1CD9B

2:2 complex of g-csf with its receptor
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
213
structure length
206
Chain Sequence
b'AGYPPASPSNLSCLMHLTTNSLVCQWEPGPETHLPTSFILKSFRSRADCQYQGDTIPDCVAKKRQNNCSIPRKNLLLYQYMAIWVQAENMLGSSESPKLCLDPMDVVKLEPPMLQALDIQPGCLWLSWKPWKPSEYMEQECELRYQPQLKGANWTLVFHLPSSKDQFELCGLHQAPVYTLQMRCIRSSLPGFWSPWSPGLQLRPTM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (GRANULOCYTE COLONY-STIMULATING FACTOR)
molecule tags Cytokine
source organism Homo sapiens
publication title Atomic structure of the GCSF-receptor complex showing a new cytokine-receptor recognition scheme.
pubmed doi rcsb
total genus 29
structure length 206
sequence length 213
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cd9B01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 1cd9B02
1G6RH 4JHAH 3U6RA 2QR0B 5EIVA 4PJCE 2AK1H 4KU1A 1DQJB 1ZVYA 2KZWA 2DL2A 3I6GB 4U1JA 4N0UE 1BVKA 3DETD 2ICEB 4PRIE 1QEWB 2W9EL 4KV5F 4L8SC 2ZWLT 3BO8A 4HKXA 1DUYA 1TTUA 1G9EA 1GZQB 3ARFC 4J6RH 4UIKL 5BVPL 3KXFE 1RK1A 2FGZA 3G9VA 4QNPE 5D1QA 3C6LA 5B22A 5JORA 2PKDA 1I8IB 1IC7L 1ZHKB 3WS3B 5CJOH 5T3XL 3BHBB 1YJDH 3RWIB 3DMMB 2MQCA 2XV6B 5B38B 2NY3D 2CKBB 4OQTA 4AH2B 1A02N 3MRIB 4ZPTA 4RX4A 1G7HA 5LGJA 4LVHB 4YXHL 4WY7L 4YHOH 3VXOB 3GK8H 4N8CL 3E8UH 5JHDB 1YECH 3GHEL 1CS6A 4BELD 1GPOH 5ISZD 3PUCA 3HZKB 3IU4L 4OGYH 3BAEL 1P7KA 2UUDK 3ARDC 3LQAH 5FYLD 3SDXE 5EBMA 4O2CA 4G9FA 4HEME 1NFDE 1F4YL 2XICA 3L7FB 4DGVH 3IVKA 1VFOA 3IF1A 4QOKE 2NZ9D 1HI6A 4RWYL 5KVEL 1Q1JH 2OJZH 1IC5H 2W9DL 2BVEA 3RBGA 1ONQA 4EUPA 4XGZB 1KPVA 1LO4H 5JW4M 1ZHBA 3L6FB 4HULB 1U8IA 4P2QE 2EDJA 4CDHA 2NTSP 2ZUUA 4HFUL 5DJ0A 2GSGB 4HMDA 5D7KD 5C07E 5CGYC 1EGJA 1GOFA 5A2KH 5JPMB 3ALWA 3LKRA 1G7QA 5FCSH 4MD0A 3WL9B 5DT1L 4PTUA 1I8KB 3T8XB 4ALAH 4LLWA 4F58H 3MRKA 4YGVA 4GRLB 2CLZB 2I60H 3OXSA 1A2YA 5DD1L 5TE7L 3U0TA 1IBGL 3BH9A 3ZTJH 1AI1L 4B53A 4FQIL 4Z6AT 4LVNC 1D5ZB 5K9JL 4S2SB 3ULUD 1HH9B 4K94L 1TMCB 1WBXB 3HAEG 2GQHA 2OSLA 3C5ZC 3BPCB 4XCFH 3ETBF 1J8HB 1RU9L 1VACB 4HLJA 3QUYB 3VFVB 5D2NE 1MI5D 4N90D 3WDHA 3VXSA 1G84A 3VGHA 1VSCA 2ADIA 4N0UA 1BWMA 1MPAL 3PL6B 3HC0A 3NABH 4O58H 2MWCA 4Z7VB 5JUEL 1DBMH 3RDTD 4ZDHA 5JTWA 2JJTA 3GO1H 4NQDE 1KLUA 3HPJA 3KPLB 3RY6C 4NKMA 1QSFE 3V0WL 1VACA 4O5LH 4QTIH 3KPRB 1KYOJ 5IJVA 1EEYB 1D5BA 5FUZH 1ZT4A 3FO9B 1AQDA 1JMZA 1S78D 3WFHB 3FAWA 5IF0A 5FGBA 3VH8A 1AIFB 3EAKA 3D85B 5B3NA 1PKOA 4CU7A 4YHLL 1U6AH 5ENWB 2V5RA 4ZFOA 2R23B 1KJMB 3NAAL 4PV8A 3CDGA 2OXHA 4UNTA 1HHKB 4JFHE 4ZFZA 1BX2A 1KIRB 2IPUK 3BD3A 1DBKL 4PUBL 4YHPB 4BQCA 3GIVA 1P84J 2X9YA 4FXGA 1EHLH 1BF8A 1AGBA 5EZIH 4NOBA 3SO5A 3WFBL 4YHZL 2BOBB 3WFEH 4LRNH 4BZ2H 1UA6L 2V7HA 1R5WB 1VGKA 3FQXA 1VKXB 3SKOA 5FA4B 1DLFH 2DD8H 4WEBH 3S88L 4GBXB 3O6MH 4C83A 3RFZC 3SO3B 1L9NA 3O6FA 5C0IA 2ZSVA 1S9WB 5EWIH 4PJDB 1RJLA 5IMMB 5F7FA 4XVSL 1IM3B 2YKLH 3I6GA 3CMGA 4WHDA 4TTDD 1JL8A 1QBMH 4JY5H 4S1QL 4AENB 2Q76A 1ZLWH 1U3HA 1S5HB 4RGOL 4UT6H 5BJTA 1WWWX 4KY1H 4XPBH 4P5MA 4WV1C 1Z9LA 5SX5H 5BO1H 3OZ9L 1EEZB 3QI9C 2E7LA 3QR2A 1INDL 2QSVA 4UTBL 4YQXL 1MRCH 5IV2B 3ZE1E 5FCUL 1QLRA 2QHRL 4I0PB 2HMID 1WJ3A 5TDOB 2LVCA 4MJIE 5LGJB 3VI3E 4PJ9D 4PREB 1G7JB 3RU8L 3PGCB 1PX3A 3EKCA 5DUMH 2LU4A 1YMMA 4WO4A 1U8MA 2H2PC 3KPNA 4EN3A 3L5WB 3JTSA 3CH1A 3CFEB 3CFJA 4Z0XA 3T3PF 3LEVH 2GK2A 3QQ3A 5IM7B 1I3RA 1JF1A 2Y06L 3VRIA 4TSBH 4P2CG 4WEMB 3VXRB 4P23C 3VFNB 5BS0B 5A2JH 3NAAH 4M6NL 4HJGA 2VDLL 4F58L 4OZIA 2VLME 3IRZA 4WWKA 1CE1L 3OTTA 3QFJD 1UWEL 2DLEA 4MHHG 4FQIH 5FYKU 5E08H 3D5OF 3TIEB 3OJ2C 4X98A 5GS0L 1C8PA 5E99H 1KPVB 1RIHL 1DVFB 3E3QE 4DN4H 4DTGH 2VLRD 1DL7H 1D9KC 3KJ6L 1K5NB 4JY6B 3S3PA 3LQMA 4WWID 3PF2A 5I8CA 1Z0NA 4KKBC 1XIWC 5J1SC 3BZ4A 5KBNC 1K4CB 4WV1B 5IJKC 4PV9A 4EIZC 1A7QL 4NBXB 1CL7I 1A4KB 3NCBB 1ZLSL 4KK6C 2R0KL 5C0CB 3FONB 4R4FH 4LQFL 1IGCL 2AS5M 1MF2H 2R1XA 1IJ9A 1XZ0A 3NCJL 4KQ4L 4WTWA 2NCMA 3V6FB 3QPXH 5C9KA 1L0XA 1NBZA 1MPAH 4LFHD 3VWKA 5ECJE 3O6LL 4NO5B 3BZ4B 2R0WH 5FUOH 2HLFD 2W59A 2GITB 5L88L 3UTZA 3FB7B 4GAGH 3I9GL 5F89B 4DQOL 1GYAA 2YWZA 3P77B 1SJVA 5SV4A 5HHOD 2H8PA 2VLKB 4C59B 1ZV5A 3PGFL 3NPSB 5IROA 2NY0B 3ZO0A 4DEPB 1WFOA 3CDYA 4NC1C 3IXAB 1NH6A 2WINA 3M1BA 3VCLA 3QQ9D 4CVZA 3K2UL 1MWAL 4G5ZL 4ZOEA 3D9AH 3W2DL 3O2WH 4NQVB 4YO0B 1BBJB 1EHLL 1UH3A 3KPMA 3TO4D 3WFBH 5HVGB 1NGXA 2VLKA 4YWGH 1X5KA 2FZ3B 4NQSB 3MRFB 3S3JA 4HWEL 2XA8H 2O5YH 3QNZA 4S1RL 3MV8E 1FGNH 4P2QD 1P69B 3T0DA 3D0VB 3EJZD 4M48H 1MVUA 2C1PB 4BSVA 5I2IA 2B4CC 2XTJC 3B3IA 4NGHH 2YPLE 4Z5RB 3PL6C 3WKML 3UYPA 4TVPE 4NDMB 4WO4D 1HHHA 1QHOA 3HAEA 3QPQD 4EDWL 3MUZ1 2CJUH 1V8HA 5I16A 4PJBB 5IW6B 1MIEH 4UBDD 1R24B 1FG2A 2GSGA 1AGCA 3LKPB 4X6EA 4UQ3A 1KJVA 3WN5B 1UKSA 3QISA 2FX9L 2NR6D 4WNQA 3QUZA 4EI6A 4NN7C 4XT1C 3ROLB 3OR6B 4WHYG 4RWYH 2EYTA 1R3LB 5LG1A 2VDKH 4JFOB 4GRLC 3CU1A 1G0XA 5FB8A 1KB5H 4JGMA 3KNBB 5D1XB 1TZHA 4P23D 2HFTA 3UZVB 5I8OL 1A1MB 3V6ZA 1Q0YH 1JTTA 2X1WL 4FFVC 5DJAA 2AJZA 3KLDA 5J13B 5TGBA 1UKQA 3OL2A 3GB7A 1LP9E 1OTSC 2A77H 2FL5A 4G3YL 4KKCD 1IGFL 1CR9L 2DQEH 3WHE0 1NGYA 1Q94B 4PJIF 4QRRE 1ZLVH 1KJ2H 2GJ6D 4C55A 1LQSR 4D9LL 2X89A 1YJDC 5LJYH 