3J07A

Model of a 24mer alphab-crystallin multimer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
175
structure length
175
Chain Sequence
b'MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-crystallin B chain
publication title N-terminal domain of {alpha}B-crystallin provides a conformational switch for multimerization and structural heterogeneity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 20
structure length 175
sequence length 175
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
A PF00525 Crystallin Alpha crystallin A chain, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3j07A01
3QORA 4MJHA 4ZJ9A 3J07A 2JKIS 4JUTA 3VQLA 4M5TA 4YLBA 2CG9X 3EUDA 1WFIA 1X5MA 2K8QA 4RZKA 2Y1YA 2O30A 2CR0A 4ELDA 3L1GA 2N0KA 2MNWA 5DS1A 3Q9QA 3Q9PA 4I88A 2RH0A 2XCMC 4YDZA 2BOLA 1WH0A 4YLCA 3IGFA 3L1FA 3QORC 3L1EA 3W1ZA 2WJ7A 2KMWA 2Y1ZA 3GT6A 3AABA 3AACA 3QORB 1EJFA 3GUFA 2KLRA 4PCKA 1SHSA 4JUSA 4PBDA 4YE0A 2Y22A 4FEIA 1WGVA 3VQMA 2N3JA 3GLAA 2WJ5A 4M5SA 5LUMA 3QORD 3N3EA 1GMEA 1RL1A 5DS2A 4YL9A
chains in the Genus database with same CATH superfamily
1QNZH 3LPPA 5TE6H 1IBYA 4PJHF 3U82B 3VXUD 1O6SA 1XB6A 1ZHBA 1NFAA 4HCFA 1KDJA 5I24A 5KSUA 2IXQA 4NKIL 3GMQA 1MFAL 2I27N 1AFVL 3FFCA 3MUHL 4AOFA 1BVNT 2ATAA 2HXAA 3S0PA 1AC0A 1B4JH 2VITB 2YGVA 3COOA 3GJFA 1NCNA 3ZDYB 5DA4A 2J5LC 4NERA 2G9HA 3VI4F 2NY4B 2DQIL 2XBTA 3DYPA 2OZ4L 4KMTH 1YZZA 4XBPB 4XB3A 4ZO9A 4CBPA 3QJOA 2AV1B 4XB7A 3U4BH 3VXRD 5IW6A 1CBVH 4LVEA 2DQUH 4PRBA 1ODUA 2P44B 4YUEH 4PJCB 4D0BA 2V2TB 1AHMA 5FUZL 4B7IA 4P2RA 2XWDA 3UEZA 1CDCA 1E42A 2J1YA 2DZEA 3QIUC 4GS7B 3OSKA 4MD4B 4ODXB 5CGYC 3MRHA 3IS0X 4BZ1A 4TULL 4RMWA 5F8RC 3GD1C 4FTVA 4XP1L 1ZLVH 1T4KB 2OJEB 3DRTB 1TYRA 1IAOB 3FT3B 2PCXA 4J28A 3DJZA 4MQXD 4DGIH 3Q5TA 4QHLB 3GSQB 1CFSA 2FZ3B 4ZS6D 4HWBA 4JHBA 3VM7A 4BHUA 4MCZB 1E7VA 1ZHNB 5AVVB 2DBLH 4J3OF 5JYMA 3V0IA 3FH7A 1WS8A 1WA1X 5D7SH 2EO7A 2WCSA 5CLYA 4BDVB 4UQ2A 4DZBB 4PN6A 1G7JB 2X4UB 4YIQA 1BAWA 1WTGT 5CILH 4Z95L 2YUVA 4RFEA 1UD2A 1QR4A 2FGWL 3MNVB 4RGOH 1H5BC 3RAJH 1IJ9A 4PPTA 4X8CA 4BSJA 3A23A 1TQWA 4HDIA 1IO4C 3PQYB 1NEZA 3HG5A 4OI9A 3N40F 5GISL 4N6RB 1IILE 2H8PA 3MR9B 2APFA 3SGJA 2UZIH 3KGSA 4CNIA 5C0EB 1BSIA 3GLEA 3HBGA 4CKQA 5D4IA 4JQVC 4KJPD 3K74B 2QELA 3NDYE 4IRJC 1QACA 2BXYA 1FLRL 4OV6F 5E7FA 4HUUB 1R0AL 1FAIL 4Q7DA 4W93A 1PYWB 2DWEA 1RZ7H 3B2PA 3HZVB 3ZHDA 4OGZA 3Q05A 35C8H 2X38A 2EKSA 2QTEA 3RNKB 4K3JL 3FO0H 1DLFH 3TA3D 5C0JB 4Q6IA 5EIVA 4GSRA 2QGCA 5DMKA 5EFIA 3BUYB 2Q76B 2R0WL 3EUUA 4H0HB 3EFDH 1EFQA 5DQ9A 1D9KA 3KGUA 5DRWA 2M83A 4X9BA 4WI7A 2CO7A 2W9EH 4YDVB 4PJDA 1PVHA 1EGJA 1U3HA 4MXQD 4FABL 2QVTA 3MMEA 5I0DA 5KYWA 3T6ZA 3VWJB 1KGWA 2ZTBA 4PS4L 4JE0A 5EUOB 2CM6A 3O9WB 4I1PA 2OI9C 3QWOA 3GXTA 3O2WL 2XWRA 5C97A 1WBXA 2VJXA 4GIAA 5F0LB 4BSVA 4GUOA 3P4MA 3TNMA 4PJ9B 5A2CA 1U4FA 2FJHA 5LCVA 2GT9B 3S7GA 3HZKA 2Y0SA 3WUWA 2ZWKA 4C4KT 5F9OL 1XTMA 3PQYE 3WEXB 4A7GF 4FQPA 1DCEA 1MRDL 4A7VA 4N0UB 1QWUA 4KC3B 4EAEA 4MAYC 5C70A 2OK0H 4Q0XL 1JPGA 4LCCB 4M7KH 2CLRB 1G1KA 2UY7B 1AD0A 1I8AA 3SDDD 2F9BT 2XFXA 4BFKA 3CSGA 3QUKA 1N12A 4ESKA 5FA4B 1KY7A 1CFMA 1U95B 3JVGC 3QQ4A 1WLHA 3VGHA 3EDEA 2YAMA 5IB4B 4HKXA 4ZQTA 3MRGA 5HDQH 4HXBH 4KOBA 1NCCL 1QLRA 3DDGA 3US0A 5AW5B 3CX2A 2JCCF 4XO4A 4L37A 2ZWNA 2J55A 1SYSA 4RDQG 2CGZA 5JIHA 4NUGH 2ZIDA 4NJAH 1MFDH 5FUCE 4HSQA 3MXVL 2XKSA 4OJDH 3RFZC 1X5HA 3BZ4B 3M45A 2YZ8A 4YVNA 2WUBL 1THAA 2RCSH 2QR0A 4TRPH 5F1IB 2LU4A 4LSUH 3VXPA 4LFHD 1JHTB 4J3SA 1LVEA 1BLNB 1A4JA 1UYWH 1I3GL 1OPGH 4FQQB 2V2WB 4J3UA 1F4XH 3E2HB 3WY3A 4BSWA 5HHNB 2GJZB 2EC9U 3D34A 2CPCA 4DW2L 1MI5D 4WUUD 2XKUA 2YRLA 3GK8H 3QPKA 2IWEA 4A68A 5JHMA 4Y19D 1W6WA 1KMGA 2YGNA 4NQEB 4N0UE 4HGKC 5IVXF 3SO3C 5A2IH 5EU3A 1Y1UA 2GHWB 2AZAA 3QJFA 1RPUA 3BT0A 1RJLA 4L05A 2YA0A 2NXZC 2Y1AA 3MROB 3BI9X 5D7IF 3MLUH 1EV2E 4I7ZC 2W9LA 3D8MA 1SFDA 4PUBH 1ZPLA 2YFOA 3KPPA 4E9TA 5J13B 5T5FL 3IXAB 2HLAB 1JF1B 5T33L 4IU3B 4C47A 5D8JH 3TVMB 1G4RA 4JCLA 3OKKA 1D2PA 5GHWL 2ZF9A 1SY6A 4JJHA 3UJTH 4JM4H 8FABB 1RSFA 1ZMYA 2ATPA 4TTGA 1G5AA 1QLEH 5FUOH 1XZWA 2GUYA 3EYQD 4LDCA 2AVGA 3PV6A 3AB0B 3EYFA 4QRRD 4BUGA 7PAZA 1C8PA 1B0RB 1MJ8H 3QG6B 3BC9A 3BPNB 1JPTH 4OLUH 2JI2A 1F1DA 3T1FB 5J6SA 5CZKA 1OQOA 2BWDA 4FFZH 1GZPA 2G3MA 2H32H 2BNQE 4FG0A 1X7QB 2IVFC 3QPXH 4UV4L 3SDXF 4F33B 4PSPA 1DQIA 1E8XA 4JVPA 3ROOB 1NDMB 4MA7H 2VRQA 1JGDA 1AJ7H 2YD6A 3K71B 3QNXB 2AZUA 4GKOA 3ZL1A 3VVVA 4W9ZA 4ODHH 3JQOB 2B2XL 3KEHA 1UJTA 4QIRA 4FHKA 1E6JH 4ZOCA 1ZJBA 3IAQA 3IU3A 3ZHFA 3BRFA 3KPSD 5PCYA 4QF1B 2WLYA 4LSQH 3G6DL 3OD3A 4P48A 2BW5A 1IGJB 4B96A 5EB9A 4LRNH 3AG3B 1ORQA 2E27L 1RJYA 4N0CD 5FCUL 1NH6A 1KB5H 3H7BA 1MI5A 4H5SA 1HNYA 3RZWA 4WUUA 3VD9A 2EH7L 3HG1B 3IDIB 4JRFA 1NCOA 5AZEL 5TE7L 1NCUA 1DJYA 1IGCH 4UT7L 1ILUA 4UUJB 4MMXC 3RNQB 5CEYB 1UHVA 3NA9L 3K5RA 3QUYA 4P4KA 4WHDA 5DK0A 4KRPC 3T0EC 1JG9A 2CCVA 