1H 3WKMH 3B3IA 2DBLH 1VB9A 2OW7A 3FOMB 2YPVL 4K94L 4WWKA 2EIZA 4AQZA 5EZOH 4NNPL 2VDRB 2YD7A 1EJOH 4N5UA 1EJ8A 3OB8A 1DO6A 2HT4C 2F19L 1P2CB 4J4PA 5JPMC 4LSTH 2ALAA 1HIMH 3RWHA 3TESA 2QGEA 3IPEA 1D5RA 3J27A 1NAMA 1LDPL 1KPVB 3IK2A 4WV1B 3I6LE 4CN1A 2DL2A 2XPGA 3FFCA 3U9PL 4AL8L 3QNXB 4UDUB 5DD3L 5F88A 2DWTA 3VXSD 4MD4B 5C9JA 5FO9B 3ABKB 1CD1B 2DEXX 4UQ3A 3D52A 5IHUH 2PETA 3NJNA 1JGLL 2V2WA 1QOKA 2L3BA 3K2IA 4CGUB 1ZTXL 4FLOA 3C5SB 3N5AA 2NY1D 5JLZA 3BUBA 4B95C 5T5FL 1LO5A 4DAGH 4ZNCD 2Z4QB 2R2BB 4YDNA 5DDHB 4O2EB 4CJ1A 3CHXA 2HN7A 3EBIA 3SZKC 3ILQD 3MV7B 3T2LA 2EQDA 3MQIA 4OM1L 1CIUA 1W8OA 3BKJL 3THML 3V0AC 5A2CA 2P5EE 3DMMD 3ARBB 3UZEC 3IKCB 1F3JA 3L3DA 4RX4A 1E9OA 2XN2A 1QSFB 3QJQB 3GBNL 3N1PC 3FU7B 1S7TA 3Q1SH 4P99A 3FHEA 3L48A 1D6EB 3L4VA 3VMOA 3MSPA 3B2MA 2F7OA 1BQ5A 4G9FD 4PBDA 1TJXA 3NIFB 1RUPL 2CBOA 1G6RH 1Q0XH 4H0LC 3O3UN 4PJBF 2LLLA 2XIBA 4E36A 4L1DA 3C09B 3MRLB 1PNDA 3EFOB 4NSKA 4FFWC 1J9SA 1AY1H 1S5HA 4AQEB 2NXZC 4Z23A 1UCBH 1NCDL 3GK8H 4PREA 1DN0B 1SMDA 4GRWH 1KIQA 4H44C 1F1DA 4MMXC 4ODXA 2RACA 3SGJC 3FCBA 5HJDA 1GS8A 2PTTB 1PSKL 3GSNL 4XCFH 3UAJC 3UO1L 5A2LH 3ZSTA 1HE8A 4F2MA 4X7TB 4KKAD 4L4VD 1AGEA 4FFTA 4YZFE 2OYLA 1RZJC 1ZLVH 4P2RB 3E9TA 3F58H 4Q6KA 2YMTA 1T1XA 3POHA 2AFNA 4MB3A 2JB6A 4H20L 2CJSA 5D2LB 1EHXA 3EH2A 3SYCA 4KMTH 1LP9F 4PJGB 1ZTXE 4NBZB 2YD2A 3ASOB 5GRWA 1A4JB 1D5BB 4FNUA 3UBXI 1BZ7A 3GBML 1E7VA 1OAUH 3EKCA 2FO4B 1VGEH 4B9ZA 3KPPA 5HTSA 1N2RA 3RY6C 3A5VA 4GBXC 1HKLH 4HALA 1V27A 1YNLH 2GHZA 4J27A 4LHQB 1TTAA 1TVHA 4LNRA 1A14H 4LLUA 5EO0B 2R4RH 2IV9A 3LH9A 1BOYA 4Y4KC 5E7FA 3L54A 2FIKA 5SWSB 1IZJA 5IB4A 2VLJA 2OXHA 4JKLA 4U3CA 2XFXB 2P5PA 3T65B 3B9KD 4IOSA 4YBLC 3LRSB 4P23C 4WWKC 4Q7DA 3V4PL 5LCVA 3KL3A 5AOKA 4EZMA 4GO8A 3ILPB 4JZNB 1FYTA 3FSAA 