2ORBH 1JFQL 1WVZA 4LCWA 3SJVD 3QEGL 3MRPA 1U8MB 4AIZB 1KTDB 4HIHB 3QEHA 4PLOB 1S7QB 3P0VH 3O4LD 2ZP0T 3ECBB 1P1ZB 3NIFF 3GIZH 3MV8A 5C2BH 3H9SD 4X5WB 3RIFF 1QRNE 2YEZB 1MHEA 1HCVA 4I18B 5BRZA 2DQHL 1FL6B 2Y25A 2CDGB 4AIZA 5GGTA 4WO4C 1M71B 1G9ML 3QNXA 4M6ML 1P5UA 4MCZB 5ACZB 5EU5A 2AJVH 1QFWM 5D5MA 3OKEB 3VFUB 1H15B 3W39A 4U0RB 1UWXH 5E94A 3VGEA 2JB5L 1CXIA 3QJHB 1QBLH 1I1RA 2RBLA 3VXRA 1PKQE 3TIDB 4NKOB 5GS1A 3HZVA 5DFTA 1EXUA 4JDVB 5IB1B 1D5IL 4M5ZL 3T4AB 1AJ7L 2VDPL 3ZDYF 4L8SB 3T2NL 1PYWB 1RIUH 4KAQH 4NC0B 1MWAA 3QPXL 3ZTJG 1CT8B 1KUMA 4QTHB 4LDOB 4PLKC 4PJFA 4OZGA 3ELAT 4YEEA 4JANB 3ZKND 5HHPB 4GRWB 5M94B 3GSOA 5GRWA 1J0KA 2ARJB 5HJ3A 3VXQA 4CKVX 2ICES 4IMKC 3HFML 4D2NA 1KJMA 1ZS8B 3ZYOA 4BA8A 2Q1EA 3DURA 4X8JB 2YZ1A 2CLVB 4CU8A 4H5SA 4YXLH 2V5TA 3S5LG 4PJHF 5C0CA 5I1EH 3S35L 1VCAA 4QHLA 4F7CA 2XQYG 3A6OA 5C09D 1BFOB 4G8GB 2AXJA 4S0SD 1QSFA 4P99A 4J3VA 1JPFB 4JRXB 5JDSB 1N64H 4U33A 4JQXC 4C4KO 5CSGA 4LBEA 4M62H 2EDYA 4IOIA 3LZFH 3UTZB 3GBNH 4WI8A 5FO8A 4EDWH 2X4PA 2J8UF 1QVOA 1PJ9A 1N2RA 4UV7L 1MLCA 2P4AB 1A14L 2IWGA 2WBWB 3MLZH 4XNMB 5CBEB 4IHOA 4NDMA 3O4OC 1IGIL 1UM5H 3S4SA 4XPTL 4HPOH 2Y5TB 4YDKL 2FYYB 4OCSL 4GW1B 3RVWC 4G3YH 1IGJA 1XR8A 2Y36L 3BQUB 1IGFH 1K4DA 3QEQE 1FO0L 4GG8B 4X7SL 1U41A 5D7IF 3UX9B 3VD4A 4Y16D 1HHGA 1P84K 3UO1H 4FA8A 1B0WA 2IADA 3KPQB 2BHYA 3DV4B 1BM3H 3DXAE 4YGAB 3MZTA 4L8BB 3L6FA 5DK2A 5F7HA 4PGDA 3VFSB 1GGIL 1QSEB 3MREB 4H26B 4Q9RH 1CICB 3QG6A 4JHWH 3MV9B 1YNKH 3LB6C 3UTSB 3VE0B 2EDOA 1NGPH 1MJ8L 4HLZH 1EEQA 1F8TH 3KHQA 4NO2B 3PNWA 4RQQB 2I07A 5DK0B 4MNQA 5GPRA 4CW1A 5IQ7L 3CFDA 4HS3B 4E41D 2EYTB 4AZ8A 2EDTA 1FZJA 3QXDB 1KFAH 3TNNB 2ERJC 2FLRT 3IS0X 5EOCJ 1XF4B 1N5AA 5GGSB 5ADPH 4Z18A 2WBJC 1CG9B 2Q6WB 1CE6A 1U0QA 3IGAB 3MJ8B 3NCJH 2Q7NA 5D70H 1CGXA 5DQDH 1AGEA 3O41A 1Z5LA 3TEUA 4Z7WA 3O3EB 4Q6IC 3S36L 5GZNC 3ARGC 3FOMB 3HI6H 4GAJL 5BRZD 4JRYE 2R4RL 5A2FA 1H0DB 1KTLA 2KH2B 3QIBD 1IAIH 1WSST 4J3UA 1T0PB 2DICA 2NY2C 4Y1AD 4U7KA 4LMQE 5I1CL 2DBJA 5C0AB 2F5AH 1D5IH 4M5ZH 3GSNL 2CRYA 1FV1A 2BNRA 3KYKH 3UBXB 4G7VH 2EDLA 5F7LB 4LSUL 1NAMB 3K7UA 3SDCD 2FJFA 3WIIH 4XP6L 3QCTL 2X4QA 4YHIB 2IPTH 4QRTA 2C1OA 3L7EB 5I6XB 4XCCL 1NEZA 4NKOA 4O00A 4C56A 1ZLWK 3VXUD 4BM7A 4BZYA 1IGML 2Z8SA 3F7VB 3VCLB 1QFWL 4LVOC 4W6XB 5I1AB 1JWSA 2OTUA 4MVBD 1AGBB 1K2DA 1HOCB 2W60B 3OPZH 2H6PA 1S9VB 2EH7L 2PCPB 1J05A 5E03A 2EIZA 2X2YA 4I5BA 3MRIA 4ZPTB 1RZFL 2NXYD 4XPFH 1KCVL 4PJXA 3LQAC 2AJSL 2OTPA 3PWJA 5F93C 4FZEH 4K9EH 3DRTA 4LSVL 3HG1B 5CIPB 1BP3B 3QIUC 4KMTH 1MRFH 3KGRA 3NTCL 4DZBB 1KIUA 2X70A 4OGXL 5D7JD 2G9HB 3MA9L 2AEPL 4M1DL 3GJEB 4FQ2H 3ZDXE 3CPLA 1OCWH 1BIIA 3MR9A 5BJTB 2FSEA 4JPWL 3U0PB 3VXSE 1EHNA 2CQVA 2Y07L 3HPLB 1H5BA 3HS0A 3K4DA 4JKPH 4DCQA 1OTSD 4H1LA 4XGZA 5MHSD 4M7JL 4HJ0D 3FT2B 2O5XL 1KPRA 2P5WB 5HHQB 3G5YA 4BUGA 1EAPA 1TNMA 4XNUH 5I1CH 2BRRL 3QDHA 1BM3L 4RIRB 1DBJH 3P2TA 4Y4KA 4NZTL 3H9YA 3QWOB 3VFGH 3PP4L 2F5BL 2YD9A 3HR5B 1G7LB 5I30L 1FFOB 4NZRH 4Q9RL 2BXYA 2UWEB 4PTUB 3DECA 1U8LB 5MP6H 1MUJB 1QFHA 1ND0B 3AXLB 1ZGLM 3RWHA 1B9ZA 5GQBA 2H9GA 3IXTA 3KDMA 5CKGA 5HD8C 3FZUC 4U6HA 2KZ1B 3SKJL 1UG9A 3JWDL 2IH1A 2WLYA 2DBLL 4YHMH 2X4UA 5JOPD 2EDEA 3IDYB 1ZEAH 4N9GA 4ZPVA 5FOBA 4YGVB 2DTMH 3HZMA 2Z91B 1I1AB 2H9GB 3IXTB 4I0PD 5SWSB 5E9DB 1AC0A 2DIBA 3MGTA 1UJTA 3TBYA 2NY6D 4ZD3H 3L3DB 4PP2B 3TBWA 5F9OH 3V6BR 3G6DH 4MA3A 4NCC1 4P48A 3G5VA 5C08E 3ZT7A 3PQYD 3KYAA 1CU4H 4O5LL 4WRLA 3DV6B 3BT2L 3TN0A 4H25A 1FIEA 2D0FA 2QKIA 5L2KE 1J5OL 4DGIL 2ICWJ 4G7VL 2VB5A 2A9NH 4J8RA 5TQ2H 4XHJC 4MQ7B 3UBXG 2GITA 1I85A 1FPTL 1TVBA 4OCWH 4LAQL 4P57B 4A6YL 1S9XA 3HI6L 4GAJH 3G08B 4GBXD 3T0XA 4J3OC 3P77A 4F7PA 4YHLH 1NC4D 5H94B 3U7YH 1DBJL 2MJWA 4POZD 4GRMB 4NO3B 5HGBA 4PJ8A 4QWWC 4XCEB 1U91A 3BN3B 2B0SL 2QADB 3OJDB 4FN0A 1QR1A 4JB9L 1XF4A 1IQDA 5D2NA 4K7FA 4NQVA 2D03H 1IGTB 3LSOB 1TJHL 5TDPB 1RZGB 2VR4A 3HNSL 3RWIA 4R3SB 2A74A 5CEYB 3O2VH 1D5BB 5HDQL 1NDMB 3VDCA 1U92B 2J8OA 1KLFA 2BOCB 2MNUA 2IANA 1U9KA 3GBNL 4IJ3C 4NQDB 4O9HL 4CUCA 3RGHA 5JIHA 5D7IE 2BRQA 3BQUD 5HHVL 3V8OA 3GSWB 1MRFL 2DLGA 2Z31B 5KVFH 3C5ZA 2BNQA 2BX5A 4P2OB 5D7LD 1JHTB 4NZDA 4PJEB 2WIIB 1CXHA 2ZUQC 4PJ8C 5E6IA 5SX5K 5C7XL 3EDKA 4HAGA 1YMMB 4LLAA 1G7HB 5DJ6A 4OGXH 4KQ3H 3MRBA 3QRGL 12E8H 1T1ZB 3C5SA 4ODXA 4K7PL 1CFQA 1EGJL 3Q6GH 4PJGB 4JKPL 3GZKA 3GUTA 4KVNL 2WV3A 4KV5E 3V8CA 2E7MA 1E4XL 2XACC 1CBVH 3K0WA 4PRAA 4PJCF 3L3OA 4U6XA 4K55A 3ZKMC 2GIYA 3QIBA 4LPUA 1JIBA 2P7TB 5JXED 3VXME 1MEXL 5F7EL 4HS6B 5B8CB 2ZZUT 4BFEA 1GL4B 4I0CC 5GS0C 3VWKC 1Y6KR 3CDFA 1FSKB 1RJCA 4OZFH 4U7SA 3H7BB 3SDAB 4TSCL 1T0MA 5FK9A 3S4SG 3TFKC 4H8WL 4KKLC 2C3XA 4U3HA 2MPAH 2D9CA 1R3IH 4M8QA 3PWNA 2E5EA 1V7NL 3SCMC 2CMRH 1U8PB 3MFFB 2IGFL 1YJDL 4ZSOB 1N3NB 3U46A 2X44D 3DBXA 5CINH 3IJHA 1XGRA 5C8JA 3SQOH 4M8QB 3ARDA 4HXBH 1IAMA 3NH7L 3TNMB 1Y0LB 2PO6C 4ZFGH 1G7IB 2FX7H 4X7TB 3WXVH 2W65A 2OR8A 2PW2B 5I74C 1XGTA 4KQ3L 2DQIH 3RP1A 1HILA 1S7SA 2IMNA 2RIKA 1A6ZB 5GGVY 4NRZB 1FIGL 3BP6A 2D0HA 4O2EB 1XGUA 3RZCD 3GMQB 3LEXB 3KPRA 4GRLD 2OR9H 4K2UL 5KSUB 1AE6L 1UEYA 5D9SA 3SKOB 2PW2A 2X4RB 3RDTA 2J4WH 1J1XL 4L4TE 3V6FA 4NWUL 