2FEEL 2P3YA 3NN8B 5EZPA 2OQJB 5KBMA 4ODVH 1C5CL 2NY6D 3MNMA 5B1JA 4GI9A 4YX2H 1MJJB 1NFDF 3FN9A 4UQDA 1NLDL 2YAFA 5D7LB 3EDFA 2EZ0C 1S7TB 1GKOA 4JKKA 4HUWA 1BVKA 2V9TA 4XNQA 5DT1L 1XGUB 1GOFA 2OTPA 1LLAA 4M43L 4MD0B 3EOAA 3MRNA 5GRXG 2NY3D 4HX1A 5BV7H 3L8QA 5GS0L 1PEWA 2RJMA 4OZHF 1HEZB 3H3BC 2PO6C 5FB8A 4FMKA 1V05A 5GRVK 1XR8B 5KS9F 2J44A 3H0TA 4OCWH 4OUUA 2Z91B 3BE1H 4Z23A 1AP2B 1MFVA 1YNLH 4ALAL 4DP5X 3DTDA 4FL4B 4FQCL 1IGTA 3TPUA 1S7UA 1PZUB 2JLPA 4F27A 3CVIH 4R2GC 5D96B 5E95B 2G60H 1KB9K 2YARA 1QFUH 3OQRA 4LOVA 1T04A 3QDMD 4JHZA 4QWWD 3ZQXA 3WTTA 1SOSA 4GJTB 2ZUTA 3PIQB 3QFDB 2EEDA 2XG5B 1DZBA 3IJHB 4HK0B 3KNBA 3PFQA 4YFLF 1YEHH 4G7RB 4S2SB 1KTLA 4ZFGH 2AJUL 1TFPA 3L3OB 1LTXA 2WBXA 4B50A 3BH8B 1EDQA 4QRPA 3D4CA 3MSPA 4TLTA 5E9DD 3WMPA 2YXMA 4WSKA 2BSTA 3U9PL 2VIRA 3ARPA 5DFVC 2IAMC 3VACA 5TPWL 4HD9A 3WL9A 3RRQA 4TVPH 5IJKC 1NOFA 1P6WA 1HZHH 1U92A 5HDBF 3KCPA 2R69L 2WQ8A 1E9OA 5DEFA 5EBLB 1P53A 1UOWA 1UURA 2NY2C 2OTUA 1S3KH 4EI5A 4NFDA 4NQCB 1XTLA 3HE6C 2Y4SA 2VUOA 3KWVA 3CC1A 1LE9A 5D72L 1UJ3A 2EVFA 4P2YA 4JHWH 4EOWL 3P2DA 1NAMB 2CIIA 5D1QC 1MOEA 5IR1A 3FQ1A 5HYFA 3OKDB 2FJGB 2IPTL 5IFJA 1A3QA 5A16B 2PETA 3AABA 1F6AB 1B9ZA 5DUMH 2YAQA 3DKHA 4OZGE 4P5MA 4JAMB 5GZNA 2YWZA 5CO1A 4PY8J 4PRIB 3A67H 4IKNA 3HN3A 3LMJL 3HBZA 2YGOA 3CN2A 1DVZA 5AB1A 4X9IA 2WZAA 3CHSA 1FF5A 5IQ7L 3MFGB 4IK7A 5IY5B 2H1XA 2BVQB 4JKNA 4Y4HA 5TDOA 4QY8B 5DUBB 1NAML 3UBXB 3K6SB 1T5WA 2IOOA 1UD6A 4QYOA 2CHNA 4AZUA 1B0IA 4GSXA 3CFNA 4LQFH 4UBDC 4YC2C 2HLFC 1CBJA 3WIFA 2OKMA 4U6XB 2ED9A 5TE4L 5IFAH 2HPOA 4KVCL 4P4RB 1ZLUH 3KLQA 2JJTC 5CLTA 3MJ8B 1JWMA 3GRWH 1TQCB 3H9ZA 3IKCA 3QZLA 5DD0L 2EXSA 3CBKB 5INDB 3L3JA 4PJ8A 2CGRL 1QATA 5GSVA 1JDDA 2ZPKH 3LHAA 3UYRL 4FA7B 3D18A 1Q1PA 4NQCE 3BWSA 5I6OA 5A2AA 2FATH 1QHQA 2COQA 3ZKQD 4F5CA 3FAWA 4WU5B 4ZMVA 2CA4A 3RY5A 1M3JA 3BQUC 3I02A 4XMLH 1GMIA 1KYFA 1ZRUA 1RJZB 1BOGA 4JFQB 4U1GC 1K8DB 4YHML 1PZ2A 2ZYHA 5I1AB 2X6VA 1QSEB 3C2AH 4F8PA 3V0FA 5GRUH 2X2JA 5H37A 1XMEB 3QJQB 2PTTB 1QFOA 2AXFB 2BLFA 4PRIE 3TO4A 3V5KB 4BKLB 2HUHA 3MRKB 1YEDB 4AM0A 4U1JB 4RAVB 1HL5A 3MXWL 2C34A 3NTCH 4HUMB 1U8QB 3BT2H 4PLOB 2NCEA 3SKOA 3IXTB 5C0RH 2WN2A 1OGAD 4C4BA 2X6BA 3FBKA 1U9KA 3MNZA 2DQJH 2RFXA 5MEPA 3KWWB 4WVRA 3EG9B 3B7YA 3QUXC 5JXED 4M3KB 4XRCA 1AHWA 2WTPA 6PAZA 3VGEA 3GXDA 1OCZB 3FU9A 5LWYL 3ILQC 4U3XA 5TH2A 2D2CC 1FH2A 4NM4H 2YO3A 2G5RA 4LEXL 4BZ2H 2VQ1B 1O7DC 3SDAD 2Z7YA 1QO3B 4ZUUA 2FIKA 2WQVA 1QFWL 3H9HB 4NUQA 4U31A 1OW0C 2CAKA 3BN9C 3K6OA 4HCRH 3QEHB 4TNVK 3QI9C 1RZIA 3WD5H 1P9MC 4LSSL 3ZHKA 2QHRH 3ILEA 2QPSA 3ARFC 1I1RA 3BKML 3P54A 4JVUA 3FHEA 4NQSB 3AWEA 5KYXA 3O2DH 3GFUA 2HVBA 3TZVD 3ROLA 2NXYB 1KCRH 1NGXA 4GXUM 2XWXA 1XB3A 3OMAB 3HE7B 5CGBA 2HRHA 2BP0B 4HWUA 1BWMA 4GG6E 5IB3A 9PCYA 1AFVH 1PX4A 3UO8B 3FN0H 1LQBC 1QVOA 2H3XC 3MZGB 4GOSA 4HZLB 5HHXL 3T3PB 3Q1SH 4Y4KB 1FNAA 4FXLA 2VWEC 2DQIH 4AGPA 2OZ4H 3BN3B 4QHKJ 1FE8L 4HC1L 4MA1C 4WFFE 2DEXX 3OPZH 1H0DB 2WLIA 3WXWH 3FRPA 3WFDL 5I1DA 1VACB 2Q6WB 3OG4B 3ZX1A 1ASOA 4RDQF 1JUFA 2C1PA 4ANKA 2OS7A 3CQPA 2HG0A 4TULH 4E9XA 3N43B 2ZAIA 4UNVA 5KJRL 3OXSB 2YBRB 5E5MB 5TFSL 2BZCA 4F1SA 2IQ9H 1E5BA 1RZQA 4HISA 3U0TA 1Y18B 2AXGB 2YMXL 5CZXD 1S9KC 5IGXH 2GTWB 4FXKC 2J8HA 1GRWA 4NZDA 1OOWA 4AYDC 4IHOA 5HYJD 1J12A 1XR9A 3F01A 5HGHA 3C5ZC 1FZJB 1YPZB 5I71C 1A6TA 1T66D 2IANE 1FCCA 4M56A 1YNKH 4Z95H 5IMMB 4QNPE 5IUCA 5HD8C 4PTUA 2E46A 5E9NA 3T3PE 4HPOL 3VM5A 3M1BB 4HIHB 4X7FC 1A3RH 3L3HB 2YGQA 4HJTA 4G6KL 1A4AA 4GKSB 5GISH 4JRWA 5J6GB 4ZUWB 5IHUH 4QDGA 3HNTL 3IMSA 5EU7E 4AW4A 4UNTA 2UZXB 4B97A 1U42A 2ZYRA 1BZOA 4XBGB 4KKBC 3PJNA 4L8SB 3ALPA 3OR7A 5EDSA 3SGKA 3VFTB 1QLFB 5L6YH 3TYFB 2Y7LA 4HG4K 1KXHA 1TQBB 4OTXH 1ES0B 4MNQB 3UZEA 3EF7A 4K3JH 1AKJA 1F8TL 4R4NC 1S7VA 3HVDA 3N9GL 5FFOA 1PZ3A 1CLOL 1N5AB 2VUYA 4TKWA 3X13B 4MLIA 1GGYA 1XB8A 3IMRA 3OHXC 3MLYH 1ZIAA 5CCHE 1IFHL 4PP2B 5EBMB 3F7PC 3MRFB 3MU3A 1KPUB 3B3IA 4TUJA 5LGHH 2OCFD 3L5WB 1YNTB 4LHUB 3MRDA 2XKNB 1NM4A 3DGDA 3DXAB 1E4WL 1K5NB 3VXMD 3OB0K 2BHUA 2H0JA 4L3CA 1JVOA 4NN5B 5AW1B 3TBWB 1KY6A 3QJZA 4PS4H 3GHBL 1YPZE 3GLAA 1BFOA 5KOMC 5DJYA 1MCFA 1DQQB 4FERA 3TCXA 3FS9A 4L4VA 4W9DC 1XIWD 4H2AA 3OHMB 1HCVA 2V5SA 5J3HD 3G6JA 4L5FH 5F9OH 1CYGA 1KWGA 3C9NB 4U1MB 3WE6A 2FHBA 2OL3H 4OB5H 5F71A 1QSFA 3ZE2B 2AK1L 3WLBA 1C08A 3O3DA 4NAQA 4NENA 4M1DL 5HYJA 3QNZA 3ARYA 5JOFA 3PDGA 2YQ2A 1QPXA 2W65B 3BJLA 1JZ5A 3WS3B 3VA6A 3ZYOA 1A1MA 1R3IL 3NRFA 2XIDA 3GQFA 4ATTA 4PG9A 4MNQE 2X3AA 5EO1A 5IHHA 4XXDB 2X4NA 4PGBA 3RTQD 5EG6C 1FN4B 2CO2A 1LJMA 2A83A 2OA9A 4LHJB 4J3BA 1JGLL 2DQGL 4IRSA 3L1OH 3V0DA 4YFDB 2E56A 2R29L 4PR5A 3DRQA 1XO8A 4WFEE 4OGQC 2NY4C 3SE9L 3DXAE 4OZFB 1G5GA 2Y5QA 3BKYH 2K0RA 2KL6A 1JSYA 2DIEA 4EJ1C 2NY1D 3WAJA 4D0CA 1L9QA 4F9PC 3GZQA 5CCKL 1OT4A 1QRNB 2ZUVA 4E9YA 1YA5A 4DW2H 4I0PB 3W2DH 4ZOBA 1I3VA 4ZMYA 3BZEB 1RQ5A 4A2HA 1SJHA 4HETA 1TJMA 5JPMB 3O6FD 