2IBZY

Yeast cytochrome bc1 complex with stigmatellin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
107
structure length
107
Chain Sequence
DIELTQTPVSLAASLGDRVTISCRASQDINNFLNWYQQKPDGTIKLLIYYTSRLHAGVPSRFSGSGSGTDYSLTISNLEPEDIATYFCQHHIKFPWTFGAGTKLEIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein 1
publication title A Comparison of Stigmatellin Conformations, Free and Bound to the Photosynthetic Reaction Center and the Cytochrome bc(1) Complex.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 107
sequence length 107
ec nomenclature
pdb deposition date 2006-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Y PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2ibzY00
3BFOA 1AGBB 3P9LA 3QEGH 1JZ7A 2Y5TA 1G7LA 2VZTA 4RMRA 2B4CC 2UYLA 1RZIA 3TPKA 1NLBH 4IOIA 1I9RH 3CFDB 1G7QA 4RGMB 2JJTA 5FO8A 3PWPB 1RIUH 1B90A 4MJ5B 1I7ZA 2AVGA 5D96B 3H9HB 3RTQD 4CVXB 5E2VH 3ILPA 5DMGD 1QEWA 2BSSB 5D5MF 4DGYL 4GQ9H 1A6AA 4NGHL 4MGXA 3KJ4B 4KPHH 3RNQA 3FRPG 4WUUA 2YUZA 3QJFA 1PSKL 2W91A 1OAXL 3PWNB 1UWXH 4MXVE 4IOFC 4LLMA 4KJPC 1HCFX 1T80A 1BQHB 3VJ6A 3GRWH 4C58B 3BD5A 4R3SB 4KMQA 3SE9H 1F3RB 3QJHA 2ESVA 3MGAA 1CGSH 4NQDE 3QG6B 1MCWW 1SJEA 1JPST 4QHUA 3MZTA 1MLBB 1SM3L 4W4OC 3MBED 4DVRH 4OLWH 5HVHB 4Y16B 1MIML 1T1YB 1YJDH 3CIQA 4MA1C 5DZLA 1JF1A 5F3HA 2NW2B 3CK0L 3MRHB 5FYKD 1TJGH 3AROA 4EUPA 3L5XL 4FNLL 5EULV 1XF2B 4PYHA 4FXLA 1J1XH 1MHHB 3G08A 3WS6C 4PG9B 4XPHH 4ETYA 5KSVA 2F74B 4PV8B 1MFAL 2X9WA 4HPOL 4YEFA 1H3WM 1U91B 1CICB 1DSFL 1A1MA 1UEMA 4WEBL 4U1NB 1MQKL 5I18H 3NCYP 3O3DA 1N0XL 4HZLB 1NANH 4NKDB 1IGFL 2V7HA 1JK8B 1IGYA 2VABB 4ZAKA 5CHNB 4Y4KA 2GYSA 1T3FA 3SQOL 1RUMH 4FFZL 3TF7C 1W0VB 2AP2A 3TA3D 4Q7DA 1IGML 4HMEA 3EDFA 1KNOA 3BZFA 5FHAH 3MRCA 5LGJA 4YBQD 5FGCB 3MRMB 1NUFA 4L3EE 3C9NA 3DVIA 1QFOA 3VFSB 1PZ5B 1QQDA 1UXSB 3IFOA 4GRMA 4JDTL 2PYEA 3TVMD 5HHNA 5DK2B 1CXFA 4D0BB 2DQDL 3MXVL 4ELMB 4PY7B 2VDPH 3LH2L 4MNGB 1X9QA 3LKOA 2A1WL 4HKZB 4KFZC 3O3EB 2NY5H 4M1DL 3QO1B 4QNPE 3O6KH 5LGHH 3EDEA 4MVBC 5LKNA 4PBXA 1EH9A 1XF3B 4PJ7A 3AAZB 5LXGH 1WK0A 2GTZB 2X40A 1OP3K 3UTSE 5J1SC 1MJUL 2RAMA 4WWID 3FOLA 4EDXB 3ZT6A 1K5NA 4IRSD 2BVUA 2PN5A 1Q94A 3GBML 1QBAA 1V7MH 3OAYK 1NC4A 5DD0H 5D7JC 5KZCD 3P2TA 1GSMA 1ACYL 1TVHA 5KSBF 3EJYD 5KAQF 1NCDL 3MNVB 1UKSA 4PD4J 3NACH 5EOCH 4ETQA 1MFBH 2QHLA 4JPVL 2ICWJ 3NCFB 2BFVH 5IWLC 2BK8A 2I9LB 4IHOA 5DDHB 3DUUB 4QTHA 1CXIA 2ADFL 2X4PB 3CC5A 4PG2C 2DQCL 1MFNA 5D6DC 1R3HA 4FMKA 4CU6A 3KYMA 2PTTB 4JFPA 1KLGB 4NO2B 4PTUB 4TVPL 3LQZB 3HZVB 1RQ5A 1AFVH 2DL9A 2LQRA 3KPSA 4PRIA 5IVNA 2F58H 4IDLA 4CN6A 5AWNL 1MCCA 5EWIH 4PJDA 1CGXA 2AJUL 1HHKA 1PG7X 2J6EL 2MFNA 3WYRA 1GH7A 4NCC1 4MJ4A 1NFIA 3CXDH 3IF1A 2BRQA 5EU6B 3QEUB 4TVSa 5IQ7H 3G5YB 3AUVA 1XCTB 5L2KD 1JHTA 1M7IB 4L3EB 5E8OA 5SX4H 1S78C 5I19L 5I71C 2BDNL 2OJEB 5ICZA 3WIHL 2I60L 1IAOA 4X9IA 4V1DE 5L88L 1A1NB 1P7KA 1JVKA 3QIWD 3KPTA 1BVKB 4GXVL 2BC4A 3PP3H 1JN6A 4MA8H 5FKAB 2EDBA 1HDMA 3V0VB 4D9QE 4BQ9A 2HLFD 3TIEA 5FA3A 1QR1A 1A21A 4OCYH 4FQ1H 2Y36H 5I30L 1ZLUK 1U92A 2CDEA 5F1KC 3OGOE 3IU4L 1E6OL 3WL9B 5C0JB 3AVEA 3C8KB 5KVFH 3QUMB 3OKLB 4DGIL 2HLAA 4JO3H 2AGJH 1CZ8L 4Z95H 3SGEH 3OPZH 5F70A 1KYOJ 3THML 2HYMA 5ISZA 3UTSB 1ED3B 1JBJA 3MYJA 1HI6A 3TZVB 1R3IL 5GRYA 4UV4L 2RJMA 4NQVB 3BSZH 2R39A 3TO4A 2ITCA 1ZA6B 4I77L 1GZQB 5C2BL 5D1ZC 4WI7A 4QRPA 1KEGH 3KYKH 3L1OH 4ODTL 2JK5A 5HXMA 3PJSA 3E3QE 3SCMC 1YUHA 1DBBL 5FUOL 2FBOJ 1NSNH 3O45B 4KTDL 1FJ1A 3BW9B 2ADGB 4Z7NE 5DWUH 5E2JA 1XH3A 3OKEA 4PJAE 3SDCC 1T03L 4PGDA 1EZVX 2AJYL 2H41A 1A3RL 5B3JF 1YY8A 3RZCC 4EZMA 5FKPA 5I71B 1PW3A 3H6JA 4L8BB 4UT7L 2YKLL 4KJQD 4WGVB 5DT1H 4GRLD 4WI8A 4POZD 2V2WA 4X7FC 2WIIB 5FYLE 5TGBA 5DMYA 2XQBH 4Q6IC 4LLDA 2DI9A 5DEGA 3V6FA 4DVBA 2XFXB 5JHLH 3V4VL 2P8PB 1I8LA 4JFYA 3WHXB 5JXEC 2XG4A 4KY1L 1I1AC 4YK4B 1HHJA 3L3KA 3OKKA 4JKWA 1HILB 5CP7B 3MOAH 4OUOA 4L8CB 2R0ZH 4P4KA 1K3IA 3C8DA 3E8UH 4RMTA 5CGMA 4XNYL 2GFBB 3O0RL 3MJ6A 3VI4E 1F4WL 1DJSA 5DD1H 3S37L 3CXHJ 2OL3H 5IROA 5FHBL 1VCAA 4R96A 1NCWL 4OZHE 3T0EE 4OAWB 1XZ0B 2VJXA 2WAHA 1G7MB 3EYUL 3WMSA 2AXGB 1G7HB 3L95B 4EDWH 3RTQA 3LCYA 3WFZA 3UYRH 1CD0A 3C5ZA 3EYVB 4ODVH 1J0IA 3LQAC 1WWBX 3RVTC 4EXKA 1VACB 3FO2A 5K9JL 2XXCB 4KGJA 5I1AB 1J8HD 3WN5C 3O3AB 1JHLH 4RX4D 5E95B 5D1ZB 1FAIH 4LDOB 5DJZB 4XP5L 3BAEL 2E27H 3ROLB 3MRPB 3SKJL 1KV3A 4D9RE 1F58H 3T0EC 1FLRL 3I6KA 5D9SB 5I8OH 4R97C 4KI5F 3CFBB 2EDXA 5CIPH 1XR8A 4APQC 3SCMB 4LSPL 5IM7B 4M4RA 3A67L 1XGQB 4MAUL 5LG1A 1JYNA 4POUB 1MHPH 3QUXA 5TQ0H 4XP4H 4J3TA 1T21A 2UVFA 3BUYA 3HAEG 3SDCB 4TTDD 1A6ZB 4NBXB 1WTLA 1BGXL 4LF3A 3BJLA 3EYFA 4EXPX 3VDBA 1OD9A 3MRFA 1DZBA 3FKUS 4YLQT 3T77A 3LKPA 3TWCL 5LGKA 4WFHD 1MPAL 4KHXL 1PG7W 3HC3L 1Y6NR 3RPIB 4OUUA 1QBBA 2VDNH 4QOKD 5CJ5A 3I6LE 4F33B 1UM4H 3FB5B 1YZZA 2R2HB 4DK3A 2FSEB 1OAKL 5E6ZA 4PJAB 5H37H 1I1AB 5IB2B 1CE1L 4ZFGL 1X5YA 1QO3A 2XZAH 4DZBB 2UWEB 1LK3L 3TA3A 5FYKU 2IFFH 3QDJB 4P2OD 4PREB 3X3FH 3RWFB 4ELMF 1GOFA 5L2JB 5DJ6B 2O5XH 1HNGA 5D1XB 1NC2D 3GMPA 4FQ2L 3F6IA 5IJKA 1YQVH 4M5ZH 1TQCC 5GGUB 2WBJD 1M6OA 3V5HB 3CCHA 4X6BA 2GJJA 4X5WB 3IXAB 3LEXB 2KBGA 