1CD9B

2:2 complex of g-csf with its receptor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
213
structure length
206
Chain Sequence
AGYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)
publication title Atomic structure of the GCSF-receptor complex showing a new cytokine-receptor recognition scheme.
pubmed doi rcsb
source organism Homo sapiens
total genus 29
structure length 206
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cd9B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cd9B02
2X6MA 1IGJA 2DYPB 3G5VA 1KCSL 3EYFB 5SWZA 2APVA 3GMLB 1H3GA 4Y19A 3VFSB 1A4KB 4H20L 2KZWA 2IADA 1RZKH 4PJ9B 3KG5A 3E6FA 4GQ9H 4O2EB 2C4FU 4F9PA 5GRUL 4TTGA 1ZEAH 4LLQA 1XF2A 1K85A 1VFOA 2VDLL 1P84K 4R3SA 2FB4H 1XIWC 5HVWA 4Q6YA 3L9RB 3QQ4A 3I2CL 4LHUA 5CP3A 5ITFB 4FNLH 2WSKA 2BOCA 4QHNA 4W6XB 4IDJH 1FLRL 2F54A 2B2XL 1Q94B 3BO8B 1P5VA 1MJUL 4PLKD 1KNOB 1QTYT 1FGVL 4YUEL 4OKVB 1NGYA 1AQDB 2RJMA 1INQA 2DWEA 2DD8H 3O2WL 3BQUC 4NP4L 2FDBP 4AH2A 1F3DH 4JFZH 4C56E 5D7IA 4QWWC 2AJYL 2OYPA 5HD8D 5DRXA 4AK1A 4NGHH 3P4OB 3WXVL 4FP8H 3DUSA 3U46B 3HR6A 3D69B 1NLBH 1JFQL 3S35L 4ZPVA 1K6QH 2YS4A 4JFDE 3LY6A 5IVXA 3ARGD 4X8XA 1J1PL 3CNKA 1IAOB 1T21A 2Z91A 4MNGE 2VWEC 1KYOK 2PW2A 4OQTH 5T3ZL 3T0WA 3U9UB 1R6VA 4X7SL 2IH3A 4FQXB 1KCRH 1AI1L 2NZ9D 5FHBH 2H32B 35C8L 3RTQA 3S7GA 3VWJA 3LMJL 4X83A 3PGDB 5JOPE 1X9QA 5IW1B 5D8JH 2HFFB 3S98A 2MTPA 1XGTB 4U0RC 2X5PA 4F15C 4FTVE 4F58L 3WFCH 1ORQB 1G6RB 4Q9QH 3RWJB 1TJHH 4ELME 3NH7H 3Q48A 3F7VB 4YXKL 4P57A 1VB9A 1FG2A 1H5BB 2DQJH 3TV3H 4ORGA 3DO7A 2ZCHL 3RVWC 1OGTA 1FFNA 1XGUA 1T0NB 4WVRA 4XCFH 4M7KL 2E6JA 4M43H 1JWUA 4OLEA 1KPVA 2Y6SC 3LKOA 3I6KA 2OSLB 5KSVA 1KXQE 1F3JB 2Q76A 1PEZA 1JWSB 1CICC 4PP2A 3V0VA 4OGYH 5K9KA 4BFBD 2QADC 1RHHA 3PDGA 4JAMB 4PPTA 4OLVL 4V2BA 1ACZA 4RWHA 2VAJA 1RIVL 4PRHD 4QYOB 1UVQB 1F90L 1DQDL 5T5FH 3SBWA 3JVGA 4OV6F 1JGLL 5DQJA 3ZE2E 4ELMF 4UDTA 5C0BD 3CUPA 1ZHBA 2LAGB 3NAAH 4GKSB 2BVOB 5C3LD 4F7MB 1MFCL 2VDRL 1MLBB 3IDJB 4JZOA 4MDIB 4I3SH 1YDPB 2GJ6D 3MV9E 2C3VB 1FZMA 5ERWB 1CZ8L 3N9GL 1BECA 4JY6A 4J4PC 1S9KC 1FIGL 1AY1H 2J6EH 2YA0A 5I18H 3LCYA 1PDKA 2DBLL 4J3UA 1CE1L 4ONGH 1KIQB 2IANE 3FFCB 5K9JH 5EIQA 3HMWH 4HWEH 4GW5B 4O2FA 4APQD 3P0VH 1AGBB 4QY8B 4R4NC 2NY3D 3GKWH 2X4SB 4MJIA 1SJHA 4K3GA 5C0DB 2JB5H 4XX1G 5BOPA 3U0PB 1S9VA 3N1GC 2BERA 1JNNH 5ACMA 5HHQB 2WAHA 3WFDH 4N1CA 3KPSA 5HHMB 3QJFA 4D9RD 2XQBL 1JHKH 5AAMA 1D5XA 3MFGB 5CEZH 4ZO9A 5EO1A 3W5MA 3PL6C 4Q74A 5C09A 3IXTA 4X6DB 5D72L 2BXYA 3BEVA 4UIKH 1EAPB 4OCRH 5ANMB 4UB0L 3WNLA 4D8PB 5ILTH 4NM4H 1OVZA 1INEH 4EN3A 1GXEA 4JQVA 1IGJB 3G5VB 3QEQD 1N7ML 5I1CL 5SWZB 4HT1H 1EHLL 1NGXA 4DGYH 1I75A 4Y19B 5CLTA 2YPLE 2IADB 3IDNA 4RMSA 1BQLH 2GYSA 3RWIB 3E6FB 2OLDA 3BN3B 2P4AB 1XF2B 4LLQB 2WANA 1D7FA 3SDAD 4R3SB 3M07A 2Z93A 5GGQL 2UYLA 2WUCL 4N0FA 3QQ4B 4LHUB 1BBJA 3QAZC 1MH5A 1N4XL 2BOCB 4QHNB 4EOWH 3C09C 2F54B 4WTXA 1A1MA 3SGKA 3DVGA 3EDJA 2JJVA 4LCCA 3LHPL 1W72L 3BIAX 4HSQA 1VKXA 1U6AL 1FL6A 1NGYB 2DWEB 2FO1A 2WNGA 2FH8A 5HI4C 3WO4C 2OBGA 2YD5A 4P5TC 3MLZH 5D7IB 1BVZA 2QV2A 5LG1A 1MVUA 5DRXB 4UOW0 4HXAL 3DUSB 3G6JA 5I8EA 4ZNEE 2FHFA 2V17L 5IMMA 5EZJB 2PYED 4ZPVB 3JV5A 5F96H 4YZFE 4LRIA 5IVXB 2GCYA 4G80A 2F9BT 4L8SA 1TCRA 1JYNA 4S10A 4HPOH 1NPUA 2PW2B 1NC4A 3HE6A 2P1YA 2ZSVA 2IH3B 2ZUSA 5FOBA 5A3ID 2N56A 1BFVL 2X42A 3U4EA 3RTQB 3VWJB 5T3XH 5ECJE 3K2UH 3ZHLA 4NCDA 4L4TA 4JFFE 5I1GL 5KOVC 4DOHE 2JKXA 3FQWA 4LPCA 2DTSA 4POZC 3MOBL 3RZCA 3BRGC 1RUKL 3R0NA 4HJJH 4Z76A 2CKBL 3BZEA 4P2RD 1FORH 1I7RA 5F1IA 1QBBA 4IOFD 4B7IA 1J0IA 4OLZH 4KJPD 3O45A 4YIQA 4N0RA 1EFXD 1I3RA 4P57B 8CGTA 3PJSB 1CK0L 5EU3A 2ADFL 4KRPD 5KSBE 4ORGB 3WV0A 3DO7B 1EO8L 1OGTB 1FFNB 2KQNA 1XGUB 3HFML 5F8QC 5DJDA 5LXGH 1A6WH 3H9YA 1XT5A 2AAVA 1HH9A 1JWUB 3D0VA 1KPVB 5J4MA 2GK0A 2GSGA 3LKOB 3I6KB 4LDEB 3GMMA 4PJFE 1IGIL 5KSVB 5F1KC 3MXWH 2DIJA 3N1MC 2Q76B 2EDJA 3RNQA 1CGWA 4M4PA 5FYLD 4PP2B 3V0VB 4K71B 3F12A 3OXSA 4DN3L 5K9KB 3UO1H 4HHAB 1F6AA 3OMZA 4AIOA 1RHHB 3BJ91 3QBTB 1XIWA 5LQBH 1DBAH 5GJTL 3ALWA 2P8PA 1DEDA 4YX2H 2EC9T 2NY6D 5DQJB 1JYXA 4Q9BA 3DPBA 1MNUH 4M4RA 4UDTB 2HMID 5D7LD 3CUPB 1ZHBB 1S7QA 2E9JA 5AWNL 4L4VA 4NYLA 1QFWH 5T3ZE 5KSBF 2GFBA 5CILH 4JZOB 4RWYH 3BQUA 3O4OB 4N0UE 3GUTA 1FZMB 1A47A 2AXGB 2WLZA 1EZVX 1ZANH 4JY6B 1LO5A 4PJFF 4HAGA 2R29H 1G7IA 2IPTL 5HHXH 4QF1A 3HNSH 5TDPA 3U1SL 3QUYC 2ZUQB 4G9FA 2CUHA 1TJIH 2R1YB 4O2FB 5FGRA 5IESL 4MJIB 1SJHB 2BRRL 3EOTH 3IDUA 3K0WA 1OLLA 3OKEA 1RULL 2NR6D 2VITA 3L7FA 3JWDH 1LO0L 4YJZL 5CLWA 1S9VB 1RQ5A 3JWOL 3BSZL 3FO2B 2IAMA 1A1OA 3KPSB 2G75A 4YEFA 2QQNL 4UQ2A 5MEQA 1D5XB 4AEHH 3ZT6A 2DQIL 5EO1B 2O5YH 4P46C 5C09B 3IXTB 3HTLX 1U58A 3BEVB 5AAWA 3DETD 2PR4H 1A7BA 3P30L 4M7LH 4U3CA 4EN3B 1MFAH 1OAQH 5FCUH 5F6HJ 1T1YA 5DD0L 1ZOXA 1TZHA 1IC4L 1A1NB 3W2DL 1NGXB 4Q7DA 2X41A 2JJWA 1AGDA 3N50A 3IDNB 3UJTL 4JM4L 2EDHA 4LVHC 2OXHA 3H9ZA 4YDIH 1A64A 3DMMD 1ZLVH 3BKJL 2CLRA 1UZ8A 4I9WD 2Z93B 4HZLA 2UYLB 4X9HA 4N0FB 5BMFH 3E0GA 3L1OH 4PB0L 1BBJB 3HC3H 1CICA 1MH5B 1UZ6E 5AYUH 2NY2B 1TETL 1A1MB 4NHUA 4P2OD 3DVGB 3IVKA 4LCCB 