4R26L 5C0CB 5A3IC 4Y2DD 4W9GC 4XWGL 1B4LA 3N04A 1P1ZA 2EQDA 3AROA 4DSYA 1IM9A 3ZE2E 2YWYA 3MLPA 2FX7L 3S96A 5CD5D 5EPMA 4OF8A 2NY7L 1XBDA 5ISZD 5IMKA 2O6EA 3FU6A 1JRHL 4UILL 5DZLA 5FF6B 4MJJA 2ZWZA 4GKNA 4NKDB 4BE5A 4PYHA 3CDFA 1FG2B 2ZWYA 1W72B 4NQDD 5GHWH 3VFVB 1YMMB 4GUPA 2D31A 2D9CA 3KVPA 3M17A 3WENA 3W0WD 4XZ4A 3ULUL 3KPOA 1F86A 3PJSB 3X1EA 1PZSA 1ZIBA 4AG4L 5B4MC 1VDGA 4NOBA 4XAKE 1KENL 3RDTB 1E27B 4WCYL 3FZUC 1Z3GL 5DUPL 1D6VL 3RUGA 4O02B 1OF2A 3IVKB 2NX5E 5DU7A 2ADGA 3C5SA 5CN1A 3KPRD 1T5XB 1NMCB 3SBPA 1W72L 3DDFA 4ZFQA 3QZMA 1GHFH 4M6NL 5GS1B 4CAGA 2IH1B 4KJQD 4UV4H 1QRNE 4B9CA 4X6CB 2HN7B 3H6AA 3ZYJA 4WNSA 2OCJA 5KSBF 2N7SA 2BK8A 3NSJA 4JDZA 5FDWB 2QKIC 4Q56A 5C7XH 3RI5K 3SOBL 5CJQH 2WIIA 3ET9F 3ULUE 4FQXD 5I75B 3JV6A 4O02L 3X3GL 4E9LA 1HHKB 2GJ6D 4XN4A 5FUCC 4DKDC 3PHSA 4PJ7A 6CGTA 4YE4H 4BA8A 1V5JA 4PY7B 2PWHA 5DVMA 3LQMA 3SDCA 8PAZA 3KYKL 2B77A 3G6DH 4P5KB 4LEOA 3U36A 5GGSY 4HKJA 2CK2A 4FYQA 3JWOH 1KPRA 3VWJC 3RL1B 5IQ9A 3O9WC 4JANB 3IJEA 1T7WA 2CSPA 5TE7H 3UGEA 3O45B 4ZTPH 1AGDB 2WBJB 4JRYA 1WUZA 4PJ9C 1Q9KA 1NCIA 2CBPA 3X3FL 3MGOA 1AQHA 1TT6A 1VFBA 2X89A 1TZHA 4KFMA 2Y25A 1RSYA 3UG4A 2GPZA 4JE4B 3MA7A 4EN2A 1RZPA 2XZQL 1MCDA 5ANMA 4XVJH 3B7UX 3I85A 4LCCC 4YSCA 1JL8A 4QTFA 2BC4B 2DEYX 2OMWA 2Z7ZA 1MZYA 1C5CH 1A4KB 1LO4H 5I0ZA 3GHEL 4DTGL 4FFYL 2VM9A 4XPBL 2R2HA 1TSRA 1NLDH 5BRZB 2OULB 4NHUB 4RNRA 3MRPB 2E8ZA 2Z92A 4OGYL 5DT1H 1JZHA 1L9RA 4XP5L 5AAPA 5CIPH 1IM3B 2WWNA 5I6KA 5IMOB 3GMOB 2Q5BA 3Q5YA 5ECJE 4U1KB 1WTLA 1MZZA 5J56B 4ZUVA 2PW2B 1XGPA 1XBRA 2N56A 3KPRA 2FBJL 5MENA 1NL0L 2JB6B 1UOKA 4U6HB 3S3DB 3LIZA 4L4JA 1RZKL 4ALAH 1XGTB 1ASPA 4J8RA 1QWNA 3MGAA 4JY5L 3BJ91 2P4AB 3V6ZA 3E2HC 4FFTA 4PG2A 3MRCB 3UX9B 3BHBA 3TN0D 4K2UH 2ARWA 3V7AE 2IWKA 1MSPA 5DQJB 2AABL 4W9EC 3QRFM 1A6UH 1SMDA 3MBXL 5SWZD 3RB5A 1BQLH 3GM8A 2BCKB 4FI6A 1Z9NA 2Z35A 3EJYC 1WQVT 5DCCA 1QZNA 4XC3L 3ZQ9A 4AENB 3ATAA 2VH5L 4QRSB 1HU8A 4UT9A 1WJ3A 3CFEA 2AJUH 4MB5A 1BBJA 7PCYA 5J13C 4EVNA 2BSSA 2ITEA 2NUPA 3U9PH 3LN9A 1OVZA 3ABZA 1VGKB 3MUGB 5TPWH 4AVIA 3P0VL 4LKXA 5LBSL 5D6DA 2B5IC 3UCQA 4KQ0A 3IE9A 4GO8A 2R69H 2MQGA 5IIEB 4V2BA 3ES6B 4ODSL 4BH8A 1N68A 1SF3A 2NZIA 3DETC 3AB0C 3H9SB 1JVLA 3QZNA 3WDHA 1V27A 5D72H 4AQ8A 4P46B 4MNGB 4X5WA 4PJFB 4IIQA 3OZ9L 5ENWB 5AENA 4TNWK 1OTUD 2MH4A 2M26A 4KDTC 2ETWA 2IPTH 3BUQA 4XPFL 5B7EA 4WHCA 1HEJC 3AC0A 1MN4A 5L8LB 1LNUB 5DZVA 5CJBA 5C0BE 3C2SA 3LMJH 2CUAA 4YBQC 2Z8VC 2NZ9D 4U1LB 4C56B 1NIBA 1VGEH 2F7IA 4FXGA 2EO9A 3BW9A 4AV4A 1LWHA 1DCLA 2I69A 2J88L 3QSKB 4LCIL 1M6OA 1QZ1A 5DF0A 5FV1L 5EZIL 1ACZA 4YPGB 3SE8L 1S9VA 1TVBB 2B0SL 2DKMA 4G8EA 5JDJA 5EU6D 3IDJA 4Q9CA 3RVWD 1QI5A 1M42A 5TE4H 2XNAB 4B0MM 2K7PA 3FB5B 4KVCH 2Z4QA 4ZPVA 3UYPA 4ENED 1MVYA 1AYRA 1HL8A 1T83C 4ZO8A 2A99A 1GS6X 3OAYH 3ZL4H 3K46A 4Y89A 5KUMA 4R83A 2O5NA 3HVNA 4PRAB 2H6OA 4HVBA 4WJ5B 1KJ2L 4OFYD 2R1WB 2ITDA 4XPTL 2VDLL 4XHJC 1HK6A 2X40A 1B4RA 5MEQA 4WO4C 3J07A 2LVCA 4XZUA 4LNRB 3L95A 3V4PA 5GS0C 3HFML 5CNHA 5C08A 1UGKA 3KS0H 2GFBB 4XMTA 4O2FA 5JHDB 2HTKD 4WWPA 5CD3B 4JLRA 4IBTA 4JFDD 1LMKA 5B1KA 1JGUL 1ZANL 3MBEA 4MBRA 3DX0A 4C56E 1OAYH 3FYEB 1RIHL 2JB5L 3F7KA 1OGTA 4IRZL 3KPQB 3KS0J 4XGZA 5JQ6H 5J11B 3GSNB 4OLEA 3IVKA 4X4YA 3NK3A 4JQIA 3L6FA 1K3IA 2DRUA 2E75C 4ZX5A 3B2UD 1TJHL 4LPYA 5D1XE 4XBEL 2QGEA 1BJ8A 1EAOA 1A47A 3BISA 5LWYH 1NICA 3IGUA 2H6PB 4NCDA 3GHPA 1NCDL 5IROA 5K9JL 5FYKE 3FCSA 2L8AA 3QORC 4LEXH 3GSRA 2XPYA 3HZ3A 4FL4C 4HSCX 3V0VB 4BCXA 3MCG1 2NYKA 2WINB 4E42B 1QFWH 1NTDA 2FYYA 4XWOD 4U1NB 2BSCA 3GSNL 5D96C 4JCMA 4LT7A 4ABUA 3EFFB 4MYPA 1A6VL 5HGGS 4CADB 3BKMH 3NACL 4NO2B 3D39A 2NY0D 5DMIH 2JI1A 2BDNL 5EOTB 5EU6A 3V4VA 3LKQA 4G6AC 3T71A 5JO5B 1A2YA 4WZ9A 2R7EA 4YNYA 4HCGA 2CKBA 4LIQH 2HRLA 3QZOA 4N2GA 5AW3B 3T2NH 5E8DH 3L3OC 4A2GA 4TSAL 1JI1A 3FCGA 1B0GA 3GEWB 5CJOH 4K3GA 3RIAF 4HK3N 5EZJB 1ZVNA 1SZNA 2XJKA 2YUXA 3MV9A 3VFMB 1YN7A 4FNRA 3WI9A 1VPOL 3QUZA 1S9YB 3AG2B 2MTPA 3G9VA 1FP5A 1OQXA 3CG8A 1A25A 3DVFA 2H0PA 1C8QA 3BVTA 1A6WL 2YPKA 4HC1H 1FORL 3NFPA 4O9HL 4YHLL 5CBAA 1A9VA 1HL4A 2DTML 2ZT9C 4X7TB 2OAAA 1AGFB 1QKZL 4UB0L 3RPKA 3SE3C 3WGUB 3B6SA 3RZCA 4MJ5B 5EDXA 3FO2B 5D2LA 3LRSA 1IKNA 2WYZA 5IEHA 5CINL 1I7ZB 4WUKH 1CGVA 1RPQA 2NW2B 5FA3B 1YQ2A 1LO0H 4RMQA 3SY6A 5EZOL 3CVBA 4YL9A 1WZKA 2FK9A 2YMXH 1OHQA 2G9KA 5DDHA 1M9SA 5DEGB 3QYMA 3VRIA 2ENJA 5EORH 4Z78B 1YJDL 2WXOA 1TNNA 2Y5EA 1CVRA 1PW3A 3L3KB 2LHAA 4JY4B 4A39A 4HOXA 4AYMC 1E4XH 3I74A 4FQLL 2F54D 1MCSA 1TQCC 5KSUB 3NZHH 4G6KH 3TF7C 4MMYA 3RIKA 4BM7A 3Q44A 3FFCB 3MA9L 2ZCKL 4WWID 4ISVB 1Q9LB 2J20A 4JN1L 1HOCA 1N70A 4K3EH 1FSKB 3LNGA 3IMUA 2G9HB 5C6WH 5JHLL 4CN6A 5TD4A 3V8CA 1SEQL 5CP3H 1BA9A 2HG5A 3HMXA 1F8TH 3FFDA 5TDPB 5IREA 4M7LH 5C07E 1T0NA 2P24A 3K6FA 5FR3A 1OIOA 3P9MA 3RWCA 4KNTA 4OLXL 2QADD 2JELH 1RIVL 3CFBA 1IFHH 2NYZA 4JM0A 4QXTA 5CKAA 1ACYL 2UXFA 1NGZA 2BH0A 4KGJA 1ED3A 1L0XA 