4PB0L 5HHOE 4FOMA 1UZ6E 4YGVB 4IDJH 3LMJL 3TVMA 4ERSL 1T83C 5HTSA 1AO7D 4N9GB 4QCIB 4HV8B 1C5CL 4HF5L 4U1HB 5ANMA 5H2BB 1FORH 2ZP0T 2ZPKL 5ID0B 3LD8C 4G6ML 4UUJB 4QYOA 4GSDL 4YHOL 4M6OL 4K55A 3MLTA 1IQDA 4MXVF 2AJ3A 2CQVA 2VL5B 4OZHB 5KTEH 1GJIA 3KNBB 3T65A 3TT1L 5DJAA 1FNEA 4R97B 1JPFB 4APQB 3S36L 2ICWB 1DQQA 3DX9B 4Y8AA 1ZKAA 1SYSA 5ETUA 4G3YL 4GRWE 5HY9B 1A7BA 1YEIH 5ENWA 9CGTA 2LV4A 3UJIL 5K9KB 3QEGL 4JQVA 2IANE 2ZOLB 1ZT1B 3UYPA 5K9OA 5TDOB 2EDRA 1ZLWH 5J9PA 1XF4B 1CGUA 3CUPB 1CN4A 1HINH 1HKLH 4HUXA 4MDJB 1NLBL 2XT1B 4LVEA 4IRSA 1KACB 4P2QD 4PGEB 5E2VL 2QR0B 3HRPA 4GQ9L 4U1MB 4LKCB 4KPHL 3VE0A 1IM3B 4OZGB 5I6XC 4YPJA 1CQYA 1NGWA 2AKRB 2C7UA 3OG6B 1OW0A 3ILQD 1X5XA 1OGTA 2EIBA 5E00A 4O00A 2XPGA 4AEHH 2J12B 2VAJA 4G8FB 2V5TA 1NEZG 4PLJC 4CW1B 1RZGA 1W8OA 4HIJA 4K94H 3GRWL 2EDYA 3DV4A 5EU3A 1I8KB 5C9JB 5DJDA 3SE9L 4JHBA 1EZVY 4YC2C 3FO1B 4M9PA 2XZCH 4YR6B 1RJYA 1PQZB 1P2CB 4DVRL 4OLWL 2ICEA 5J56B 5GXBB 4F7PB 3BPNB 5CP3A 1OARH 1YJDL 1QRNE 4XNQB 4RGNB 1KB9K 3VFOB 1B0RA 1TQCB 4FQHA 4LIQE 2D3VA 4UOW0 2G9HB 1BJ1H 4AIOA 5KVMC 2EDWA 5A40E 1NGXB 3PL6C 4MSWA 1J1XL 5I1DB 2WINB 4XPTL 4XPHL 3S97C 5CZKA 4WW2B 5IF0B 3L3OB 4X6EA 3LOWA 4GBXD 1AHWB 1ZA3A 3LKRB 4GKNB 3P4NA 2DF3A 2MSPA 3P40A 3I84A 5L2KA 4XMPH 3VXUB 3D0VB 3SN6N 2YMXH 3OZ9H 4XTRC 5HHOB 4Y2DD 4QNPF 1RUML 5IVZB 2ADIA 3MRQA 1MAJA 4Y4HC 4L4JA 1SBBA 5FHAL 1FVEA 5C86A 4XI5C 5HVWA 3MA7B 2OCFD 3CGTA 4PRHD 4QRTB 5E5UB 2DKUA 1OP5K 4XNZC 2ED7A 4MJIB 2GT9A 5ITFA 4F37F 3FB7B 4LPVA 2FJGA 2M2DA 4MMZC 1G0DA 4CRPA 2PYFB 4F8QA 3PQYD 1BPVA 2OR7A 4PJ9C 1MCSA 3OR7A 1WZKA 1YEDA 1M7DB 2IANB 4Z7UE 3WD5H 3CVHB 4JB9L 1F4YH 5J1AA 2J3SA 2NY5L 4UDTB 5SWQB 5DC9B 2ILLA 4Z78B 3O6KL 3P73B 5CEYB 2Z8WC 2FO4B 1FFRA 2FHCA 4H5SA 1YPZA 1FYTD 2F5BH 5LXGL 5GGVY 2GCYB 3Q6FB 5GS1A 4FXKA 3QBTB 5INCB 4R0LA 4YFLF 2CGRH 3V79C 2Z31D 5JO5A 1ZE3C 5F44A 4PGZA 4G42B 3IDUA 4Z5RB 3GSWB 2FYYA 3U9UB 4HULB 2ITDB 3BE1H 1NDGB 1KJ2H 3SOBH 2XWJB 4ZUWA 1EGJA 1MCEA 5CBAA 3PL6B 3RU8L 3BP4B 4RAVB 1I3VA 5FUCE 4XVUC 1GAFL 4NNYA 3LSOA 5GISH 1MCIA 1XMWA 5DD0L 4S1QH 3QG7H 4JZOA 1BM3L 2VLKA 4U0QB 2E9JA 3FQWA 1AKJD 4NZUH 1AQDA 1AJ7H 1FV1B 1S7WB 5EOCL 5C0AE 5SWZB 3FOMB 3AS3A 3BI9X 4XCNA 5F7DA 3HZYB 2BFVL 2HFFB 1P5VA 4GRLA 1ORQB 2VC2H 3NVQA 2FIKA 3SDXA 3VXRD 2H45A 1JFQH 4Y4HB 5FUCC 1HWHB 1KIQB 4NC1E 1DBKH 1BHGA 1AFVL 1VADA 4F8TA 5I1CH 4KJYA 3U0WH 1A0QH 5IG7A 5IVXA 1X5ZA 3BP7B 2M8XA 3GM0A 4J1UA 5EWIL 4NHUB 1KJVB 4W70A 5GGRB 4LHUA 2JJVA 5B21A 4X8XA 4PJ9B 2AJVH 1EFQA 3PV6A 4JJHA 3DVGB 1Y18A 4NC1C 4YE4L 3JWOC 4ZXBD 5I8EA 3JVGA 5GSRA 3EUUA 3MCLH 5FK9B 3T0XA 5C0CE 4CDGC 4H0GA 5C6PB 4E41D 3JV0A 1J8HA 4ZDHB 1LP9E 1I85A 2FLBT 5LAXA 4P46B 1I1YB 3MRIB 2R29H 5T3ZD 4AY0A 5GZND 1LGVA 3MRJB 4MA8L 5A2JH 2FH6A 1LE5B 2YUXA 4OCYL 4FQ1L 1BLNB 1JNNH 4OV5A 4O51B 2AK4E 2CSPA 4JY4A 2PETA 3AREC 2F53E 3WLWC 5I17B 1FNGA 1VFAB 2ATKB 2GEEA 5KVFL 1C12B 4Z7NF 4GMSL 4JO3L 2F5AH 2P8LA 2AGJL 2AEQH 2JTDA 3X3GL 2DKMA 3DIFB 3OPZL 4PJAF 4GKSA 4QXWA 1S3KH 3GMMB 2FBJH 2X09A 1A3QA 2J1KA 3GGWB 1T6WA 3MNZB 4HWEH 2NY1C 3RKDD 3VWJD 3H9SE 4OGXL 3O4LD 4EQ2A 2IPUK 1VFMA 2YD6A 4MA3A 2H1PL 3EO0A 1BD2E 2HMIC 4O2FA 1CT8B 1T2XA 4G9DB 5ADOH 1KEGL 3KYKL 4PJHE 5DD6A 2W65A 2VUOA 3NZ8A 4DKEL 1EEZA 4MD4A 2ZUQC 3S6CA 1JGDA 3KDMB 5F9JB 5KG9A 5GRXG 1H3XA 5C0AB 1P7HL 4LPCA 1GYAA 3C5JB 4P2RE 1NSNL 4P2OA 4X6CA 5JA9A 1UACH 5DWUL 4MXQC 2LTQC 3PWUB 4LCYB 3JV4B 3VI4F 2DQEH 1W0WA 1I9EA 4I4WB 1JWMB 4GAJH 5BZDB 1ZVSB 2WBJA 4OZHF 5TH2A 4HKBA 4YX2H 2AQ2A 4TSCH 5HGGS 2QQNH 5IEHA 3O11A 2QQLH 5J6HB 1FNLA 2Q1EA 5C0FB 3JV6A 3DUSB 3G5VB 4JRYA 2AABH 1DL7H 3IXTB 4HH9A 2ZOKB 4NKIH 2A38A 1TIUA 3DYMA 1INQA 2DAVA 2ZCKL 1NCBL 5JHLL 2FEEI 3S37X 1I75A 1CGYA 2OQJB 1G7JA 4JFQB 3DVNA 4QWWD 2SEBB 2OR9L 3T2NH 1EEYA 5FM8A 3BH8B 4PPTA 4XRCB 1ZVYA 3T1FB 4JFED 2Q86A 3FTGA 3AREB 4XAKE 3MOAL 4XVTL 2DJ4A 2R0ZL 1D5ZB 1EIBA 4R4FH 3WNPA 4PJIE 3TBSB 3ZKXB 4XBEH 5MP6H 4OZGF 1OAUH 4ODUA 5J0BA 4ZD3H 2OL3L 1QSZA 5D5MA 2Z8RA 1LP9B 3TYFA 1KCVH 3MRLB 1I3RB 1EK3A 3KPPB 5JR1L 5DRXB 1I7UB 4P2QA 5GZOC 4N8PA 4EDWL 4Z6AT 5INDB 3IETA 3P4MB 5FO7A 1JHLL 3OF6A 1FAIL 4L3AA 4HJGA 1NH6A 5AZEH 2DWDB 3O4OC 3TBWB 3O81A 4H8WC 3RIAF 2AAVA 3TN0B 2BMKA 2E27L 2R69L 4F7MB 4ZODA 1RK0A 3MFFA 1F58L 3MOBH 3O6FD 1OAZH 2H9GA 2DTSA 1J1OH 1I3GH 5BRZD 4UB0H 3N06B 35C8L 1N59B 3QFJD 4N1HB 1MHPL 6CGTA 5TQ0L 4YDVB 3H9SB 4XP4L 4OQ1A 1KPVA 1VFBA 5HVGB 2A6JB 1T0NB 4NQSB 2E3VA 2FEDC 2Z35B 4X4MA 4PBWD 1NDMB 4P48A 3H7LA 5GRVK 5FYJD 1CFQA 5HYJD 4AT6B 3SGDI 4PJHB 3BGMB 3OXRA 2UZXB 1VERA 1T0MB 4HIHB 2CIKB 1T66C 4BQCA 2CKBB 1ZLSH 1UZ6F 3QIUD 2R23A 4AM0A 1P9MC 3ZL4H 3EO9H 3VXSA 1KLUA 1UM4L 2WWKO 1A7QH 3STLB 5JXAH 3N1FC 1ETZA 1BIIA 2CR6A 2VLMD 5KN5B 3QHTC 1S9WB 2BVQB 5E4IA 5MENE 5HDBE 3FJTA 5CJXC 5DGRA 4IOFD 2XZAL 2P8MA 3BMWA 4Y2DA 2AJSH 2NX5D 2IFFL 2AV1B 3VCLB 2RCSH 5DJ8B 5T3XH 4FQPA 4PRHA 4GRWF 4PGBA 1AD0A 2ZNXA 5CP3H 1I4FA 4NZRL 1YEGH 4M5ZL 4HLJA 2G5RA 2VLLB 3VFPB 3A6OA 5DO2C 4I3GA 4W6XB 4XB7A 1LO5B 4CVUA 3LN5A 4IDJL 5D2LB 3MLVH 4OIIL 4UOW1 4Z7VE 4LL9A 3PQYA 3WSQH 2ARJB 1JNHA 4XP6L 1FORL 3STBA 1P7QB 3EDJA 4YO0A 1URLA 