2HN7A 2Q20A 3MCG1 2XKNA 1VKXB 3PWPE 4M93B 3H9SD 5D2LE 5CZXD 1FL6B 1HSAA 3NFNA 4LKCA 2GTZA 2IH1A 4XHJC 3VGEA 1R0AH 1MVUB 3HCVA 3VI3F 5DD1H 1RUAH 5H37H 3G6JB 3UROR 5I8EB 3BWAA 5FOJA 3DVNA 1RK1A 2WMPA 5GSRA 3FB6A 3H42H 2RB8A 5IMMB 1MHEA 3BRFA 3TO4C 5AG9A 4MLIA 3B9KD 2GCYB 4G80B 4L8SB 1TCRB 4J4PA 3ZE0F 1CVSC 2B4CC 1F4XL 3LEXA 2DM2A 4NQCA 1NC4B 2IMMA 3HE6B 5KS9A 2ZSVB 2R23A 4I0CC 1OWRM 1ZHLA 1UZ6F 2HLFD 5FOBB 3LQAC 1J8KA 4S1QL 1KFAL 3U4EB 5C08A 3CVHL 3MV8E 1VA9A 4HGWA 4L4TB 2DTML 3FQWB 3B83A 5F7KC 5CJOH 3RPIA 3RZCB 2F58H 4JO3H 4Z76B 3BZEB 3VFPB 4AIZA 3EOAA 4PJ7A 5F1IB 1QYGL 3TC9A 4EXPX 4Y5YA 5F72S 1RVFL 3CC5A 3O45B 4YIQB 3V6OE 5JIKA 3D2UD 1I3RB 3BDYL 3KYKH 4OM1L 2A9NL 1TPXC 4M9OA 5EU3B 1EBAA 4GLRH 3FMGH 1C5DA 4PP1D 5HYJA 2OTWA 4JG0H 3WS3A 5DJDB 1CGYA 4MZ2A 5JR1H 1HH9B 3D0VB 2GK0B 2A83A 1N2RB 2GSGB 4OD3L 4ZODA 1F5WA 3WUWA 3GMMB 1F8TL 3ARYA 3NVQA 3RNQB 1GC1H 5D7JD 1LO4L 4LPYA 3F12B 3OXSB 1F6AB 5C0AD 5IVNA 3DURA 1XIWB 4K3HA 3B9EA 5HVHC 2P8PB 4E41A 3DRTA 4QKXB 1DZBA 2D03H 1ZXQA 4G6JL 5C3TA 4L4VB 4NYLB 4BFEA 2AXHA 1NCWL 5EUOE 4V1DB 1YNLH 2FGWH 2GFBB 3VFGL 1W8OA 4OZFG 1JV5A 4U1HA 4X6BA 4EUPA 1JZ3A 3BQUB 2BX5A 4EEEA 1N6UA 3GUTB 2ZP0T 5TJWK 5EWIH 4P5TA 4NBYB 1LO5B 1TZIA 3G5YA 4OFDA 2DQHL 2Z0BA 3FT2B 3KJ4B 1T2QL 5I2IA 5I76A 1T80A 1G7IB 1QSEE 4QF1B 5TDPB 4JN1H 2W07A 1KGCD 4KJQC 3MRLA 5IJKA 3FT4A 4G9FB 3MOAH 4KJWD 2ESVD 2G9HA 5BRZD 1FNFA 5AZ2L 4QHUB 1HKFA 5IVZA 4ENED 2DQTH 3OKEB 4K9EL 4K3JH 2VITB 3TO2A 3NCYP 4XCCL 4PS4H 3STLA 5EUOF 2FBJL 2Z31C 3UC0L 4QTIH 3ULUL 4MS8C 2Y5EA 2IAMB 1A1OB 2G75B 1OP9A 4UQ2B 5MEQB 3BPNB 4U3XA 5CIPB 3QPXL 2DLFH 1U58B 5TFSL 4ZTPH 4KV5E 3IETA 3MBXH 1LMKA 5TQ0L 3RKDD 3S37X 1A7OL 1T1YB 2EIBA 1TZHB 3PWVA 2YD4A 4XNXH 3QXDA 3ARPA 4GRWB 3KPOA 1O7VA 3I3EA 4QRRE 4IOIB 3MX0A 1X4YA 5CJXC 2CLRB 1UZ8B 1RU9H 3NTCH 1I1CA 1F2XK 4HZLB 5F44A 5DGQA 2CH8A 2DICA 5IROC 4PLJD 3IRPX 1CICB 1OB1A 4NHUB 3ZYOA 3W0WA 4Z95H 5SWQA 3IVKB 2HN7B 4RBPH 2XKNB 1OT1A 4HXBH 1XZ0A 1IKFH 2AEPL 1HSAB 2EXYC 3DYPA 1JTTA 3NFNB 4LKCB 4C56A 4KV5F 2GTZB 2IH1B 4Q9RH 2UZIH 1MRFH 4JG1H 1IM9A 4XAWL 4FRWA 3HCVB 3VD7A 3WFHA 4YO0A 1Q0XL 3BWAB 4DJMA 3DVNB 1RK1B 4PJEE 5GSRB 5ACZA 4JFDA 2X4RA 1MHEB 3MBED 4UV7H 5I1AA 1NKRA 4U7MA 5DXWA 3V9FA 1FQ9C 1CFQA 3LEXB 4BJLA 4H88L 3SGJA 3ZDZE 2VLJA 4NQCB 1SBBA 5KS9B 1WITA 2R23B 3Q5OA 5AZEH 3TLRA 2VLRD 1F4YH 5I73B 3ZO0A 5GS3A 3PDDA 2EE6A 5E70A 1UYWH 4YHMH 5C08B 3S34L 2R56L 4HGWB 1TVDA 2PN5A 3V5HA 4ZFOA 5E2WH 1PSKH 3RPIB 5I8OH 2ARWA 3F65A 2NY0B 3EYSH 4FTVA 4WWKA 4RFOL 3DI3B 1TIUA 1NFDE 2DLIA 4AIZB 3EOAB 4PJ7B 4FQ1H 4Y5YB 1SBSL 2B39A 2ITCB 4PJEF 3SCMC 1FFQA 3P9LA 1Q1JH 4KKCC 5DHVA 2XXMB 3IKKA 4P46A 2K9UA 1C5DB 4U3HA 5HYJB 3BUTA 2NY5L 2OTWB 4OF7A 3CK0L 3WS3B 3ZDZF 4Z6AT 1CDHA 3MRRA 1YECH 2LU3A 2VTFA 1UCTA 5KSAD 4EVNA 5B3JE 4LHQB 2A83B 2OM5A 4HWBH 1T0PB 4RCAA 3TBSA 5K59E 3WUWB 2NY1C 4KC3B 4NRYB 3AFLA 4A6YA 3D9AH 4JRYD 4M6AA 3KPTA 2VYRE 3L6FA 3BE1H 3MJ9H 5A43C 3EO9L 3EJJX 1FGNH 2BVPA 5FA4A 3TA3C 4HC1H 4HUNB 3DRTB 3QAZB 2XWTB 4PRPA 1E4WH 3AS1A 5KVGH 1Q38A 1NGPL 2JELH 3CH1A 1CIUA 4PG9A 4U1HB 1JV5B 4X6BB 5EOCL 5I30L 4EUPB 3NIGE 4KVNH 3WO4B 2MPAH 4R4BA 5FDYA 5B3JF 4FMFA 4P5TB 1X5GA 1TZIB 3G5YB 3SY0A 1MAML 5I2IB 5I76B 3CX5K 5JW5B 1PX4A 3WCYA 4IIQC 2P8MA 2QHRL 3TO4A 2J3SA 1WEJH 3FT4B 1N5AA 5B4MD 2BC4B 3QUZD 3VJ6A 1IARB 2G9HB 2W60A 3V95A 3LKNA 5E94A 1KLGA 3DUUB 4WU5A 5IVZB 2PNDA 1F4WL 4F57H 1TITA 2H6PA 1J1XL 1KELH 5ABDE 5TH2A 3TO2B 3U9PL 4NZUL 3STLB 1SY6A 3R8QA 3V6OC 2YUWA 5HYSA 1T22A 3GHBL 3NIGF 4ODBD 1TJGL 1BQUA 4RA0C 4X9GA 1Q72H 3JBG7 1BM3H 4G7YL 1MY5A 3CFEA 3UTOA 4JJHA 2HTKC 4HUKB 5HXMA 3IETB 2XRAH 4LKXA 4GKZA 3AS0A 2KKQA 4J3TA 3SPVB 3N1QC 3PWVB 1D6VH 4PJ9D 4TSBH 3QXDB 3S5LA 5HY9A 3DYOA 1EGJL 3KPOB 4FN0A 4YFLI 2VZUA 4JREC 4OIBA 4M1GL 3IAPA 2ZG2A 4PJAE 1OAKH 5J0BA 1UM5L 1DE4A 2E9WA 5C0EA 2ZCKL 2PYFA 5ADPH 5E2VL 1EHXA 2XG4A 3E8UH 5D1XD 3GI9L 4MD4A 4L8BA 3JSSA 3W0WB 5EU7E 5SWQB 2C5DC 2DQGH 2VUOA 3BMWA 4YBLC 1OW0C 1S7UA 1XZ0B 4MQTB 5J6GA 3ME0A 2BHZA 3VXTA 4PJIE 4ZTOH 1HHKA 1NAKL 2EO1A 2XZCL 3GJFK 1NAML 5F9AC 2FEDC 1IM9B 5SX4H 3DHJA 4KK5C 4ZNEA 3WFHB 3EDDA 3MV11 4OBRA 4YO0B 3TPUA 3X13B 5E9DE 3PGFH 5ACZB 5T3XD 5C07E 3D3VD 4JFDB 2X4RB 4FZ8L 2FWOA 4HF5H 4KAQH 1IGCL 4X9BA 5I1AB 2W9EL 1FC1A 1IRAY 2DS4A 1IBGH 4KKLC 1NLDH 3A6CH 5ACLA 5ESAA 1CFQB 4FQXD 3ULUE 2VLJB 2DL9A 4OZGA 4OGXH 2ZKHL 4P5MA 5F9OL 4F37F 3SGEH 4PGDB 2HKHL 4JFFA 5ISZD 4A2LA 4DUWA 1ZHNB 1BVLA 3V5HB 1BLNA 1I7UB 5GS0D 1GIGL 2IGFH 4KTDH 5AUMB 3TJHC 4PJIF 3MRMA 4TUJA 2ORBH 4BZ1H 2Z92A 4WWKB 4FTVB 1HHJA 2YD6A 2YRPA 3EUUA 1MPAH 2F5AH 5L6YH 3WEXA 2Z31A 2RCSH 3H7LA 4WO4D 1INDL 4RA3A 4LCIH 3REWA 3P9LB 1CXKA 1IM3A 1ES0A 1K8IA 2EDNA 2VLMD 5DHVB 5TF1H 4P46B 1EJOL 4NSKA 1T03L 4NKOA 1GGIL 2JTDA 3MRPA 3MRRB 1AR1D 4X7DC 3GSUA 4EVNB 5IK3A 4GAGH 3ZDYF 1T4KA 3TBSB 2XZAL 3LKQA 5FM8A 4LEXL 1SJXA 3T0EE 3LKRA 4A6YB 1MFEL 4P9MH 3BRDA 3QIWB 4F9LC 4BFIA 1R3IL 4LVHB 5DJ8A 2IALA 1I3GL 1KB5B 4RGNE 5CJXA 4DAGL 5E56A 1GGBL 2BVPB 5DK3A 3C60C 5FA4B 4QGYA 4RSVA 3OZ9L 1J5OH 4YPGA 4AQ1B 5D70L 3LPWA 1A7RL 2YD7A 5ADOL 1HIMH 