2V2XB 3M1BB 2FSEB 3EYVB 4E0RB 1LEKB 5DVNA 3JBG7 3IT8D 2PTTA 4HIXH 2MOVA 5TE4H 4ORZC 2CD0A 1CD0A 5M7QA 4GXVH 4J2XA 3QUXC 3MV7D 1G7PB 1Y18B 3VFOA 3OKDB 3WIHA 1QACA 3O2VL 1ZGLA 1MCBA 3MTRA 4M48L 5T1DH 2BCKA 3SKNB 4UQ2B 4WI4A 2GTZA 2IQAB 4WU7A 4YDVB 3RWGB 4PGZA 3HRZA 4PJHB 1PEWA 3ZDXF 4LSPL 4I13B 3EO9H 1ZT1B 2P49B 1ZT7B 5DJXA 2A6DB 4JFPA 3K8LA 3DGGB 5ID0B 1QSEE 1A5FH 5FYJL 3DX7A 2VDPH 1FNEA 2Q76B 1UXSA 1K3IA 4OT1L 1S7UB 4I2XE 3SBWC 4OUUA 3Q6GL 4IDJH 1OF2A 4NQDD 4X0KB 2Q8BH 1KPRB 2FO1A 1TQCC 3FCTA 2ZOKB 4L9LA 5DGRA 1XCTA 4MB3A 3MLSH 1F3JA 1ACZA 4YE4L 5TF1H 1GSMA 1KB5L 3HI5H 2AJUH 1UQSA 4U1GB 3RZCC 3WJJA 2P1YA 5GGQH 1CLOL 1E27A 1ZA3A 3GBML 1TIUA 5JOPE 4OLWL 4YIQB 5EC1A 3ARSA 2XYCA 3RL2A 5J3HD 1AE6H 4QRQA 4Y4KC 2EDNA 1ZLVK 5IKCB 3QIWB 2L7UA 3QIBC 1QNZH 4BSJA 5CBAA 5GS2D 3BPLB 3R4DA 3B3IB 1NCCH 1OAXL 2ED9A 4DVRH 3T0ED 5FUCC 4UIKH 5BVPH 3VFTB 1DANU 1SYVA 3AUVA 4RAUB 3NIGF 3GMLB 1P2CA 2Z4QA 3PNWB 4RQQA 1JYXA 4P4KA 4CW1B 1JF5A 5DJ8A 2IALB 5D7KE 2IH3B 2VLMD 1AD0B 2PXYC 5KSBA 1J86A 1XAUA 1E4KA 4QRUB 1NGQH 3IDIB 1CIUA 1F4WH 3E0GA 5D5MF 2VDNL 3WXVL 5F1KC 4OKDA 4Y4HC 3WD5H 4KI5F 5C0GA 5DJYB 5D7SL 4I0KA 5J57B 1MLBA 3VRLE 2X4OA 3G04A 3LAFA 5HYJD 2OBGA 1J0IA 2BFVL 1HIMH 4XC1L 4R0LC 2H3NA 3BXNA 3BIKA 4A6YH 4LF3B 5ESVB 3MRJB 4I18A 4XNZB 4G9DB 1A2YB 1ORSA 1S9XB 5D1ZA 5ISZE 1FZKA 5HI4D 4NKMB 2YPLA 4FXKB 2AEWA 4JPVL 4D8PA 3BGFB 3CMOL 1PKQB 1U8NA 1RUKH 2RFXA 3V6OE 1QEWA 3WFZA 3OGCA 2CO7B 1SY6L 1LVEA 1AO7E 5GIRB 3UTTA 1W0WA 2VZUA 4RAHA 1K8IA 1TJHH 4H20H 4IJ3B 3ARBA 5DRXA 4NQCD 2ENYA 2VXSL 2A6IB 4KRPB 1J8KA 1AKJB 1GAFL 4CVXB 1DSFL 1CGTA 3UBXA 4JO2L 2BVOB 4ELME 5DI8A 3ARVA 1NPUA 1B0RB 1M7DA 4QTHA 3P0YL 3AB0C 1AQKL 1VFAB 5E24E 5AUMB 1QSFB 2XQBL 3EJYD 3FFCA 4MWFA 5FA4A 3LN4A 4PD4K 1J0JA 4Q0XH 3TBVB 5KSVB 4UV7H 5L9DH 5AG9A 4H88L 4HKZB 5KSBF 5IW1B 2ITDB 3AREA 4AY0A 5MEQA 3ARFA 3ARGD 1JZ6A 1R3HB 4H5SB 4EI5B 3H42H 5C0FB 3GI9H 4ZFZB 4MA1C 4X6FB 2BDNH 4JCLA 2A1WH 3TBTA 2WUCL 3IFLL 3VXTA 1ZHLA 4HUUB 2BJMH 1CD9B 2J7LA 3MLRH 4B0MM 4KMLB 5A16A 5C86A 3RVXD 3U30B 2X9WA 1WIPA 1N6VA 2J8UB 3HNVL 3UC0L 5D7SH 5EIIA 4LHUB 4XP6H 1VEMA 3UJTH 3MPCA 2NYYC 3K1DA 4DVBA 4QHUB 5CCKL 2Q8BL 2JB6B 4YXKL 5GS3A 4PJ7E 3S96B 4N8VA 4XVUC 3C6LB 2D7TL 4UV4H 5C6TL 1OWWA 4KTEL 2D4FA 2AQ2A 1QFOA 4EXKA 5JR1L 1NUDA 3QG7H 2CK0L 1IC4H 3WNMA 3OJVC 1MAML 3IFNH 2RCSH 4LSRH 5HVHC 4LCCA 4X4ME 4U1JB 3DV4A 3EDDA 1N0XL 2WIMA 4M7KH 3CAFA 1RZFH 4KROB 5DZLA 4M43H 5FO7A 5SX4I 2B39A 1OP5H 4EN3C 4AG4H 2HVJA 4K9EL 1HDMA 1OB1A 1F8TL 4XWGH 1MCSA 3SDCB 4EBQH 1UACL 1T3FA 3UJIL 3IAPA 2WZPD 2YR3A 3IF1B 3D85D 2D31A 4G6ML 1FAKT 4JFDD 3QIWA 1HWHB 1TPXB 3KPNB 3ECBA 2XWTA 2VAAA 1L7TH 4ONFH 4XB7A 1MOEA 1KLGB 2X9XA 3LV3B 3QAZC 3FHQA 5KS9E 5GSRA 1N6QL 3GSQB 4XRCB 1CG9A 4PV8B 1CVRA 4DWHA 2BNRD 7FABL 5MENE 3MRRA 4OZ4A 3CSYB 4M7JH 4MA7H 5TQ0L 2DKUA 1OOAA 1RV6X 1U58B 3BWUC 3WLBB 3QXUA 1MH5A 5D8JL 5HHPA 2IAND 2R2HA 3ULSB 5HPOA 3DUUB 2QHRH 5HYSA 1AO7D 2F8OA 3W82A 3DPBA 5DUML 3V95A 2JELL 1KB9J 4WI6A 5J89A 3CMOH 2DWDA 3C6LC 1A7NL 3FT3B 5F70A 2K7PA 5BV7L 5E5RB 5ALBL 2LQRA 1JPST 2H2PD 4LHJB 3WLBA 5M95B 1YMHA 3QQ4B 1S3KL 4Q2ZA 4OGAC 4MXVE 5LQBL 1J8HA 3FB5A 4D9QE 1W8OA 1VGKB 1U91B 1MAMH 3FQXB 3IFNL 4Y5VC 5D7JC 3DX7B 1VKXA 2W91A 5HJ3B 3VXQB 3ULVL 1A6VL 1RJYA 5D96B 3O6ML 3HE7B 1RJZA 1BX2B 3U0TB 1ZAGA 1DP0A 5JORB 4GW4B 5EWIL 4Z76B 4OGZA 3CK0L 1C5BL 5J11C 1EBPA 2DQGH 3QNZB 4OKVB 4QRPA 1CK0L 3NCCB 4DUXA 5I6XC 1QD0A 1B0GB 3QCVL 1OCWL 2F19H 3D3VB 2Q87A 1T7WA 5I18L 4Q6IA 4X99B 4IOIB 3AS3A 4OFVA 5DJDB 5GHWH 1GVIA 4UAOC 2MKWA 2VQ1A 3DROB 1V3LA 2J6EH 3MJ6A 2P8PB 2AJZB 3I3EA 1YEHL 3MRMA 2M26A 3M07A 5IP4A 2NY2B 2C5DC 4ODWA 5L7XH 1BOYA 5GRZA 5TH2B 1EHAA 2OQJA 1R0AL 1JNJA 1MJUH 1MY5A 3TH2T 4JFYB 5EU3A 3DVGA 3RAJL 3H7LA 3T4YA 3JV6B 4H0HB 1XR9B 1AKJA 1NSNL 4XCYA 4CVXA 3O6FB 3O3AB 2AXHA 4TVSa 4MAYC 5DMKA 1FVCA 3RVVC 1BLNB 3F7QA 4JJHA 2OI9C 2R1WB 5IESH 4X6DE 2NY7H 1C16A 1J05B 1KB5B 1MCNA 4Y5YB 5IHUH 3L5IA 4U31A 1TJGL 4TPRH 5DYOB 5E9DD 5ESQB 3GRWA 4GRLA 4O9HH 1H8NA 2ZNXA 4BK4A 3TO2A 1UCBH 4K8RC 4G6KL 3QDJD 3MV7B 2PR4H 1LE9A 1ACYL 4PREA 2RGSA 4MA8H 4Q9QH 4N8CH 3X13B 3VFUA 1V3JA 5D2LA 1CDYA 5JIIA 3FFCD 1OGTA 1FO0B 1SYSA 3P4NB 3PL6D 3O6KH 1RIVL 1E4XI 3WD5L 2FATH 4KDTA 2AI0H 4WEUD 4UDUA 1W0WB 4OF7A 4RGNE 3HC0B 3TBWB 4QY8B 2OZ4H 1KXTB 2FH8A 3WUWA 3AROA 4D0DB 1TDQA 4Y4KB 4LEXH 1VENA 2X7LA 3IJSA 3BJ91 5B38G 4WFFE 5BW7C 1WCBA 4Z0BL 2YK1H 4WUUA 5HYJE 4QXTB 3VJ6B 3PWLA 5TQ2L 4JPVH 2NX5E 2BSTB 3QEQD 4MD5B 5L2KB 1MI5A 1I8IA 4PRPD 1T2XA 3FHAA 5DHVH 1KPUB 3UTTE 4YO0A 4WDIB 1VESA 4IRZH 3O0RL 2AXGB 1E6JH 4NNYB 4X9HA 5CGTA 3D18B 4XAKE 1S5HA 1KGCE 3FFDA 1M7XA 2ZG1A 3CZJA 3KYOA 5FM5O 5CIPA 1X4ZA 4LIQH 3X3GL 2O61A 3VH8B 1QTYT 2MTPA 4JB9H 5IR1A 3ARXA 4KJWC 4P2OA 4R3SA 5KN5B 2DL9A 5IMMA 5IK3B 2HT3D 3QO1B 5C92A 5D1XD 3ZT5A 4CRPA 1IQWL 2F19L 4U1IB 2BOCA 1CGVA 2X1PA 1OP5K 4M6OL 3LKPA 4LCIH 4Q74A 5HYIA 5IT2L 4JAMB 5HXMA 1FNFA 5FDWB 5I1GH 4JQVC 4NUGH 1FP5A 1U93B 2UVFA 2IPKB 4NUJB 5D70L 1NCWH 4WHYH 1D9KA 1ZHLB 3NABL 4K23H 2VL5A 3F58H 1H3PH 3S36X 4ODHH 5CJXC 4K94C 3VGBA 4JFFB 4WHTB 1N5YL 3TGXA 5DLML 2DDQH 2YN3A 3GMPA 