3O4OB 3L3HB 4U49A 1E4KC 1R3LA 2D0FA 43C9A 5E5MB 5J1TC 5KTEL 5IHUH 4D0CA 3QCUL 4FQQB 3QHZL 5DHVH 1S7VA 4O2CB 4U3CA 2NY0C 5C8JA 5AAMA 2A6IB 1YEIL 2VMFA 1T6VN 4V2BA 1G9EA 2X4RA 3QDMB 4NUJB 2Q7YA 3UPRB 5KSBA 3SE8H 4PJFE 1HINL 1HKLL 2X70B 4IS6A 3ALWA 1RUKH 1SMAA 1TPXC 4JFFB 4ZPTA 1SEQH 3QRGH 3EFFB 5JNYA 4P9ML 3QUKA 3HMXA 1A7PH 4DUXA 4U6HA 2DB8A 5ICXB 5EZIL 4HXBL 2N7BA 4P5TD 1I7RA 1S9KC 2BNRB 5I76A 1DLHB 4HDIA 4K94L 3CJJA 4AH2A 4YHYC 5KVEH 4HIXH 4PGCB 4M1CC 1NFDB 2E9BA 4HFUH 2XZCL 1GC1C 5E8NB 3LRSA 3AM8C 5IW1A 4Y8DC 1HNFA 1F13A 5JUEH 1J05B 1OARL 3V7AG 4WO4C 2XNAB 2R0LH 1CFTB 2H2PC 4KK9D 4MDIA 3MFGB 5DQ9A 5MENB 5B38G 3FQXA 1YMHB 3UTQB 2XACC 4OCRH 3RWIA 5AD0B 4PRPB 1F4XH 4U1KA 4F9PA 2J4WH 1D5MA 1W2KT 4RFNC 4HIIA 1MRCL 4PRAB 2WQ8A 1JF5A 2Y6SC 4HD9A 5DQJA 1HQ4B 4ZUVA 1FFNB 4Z7UF 2YMXL 3WFDH 4K3DH 1MVFA 2IJ0C 5F93C 3KHQA 1SQ2N 3QHFL 3A6CH 4E41A 1MJ7H 2NY0B 1BQHG 2FIRT 1MUJB 1UVQB 3QT2A 4NRXA 1O0VA 4IMKA 1JPSH 1NPUA 2NY4D 4PJCE 4RA0C 3V7MA 3I3BA 3G6AA 1LEGB 3UTOA 4WHTA 3OAZK 4I0PD 1BZ7A 2KZ1B 1TPXB 3KPOA 3HG1E 3JV5A 3BEWA 4QGYA 3H3PH 3T2OA 5F6HJ 5JPNA 2EO1A 1WC7A 4LARH 4DCQB 3MJ8B 4LLVA 4ONGH 5DFWH 2Y23A 1AGCA 2WK2A 1Q9LA 4Q2ZA 4ONOA 3TLRA 4P5MB 3WD5L 3OX8B 4X0KB 1F4YL 4HWBH 3BP6A 1E0OB 3VWJA 2XY1A 4WV1C 4F37K 3VXOA 4YHYB 1JWSB 4Y4FC 1BAFH 3O4LA 1WGOA 3WFEH 2A83A 3CFJA 4JANB 3O8XA 4BSVB 3W0WE 2F5BL 2XKNA 4N0YH 4LRNH 5E2WH 3L7EA 1A6PA 2CGRL 2JF1A 5DJXA 4WO4B 4X6DE 2HT3D 1XF5B 3VRIB 4X7DC 3BE1L 1IM9D 2DI7A 5GQBA 1KJ2L 2PXYD 5EA0H 3SOBL 5MEOB 4F7TA 2NXYD 2VZVA 3F7PC 5EU5B 4XBPA 4BZ2H 4QEGA 3SDAC 4QHMA 3DROA 1T20A 4RFNB 4S1QL 1CVSC 2JB6B 5EB9A 4ZUTA 2F19H 3DURA 4OB5L 2ZSWA 4KJWD 4V1DD 4NZUL 1AJ7L 4QRQA 1CBVH 3PWLB 4X7TA 2G60L 2VDQH 2ZUUA 3IDNA 4Z18A 2VC2L 5AZ2H 1BMGA 1BJMA 3WDJA 1LHZA 2Q8BH 4F57H 4ZUSB 1LEKB 4LKXB 1JFQL 2BSRA 2BSSA 5FGBC 1LP9F 1WLHA 1MI5B 4XWOC 1DBKL 4BH8B 4JKMA 3DSFH 3SGDH 3U2SA 2I9TA 3R0NA 1CDCA 4GS7C 3QH3B 1A0QL 4S0TD 4JFEA 4HUWA 2CDGB 3PABA 2VOTA 3PGFH 4ONFH 4R3SA 4U1JB 5C0GA 2L0DA 4U1SA 4A2MA 4J4PD 3P77B 4XPGH 3QG6A 1MLBA 3ULVH 4K7PH 3TV3H 4JFZL 2L4OA 1XGPA 2HT4C 2Y72A 1P1ZB 4NO0B 1F6AA 1C08A 2H32A 3VD7A 4PLKC 2IH3B 3MRHA 5EC1B 3MCLL 4P9HH 3SY0A 3QDHA 3RVXC 1XF2A 1TETH 2X4QA 1TZGH 3ULUC 3T2PA 2XIDA 2EIDA 5IMKB 1ZWIA 1G9MC 5JPMB 5ITBH 1CICA 5C08D 4MQXC 4PJHF 4OF5A 3O6FA 4HZLA 5E9DE 3W9DA 2LFGA 1JNNL 3MV01 5BRZA 3U7AA 4MNHB 5BV7C 1A5FL 1Z6JT 5CKGA 1JGVL 4U2ZA 3QFJA 2I27N 3NIFE 3SDAB 3DXAB 5DUPL 3SPVB 3CNKA 3LEVH 4MWFA 2F5AL 2WMPA 2AEQL 5HYJA 2NY6B 2UUDK 4KKCD 4RMWA 2AXFB 5FYLD 3SBWC 4F9LC 1S3KL 2FBJL 3RWGB 5FA4B 5I1IH 4YHPB 1IGJA 3B2VH 4LSSH 3QIUA 4U7KA 3O9WC 3GUTB 5CWSB 2F54B 5F7NC 2BVOB 2B39A 4ELMA 5DHYB 5IOPB 3G6DH 4HWZB 1NLDL 3V52L 2IADA 5I9QC 1I1FA 4NSKA 3UTTB 2VERN 3KYNA 3D39B 5FYJU 2HN7B 3QDAA 5HHVL 4R4BB 2LU4A 2DQJH 2NX5A 4EI5C 1BOGB 3MV7E 4GH7B 3MUGB 5LQBH 4PJIF 2YPLD 2IMNA 4CADB 1QFWL 1N5AB 2DQEL 3R1GH 3LAFA 4NQED 5IJVA 2CUIA 2GTZA 4GAJL 4OD1H 2DLFH 1W0YT 2YBRB 3IB4A 4YX2L 4TSCL 5DJCB 5GGQH 5T1KD 2W1NA 1A9BB 2QQNL 5D7KE 2QQLL 3MRNB 2CH8A 4XVSH 1H3UA 2DMKA 3BT2H 3TT3H 5EC2B 4Z0XA 3ZKNC 2AABL 1DL7L 5DJYB 4D9RD 4X8JA 1VGKA 3MROB 4Z9KB 3I02A 3K4ZA 4JHZA 1KF9B 4TNWK 4JHWH 2CKNA 3NCBB 2FHFA 4NFCA 3U4EB 4NQDA 3ZT7A 3TYGH 3K2UH 3HZMA 1J0YA 2IGFH 1CFBA 5DC4B 3HR5B 3T2NL 4LVNC 2XA8L 2BOBB 5EBMB 5EU7C 4TQEL 1AGEA 5BV7B 4PP1C 4PJ8C 2EE3A 3RJQB 3W39A 4H20L 1P4BH 2J8UE 2NW3A 4XBEL 3W2DH 1T04B 2A6KB 1OAUL 2KL6A 4ZD3L 3DBXA 4KKBC 2C3VA 1VGEH 1KCVL 1TJIH 3MUZ1 2XTJE 4N5EC 5C07D 4FFVC 3A6BL 4CJ0A 3GSQA 5CJBA 1S7TB 2PW2B 3TNMB 3BZ4A 2BNQE 3TFKD 1K4CB 1WWCA 1DBAH 1HSBA 3WDIA 4ZNCD 3NAAH 1BJ1J 4LNRA 4ZTPH 3QULA 4R8WH 3O9WB 2BNUB 3GSNH 3HPLA 3MLRL 3GK8H 4G6FB 5C92A 3MTRA 5HGAB 3RGVD 3V2AR 5T5NF 5AZEL 3D0LA 2HJKB 4P5TA 5D1QB 4G9FE 5C6TH 4QRSB 4U1LA 2H3NA 5I9QB 3UDWA 4CMMA 4OZFB 2XTJC 2APFA 3MOBL 4JDVB 5HDBF 1I3GL 4FZ8H 3GFUA 1QHOA 4EI5B 4NM4H 1IGTB 1Q1JH 2GAZB 5EFIA 3FT4A 1NAML 3EHBC 2IQAB 2Z9TA 3S98A 4FQXD 3BZEA 5F7WC 3V0AC 3VGFA 3MLUL 1G7PA 3RIAK 5D2NC 3VG9C 3OB0H 4FTVE 2CDFB 4JN2A 1H8OA 1AR1D 1ZLSL 1GOHA 4LLQA 3X12A 4HCRL 1KB5B 4BFEA 1WEJH 4NM8L 5GS2H 2ZSVA 1FGNH 3EO9L 3ZL4L 4Z7VF 5LBSH 2VIRB 5JXAL 1T7YA 5D7JA 4J2XA 3DRQB 5D7LB 1G9NH 2E9WA 3BPCB 4MAYB 4YDKH 2GUOA 2YPVL 1FO0A 4C4KO 4LVNB 5E1HB 5EBLB 3MCG1 3UTSA 5IW6B 1K3ZA 1OTTC 4YHIB 4CMHC 2AJSL 2HFEB 4PJ8B 5IWLA 5E2TH 2I24N 4JGUA 5B39B 1JCKA 3BKMH 1OF2A 2RCSL 3BKCH 3MO1A 5T3XL 1TVBB 4YFDB 4WVRA 3MA9L 1R5WB 4KI1A 1ZA6A 3QEQB 4PG2A 3JSSA 2EDKA 3TPUA 3U46A 4ISVA 5TDNB 4I3SH 4HS8H 4BFIB 1YEGL 2VRAA 5IHZB 4I0PA 2R56L 4G6JL 3JWDL 1VENA 1BVLB 1A22B 4PJFF 3KWWA 2BCKB 1VDGA 3R4DA 3MLVL 1I8MA 1U36A 4HIEA 3O2WH 4NJ9H 4Z76A 3JZ7A 2E6PA 3WSQL 1XIWD 4R9HA 2W9EH 5ILTH 5CD5D 1INEL 5HYSG 3FQRB 2YN5A 3TBTA 1U8JB 2XTJB 2PTUA 4QO1A 5IHUL 3U7WH 3QPXH 3RWEA 1FFOA 3G04B 5FECB 2BNQB 3S4SB 1FSKC 1QRND 4M5YH 4LAQH 3QIBC 1KIPA 4HKJB 2EICA 1D6VH 5JMRA 3S88H 4XI5D 5D2NB 3VG9B 1FVDB 1A14H 3N1GC 3SE8L 1ADQL 1IM9A 2P5WE 2PXYA 1LO3L 4KKLD 1RUKL 1MFDH 4JFXA 1SEQL 4EVNA 3BEVB 5IBTL 1EXUA 2RGSA 1QFHA 1ZHKB 1MOEA 2HRLA 4KAQH 3VD3A 1P69B 