4PRPB 4JHBA 4M62H 3GSVA 2CUMA 5IQ7H 1GCFA 3GGWA 5L8JB 5JW4R 4ZS7L 1NMAL 3CH1B 4PG9B 3VG9C 4MQ7A 3GBNL 1UKTA 2EEBA 4JPVH 5IBTL 3JWOC 3RVVD 4R4BB 1CFSA 1IL1A 3W81A 1BMGA 1JZ8A 4JHWL 3RIAF 1GZPA 3SY0B 4YFDB 3QWQB 4S1DC 2Q6WA 3VD4A 4MXQC 2P8MB 2OQJA 3FFCD 3FQRA 3RUGA 2BOBA 2A2QT 2UY7A 3HMXH 3TO4B 1VESA 1HQRA 1N5AB 4YBQC 4YDJA 3VJ6B 2W60B 3S37L 5IT2H 2ARJQ 3LKNB 5E94B 1KLGB 2H41A 4GXUM 4WU5B 5IB5A 4X6CF 4YR6A 2R8SH 3MTRA 4LRNH 3GSQA 4ZDHA 4KHXL 4ZFFA 5C0CE 5TH2B 1YEDA 4XBEL 1WT5C 4J23A 3V2AR 3ARFC 4UT6L 5HHMD 1CDJA 5HYSB 1T22B 4XRCA 2DQDH 3TT3L 5IFHH 2CPCA 3QIBD 4YWGH 2BFVL 4HFUL 4DGVH 3I3BA 4YHYC 4WHTA 4RDQF 4WU7A 3PHSA 4PJGE 4G6FB 4LCYA 1FCGA 3CFEB 3U79A 1A0QH 2CMRH 2AEQL 2KH2B 4JEGB 4J12A 5SWZD 2CDGA 1AHWC 2N7AA 4LKXB 1NANH 4GKZB 4QXGL 4DEPB 5JHDB 4Y19D 1IFHH 4XNQA 3SOBL 5DMGC 3L95A 3S5LB 5HY9B 3S3SA 3SDCC 1P53A 4XNMA 4OCWH 2E8YA 4TVSa 2BP3A 2OL3L 3O6ML 3IFNH 3C08H 1P7QA 3QDGA 3T0VA 5C0EB 4PJXE 2PYFB 4DZ8A 4YHPA 1VFAA 1XGPA 2CGRH 3QFDA 4HJ0D 1QKZL 2A73A 2QSCL 3TH2T 5KANI 5EZOL 1IGML 4DZBA 4NJ9L 3PWPA 4Q6IC 1X5LA 4L8BB 4MD4B 4E5XA 2RAMA 3LS5L 5D2LA 1A9EA 1P6AB 5I8KH 5I74C 2PXYC 3TA3A 2ZSWA 5HVHB 1S7UB 3C6LA 5J6GB 3VXTB 4JO1L 5I1HH 1HHKB 1X5HA 1MCSA 4HUWA 3V6ZA 4LLDA 4OF8A 2ATPA 2VXSL 2ICWA 3TPUB 2OXGA 1MJ7H 3GMRA 1V3MA 2FWOB 4YFLF 3S3JA 3VXSA 4KQ4H 2DQCH 5JW3L 3A67H 1GPOH 3FO9A 3VXPB 1LQSR 5ESAB 3TBWA 3ILQD 4OZGB 1A9BA 1S3KH 4JHAL 3RTQD 3MLUH 4P5MB 4YXHH 3VWJD 1UJ3C 5DA4A 5INCA 3MV8A 2E9IA 2YKLL 3P73B 3CMOH 4JFFB 4CGTA 1BVLB 1YEHH 1DUYA 4ZUWA 1BLNB 3EFDL 2I27N 1NFKA 4FFVC 4IRJA 1RURL 5HHOE 4OGAD 3MRMB 4TUJB 1RSFA 2Z92B 3GSNL 1HHJB 1A8JH 4P2QE 4D9QE 2X2YA 3MA9L 4MA8L 3WEXB 4K2UL 3V6OA 5KZCB 1TMCB 4KFZC 1TVHA 4ZOAA 3REWB 1XGYL 2EZ0D 1IM3B 1ES0B 1K8IB 1WVZA 5HHVL 1QQDA 3AC0A 5TF0A 4JDTL 1N64L 1KJ3L 3PP3K 4NSKB 4NKOB 2VABA 3MRPB 4UBDD 5BQ7A 4YPJA 4UTAL 1W72A 3UJIL 4CMHC 3GSUB 5CEXA 5IK3B 4OT1L 1K3ZA 1J0HA 1K9TA 2HJLA 4OF6A 1AQKL 4Z18A 1T4KB 25C8L 4XZUA 3LKQB 3W9EA 4K3DL 2VDNL 5CD5D 1FVCA 4RGMC 5DHVH 1DFBL 1B2WH 3LKRB 1LO2H 3PQYE 5FAAA 5KJRH 2JCCE 4O9HH 1QG3A 5F3BA 1F6LL 3CX2A 3HAEG 1H3TA 3HA0A 4BFIB 2NYYC 5EU7C 5DJ8B 4FFYL 1M71A 4OTXH 3PE9A 4FABL 4KZDH 4NQXA 4IRSC 3GJEA 5CJQH 4YPGB 3HG1E 1WBYA 3VXRE 4UV4H 5EUOA 3GSVB 2Z35A 3GGWB 4G7VH 4PUBL 4NWUH 4MAYA 1MCOH 4K9EC 3MA7A 4MQ7B 4OZFH 1KACB 2IJ0C 3N85H 3C2AH 1HINL 1CFSB 1IL1B 4MDJA 3MUY1 5A2FA 3ULUC 5F7LB 4GXVH 4XWOD 4YAQB 1GZPB 4N0CC 2Q6WB 1FNLA 3VXUE 4KPHL 4QHLA 4DKFL 2JCCF 2CKBA 1N6QL 1YC8A 5BZWA 1UKSA 4WCYL 4JM2F 2OQJB 3RGVA 3RUGB 3FQRB 4QRUA 2BOBB 1KJVB 2HJFA 1HQRB 5JPNA 2QR0B 2CO7B 4J7RA 3N1PC 4MJID 4OM0L 4YDJB 4EDWL 4JFEA 2IEPA 4JLRA 5E8DH 4YDLC 4P49A 4AG4H 4YR6B 2JK5A 3V7AG 3SE8L 4ZDHB 4ZFFB 3O81A 1YEDB 5I19H 1J1OL 5DVKA 2B4CH 3BESR 3LN4B 4XRCB 3P9WB 2W0FA 4WHTB 4WU7B 1QR4A 1C5BL 1MFBL 2P46B 3GRWL 3VFTA 4LCYB 3F6IA 4A2MA 2EDXA 2NXYC 4LEOA 2R39A 4EN3D 5FKPA 1C08A 2E7HA 1S7RA 4L1DA 4PIRF 2P5WE 2CDGB 3MCLH 3T0EC 3SKMA 4CW1A 4XNQB 3ORJA 1DANU 1KJ2L 3U6RA 1E6JL 1T6WA 3QDMA 4XNMB 4RGNC 4PB9L 1FH5H 3T2NH 2YWYA 1DDHA 3C9NA 2KZ1B 3QDGB 1FE8H 1P7QB 5H2BA 1JPSH 1V7NL 5DZLA 4NDMA 4DZ8B 4YHPB 1VFAB 1XGPB 2NY2D 2D7TH 3QFDB 2A73B 2WQ8A 4YQXH 4DZBB 3X3FH 3PWPB 4E5XB 3CFJB 5D2LB 1A9EB 3TA3B 1W0YT 3C6LB 4N8VG 4N90D 4XBPA 1OHQA 4KQ3L 4BFGA 5J1SC 1FNGA 2VIRA 2Y7QA 5SWSE 3QQNA 2H45A 4XGZA 4X4XA 3V6ZB 4LLDB 1WZ1H 2ATPB 1AD0B 2ICWB 1LDSA 4ZS6D 6CGTA 1ZMYA 2YD8A 4J3WA 4LSRL 1JZ7A 3GMRB 5HYQB 5EZIL 5C9KA 1JRHL 3VXSB 4R90L 3T0XA 4LIQL 2H2PD 3HE6D 3FO9B 5HGGS 1S78C 4NO3A 3TBWB 4I18B 2Z9TA 4HCRH 4R97C 2VC2L 1A9BB 1YNTA 2X4PB 3BAEH 4EDXA 2VXTH 5INCB 2WWKT 3MV8B 5F9DC 3C2SA 3FAWA 4M61A 5HGAA 2VR4A 2Y4SA 2CRZA 4G8IA 3EGSA 5DF0A 3FHAA 4NRZA 3E6HA 5ALCL 4ZUWB 4ALAH 4UI2A 1JZ5A 3RZCD 5MHSE 2LQRA 4IRJB 2UVFA 2XPGA 3MGAA 2R2HA 1JBJA 1NFDA 2OX5A 3OPZL 1CLYL 1FL3A 2A9ML 1T7WA 1WT5A 4KMQA 3RBGA 3ARFA 1UA6H 3SJVA 1CDGA 1KCSH 4LLVA 4EQ3A 1TVHB 1CBVL 4ZXBC 2W0PA 1MWAA 4H20H 4Y2DC 1T83A 1QQDB 5L7XL 3T4AA 3IAQA 3O3EB 2EYRA 5B8CC 1OARL 5EOQL 5GRUH 2VABB 2A0LD 5D2NE 3NPSB 2X9WA 2FSEA 3AREC 5BQ7B 2VDLH 1W72B 3UMTA 3MRFA 2HJLB 1JNLL 3MODL 1FPTL 4K7PX 4XZUB 3CDYA 3W9EB 3I2CH 1JGUL 1FVCB 2QJDA 1B0RA 5DRWA 4LVOC 1FLRH 3N1FC 2B0SL 1G84A 2D9CA 2B2XH 1OGAE 1M71B 3OKKA 4JREB 3ZL4L 1XIWD 4J6RL 4YUEH 2EE3A 4NQXB 3O2WH 4NP4H 1YYML 2GK2A 1JRHI 5FA3A 3BPOB 1WBYB 2I25N 5FFLA 2AJYH 4L4VD 3O9WC 3GNML 5GRVK 3WXVH 4MLSA 2Z35B 1A3QA 3QNXA 2K7PA 4KKAC 1MAKA 3QDJE 3E1F1 4MAYB 4U1GC 4TPRL 4QXWA 3BQUD 3MA7B 1JFQH 3S35H 4RMUA 3CVHA 3H9HA 1IC7L 3NIFE 4Y7MA 3X12A 1J1PH 5E8OA 4MDJB 4O02L 4NKIL 4JCMA 1YYLL 4G42A 4O5LL 5T3ZH 4X7SH 1AI1H 3TESA 4QHLB 1GGCL 2CKBB 2JJTA 4L8CA 5E4EC 5BZWB 35C8H 4RDQG 3RGVB 3LMJH 4G9FD 4QRUB 5F8RC 1TLKA 1ZEAL 2DKMA 1HHHA 2XTJB 4YK4C 2HJFB 3B5TA 2FB4L 5JPNB 2G5BA 2Y25A 1OD7A 2P5EB 3TEUA 4JFEB 4JLRB 2YRLA 2JK5B 1U8KA 1EUTA 1UJ3A 3VFVA 4F58H 4RMQA 1BF8A 5JOEA 5I75C 4P3DA 3GMOA 4H26A 4XMLL 4Q97A 4C4KO 4FQ2L 1NBVL 1CL7I 4FFWC 4HWNA 4YXKH 4PRAA 3V5DA 2W0FB 3ZKNC 4Y4FA 3A6BL 3VFTB 2ZCHH 3MLYL 3OGOE 3QH3A 4M7KH 1CU4L 3DO3A 