3WLWC 1YDPA 2NY7L 4U0RC 5HY9A 1N6UA 2GUOA 4ZQKA 2CLZA 3OXSB 3UTSE 4OZGF 3BYTA 1NLDH 4R2GB 1DBAH 2EE2A 4K7PH 3QXWA 2CH8A 4JN2A 3DGGA 1KJ2L 4KK5C 2OI9B 3E6HA 4V1DB 4KVNH 3QUYA 2VOTA 4WI2A 3H3BC 3KPSD 2QQLH 4KC3B 4LHQB 5IHZB 5F1IB 3JUYA 1KEML 4H1LG 3BWAA 2NY4D 4GW5B 2AK4E 3U9PH 5EUKA 5HDBE 3QEUA 1YN7A 4JM2B 5ID1B 1P7QD 3NBNA 2OS7A 1D5ZA 2NY1B 4BYHA 3KJ4C 4N8VG 4WGVB 4LLVB 15C8L 2GKIA 2IGFH 1IKNA 4G80B 4HXBL 5DJ6B 2AJVL 3S88H 3QIUD 2IQ9H 3SDAC 1WAAA 4GW5A 1R3IL 4QHMA 1EUTA 3KPQA 3JXAA 5CINL 4G8IB 4L4TB 4X7FC 5FYLE 1W72A 4PBXA 5B8CC 3CDGB 2B1HL 1NLBH 5IGXL 3VFPA 5I8CB 1UH4A 1U8IB 1J87A 4QXUL 4F3FA 2B5IB 3CXHJ 2QLVB 4WUUD 2W0FB 1I8LC 1AD9B 3VMOA 1X5FA 3N9GL 1AD0A 3OZ9H 3OHXB 5CZXC 4HK0B 4OI9A 3SDYH 2EYRA 3PWPE 5GJTL 4OF6A 4X5WA 4OT1H 3V4UH 5I1AA 4Y5VB 4MQTB 4HS6A 4HUWB 3ILPB 3RGVB 1SEQL 3MXWL 2J4WL 4FXGB 2WWKT 3PIQA 5LCVL 5DVLA 1I7UA 2Z8WC 4LCUA 4JQIH 2A83B 4EDXB 4QT5A 1WBXA 4DN4L 2XTJB 4AH2A 3PWLB 2DOCA 2HRPL 3RNKB 4PJ8B 4M9PA 2Y06H 5IB4A 2P5WD 3TV3L 4EJ1C 4EQ3A 5I1JL 1YNTB 1KEGH 1OAZL 1X4YA 2VABA 5E2VL 4M6NH 1G7PA 1Y18A 1FZKB 1EFXA 2Y72A 2PYEE 2CKBL 3HNTH 1FH5L 1FDLH 5EO1A 4QGYA 3X3GH 2LE9A 3ARED 1UM6L 3QCVH 2GTWA 1FVEA 3LKRB 3ZKSD 4TVPH 1T04B 3IU3B 1BVKB 3K8MA 2OTWA 3KPOB 2VJXA 3WNKA 2AEQL 3TZVA 5BS0E 1OQOA 3FQTA 4EI5A 2I24N 2FO4A 4ODVH 4W6WB 4Z7VF 2R4RH 4ZUVB 4HJGB 3LD8C 1S9WA 4X6CE 4NNYA 4FQ1L 5ALCL 1FGVH 4OCYH 1R0AH 1RVFH 3BP5B 2YWYA 3VE0A 4TUOB 3I6LE 3CZFA 1BFOA 5T1LD 1MAKA 4G6AD 2XNAB 4EN3B 1U95B 3JWOH 1II4E 1RUAL 3BDBA 1SY6H 3L3GB 2AXFB 2G75B 3U7WL 2C3VB 1YYLH 4OLUL 1YA5A 1JI2A 4H26A 4WUKH 2WP3T 4FQJH 2KDGA 1YUHA 4JO3H 1WITA 1IGMH 1C16B 3GJFK 5MHSE 1RQ5A 4PJEE 4U1NA 3FTGA 3CFCH 2AW2A 2IG2L 2R1XB 4FQXA 3QXAB 2WSKA 2YD2A 4JFZL 4PJCA 3VDAA 1B2WL 2OL3A 3CLEH 3RTQD 3VFWA 4NRXB 4HWEH 5B39B 1JPTH 2XOTA 4M61B 2JLLA 2CR3A 1ACYH 3H6JA 3WE6A 5GGSA 3TJHC 4OZHE 3S7GA 3SDCA 2E7HA 1NAKL 3LPWA 4ZTOL 1KTRL 4QXGH 5ANMA 2AJYL 5HHOA 1EAPB 3OG4B 4ERSH 4KMTL 3CSPA 1GAFH 1I75A 4X6BA 1FFPB 5IMOA 1CVSC 4FP8H 5EZOL 3MJ9A 3P4OA 4LGSB 1IVLA 4LLQA 2GCYB 3TM6A 5KS9A 5C08A 3CLFH 3QUYD 5FM4A 5HHOB 3MREA 3U4BL 4HV8B 3F7YB 1SEBB 3LEYL 2AJXH 4G6JL 3V7AE 2XPGB 3U46B 2ARWA 1B88A 2DLIA 1U8OB 1GGUA 4JM4H 2PW1B 3EFFA 4M03A 1B4JH 2X4UB 4NM8H 1CGSH 3ULVE 1K8DB 2P47B 4KRPC 4MNQD 3PWJB 3MOBH 3GMRB 1CD1A 3LKSB 4OB5H 3IDGA 5JPNB 4J1UA 3QO0B 1MHHB 4WHCA 1OTUD 4B5EA 1IAKA 3UJTL 5HHMB 3PWVB 3MLVH 4Z7UE 3EW3B 3SE4C 1T6VN 1S9VA 3ZL4L 1EIBA 3QUML 3LS4L 3NIFE 4R7NA 4N68A 4PJDF 3VRLF 4PBVC 3H3PH 4N1HB 5I17A 1PD6A 2HJLB 4LEOA 2E6PA 3P73B 4KI5E 3RX8A 4HUKB 1FZOA 1XGPB 4E41E 3NCYP 2VZOA 4NQDA 4CGTA 3AFLA 1IKFH 3D0VA 2PTVA 3P0YH 3O8XD 1EV2E 5FYLH 1YDPB 4UU9A 3VRJA 5TDPA 4GKZB 5L9DL 3IDNA 2ILLA 4I0PA 4AIOA 5LKNA 4R26H 1I9JL 2QQKL 3FO0H 4LPVA 4N0CC 4L3EA 3LN5B 1UJ3C 4G42B 3MR9B 3G6DL 1DR9A 5DTFB 4MLSA 1HINH 1Z0MA 4KXZH 4C56E 3WFDH 4JZNA 1AHWC 3F58L 3HI1A 4WI9A 1VERA 4OCRL 2BERA 5I19H 2NXYC 3GFUA 1Q9KA 3N1QC 2YXFA 1JV5A 5IQ9B 4R7DA 3C08H 3QG7L 2PYEB 1WICA 4QF1A 4DK3A 4LAQH 4X4YA 3WUZA 3TZVD 1N59B 4MA7L 2E7CA 3UC0H 3R8QA 3UTQA 2KQMA 4MNGA 4KHTH 3BPOB 5AZ2H 4OCMC 2D4DA 4WI3A 3I85A 5C07D 3QIWC 4P3DA 1FYTB 3U7AA 2DYPA 1JGLH 2ZOLB 35C8H 1XGYH 3P9LB 3TVMD 2XTJE 4FQQA 3GKZA 5JW3H 3C5ZB 4HCRH 2AKRB 1M71A 1CICA 4ZNCD 3RUGA 3MV9A 3T3ME 1WZ1L 3FRUA 5D2LF 5KSAB 3CFCL 2CPCA 2Q3ZA 1EVUA 1YN6B 2CDFA 1TQCB 3AS2A 3HFMH 4QHUA 4N9GB 5C09E 4DN3L 1HHGB 4YDIL 4JJ5B 4P2OD 2WBJB 3G5ZA 2FECL 3KPTA 5GRUL 1L4IA 2ERJB 4TVPD 4E42A 1YEDA 2FNBA 1F58L 3DHMA 4CMHB 1EHXA 5DFVC 3VXTB 3DX8B 3ARWA 1I7RB 1Z2KA 3QWQB 3WIFA 4NFBA 3TNMA 2X4NA 2BY3A 2XTJD 1EEUA 4DGVL 3D39B 4RA0C 3NFNB 1PG7X 1P6FA 4K3EH 5C3TA 5IOPB 4IDLA 4B7LA 4X6CA 2XN9A 5IVNA 5KVMC 1Q38A 4BJLA 5I8EB 1NSNH 1HWGB 5AYQA 4PJXE 3QUKB 2IAMB 3UPAA 1T1WA 3NOIA 4K07A 3QUXB 3SE4A 4IDJL 5EO9A 1C5CL 2QKIB 5GRXG 2FZ3A 4P3CH 2EC9U 2IAMD 3TIEA 4IS6B 2YA0A 3C8KA 4M61A 2Q20A 4X6CB 5ALBH 3M8OH 3SE8L 4UTAH 3WHXB 4V1DE 3O4LA 4JM4L 4JFQB 4JHWL 1A7RL 1INEL 1RJZB 4LVHC 4D0BB 4KKAC 1OL0A 3O4OB 4RZCA 4F15B 1RZGA 5A43C 4ALAL 4PRPE 1Q9OB 3NFPA 3T0EE 2B20A 4NP4L 2VERN 3RUGF 2HRPH 4NC2B 5C0BD 4U6HB 1KIRA 3BH8B 4LQ1A 4YHPA 4D3CL 1A4JA 3ZE0E 3FB5B 3VFMB 4GRWF 4RFEB 1S7RA 3FKUS 2RQ8A 4KVCH 1A1OA 5D6CA 3GMRA 1FLTX 4P9ML 4IOFD 3ULUH 4OLZH 1OP9A 3FB6B 4XP4H 2ICWI 3ES6B 3WSQH 4Z78A 43CAA 1KN2L 1MJ7H 1WTLA 4KPHH 1YEGH 2XPGA 1RK1B 5C9JB 2YC1B 4M8VA 4DKAA 3HZVB 1C12A 3MLUL 4OZHF 3MOAH 3OKLB 2ADFL 2XWJB 1DBML 5F71A 1ZANH 1RY7B 3V5DA 3C9NB 4HZLA 4FFZL 4Q6YA 5DZNA 1NCAH 5T3ZD 3SCMB 3HMXA 4M3KB 2VN4A 4BSWA 3N1PC 5T33H 4Z7WF 1IAKB 3RIFK 3MRHB 2OLDA 3FRPA 4HBCH 3MNZB 4K3EL 1R5VB 3D3VD 3RVTC 3FAXA 4HWBH 4TNWF 2LAAA 3QFJB 4NQXB 2F5AL 4JY4A 3HUJB 3IDUA 1YYLL 4EQ2A 2VR9A 1ZKAA 2Q3AA 3OJMB 5FYKD 4YDJB 5D6DC 5IVXB 2G5BA 4IRSD 3VMPA 5BOPA 1KJ3H 1P1ZA 1N7ML 2QJDA 2GHWB 1FRGH 3BESR 4JDZA 1CF8L 3DX6B 2DYPD 4AEFA 3A0OA 2HA1A 3SDDC 3QQ3B 4UZGA 3U4AA 2NLJA 1JZ8A 3QHZL 4JZOA 1LO2L 2V5SA 3ARRA 2V6HA 2R9HC 2CXGA 4GSDH 1LWRA 5GJSH 1KIQA 2EKJA 35C8L 5CP7A 4U0QB 5C70A 5HGHA 1GGCH 3BIAX 4MNQB 1KCUH 3MC0A 3N0PB 1W72L 5EBLB 4OI8A 2PR4L 2JIXB 1NCBL 4P59L 