3ALXA 5CIPB 1WT5C 3V5KB 5M94B 3H0TA 3N0PB 1UH2A 1CF8L 3BWAB 4V1DA 3WFHB 3U6RB 2EO9A 3HB3D 4QT5A 1M71B 5HI3D 5BW7C 3KPQA 3P9LB 1XEDA 4QXUH 2WP3T 3WCYA 2ID5A 5KVEL 2Y5TB 4HIXL 3BN3B 4K3HA 4CMHB 2K9UA 1S5IL 4M3JA 1F3DJ 4OJFH 1J11A 2UYLB 1RZIB 4HFUL 3CSPA 3EYVA 4IOIB 2OYPA 3BN9C 1G7QB 5FO8B 2YK1H 2AXJA 5FGRA 2DLEA 1I7ZB 4GG6E 2LE9A 3QCVH 4OCWH 4PJ7E 1A9EA 1SJVA 2NYYC 5DK0A 5JUEL 3ILPB 4PJCF 5J13C 1QEWB 1U2HA 3HNTL 1A6AB 3OTTA 2R0LL 1ONQA 3RNQB 4WUUB 1NEUA 3ES6A 3QJFB 3MACH 1Q38A 2FJFB 2NY3C 2QSCH 3CFBA 5EO1A 4LLMB 3K74B 4OCRL 1XGQA 4J4PA 1F4XL 2D7OA 5DFVD 4XVUD 1CFSA 4WJ5A 1D7FA 3RPKA 1HSAB 2ESVB 4IBLT 1SJEB 1AH1A 3T0BA 3U30C 3RL2A 3RZCA 3WFDL 4K3DL 1FSKB 4AZ8A 3A6CL 2EC9U 1F5WA 3QXDA 1JF1B 2XA3A 1G0YR 5F3HB 2W0FA 4EUPB 3VFTA 5A2IH 4Q6IA 1JPSL 2J8HA 5CEZH 5C08A 1HE7A 3G08B 4DGVH 1MJ8H 2FSEA 3ARFD 4X6DF 1U93A 3K7UA 5D8JH 1U8QA 1A1MB 1YEHL 5E7BA 3LB6C 1X5FA 4YFLI 3O3DB 3OV6A 3BESR 2CXKA 3H3PL 1BQSA 3NCCB 2H26A 2K7QA 2P42B 1IGYB 5DMIL 2FEEL 1G7IA 2N56A 3NA4A 2DM4A 4PJDE 1KCSH 4ZAKB 3H7BA 3NN8A 4Y4KB 1UJ3C 1T3FB 5DJ6A 3CX5K 1QBMH 3Q3GA 4HHAA 1U8NA 2P43B 3RIFK 3FO9B 1KNOB 3BZFB 3WUZA 4HWBL 3MRCB 2AEPL 5EBWA 1RJLA 3LEXA 1FE8H 2X44D 3EGSA 5HYEA 1QQDB 3B9KD 2C1PA 4UDUB 3WKMH 2X6MA 3T04D 3IFOB 1QLEH 3WN5A 3D85B 4N0YL 4LRNL 5E2WL 5E08H 5HHNB 3S7GA 3DARA 3QQ3A 3T0EA 2H8PA 2WUBH 1HWGB 2NY3B 4L4VE 4APQA 1XGUA 3LKOB 3ULSA 3R06A 3C08L 3I2CH 3ULUF 1HK6A 3CFEA 3NFNA 1XF1A 4BYHA 4NQEA 2XQYG 4BQ6A 4XP9L 1MAKA 5CZXD 1TTGA 5C0CD 5K9KA 1PEWA 2F19L 4N5UA 5HHME 5C71A 4FFYL 1ZT1A 4GG6B 4PJ7B 1E6JH 4O4YL 3CUPA 2B4CH 1CBVL 4X83A 3DX8A 3PHQA 5AZ2L 2ZUXA 2NY1D 4AG4H 5J06A 3FOLB 3TM6A 1PY9A 5CSBA 4D0DA 1FNSH 1K5NB 4XAWH 3F58H 2F53D 1Q94B 4TNVF 3DSFL 2HMID 1NC4B 4LBEA 2P49B 3DYPA 4JQIH 1TVHB 2QBWA 4G8FA 1I7TA 1LWRA 3RVVD 1PZUB 3PDGA 2G75A 1I8KA 4LSDA 1F2QA 4ETQB 2J5LC 3NIFF 1NEZA 4XPGL 1OGAD 1QD0A 4L4TE 4IHOB 3ULVL 4K7PL 4MXQD 5I73C 3TV3L 3DO3A 3MLXL 3TNNA 3DX7A 5I1KH 4MA7L 4QTHB 5GRJL 4N0RA 3CC5B 1BD2D 4K3EH 1R3HB 3KYMB 2OI9C 4KROB 5JZ7D 5EO0A 3FHQA 1FDLL 1L4IA 4P9HL 1IL1A 1CIUA 2YR3A 4K71C 1MELA 3SGKA 3KPSB 2IBGA 1T83A 2A6DA 1TZGL 4PLOB 4PRIB 3RGVA 4DFHA 4DUVA 1JHKL 3TCXA 5IF0A 4P2RD 3VGGA 3QWQB 5ITBL 3QCTH 4PJDB 1PBYA 4U31A 1XGRA 1MEXL 4U7SA 4GKNA 2DDQH 3RX5A 5HPOA 3S96A 2VLRE 2X4NA 1U6AH 2XRAH 1KCUL 3LRHA 4JY5H 1NFIB 3U1SH 4DAGH 3CH8A 2DBJA 3D0VA 3IF1B 3DHJA 2FWOA 1AY1H 4KTEH 2IWGA 5HHOA 1J7VR 1JHTB 2BVYA 4OF7A 3LEVL 5E8OB 4FQXA 4LU5H 2BRRH 1HHGA 3B9EA 5ICZB 4S1DC 1IAOB 1SY6H 3UBXA 4Q9RH 1P7KB 2WBWB 3C60D 2OJZL 3ZO0A 1IZKA 1WITA 5I1IL 4YHMH 2R1XA 1L0QA 3B2VL 3FB7A 4RNRB 1JN6B 4OLUH 4PJBE 3RHWF 1HDMB 1A3LL 1AIFA 5FA3B 3MRGA 4L4VB 1QR1B 5KS9E 2ICWI 2GJ6D 2Z91A 4L8DB 2CDEB 2PYFA 3ZE2E 3OKOA 3G6DL 3WJLC 1F02I 2VXSH 2HLAB 2IANA 3CVHA 4C83A 1D3CA 2DM2A 2DQJL 2EEAA 4RFEB 1M7XA 5IESH 3Q0HA 5IKCA 3VFUA 1AXTH 1A7OH 4A6YA 2J5LB 2YHGA 4JDZA 3MYJB 1UXWA 1HI6B 5E70A 4LGRB 2J8UF 4ZQKA 2W60A 3R1GL 3TO4B 1N7ML 4MQ7A 1F2XK 5I1GL 3P4OB 3RWJA 2ITCB 2FEDD 1MCKA 4YJZL 3KLDA 1AC6A 3N1MC 5IIEA 2OI9B 1KXQE 4UAOC 3RI5K 3TT3L 5FYKE 3NFSH 3MV8E 3LRGA 5GJTH 1XIWA 3PJSB 4ZO7A 3MRDA 3WIIH 4JHWL 1YUHB 5BOZG 3HKFA 4LSTH 3NCEB 4YXHH 2VR5A 1FJ1B 4TULH 3K2UL 2EDTA 2IGFL 3MBEC 4OT1H 3MR9A 1RD6A 5AYQA 3OKEB 1FV1A 5L0QC 1QRNA 4GAGH 4PGDB 3WS3A 1P4BL 1ORQA 4EN3D 3W2DL 4XNXL 5FKPB 2XG5A 3EJJX 3DWTA 4QXGH 2HFGL 4KUZH 1J88A 4KDTC 1TJIL 5SX5K 3Q5YA 2V2WB 5JW4R 1C5BH 1KTDA 4LLDB 1ZK9A 4WI4A 2X1PA 5TE4L 5DEGB 3V6FB 3VXTA 4DVBB 1DBAL 1KTRL 2VLRB 1FLTX 3IFPA 4JFYB 5DO2D 3HTLX 4ZTPL 4HH8A 3GSNL 1OLZA 1BREA 3GK8L 5ELIA 1HHJB 2NY2D 3OKKB 1NQBA 1KN2H 1OL0A 4HX1A 8CGTA 3V6ZA 5DZOA 3CSYA 4P4KB 4PJ9A 3H9YA 5MEQB 4TOYH 1RHFA 4YBQC 1CFNA 2ARJQ 1CE6B 4CVZA 4R96B 4FZ8L 3PDDA 2WW8A 5IJKC 3GJFK 1Q1JL 1AI1H 3FCTB 5FK9A 3GDBA 1OLLA 2DJUA 5FF6A 4ZDHA 3RTQB 2FGZA 3TVMC 5EUKB 1BWMA 4ZSOE 5J12B 3ISWA 3FO2B 1MFEH 4DOHE 4MQTB 2J7LA 1MHEA 2X1WL 4Z7UA 2ZUWA 5GS0D 3MJ9A 3ARGD 5CSZA 5IR1A 3AMLA 2ICCA 1FGNL 5E6IC 3FN0H 5LBSL 1XR8B 3C5SA 1UWGH 4KK6D 5D72H 2WLZA 4ONHB 1PEZA 1G9NL 4J3VA 3MBEB 1T21B 1WV7T 3GMRA 3V9FA 4S1RH 4OIAA 1N3NA 4JQVC 3EYFB 5E2TL 3P3YA 2Y7QA 3TIDA 5IB5A 1GGIH 5F7UA 4GMTH 4LHJB 3KPNA 3T77B 4NNPH 1BF2A 3LKPB 4NWTH 2AEIT 1OOAA 1E4WL 4JRXE 4WHCA 4HS8L 4OUUB 5J3HD 2CK0H 3MCKA 1KC5H 1H9VA 1S7SB 5F9JA 1J0JA 4XMKH 1OW0C 2H2PD 2VXTH 3RKPA 1T5XA 5IGXH 1QTYT 1K8DA 5ILTL 5JW4M 3L7FA 3NCMA 5HHXH 4F7CA 4LCYA 3TA3B 2EH8L 3UTZA 4N68A 5H8DA 5K9QI 2BP3A 3KLAA 3U7WL 3QPXL 2O93L 2Y6SD 3RUGE 3GMPB 4M5YL 2MCG1 1DUZA 3B9KA 1M6OB 4XGZA 3CCHB 4LCCA 4X6BB 4B5EA 3IXTA 4YPGA 4RBPH 3M1BA 1U42A 2ZOKA 1D6VL 4H0IA 4U6VH 3TVMB 3S3JA 5CUSH 3GHEH 2OLDA 3IKKA 4GG6F 4PJ7F 2PTVA 4UT9H 3UX9B 1IGCL 5ANMB 4ZFZA 2SEBA 4QYOB 5DZNA 1MFDL 2V5SA 1RSFA 3WNOA 4WW1A 4OGAD 3MLTB 1IQDB 2WBKA 3T1FA 5HBBA 5ADPH 2AJ3B 4D3CL 2KPNA 3T65B 5DJAB 1SYVA 2X41A 3UEZA 5C0CA 1U3ZA 2LAGB 2C3XA 5FYLH 1SYSB 1BX2A 2NLJB 1SJXA 3GMLA 1LP9A 3QIWC 5ETUB 1RZFH 3BHBA 1I3RA 2XY2A 1U8PA 2HKFL 3MNWA 4QXUL 5F7KC 5K9OB 1QOKA 5HYFA 5J9PB 2HLFC 3DGCR 4HUXB 2B5IB 4OJFL 4Y4FD 2CO6B 1DQLH 1D5IL 2AK4A 3LQAH 