3L7FB 2ZXWB 1RFDL 4X99B 4XMXA 4LKCA 1ZE3H 4AGLA 5SWSD 2A6JA 4TNGA 4BINA 1N8OE 2APXA 1TZGH 2Z31D 4IJ3B 2YEVB 3OKOA 4APQA 1SXSA 4ZW3A 1CFSB 3GHBH 4H7VA 1AZZC 3AMLA 1JTPA 3WNJA 1EJ6A 3MOQA 4RX4D 4YDMA 4Z18A 2PYFA 1LEKB 4JW3A 1JNNH 1YAIA 4BZ1L 4F24A 1P2CA 5ES4B 3V0AC 1CF8L 2FNWA 4LCWB 3AS1A 4UQIM 3SD2A 1NMBH 5HJBA 2G5UA 4Z7OF 5BMFH 5F3BB 4MA3A 3CV5A 4RFEB 3ZZ1A 1RKRA 3UJIH 1FZKB 1HZLA 2DLHA 3WTYA 2AK1H 1UB5A 1PGRB 3MKGA 1NEZB 1IC5H 4HWBL 4C58B 2H8PB 1OP5H 2NXYC 4CNIB 1BZ9B 5EN3A 3VE0A 2D0HA 1DBJL 2PWFA 3K7UA 3K1DA 4ZI8A 4HT1H 3JXAA 3HE7C 3VXUB 3HC0B 4QKXB 1J8SA 4YGVB 2P8LA 2CLZB 3BUBA 5IV2A 2CRMA 4KY2A 2DQGH 4V1DD 2ERJB 3K2UL 4LMQI 2HRPH 2X4TA 5SX5H 4L8CB 1KYDA 5I6MA 1DO6A 2V6HA 1NA8A 4H1LA 2R29H 3TT3L 4Y4KC 1NDGA 5CN3A 2AJZB 5DMKB 4Y2OA 5I15H 3SE9H 3KL0A 4L1BA 4PV9A 3JVFC 3HNVL 5DQ9B 5SWQA 4HS6A 5KSVA 5DRWB 1D5ZA 4FG4A 4ERSL 4M6AA 3VXRB 4PJDB 5DC4B 1TTBA 1GTFA 2BIPA 4QGYA 5CCKH 1TTCA 3MMEB 1TQVA 2MPAH 2ITFA 3QS3A 5KYWB 1SPDA 5T1MA 2GEQA 3GMNB 3EW3B 4LCWE 1N8ZA 4FFWC 1SLVA 4R26H 4AIXA 2RAMA 1AVAA 3U6RA 3P4MB 5CEXA 1TQTA 3FUDA 2O61A 1RLBA 4OZFH 2ED6A 3OLDA 3HZKB 4ODUA 3WUWB 1ORSB 3FCTA 1GGCH 3DARA 3IETA 1MDAA 3QDHA 1ACCA 1S7WA 4FLSA 1E40A 2OMBA 5E2UH 1JPGB 1ZKAA 4I9WE 1EGJL 3BVNA 4UILH 1DHKA 1SUHA 4MD5B 2A9NL 5ADPH 2GB2A 2XFXB 1JBJA 3QUKB 1UATA 1YEFL 4LVOB 5E2TL 3H3KA 5E5LA 3VXUE 1L6PA 1HSBB 2O5YL 3AGWA 1S7RB 3D87B 3EOTL 7FABL 1EO5A 4QRQB 3WN5C 3QQ4B 5LCVL 4RLDA 4Y0GA 2RHEA 3GO1L 4HKXB 1P4IL 4XOCA 1KCKA 1NEZG 2FEJA 4BV1A 3W1ZA 4F91B 5ID1A 3DJSA 1KENH 2H2PC 1Z3GH 3EJZC 1SYSB 3FB7A 1WIPA 5DUPH 3IYLW 4IDLA 2OBGA 2O5ZL 4NQXA 1HQRB 2QQQA 1WBYA 3GDCA 5K93A 1RU9L 3V6OA 3VXRE 2F7OA 4M6NH 4W9IC 3W56A 4CU7A 4HEPA 1PLCA 1S9WA 2F8OA 4L8SC 1M1SA 2B1OA 4KH2A 3RWIB 2RA1A 1FGVL 1TQBC 3S48A 3Q0HA 5CR1A 4Z8FL 2W9DH 3D07A 1ONQA 3S34L 1UT1A 4JBSA 5DS2A 3TP4A 3WY1A 3TA3B 2CO6A 1ZVSA 1LP9F 1KBGL 2EXYD 4MQ7A 4EN3A 2JJSC 4YDZA 3BLBA 4WTWA 3QJFB 1DFBL 1TZOA 4P59L 5JUEL 5ERWB 3WO3B 3SPJA 2H2SD 1J05A 4R7NA 4NN5C 4XCYA 1XCWA 4WW2B 2DI8A 1NC2A 2ZX6A 2QJDA 2JKXA 4B3VA 2F6AA 2R9HD 2CDEB 1WZAA 2Z65C 2KT6A 1IJNA 2LU3A 3HRZB 4F7KA 5C0GA 2ZSVB 3LRLA 4UOQA 4XCCL 3X3FH 2N01B 2X4QA 1ZGLB 3DLQR 2VR4A 5DI8B 1LK3H 3KVDD 4RVBA 4MQTB 3BSZH 4E41A 4CN4A 1WZLA 1U6AL 1FZMA 5J06A 2DOCA 4HCIA 5CR8A 1H8NA 2ZOKA 1EFXA 3FQ4A 3SDDB 3GHEH 2FJSA 3MV7A 3LD8B 4KXBA 5DFAA 4FFYH 2GCYA 5BZXA 2A6KA 1TETL 3FO1B 4PIBA 2VDPB 1KJ3L 1A7OL 3FTXA 2J6EH 2E47A 2FECI 1C5DB 4OGYH 4QAMB 4QCIB 4QO1B 4XNDA 1IAIM 3ESPA 1IARB 4XP5H 3O3BA 4UQ3B 5AYQA 2I9LA 3QIBD 5D70L 4X6DF 4R7DA 2LW3A 3GS4A 1JGDB 1U8HA 1YYLH 2Y07L 1NL0H 1GJIA 2IJ0C 4JO1L 4DK6A 2FL5B 1NKGA 3MUZ1 5DLML 1JHLL 2J2ZB 3UP1A 2NSQA 2KDYA 2VDPL 1AGCA 5DHDA 4JNXA 3QEUA 4CSPA 1RZKH 2BOCB 2F1AA 1U4EA 4DWHA 1CXIA 3PXJA 4JY5H 3AFLA 5GJSH 1U0QA 3QVAA 4YSPA 4YGAB 2X2IA 1RV6X 3U1PA 3TNNA 2C8NA 4OKDA 2ADJB 1RJYB 2BNRA 4I0PC 4R4BA 4WIQA 5FKAA 5FYLH 1MI5B 3RPIA 3GXPA 4WUUB 2AABH 3MBXH 5JPMC 2ZYIA 3MLRL 4UZUA 4Y19B 5INCA 1AANA 1G7QA 1CICA 3ULUC 1KBPA 4IMKA 4JFWA 2WO3B 4X6BB 3APFA 4PJBB 2EDRA 5F96L 2MKWA 4EKJA 2VH5H 1R5WA 1ZVHA 3D52A 1X5KA 5ELIA 3KPMB 2OW6A 2V9RA 1GW0A 4AUUA 1CB4A 3I6GB 1M2VA 3BWAA 1PTZA 4FJ6A 1E3FA 2PW1A 4JKLA 3EFOA 3QO1A 5FIEA 5C0AD 2AEIT 1M7IA 1QUNA 2CNYA 2K1MA 1J0YA 3FULA 4N28A 4HXAL 4B9IA 4LVNB 4IBUA 5E4EB 2APBA 5LBSH 1Z9OA 3EXLA 3FTSA 5DJAA 3QJVB 4LRIC 4ZYKB 4KXAA 4ODSH 1BVKB 4XNQB 3PDOA 3QUMB 3LH9A 3RDTC 2F08A 4DN3H 1RD6A 4AT6B 1HYRC 3EOAB 1JD9A 1T7ZA 3OZ9H 4JN2A 2WLNA 2XZCL 4XBMA 1Y0LB 5KW9H 1NMCC 1J0HA 3DX7A 4XPFH 5GS1C 5FB8B 3TIDB 4KBPA 2P5WD 4DETA 4MYWB 1UB6B 1A64A 1NAKL 2AQ3A 2IDCA 1CLCA 4M7ZB 4Z7VE 3VXOA 4ZX4A 1BVOA 1S5HB 3CE1A 3QUML 3ZKSD 4L1SA 4JFTA 3D85A 3TYGH 1G6RH 3SIKA 4NWTL 4LCIH 2YK1H 5E6UB 3PHQB 1FGNL 2BY0A 3OJDB 3SE8H 3NH7L 3MRQA 1C12B 3F12B 3VXSD 3KPSB 3WFBL 4TN9A 1HCYA 4N8PA 5H94A 4B7LA 1L9OA 3D2TA 1EHAA 3KNBB 4HEME 3UO1L 3MTRA 1LM8V 5CEZH 5KG9A 4NEHB 1KTLB 4L1HA 4L1LA 4V11A 4JX0A 4RWYH 4QRPB 3Q2VA 4O5LL 2WBJC 4QOKA 4ONOA 1SBSH 1OEZW 1GSKA 3DUUA 3KXFD 4ZPTA 5DS1A 5BNXD 4N68A 3UCRA 4XN5A 1Z7JA 1A7PL 1KJ2H 2X7LA 2C3XA 5J57B 1T20B 4FYRA 2GK2A 4IOIA 2VDLH 1PLAA 4XPTH 4QRRE 4WTQA 3KCPB 1CL7L 1I3UA 5JYLA 2OTUB 1M56B 2YFNA 3HFMH 4HUKB 3UTSA 3FUJA 1LE9B 1AG6A 4NWUL 2NY6B 5CJ8A 1R3KA 1FFRA 5DHEA 2CIIB 1E6OL 1JGUH 5ICXB 1R5VB 5ACZB 3BMWA 3L7EA 1OAUL 2GITB 3IFOB 1RIHH 2JB5H 1T5KA 4YO0B 4JGNA 4QUOA 4IRZH 1FFTB 2C4XA 1ZTXE 2ICEA 4KKQA 2VDOB 1MY7A 4QGTA 1KCSL 5FYJL 3RX9A 43C9B 4KZDL 1EAJA 1I7TA 3OGCA 4UOW1 1L3NA 2B1HL 4Q14A 4Y5XA 2OYKA 2NSMA 1Z9SA 5F3HA 3KPSE 4F2EA 1EZSA 1TJHH 4MA8L 5TDOB 3WTWA 5EV7A 1EZUA 1T5WB 1HTYA 4DVBB 3KWXA 3QP3A 4JMNA 4JO4L 2HTLC 2YOAA 4O58H 4PRPD 4POZC 2VLLA 3WIFB 1U8MA 4OJFL 3DV4A 4YDNA 4CC0A 5IB5B 4DKEH 1DQJB 5JOEA 5FECA 3GSNH 3F58H 2Z0UA 2X4OA 1UKSA 4OFDA 1ECZA 1NPJA 4NRZA 4POUB 5EC1A 1WEJH 3ZTCC 3VFRA 1A6VH 1WBZA 3HZMA 