4LEOB 2CK2A 5FKPB 1C08B 1S7RB 3CJJA 1FZJB 1SJVA 1T66C 3SKMB 4CW1B 1OTSC 4NN5B 3RVWD 3GZKA 1R3KA 1TZGL 1J8HE 3U6RB 3QDMB 4OIIL 3QUXC 3WHE1 4PJAA 1IJ9A 4OLVH 1DDHB 3C9NB 4R26H 1UXWA 1RIVH 4HLZH 1F90H 1DQDH 5H2BB 1CICD 1GH7A 1JGLH 4POYA 1FNSL 3QPQC 2IWGA 4NDMB 3HRZA 3EYVA 2GEEA 1EZVY 1MFCH 2VDRH 3TCXA 5CFHA 2APTA 4IRSA 4ZO7A 4PJIA 1BFTA 4AEIL 4Q9QL 3P40A 3O4LE 4XBPB 2WBKA 2C3GA 1CZ8H 3N9GH 1FNGB 2VIRB 2Y7QB 1XFPA 3DX7A 1TQCC 3MJ6A 4XGZB 4X4XB 4E0RA 1FIGH 3T8XB 4XMKL 5E9DA 2K3TA 3TV3L 2DBLH 5J12C 2EDTA 3VXOA 1CE1H 3CXDL 1XF4A 2YZ8A 2AEWA 1YEIL 1ZWIA 4J4PD 1XGQB 4Y4HC 1KF9B 1KIPA 4NO3B 4ODTL 1IAMA 5J9PB 3OX8A 2QQLL 3DJ9A 4XTRC 1NCBL 1AKJA 3F5WA 4OCNC 4Z7WA 4EDXB 5C08D 2Y06L 3MLVL 4Y1AE 4M61B 4WHCA 4G8IB 5F3HA 1U8IA 4NRZB 3E6HB 1SVZA 2XQBH 5MENE 2XPGB 1NGZA 3Q1SL 2R2HB 4NQSA 4OFPA 1NFDB 4U1NA 1N3NA 1FL3B 3BKYL 1YPZA 5D72H 1Z9OA 3BD5A 5DUPL 4UB0H 4R0LC 3ISWA 1OD9A 3ARFB 4WI2A 1IMHC 3SJVB 4I3SL 2EO9A 4LLVB 4H1LA 1N7MH 1UWEL 5I1CH 5LCVL 1EHLH 1MWAB 2CDFA 3T2OA 1IKNA 1ETZA 3T4AB 1AY1L 2DIBA 2EYRB 2CK0L 5ID0A 4L8DA 1ZGLA 2V9TA 2FSEB 2R0WL 3MRFB 1BD2E 1IGFL 4OFVA 1Q9KA 5GGQH 3T0EA 4BUHA 2MKLC 5DRWB 2PTVA 1N4XH 4XCYA 4QRPE 3GKWL 3BN9D 4OCYL 4JHZA 1ZLVK 3LVEA 3OKKB 2GJZB 3LHPH 1PG7X 1D9KC 2XWBA 4JRXA 1U6AH 4BH8B 5FEBA 4E41D 2NLJA 2PTTA 5EU6A 2AGJL 1HN1A 5FA3B 4GFTB 1CLOL 1Q9OA 4HXAH 4Y8AA 3QNXB 4MSWA 1B6UA 5I74B 4Z7VE 5HI4D 1FDLL 2P45B 3HLAB 3CVHB 3H9HB 4P5TD 1INEL 2SEBA 3X12B 5C0FA 4HT1L 2LVCA 2VLLA 4Q0XL 1HNFA 3B2UC 1CXLA 1V8HA 4NC0B 4NNXA 4L8CB 1BFVH 1I4FA 3B43A 3TN0C 1A6ZA 4G9DA 3VGAC 1HHHB 3SKUD 1ZS8A 4ONFL 5I1GH 5KOMC 2G5BB 1Q9WA 3MOBH 1QPPA 3L5WA 3WLWC 1RUKH 2CKBH 1U8KB 1UJ3B 1X5IA 5FO9A 4P3DB 4H26B 3P0YL 4ZO8A 4Z7VF 1BWMA 4POZD 1AXTL 3OR6A 1LP9A 1T2JA 3NGBB 2WQRA 3ARXA 4PRAB 4PJGA 3BI9X 1CK0H 2ADFH 3V5DB 4Y4FB 1X5YA 3ESUF 1EO8H 1G1YA 3HFMH 4GJTB 5D2NC 2I07A 3QH3B 4F2MA 3KLHC 1IQDA 4JO4L 5D7KD 1IGIH 3IDIA 5F96L 3I75A 4NKDA 5B8CA 5ENWA 1JZ2A 4LFHD 4DN3H 4RMTA 4PJAB 5T33L 4HBCL 4MJ4A 3BW9A 1RUML 1MEXL 4LSTL 5GJTH 1UXWB 2VSDA 4PJXA 4MX7A 1ZLWK 1L7IL 3ARBC 3C8DA 1NUNB 3HRZB 3EYVB 5EBWA 2IBZX 4LP5A 2P43B 3W0WD 3IDGA 1PY9A 2EIZA 4HJJL 1VHPA 5FECA 3QXVA 4C56D 3RA7L 5A40E 1CD8A 1IM9D 3DX7B 4E0RB 1KUMA 4HUVA 3QCTL 1NDGA 5E9DB 3UTPE 4ODVL 3RAJL 4JFDD 1P4IL 2IPTH 3UYPA 1I8MA 3VXOB 5C0GB 3U1SH 1XF4B 1ZWIB 4KY1L 1FO0A 4HS3A 5IESH 4O51A 2IPKA 3MXVL 3TVMC 3OX8B 1MFDL 3QHFL 1KEGL 2BRRH 1AKJB 1P2CA 3F5WB 4N68A 1RULH 4Z7WB 1OY3B 2GY7B 1LO0H 1K3IA 3WKML 3JWOH 1KPUA 3BSZH 2BVUA 4EI5C 1U8IB 1MCWW 5FYJD 4K7PL 2V7NB 2QQNH 4FTVD 1NGZB 4KK6D 3A6OA 3RKPA 2DQIH 1C12A 4NQSB 1MNUL 3ROOA 4HUUA 4U1NB 1N3NB 1RJZA 1YPZB 3VG0L 3WKNA 4L29A 4YDKL 3SDYL 4F33A 4NUJA 3P30H 1QVOA 2YZ1A 5DD0H 4H1LB 1IC4H 3W2DH 1UB5A 4P46D 3K3QA 2MMXA 2CDFB 3ARGA 1ETZB 4KI5E 3UJTH 4JM4H 2ZOLA 2VB5A 1KG0B 3WIFA 5ID0B 4L8DB 2NXYB 1ZGLB 3FFDA 3BKJH 3FKUS 2AVGA 1O0VA 5GQBA 3U30C 4F3FA 1HDMA 4LSVL 3T0EB 1Q9KB 5HI5C 4PB0H 4KMTL 2R9HD 4XCYB 2DQFB 1NAMA 5DUBA 4RGNB 3QUXA 3HAEH 2F15A 3KJ6L 1UB6A 2XWBB 4JRXB 2BDNL 4XNUL 2NLJB 2PTTB 5EU6B 1CWVA 1I1AC 4PRPD 1X3DA 1PGRB 2FX9L 2BHUA 4RFNC 2IPUG 4R7NA 3OG6B 4ZSOE 1Q9OB 1T20A 4QOKE 4CBPA 1UENA 4W6WB 3NZHH 1FRGL 5E8PA 4OZIA 4XCEB 3MV9D 2O5YL 4MSWB 4KI5F 4Z78A 2ZUVA 1CD9B 1HSBA 4XHJD 2VL5B 4I2XA 1UT9A 3RDTC 2X70B 2SEBB 5FCUL 4WIQA 1F4XH 5C0FB 4WFGE 4PJHE 4MA1C 4J2XA 2VLLB 3EHBC 4POUB 5HGBA 5ICXA 1S9WA 5JUEL 4NNXB 3TO4D 1I4FB 4S1QH 1KFAH 1A6ZB 4G9DB 1ZS8B 1I1RA 2DTMH 1Q9WB 3LN9A 3WNPA 1NFIA 3L5WB 1JGVL 3ZKQD 1QYGH 5FO9B 4JRWA 5K9QI 1RVFH 3BDYH 3OR6B 1LP9B 4OM1H 2A9NH 5GGSY 4PJGB 2R1WA 4G6FD 1NMCC 5KW9L 4GG6A 2C4XA 2I07B 4F2MB 1RUAL 2QEJA 1AIFA 2EE2A 4TOYH 1IQDB 4OD3H 4U6HA 1JF1A 3IDIB 5DD6A 4LPWA 3I75B 2E3VA 4JFXA 1LO4H 4M7LT 4NKDB 5B8CB 4RAUA 3SO5A 3BW9B 4Q2ZA 4PJXB 1BREA 4MX7B 3DVIA 3IU3A 4MQXC 2EDWA 5CBAB 3BKCL 1PLGH 2VZ1A 4G6JH 4LVOB 3JV6A 5EBWB 4XB7A 3IDGB 1NCWH 4WV1C 2EIZB 5DT1L 1MCLA 3VFGH 5E00A 3MLXL 4NNYB 5FECB 4PYGA 5D93B 1DQQA 2MWCA 5A2LH 4KI1A 4PJBA 3QEQA 4HUVB 2DQHH 2CLZA 1T2QH 1NDGB 2Q7NA 3NFPA 1H8NA 1D6EA 1I8MB 2PETA 1OAZH 2ED7A 1BF2A 5JXAL 2VSCA 5GS2H 1FO0B 2GSIA 4KUCF 1KSRA 4HS3B 5AZ2H 4Z5RA 1G7PA 5JO5A 4O51B 2IPKB 2E7CA 1P2CB 3QXWA 4K9EH 4KJQD 5E4EB 2VDPL 4JFFD 4XCCH 4JQXA 2EDDA 2EE9A 1DVFC 2FBJH 2R0KL 3M17A 3UC0H 1XCQA 4EBQL 1KPUB 1NKOA 2VR9A 5DC9B 5CUSL 5EOCJ 5KTEL 4LAQH 4OAWA 2N1KA 4ZOCA 3UX9B 1B90A 1C12B 4DCQA 4HUUB 3W9DA 3QPXH 1RJZB 3RU8L 2Z31D 5TFSH 1UG9A 5I75B 1SM3L 5KZCD 4L29B 5E1AA 4MS8D 4F33B 1PG7L 4NUJB 1QVOB 1WTGT 1ZAGA 2P8LB 1A7OH 3LSOA 2NXZC 2MQCA 3ARGB 4WTZA 2ZOLB 3WIFB 1FV1A 3LPFA 4XPBL 3FFDB 1XCTA 3VA2C 5LKNA 1JE6A 3IFPA 3WN5B 1LGVA 4F3FB 1HDMB 1X5ZA 5F71A 1L0YA 4UNVA 5F7MC 5JIIA 1OGAA 3WXWH 5ICZA 1IAKA 4NM8L 5DUBB 3QUXB 4FZEL 1U93A 1UB6B 1GOFA 1NCCL 2VQTA 4GLRI 3X14A 2FIKB 4PBWD 1IZKA 2AEPH 4P3WA 2WP3T 5EIVA 1RZ7L 2QKIA 2X44D 3ARBA 1F97A 4R7NB 5T3ZD 1T20B 4XAWH 1L6XA 1XF1A 3LQMA 2YSSA 4OZIB 1Q0XH 2DI8A 2EXYD 4HPYL 4Z78B 1QLFA 1HSBB 4I5BB 4X9IA 3SN6N 4I2XB 2MQ0A 3RJDA 3NACL 4CVUA 4ZAKC 5HGBB 1HHGB 5HYIA 5ICXB 1TENA 5J12B 