4IRSB 5JLZB 2F53A 4OCWL 3QCVL 1CK0H 4C55A 5KZCB 1T7WA 3GNMH 2AJXH 3MACL 5DD3L 3X13A 1NGWB 2EZ0D 5DD5H 2V7NA 2C7UB 2DMCA 1HXYA 4WTXA 5E56A 2C5DC 1MF2H 5E00B 2XPGB 2DKSA 5IQ9A 2X4TA 1Z9MA 2N4IA 1F90H 1RZGB 4HIJB 4MD0A 3H9SA 4B41A 1JGLL 3DV4B 5EU3B 4UIKH 4PJDF 5DJDB 1FPTH 1QPXA 4HFWA 1BD2A 1NDMA 3W0WD 3U4BH 1RJZA 4MZ2A 5GS1C 2ICEB 4R0LC 3ZKQD 3LKQA 2MOVA 4HIHA 1KB9J 2CIKA 4NQXB 4OCXH 1B0RB 4N1EA 3FFCD 1JV5A 1WCBA 4FQHB 2MWCA 3ZTJH 1MCOL 4G43A 1WF5A 3QSKB 2A9NL 1CYGA 1QLRA 4LVHC 4P2RA 3VDCA 1TITA 3DMMD 5CEZL 4YXLH 4MSWB 5EU6D 1JRHI 4DGVL 1FIGH 4CU8A 4DK6A 4UIMA 1MJ8L 1HCVA 4O02H 2Q20A 3Q1SH 3FQNA 4X6EB 5D8JL 5I1HH 4WFFD 1ZA3B 3P4NB 4LK4A 5JW4N 5I8KH 5L2KB 4LPYA 5CLWA 3RY6A 5K33A 1RK1A 5C0IA 5CINL 4MD5A 1QBML 2ADIB 3MRQB 3C60A 5IK3A 1JZ5A 2VDRH 1FVEB 1HXMB 4BK4A 1F3JA 3BUTA 4OCNC 1FE8L 4XT1C 4LVOC 2GT9B 5ITFB 2GJ6A 3QXVA 2QLVB 3WKML 3DV6A 2HTLD 3KYAA 5GJSH 4IRJC 1QLEL 4PJIA 2FJGB 3GIZH 3UROR 5E08L 4YDIH 4Y89A 3K8MA 2CRZA 4E42A 3OR7B 5EZLB 2WUBL 3FB8A 1YEDB 1ZLVH 2APXA 1UZ8A 3HC4L 4O2CA 5J1AB 3I2CL 1AGFA 2VQ1A 3TC9A 1U8KA 4H5SB 2P7TA 4NUJA 1E6JL 3DO7A 5I1LA 2B4CL 4LEXH 5EOTA 2X70A 5GS1B 4FXKB 3E0GA 4R0LB 4W4NA 4Q9CA 3E6HB 1MFCL 4RDQG 5JO5B 2IEPA 4WFHE 3QQNA 5E9DD 5TF1H 3EFFA 1J0HA 1P9MA 4R26H 1PLGH 4ZUWB 4QOKE 3F58L 5CBAB 32C2A 1LDPH 3C6SA 4GRWH 4NJAH 2BY1A 4K7PX 2DQTL 1NMAL 4JZOB 3CVHH 5M7QA 4JPKL 2EH7H 1AQDB 4EN3A 5BVJA 3HR6A 5JW3H 4M7LH 4XCNB 4GRLB 5EZOH 4BELD 1R3KB 2ZG2A 3SDXB 1R6VA 4K3EL 4BZ1L 3DVFA 1RUAH 3ZYOA 5DA4A 3ZHKA 1YMHA 4KJYB 4PJBF 1X3DA 5IG7B 5IVXB 1AO7E 2VXVH 5AD0A 2YC1A 3MUHL 3TCLA 4XZUA 2XZQL 5KS9F 4P2OC 4J1UB 3MV7D 3ZE2F 4ZFFA 3BH9A 4LHUB 1E4KA 3JTSA 2XRAL 4JY5L 3U1SL 4DAGL 5CGYD 1QYGH 3WV0A 3PV6B 1Y18B 2WBJC 4LIQH 15C8H 2PR4L 5D7KD 2QTEA 5I8EB 4LU5L 1NJ9A 3RX8A 2BRRL 3VA6A 5GSRB 4G8IA 1F97A 5TE6L 4WEUD 1G0XA 1S7UA 4Z7VA 4KUCD 3HLAA 5D4QA 3LIZH 1SY6L 4H0HB 4Q9RL 1J8HB 5FM4A 2B2XH 4K9EC 5LAXB 4N8VA 1LEGA 5FGSA 4N5ED 4FFVD 4LSRH 4YHML 4XX1E 4OLUL 1U9KA 5K93A 1P53A 4R2GC 5DMJB 4WDIA 4WRLA 5HDQH 4L5FH 2E7CA 5DFTA 4OV5B 3N1QC 4JY4B 1HEZA 5HGDA 4DCQA 2CLRA 4RAHA 2DIJA 1FNGB 1ZEAH 1L7IH 4U3XA 2R4SH 3IDYC 2YD3A 4YDLC 3HS0A 4NYLA 2VXSL 4JREB 2P8LB 3EW3B 5J11B 1T1XB 4PJFA 5IESL 1AXTL 1TDQA 5F1NB 1JPTH 3ET9F 5C0RH 2BX5A 1XGTA 5D93B 1AXIB 3AM8A 1YEJH 4QOKB 2YD5A 4MA3B 3EO0B 4IRZH 3CZFA 4O2FB 1KJ3H 4LMQE 2O61A 5DD6B 1CLYL 1XF5A 2W65B 3ILQC 3NZ8B 4G9FD 4GXUM 3ZHDA 4MD4B 3TO2A 2QHRL 1JGDB 4CNIA 2FL5A 5KG9B 2ZCLH 3WIIL 4LAJH 3QUML 5D1XD 4YXHL 2Y5EA 4P2OB 4X6CB 3ARYA 3U48A 2JB6A 1N0LA 3GZKA 3DRTA 1ULVA 2DTMH 4C54A 1NC2B 1S7XA 1W0WB 2VDLH 3LVEA 2OSLA 4EQ3A 2WBJB 3P0YH 3VFGH 5TH2B 4HKBB 2YA2A 5IEHB 3O11B 4FTVD 5BMFH 3DETD 4WTZG 5GRZA 4QXGL 1SJHA 4GG8A 2FJHB 2O5ZL 1AO7B 4KUZL 4W68A 4JRYB 4CVWA 1U8OA 4HH9B 4JPIA 4HW6A 5AEAA 1C5BL 1KBGH 4HT1H 1INQB 4GBXC 4M7ZB 3VWKC 2DOCA 3DYOA 1BFVH 4L9LA 1G7JB 3EOYG 1OSZA 3DVNB 5I74C 3D48R 1EEYB 2UVEA 3H2WA 1KN2L 1DDHB 2NY7H 3FTGB 1JRHH 2Q86B 1UADC 2HVJA 3HMWH 3P77A 4QLRA 4X80L 4PRBA 4AIZA 4TOYL 5E2UH 4RMVA 4PJCA 5D5MB 4CU7A 1X7QA 1K4DB 3TYFB 4WV1A 1TQBC 3VFNA 1AI1L 4Y4FA 2Q76A 1DN0A 5CZVL 3HG1A 4P2QB 1OAYH 3BKYH 4RMSA 1JTTA 3PGCA 5TQ2H 3QIBD 1FYTE 2XI9A 4I48A 2VLJD 3IETB 5FEBA 3I50H 5FO7B 5JPMA 3UZEA 1MFEL 1PFCA 3UPAA 2QEJA 1WFTA 4HJGB 2BMKB 5B3NA 4MNHA 2MQ3A 2DI8A 1RK0B 3MFFB 2H9GB 2XKUA 3FN0L 4HC1A 4KZDH 1UWGL 4L3CA 3OKYA 5ESQA 1UWEH 2B7DT 2HVKA 3W0WA 4M93C 1KPVB 1VFBB 1NBZA 2XICA 3MLWL 4BSWA 1U3JA 5L6YH 4ZOAA 4S1RL 1RZ8A 5JDJA 1A7RH 2Z31C 4X6DA 3FFCA 3CLEH 3RUGF 1CFQB 1GGIL 4GMTL 3OXRB 2P5WD 2F8VA 4NNPL 1E4JA 3HFMH 4NWTL 3VXRE 1UGNA 1QA9A 4XVJH 5FGBA 1F6LL 1NL0H 3GB7A 1UC6A 2R23B 4GXUN 4P99A 1J5OL 4P3WA 3RNKA 2CK0L 2F15A 5IOPA 4GBXB 4KKAD 1AR2A 3HNSH 1KC5L 1KLUB 1ETZB 1BIIB 5HI5C 2VXTL 5IGXL 2HN7A 5T33H 3NTCH 1IE5A 4RWHA 3HI5H 1BOGA 5DEFA 1MWAA 3P30H 3GSUA 4M43H 4Y2DB 5HHXL 3BDYH 3UJJH 1OT2A 4PRHB 3QAZC 1QSVA 3NIGE 1AD0B 4PGBB 2VKXA 5DJCA 3IKCB 5E99H 4P5KB 4JJ5B 1I4FB 4XB8A 1TQBB 1FZJA 4AYFA 2CKBH 1WQVT 3DSNA 1RFDL 3LN5B 3HE7D 5B39G 3CMOH 5ACZA 3H42H 3GHEL 4Z7WA 3PQYB 4UT9L 5M95B 4NC0B 4HS6A 3HR5A 4YO0B 5IB4A 4S2SA 5FV2A 4ZXBC 1R3LB 43C9B 5ADPL 5I16B 1ZOXA 3L5WA 4D0CB 1NBQA 1JYXA 1JL8A 4OZ4B 1S7VB 4U0RC 1IC7H 1RZFL 1FYTB 5C8JB 2EDNA 1PGRB 4M93B 4KV5E 2XQYK 4F9LA 4IMKC 2PW2A 2R9HC 5GZNC 3QRFM 5CBEA 1KELH 3B8SA 2YXMA 2ZKHH 3MJGX 5E9DA 5EZJA 5KSBB 3ARRA 2VITA 4IS6B 3LQAL 1DBJH 2BNUA 4ZPTB 3S4SG 1HZHH 3NFPB 2DL2A 4BH7A 4I0KA 2UV3A 3G5ZA 5DVLA 1CK0L 2OZ4A 1EHLL 3GNML 4QRSA 4GAYA 4U6HB 2AJXL 4K2UH 5MEPA 4JDVA 5DD5L 2F9BT 1AKJB 5IFHH 1I7RB 3IT8D 4OFVA 2IF7A 5IVXF 1YNTA 3RKDC 5I76B 4J23A 4HDIB 3VWJC 5C3LD 1F90L 4AH2B 1EFXD 4WNQB 4LSQH 2BSTA 2B1HH 3HCVB 1FPTL 2YUWA 3VXRB 4OTXH 4JKLA 3U4BL 1KN4H 1MH5A 2MJWA 3LRSB 3QAZB 4LDEB 5DVOA 5IW1B 3V0WL 4OLZL 4Q9QH 4UT6H 3MQIA 1K85A 1V3LA 1CCZA 4OCXL 4RIRA 3ABZA 4MDIB 5DQ9B 3FQXB 2D4FA 3MV7A 1RMFH 3RWIB 4U1KB 4O02L 1D5MB 3Q1SL 4HIIB 1KTKE 1UM5H 1PKQE 4JO4H 1A7NH 5HHMD 1MCDA 5I8KL 5D7SH 5FV1L 4ZUVB 2ZUVA 4YHZH 3D5OF 4PJ8A 5TE7L 1A6TA 4X99A 2D7PA 3VFMA 25C8H 1H5BC 5H37G 2E6JA 2OR8A 3UO1H 