4PQXA 4U6TA 2B3IA 4WTXA 3I9PA 3QDMB 5GSVB 3O0LA 2WLLA 4CRPA 1MNNA 2P52A 4XTRC 2DQCH 1DL7L 2AW2A 3LKRB 1WISA 3O3EA 2WLKA 2YKLL 2OXGB 3ARED 1BEYL 3NPZB 4AE1A 2DQHL 4XPHL 2AK4E 2DV6A 3I02B 3CFQA 4M61B 5E9DB 2OMUA 5LAPA 4CSSA 1I4FB 2J56A 2FR4B 3RGBA 2JKWA 1VPOH 4PJHA 1CQYA 3CBRA 2PKDA 3TO4B 5F1KC 3VGDA 1DUYA 3APMA 3SBRA 2PCFB 4FI7A 5F88B 4AM0B 1A6WH 1JV2B 1LO3L 3SKOB 3WS6A 1FORH 1X5FA 4O9HH 1YY9D 4MKMA 3I75B 4HS8L 5D9SB 4P46C 2EP6A 3FOLB 2DTMH 4PJ5A 4HAGA 3V9CA 3T8XB 3C6SA 4YBLB 1IT9L 3VI4A 1QKZH 3L9YA 4FDWA 1RERA 3O6LH 1MFBL 4AJYV 4ZW5A 5DR5L 2WVTA 3WGVB 3CFUA 3IAGC 1JK9A 4JFFD 4LCUA 2RH0A 2PR4L 4NNXB 4DPCX 5TH2B 5ICZB 3ARBA 1RVFL 2F19H 2Q10A 2EC9T 2WB1A 2DQFA 1UG9A 2FX9H 3SKNA 1ZEAH 2E74C 1G9MH 5DJ2A 3SGEI 4AJWA 3QDME 5BZWB 2XQYA 2I25N 4OLWL 2ZKXA 2K4WA 5I19H 5GGTA 3VMNA 5EIIA 3DBXA 4PVLA 2NNAB 3SPHA 3LKOB 4P8QA 3B9KA 5AW0B 4PRPA 3ROLB 3KJ6L 3P73A 2CR0A 5E9DE 1NGXB 1MUJA 3BP5B 3S3JA 2N7AA 1DE4B 5ADOL 3ARTA 4HIEA 3MOBL 1BPVA 4TLKA 4X80L 5DQDL 1KCVL 1L0QA 2OW7A 5I30L 4IGBD 1EHNA 1KLUB 4GSDL 4GRWB 4AXWA 3UZQB 4E0RB 2GEEA 3ZTDC 1QVOB 3MPCA 3Q2NA 1VLXA 2E7LC 1PIFA 1CTMA 3G5XA 4KI1A 5DJ0A 5DLLA 4YDJA 2WWMC 3KHQA 5H37G 4Z7UE 4AC2A 5FO9B 1SEQH 5M95B 1GYUA 1MHPL 2G4GA 1KZYA 4HAFA 4Z7WE 4F7CB 3FKUS 5GPRA 5FO7A 3JYCA 4OLXH 3ZUNC 1NEPA 3TGXA 4BJLA 3QWQB 3V0GA 5FHAL 3ILPB 5DEZA 1JUFB 1MQKL 3V0HA 3GJFH 1UH3A 4ZRGA 2F7RA 5GZOA 2HH0L 1OGAB 1RFDH 2WZPD 3MVSA 3TFKD 2ALWA 4JZJA 1AXIB 2BVEA 3BAEH 2QSCH 4ODBD 4F7PA 3ABLB 3BD5A 1JMZA 2HKFL 5DSCA 3QYNA 3BKJH 4IHOB 1XCTB 2F8IA 1XR9B 5HYSB 1N2RA 1GY2A 4BZ1H 2BSDA 4YBHA 3SDAB 1N6QH 1FVEA 3FL7A 4K23L 3B1UA 4U1SB 1TYJA 3WFZA 4PTUB 1Y7VA 2NR6A 4A7QA 5AUMA 4J2QA 2HT3C 4FG2A 4GY4A 3PUCA 3TZVB 1JWUB 1MCIA 4JGMA 4K5LA 4RESB 2WXRA 4QLRA 4EUPA 4Q4EA 1WH0A 3ARGD 4R84A 3B5GA 1WA2X 1GGBH 5L2JA 2GY5A 4IGBA 2JF1A 3W11C 3K2UH 4Z7UA 1J9QA 1LEGA 4GFTB 1OT1A 4Z7WA 3TT3H 1OGAE 4PBXA 3KLLA 5JHBA 1DJWA 4RDBA 3VW3L 3HNVH 4QEGA 4JM2C 1D5BB 3FRPG 5JW4N 3B3IB 5FO8A 1X6NA 4ERSH 3DPBB 2AGJL 2XPZA 3B7SA 1U3NA 3G08A 1QOKA 3L4XA 2BY1A 3MRDB 2H32A 5EBGA 3BVDB 1ETZB 2X53A 3CGTA 3X14A 4MDIB 5KVFL 3RWEB 1BFOB 1AGBB 3BP6A 4JKPH 4KK9D 2VZ1A 1YJDC 2YAHA 3LN5B 2QFPA 4O51A 3UTQA 4GBXA 2UY6B 4L4VB 5DMJB 3ZRFC 5E03A 2QSVA 4JO3H 4R9HA 4JL1A 3H42H 5EN2B 2XA8H 3Q8BA 1YEGL 2DLIA 1SJMA 2XOTA 3C5JB 2ZWLT 3TBSB 3VXQA 4HV8A 4YR6A 4DAGH 3CVHA 5KSAA 4PRHD 4KI5C 1EGJH 3L2LA 4DO4A 2TSAA 2CUMA 3VYPA 1MCQA 2YPLD 3BYYA 2C9XA 3JWDC 4L8DA 1C08B 3WLBB 4UTBA 4NENB 1EHLL 1OM9A 3QNZB 5HYJB 4QPEA 4BFOA 1XT5A 4I5BA 3HC3L 5D7IA 3LXCA 3EOTH 1IKFL 1CFVL 1I1FB 2CNZA 1TPXB 5LCVH 2VOTA 5KVDH 1DJZA 1P4IH 1YEKL 4DIXA 3VYNA 5FHBH 5KVFE 3RA7L 1AMYA 3R4RA 2R0LL 3P3RA 3HJ0A 2Q2EB 4HGMA 4KY1L 2HFEA 4TVPD 4JPWH 4N0RA 3L4YA 4LLDA 3GB7B 5HI5C 3V6FA 4Y16A 5G5DA 4IRSB 2O5ZH 3AXLA 3MJ7A 3LQZB 1ZHLA 1HC1A 1NBVH 1RU9H 3PWJB 3PFUA 3DRQB 1FSKC 2H5UA 4RAUA 4GMTL 4KPHH 1JCKA 2ITCA 1RK0B 4KK6D 1N9PA 3VX0A 3AY4A 3GSUB 1FGVH 4Z8FH 3NIDB 1GXEA 1ZV9A 1SOXA 3S34H 4LDEB 4KXZI 4PAZA 5F7HA 1GW6A 4NFBA 1LDPL 4XE0A 4APXB 43CAB 3U0PA 1D3CA 4K9EC 2FT7A 3MRBA 5E4OA 3Q48A 4QHNA 2Q8BL 2Z93A 3P69A 4N8CH 3TX4A 5LXVA 4EQ3A 1FL6A 2X4SA 1I8LC 4KV5E 2PP7A 4JPKL 1TMCB 2BSED 4G83A 4M1CD 3LXBA 1SXBA 4IJ3C 5D1ZA 3VXMB 4NYLB 1UH4A 2ZUUA 2VXUL 5JNYA 1VKXA 2QVFB 5IMKB 1H15A 4P2OD 3VD7A 3BSGA 1GC1C 3R8QA 5I1IH 4GKNB 1K2DA 1F4HA 1XIWB 1ZJAA 2MIZA 3G04A 4XCCH 2H0EA 3PV7A 4YEFA 5D5ME 3GSWA 2D31B 5LHDA 3VFOB 4GRMA 3M17B 4XAWH 1XSIA 1QTSA 1XF5A 3CZKA 5LLIC 2BHZA 5FEBA 2JTDA 3DX6A 1HH9A 1IBGH 3LKNB 1OSZA 4LAQL 4F58L 5LN4A 4BGDA 4BELD 3NCFB 2C3VB 3BH9A 4XMPH 4F9LC 3LNFA 1M7DB 4K94L 3RUGB 1MRCL 4J1UA 3SGJC 1U2YA 4JRXD 1FCGA 4RSVA 3LB6C 1KJ3H 1A7OH 2GTQA 1RUPH 3D69A 4K55A 4P3DB 1SY6H 5MP6H 5ACMA 2WXFA 4IDJH 5IHZA 1NCAH 1IC1A 1GGUA 3C12A 5CSBA 3VDAA 2C9QA 3RTQB 1AS8A 5BZDA 3B1TA 4KAQL 3X1NA 2AQ1A 4G42A 3JUZA 3K6IA 1SNRA 2ERJC 3NZSA 4LF3A 3U7WL 3JWNE 1ZA3A 4NUJB 2DI9A 1TVHA 5FM8A 4YXKL 1KJVB 4DOHB 2ADFH 2WIIB 4KKPA 4P2QA 5CZVH 5IB2B 1FPTL 3IB4A 2TAAA 3VXME 2AQQA 3WNIA 1BM3L 5IQOA 4K7PL 1I7RB 3ZU8A 3REVA 3BP4B 4OZHA 3W82A 1AO7D 2NY1B 3C08L 4TQHA 1JWSB 1J0IA 4HKJB 2YXWA 1AXTH 2BNUA 1AKPA 5KS9A 1KPRB 2D7TL 5I8KL 3VD3A 1UCTA 4GQZA 3IJEB 3MLRH 4NPYB 2VAAA 3S88L 1I85C 3ORJA 4AKOA 2OXHB 2FT8A 3MGOB 1VFBB 1X4XA 3MREB 4LU5L 2CIKB 4AYEC 4N9GA 4MQXC 5C3TA 3MA7B 1X9LA 1T22B 2J12B 2J1KA 1ZHKA 3EYUH 2W88A 5ANMB 4ZS6C 1W16A 1P7QD 4CMMB 4H8WL 5E08L 1T21A 5ISZB 1K6QH 3LNHA 3V52H 3TOPA 4KTDL 1CJYA 3C8KA 5DVOA 5ILTH 2OMXA 4TUOB 5HPMA 3JTBA 4LVOC 4GXFA 2ZXEB 4NRYA 5B8CA 5E1GA 1S78D 2ISDA 2R2HB 5DRXA 4RNRB 1VZIA 4J8QA 3W0WB 3BAYA 4IBZA 1V3JA 2EVGA 4U4BA 3BAIA 1I1YA 4DOHE 3HUJE 1EXGA 3EGSA 2E9JA 3LZFH 1CI3M 2EIJB 2OMYA 2XXMB 1OZTG 5BCAA 3D9AH 2XBZA 1XEDA 2AJ3A 4L3EE 2H6UA 1L6XA 2A4CA 2XZCH 1EO8L 4FNLL 1XGPB 4PRNB 2PCPA 3K8KA 4ZUVB 1HYSD 3KPRB 5FM5O 4KJPC 5F7UA 3N5AA 