1S9WB 3IAGC 4EJ1C 5IWLC 2VN7A 4IMLA 1JGDB 3S34H 2R56H 4JDVA 1TQBC 4BQBA 1RU9L 32C2A 1HYSC 2PW1A 3BYTA 1HHIA 4RFOH 2E6QA 4R96A 5D7LA 3B2VL 3FONA 1SBSH 4HXBL 4EI5A 3FO1A 3DX9A 3CU7A 5I1KL 4MAUL 4X6EA 2GJ6B 4KWUA 1CLZL 1ZV5A 2DQUH 2R1WB 1MRFL 4KI5C 3RX8A 3OKYA 5J3HD 4Z7UE 2ZJSL 2NY5H 2JLLA 3CK0H 4HIXL 4GG6B 1OSPL 1OP3H 3EO1A 1AIFB 4KKCD 2O5XL 1AR2A 5MI0B 4R7DA 1M4KA 4U6HB 1JF1B 4NQEA 3B3IA 5DD6B 3O2DA 4JFXB 4TNVF 1I85C 5CKAA 5AZEL 4RAUB 5L2KE 4NHCL 3SDDC 2FRGP 3EO9H 3KXFA 2NY1D 4Q2ZB 1IILE 4OZHE 3P9MA 2VERN 1T04A 5BV7B 3IU3B 3MRNA 3B8SA 4I48A 3PWPD 4PD4K 1PY4A 4NN7B 4DFHA 4WHDA 4YHKL 2ICEA 4AT6A 3TA3D 4Z7UF 5E00B 4URTB 3KS0J 3OXRA 5EOCH 2G5RA 5I30H 1BEYL 1G9NL 1I1AA 2VH5L 4NNPL 1DQQB 3VMOA 5IVOA 4NZJA 4XPGH 4PJBB 5DURB 3QEQB 1WGOA 2BJML 2CLZB 1MAMH 4WW2A 3HC4H 3NFPB 1BPVA 5TDOA 3UTTE 1D6EB 1V05A 2QHRH 4WRLA 1OPGL 4IOSD 4WI3A 3TZVC 1N5YL 1YECL 1CFNA 2HT4D 1FC2D 2ZUTA 1MCQA 3QUML 2GSIB 1SMOA 4Z5RB 1G7PB 1MCKA 4LCWE 4WJ5B 1Z6JT 1OSZA 3BZ4A 2YC1A 2YPVL 5JO5B 1JPGB 2YXFA 4MB5A 1F4WH 1HI6A 3MV8D 3D9AL 3GRWA 4W4NA 1J1XH 4L1HA 2PKDA 5JHLL 1JP5A 3U9PH 4NZUH 3RNKB 2VISB 4P2OA 3VGAB 2CD0A 2H1PL 6FABL 3M17B 3L5HA 4IRJD 5MENA 2CDEA 3GHBH 4OAWB 4M1DL 1TJGH 2Q8BL 1IAIM 3ZZ1A 2ADGA 3SE3C 4DCQB 5HSFA 4G7YH 1XF3B 2J1KA 3U0WL 2NY4B 5E1AB 2Q8AL 2Y9RT 4MZ3A 3BWUC 3FRPA 3AMLA 2WBWB 4KVNL 3O41A 2X1WL 2BVTA 3LSOB 3Q6FA 4WW1A 5HGHA 3B9KA 1EGJH 3S97C 5IMKA 2HTKD 1WBZA 1FV1B 4M1GH 1XCTB 3T3PE 2B5IB 4YBHA 1UM5H 1E28A 3AS3A 3DTXA 2YUVA 5ICYA 3QR2A 5I17A 5E2VH 1OGAB 3TH3T 5ICZB 1CTNA 1IAKB 3PHOA 4M6NL 5CSBA 1VEPA 1KLFA 1O5DT 1X7QA 4KKBC 1SEBB 1U93B 2JJUA 3X14B 3DSFL 3IFLL 2QKIB 3ARBB 1NEZA 3HZMA 1NAKH 4YFEA 1DQML 2XZCH 4L9LB 4XVSL 1NAMH 1RI8A 4J3VA 3V52L 4MAYD 4WV1A 4Z7VA 2YSSB 2ZPKL 3HB3D 1ODAA 4LVNB 1Q72L 1MRCL 1FLTX 1QLFB 3EJYC 5TE7L 4FZ8H 1BQHA 1IGCH 1LHZA 1XH3A 2W9EH 5GPRA 2XRAL 2FEDD 4EQ2A 2XA8L 4KK5D 4AJ0A 4U6TA 1A6TA 2ZKHH 1NQBA 1QSFE 5F9OH 2VLKA 1S9YA 2HKHH 4IMLB 3UCRA 4KKLD 4JDVB 5E08L 3DROA 4JFED 1GIGH 1Y6NR 1GJIA 32C2B 3QG6A 4P99A 5C7XH 2PW1B 5JZ7C 1HHIB 2LVEA 2D9QB 2NY6B 2ATKA 4R96B 1BJMA 5D7LB 3RWGA 3FONB 4PRDA 3LD8C 2P48B 1INDH 3FO1B 3DX9B 3QB7C 3GSWA 1T1WA 4X6EB 5DJ6B 3OAYH 1YC7A 1EJOH 1T03H 4QHKJ 1CFVL 4OJFL 4CU6A 1GGIH 2R0ZL 1DEEA 3EO1B 2AV1B 4GMSL 4KAQL 2ICCA 2XZAH 4MNQA 2J8UB 4R7DB 4NQEB 5TGBA 3B3IB 4DN4L 3B9VA 4LEXH 4I4WA 4MB3A 1MFEH 2ESVA 4HMEA 1VERA 3ALXA 5BRZA 5A2KH 2V2TA 1R3IH 3RWCA 2EIEA 3ZTJG 3PWNA 2X05A 4DAGH 3U30B 3KXFB 1GGBH 3BUYA 5C0BE 3MNWA 3OZ9H 5D70H 1A7RH 1T04B 5ADOH 3MRNB 4I48B 1FAKT 1A6PA 2VZ3A 3VDCA 4ZS7H 4HIJA 4XP9L 3BEWA 1NMAH 2ICEB 1OAYL 4AT6B 3C60D 3OXRB 5IKCA 3GBNH 5IBLC 5L6YL 5IBTH 1F4HA 1I1AB 3GEWB 5I1DA 1DBKL 2XN9E 3ARTA 4JHWH 2BCKB 5C1MB 3U83A 4X4YA 5DWUL 1QFOA 4WW2B 4PRIE 3ZE1E 5TDOB 3RPKA 4KMLB 3BPCA 5J1TC 3RL2A 1J10A 1IGTA 4OCSH 1CFNB 3DMMB 2I9TB 1P9MC 2EEAA 1R3HB 3S37H 1FIEA 5H35A 5F7UA 1OSZB 3BZ4B 2YC1B 4ZAKA 3RZWA 3MV7A 4JFOA 3HZKA 1HI6B 2ZUXA 3LKPA 4XP4L 5IWLA 4KHXH 3TT1L 2W65A 3CFCL 5SX4I 4XBEH 4P2OB 5CKGA 4YBQD 3BXNA 5C0NC 4UT6H 1R3LA 1SYSA 3TT3H 3V0WL 3H9SB 2CDEB 1UH3A 2BFVH 2IFFL 3AM8A 2HT3D 3QA3A 4HFUH 5EU5A 4N0YL 5KN5A 5GZOC 4M62L 4XI5D 3G6DL 4OLUL 1UCBL 4WI7A 2M26A 3ILPA 3ARFD 3SJVD 1DQJA 2AEQH 2X1XR 4M9PA 2UV3A 4QXGH 3O41B 3MBEA 4TN9A 3SOBH 5C6WH 1LE9A 1G1CA 3Q6FB 3CDFA 3QP3A 4WW1B 5HGHB 3H7BB 3O6FA 1NMCB 3B9KB 4HIHA 2ZNWA 5IMKB 4NO0A 1YEFL 3QXTA 1WBZB 4KDVA 4ODSL 4XXCC 2OL3H 3O6MH 2NZIA 1U41A 5D7SL 4KKNA 4D9LL 1E28B 5DMGD 3DTXB 1H3XA 5ICYB 2X09A 3KLDA 2BZDA 5I17B 1QKZH 2QSCH 1JYVA 1NEUA 5DRNA 1IGMH 3PHOB 4NJ9H 3LS5H 1F42A 1X7QB 2VRAA 3SDDA 2C3WA 4FOMA 2VZTA 2GY5A 4KGLA 4LGPB 4JO1H 5J89A 4Z0XA 4ZSOA 1NEZB 3HZMB 1GOHA 4RISL 3IU4L 5DSCA 3VH8A 4XWGL 3M8OL 4WV1B 2PYEE 5DVNA 1KBGL 3QQ3A 1VFMA 5IMOA 2X1PA 3OQ3B 3FZUD 1RIHL 4Z7QE 2DN7A 1BQHB 1S9XB 1XH3B 2X4OA 5JW3H 4H1LG 3A0OA 1KCVL 3K1KC 3K8KA 5EBMA 5KSAA 4PJHA 1YEGL 1FAIL 4NO5A 1EFQA 3D39E 4FQJL 4MQSB 1A6TB 1OQXA 2J2ZA 1X44A 4JHAH 5J13C 2VLKB 1S9YB 5IV2A 2YKLH 3TZVA 4NCC1 3DROB 3EFDH 3G9VA 3BGFC 4P2RE 3QG6B 1RURH 4YHZL 4JANA 3ARWA 3GSNH 3VU2A 3K1DA 2ITDA 5H94A 1IQWL 2ATKB 4AQOA 2J6EA 3OL2A 3RWGB 5MEOA 4PRDB 4MA8H 4K2UH 1QUNA 3QI9A 1Y0LA 4FFVD 2ZUWA 3CFIC 4XPFL 4I0PC 1XGYH 1CYGA 3GSWB 4UOW1 1T1WB 1JHLL 4M5ZL 4P3CL 2YN3A 5HHVH 1FN4A 2NTFA 4JDTH 1N64H 1KJ3H 3IRZA 4TVPL 5ITBL 5DMYA 4UTAH 3UJIH 1DEEB 4OT1H 4PJDE 1AQKH 1UEMA 4QRTB 25C8H 2VZSA 4MNQB 5TGBB 4K3DH 2VDNH 2AP2A 2XICA 4XX1E 3UDWC 2J5LB 4KGJA 3ZYJA 2NXZB 4I4WB 4HK3N 5GGVL 2ESVB 5LWYL 2HKFH 5BRZB 1KIUA 3RWFA 2V2TB 1A2YB 3RWCB 2P24A 1S3KL 1VDGA 3PWNB 4FABH 3DBXA 3BUYB 4YXLL 3MNWB 5HD8C 1WCBA 4LP4A 12E8H 5E2JA 2NYYD 4JZJA 5BVJA 1MI5E 5B38G 3HZVA 4PUBH 1P84J 4IRSD 4HIJB 3BEWB 3BVNB 1AJ7L 1QBAA 4GRMB 3UJJL 3B4NA 4OF5A 3KHQA 5IKCB 5GJSL 3L3KA 4FXGA 3HNVL 5IEHB 5I1DB 1HINH 2GITA 4PJDF 5FV2A 5E9DD 2X10A 4X8JA 2ARJA 4X4YB 3RIFF 4KPHH 4DKFH 1BGXL 1N6QH 3P3YA 4LLAA 1BOYA 1LO3L 3BPCB 3RL2B 1IGTB 4NT6A 3ULUD 5FYKU 5IFJA 3I50L 3MO1A 1W0WA 4OM0H 4EDWH 4N0CD 5H35B 1AKJD 4GOSA 4WFHE 4ZAKB 4M00A 3MV7B 3SE8H 