3K2MC 4E41B 2ATPB 5GRWA 3B43A 3EYSH 2CJUH 3WJJC 3BXNA 1HYSD 3RDTD 2VDRL 4BFIA 1UB6A 4M61A 5IHZA 4NRXB 4XNUH 2BERA 3G6AB 2BCKA 4WHTB 4LCIH 5TJWK 1N2RA 3JUYA 1KLFA 1BZ7B 5DJ2A 3KPOB 2V17H 3BEWB 1JGEA 1MIEL 2APBA 4F58L 4LFHG 5JPNB 2J8UA 3GIZL 4YDIL 1WC7B 2R2EA 5E4EC 1TCMA 4LLVB 4L4TD 1AGCB 1Q9LB 4RQQA 1UB5A 5T1DL 5KVDH 3G04A 1NGZA 5FECA 5BRZE 1LILA 3BP6B 3VWJB 3VXOB 1JNLL 4HKJA 4ZNEA 3O4LB 3KJ6L 3L3IA 4X5XA 4ZS6D 3PP4H 3F5WA 2A83B 3CFJB 1C16A 5CS7A 4OM0H 1O5DT 4JFDE 4S1DD 4LEXL 4G9FA 1Z9OA 3L7EB 5SWSE 5DJXB 2VXQL 1LO4H 1IJ9A 3VW3H 3QP3A 1HIML 3RGHA 1ZHKA 4LCWD 3MREB 5B4MD 4R26L 1MCBA 4ZTOH 3V5KA 4XBPB 4EIZC 1ZTXH 4EBQH 3DROB 4G8EA 1T20B 5L9DL 1FZKA 4BSJA 5JW5A 3CVHL 7FABH 2R0KH 4TVPD 4ZUTB 3DURB 2ZSWB 2DLGA 3HI1B 2P48B 2EH7L 3WDHA 5JW3L 4QRQB 1PVHA 4FTVA 4M7LL 4NZTH 2NX5E 3IJYA 5A1AA 4X7TB 2AV7A 3JXAA 4P57B 1H5BB 3IDNB 1ZHLA 4XXCA 3FMGH 3QIUC 5F6HI 1CDHA 1NGQH 3VMPA 2BSRB 1GGUA 4HS3B 4NQUA 1RUAL 2NXZB 3U2SB 2FJFA 4R7NA 2I9TB 1CGWA 3MGOA 1YEKH 1YMMD 2VXVL 3FO0H 4JFEB 1KIUA 1LD9A 4UBDD 5FXCH 4HUWB 3PABB 3LKSB 2AEWA 2Q8AH 3PG2A 5C0GB 5E4EB 1HSAA 4U1SB 1UCTA 3ARDD 1ZGLA 3J8F7 3ZKMD 4TSBL 3I3DA 3MBXH 1XGPB 2YUVA 3CFCH 3F12A 1B3JA 15C8L 1F6AB 3WLBA 1C08B 3T3PE 2H32B 3QIBA 2YSSA 4PRNA 2VLJA 4WI5A 3MV8D 3SY0B 1WZ1L 3GO1H 1WSST 2X4QB 1CLOH 2B2XL 4WI3A 1JI1A 4K8RD 2P24A 5AG8A 1ZWIB 4IMLA 4LSRL 2RIKA 4HPYH 5F1OB 4M7KH 1QSFE 5ALBH 1IC5H 1S7QA 2GSGA 3V5DA 3O6FB 3WIFA 4OBSA 4NBYB 4L5FL 3CDGA 3W9DB 3N9GH 4N0UE 5BRZB 4GW1B 3I85A 4X6FA 3QFJB 2D9QB 1L7IL 1WT5A 2R4SL 2VKWA 4HZAA 4MWFB 2I26N 3FO9A 3BRGC 3B5HA 2OX5A 3IFNH 2FX9H 5BW7A 5HYJB 1UCBH 4AQ1B 2P5WA 2G5BA 5C0RL 1U8IA 2RR3A 5TPWH 3NZHH 5E8DL 3ZDYE 1IGJB 3OL2A 1JIBA 4UDUA 4JO2L 3WUWA 4DKAA 3GSXA 3ME0A 3QIUB 1YEJL 3WKNA 2HKHL 3W9EB 3KHOA 3D85A 8FABA 5JA8B 4IRZL 4WU7A 5EU4A 3ZTNH 1YC7A 4P5TC 1E4XI 1SVZA 3PIQA 3SGJA 1CI5A 4GLRH 4X5LA 1IBGH 1ZT4A 1ZS8A 2Z4QA 2IADB 3QQ4A 3UDWC 1I1FB 4NSKB 2AI0L 5LVEA 2CIIA 2ZCLL 3KYNB 1LEIA 4X4XA 1PDKA 4WU5A 3CMGA 1JPGB 2NX5B 4XP1H 5E6ID 1KIRA 2EXYD 4JY6A 3IDXH 5E03A 5KBNC 3L5JA 4GG6A 2DTML 4JKPL 5IJVB 2VDLL 4CJ1A 4U05A 3V6OE 3P0YL 3VFGL 5DVMA 4KK9C 4AK1A 2X10A 4MA1B 5BMFL 4NWUL 4Z0XB 2IALA 4X8JB 1VGKB 3I02B 3NA9H 1KBGL 4Q0XH 1CGTA 4HT1L 4JEGB 5C0ND 2VDOL 1YN7B 4LHQB 4KQ4H 4NQDB 3EAKA 2IG2H 2ZCHH 3HZMB 5GGTH 4OQTH 2QADD 4HGWA 1L7TH 3V6OC 1MWAH 4KRNA 3HE6C 1AGEB 2NY7L 3SO5A 3W39B 1OCWH 1UJ3A 2NW3B 4RISH 5E2UL 4J6RH 4GAFB 3CLFH 3K8KA 3C6LC 3DBXB 2NY4C 4JFFD 2C3VB 3GBNH 5DURD 4JRXD 4DEPC 4G6AD 3BO8A 1KXVC 1GGBH 3AFLA 3GSQB 4I0PC 3BZ4B 4GW5A 4NKQB 3ZDZF 4MB3A 5E6YA 1OAYL 3BKYL 1HSBB 3ULUH 1LQSR 5TQ2L 2RHEA 1R0AH 3RWDA 1Z5LA 1G9MH 4LNRB 5C0BD 3QULB 3HPLB 3I50L 3REWA 2BNRD 5C7XL 1H0DA 1YYMH 1QUNA 2VN7A 5LWYH 3D0LB 1HHIA 4P5TB 3H8NA 2R4RH 5BV7H 1WUNT 5L7XH 4U1LB 2H3NB 4CMMB 5KSAC 2V9TA 3L3DA 1EFXA 2IAMD 4JPWH 4KZDL 4G8GD 1Z9SA 1DLFH 4KMTH 1UWEL 5ID1A 1YY9D 5EFIB 4DKFL 3FT4B 5E8PB 2OTUA 2XN9E 1QSEE 5EUOE 1WZMA 4PYGA 2CUMA 5L6YL 4NRZA 3BZEB 3NIGF 1QBLL 1A7RL 5F88A 1FRGH 1G7PB 2HT3C 4MCYA 4MXWL 4L1HA 4PRPD 4RNRA 3O2DH 2PXYC 4JN2B 3DECA 4L4VA 2NXYC 3HFML 3V4PH 3VI3E 4XVJL 3OGCB 1OQOA 4H88L 4L8DA 4LLQB 4TYUA 1NL0L 3X12B 5C70A 2ZSVB 1WWWX 3HNSL 3BQUC 4OZFH 5D7JB 2P1YA 3CPLA 2NZIA 1IAIL 4K8RL 4KJWC 5T33L 3AMKA 3NTCL 3K4DA 2HTKD 2GUOB 3X17A 1FO0B 2W92A 4RFEA 5F71A 5FUZH 1N4XH 4HG4J 4BKLA 1JP5A 3MJ7A 4NNXA 4M43L 2HT2D 3BDYL 1YNKL 2YS4A 1KXTB 3UJJL 1OF2B 4NN7C 3MO1B 3LDBC 3P4OA 4KV5F 4S0SD 3W5MA 3TPUB 3U46B 4ISVB 4DEPB 4NRYA 2CKBL 4I0PB 3EYOA 1KB5H 3KWWB 5E94A 1ES0B 3VFRA 3QUZD 1MJJB 4TSAH 5F7YC 1I8MB 1Z0NA 5GRUL 4HIEB 1QFUH 1GGCH 3ZZ1A 4Z76B 1VKXA 2W38A 4J4PC 1EEUA 1TXKA 4L4TA 5C08E 4Y19D 3UZVB 3N85H 2ZNWA 3KXFD 2E7MA 3T8XA 4QY8A 3IU3A 3TBTB 2XKSA 5C09D 3RWEB 3P11H 1FFOB 1LO0H 5T1MA 3WXWH 1IC7L 2X42A 3E3QC 1KIPB 4LASL 4PV9A 1RHHA 5KANG 4K3JH 1KELL 1Q0XH 1Z3GH 1CDGA 2ZKHL 3QISA 2VLRA 2QSQA 1TZIA 1IM9B 1OTSD 2O5YL 4LCWA 2PXYB 4JFXB 1BFSA 1HZHL 3PUCA 4MCZA 4EVNB 3DHMA 1EXUB 4OLXL 5ESAA 2K7PA 3SKOA 2EYSB 1SHMA 4IRJD 5MEQA 1TENA 4JFHE 3WJLA 3AXLA 1N5YH 2HH0H 1BF8A 5HHPA 3JWNC 3JWDC 3U79A 3H0TB 4KKCC 1CE6A 4V1DB 3WFBH 4QT5B 4XMLH 1MCLA 3FCTA 6FABH 1SEBA 3KPQB 4PJBA 3TGXA 2YPLE 4LSQL 4PJ5E 2B1HL 5FDWA 1S9XB 2J6EA 3NH7H 4NN7B 4NQEE 4OTXL 5EUKA 2X05A 5KS9A 4YWGH 2DRUA 1A9EB 5DK0B 4Q9QL 4UT6L 4ZO9A 2WV3A 2BXYA 1U8LA 3A0OA 3ALPA 1ONQB 1YMMA 1SBSH 3ES6B 2R0WH 3SDDD 3WIHA 3QQ9D 5EO1B 1C7TA 1RMFL 4M48H 1DQTA 3ARDA 4FABH 4ONHA 1D5XB 2YWZA 1CFSB 3D9AL 1E4XH 4WJ5B 3MBEA 5HVFB 1A7NL 3IJHA 3QXAA 2OTPA 2GQHA 4HMCA 5DRNA 5D7SL 4FQCH 4YHZL 4EEEA 2WUCL 3RL2B 1PKOA 3RZCB 4K7FA 25C8L 3MV8A 3HAEB 4TRPH 1PY4A 3RWHB 3QXDB 1DR9A 3EYSL 4KDTA 1HH6B 1BFOB 3BIKA 2W0FB 5C07E 1NCAL 3VFTB 4XNUL 4Q6IB 4NQTA 2EDLA 5C08B 1S7SA 3L3GA 3SE3C 1NMBL 4FZEH 5TF0A 3HA0A 4LCIL 4YZFF 1TCRA 1U93B 2ZG1A 1MRDH 1U8QB 4P0DA 1CLZH 4CUCA 5F7HA 2V17L 1CXHA 2H26B 2NY6D 2EDFA 3U0TA 3PE9A 1H3PL 3CVIL 2PO6D 3B2UD 1G7IB 3H7BB 3NN8B 2VDMH 3REVA 3CX5J 4YHLL 3Q3GB 1EA9C 1KTLA 4HHAB 1U8NB 1YECH 4HK3N 3TFKC 1CIDA 4Y88A 1I1RA 3WFCH 1IQWL 4AMKL 5EBWB 1RJLB 2F54D 3QPQD 