2CMRL 1SHMA 2DQTL 1ITBB 4Z7VA 1XCTB 1QA9A 3QG6B 4ZUUB 1INDH 5GXBB 1NCWL 3P30L 4Q58C 4LEXL 1U8HB 3TA3B 1EDQA 3MA9H 1JMXA 3T09A 1LK2A 1MY7A 3QDMA 3ZZ1A 1DEEA 4S1DC 4PR5A 3WIHH 5HYQB 3U83A 1LE5A 5K93A 2FWOB 3CC5B 4UAOB 4ONHA 3O8XA 5C08D 1WWBX 5C0AA 3MGTB 4CJ0A 5I1GL 4HC1H 1NMCB 2YPLB 3BH9B 1CFQB 5SWSE 1CWVA 2X40A 3CXHK 5T1MB 2H41A 1ZTXH 5I71C 5EU4A 1HXYA 2JJSA 4KWUA 4OLVL 4TQEH 1VPOL 4UDTB 3WFCL 4LOUD 1K6QH 4NZRL 2I07B 5DK0A 3MMEA 2XY1A 4GAYA 2YBRA 5IVXF 1JHTA 3HE7C 4NP4H 3LQZB 2X41A 5ILTH 4LLDA 2NY3B 3SGEH 1JGDA 5E2TL 3BSZH 3UZQA 1NCTA 2R1YB 3EDJA 2NMSA 4G7YL 2X10A 3BEVB 3B9VA 1RAMA 1GGYA 3T2PA 2VABB 4FOMA 4PY7A 5F9OL 1IKNC 3EYQD 3WJLA 3OR6A 5DJDA 4PJBF 4DUWA 1LO5B 3MOAL 3BT2H 4P9MH 1ZGLB 2Y5TA 2GEEA 3WFDL 1DQQA 1YNLL 3R06B 4LSQH 5ICYB 4XC3H 1XFPA 4NQCA 4Z7WE 5FYJH 3VGGA 1MFDH 2FIKA 2R2EB 1ND0A 2IPKA 4F9PC 2FL5B 2HT2D 3TJHD 5CUSL 4LQFH 2JJUA 4S11A 3B9EA 5KW9H 4NN6B 5T3ZH 3IDYC 4P46A 4ENEC 1KBGL 1G1CA 2YSSB 1DQQB 5D8JH 1YC7A 4CN4A 2HT4D 1IFHH 1YQVL 1F6FB 4KH2A 5FF6B 3GMNB 3L1OL 5IGXH 3K2UH 4RMQA 2UWEF 1LK3L 3UXFA 1TPXC 1A0QH 3LY6A 3GBMH 4DGIH 5IUSA 1ADQA 4X98B 5F1IA 1ADQH 4YH6A 3VFVA 3ARQA 3J8F7 4FRWA 2O61B 1OHQA 1D5MB 4MQXD 2OL3H 1HE7A 1DANT 5E8NA 3QHZH 5IOPA 1FL6A 2X4TA 3MRCA 2BC4B 4KUCD 2AK4A 1MCWM 3B83A 4RBPK 2CKBH 1A6VH 3AM8C 1HI6B 2R2CA 5FOBB 4ZQKB 3WL9A 3HUJE 2VAJA 3SKNA 3QQNA 1MIEL 5J1AB 3DSFH 2CGRH 1XIWB 4OF0A 5EZJA 4O2FB 4PRHA 3INUH 2I5YL 1YYMH 1D9KB 5JOFB 3OAUL 4KZEH 4XNXL 5AAMA 3GEWB 5EO0A 1Q9OA 4ZXBD 2E6QA 1Z5LB 2X5PA 4JRYD 1T1XA 4JANA 5K59E 3HR5A 1MHPH 4X9GA 1TQBC 2GCYA 3QIUB 5KS9B 4OLYH 3G6JB 4S1SH 4K3HA 1P6AB 4TUJA 4HKJB 4Q7DA 4EI5C 5C0RH 3D2UA 5DC0A 1FE8H 3FCTB 4X80L 4OFYA 2A74B 3BP6B 3WFCH 5C7XH 1NFIB 4KHXL 1SYVB 5ICZA 2NYYD 4XBPA 1IFHL 2W38A 2IANB 4GKNB 5C0ND 5FGRA 4FNLH 2JF1A 4RMWA 2HFGL 1I3VA 5K59F 2F54B 3W9DA 3C9NA 4HZLB 3ZKMD 1H3UA 3BZEB 4AYFA 2OCFD 1B2WH 1U6AL 1A8JH 1OAZH 5I8KL 1ETZA 4UOW0 5CEZE 4PJ9C 2X70B 2VDML 3MBXH 2V17L 5I0DA 3IGAA 2Z0BA 4GKNA 5HHXL 2Z4QB 4CU6A 3HG1E 4XXDB 4RDQF 4ZO7A 4Y0GA 4X9BA 5HI4C 5B38A 4I5BB 3HMXH 1AQDB 3TT3H 4LU5L 3BIKB 1TTGA 4Y5VA 4QOKB 1IAIM 1DQLL 3LKNB 1QQDB 5K9JH 3SKMA 2CGRL 5JW4Q 1JWSB 2OTUB 2W92A 2WANA 4XNZC 2E9BA 3BGAA 4G7YH 4XVSH 3C5JB 2P8PA 4KROD 4UT7L 1RU9H 2AEQH 3C60D 2VXQL 3T2OA 3IFLH 4NM4L 1T89C 4LRIC 3DMMD 2YMXL 3QH3A 4NQCE 3F65A 1UZ8A 3P9MB 5F6IB 2CR6A 2C4FT 2N56A 3U1SL 4IRJB 3MJ7B 1OSPH 4GMTH 2IADB 2JTDA 1JWMA 4RFNB 2NY5H 4WWKD 1J0HA 3L5WA 5EN2B 1BFTA 5J6HA 4OLXL 1KJ2A 2A0LD 1U42A 4QWWD 4B50A 4HIJA 4JRXE 4LSSH 4PJFE 3V79C 1MIMH 5MI0B 3ZL4H 1A7PH 3MRGB 2HN7B 2ATKB 1CICC 3D0LB 3M17B 3RBSA 4MHHI 1S9KC 4WIQA 3U82B 5DYOA 1JZ4A 1G7QB 1MUJA 3EJJX 4JZNB 1N0XH 2XQYK 1X4XA 3O3DB 2UWEA 3A6BH 1I9RL 1TLKA 1DBKH 4M7ZC 4PUBH 2ZCLL 5CMAB 4Y19B 1UB6B 4KTDH 4UUJB 5E6ZA 4XVTL 1AFVL 4JE4B 4JO3L 6FABH 4PLJD 3BQUC 2VUYA 2CIKB 3OBAA 3LZFL 3GMOB 4PP1C 5EUOB 1TJIL 4JREC 4XX1G 5BVJA 5TH2A 3RZCB 4U1GC 5E99L 3TBVA 1F02I 4QXGL 2DQGL 5SWSA 1HILB 1S7SB 1DBBL 5EU7E 4NO0A 3MRDB 3VGAB 5INDB 3K3QA 1D6EA 1HDMB 1OB1B 1T1ZA 3I6LD 3E8UL 2RR3A 5SWSD 2EYSA 3WIHL 1C1EL 1EPFA 1MH5B 2AJYH 2DIAA 5EC2B 1PEZA 5JNYB 4HBQA 3KPRD 3Q48A 5DDHB 4FQHB 1QLEH 2VITA 3TP4A 4QRRA 1KC5L 1K8IB 3O9WD 4OLYL 4U2YA 1PQZA 1R5IA 5HGBB 4HQQH 5GSRB 1GC1L 2EKSB 2HWZL 5IF0B 3MCLH 3RTQC 3STZA 2VC2L 3QEQB 4Y2DD 1BOGB 1PSKH 4BZ1H 4OCSH 2YUWA 4N8VB 4GW4A 1NDGA 3OKDA 8FABB 5CSBA 2D7PA 4YDLB 2BXZA 3EHBC 1OAYH 3IFOA 1BAFH 3QI9A 5DRNB 5FECA 3DYOA 3RVXC 4LSTH 1XH3A 4PRIB 1RURL 3IJYB 1MI5E 3RNKA 3FONA 2R0LH 5CJ5A 4LLQB 1MAJA 4NJ9L 1MFNA 3QWRA 2EXYC 2ICEA 4D9RD 1NGPL 1LO0L 5EDXA 1TJGH 4APQB 3DUSA 4R90L 3DIFB 1QR1B 1MWAH 3T0EA 1MREL 4ZS6C 4GKZA 1FORL 1YMHB 4HWUA 4OD3L 1TZGL 5HHME 1C5DB 1Q9LA 3IJYA 4L4VB 5ADPL 3P4MB 4JRWA 4LPXA 3LIZH 3DMMC 4LAJH 3IDXL 1YNKL 2LAGB 3QCUH 2YD7A 4DVBB 4KK8D 3STLB 1R5WA 1YEJH 4X7TA 1NCCL 5IMLB 3HI1B 3GDBA 1MCRA 2P7TA 2IBZX 4O4YH 5EA0H 4QLRA 3CVHL 5BQ7A 1DDHA 2VDOH 3BW9B 4HH9B 5C0BB 3TBTB 4L3EB 2BFVH 3H3KA 1BHGA 3GJFB 1L6XA 4XC1H 3DHJA 3F7RA 3RWFA 4I18C 4AM0A 1CICD 2VUOA 1HNFA 1H3VA 3CH8A 3LS5H 4MJIA 4FQCH 5FUZL 1V5JA 3RAJH 3NA9H 4AIXA 3MJGX 1CGYA 3HB3C 4P5TC 3WMSA 2MMXA 3MV11 1IM9B 4FFWD 1IAIL 1FNGA 4OIIL 1FZOB 4O2CB 1BZ9A 3J7HA 5IW3A 3OX8B 4JFEA 3KXFB 2OL3L 1G6VK 2DQJH 1BQHG 1MCDA 1KV3A 2EH7H 2ZJSL 4L8DB 4NO2A 5JW3L 4RFOH 4H0IA 4UILL 1E6JL 3P11L 5JZ7D 1C5CH 5D7LA 5JHDE 2YS4A 2N4IA 1AKJD 2EEDA 1S78C 1WZ1H 5F21B 5CZXD 1IMHC 1A47A 4OD2A 1TJIH 5J13C 3THML 1LEIB 4Y1AB 3CDCA 4XP4L 1INQB 3WSQL 4JZJA 4MYWB 4NRZA 3D87B 3CXDL 5BZWB 3FJTA 5BRZB 1NMBL 5JQ6H 4GMSH 4L3ED 5CILL 4XPAH 3WIFB 1QFUL 2GY7B 1T03L 3S3SA 4ZOCA 2D31B 3GNML 5FGCE 4ZXBC 1X5ZA 2LVEA 2CIIB 4PRHE 2ZUTA 2C26A 3AC0A 2QSQA 5HYFA 1BMGA 5IB3A 2F54D 3MRJA 5CJBA 1LDPH 3CFDB 1INQA 3WKMH 3V9FA 4K7FB 4LGPB 4RGOH 2XTLA 5GZOC 2NX5A 2FHBA 4G6FD 4FXLA 1N3NA 1X44A 2VNCA 3L5HA 1MCCA 1DJSA 5C0GB 1J18A 3G5VB 3E6HB 3MROB 4U4BA 5DJ2B 2BJML 3MLRL 3DRQA 4M7ZB 3SGDI 1GOHA 3NGBC 1CYGA 1FE8L 2C1OB 1D6VL 3BP4A 3CNKA 3M8OL 2ZUQB 3SE8H 5KSBB 2VC2H 2DWEA 1J0YA 4IRSC 4HEPG 1BFSA 4P2OC 3VI4E 3QEUB 4Y4KD 4QOKA 5LXGL 