4JFOB 2QSVA 1Z5LB 4MA3A 3S4SA 1BWWA 2W65B 4LSDA 1J1OH 3AAZB 4N8CL 3HUJE 5CGYC 2G2RA 3BXNB 2ERJC 1EO7A 1R3LB 1MIML 1SYSB 5I15L 4NIKB 4J8RA 3DV6A 3QA3B 5KN5B 1JTOA 2J12B 2ZUYA 5EU5B 1C5BH 1MFBH 1RHFA 4UV4L 4B53A 4JKPL 4TULL 5DZNA 5J1AA 3ILPB 3VDAA 1MCEA 1DQJB 3K8LA 1TNMA 3LV3A 3D3VA 3DXAA 1QBLL 3MBEB 1LE9B 4HLJA 3VWKA 3O6FB 1KJ2H 4HIHB 1E6JH 2NXYD 4OI7A 4PB9H 1ADQL 4NO0B 4X4MA 2HP4A 3TNMA 3T0ED 2YD1A 4DK6A 2I26N 1V7NH 3HUJF 3WUZA 4NQDA 3TBVB 3VXMA 3FAXA 3M45A 4RGND 1RZGA 1YMME 5DRNB 1B3JA 5SX5H 4AG4L 4JRXD 3SDDB 3VD5A 4PJ8A 4WTWA 5EU6D 5DQ9A 1J88A 4OCMC 5F6IC 5HGDA 4KQ3H 5DJXA 4ZUSA 2VXUL 3C8KA 4ZSOB 3OBAA 3TIEA 4HIEA 4WO4A 3U4BL 5DSCB 3GIVA 4EZMA 4G5ZL 5JTWA 3QQ3B 4APQC 5IMOB 4LSRH 1D5ZA 1ZTXH 3V8CA 5EZIH 1JRHH 4HS6A 2X4OB 3UYOD 4R90H 1BFOB 1T0MA 1I7ZA 4LIQH 4PJ5E 4W4OA 4OFYA 5EBMB 5KSAB 4PJHB 3QHZL 4NO5B 4HQQL 3OAZH 2VC2H 4JPWL 2CRYA 2OP4L 4N8PA 5F9WC 1G7QA 2XY2A 3TZVB 3T2NL 2FX8L 3ZHDA 1CE6A 3MNVA 1P9MA 1S78D 4I0KA 4DKAA 5ALCH 4FMKA 4RGOL 4JANB 5GS1B 4YH6A 3OPZH 1CLYH 5I16A 5H94B 2ITDB 4BK5A 3QEUA 2A9MH 1HXYA 5MEOB 1W8NA 3K46A 3VRLE 3PIQA 3QI9B 1DCLA 1KV3A 3EZ8A 1CBVH 1RIUL 5F7FA 2LV4A 1FN4B 3SDAC 2NTFB 5L7XH 2F8XC 3IJSA 1OARH 5EOQH 2VO5A 2BNRA 3D18A 4KU1A 2YA2A 5FGSA 1JNLH 3MODH 1FPTH 4ZXBD 4Y2DD 1G9NC 1JGUH 4LBEA 2O26U 2AABL 5JPMB 5C0AE 4W81A 2J4WL 5BS0E 2B0SH 3QUZB 3WSQL 3ARED 3RWFB 2FX7L 3AY4A 2P24B 4HEPG 3ZL4H 4HW6A 4J6RH 1Z2KA 3SGDH 4OZHA 4UT7L 4U7KA 3DBXB 2DKSA 1K5NA 4NWTL 3SE4A 1KCLA 5FDWA 4BZ2L 3GNMH 3UPAA 4JZJB 1FSKB 4U7SA 3HZVB 3QIBA 1JPST 1DBML 1HKLH 4TPRH 4NCC2 1AH1A 1IC7H 3IJYA 5F97E 4FXGB 3O9WD 3RWDA 2GITB 1CVRA 5D96C 4O02H 4NKIH 4WDIA 1YYLH 4O5LH 3STZA 4KKAD 2ARJB 3UTTA 3WBDA 3SEPA 4NN6C 1G7JA 1GGCH 2H2SD 3U7YL 5FYJU 4BK4A 4CVZA 2MJWA 4QXUL 3CLEL 5GGRY 2E9BA 5GGUA 4QGTA 4NT6B 1OAUL 3VMPA 5IFJB 5KBNC 5E99H 3MO1B 5D6DC 3L3IB 4PYHA 3ARRA 1CGVA 4MA3B 3S4SB 1QFUL 3DVFA 5D1XB 4BSVA 4TVPE 4WI8A 4XMLH 1VGKB 2G2RB 3MRQA 3NCJL 5HHOD 1E0OB 3C5SA 4FQ2H 1NBVH 1UXSA 2RQ8A 5BXFA 5ESVA 4J8RB 4D9QD 4JY4A 5IB1A 4HJGA 4PRBA 3A6BH 5GS0L 4PJCA 2HA1A 3MLYH 4OCXL 2YXMA 5J1AB 1CU4H 3LD8B 5J56B 1LK3L 5JW4M 1KEML 3GSXA 4FFWD 2AERT 3LV3B 4F7CA 3D3VB 3DXAB 1HXMA 1EEYB 3QEGL 3VWKB 1BX2A 3K4ZA 1TZGH 1MQKL 4OIIH 2CRMA 3QZWA 1Z0MA 1P4LB 2IBZY 3TNMB 3PQYD 4KRMB 1OTSD 4CDGC 1H0DA 1A6AA 1FNSH 3UDWA 4NQDB 3VXMB 5ISZB 3QUXD 1RZGB 3ABZA 2V2XA 1BP3B 4AL8L 5LGHL 4XC3H 3KPQA 1WAAF 4M03A 4PJ8B 3HG1D 3RVUD 1CGSL 3QPQD 5DQ9B 1VPOL 5HGDB 4AEIH 3CIQA 5DJXB 4NKQB 4ZUSB 3O3AA 3SDXA 4CU8A 3C8KB 3TIEB 4HIEB 4WO4B 2WK2A 4XMKH 1DUZA 2A77L 5LBSL 2BMKA 3VFWA 1D5ZB 2KPNA 3CXDH 5C8JA 1BAFL 1YEIH 3AU1A 4HS6B 1T0MB 1I7ZB 3AB0B 2Q3AA 3VXUD 4ODTH 5EU4A 3FB5A 4PTUA 1QSFA 2QQLH 4HKXA 1NCBH 3ULVL 3CSPA 3C5JA 2Y06H 3MLVH 1G7QB 4Y4HD 5JQ6L 1SYVA 3DRQB 1R3JA 3MRDA 1CE6B 4M7ZB 1EHAA 3MNVB 1UH2A 4JN2A 4R26L 3MUJA 3MRCA 3DGCR 4XTRD 3Q1SH 3BGAA 4UAOC 4RMWA 4X0KA 5I16B 2EH8L 3BKYH 2EICA 4GH7B 3QEUB 5DUPH 3VXNA 3PIQB 5GXBB 1A21A 1D5IL 2YWZA 5TE6L 5JDJA 1M6OA 1WUNT 1HWGB 1UWEH 5LGJA 5LCVH 3CVIL 1XEDA 2NW2A 3ZTNL 2C26A 3IJSB 3NCCB 2CK0H 1JMZA 2BNRB 2H3NB 2P5WD 4HMCA 1YEEL 3D18B 2R0WH 1VFBA 1IGFH 5E8NA 4JRYE 4GAYA 4LBEB 1JZ6A 3V5KA 5I1IL 4MMZC 1U36A 1JUFA 4OCYH 4W68A 1NJ9A 5B3NA 1P1ZA 1WZLA 4OZHB 3QUKA 3ZTJH 2WWKO 4NQVA 4LVEA 5FO7A 2AGJH 3R4DA 1M7DA 1R5IA 3OJVC 1CLOH 4N9GA 5JIPA 4FS0A 1U3ZA 2GQHA 4OLWH 5FDWB 5I0DA 1PKQE 5DEGA 4MXVE 4KZEL 1D9KD 2DLGA 3QIBB 1E4XL 5DHXB 1AO7E 1FDLH 5SWSD 3E3QC 4JFYA 3IJYB 4D0CA 5DJ2B 4LARL 5DURD 3RWDB 2HLFC 4WDIB 4PRIA 3STZB 3MR9A 2VKWA 4Q0XH 2P7TA 2VR5A 3UTTB 5D5MF 2F8OA 3BKML 4RZCA 1G7JB 1I9RL 2VDQL 1MCWM 4CAGA 1WF5A 2MKWA 2BRQA 5GGUB 3TNNA 1JI1A 4ONFH 3VGFA 3V4PL 1MFNA 3CCHA 2F53A 3B2UD 1UJTA 3E2HC 4KUZL 1JHTA 4Y5XA 2EDEA 1AE6H 4KH2A 1BIIA 2CUIA 2K7QA 4MXVF 5F89A 1RZFL 4BSVB 2AJUL 5MHSD 3P0YH 3MRQB 1INQB 1AXTH 4ZOBA 5DR5L 3UBXG 1UXSB 4H8WL 4XHQA 3WLWD 5BXFB 4AH2B 5EC1A 5ESVB 1GGTA 2X4TA 1YEKL 4JY4B 5IB1B 4HJGB 4PRBB 1MSPA 4PJCB 2DJ4A 2NY4D 3C87A 1KLUA 3GO1L 4GSDL 3UYRL 5CP7A 2D4DA 5TQ2L 5D7JC 3GSXB 4JO4H 3ET9F 4UQ3A 5I1JH 1EV2E 3MYZA 3IJHA 1BX2B 1T21B 2Z91B 1QP1A 3H8NA 4FXKA 4WWID 1VENA 1X5AA 2UWEA 4NBXB 5T33H 3QZWB 3JTTA 4HBCH 3GSOA 1RUMH 1MEXH 4LSTH 4FG6D 3DX6A 3G08A 1H0DB 1A6AB 1L7IH 1OGAD 3WDIA 1GYAA 1IEAA 1B4JL 2O61A 2V2XB 2V9QA 3PXHA 1B4RA 1WZKA 5EN2A 3KPQB 1EO5A 1PZUB 1FBIL 3RA7H 3ARBD 3SDXB 3O3AB 5EA0L 4HWBA 3V8OA 3QCTH 1FG2B 4LDLB 2R2EA 4ODVH 2Y36L 2XV6B 2YMXH 3RAJH 1P4IH 2BMKB 3M1BA 4LAJH 2HRLA 3VFWB 5IB3A 5GGTL 5KAQF 2EYSA 3WIIH 5C8JB 3MJ9A 1DLFL 4UT9L 3AU1B 3RI5K 4KY1H 2WINA 5E6IC 4MA7L 4MB4A 3HHRB 2CKNA 4HC1A 4MD5A 2Y1VA 3RY4A 3MXVH 5EU4B 3FB5B 4PTUB 1MFDH 1QSFB 3QHFH 1KEGH 4HKXB 3C5JB 2YHGA 4U1IA 4OB5L 4NFBA 4EI6A 1SYVB 3WKMH 4C58B 1R3JB 3OB0K 3MRDB 4H0GA 5BO1L 4JN2B 1J87A 3TVMD 4K7PH 2DM7A 1CIDA 2ED8A 2FHBA 1JJUA 4X0KB 3VG0H 4YDKH 3ARVA 3SDYH 3VXNB 1IEHA 4EI5D 2VLME 1M6OB 3Q2CA 1AP2A 5LGJB 1F4AA 4J1UA 2NW2B 4GT7A 1DL7L 1S7XA 3UAJC 2D7QA 4PJDA 2ID5A 1MCDA 1K4DA 3W5NA 5DJAA 2FBOJ 4NQED 3BPLC 2FIRT 4LSVH 1C16A 4RX4A 5E8NB 2R0LL 4TSCL 