2BDNL 3BD5A 4M1DL 3MRNA 1HL9A 1UURA 5MI0C 4NFDA 4UNIA 3H4FA 1OTSC 4F7KA 1EAPA 1N59A 2J43A 3SKJH 5JR1H 1EO5A 4HMEA 1AQKH 4GW1B 1QRND 1PD0A 4BSJA 1Z9NA 3N0PB 4FL4C 4JFQB 5DJ0B 3VXRE 5IHZA 2CR0A 3ETTA 2QSTA 5F9OL 1GZQB 1OZTG 2YAFA 3F01A 3LNGA 4L1LA 1NCCH 2CGZA 3P11H 2ZG1A 3NAAL 1U8CA 2F54B 1LILA 1BLNB 1QFOA 3QJSB 2KHAA 2H9GB 1H0DB 3V0HA 3H9ZA 3TO2B 1FUNA 2OJEB 4LFHD 3OHXA 4JPWH 3BAWA 3LAFA 4L37B 3MFGB 5CZXC 3K1KC 3H85A 3O41B 4P23B 2Z7WA 4C4KO 5I1KH 4NO3A 1CE1H 1N64H 3FQ2A 3GLDA 1C5CL 4S10A 3DC0A 4UOW0 4HOWA 5EH1A 1ETJA 2LW3A 2Y1AA 4PQXA 5FOJA 4NYLA 1MCNA 2DWDB 2YLKA 2ZOTA 1FPTL 4K3DL 3DOHA 1MHHA 4OZGB 3Q13A 4ZOBA 1M7XA 2GC7C 5KANI 1CXEA 1HSBA 4LCCB 4PJ9D 3W11C 3PIQB 2BSCA 3KE0A 3GHBL 3VJ6B 3U7WH 3QUMB 2YD5A 2VZVA 4QF1A 4WUKH 5DLMH 2HVJB 4MMZB 1GY1A 5KUKA 1OGTA 1U42A 1QZ1A 2ARJB 3LPFA 2N7SA 2XSKA 2ROXA 1CTMA 1TQCB 3LEVL 3MNZA 4JGUA 5GGSY 3CZFA 4GQ9H 3C08L 4J4PD 1A3QA 1CK0H 1MREL 2HLFD 2WD0A 3W57A 2ZCKL 4HKXB 1GYAA 1R46A 4FQ1H 2AKRA 2WVTA 3AWFA 4PCTA 5DMKA 1TUPA 3EJTA 4ZFQA 4DP7X 3LS5L 4L05A 1DQMH 2CDFB 3D85B 3O6LL 3PUCA 4XC3H 3FFCD 1RQ5A 2WWNA 3UTQA 4QRUA 3WY1A 2C1PA 4A37A 4NN7B 4K23L 4AYGA 3ULUF 4EKXA 3B37A 2OCFD 3W0WE 3MRDA 1ADQH 1Y07A 4XNMA 4XAWH 3TONA 3FO0L 1CFVL 2F0CA 3P4MA 3DXAB 1D7BA 4LQFL 4AIZB 2YUXA 4OQTH 4GP5B 5CLWA 3KPSA 1JTTA 3C5ZA 5BPPA 4MAYA 5T1LD 1U95B 1JMZA 2IANB 5C0EA 3NZUA 1AGCA 4LCUA 4PTTA 2VWEE 5FUCE 3X3GL 1OK0A 1E4XH 3UJJH 5EBGA 4ZS7L 4NGHL 5E1IA 3TT1H 5C71A 1Y1DA 4OM0L 4YDVA 1FN4A 2BS71 2W65B 4I0PB 2JIXA 5BO1H 5C0ND 3K0YA 4OI8A 2UUDH 5EZLA 5DU7A 3BT0A 1T04A 4FI8A 1DUYA 3WD5L 3I9PA 2X4QA 1A9BB 3A21A 1KFAL 3HR5B 4CA4A 4JFHD 3VFOB 3MROB 4PAZA 3L95B 3FQWB 2OMXB 1WAAF 2X38A 2BOCA 2ITEA 2H32B 1CLCA 3GPSA 1ZLUK 2UVEA 4Z7OE 4Q9QL 1QFPA 1U8JB 2XQYA 1DUZA 1X5ZA 3O45A 