2N1KA 2KQMA 1DBKL 1DVTA 4YPJA 2R1YB 5I6LA 5EOQH 5J8OA 3OC8A 5I1HH 1NAKH 2Y6SD 3CZGA 4UQ9A 2BVPB 4ELMB 4CSTA 1BBDH 1LGVA 1XF3A 1SEBA 1S8DB 5EU5B 4ZSOE 2J1WA 3W39B 5KBKA 3OR6A 3VFPA 4OD3H 1WD8A 2VDNH 2VXQL 3TA3C 4NWTH 2NY4D 3BWZA 4FQXB 2Q9OA 4HP5A 2DWDB 1J1OL 1FGNH 4FKEA 3NH7H 5IHBA 3CXHK 1IAKB 4GQPH 4GEJA 1LWJA 2RIKA 5DA0B 1KN2L 4PWIA 1YC7A 1Z9LA 2LLNA 3EGDA 4QHMA 1RZ8A 3ECVA 5AVZB 5ISZE 3LIZL 3DMMA 1P6FA 2ESVD 4LDOB 3CX5J 3UO1H 1WFOA 4MXQC 2HRGA 2DQEL 3EKCA 4NQDE 4WW2C 2E8YA 1JI2A 4XODA 1BBJB 4ZMTA 4M4RA 1FYTD 3JYBA 3LPWA 2ZCLH 5C0ND 4O5LH 4BUHA 2XTJD 3W0WE 3GDBA 2QQKH 3CH1B 3HRZC 2CXGA 3KBHE 1A7PH 3ATDA 5FM4A 1OY3B 4LKXB 3CDZA 3GMLA 4FCHA 4NIYE 3FRUA 3LXUX 1TTUA 2P8PA 4YHZH 4JB9L 2B08A 4N90D 4UT9L 3B9VA 4NWUH 4PJAE 3SDDC 2C26A 2ZP9A 3PWUA 3SBQA 3LD8C 1SJEA 1LK2A 4XCNA 3DIDA 2X2HA 5DHYA 4ELME 2V7HB 3D0LA 5TJWK 1SOQA 1OARH 1N4XH 3I6LD 5KVGH 1HI6B 4FG6D 1HJBC 1GGIL 1FNEA 1DBML 2EEBA 2LLLA 1KCSH 5FYJH 5DHXB 3KZ8A 2DIJA 4KZDH 2GJ6E 2B1HH 4KO6A 3B3BA 4WEMB 4L8BA 4F3FA 4YSEA 5C0FA 2OR9L 4OJCA 4A04A 3SGDI 4N1CA 4H4NA 3OKMB 1S9VB 4G8EB 3TV3L 4JO4H 4OR1A 4GXVL 3IDJB 2IGTA 4OJFH 3RGVA 4OZGF 2VMJA 4KHXH 4W68A 2Z4QB 2YAPA 1XL4A 3VU2A 4AQ1B 4NKOA 3TN0B 1AE6L 3MGTA 5AOKA 3NFNB 3VFWA 4QJ3B 4F7TA 3W38A 2VXSL 1P1VA 2AVFA 1PKOA 1Z5LB 5IHLB 3EO1A 2IH3B 2I7SA 2F68X 3FQTB 1DQDL 1HHJA 2PYEA 4N2LA 2ITDB 2Y36L 3V4UL 3NZUA 1Z2KA 3O9WD 3M07A 1MWAA 4XZUB 1VFAB 4GYBA 2MPVA 5I8EA 3DV6A 1AMXA 5MEOA 3CSPA 4MVBD 4LSRL 1ZV2A 4J12A 4LVNC 4U1HA 3IN2A 5E4EC 3CNKA 4O2FB 4PJAA 2KDGA 3IFPA 4NO3A 1I7UB 1LO2L 1B3JA 4CVXB 1LO3H 2WVVA 3TH3T 1PLBA 3CSYA 1MREH 1OGTB 3EYQC 5L7XH 1BIIB 4XGZB 1EZVY 1D5XA 1ETA1 2YEZA 4AI7A 1IT9H 3L4WA 3C6LD 4UOJA 1N3NB 3S3CB 1MFBH 1HILB 5H37H 5DR5H 2AAAA 4PLJD 4UMGA 1KEML 5K59E 3RBGA 1EAQA 1QFHA 4X5LA 4M7ZC 4RAHA 3FCSB 3F7YB 3IDMB 4QXVA 1DDHA 3CZLA 3GXUB 2G75B 5SWZE 1Q1JL 2AQNA 2DJUA 3MAWA 3ARQA 1A7BA 1G7HA 4I48B 1ML0A 4OLWH 3MRMB 4Y9CA 1U91A 3HKZA 1IE4A 4GAGH 1J1XL 5EU6B 4ZUTA 1DN0A 4NNYB 1B2WL 2P8MA 2YUWA 4FP8H 4N0CC 4PJ6A 5ADOH 5E8OB 1FDLL 4W81A 3L3DB 1B90A 2ATKA 2FYVA 5DQDH 2WZ6A 5I30H 4NQED 5E70A 1CUOA 3P3SA 5AWNL 1K4CB 1LQSR 4PGDB 3CHQA 3VYOA 3MYJA 5C9JA 5LN8A 1YN7B 3OMNB 1JZFA 5K1JA 3QRLA 1E5AA 3WFHA 3QUZB 4OZ4A 3A6CL 5T3XD 3LEYL 4BCZA 1L7IL 2TSBA 4FXTA 4G80B 3RI5F 4ODTL 1INDL 3VSUA 3NSXA 4FFVD 4IIZA 2UUDK 1SFHA 1FJ1B 4I4WA 3ULSB 4R6UA 3EDDA 5TGBA 2YPVL 2F61A 3TVMD 1TLKA 3HPLA 3NFPB 1QQDA 1MHPH 5CBAB 2NY6C 1CGSH 1NBQA 4WLCA 3GRGA 4HJGA 5C8JA 4GG6F 5IOPB 4C8XA 3LZOA 4JFDB 4NZUL 4EPSA 5BXFA 1FIEA 2BVOA 3NBNA 1G7MA 2PPEA 1MQKH 3NQIA 5D2LB 1VRSA 5SX4I 3LRSB 5IEHB 4R96A 2L7QA 4WWNA 3WKNA 2XJLA 2B59A 4K9JA 4B6ZA 5ACLA 4PLKC 4DP4X 4GEIA 1MJ7L 2WNWA 3D09A 3EH3B 3MLZL 1G6VK 3CN4A 3PWPA 4Q2ZA 4TUUA 4OV5A 5JPNB 4JY6B 1ZAGA 4UIKL 2V17L 4TF4A 2HKFH 5D7HA 4H0IA 4OSUH 5BS0D 4M5SA 4P57B 1EEYA 4YXLL 3QQDA 4PJXE 2EACA 2EIZA 2WAQA 3S5YA 5IESL 1KCLA 2IPKB 3FQNA 3POCA 3Q9PA 1I1CA 1HIML 3CTTA 1TJGL 3UACA 1E9QB 3DWTA 4Z7IA 2GAZA 4N2AA 3TTSA 4MMYB 1E43A 5JLZB 4QWWC 1RUAL 2AANA 1YMHA 4Y7OC 1UVQA 2AJYL 2WBKA 2E6PA 2C1OA 5GGRA 4URKA 4EZJA 1HOCB 3G6JF 4F2MA 3VTAA 1ROWA 2E7BA 3HG1D 3FQXA 1VADA 2NQCA 2JIXA 1UM4L 3VWKA 3E8UH 3U6XA 2HG5B 3UIYA 3OZLA 4YSSA 3WIHA 4ZW6A 2W07B 4L1DA 2YC1A 2P24B 5AW4B 3QIWA 3TO4C 3WJLA 5HPOA 3P9MB 2PPCA 3BQVA 3IBEA 1MXDA 5E6ID 3HPJB 3FF7A 3QCVL 4XMWA 2X6UA 1YVLA 1NGQL 4G8IA 5DJCB 3B2XA 4Y1AA 1ED3B 4QRUA 4JJ5A 5KJ7E 5C9KA 1P5VA 1IL1B 1J8RA 2AGJH 2ZOUA 4N8VA 1HWWA 2A6JB 3NCYS 4YBLC 1OAZL 1QSZA 3CDGB 3CHOA 3LQAC 4APQB 3WTXA 3HI5H 3QWRD 1BXVA 1RPKA 3VGAB 2EXWD 5A2LH 1ZA6A 3FB8B 4GO6B 4LP5A 2RMNA 1P2CB 4Q58C 1YEGH 2F53A 5E4IA 1XDTT 3OAUH 4PJXA 1MHEB 2EYSB 4D0DA 1L6ZA 4G8GE 3NJMA 4ZQKA 1KFAL 3ULVF 2J8UB 3ZGHA 2I5YH 1PZ5B 1HAUA 1UOVA 3FT4A 1KG0A 5E8NA 5E8PA 1BQHB 2DF3A 2DYPA 1CFVH 2R4SL 1MIML 3DX1A 3VE0B 3WNMA 1EHKB 4PW4A 4XC1L 2GI0A 1YEKH 1JYWA 1WC7A 1A8JH 2BVUA 4TNWF 4FQIL 1XCQA 4ORGA 3KDMA 4KY1H 2P8LB 1AG0A 3LV3B 4K7FA 3RJQB 5C86A 1J11A 1WZ1L 2IALA 3DGCR 4F92B 5F7EH 5EEXA 3AJ7A 1DLHA 4FQ2H 4BK5A 1KUMA 2V5YA 4H1LB 3NJVA 3RX8A 3F62A 3NIFF 1H3XA 4NN6B 3D25B 4Y2OB 4RZCB 4PV9B 1NDTA 1PG7W 1VEOA 4HS6B 3DX3A 2Z7WA 2YQ3A 2A38A 3NT0A 4XNYL 2C7FA 2IQAA 3PPEA 1Q0EA 2KH2B 1I9IH 4WNQA 5L88H 2XN9A 1KN4L 4IKIA 1LDPH 1KIUB 2ALAA 2C4FU 2QADB 3RB7A 2D7OA 5ABZA 2BRRL 3QG7L 4KQ4L 5KSBA 5EWIH 1N8ZB 5F7DB 5DD3H 2EUWA 4AC4A 4DGVL 2R2EA 4XNZB 5FV2A 2O61B 2XVLA 5D7JD 4AE0A 2J8UE 2PP8A 2YD1A 3OXRA 4ODUB 5DUJA 4WY7L 5AVSB 3DHMA 1X5LA 3TL5A 3MYZA 4XO8A 1FFOA 3F6LA 1S7WB 5JXEC 5L4IA 3QISA 1X5AA 3FH8A 3QWRA 4ZOAA 3ULVH 4G8GA 1BREA 2R0ZL 2FSEA 3V0JA 4U6VL 2ADYA 5I8OL 5AYUH 1NEUA 4GUCA 4XVTL 1WVZA 3AWGA 2MWCA 1XGYL 4PJ7F 1OWRM 2F54E 3SDAC 4P99A 2EDNA 1LD9B 2I24N 5LNEA 2X3CA 3IDXL 1X9UA 2FGZA 4G7VH 4EDXB 4KFZC 3WU1A 5AAWA 3OLIA 4LAQH 4ADJA 5IMLB 1QR1A 4MNHA 4LSPL 1QABA 1OAKL 3TZVC 1TR7A 