1S7SA 4GAYB 4KMTH 3V5KB 5E5UB 4GRLC 2QHLA 5DJZA 1JUFB 1JF6A 1NJ9B 3KJ6H 3RBSA 3KXFD 5EUKA 1P1ZB 1EA9C 1N0LA 2BDNH 2EDQA 4UMGA 3QUKB 1U8NA 4XNUH 5HI5D 4NQVB 5C2BL 1M7DB 1R5IB 2FX9H 3QO0A 4GKNA 2R1XA 3D6GA 4N9GB 3EDKA 3QJFB 1MI5A 5DEGB 4X5XA 1FRGH 1KULA 4Y88A 3S36X 5J57B 2OI9C 3R1GL 1JCKA 5IB4A 3ULVE 1I1AD 5F6IB 3V4VL 4JFYB 4D0CB 1CDIA 1J0KA 1BVKA 4N5UA 3IDMA 1MHHA 3VI3E 3MR9B 5DMKA 2EXWC 2P7TB 1KENH 3THML 5FXCH 4RZCB 1FCCA 5JUEH 4ERSL 3TNNB 5B39G 5KVMC 3WFZA 3ZE0E 3CCHB 4OFKA 3EHBD 3FL7A 2J8OA 2F53B 1ACYL 1E4KC 4Y5XB 3BZDA 2Z4QA 3ARUA 1JGVH 5HHME 2KQMA 1BIIB 3SKNA 5F89B 1F6FB 5MEND 4NC2B 4AZ8A 1MOEA 4EKXA 1PJ9A 3ULVF 4X6DE 2XYCA 5ANME 5IGXL 2F5BL 5EC1B 2X4TB 3SKJL 3K74B 2DM3A 4C59B 2O5ZL 5KW9H 3NZHL 1KLUB 4HULB 2H8PA 2BSED 4XP5L 4Y19E 5CP7B 1T5WA 4O2CA 2DI9A 2EECA 4UQ3B 4YLQT 3EZJB 4PV8A 4M02A 4WI4A 4FXKB 3EOYG 1F11A 2UWEB 5T1KA 3JTTB 1OP3K 1JZ4A 4M48L 3GSOB 3DSNA 1IE5A 1RY7B 2F54E 2YUXA 3DX6B 5F7YC 5KVFL 3G08B 4FQQA 5DMIL 4DTGL 3BKCH 1IEAB 3F7YA 4X6DF 3X11A 2O61B 3P77A 3VGDA 5GGVY 1A3RL 5EN2B 3T0BA 5DT1H 3MLXH 3DOSA 4O00A 4MQXD 3U7WL 1I7RB 4S1RL 2XNAA 3SE9L 2EKJA 5K9OA 2FH6A 1Y18A 1ZT4A 2I24N 1IEBA 5KVDL 3MQIA 2DF3A 5CSZA 5E5MA 5M7QA 4MGXA 3RVTD 1NDMA 1HQ4A 4U31A 3PL6A 2R2EB 4ZPTA 1WC7A 3M1BB 4U1MA 2W59A 5IB3B 3T65A 2WUBL 2EYSB 5JXAH 1G7MA 4PJ5A 1KTLA 1WIUA 2WINB 4TOYL 5K93A 1CXFA 1U8MA 5D96B 2XKSA 2HRPL 4GS7C 1H9VA 1GL4B 2VLKD 4NN6B 1G9ML 1KTKE 5CGMA 2VDPH 3EOBA 4U1IB 2R0KH 4EBQH 5D7IF 1P7HL 1OTUC 4NUGH 5CUSH 5KTEH 5C0RL 3LIZL 3CX5J 3UTSA 1W2KT 1T7XA 3VXQA 1PLGL 3K4DA 2DQEL 3C8HA 1S7QB 1DVFD 3RU8H 2NY7L 1SM3H 4HK0A 2QTEA 5IVXF 3W11C 4QO1A 4WI6A 1PG7H 1QHPA 2PCPA 1UFUA 3HMXA 1NMBL 2XQYG 1AP2B 2X89A 4J1UB 4Y2OA 2VQ1A 4ZOEA 1S7XB 4XPBH 1CR9H 4LLUA 4MNQD 5DJAB 1OAZL 2DLHA 3HRPA 5CSGA 1C16B 1PW3A 2NXZD 4FQLL 5BS0A 1S7SB 4ISVA 5L9DL 1ZT7A 4NM8H 5DJZB 4S0TD 2W9DL 4FZEH 3U4AA 3GMNA 2Q87A 5EUKB 1NCCH 3L7FB 4GUPA 5I8CA 1RZ7H 4GMTL 1VACA 15C8L 4GKNB 2R1XB 3ZYZA 2W9LA 4U0RB 1AXIB 1MI5B 4LAQL 3H6JA 4X5XB 2EEDA 3VW3L 3TGXA 3LKSA 5IQ9A 3B6SA 4F15B 3BP5A 4HPYH 5IB4B 3VD3A 1MCIA 4H5SA 5T1DL 3OKMA 3ARZA 1BVKB 3UTPD 3NACH 2H26A 2L0DA 3IDMB 1MHHB 2CJUL 5DMKB 4M1CC 1AGDB 5CHNA 2B20A 4LLYA 3BHBA 1VADA 1CGUA 4ZAKD 3MV7D 2CIKA 2K1MA 3AROA 3L3JA 5FUZL 4PGJA 2Z4QB 3WXWL 3KPSE 2YK1H 1TDQA 1H5BC 3B2VH 3SKNB 3U82B 2QADB 1F2QA 2DJSA 4DGIL 5C09E 5I1KH 4NQUA 4MAUH 1T2XA 4K8RL 1CLZH 1S7VA 3VGHA 4PGZA 2ZJSH 3OSKA 2NX5E 5DC4B 1HOCA 4HIXH 1CTOA 4BZYA 1OSPH 2H8PB 3VRJA 4O2CB 2O93L 1KB9J 5FYKL 3T04D 3FB6B 2O5XH 1HWHB 3FN3A 5I9QC 1L7TL 4LSUL 1OQOA 3OAYK 4M7JL 4MNGA 2WZPD 4KK8C 3O6FD 4PV8B 1FVEA 1YA5A 4NO0D 1AD9A 1CN4A 5DLML 1F11B 5T1KB 1J18A 1ZHLB 2D7PA 4NHCH 3BZFA 1ZE3C 4IMKC 3QUYA 4FQQB 5KAQG 3QWRA 4GRLA 5EO9A 1WWAX 4KDTC 3F7YB 3X11B 4R4FL 4JO2L 1G0DA 1Y6KR 3SDDD 4YHKH 3ULVC 3GIZL 2APXA 4RRPG 4AEEA 2XNAB 4ELMA 1BEYH 1CFBA 1G9NH 1Y6MR 4K23L 5K9OB 2VH5H 4NNPH 4QHMA 3CC5B 1L9NA 1IEBB 4DQOL 2BJMH 1KC5L 5CSZB 2DQUL 1NDMB 1LEGA 1CQKA 1HQ4B 2EDOA 3PL6B 4ZPTB 5KG9A 5SV3A 3NZ8A 2FEEL 4LSQL 1OPGH 4U1MB 3T65B 2IMNA 4WENB 5L0QC 5AD0A 1N5YH 4PJ5B 2V5RA 3QISA 4WFGD 1KTLB 3IDYC 1BZQK 3QUMH 1U8MB 1DBBL 3ZKXC 2YPVH 1LVEA 3WE6A 4Y4KC 4L4TE 4NPYA 2BVQA 4X7EC 5MP6L 3TZVD 5IJVA 3EOBB 5JHLH 1P5UA 1Z9LA 1JGEA 2H1PH 3DURB 3GBML 6FABH 3CZFA 3QQ9C 2OZ4L 4OZFA 3LH2L 3BH9A 4E41B 1E4KA 3HE7C 3UTSB 1FFOA 3G6JF 4M1DH 3GMPA 3VXQB 2Q8BH 5IOPA 3C09B 3O11A 1P6FA 3UZQA 4L3AA 3QI9D 3U0WH 4HK0B 4OIAA 2Q8AH 3CDGA 3MV9A 3LRHA 5GHWL 3MLPA 1V3KA 3TM6A 2PCPB 1WWCA 5CZKA 2FCBA 4TRPL 3WNNA 1J11A 4XPGL 1L0QA 2VQ1B 1E6OL 3LN5A 1JPTL 3HC4L 4ODWA 3S36L 4JDZA 3JXAA 2IANA 4LLUB 5DC0A 3V7AE 3MRLB 5FGCB 4F8QA 4D3CL 5BS0B 4ISVB 4M6NH 5CEZD 4ESKA 1QFPA 3GJFH 3GMNB 5DMJB 1ZT1A 2FEEI 3DSFH 1KIRA 1NCAL 1MHPL 4OF0A 3IFLH 3HR5A 4GUPB 5I8CB 4V1DE 3MRIA 1VACB 1DQMH 2IF7A 4XVSH 5ALBL 1RZIA 4KKBD 3V52H 4BM7A 1SQ2N 3LKSB 1AO7A 2ZPKH 5IQ9B 3B6SB 4P5KA 3BP5B 1MRCH 5TE7H 4H5SB 4MYWB 5BVPL 4B0MM 3OKMB 4HH9A 3VWJC 2QSTA 2XA8H 3G5ZA 2H26B 2YPLA 4H8WC 4HUMB 5IW6A 4G9FE 3VFMA 4GAJL 3EJYD 5IR1A 1IAIL 2J88L 4BQ9A 3I6GA 4LLYB 3BHBB 2QBWA 1VADB 4X99A 5E08H 4PGBA 5D71L 5CAYB 3KWWA 2CIKB 3L3JB 5IM7A 3MV01 1CGXA 5AYQA 3LRGA 1MUJA 1OB1B 2R15A 4WEUD 1DQTA 1HYRC 2A6KA 4ORZC 4C56B 5JZ7D 1S7VB 2ZNXA 1QNZL 1CFVH 2EDKA 4OJFH 3KGRA 4HCRA 2A6DA 5EBGA 5FYJL 2GTWA 2R0ZH 3ZT7A 5JQHC 3VRJB 4Z77A 3DXAD 4GMSH 3DIFA 5IW3A 1PVHA 3VWKD 4DN4H 4MNGB 5DD3L 1FNHA 1GAFL 4FA8A 4KVCL 1FVEB 1I9EA 2XT1B 3SBWC 1AD9B 4HFWA 4Q9CA 2BK8A 5FM5O 5HBBA 3TP4A 4LDOB 3BZFB 3ZDYE 3S9DB 2YBRA 3QUYB 4R6UA 4NQDD 3VXMD 1MREL 2X4QA 5HDBE 4ZFOB 4LHUG 4GRLB 4TNWF 5E2TH 5EO9B 4LNRA 3O4OC 5I1LA 2VDOL 5C7XL 4A6YL 3KR3L 4XP9H 4PJ8D 1OAYH 1J0ZA 3FO0H 3S8WA 4CN1A 2IQ9L 3TBTA 1PBYA 5H37G 1KB5L 4U05A 4ELMB 4QHMB 1DBKH 4GRWF 2VZOA 4UTBL 2ZUQC 5KSBA 4YC2C 5DWUH 1LEGB 4MJ6A 2DB8A 4IEFB 5KG9B 3NZ8B 3U9UA 5IBLD 4WFFE 1HCVA 2PF6A 4U2YA 4NQCE 5KS9E 2H32A 4OFYD 4PJFA 2C4FT 1C1EL 2GKIA 3FT3A 2HFFA 5HDBF 3ZLQC 3WE6B 5DJ0A 4NPYB 4XP4H 3TT1H 3CFCH 3L6FB 1JGEB 4XVTL 3CZFB 4Z9KB 1R5VA 3V0WH 3IB4A 