2PP7A 4XBEH 1BQHB 1AHWB 1LK3L 2OMNA 1I1RA 1VERA 4PGCA 1I7RB 4XXCA 4LPTA 2BSRB 4GKZA 4FFYH 1ECYA 2IGTA 4F8OA 5E8DH 5LBGA 2DZEA 4U1SA 1YEFH 3V0WL 5G4MA 1WAEA 3P3UA 4POUB 2GG1A 1TLMA 3ZE2B 4U1LA 2XICA 1EXUB 2VLKB 3GD1C 4IMLB 2I7OA 3NABH 4WGKA 4W9DC 5LGHL 3EJZC 4IS6A 1UQSA 2VSKB 3D7PA 2WMPA 4TSCL 3VFNB 3I9GL 1R6VA 4LRIA 3WJLC 1AZBA 3G08B 4AGQA 4NQCE 2O61B 4UINL 2OL3A 3VNYA 3P4NB 5C0AE 4LLMB 4U33A 4PBXA 2QSQA 2XTJE 1BVLB 1MLBA 3VSUA 4MKMA 4HUNB 5T1MA 1I9IL 3HZVB 4X5PA 5J7CC 3WIIL 3UADA 4BK8A 1W15A 3HZKB 3B2DC 2VQ4A 1YEDA 5D6CB 2OKMA 3MLTA 1I8MA 3O4LA 4AV0A 3CLFL 1LWJA 1S7WA 4IIZA 3S5LA 1PF3A 2JKRM 5EO9A 5CF3A 1RUQH 3S4SB 1LJMA 5DHVH 3WJJC 1K2DB 3PU7A 3GKZA 3NUKA 5C07B 2ENQA 1DQLL 1PIGA 3I2CH 3K5SA 4TVPD 4PRNA 4ZQKA 5HD8C 4POYA 1FYTD 1G1KA 2R29H 35C8L 4N5EC 4DVBB 3B56A 4KNUA 5E70A 1URIA 4X7DC 1SOQA 3FW6A 4XN8A 5F7UA 2LFEA 5GS1B 2AXHA 2DLHA 3APFA 3GSRA 5T1KA 1ND0B 4J3UA 4N9GB 2D4FA 5CJQH 1MFCH 3PHOB 1F58H 4NFBA 4WSJA 5F6HJ 1HOCB 4KJQD 1IQWL 4QD2E 2YQ2A 2Z31A 4IBSA 1LXMA 2H7WA 5CNHA 4N8VG 4PRBA 3INUL 4AG4L 4DPBX 4P4KC 3A4DA 1CS6A 4WK4B 5LGKA 1IFHH 2OZ4H 3MRIB 5ABDE 4FQPA 4JE0A 1RCYA 3S36L 1J8HA 1EH9A 3BN9C 3V8CA 3Q06A 3IFLH 3C5ZC 1GYUA 2H6UA 5F1SA 5IOPB 4RDBA 1FH5H 3NCFB 3PHQB 4J3OF 3ULUD 4N2DA 2NNAA 1JVLA 1WG3A 1M7IA 4G5ZL 2K78A 2JSFA 3A4AA 4TUJB 4H8HA 1E6JL 5C0DB 5CP3A 3S8GB 3AG3B 1AR2A 1JXJA 1DQQA 1JZ5A 5E8PB 1L9SA 1KB5H 1ETZA 3DX9A 4DN3L 3QEQB 1RJYA 1J10A 3GSWB 4MJIA 3G6JB 5IROD 5HYEA 4PS3A 4P46A 3EGDA 3BPNB 4D8PB 3SJVE 2TRHA 3WE6B 1E6OH 1WFOA 4BQCA 4MA3B 4KUCF 4OLXH 3QHZL 4N3UA 4H5SB 1OP3H 3SDCD 3QQ3A 2AV7B 1MW1A 3QHTC 2PCFA 4X0KA 3BD4A 4LBEA 3DX8A 4NM8L 5IIEB 4OAWA 4UV4L 1E4HA 2MFNA 2A9NL 3MRJA 3RL2A 3ARGB 5ANME 4DERA 2QQQA 4WK0B 4AKPA 4PP2B 1ITBB 5D1ZA 4XXCC 5EUOE 2E59A 4MHHG 