5IK3A 4LBEB 1M7DB 4KRLB 4MMZC 1HYRC 4YHYB 1I1YB 5IEKB 3C2SA 1B4RA 5CEZL 3U7WH 1YEKL 1GHFL 1S7UA 1AGCB 2VDLH 4PYHA 3MUJA 2FH6A 1OGAA 2D7QA 2FEEI 3NFSH 4Z7WB 2M2DA 2NY0C 4EBQL 2PYFA 3P11H 7CGTA 3K1KC 4RMSA 5F6IC 5HHXH 2WQ8A 2YC1A 1P4IL 4OD3H 2QADC 4MDIA 5CJOL 4Z5RA 5D7JA 4YHML 4P57A 1UQSB 3S35H 1RZIB 4LPTA 3BMVA 4U1IA 3ZYJA 1YEFL 5DQ9B 4RA3A 2DTML 4PTTB 1ROWA 4JFDE 4OZHA 1H3GA 5T3XH 1ZLSH 1QUNA 1RD6A 4JR9H 3QA3A 1M7IB 4ONFL 1DQTA 4IIQB 2GAZA 3IDJA 2BNQB 4JN2B 5AWNH 4GMTL 3C09B 4L9DA 2NY5L 1GGBH 1A3RL 1N26A 3TLRA 4MS8D 3VXUA 3I3BA 3O81A 3GHBL 4RMRA 5EA0L 5TFSL 2WWMC 1U92A 2XY2A 3FOLA 1JZ7A 1DVFC 4OD1H 2YRLA 5BQ7B 3O8XC 3NN8A 1P4BH 5A3IC 4XMKL 3VG9B 3QXDA 1S3KH 5FF6A 1NKRA 3B6SA 5J8OA 3V5KA 1UWXK 3RIAF 1IGYA 3QHTC 2WM0A 2X4OB 3ME0A 4P23B 3ZDZF 3VD3A 2JELH 3O41B 4KDTC 3CGTA 5F9AC 1U8LA 3QB7C 3L5JA 3W39B 4EI5D 4N0FB 4FQLH 4PGDB 3VFSA 4LNRB 2XZQH 3B4NA 3O9WB 1AGDA 2H45A 4O2EA 1OQXA 2EDKA 3LKOA 3FO2B 3QDMD 1NAMA 3DNKA 4KK9D 4FG6C 4TULH 2C4XA 1K4DB 4GG8A 1MJ8H 4PJ8D 1U8KA 5DD5H 3VXSD 3QI9B 1QZ1A 4ZG1A 5HBBA 2AV1B 4OV5A 1RUMH 2A0LC 4GG6F 1S7TA 5DUBA 5INCA 4CMMB 4G8IA 4L4TA 5CBAB 5E2UH 4W81A 4QCIA 3MV9E 1AXSB 3BP7B 3GKWL 3N85L 4WTXA 5IFHH 1FNAA 1OSZB 1EO5A 2CLVA 4QYOB 1KIQB 4ODVL 1IAOB 3IJHB 4J23A 1BF2A 4RNRA 2Q6WA 1TETH 2OSLB 5IB5A 3DVNB 5EIQA 3GHBH 3JUZA 3OB0K 3IAGC 5E00B 3BXNB 4X4XB 1G6RA 4EUPH 3STLA 2NY0D 4HFUH 1ZK9A 1RUAH 3OKKB 5H35B 5T1MA 4G8GD 4Y4FC 3TZVC 1BBJA 1EXUB 1QKZL 1SM3H 4JDVA 5DJYA 1A9EB 4YBQD 1WFTA 2AQ3A 4XCNB 4NO0D 1N4XH 1P4IH 4NN6C 5E2WL 3UEZA 4FQPA 4APQA 3D3VA 4PGBA 2VRAA 1RZ8A 4E41A 2QEJA 5T3XE 1BD2B 2A6JA 1P7QB 2BMKB 4RAVB 4ZUUA 4CVZB 5CD3B 2A9ML 4KJQC 4CVWA 4XXDA 1PKQA 1FH5H 1U8NB 3BEWA 4JY5L 4XP5H 4P2RD 3ZDZE 4I3RH 1LD9B 4JGJA 4XPFL 3BP4B 5KANI 5EUOE 5IWLC 1G9MH 3QJFB 5F6HJ 1NCDL 4Z78B 4WGWB 5GZOD 2APXA 1RHHA 1QBML 2DI9A 1RUML 4MJID 4QRSA 5C0DB 1T5WB 5EZLA 1BQSA 3LRSB 4N1EA 2FD6L 2BHZA 3BUTA 4I3SL 4HUUA 3GJFA 5A16B 5FO9A 4XHQA 3SQOL 3C6SB 3PXJA 1A3RH 1RVFL 1WF5A 4NNPH 1EUUA 4ZO8A 3VXUE 3DUHA 5CZVL 1U95A 3DVGB 5KAQG 4Y2DC 5CUSH 4MDJB 4HLZG 4L5FL 4WUKL 4IRZL 1JGEB 3IRPX 3NCMA 4JFOA 1AP2B 3VW3L 4JO1L 4XPGL 3DXAD 2VDMH 3MBXL 5JW5A 3QEHB 2BNQE 5E6YA 3EOAA 1BD2D 3BPCA 2P5EB 3X12A 5CP3A 1VFUA 5MP6L 1F97A 4P0DA 1OD9A 1FL5B 4WFHD 4Z7OF 2R56H 4WWKC 5T5FL 3AU1A 4X6DB 3OV6A 4WW1A 2F8VA 4PJDE 1OLLA 2OP4L 3QDAA 1EFXB 3RY4A 1N64L 4M6OH 3KLHC 3G08A 3I75B 1NBQA 2XIDA 4F8QA 3EO9L 4TUOA 5C0CD 4QHKJ 1I9IL 5DQJA 2ESVB 5HD8D 3BFOA 1BQHA 2OM5A 3RWEB 4LCIL 3O6LH 5IT2H 4V1DD 4UNVA 1YUHB 2MFNA 9CGTA 3WJLC 3MLZL 4Y5XA 3OKYA 5L8KB 4X6BB 4FTVD 2FCBA 1T7XA 1RZJH 1TTFA 4AQOA 3DVIA 5INCB 3PDOA 3MXVH 3OHXA 1SVCP 2H8PB 4HWBL 3LRGA 1P9MC 3VXRD 2Z91A 2DQFB 4ODXB 1NDGB 5SWQB 3FO1B 3RL1A 1QNZL 2VE6A 5C0EA 3FO2A 3ORJA 3LS4H 3FN3A 3F12A 1HHKA 3ZYIA 1KXVC 3UYRL 4EDXA 3RVWD 4JG1H 4U1LA 3C87A 3I50H 3U0PA 1GOGA 3HI5L 4UQ2A 5GIRA 3IDGB 5JPNA 2VAAB 4EXPX 4NCDA 3D39E 1KLGA 2V7NA 4OQTH 4JHZA 3SE3A 3H9SA 4DN3H 1KEMH 5CJ8A 3MLTA 2GY5A 4XP1L 5KSAD 1IEBB 1F4WL 1U8OA 5D1QB 1ZVHA 2R69H 5HHMD 4HPYL 3H7BA 1IGCH 4UINH 3B6SB 1UM4H 4HUVA 4PD4J 5DD3L 3TVMB 1W72H 3SJVA 5FA3A 15C8H 2F58L 4CNIB 3AREC 1U8JA 2EH8L 1RZ8B 1OF2B 2EDXA 1JYNA 4HKJA 1FVDB 1JHKL 5DC4B 4H1LB 3OJDA 1KT2B 5C07A 2DM7A 3U6RB 4JHBA 1L7IH 3BYYA 1UCTA 3VXMD 4X6CF 4BZ1L 4XCNA 2HJLA 4QRPD 2X1XR 4W70A 5D7IB 3K8KA 4WDIA 5EO1B 5AAWA 1F3DH 5ESAB 3ZE1F 4F15C 3KPSB 1K9TA 5IBUG 4PLJC 4I3SH 5B39A 1LMKA 2IBGA 4WO4B 2FB4H 3LKSA 4JM2A 4EI6B 5KVEH 4N8PA 4JY6A 4F57H 3ZTNH 1I3UA 5HI5C 2Y23A 2B8OT 2VDKL 2IAMC 4KRPD 2H26A 2VWEE 3NACH 3S4SB 1MREH 4YHKL 4FABL 5F7WC 3SHSA 1V3KA 1A3LH 4WWKB 3Q3GA 4FTVB 1HQRA 3UPRA 1CBVL 2XWTB 1AFVH 3I50L 5C08B 4JO1H 2DWDB 5AD0B 2FJGA 4QRUA 1J1OH 4FQQB 5H2BA 1S8DA 2ZKHL 3F8UB 3L7FA 3PE9A 2EIBA 3CFKB 4OF3A 2DN7A 3TIDA 1P7HL 1T2QL 3CX5J 5DJZB 3KXFA 3U4EB 2WWMD 5KSBE 1XF3A 3RWCA 1BFVH 5TPWL 3SOBL 3KPRE 4IRJA 3UTSA 5H2BB 5D1XC 4LSDA 3FOMA 4P2RA 3B5GA 4NJAH 4XCEA 2V5YA 4NRXA 5EPMB 2ICWB 1KELH 2JKXA 4MAYA 4EVNA 1CI5A 1PZ5B 5GSVA 4NN7B 4BQ9A 3DBXB 4X8JA 4DKDC 4HK3J 4KZDH 2P8MB 3TN0D 2M8XA 2KKQA 1QBLL 3D0LA 4M6MH 3RA7L 1VFBA 2FX8H 4FFWC 4HUXB 2HYMA 3AY4C 2FX9H 5AZEL 4Z7NF 4U6TA 1SJXA 1RK0B 3TYGL 3UYRH 4GT7A 4UU9B 4N0YL 3ILQC 3BDYL 5GRVK 4I3GA 2FJHB 1PBYA 5E4EB 1OM3L 5CJXA 3N1MC 3TCXA 1NC4A 3NA9L 4Y7MA 1E4XH 3SE3C 3GSVB 1OAYL 3FRUB 3GSNA 5EBWA 1NFKA 5DA4A 4LCYA 5C0JA 1NJ9A 3RVUC 3T3MF 3TBSA 1J1XH 1QVOB 4YXLL 4HK0A 4QRTB 3BKJH 1LO0H 3VXPA 5HPMA 5L2KA 2GTZB 4F2MA 1EZVY 1UJ3B 4U1MB 3FN0L 2VDOL 3HMWL 3AGVA 4HFWB 4DEPC 1WCQA 2PYEA 5ETUB 3KLHD 4M3JA 1Z3GL 4UINL 1JHKH 3OAYK 1ZT4B 1A1OB 4GW1A 3JV0A 1RI8A 4ZD3L 3CLEL 3VFOB 2I9TB 1RULL 2XWBA 3FFDB 2BNUA 2F58H 2JB5H 1CXKA 1DN0A 4MNHA 4XWOC 4LDEB 1N6QH 4P9HC 1GIGH 5CAYB 4QRSB 5IKCA 1NAKH 3KYMA 3H2WA 1MLCB 2W0LA 2KPNA 1P5VA 1KN4L 3OKNA 3P4LA 4WY7H 4YHOL 4ZS7H 3LEYH 1X5YA 1ZHBB 4NQXA 1JRHH 1WEJL 5I66B 3QUXA 4S1SL 2HFFB 5E1AA 4UIMA 3IB4A 4OZHB 1RUPH 4PJ7A 5IMLA 3O2DH 4KXZI 3P40A 5I1KL 4PS4H 4WFHE 1A7OH 2H32A 1JF6A 3RU8H 3BKCL 1ZSDB 4OUUB 2AJXL 3MX0A 1I1FA 3ZMRA 4WJ5B 4EKXA 4K3DL 2IJ0C 5HGDB 3V4PL 3QDGE 