3QG7L 4OZFB 5FYKE 5IROA 4EN3C 2IFFH 4X6CE 1FFOB 4N0YH 3GMPB 3FCTA 3O11B 3G6DH 4OLUH 1UCBH 5T1LA 5HVFB 5C0ND 2B1AH 3ZSTA 3CDGB 3MV9B 4N0UA 4X98A 5HYJE 4RFEA 1SY6L 2JE8A 3C5ZC 5DI8A 5GZOD 5KS9F 3RP1A 1IT9L 4HWUA 3MJ7A 4OGZA 4JKKA 2BNRD 2RGSA 1JWSA 1WICA 1YEFH 3LN5B 4ODSH 1EBPA 1T7YA 4ODWB 4JDZB 4KROC 2NY2C 5D7SH 3SGKC 2IANB 3MC0A 4D9LH 4LCCC 3QNYA 4OCSL 2R4SL 4M93C 3CH8A 3RL1A 4TYUA 4PJ7F 2ZG1A 5F7DA 1ZT1B 2H6PB 3MACL 1KIRB 3H3BC 1MLBA 3IDJA 3HR5B 1M1SA 3TFKC 3MRIB 4ZS6C 2R2BA 4G8FA 4G6AC 4RISH 3IU4H 4KDTA 2CR6A 2P49B 5DVMA 1RZIB 2CXKA 2Q86A 4HKBA 1UWXK 3VMNA 4L8SC 4XWGH 3M8OH 1AO7B 1UM4L 1KBGH 5HHNA 4P5KB 1YQVL 1RIHH 3CXHJ 4WY7L 2CR3A 1VEMA 5D1QC 5DQDL 3GMQA 1KCVH 1PQZA 3SCMA 5FHAH 1YEGH 1FAIH 3G5ZB 3INUH 3K4AA 2FATL 2ICES 3UTTD 1TPXB 2YPLB 1MAJA 4FQJH 5E95B 1H3PL 5IW6B 3VFMB 2YD2A 5IR1B 4PRNA 2VXQL 3I6GB 2MQ3A 2AJSL 4X99B 4PGBB 3Q5TA 4UNUA 4DK3A 1DE4B 3KWWB 4YHZH 5C86A 5HHQA 5IM7B 4Y4KA 2V7HA 1IQWH 4EXKA 1MUJB 3ELAT 4WEBL 2A6KB 4X6DA 3PP3H 2YEZA 1EAPA 5ANMA 3TIDA 1JF5A 4XPFH 1Q0YL 1G9EA 3HE7A 1TNNA 2ZWLT 1JHLH 4M5ZH 4M6ML 2AK4E 4P3CH 4W6YB 4TVPH 2A6DB 2GTWB 5D7KE 5ITBH 1PYWA 5EOTA 5GRZA 3RWIA 2LFGA 4I0PD 4Z77B 3DIFB 3T3ME 5HYFA 2XOTA 4N5EC 2A6IA 3MFFA 5GGVH 1ZLSL 2LTQC 5LWYH 4RMRA 3D87B 4HFWB 4IIQA 3J8F7 2HTLC 2RHEA 4YXLH 2YBRB 1T3FA 4PV9A 4DOHB 3W0WE 2X4QB 3WIHL 4KK9C 2OJZL 2V6HA 1QRNE 5IHZA 4L5FL 4LNRB 4JGMA 5I1LB 3MPCA 4FQIL 1MCPL 2AJ3A 3GKZA 2V5YA 3WFEH 1G9MC 1NBQA 2V2WA 1AJ7H 3TBTB 3KJ4C 3UJJH 5CZVL 2A1WL 5GJSH 4UU9A 2Z31B 3X3GL 3HNVH 3OHXA 1ZLUH 5EZJA 1OP5H 3FOMA 1LD9A 4PFEA 5E03A 3T3MF 5KSBB 2FJHA 3HS0A 4MJ6B 4OUOA 1BGXH 2D4FA 4XPHL 1LO3H 3D1MC 5DEFA 4XPAL 2VZVA 2VLJE 2NMSA 5DJ2A 2WBJC 2A38A 4PJFB 3I50H 1I9IL 5A2IH 1QSFD 2UVEA 5CEYA 3FT3B 1U8PA 2UZXB 2IAMC 2XA3A 2LU4A 5DJ0B 2HKFL 3W82A 3BPNC 2IALB 3QFJE 5FYJE 4N8CH 1MIMH 5I15H 1R5VB 1RJCA 4HAFA 2HLAA 12E8L 3FCTB 3PJSA 4QHKI 1DJSA 4JKMA 4JKPH 4TULH 5T1LB 3S88L 5CGYD 4P4RA 1EPFA 1O7SA 1RPQA 5JMOC 1OW0A 5GRYA 3NN8A 2J8HA 4N0UB 4X98B 1S7WA 4RFEB 1QBLH 5DI8B 1FFRA 3V4UL 2ZOKA 1F3RB 4HIIA 3MJ7B 1QBML 5L8KB 1EEQA 2HWZL 1CCZA 1ADQH 3F58L 3CSGA 1QSEA 3IKCA 4WI5A 5L88L 4DW2L 2IFGA 4PGCA 3KPRE 4HHAA 3VRIA 5I9QB 2UZYB 3QNYB 3OJ2C 3RL1B 5TDNA 3BISA 4XVUD 5F7EL 4BQ8A 5IB5B 5DVLA 3F6LA 4L3CA 3GSQB 5F7DB 4PRPE 1V7ML 5GGTA 4B5EA 1FZOA 2VXUH 2M1KA 2R2BB 4G8FB 3U4BH 1U9KA 4HKBB 2Q86B 2FJFA 3VA6A 2AXGA 4G5ZH 3SO3C 5HHNB 4JFPA 2XN9D 3AVEA 4L3EE 5I73C 2I5YL 3GMQB 1PQZB 3SCMB 4LNVA 1T6VN 1ZK9A 3QHZH 3DI2B 4PRID 4PBXA 2R1YA 4HQQH 4K8RC 4MD0A 4JPWH 7CGTA 3L95B 2DIAA 4CN6A 5IIEA 2XWJA 4QRRA 5I66A 4PRNB 3K80A 3EJZC 2OP4H 5T5NF 2NY0C 3ZE2F 4JFHE 2FX8H 5L0QB 4LPTA 1IVLA 3QCUL 4Y16C 1X5FA 1M05A 3IDYB 3O3DA 2F53D 2JIXA 2WM0A 2NY1B 4Y5YC 3ZKXB 4RMVA 1J05A 4RGOH 3ARDC 3FO2A 3B9AA 1J9CT 4Y4KB 2V7HB 3WNKA 4F9LA 3K7UA 2E7BA 3KPLA 5HDLA 3ROLA 2OTPA 3T08A 4L9DA 2YEZB 3C60A 2ZSWB 3TIDB 3HE7B 1RIUH 4FFZL 1OM3L 1BFSA 1A6UL 1H3VA 1QACA 2NX5A 1B0WA 1F58L 3T1WA 1A1NA 3X17A 5FM4A 5DS8A 5FIEA 4HUWB 5JHDE 2GUOA 4PJEA 1PYWB 5EOTB 3UXFA 3MUZ1 1ZTXL 3BN9C 3C5ZA 4TSAL 1KN2L 4PY8I 5EZLA 2A6IB 2AABH 2J4WH 3MFFB 43C9A 3WSQH 5C9JA 2FX7H 4IIQB 4UT7H 1DR9A 1CF8L 2NY5C 1RD6A 2FZ3A 2LE9A 4NWTH 1T3FB 4PV9B 1JK8A 1DUYB 4BSWA 4BZ2H 2A74A 3ZDXE 5IHZB 4D0DA 2AJ3B 4OF3A 1HILA 1DBJL 4BUGA 1DBMH 2WWMC 2V2WB 1NCDL 2YOCA 4GG8A 4UU9B 2ICWI 3OHXB 3IFOA 4CNIA 3FOMB 4H0HB 1LD9B 5IJKC 4Z0BL 3BP4A 2FJHB 3HS0B 3U7YH 3AXLA 4QXUH 3CLEH 5TPWL 5DEFB 3HAEA 5D1QA 4OZGE 1OAUH 3D39D 5CEXB 5ESQA 4KDWA 1AHWA 3GK8L 5AG8A 2E5EA 5CINH 3CSYA 5CEYB 2FD6L 5HJ3A 1U8PB 5KVEL 2OR7A 3B9DA 1AFVH 3SDCA 4K55A 5F3BB 2UY6A 3ZDXF 1MCRA 1QFUH 1P7KA 2H32H 3NCJH 3VFPA 1EVTC 2HFTA 3WDJA 2D7NA 3RWEA 3GJEB 1MCCA 1V3LA 1Z3GL 2HFEA 4NZTL 4CVXA 5E6ZA 2R4RL 1YMHA 1YQ2A 2HLAB 5GS0H 2F19L 1F13A 4OCXH 4X7FC 5EUOB 4YZFF 3QIUC 4Q6IA 4HGKC 3RHWK 2DDQL 4OI9A 4P4RB 4QEGA 1IGYA 1HKLL 5LAXA 1G6RH 1LK3H 4YBLB 3GB7A 2PXYA 1KEMH 3NN8B 4GXUN 1S7WB 4OZGF 3NFSL 1N2RA 2ZOKB 4QWWD 3HZYA 3QEGH 4HIIB 1CLCA 4X4ZA 1MQKH 4QRSA 1QD0A 2NCMA 3I84A 3IKCB 1QSEB 3HN3A 3MUGA 4PGCB 4ONHA 4HS8L 4RX4D 1QFWM 3VRIB 4X5WA 1GZQA 3OJDA 4G8GE 4LQFH 3GI8H 2IBGA 2VL4A 3WUWG 5E99L 5C71A 5TDNB 4U2ZA 5E6YA 4AL8H 3LDBC 5LGHH 1NGQL 4AYFA 4L3CB 4H0IA 3O3BA 2UUDH 1CGSH 4V1DA 5F7HA 4XNYH 1VPOH 1FZOB 5GSVA 2LU7A 3QT2A 1MI5D 4XP1L 1NL0L 1JI2A 3QEHA 1A7QL 2FJFB 2A77H 5LBSH 3DYMA 3SQOL 3RGHA 3FT2A 3SGJC 4JFPB 1BAFH 3L3OA 4K94L 4EUPG 3SGDI 1MJ8L 2E7MA 3TH4T 3RUGE 4ODXA 4YC2B 3TBYA 4MD0B 1I9JL 2Z8VC 4JM2C 4QHUA 5IIEB 3ULVH 4JKWA 2XWJB 4QRRB 5I66B 3BIKA 2Y6SD 4WWKC 5JQ6H 2WBJA 1T5XA 5CS7A 4KK6C 1LEKA 2HVKA 1M05B 3O3DB 4WFHD 2JIXB 3KLAA 1LDPL 1J05B 4N8VA 1G7LA 2BXZA 4Q58C 2MSPA 2AEIT 2EH8H 2QADD 1A5FL 3KPLB 4KXZI 2Q3ZA 3ROLB 4XC3L 5CIPA 1FVDA 5D9SA 1D5IH 4JPKL 5TE6H 3CFBA 2APWA 2CXGA 4YHOH 3C60B 1JWMA 1N0XL 3ESVF 1EH9A 2Y07L 3CVIH 3ZTNH 5FUOL 2NX5B 3RUGF 5DS8B 3O6KH 2GUOB 5BOZG 4P4KC 4PJEB 1YEEH 3QIWC 5E7BA 5C07A 1E27A 5C6TL 4TNVK 2E8ZA 5FO8A 2R9HC 3VG9B 3MLRL 4IOIA 3C5ZB 3HNTL 4TUKL 5EZLB 1EEZA 4LHJB 3S6CA 1FFPA 43C9B 5I1IH 4FQCL