4ZMZA 3RU8H 2BC4B 2XUWA 1LVEA 3SCMB 2EDFA 4XVUC 2YQGA 2PPEA 3P9MA 1QLFB 2AQSA 2NX5A 1ES0B 1RZFH 1QKZH 4S1RL 4W9IC 2UYLA 4JHZA 2X1QA 3BUPA 1JBJA 1DBBL 3IDNA 5I1GL 1BYPA 4XZUB 1PCSA 3IGUA 2VR8A 4Q2ZA 2Q6WA 4OIIH 5I0DA 2K8QA 4UOZA 3FTZA 2L7QA 3MRKB 5CEYB 3TZVB 1E4XI 5AAMC 4MAYD 2O6DA 4TTDC 4FEMA 3IDXH 2J44A 1EEYB 2X4RA 1N6UA 1NIDA 5E9DE 3MNWB 1JK9A 3RY5A 3U82B 4XC1H 1A7PH 2E4FA 2GJRA 1PLGH 4IRZL 1NMCB 4OSUH 4JQXA 1Z9OA 1E42A 3SZ6A 1UT2A 3FNKA 3E3QC 3N40P 2JIXD 4QTIL 3PV6A 4N8PA 2A9DA 1CTNA 2DF3A 1CLZL 3LMJH 4M62H 4PJDA 1EEUA 2AEOA 1OGPA 4PD4J 3BIKB 1L9TA 4QXUL 1OF2B 1WBXA 4FERA 5TK2A 4JFZL 3IRZA 4P2OC 2I60H 1ZANH 3HG1B 4HC1H 4UTAA 1U8QA 3FO1B 3UYPA 3BEVA 4L2YA 1RI8A 1V7NH 3Q48A 1A6TA 3VTMA 4CKVX 4Z3EA 1CI3M 3FBKA 4RWYH 1OTTC 2APWA 4H1LA 4KHXH 5GJTL 4RSVA 3GMRA 1JZGA 2BOBA 1G9ML 2ERJB 4FF9A 5HGGS 4EN3A 1AS7A 1IM9B 1CG9B 1FL6A 4I3SL 4OJCA 3A6BH 3HN5A 4UQCA 2Y0SA 4P5SA 2BNQE 4P2AA 4KK6D 4LCWE 1T1ZB 3WDHA 1KY6A 1LEKB 1B9KA 3FT3A 3L13A 3QR0A 4AZ8B 3BEWB 3BDBA 1LO2L 3VFRB 3U7YL 3I74A 1HHKA 2CO3A 5IVZA 3GNML 3QNYA 1KXTB 3L4UA 4FFVD 4AGOA 3NK3A 2DWEA 2K45A 4WAFA 1RIVL 1DBJH 5EU7C 1AHMA 3EG9B 4F7PA 1J5IA 5FDYA 2OMVB 1KBWA 3FCSB 3O3BA 1IBBA 3WSQL 4QHNA 3UMNA 3T4YA 2D0FA 4OD1L 4HEME 4ZPVB 2DBLL 3EBAA 5AWNH 3DVFA 1GH7A 2NR6A 4PN6A 5KSAC 2BX5A 1X5IA 3MV9A 3QA3B 5F70A 5AVVB 3VSTA 5MEQA 2PXYB 1GW0A 3DTXA 3G5XB 3SB3A 4Q89A 1EJOL 2Z7YA 3QJOA 3TVMB 3RTLA 1M6OB 2MPVA 1CUOA 4YIQA 4NWUH 4ETYA 4N2NA 5FHAL 4LSTL 1HIML 2YAEA 4I13B 4RBPK 1U91A 2OV0A 4RGNC 3O4LD 2CIIA 1LP9E 6PAZA 1I31A 3C75A 3KW7A 1L3WA 4MCYA 2XFGB 3OKKA 1JD7A 5JQHC 1XBRA 4N22A 4JFHE 3IU3B 2ED6A 4R7LA 1E9PB 5FKPA 1TZOA 2DQDH 3VQ2C 2Q8BH 4HAGA 2A38A 4HUVB 3JVGC 1DFXA 5D1ZC 5IHUL 4IYKA 5E2UL 3KGRA 3W5MA 3HMWH 5T1KD 3N41F 5JA9A 4NKMA 