5D7LE 4JLRB 2OJZL 3RPIB 1QFUH 2XWJA 1ZT7A 1U3HB 2D7MA 2OX5A 5C8JB 5CLTA 3QXAA 1EMTL 3LKQA 3BOVA 5IJKA 2SEBB 4QNPF 3L9RA 1SJHA 3WNOA 4XMLL 2WUBH 4ZPVB 5DJ8B 4GS7B 4LF3A 5ESVA 5FKAA 2NQCA 3QUMH 4O02H 3SDXA 4X7DC 5E08L 1XF1A 3PWUA 2E7BA 3QUMA 5TE7H 4OIBA 5TDOA 3CK0H 2YSSA 1C5BH 2YEZA 3X11A 2VXVH 3BRGC 5HI3D 3EFFB 4DTGL 5A2LH 1HOCA 2W60A 5HDLA 1OP3H 4Y2DA 3EYSH 4MMXC 3FL7A 4YPGB 3QDME 4OM0L 3FB8A 2XKNB 1GGBL 3O8XB 4XXCC 4OD2B 1IGIH 4MVBC 4HW6A 4Y1AA 3L7EA 4OSUH 1GGTA 1M1SA 4XTRC 5JW4N 2Y9RT 5ABDE 1XF2B 4GKOA 1SQ2N 3C09C 1OAKH 4NOFA 1BZ9B 3L3DA 2ESVD 4PRIA 3VFTA 3MUGA 2GTWB 2ESVE 1FG9C 2ZUYA 3ZDYE 3ZHKA 3GSNH 5B39G 3BEVA 3N1FC 4OLVH 5L88H 4O58L 3NFSL 5ITFA 1Y0LA 2R15A 3V0WH 1MIML 2RB8A 1KCRH 1A7PL 2CLRB 2V2WA 3DXAA 1IGTA 1OM3H 4GBXC 3VGDA 3DURB 1DTUA 3RQ3A 2VR5A 3VFMA 2HLAA 4A6YA 3R1GH 4N0YH 1K2DB 3IS1X 3ZHDA 5FHAL 5DWUL 1YPZB 3O2WL 1XGYL 3PHOA 2AXFA 2G75A 4ZFOL 2YPKB 1BQUA 3OMZA 2DD8L 5DSCB 5DMYA 4X0KA 4XMLH 3VMNA 4LKXA 3JWNC 2DM4A 1RFDH 3S37L 3U0WH 5BZDA 1H3XA 2HRLA 5I2IB 4O02L 3BD5A 2EZ0D 4J7RA 4Y16A 3D48R 4YHYC 1GJIA 3Q0HA 4OJFL 1F11B 3JWOC 1S5IH 1T22B 4KTYA 4TTGA 4JR9L 3UTQB 2BVOA 1TVHA 2MKLC 4LLYA 3T65B 1ERNA 2AEPH 4FQ2L 3FQTB 3HPLA 3WN5A 3TZVB 4Y4FB 4JZOB 2PO6A 2EXWC 3BGMB 2NXZD 4JPWH 5DEFB 3QFDA 4F33B 1QSVA 5ISZB 1T22A 1PAMA 2VISA 1A7OL 3VRIB 2DLTA 1FHGA 1WAAF 4G80A 4KJQD 1HEZB 1LO3H 2DM3A 1RUPL 4M5YH 3KYNB 4YDJA 3ZE0F 5IVXA 1TNNA 2EEBA 1U3JA 4XP9H 3D25B 4Y4HA 4YQXH 2VZSA 2C1PA 4BSVB 2YA2A 2FRGP 2Y5EA 3O2DA 5I8OH 3ILQD 3MQIA 1P7KB 1JRHL 4LVNB 5DA0B 5ISZA 3H8NA 1P4LA 3B9KA 1P4BL 3WBDA 2Q86B 2YUVA 2WWKO 4EZMA 1QSFD 1P53A 4NO5A 5GS0H 5BXFA 1KIPA 3WS6C 1NGYB 4X6FA 5JDJA 4L3EE 3FQNA 4XH2B 5B4MD 1OD7A 3R0NA 5F1SA 3C8HA 4KK6D 4JDTL 2VQUA 1CE1H 2A9MH 3HE6A 4H0GA 5E8OA 1DQDL 4JM2F 3R1GL 5D93B 5D1QD 5FYKH 4M93C 1D6EB 4IIQA 4KDVA 3HN3A 4JKMA 4HHAA 2C3WA 1F13A 2IAMA 1NFIA 1H5BC 2HFFA 4UBDC 4Q0XL 5EUOA 3W0WE 4CL7A 2E9IA 2VLRB 4QF1B 2IH1B 4JM2C 4PGCB 5HI3C 5C71A 3A6CH 2VQTA 2QV2A 4R4FL 1CFBA 4TUJB 1CDCA 1VDGA 4N0FA 4NO3A 2DDQL 1CD1B 1JHLH 1J11A 4HV8A 1PZ5A 3U1SH 2GFBA 3NFPB 4QYOA 3VFRA 1KB9K 5MENA 2UZYB 3VG0H 1T5XA 2DMKA 3RPIA 4NFDA 2NY6B 4LPYA 1NLDL 4MD4B 1IILE 1KPUA 4HAFA 5EO0B 2Q8AH 3R8BB 1QRNB 1FZMA 4PRDB 2PW1A 1E6OL 4POZC 3P0GB 4WW2F 1UH2A 1S7WA 4OAWB 4XI5C 5EOTA 3PP3K 2K1MA 4PGEB 3V6OC 4ELMB 4ODHL 1MCOL 2DQUH 5FKPA 3TO4B 5EOCL 4PJGF 4LHUG 5JXEA 3DSNA 4KUZH 2H1PL 1FJ1A 3EOBB 3S35X 2EEAA 2D03L 4WCYL 4GQ9L 1FGNL 1Z9MA 1J1PH 1NMAH 2DQJL 2W9EH 4MCZA 1I8MB 1EX0A 1OT2A 2O26U 5LBSL 3GUTB 3MV01 3S6CA 3FB8B 1A6AA 2Q7YB 5AUMA 4YHNB 4IS6A 1T7ZA 2AV1A 4G5ZH 4OV5B 2KBGA 3E3QC 5HYJB 2APTA 3QA3B 1FJ1B 3EOBA 1G6RB 3MNWB 3MLTB 1MHHA 4Q9BA 1QQDA 32C2A 4O2FA 4DKEL 4HIJB 4NQUA 5ETUA 1A9BB 4RRPA 2YRPA 2Z93A 2O5ZL 3GMNA 1CD8A 4XPHL 4JN1L 4ZAKD 2A38A 3UTOA 5LGHL 4PJEA 5DURD 3QDJE 4GG6B 2DLFH 5CD5C 1MFAH 1PY4A 2DLHA 3MRLB 5GS2H 1J9CT 5IG7A 3V6OA 1YECL 2C3VA 4XTRD 1NUGA 4YJZL 3SE9H 5E8NB 5TGBB 2XKUA 4JFQA 1QPPA 3CJJA 4N5ED 1IC5L 1FC1A 3L3JA 5KTEL 3VG0L 3HUJA 1NLBL 2J6EL 2EE6A 1IEAA 1Q9LB 3SGKC 2QQQA 1K6QL 4QRPE 1UB5A 2FR4A 1MCLA 2V5MA 2ATPB 2R8SL 2ED8A 3FOLB 3TJEL 4NQEB 5D4QA 1UB6A 4UUJA 5JHLL 2ZCLH 4RISH 5ACMA 1ETZB 1QSEA 2Z31D 2VIRA 4DAGL 4R90H 2AXGA 3OKLA 4P23A 1HNGA 2O5YL 2R69L 2FIRT 2HKFH 3JTSB 4G42A 4Y5YA 4P4KB 3CFJB 4J12A 3FT4A 3GJFH 5J12B 5I1IL 5F96H 1E0OB 4QXTA 4ZUSB 1CFVL 2R56L 1UCBL 2FYYA 2MPAL 5KOVC 3B8YA 1JV5B 5MI0C 1R3JA 3LMJH 1CK0H 4JFDA 4KK8C 4MJ2A 4JY4B 1JNLL 2Y6SD 2ZPKL 3QH3B 2KQNA 3EYOB 3NIDF 2VSDA 4NSKB 2DM2A 4PJXF 2F54A 5IHLB 3EJZC 1E4WH 5F7NC 5INDA 5J0BA 3WHXA 1SYSB 3DUSB 2WBKA 3VXRE 2EIEA 3G6JF 2P45B 3HE6C 1E4JA 5DD6B 2VO5A 2FX7L 3BDXA 4LARL 1YNLH 4LSQL 3NVQA 5DJZA 1T1WB 4ZO6A 1S7XA 2D3VA 5L7XL 2VLKD 4L4VD 5ANMB 2OR9L 4K2UH 4KTEH 1CDJA 1UXWB 5L2JB 3O6FC 4YPJA 2A77L 1JI1A 5A3ID 2IFFH 1NBZB 12E8L 4WFEE 3QIUA 2EO1A 4F7CB 1MCJA 1T5XB 2OZ4A 43CAB 4MD4A 3AU1B 4JFED 1HH6B 1V05A 4ZYKA 3LH2H 3CFBA 3HRZB 3L95B 2BSSB 2AV7A 4JKLA 3R06A 1A0QL 5ICYA 4RISL 1S7RB 1CXEA 1D7FA 1W0YT 2WIIA 4TPRL 4XNQB 4GMSL 5CILH 1Q9WA 1GCFA 1MNUH 3MJ9L 1QG3A 4PY7B 1SY6A 2VZ3A 5LBSH 2DWEB 2EDQA 4JFZH 3GI8L 4NQTA 2ADGB 3ULUF 2NY6C 5JMOC 1WGOA 4R6UA 5TE4L 4YEFA 4HJ0C 1QPXA 1XEDA 4EN3D 1NANI 5J11B 3V5HB 3BKYH 5KSAA 3JTTA 3OKMA 4OQ1A 1V7MH 5DI8B 2VQ1B 4ODUA 4Y2OA 1ZT1A 2DRUA 4LEOB 2RJMA 5FFLA 3DSFL 4RDQG 5HTSA 1JNLH 5D96C 3ZSSA 4FMFA 1B4JL 4KY1L 4XPBL 2IH3A 4NUGL 1FYTA 1H5BB 4PB0L 4YDLC 5ENWA 1FIGH 2G5RA 2E3VA 2DI8A 5I76B 4LGRB 1LO3L 1GZPA 1FNGB 2DQCH 4ODTL 4U3CA 3SPVB 3UTTD 2EIZB 2VL5B 4MQSB 4A2MA 4WTZG 2AGJH 4MXWH 5CFHA 2HFGH 3A67H 1F3DJ 4M1CC 2YD6A 4AK1A 1AC6A 1S9YA 43C9B 1A1NB 4XNUL 4LHUA 3LEVL 1NFDF 1NCNA 5K9QI 2JJWA 2MCPL 4LASH 5FXCH 4U6XB 3H3PL 3T0EB 2C7UB 3VGAC 5HHNB 5C0BA 1G7MB 4MAUH 4YE4H 1R3KA 5TF1L 4P46D 3ULUE 1CZ8H 1T7YA 5KVGL 3MLVL 1FFPA 5IMOB 4MXVF 1J1OL 1FL3B 3UZEA 4AT6A 4PRNB 3EFDL 3GB7B 1I1AD 5F88A 4RGNC 3UMTA 4OZIF 2JIXA 1BGXH 4LNRA 2R0KH 2C3HA 4P3DB 3DLQR 4MD5A 3CUPA 3PWPD 1YPZF 1AH1A 1DQLH 3TH3T 4IMLA 3QJHA 4X83A 1I9JH 2QQKH 2XZZA 3FO0L 3H0TA 3FQUA 4PRPA 3PGCA 3BPNB 5JHDD 5I1IH 