5H8DA 1OB0A 4NQXB 1HS6A 3ARZA 3P1VA 1WBYB 2AQRA 1A6AB 3TONA 4MDRA 2VN7A 5A2BA 4P3CH 1RZFL 6FABH 5E00A 3P3YA 3FCBA 3BDBA 3A47A 4OAWA 3QO0A 3O6MH 3EIFA 1X6LA 4KAQH 3WNKA 2XY2A 4H1LG 4PLNC 3U7WH 3UZEC 2BOBA 4V1DB 1ONQB 2W0FA 4YXKH 1XF4A 3AACA 2F58L 2CPUA 4BBWA 5AB9A 1FPTH 3OMIB 4BUQA 5SWSE 2DLTA 4MQ7B 4R0LC 5IB1B 1H8OA 4W1TA 1BM3H 4OQTL 3MV8D 4HIPA 4X8GA 4K7PH 4ANUA 1QSED 4JUTA 1F11A 2H4EA 4GQ9H 2EIEA 1SLXA 2F1BA 4ZS7L 4L3AA 1N64L 4TQEL 3PWNA 1J05B 4R7NB 4GRLD 1QPPA 2ADIA 2D7TH 1WWBX 2F5BH 5I8KH 5TQ0L 4N85A 3L9BA 5ECGA 2VRKA 4GKZA 4LLQA 1W0VB 2FAUA 3S88H 3MFFB 5ESQA 5C0GB 1C16A 1AR2A 1NJ9A 1P5UB 2VL5B 3FT2A 3VSVA 2IWFA 3ECUA 3LH2L 1C5BL 2VCOA 4FKKA 5CZXC 4H8WH 5D4JA 5F1NB 5GRWA 5JR1L 5E08H 1BYNA 5EF1A 4NO0A 4S0HA 1WRFA 5I1GL 4UT6L 3T2OA 3MV7B 4BD4A 2YD8A 2BOLA 1T66C 4FD0A 1X7SA 1TPXC 2VDQH 5FWQA 1NQBA 2DWTA 3IGFA 5EO9A 3L1EA 5TDNB 4V1DE 3FPXA 5ETUB 5JIKA 5KN5B 1FO0A 1EJFA 2M2DA 3HR5B 4RMSA 3O3BB 1P7KA 4W4OA 2XPGB 3AMKA 2WLJA 1XF1A 2HX9A 3HZYA 4HEPG 1U8HB 1OGPA 3FH5A 3MRIB 2Q7YB 4NM8L 5E1IA 4ZFFA 5CKGA 4GO9A 1HWGB 3C5XA 3GNML 4MDJB 1AGCB 4O2EA 2XX1A 1JMXA 1NC4A 3SQBB 4AJVA 3QWNA 4OZIA 2AP2A 1U8KA 1PDKA 3QC6X 3NOIA 2LFGA 2B4CL 2L7EA 3Q2WA 3Q6GL 2D0GA 4NZTL 3QBTB 4ZFOA 2LVEA 3FW6A 2BMKA 1MFNA 4R4BB 1BD2A 5FKAB 5TQ2L 3RPIB 3NDZE 1J1OH 4CMHB 3RWGB 1FWXA 4I2XE 4EBQH 1HXYA 1ZK9A 1JK8B 1KN2H 3LIZH 1NCJA 4WSJA 2X9XA 1MIEL 2ZNXA 2DQEH 2DEWX 3AG4B 3NCYP 2P5EA 4GW4B 4HWZA 3UPRA 3D2UA 4K3HA 1M2VB 1H6TA 3F65A 2PW1B 3EFOB 4K94C 3OF6A 3BCDA 5DURD 1INEH 5MERB 4Z7NF 1BYPA 2VISA 1XIWC 1PLGL 1KIRB 5J3HC 1K5WA 1A5FL 2BERA 1N0XL 1F97A 2CJUH 2ZICA 1W80A 3CVCA 2GUOA 3NIGE 4OCXL 3CBJB 3PDOB 4OM1L 1MFEL 4JB9H 2OLDA 3SCMD 4AITA 4UT9H 2H26B 5E0FA 3NMEA 5IEKA 4DZ8B 4JN2B 2EC8A 2A6DA 1USZA 2O6CA 4P23D 1Q9WA 1T0MA 1IAIL 3PWVB 3O8XA 1JNHA 1KULA 2KPNA 4GAYB 4PJEA 3X12B 3RTQC 2BP5M 4DP2X 1JXFA 2R2BA 2QT6A 4J39A 2A73A 4PS3A 1QBBA 2EDBA 2V7NA 3FQYA 3RVXD 2ZXDA 4BWUA 2R56L 3S6CA 1HHHB 2OR9H 4J4PD 1RZJL 3QJHB 4I18A 1MCHA 4E9VA 4UINL 3IPFA 1KELH 2KS0A 4FADA 4PMEA 2I60H 3TV3H 4DCQB 3QZBA 4JS7A 2NY1C 4I2XA 4OM0L 5BUGA 2NNXA 4AYFB 2X0VA 4UQCA 4H8WC 3VVWA 2WY3B 3B9AA 2GBAA 3STZA 5KVEE 5LVEA 3T6WA 2FO8A 4ZNEE 3HS0B 2AI0H 2NDGA 15C8H 3O0RL 3O6FC 2VXSH 3DUUB 4ZPTB 3FQWB 2XZAH 3GSXA 3BZFB 5DK3A 1MJUL 2X7LB 4M6OL 5HHVL 2D3NA 2DYSB 1X5GA 1DQDH 1CTOA 4IW4C 4M6ML 1IBDA 3AG1B 5LNDA 1MCPL 2Y36H 3V4UH 1KPVA 2JNZA 1YEIL 2KPWA 4ZTEA 2JJVA 4ELKA 2WXMA 3UYOD 3V5DB 5C0AB 3UTSB 4IOSD 4LSRH 2N1TE 4MJ6A 5J12B 3CZUB 4JFED 4UM9D 5KYUA 3FXIC 3D0AA 5C6TL 1ZS8B 1SLWA 3VFNA 3P4OB 5GGUB 5IT2L 1MAMH 4CU6A 1BZQK 5AVXB 2BW4A 4G1EA 1R47A 1UWXK 3C60A 1BAFL 1KIPA 2O93L 2QQLL 3VI3A 2YD4A 4M3JA 2YD0A 1ROCA 2ZX5A 3KCWA 1V7ML 3SCMA 1J5OL 4LQ1A 4N2HA 2Z64C 3GMPA 1XH2A 4GMSL 4OW6A 2Q3ZA 2HVKA 3V4PH 2WXGA 5F7WC 5DMYA 5EOCL 3RHWK 4N8UA 3F6IA 2JQZA 3T4YB 1UWFA 1BFSA 2CBOA 2X70A 3BFWA 4XP6L 4KJQC 2P5WB 3LS5H 3N06B 4JHAL 4FULA 4XOEA 2ICWB 4Z0BH 4PP1D 4G43A 2VLLB 4HFUL 1U8MB 2X42A 3QIUA 3FTYA 3JTSB 3LS4H 4Q89A 3WIAA 4PG2C 1CFNA 3Q7JA 3GMRB 3K80A 5DFWH 1PD1A 3CUPA 3ZDXB 3R19A 2AF2A 4FQXC 2RBLA 4NRZB 2CK0H 3VD1A 4PJIB 4JQIH 5I82A 3O81A 1CBVL 2F2HA 3DTUB 1BYOA 3PREA 4N2MA 1J1XH 2DQUL 3SEPA 1QHOA 3QFJD 1N59A 3VXSB 1BXAA 1EZLA 5C0AE 3RU8H 1B2WH 3O3EB 4I0PD 1G84A 4JGJA 1KGYE 3GXMA 5C0CD 2WV3A 4FLHA 1ND0A 2OMUB 2IC2A 5AWNH 4P5TD 4F20A 3H2QA 3KXFB 4FNQA 1UD5A 1KGUA 4MB4A 4PJHB 1H5BA 4UWQB 4WWKD 4OLVH 1BOYA 2NY5C 1DUYB 1INDH 3AWFA 1JHKH 3V4VH 2FH6A 3NJFA 3VCLA 2PUQT 4JFOA 2CKBH 1EANA 3VJ6A 2Y2YA 1XZ0B 4JQVA 5D7SL 1KACB 3OZKA 4IRJA 2ZUQB 2P5WE 1YMMD 3HCVB 4RBPK 3VI4B 3L08A 5CILL 2XWJB 2Y22A 2ZNWA 3REWA 3UTZB 1KF9B 2CO4A 3D0VB 4L29A 1CN4A 1JK9B 1QBMH 3ZDXE 4LCUB 4YOKA 5D2NB 1NIDA 5I1EL 4RRPA 4XOBA 4KMQA 2EIDA 4OVUA 4PJIE 3SKNB 2N0KA 4TQ8A 2YAOA 1E7UA 4HHGA 3VXSE 2V17H 1FNFA 3ME0B 1G7PA 3GKWH 4P9HL 3RG1C 5EIIB 2Y72A 3BGFB 1T0OA 1F6LL 1RZ7L 2FUQA 1AQ8A 4PU2A 35C8L 1I1AD 1QP1A 4IQHA 4PRPB 2HKHH 5IESH 3FO0L 1DLFL 1NM9A 3J2PA 1MUJB 4HPHA 3BGAA 4AQ1C 2ZCZA 3L3IA 3KXFE 3TN0C 3QDGA 3AQYA 5FYKH 1J5HA 1AZUA 3EFDL 2BSBA 1FYHB 3G9AB 3MRLB 2G0LA 2BWQA 2OJZL 3DROA 3T6QC 4YDKL 1RUAH 1J1PL 2IDQA 2W9EL 4K8RL 2A3TA 4K7PX 3G5YA 1HQ4A 4TTDD 4AXWB 4MAYA 4UZSA 1H6FA 2AJYH 1O6TA 3FQRB 3FHQA 3RFRA 2UX6A 3G5XB 4UDTA 3AREB 5D4QA 2XETA 3MJGX 1FNGA 2ED8A 3W9DA 2AAVA 3PDDA 2IBZY 1W0YT 4Y4FD 5D6CA 4WEEA 3C09B 1UM5H 5F9WB 1H8LA 4G8FB 5D2NE 4WWKA 5FO7B 4XVSH 2E9IA 2DD8H 1A8ZA 1NGQH 2AITA 2OK0L 4LSDA 4M7KL 1BAGA 5I0YA 3ZJAA 3ECBA 2VLJD 2G2NA 3GPSA 3WDIA 1KNOB 2P7TA 1I8KA 3RFZA 4BXSV 1X5IA 4I3RL 5C2BL 2X9ZA 3QEQD 4JZJB 4ODWA 1XAKA 1OAZH 5BRZD 2KZWA 4UCFA 4D9RE 1OTUC 1M6UA 3HMXH 2B15A 2YAEA 2EDFA 3CZFA 4A66A 4HXBL 4PTTB 4N2NA 4Z77A 4LLYA 1KXVC 3RIFF 1LEIA 4AJ0A 2IIJA 3RJDA 1TKWA 2YEQA 5FYLD 1GMEA 5I5RA 2NZ9C 1MH5B 5E7BA 2XQYG 1UADC 5I1CL 3FTGA 3BVWA 1J0ZA 1MFDL 4NJAL 2FHCA 