1CICB 5JA8B 3H0TB 5DD6A 2FO1A 2L04A 5H37A 4X6DB 1KCBA 2Z31D 3DV4B 4M8QB 5EF1A 4DAGL 5J11B 1E5YA 5IK3A 1IEBA 5HGHB 1M7UA 3MYZA 4PHXA 3V9FA 3EYOA 5I1AB 3GQFA 1WF5A 3DWTA 4ISVB 4KRNA 1FFPB 1JVKA 2NTFA 4Z7VB 1KPUB 5ESVA 4APXA 3N85H 5CKAA 5I76B 4E9LA 1CXIA 3JYBA 2WLNA 2VDLB 4KROD 4UUJB 1HEZB 5DJDA 4LDOB 4ODWA 4F57H 2BSBA 3NFNA 3DROA 3SY0A 1RZKH 4UYQA 1A3LH 1G6RL 1F1GA 1R5IB 4F1ZA 2XX0A 1J8KA 2Q76A 1DQTA 3JTTB 1OZUA 2EXTA 2GITB 5EU6A 1R3KA 4PHZA 4EBQH 5L0QC 1G6VK 1WZKA 4MJID 4JZOA 2MOVA 2HB0A 1AY1L 2PTVA 4UZUA 3ZYOA 4D0DA 2HVBA 4P46D 1UCBL 4Y5XC 5JHDA 3GK8L 2XWTB 4XCCH 2XYCA 4OGYL 4KKCC 4QHMA 2CE6A 1CE6B 4NUJA 1R24A 5B7MA 3CNKA 3QXDA 4R8WH 5IB1B 4XCFL 4ELMF 4BUQA 1F8TH 3GHEH 5IW6B 2WO2B 5C09A 4EN3C 1B2YA 4QLRA 4FLQA 3KYMA 4MQ7A 3ULVC 1EZUA 2X87A 3DYMA 4YO0A 5T3XE 5L2KA 1U8PA 1IGMH 2NZ1A 4KMTL 2XWBA 3MOQA 1E4KA 5JO5A 3Q3GB 5HDQH 3V5KB 4OKVB 4W9KC 1PD6A 1I8LA 4G1MA 1IGTA 4YS4A 3M6DA 4GS7C 1OAUL 2Y6SC 2GK0A 3T8MA 1VGEL 3GI9L 1A64A 4PLJC 2AXGA 2CR3A 4ZDHA 1HKLL 4WI8A 1E27A 3MA7B 1YNLL 4JNXA 4MSWB 3AS2A 2DQ6A 1N7MH 4Z0XA 5GISL 1A14L 3BQUD 5KTEH 2R4RL 1OB1A 4XBPA 3R0MA 1Z2KA 3B83A 3U6RA 3LVTA 2A9MH 3IDIB 4TQEH 3TT3H 1HH9B 2WXOA 3CFTA 3F83A 1JRHH 2Z7ZA 5I17B 3BC9A 3FQTA 4RMWA 4RISH 1WT5A 2B39A 2FSEB 2Z8SA 3W9DB 1AR1C 1XGUB 5DRNB 1JGDB 3QCTH 4PMFA 1D3CA 3N44B 5IUCA 5IQNA 1Z9SB 1ZS8B 3D25B 4BDVB 5JR1L 4PJFB 3SKJL 4LK4A 3MMEA 1AQKL 3PWNB 4NHUB 3HMXA 4YDIH 3TNNA 1CGUA 5KSBB 3CDYA 1FFNA 2WLKA 3GJFK 3UBFA 1KGCD 2MCAA 4HD5A 4D2NA 3KMDA 1WIPA 5HHMD 1GGTA 5IEKB 2VDPH 3WY4A 1NCCL 3P11L 4F7MB 4XO9A 4F37F 5F71A 2X42A 1EMTH 4GG6A 3UPRA 3T0XA 4OZIB 5IG7B 3V0FA 4JPWL 3WO4C 4X50A 5FWRA 3F85A 3D2UD 2R9HC 4ONFH 3LKOA 4F9PA 2CDEA 4AYSA 2CU9A 1WJ3A 1YHPA 3ARDA 3H56A 2MSPA 1WAAE 2E6JA 3GZQA 2VJ8A 8FABB 3MJ7B 