5D6CB 1DE4A 1Q72L 1NEUA 3F5WB 3Q6FA 2OTWB 3K46A 4UDTA 4QHMB 4KJWD 1PG7H 5EZJB 4D0BA 4QCIB 5I75B 5C0EB 4UDUB 1L0YA 1CLOH 1KCSH 5DMGD 8FABA 3ULUC 4RFNC 1T4KB 1YEEH 2HJKA 3WUWB 1FPTH 4OCWL 5HYEA 2I9LB 3FZUD 3T1FA 3UO1L 3VD5A 1LE5B 4IMKA 1PQZB 1R5IB 2ICWA 5K9KB 5F9JA 4D0CB 1ULVA 2MQ0A 4HCRL 1BVZA 5EZIL 3ET9F 5EULV 1WUNT 1F5WA 1W2KT 4PJAB 3ARBB 1JPGA 1LEGB 4E9LA 5B4MC 2EE3A 4FFYH 3RNQA 3MUHL 3U48A 1FC2D 3TVMA 3P73A 2ZUSA 4ZAKC 1EO7A 3TN0C 5E8PB 3QJFA 1AXIB 3UROR 5IIEB 3KR3L 2BSRA 5HY9B 3STBA 3CIQA 3EOYG 3FB6A 4JN1H 2OMNA 4JPIA 4QO1A 3VDBA 5JIKA 3WHE1 25C8L 4LIQE 4F37F 4LLMB 1KCVH 3C6SA 3GM8A 3LCYA 3BZFB 4UT6L 1VGEH 5DO2C 3HC4H 5DS8B 5DRWA 4JM2D 4KKBD 1UM6H 3RKDD 1FCCA 2W07A 1NMCC 4MJ6A 4M1GH 1A4JB 1FQ9C 3S36H 2DQDL 2ZCHH 5DVKA 1D9KD 3O2DL 1JNHB 2B1HH 2ITCA 4P5MB 3LDBB 2APWA 4I48A 2LV4A 3F6IA 2VLLA 2BY1A 4JFYA 1XIWD 5IBLD 4WJ5A 5A2IH 3DO7A 1GH7A 5C09A 4ZS7L 5D7IA 3VA6A 5L6YL 3SJVE 4MXWL 4RRPG 1KC5H 2X4SB 1JE6A 1TQBB 1HIML 3VFGL 4D3CH 5CP7B 4XMPH 5MERA 3TCLA 3GMLA 2F5BH 3JV4A 3Q1SL 2QADD 5H37H 4TSBL 3MJ7A 1JGUH 1MJJA 3KPPB 3RUGE 4U2ZA 1W0VA 4XVUD 4I4WA 1N4XL 1RZ7L 2AGJL 5CMAA 4LASL 1HK6A 4ZOAA 3LV3A 4HKBB 3RI5F 4JQIL 1OSZA 4M7KL 4Z7UB 3FN9A 3UJIH 3QSKB 1NFDA 3E6FB 3HA0A 1BREA 2ATKA 4NZUL 1KB5A 4LLVA 1JK8B 5CZKA 2BNUB 3SEPA 3I02B 1DN2A 4ZMAT 1BECA 5CWSA 4O4YL 5GGSY 2PUQT 2VXSH 3QEQA 2H3NB 2WBJA 3UTPD 5EN2A 3BWAB 5DXWA 4ZXBA 4HWNA 2GJZB 4LCWB 4ZTOH 2ADFH 3S97C 4R96B 1U3ZA 1HHJA 1IAOA 4HBCL 1CFSB 3SGEI 4ERSL 1I7ZB 2E9WA 3WEXA 3CVHH 3PIQB 4CAGA 5JNYA 3G6JE 5KVDH 4FFZH 1JGDB 3W11C 1K85A 5CD5D 4PRID 1XGPA 2XXCB 5F7UA 1F4YH 1TETL 5J6GB 1FAIL 5AG8A 3SN6N 3QIBB 4JVUA 2BK8A 1N5YH 1KCLA 5ERWB 2FECI 4RGND 1CU4L 1ORQB 2AK4D 3LS5L 2I25N 3TYFA 1NUFA 4HCRA 1MCKA 2MHAA 3ZLQC 2QBWA 1ZWIA 3MBED 3H9HA 4DZ8A 4HIHA 1I4FB 1MFCL 1U58A 3AAZA 3LSOA 4A2LA 4TNVF 4YDKH 1VFBB 1VHPA 4HUXA 1KJ3L 4OLUH 4X7EC 1X5HA 3L9RB 2UUDH 3MUY1 3QDJA 5C6PB 3MV8B 4AG4L 3G6JA 4X7SH 5ERWA 5J9PB 2YHGA 1R24A 5I1EL 1DUYB 3Q2CA 2PYFB 1ZXQA 3C2AL 4ZYKB 3MNVB 3BZEA 2BZDA 4ONOA 4YHKH 4FABH 4ONHB 5BMFL 3ROOA 8CGTA 1H9VA 5F3BA 1UGNA 2UY7A 4LHUD 3SCMD 4P5KA 5JOFA 1X7QA 2R1WA 4QKXB 2HN7A 5DR5H 4XBPB 3PABB 2X4QB 4JFHD 4YHIA 2Z9TA 4Q2ZB 5JQ6L 3OXRB 1PY9A 5FB8B 5K9KA 1VFAA 5EO9B 1A64A 5GGVH 5EG6C 4NWTH 4KI1A 3BRFA 1KF9B 2DQFA 1S5IL 2XG5A 1F2XK 3CXDH 4G8GE 4Y16B 2H2SD 5GRJH 2IQ9L 3BAEH 4Y19A 1UWGL 1CFTA 4M62L 4OZFG 4LKCA 2J6EA 1HKLL 2I60L 4PJAE 3QDGA 5I17B 3AS0A 5ELIA 4L3CA 5IB2B 4KK9C 2Z92A 4R97B 2VTFA 2GJ6A 1KELL 3CCHB 2BSED 3LN5A 3TESA 1O0VA 1UT9A 2GUOB 3KPOA 4W4OC 3QRGH 1P4LB 1Q0XL 3B9KB 1D3CA 3ES6A 5C0IB 3MV9D 1CCZA 4L29A 2IMMA 1XR9A 1ZTXL 3CUPB 2QHLA 3JSSA 1FO0H 3KLSA 3KYKL 1MFCH 1T0MB 2DQEL 4MD0B 5FK9B 5LCVH 3EO0A 2BNQD 1FNSL 3TA3C 4HPOL 4DFIA 2YD1A 1EGJH 5F44A 3EHBD 5FM5M 3RVVD 3G6AB 2J8UE 2PO6B 2VDRH 1FL5A 3C60A 3OKEA 5FO7B 4HJJH 3MRHA 4HXAH 2UZIH 4YUEH 4F7EB 5KOMC 4G6KH 2ZCKH 4PJ5A 4G8FB 4NNXB 5HDQH 3TCLB 4F7MB 1LHZA 3EO1B 4WFFD 5C0AD 3GGWA 5EU7C 5ILTL 4H8WH 2W0KA 3OF6D 5IFJB 2FJGB 5EBLA 3BMWA 2CK2A 4MJIB 3OKKA 5H35A 2W65B 5T3ZE 3SGJA 1BOGA 4L9LC 1G0DA 3SE9L 5LAXB 3O11B 5BS0A 1AO7A 1JGVH 2E27L 2VISB 5EC1B 5AYUL 4NRYB 5JPMA 3CSYA 4QRRB 1RZJL 2COQA 1MJUL 4FTVE 2EDRA 4OD1L 5L0QC 3A6CL 4GRWH 3QHFL 4PR5B 1AHWB 1OAUH 4HGKC 4G8EB 3ZSTA 3RL1B 5D1QC 5LAXA 1WCBB 1JHLL 5J1AA 2QSCH 5SWZE 1JNNH 5JZ7C 3WO3B 5JHLH 3PP3H 3VXNB 5DHXB 2UYLB 5AEAA 1HCFX 2IALA 1C5DA 4L4VA 5ID0A 1KCKA 4PFEA 1SMAA 3VXSB 2XZAH 1T21A 2YPKA 5I1LA 3ARZA 4UTAL 5F3HA 4POUB 2GYSA 1F4XH 5IEHA 4P4KD 4BSWB 1NC2A 4HIXL 2H1PH 5F72S 4GUPB 3UYOD 3L95A 4NWTL 5FDYA 3PGDA 4F9LC 3LPFA 2R29L 4PRHD 2HTKC 2JJTC 1ZLUH 1DN0B 3NTCH 5C6WH 1MFAL 4TNWK 1E27B 1ZA3B 2G5BB 4TRPL 1HYSC 4OLZL 4ZO9A 2V7NB 1QLFB 1MF2L 3IYLW 5DR5L 5ICXA 3MRBB 5BCAA 4XNXH 2F53A 3H9HB 4KGJA 1ZA6A 4ZNEA 4IRJD 3SDXF 2FGWL 3OR7A 2BVQA 1QLRB 2WW8A 4MA8L 4Q9QL 4AENA 1M05A 2I5YH 4OM0H 2G60L 2X4PB 5EORH 4Z7OE 4XPHH 3ZKXC 3V0AC 2BVUA 5BO1L 5FHBL 1I1YA 2CKBA 3K4ZA 5CS7A 1EBAA 1JZ2A 1U8JB 4YZFE 4JRXD 4NHCH 3WFHA 3HZYB 2P48B 4KJPD 4C58B 3NPZB 4TSAL 4JAMA 5DHYB 3MRDA 2P8LA 1X5GA 2OQJB 3EZJB 3Q5YA 2ZOLA 5CKAA 5C3LD 2EXYD 3O0RH 4PLKD 5D1XA 4OCXL 3O3UN 2NZIA 4Z9KB 3HRPA 1HQ4A 1UB5B 3L3HA 2FR4B 3PJSA 3GMOA 1HQRB 1CDHA 4UIMB 3UPRB 4X5XA 4Z0BH 3EDFA 2B1AL 3X3FL 1KCRL 1TCRB 5JOEA 3TT3L 3O3EA 1A6WH 5C2UB 2VZTA 4PJHE 1X5LA 1BZ7B 3DX6A 1J88A 3L3HB 2EYSB 3MCKB 5SWZA 4Y2DB 1T2JA 1HN1A 1WV7T 3U36A 2CIIA 4BFBD 4UT7H 3GMMA 1KFAL 3MLWL 4QHNB 2ZCKL 2W0FA 1PLGH 1K5NA 5KSAC 3QYCA 2BNRE 5MEND 5DUPL 2XA8L 1DL7L 3CC5A 2X09A 4GKSA 5BV7B 3GRWL 1XGTB 3SBWA 1R3KB 1L7TL 4QOKD 1T66C 5FIEA 5JA8B 1EJ6A 2P24A 5ACZA 4HT1L 3EUUA 3WDIA 5LWYL 1U8HA 2LTQC 3TA3A 3LB6D 4P46C 3B9DA 4NSKA 3BPOC 4OCNC 4RGMB 4JFEB 4PLNC 3EO0B 4FTVA 3V7MA 4LCCC 3MROA 1E28B 3SDDD 2V2TB 5EU4B 5TQ0H 2X4NB 6CGTA 4U3XA 5E1HB 5IWLA 1PGRB 3CVIL 5AZ2L 3VJ6A 1OSPL 4PRHB 5BRZE 3DRTB 1FV1B 3PGFH 4KK5D 4KTDL 4BFGA 4XP9L 1YPZE 4OAWA 5FGSA 3MRFA 1CDBA 2BP3A 1X5IA 4FQHA 1XZ0B 3LH2L 3KLAA 4ZFFA 4L3CB 3N9GH 4L5FH 1JWUA 1RHHB 4P49A 1HH6A 3KYMB 3RX7A 3MNVA 5FDWA 1T20B 4LPWA 4ZSOE 3O11A 4F9LA 1F2QA