4EUPH 3ECBA 1FFQA 4OD3H 3C09C 5DI8A 3EGSB 3SGKC 3JTTA 2C1PB 3RGVC 4OM0L 4YIQA 4P23D 1WBYA 2OTWA 1HHHA 3VH8A 3WN5B 4W6YB 3HNVH 3P9WB 1A02N 5F9OL 1Z2KA 3OHXB 3BISA 3EFDL 4JM2D 1LO4L 4NP4H 3QQ3B 3WO4C 5I2IA 1RIHH 4K07A 1U3HD 3T0EB 4R2GD 2H8PB 3D3VE 5E6IA 4BFBD 3TJHD 1XGUB 4ZTOL 2J8OA 3ULSB 3R06B 1ZHNB 1WICA 3OQ3B 2GTWA 2YPLB 3LHPH 4ODXB 4EBQL 2NLJA 3CFEB 4FQXC 3VXPA 3NFNB 4G7VL 1FL5A 4NQEB 1KPUA 1N6VA 3R8QA 2R0KL 7FABL 5GGVH 4ZSOA 4QRRE 3ARPA 4PS4H 4UU9A 1UA6H 3KAAA 2XV6B 3ETBF 4NZTL 2YD2A 3MRKA 3B6SA 4GW4B 1AR1C 3W82A 3T3PF 3DX8B 3FRUA 1I9RL 1Y0LA 3PHQB 5JLZA 1U95A 1RIUL 1QFWM 1NGQL 3KPRD 2BVEA 2E5EA 5EOQH 2HA1A 2P5EE 4D0DB 3VXNA 4M6AA 2ENYA 2VYRE 1T7VA 2VZ3A 2VH5H 3EDKA 4LBEB 1GPOH 5C1MB 1YEKL 2IFGA 1NBYA 1I7TB 1WAAE 4P2YA 2G75B 5BVPH 1VEPA 2Q8AL 5CKAA 2VSDA 4QKXB 3U7YH 1NEZB 1CGSL 1EUTA 3BPLC 1FVCA 4JRXA 3EO1A 2KDGA 3PHOA 5C07B 3K1DA 5DUMH 3TNNB 3DX7B 5F3BA 1Q9OA 3CFCL 2DN7A 1XR9A 2AK1H 3OMZA 4NQXA 5T5FH 5JOFA 4S10A 5EO0B 1WBXA 1TJGL 3T2QA 4K3GA 3ZDYF 3RVWD 4E5XA 1IL1B 5JHDD 1KT2A 3OSKA 2Y1VA 1XIWC 3C09B 2BY2A 2IH1A 1CLOL 2A6DB 3RGVB 2EDOA 5CD5C 1YDPA 3ARWA 1LMKA 4HPYL 4M7KL 4XPAH 5KANI 1IEAA 3LD8B 4GQPH 1IC5L 4MB5A 2MQCA 1XGRB 4Q74A 4YAQB 2LVEA 3VWKD 5D71H 5I18L 1IAMA 3S96B 2X4NB 2I07A 3WO4B 5GSVA 3RUGA 3N9GL 2E7LA 1S5HA 1F8TH 4X7SH 2FWOB 3GSVA 4NGHH 4OBRA 2ORBH 4U6YA 5EN2A 1PSKH 3V6BR 5F9DC 2ZWLT 3QIWA 4FQXB 1DP0A 1HHGB 1HXMA 2CLZA 2FX9L 3UBXB 1UCBL 4LHUG 5D7IE 4KKLC 1OVZA 5TPWL 3TESA 3L6FA 2NR6C 2R1XB 2CMRH 1E28A 4RRPG 4PR5A 4JFOA 1AIFB 3TH3T 3MRGB 4MQSB 2DYPD 5JOEA 2FRGP 2C1OA 2Z91B 4A2LA 1MIMH 5DVKA 3ZTNL 4UNVA 4GUPB 5I6XB 3GIVA 4GRWB 3HB3C 3IRPX 3OKOB 5EZLA 2VDPL 3LV3A 2OMNA 5HI3C 1A4KA 2BJMH 4P9HC 3C87A 4C83B 3QEQD 3QDGD 3MX0A 4NKOA 4XP1L 4TUOA 2R1YA 5IKCB 3VFUB 4I2XE 4Y1AE 4HSQA 5LGHL 3IDXL 4A6YB 4JDZB 1UXWB 4YC2B 4EIGB 3GBLA 4ZQKB 2W60B 4LOUC 3PDOA 4X9FA 1N0XH 5ECJE 3B5GA 4MQ7B 3RWJB 1F00I 1JNJA 3E6HA 5IIEB 3QUZA 3SKUD 4LDLB 3HPJA 4NFBA 4H1LA 4ZPVA 2QSTA 1XIWB 3ARBD 5DFVC 3MRDB 4NKMA 4Q0XL 1RUQH 1V7ML 3KXFA 4KQ4L 5DXWA 3M8OH 2IG2L 2ZCHL 5GGTL 2DM7A 1W72B 5HI5D 4OQTL 3QWOA 3MR9B 3MV9D 2IC2A 1L7TL 3NACL 1TVDA 1AC0A 1QRNB 1MFBL 3NCYS 1N8ZA 3WS3B 3VFVA 3T09A 1Q9WB 3CH1A 3OKNA 4XC1H 4C56D 1R3KA 3CLFL 1ACZA 1MRFH 5EUOF 3B9AA 3GBNL 3S35H 1W8NA 1AE6H 3ARFC 1KTDB 4XNZB 2C4FT 4M1DH 3GRWA 3VXTB 2WSKA 3ULUL 3IFPB 2F58L 1FG2A 1R0AL 3VI3F 5B22A 1G9ML 4IRJA 3HUJE 4LPXA 3SDYH 4Y5YA 3VGDA 5BS0E 2X2YA 1FFPB 4OKVB 3U36A 4HX1B 1JTOA 2A77H 3V6ZB 2W59A 5LWYL 5MERA 3CSYB 1U58A 2VSCA 1HH9A 2R4RL 5BV7L 3CXDL 5L7XL 2BVTA 5C6WH 1CFNB 1C5DB 3GMOA 5IQ7L 4JPWL 4CVZB 5D7IB 1F3DH 1X6NA 3RZWA 4KMTL 4WFEE 5HI4C 3B9KC 3IAQA 2V2XB 1EAPA 4LCCC 4PFEA 5FF6B 1NCDH 4RX4A 3GHBH 1S9VA 4DKDC 1BBDH 2WANA 1FRGL 1RPQA 3CX2A 1A4JA 2R9HD 2APTA 2R1WA 4N90D 4ODWA 3O2DL 5ERWB 1MHEB 4DN3H 3V4PL 4JR9H 3PV7A 2Y36L 4Z7UB 4HBCH 2ADFH 3O41A 5CSZB 5IR1B 4Y2OA 1J1PH 4XCEA 3C5SB 5CZXC 3G5XA 3MRRB 3QNYA 2CPCA 2C4XA 3S8WA 1UH3A 4LLAA 4Z95L 4LFHD 3GMRB 4M00A 1T1XA 3DPBA 2ADJA 1N3NB 3LPFA 2MCPH 1CG9A 3D18A 5F1NA 1C7SA 4MX7A 4ALAH 2Y7QB 1OGAE 3BSZL 3TIDB 1ZVHA 2VAAA 3O6LH 5IB5B 3KPNB 2DMBA 1ND0A 4H26A 4QOKA 4JAMA 2AJZA 1L9MA 4P3DB 4BJLA 4G7YH 3X11A 4M8VA 3ARFB 3ARQA 3L1OL 3MCKB 5A3IC 5JOPE 3B3IA 1KB5L 3RVVC 5F1IA 4Y4KD 4TSAL 1D9KD 2I60H 3WIHH 5GGSA 1T5XB 5L88H 1QFUL 1GGCL 2PO6A 1RZJH 3E6FA 2JJSA 1K8DB 4NO3B 3L7FB 3N85L 1MVUA 3F7YA 4TNWF 2DICA 4ODSH 3RVUC 4F7CB 1DTUA 2D7TH 3RAJH 4Y5VA 1NC2A 3UTZB 3KLAB 3P11L 5JZ7C 5FYKH 4Z7QE 3IU4H 3QZWA 1LO0L 4WTWA 4YUEH 1EHAA 2PYED 4O2EA 3WXWL 4HUMB 4RFOH 1DUZB 1IFHH 2FJHA 3B9KB 1AO7A 1EERB 4LCCB 4XGZB 5DT1L 2DLTA 4RSVA 1FZMB 4YPGB 1K6QH 3M1BB 1UENA 2XQBL 1BQLH 1G6RB 2W07A 3NPSC 4K3JL 1Z3GL 1Q0XL 1I9JH 1LNUA 1U3HA 2D0GA 5E1AA 4ZFZB 4W6WB 4CN1A 5C0EA 4HAGA 4WW1B 5KOVC 5IMLA 2GJ6E 1DDHA 4JM4H 1DEEA 4WHYH 2G2RA 4I77H 3RY6C 5J89A 3E8UL 2R2BA 1SYVB 1ZLWK 2HH0L 5DD1L 4QTIH 5C0CB 1MSPA 3OJ2C 1UYWH 1BX2B 3GMLB 1K4DA 3WFBL 3C60C 1DQJA 1EHNA 3BHBB 5F7LB 1T1ZA 1U8PB 1OP3H 4XMLL 3MNWB 6FABL 1UQSA 4LQ1A 3RQ3A 1KCRH 2NY1B 3KPRA 2JELH 3K3QA 5BJTB 1DBMH 3NH7L 4HKXA 2VE6A 1J9CT 4MS8D 3UYRL 4ODVL 2AK4B 3SJVD 2F53B 3W11D 4BK5A 4YWGL 2AJYH 4HWUA 2XWBA 2JJWA 3OAYH 3INUH 4PRDA 1BBJA 4Y5XC 1SBSL 3GJEA 2ZUQB 4X4YA 2R0WL 4UT7H 4QHNA 4U3HA 3X13B 5I8OL 2V7NB 1HXYB 5EBGA 5KAQG 1V3KA 4M48L 5HHQA 5IQ9B 2X4TB 1OQXA 1EJOH 4FABL 1OGAB 4MD0B 3D2UD 1E4XL 2LTQB 3BRDA 2L7JA 3ARZA 2EC9T 4HFWB 1BD2B 2R8SH 3EJZD 4FQCL 4HUUA 1CDIA 4JFDD 1RJZB 1MCHA 1VFOA 2VZ1A 3LKQB 4ZYKB 1EX0A 5SWSD 2YD1A 2LAAA 4ZFOB 4TRPL 5JHDA 2N7AA 1FNFA 3SKNA 4KRPC 1JV5B 1WCBB 1EUUA 2GIYA 3DI2B 3OAUH 4G43B 5HGBA 1NCWH 1QLRB 4P2RB 2VDNL 2KUTA 4GBXA 3NPSB 5KVGH 2A73A 3VWKA 4FZEL 2YD8A 4UIMB 1EHXA 3FQNB 1MRDL 3QB7C 1CLZL 3V7AE 3JUZA 5FO9B 1NKOA 4EN3C 5K9JH 3MUY1 1KENH 3B8YA 4QHKJ 5MHSE 3AB0C 1KGCD 4NPYA 3X3FL 1RK1B 2VDML 5C0IB 3BAEH 5C9KA 1QVOA 4MD5B 2O5XL 3PWPE 3IKCA 4P5KA 4JJ5A 1A8JH 3C60B 5IK3B 1YECL 4XCYA 5I15H 3WFCL 1YQVL 1VFUA 1F3JB 4MAUH 1WJ3A 1ZV5A 5B8CA 3KYOB 3KGRA 2DYPA 4OD3L 2NY2C 2GJ6B 3T4AA 1ZLUH 3ZSTA 2EXWD 3S36X 3DV6B 