1UTDA 2NLJA 5AOZA 5I1KL 1CE1L 3QJFB 1N64L 3X13A 2V8LA 1X9UA 5TH2B 4PRHE 1CGSH 5I8OH 1MLCB 2X6CA 1IJ9A 1OM9A 2PP8A 5DJCB 1AC6A 4HZAA 4BFOA 1VZIA 3TURA 4KOBA 3R4DA 3E8UH 3FU9A 4KC3B 4QRPE 2W88A 1ZA3B 3SE6A 5T3ZL 3U7WL 1RJZB 3II3A 1TT6A 3Q2NA 4WUKL 4KGLA 1QRKA 2NR6D 3ES6B 4BFFA 4X6CB 1FO0A 2J71A 2AJSL 2XBTA 3QARA 3BKCL 1FZOA 3PXJA 1VEPA 3GSVB 4KTEH 2FGWH 4GQ9L 3K6IA 3GSUB 3ZW3A 2VGLM 4KZ0A 1TMQA 2PCXA 3VSQA 5SWZD 3C6SA 3TPKA 1MJ8H 1JWUA 3BLBA 1NWOA 3T0ED 1G7QB 4GRLB 1ZV2A 4HUMB 5DJ8A 4NOBA 2WQ8A 5I18H 5D7JC 3O9WA 4L3FA 4GSQA 1S7VA 4XC3L 3QUHA 4ZPTB 1OAKH 4QGYA 1JHLH 3RL1A 4QOKE 2UZPA 3BSZA 3S5ZA 2A3TA 1HNFA 4PJEA 3MXWL 5DCCA 3TYGH 5IZ7A 3IJHB 4J3BA 4DCQB 4MA8L 3DVNA 4V1DD 4K73A 1AC0A 3QFDA 3WDJA 1NGZA 5DRXB 1ASOA 1BYNA 4GQQA 1SYVB 1H6EA 3O81A 5IHHA 2B59B 4ZS6D 2HFGL 3IBEA 4OF8A 1JYNA 1UG9A 3C60B 4TSBL 3VB9A 3Q05A 2XWJA 1VFAA 1HL4A 2W91A 1G9NH 3PP3K 5I1DB 5BO1L 2CO7A 2BHZA 5J13B 3MCKA 4H8UA 2X05A 3KWXA 3AM8C 3LS4H 4GO9A 3CV5A 8PAZA 3ZE1F 1LNUB 2E7LC 4XXDA 5KS9F 3GB7A 1KTLB 4YL9A 2WLJA 2YN3A 3LTVA 4ILDA 4LHUD 4W4OA 2MQGA 5AVTB 5T3ZE 1OOWA 5HYJD 1I8KA 2G0KA 4I85A 4JFEE 2MHAB 4M02A 2K8MA 2NUTA 5EU6D 2B08A 3T0WA 5KYXA 2BY0A 1CC3A 3V6OC 4M61B 1N8ZB 5E2VH 1M1XA 1S8DB 4XCEA 1OW0A 3US1A 2QHRL 4PJ7B 4FFYL 4CILA 3IXTB 3KL5A 1WICA 1OAJA 1K4DB 1X5FA 4FXLA 5E8DL 1Z0MA 4YHML 1E2WA 1U58A 1YECH 1YEFL 3RNKA 5HYQA 2WLHA 4ODBD 3NJJA 1DEEB 1IV8A 3FRPG 4PJXB 3I3DA 3WY3A 2GUOA 5CAYB 4YGVA 4AWJC 4A67A 5C09D 3MOBH 5E24E 3PXLA 3NABL 4XN5A 2RB8A 3L7EA 1HCVA 3RPKA 5H94B 5C0BD 1YUHB 3WTXA 4BFRA 2A74C 3EHBC 5TFSH 5L2KD 2Y7SA 2V0AA 3CFEA 5DQ9A 2VDKH 1GSMA 3ARDC 4NHCH 1ZGLB 3WFZA 2ODHA 4R5TA 4APQA 3NACH 2RH0A 1J1OH 4LEBA 2J6WA 2FUQA 4GG8A 4N8VB 1DCEA 2ZF9A 3M17A 3T2NH 3HHRB 3QK0A 1JPFA 2P8LA 2WXIA 4LCIL 1AANA