4JN1H 4E9LA 4PJIB 3HNVL 1TJHH 2IPKA 2IPUG 3CU1A 1NAKH 5ISZD 4RGMC 4E42B 5I16A 3WNMA 1S9YB 5D96C 2CRIA 1ZT7A 2Y4SA 3FB8B 1U8HB 4OF3A 4KWUA 1WAAF 3QXTA 4OZ4A 1UZ8B 1QACA 1ZANH 4OFPA 1AGFB 1FYTA 4QRPD 4J8RA 2APWA 2VQ1B 5GGVL 4KI5E 4PS4L 1U8KB 2P7TB 2Z31A 1UA6L 3DO7B 1FBIH 5I1LB 3S5LA 5EOTB 3V8CA 1ZSDA 1QSFD 3UPCA 2FCBA 2MQ0A 1QRKA 5GS0C 3ARGC 3NFPA 5F8RC 3ARBA 3SKMA 5EOQL 2OL3A 5HVHC 4KK6C 4Y16C 1OWWA 3U9PH 32C2B 3C6SB 4JCLA 3DX6A 2VH5L 3C2SA 3QNXA 3QFDA 1AKJA 2A0LC 1P4LA 3FT2A 3LMJH 4AEHL 3LQMA 4L9DA 4D94A 3QWRD 4WNQA 5FGCE 3ZSSA 1A2YA 5BVJB 4EN3B 1ORSA 4B50A 3GJFB 3HCVA 3U7YL 4GSDH 3VXRA 1LK2B 2D4DA 4WIQA 5DUML 5DRWA 5J3HC 3MMEA 5H35B 2AK1L 3PXJA 5ICYA 5T5FL 2X4SB 4NQCD 5D7IF 5F89A 2GK0A 4H1LH 2BHUA 3IDIB 2NY2B 1EGJH 2HJLB 2DLHA 4MNGE 3UJIH 2YC1B 2R2CA 3TCLB 4XZUB 4XPAL 5B38B 5DJ0A 4NUGH 4BA8A 3MLPA 4ZFFB 3BH9B 5D71L 4P4RA 3JTSB 4ZXBA 2D31A 4XMPL 1K2DA 1F8TL 4X7SL 3OZ9L 3C5ZD 3HE6D 2ORBL 2ATPA 1NJ9B 2XYCA 2FX8H 4G8IB 4HK0A 4Z7VB 1S7UB 3HZKA 5HDLA 4GKOA 2RQ8A 3C6LD 2FHBA 3HLAB 1Q8MA 3RIFF 1OB1A 4N8VB 5CJ8A 5KSUA 1FCCA 3IS0X 2OM5A 1T7ZA 4L9LC 2CMRL 4OGAC 3ARGB 3QUXD 1AQKH 1EBAA 4WDIB 2GITA 4PBVC 1D5BA 4AENA 1HEZB 5HGDB 1VPOH 2CLRB 5CD3A 5I1JH 3OJDA 3HS0B 1JYWA 3G9AB 1E27A 4NYLB 1JJUA 2BJML 1RZ7H 1BZ9A 2VISA 5KSAD 4WEMB 4XPTH 4PJFB 4R4ND 4R6UA 3VFWA 2F8OA 2WIMA 1HQRA 3K8LA 1XGTB 2WWMC 2ED8A 4QRUB 5IMMB 1X5GA 3CZFB 2EZ0C 4ELKB 3L5IA 3FFCE 5I66A 1D9KA 2FR4B 1RY7B 5LJYH 2O61B 3MREA 4HMDA 3TO2B 1CL7I 4CNIB 2FL5B 5EU6E 3HUJF 1RUQL 5GISL 2IMMA 2YZ8A 3NGBC 3QG7L 1JZ6A 3M8OL 4WFFE 2LU3A 3BQUD 3DRTB 2XN9D 1QSED 2BVPA 3EOAA 5EPMA 4P49A 3HI1A 1R3JA 1S7XB 5E0QA 2OSLB 4U1IB 3NOIA 1KG0A 2P47B 3CFIC 4P57A 1H5BA 2F8XC 1BWWA 2PW1A 1Q9KA 5CCKH 4PJEA 4XC1L 2QSVA 3WJJA 1SJHB 3DMMC 4GG8B 1MRFL 3S3PA 4KQ3H 4HLZG 3S35L 2XOTA 4HS3A 1AE6L 1FP5A 1U8OB 4JB9H 4JPIB 3PGDA 1TZHB 4YBHA 1PKQA 2EE9A 5I1CL 3U0WL 4L9LB 3FRPA 3HHRB 1OSZB 2NNAA 1IEHA 3CFKA 4WWKD 3SDYL 5TFSH 1XGYH 3LKSA 3KPLA 3NMEA 2A77L 4Z7WE 2ZZUT 3OG4B 2HVJB 5F96H 4PRBB 5IFJA 2AJVL 2Q6WA 4AIZB 4PJCB 4XH2A 1X7QB 3RU8H 4WV1B 1GAFH 3H3KA 3VFNB 4Y4FB 3F7VA 2Q76B 3N50A 5F1SA 2D2OA 1DN0B 3SJVA 2HTLC 4KXZH 1BM3H 3HG1B 4FXGB 4D9LH 5F21B 3PGCB 2X1XR 4K9EH 5F7EH 3GHBL 4I48B 1BBDL 2R29L 3NABH 4OI9A 3TZVC 1GZPB 1KFAH 1WCQA 4DN3L 4JR9L 3FFDA 4HBCL 4GW1A 3S34H 2X89D 2YN3A 5J6GB 5T3XD 2DIBA 3D2UA 1J1PL 3S3SA 4L8SA 3NGBB 4AEEA 3QI9D 4L3CB 4F3FA 5ESQB 1MCWM 2HVKB 2V5RA 3W0WB 3G6JE 4JFDA 4TPRH 1NBZB 4BSWB 3C2AH 1RZ8B 2MCPL 5SWSA 4HWEL 4X6DB 4Z7QF 3FFCB 4ALAL 2BOCA 4KK5D 3O6LL 4ENED 3W9EA 3DMMB 4F80A 3EDDA 1QA9B 3M45A 4G7YL 4YE4H 3BVNA 1REIA 3GB7B 3IAPA 5ADOL 3RNKB 4JFHD 1P6FA 2X4OA 4GS7B 1V7NH 4PB9H 3T4YA 3RI5F 4QF1A 3ZYIA 1JPGA 5DEFB 1RZJL 3GI8H 3EOBA 1MWAB 3GSUB 4U33A 1MAMH 1UACL 4ODSL 4PJ5D 3EYQC 2D7TL 5JQ6H 3RAJL 4YK4C 5EZIH 2EIEA 1FN4A 3KG5A 1FZOB 4ZS7H 1KJ2A 2X9XA 5FYKL 1OP5H 2OBGA 4YUEL 4I18A 4RFOL 1FZJB 4HUVA 1IFHL 4GMSH 2FO1A 3C8HA 1K6QL 3X3GH 1BQLL 4NKIL 1NCNA 3LS4H 1T1WA 4OGYH 5ACZB 1YN7A 3FONA 4Z7WB 2R15A 1I9JL 3AY4A 5CGYC 4HS6B 3NCJH 4OGXH 5IB4B 5GGSY 4S2SB 4JM4L 2H1PH 3L5WB 4YXKH 4R4FL 3QXWA 2B1AH 3RL1A 1L6XA 2MHAA 5MP6L 4LPWA 4QTIL 4DKEH 1UYWL 2Z0BA 5IBLC 1R5IB 2K3TA 2QQKH 1B4JH 2WQRA 1QSFA 3FQUA 1KCRL 4ACPA 5CBEB 5E9DB 3VRJA 1AGDA 2DQUH 2JELL 3L3JA 5EZJB 1DBML 4ZNEE 4N0UA 2EYRA 2VITB 4IEFB 4OI7A 2C4FU 2VLKD 4BH7B 4P3CH 5I75C 3G5ZB 2UWEE 2BHZA 3INUL 1IC4H 4GAYB 3QDJE 3G6JB 5MEPB 1OAZL 3QWRA 4OI8A 1J1OL 4UB0L 1YNTB 3D25A 3E1F1 1EJOL 2ZCKH 1NCBH 1L0YA 1SMOA 5E8PA 3IAGC 2YD4A 2BSTB 1YQ2A 3WEXA 1V5JA 5BXFA 3W5NA 2OR9H 2NCMA 4G80A 2R8SL 1P84J 4OM1H 1YYLH 2JIXD 1MH5B 4NQCA 2DQFA 4XVTH 4CKVX 2PNDA 1HOCA 1WZLA 3FHAA 2GSIA 4HJ0C 4RIRB 3OGCA 4LHUD 4DW2H 3OAUL 1KCKA 1R5VB 5D1XC 3HMXH 3D3VD 3MV7B 3WNKA 2C9AA 5KVGL 4RCAA 1A7QL 1K9TA 5JR1H 5HJ3A 4WFGE 4C57C 1WISA 3L9RA 1CL7H 3V6OA 3HE6A 3PHSA 4QRRD 3U82B 3P0VH 3M17A 4NCC2 1KENL 3DETC 1A6TB 4X99B 3VFMB 2WWKT 5J7CC 2EDHA 4XXCC 1KSRA 3C6LA 4MMXC 4CBPA 2R69H 3AS0A 5FOBA 3ZHLA 4ORGA 3BXNB 3F7QA 3GM8A 4LEOA 1QLFA 2P5ED 5I15L 2V9RA 1UB6B 2RBLA 4M61B 35C8H 1CD1A 4OZGE 1ES0A 4FQIH 4CGTA 1MJJA 4LP5A 1FC1A 1N2RB 2VLJE 5DJ2B 4JN1L 1JGEB 5DRZB 5I75B 1TJHL 5IV2A 2J8UB 3RX7A 2R2EB 1NAKL 1VEMA 2A74A 2HJFB 4FRWA 4LGPB 1T22A 3UC0H 1IZJA 4Q97A 5KSAA 4RQQB 4AIXA 1UB5B 5HYSB 1NGZB 3IRZA 1ZANL 4RGNE 1I8IA 3HC0A 2CUHA 4X9GA 3L3IB 4X5XB 4Z77A 5T3ZH 1IGIH 3F5WB 4MLSA 2IPTH 1C16B 4UINH 3PWJA 1FBIL 4U4BA 1DEDA 3RFZC 4E0RA 4G9FB 3QO0A 5DF0A 1NFKA 3MODH 3QRGL 2NR6D 3TBVA 3O2VH 2EYSA 2XXMB 1A7PL 3BPNC 2D0HA 3H9ZA 3VXUE 3ULVD 4NZRH 4RGNC 1RVFH 3QUYD 3U9PL 4D2NA 3BQUA 1RUPH 4PY8J 4HWNA 2XN9A 1QSEA 3BJ91 5EUOA 5FB8A 5IP4A 4G8EB 1FZKB 1N6UA 5JW5B 5EORH 4OIIH 2GHWB 4JRYD 3KLHC 4IIQA 4XP6H 4FTVB 4WW2C 3IJYB 1S9XA 4KKNA 1AHWC 1EBPA 2AV7B 4MJIE 3VXQA 1MCJA 1ZHLB 3X14A 3RA7H 4S11A 4WCYH 4LOUD 3QCUH 4KKAC 3QHZH 1F4AA 1YEFH 1CFVH 3Q5TA 1CXLA 3LKNA 4WWKA 3SGJC 4R7NB 1EGJL 1NAMA 2IQ9H 4X98A 4XHJD 1EAJA 3MGOB 1LD9B 3VD5A 4U7MA 3F8UB 2J4WL 1D5XA 4NUGL 4Y1AD 3ZTJG 3CDCA 3CU7A 3D69A 1WBZA 4GJTB 4PUBH 1ZGLB 2EYTA 3CSBA 3OR6A 4RAUA