4PB0H 5DS8A 1FVEB 2WC7A 4HALA 1L3WA 3ZDZE 5FGBC 2DQDL 5EIIG 3CD4A 5KYYB 2E6JA 2RCSL 4TRPL 1J86A 1I8IA 5E0QA 5JIDA 1BM7A 2NNCA 2WNXA 5HYQA 4LOFA 4XXWA 2PF6A 1UYWL 1WSST 2A4ZA 3UTOA 3O4LE 8CGTA 1JZ3A 4QRFA 3RVWC 4E9WA 1GJWA 4HUCA 1MIMH 4QTHA 3KYMA 3TU6A 4KWUA 1ZGLP 2NRDA 4XC1H 4ENEC 3FAXA 1XSJA 5D7KD 1DBAH 3MX0A 1BGXH 4OFPA 4IGBB 1WZ1H 1U8PA 5GRJH 2YHGA 1ID2A 2FX8H 3L16A 2HAZA 3CHXA 2G3ZA 3PAZA 3VTMA 1WUNT 4MFHA 1I8MB 2FO4B 5I16B 3IFLL 3N1QC 2JCCB 4MWFA 1A9EB 3L1FA 4H25B 1FVDA 1J7VR 4NC0B 5CS7A 3P77A 5D8JL 5FO8B 3LRHA 3NABL 3U2IA 4Y4FA 3FB6B 1CFQB 2H3NA 4QRTA 4YSAA 1D5MA 2ENQA 4AGQA 1CDIA 4KKNA 4KUZL 4X6FA 4JM4L 3BESR 2H32B 5I8CA 4JFFE 5G4NA 1R3LB 2HTKC 4KJWD 3VH8B 4ZW8A 1AY1L 2BRRH 3QG7H 4N25A 2PXYA 3X14B 4H1LH 4O51B 2BXZA 3TO2B 4DGVH 5AW9B 3UTQB 4UTAA 1CT8B 2XXGA 1KSRA 4HGWB 3VD5A 1PCSA 2F74A 3VG0H 4MCNA 2WK2A 1E65A 4WY7H 1WS7A 4RISL 1JPTL 4EIBA 5JPNC 3VNZA 5ITFA 4YR6B 4YXHH 3CVHB 3B2UC 5IVXB 1OF0A 3IDNA 2JK5A 2R0ZH 4BZYA 1K4DA 2I07A 1MNUL 2W91A 1EEZA 5I8OH 5CEZD 2Y23A 4XVTH 4U3SA 5D7IB 1J9CT 1HHIA 3RTLA 1KB5B 4MA7L 2ZKYA 4HIXH 2JKIS 3BEWA 3QA3A 3O4LA 3RWJA 4B9GA 5B39B 3ZKXB 1Q72H 2X44D 1HDMA 3QDAA 4MMXA 1OD9A 2GJRA 2XCMC 4Y8DC 1R9FA 3SJVD 1H3WM 3CVHL 3HW7A 2JCCE 3Q3GA 3V6FB 3UBFA 5G5DB 3T0EA 3BP7A 3PABB 4UTBL 1KXTA 1BX2A 4PREB 1ZHLB 2NW3A 5HY9B 4EUPG 4URTB 2JXMA 2ZSWB 4LRNL 1KLGB 1J8HA 1RZFH 4NSKB 1KB5L 4NBZB 5JOPD 4KUCD 5T5NF 3U2SA 2X2YA 2A0LD 3DIFA 3SHSA 4XCEA 3ARGB 3T2PA 2KBGA 4N2CA 1IGCL 2IFFH 1UXWA 3AVEA 1WT5A 2C9PA 1QW8A 5HSFA 2YJLA 1EZVX 2CO1A 3CC5A 5FGCB 5L2KA 3ENEA 4PRDB 4S1SH 2DB8A 4PJGE 3SDXB 3PYCA 3OAZK 4JFYA 3MRBB 3MCLL 3WNNA 3TPKA 5BV7B 2Z93B 4X6DA 4BQCA 5IBTL 3ETBF 3GMMA 1KJMA 4ODVL 2X4SB 3VGFA 4YX2L 5IVXE 2PO6A 2X1OA 1DQLL 1ODAA 4G5AA 1UM6H 3L3GB 4UDUA 1N64H 2Q1EA 2UZYA 1K9TA 4APQC 2WMPA 1LHZA 2XN0A 1GZQA 1TENA 2VKWA 2MHAB 3VGAC 1H15B 4L9LA 1F90L 3PNRB 5I73B 1K2DB 1K72A 4AEIH 4DN4H 2DW5A 3G04B 3BZDA 3FU0A 3I9AA 4XN9A 3S4SB 2IADA 5LAXA 2GIXA 3GSWB 2J7LA 3A6BH 4GRMB 5IK3B 2WYHA 1TZIA 1IIIA 2VLRD 1GOHA 1XF5B 5E94A 1C5BH 1O7SA 4CGUB 4PRHB 1TU2B 3DX6B 4MJ4A 1HH9B 2YPLB 1MLBA 1OSZB 5I1GH 3BE1L 3BH9B 4UU9B 1NWOA 2Y5TB 3HI1A 4FOMA 1MLCA 1CD9B 3AADB 3PHAA 3CVIL 2NT1A 4YHYB 4L4TD 3TBVB 4ETQA 5CJXA 2G60L 5FGCE 5IHZB 5FYJU 2IAMA 1F4WL 3SJVA 3U2JA 4OBSA 3SDXE 3D50A 2WSPA 1NFDB 4P9MH 4XPGL 2LGNA 3TBTB 4U1IA 4LF3B 3U9WA 3QCUH 3S98A 5HYIA 1ZA3B 4JL2A 4NM8H 4X4ME 5CUSL 4P2QB 3UAFA 4NN6C 3HE6A 1YEHL 3N1FC 4YZWA 1YEEH 4HIJA 3BEVA 4ZMZA 1IEBA 2VLKD 4ZUSA 4PVBA 4KTYA 1WAAA 3BAWA 1NBZA 5AG8A 4DP1X 5D1QA 5HHPA 3UTTD 1H6UA 1FNHA 1N6VA 4G6MH 4OZHB 5D7EA 2FEDD 4C83A 3I6KA 4PM1A 3Q6GH 1FQ9C 1XEUA 2VLMD 2WB7A 4NZTH 1U8CB 1HZHL 5L0QC 5DO2D 5IG7A 2C7UA 3Q8CA 5KS9B 4Y5YC 2QADC 4K5MA 1J5CA 2IAAC 1S3KL 2XUWA 3NVQA 3ISRA 5F6HJ 3PRZA 3HHMA 4XNZC 4LOUD 2JKLA 4PRHE 4RGND 4G71B 3KL3A 3QDJD 1S6NA 1AOZA 2YPLE 1G43A 4N9GB 4AV0A 3U46A 1UUSA 2F1EA 2C5DC 1PY9A 3GSVA 1ZHKB 4KK5D 1Z5YD 2CZNA 4HS3B 4P2OB 3C8KB 3DX9B 2CMRL 4M8QB 2OMXB 3L5XH 3QR0A 2JJTA 3E6FA 4HJIA 4G9FD 4I1RA 3UIZA 1BXUA 1A5FH 2WXHA 1N0XH 4TVPE 5C09D 4Z7AA 4OCXH 2XHNA 3WSQH 4KI5D 4U33A 3NJGA 5IFHL 1S3RA 3BLKA 4MJIE 4OM1H 4UZGA 1I1YB 2VDKH 3U7YH 3EGSB 1JE6A 4LQFL 2G2RA 2ZYSA 1QEXA 1O7VA 3DUSA 1AACA 1AZNA 1OAXH 2Z9TA 5HDBB 4WV1B 2PCPB 2JVUA 3BQUA 5AAMC 1IAIH 2EO1A 3QRBA 4X6EA 4MS6A 3F7VB 2PPDA 3SYCA 3U9UA 1UZ8B 4OFVA 5FKPA 4X4KA 1EERB 3GRWL 3QH3B 2WSKA 5ALCL 1CLYH 4OJEH 3FFCD 3LRMA 5ALBH 1B2YA 2WJ7A 2FATL 3GLDA 1O6VA 5F7KC 4Y9FA 5K39B 1SN2A 1KYUA 1EUTA 1LXMA 4UINH 4XMLL 3ATBA 3RL2B 3U1SL 1N0LB 1KV3A 4NUMA 3QUXA 3C2AL 4P2RD 1RUQH 5GRUL 3VQLA 3G6AA 4Z7VF 1Q0XH 2K45A 5CP7A 3NTCL 3BT2L 4M9PA 5C0RL 4FNUA 4PWEA 4FTVD 5TTRA 1QAWA 1VHPA 1SDDB 4KTGA 4UIMA 1MJUH 4M6OH 1OW0A 3KJ4C 1SM3L 5HHVH 1AZRA 3SPGA 1P5UC 1P9MA 4HMCA 1W2KT 2HB0A 3CDZB 1MCPH 3HI6H 3THMH 3ARFA 4D9LH 3GMLB 5ICYB 2CDFA 4LXFA 1A1OA 1WFJA 3VRLE 3FRUB 1SLUA 3PLYA 5HDBE 1NIFA 2MKLC 2P8PB 2N7BA 4JRXE 1T3FB 4MJHA 2X4PA 4EZKA 5IKCB 3PWUB 1Y6MR 2HFFA 1YDPB 2UYLA 1LK2B 1H9DA 5C6TH 3OX8A 5EEYA 3ZE1E 1S5IH 3MN8A 1JTTA 1OWWA 4X0KB 1WHPA 3D0LB 5IT2H 2Y3AA 4HH9A 2HJKA 1DEEA 2HFTA 1BAFH 2P43B 3WD5L 1NBYB 4XHQA 3D4ZA 3ZO9A 2QHRL 2B4CC 3FHAA 5DD6B 1AD9A 1FNEB 3WEOA 1WFUA 5IBLD 1GY1A 3IWVA 1BMWA 3WXVL 2KLSA 3O2DL 4XN8A 3MBWA 3JWNG 4NN7B 3WFEH 4MXVE 1IRAY 5EOCH 2ZWSA 1UC6A 4XN2A 4L8BB 1WCBA 2UWEE 3LN4A 3NCWA 5I76B 5CSZB 1FUNA 1AO7E 4XP6H 4BFIA 3FONA 1KYOJ 4JHAH 4OF6A 3LKSA 5IM7A 1J18A 1G7IB 1PMYA 2WNKA 2C3GA 4LLMB 5EOCJ 4HFUH 3FN0L 3GSOB 2JE8A 4OD2A 4WW1B 5CSGA 1KIQB 1T2JA 3QJXA 3KPNA 3Q1SL 4NKOB 4UI2A 2Q3AA 3NEEA 5G4OA 1TQSA 2EXYC 1TQUA 4AH2A 1D9KD 2XWBA 5HGDA 4CMHC 4F7TB 2VQ4A 5EBWB 1CMOA 1JVKA 3OPZL 3BAKA 4HKBA 1IFRA 3EO1B 3WXWL 3IFNL 1U3HD 4ZMNA 1I9EA 1UZ6F 2PYEB 5SV4A 4FXKA 4YN3A 2ESVB 2H45A 2H2SC 4WI6A 4NDMA 4NP4H 1IBZA 3F7QA 3CXFA 1PQZA 1CO1A 3C5ZA 3RGHA 4CDGC 1FYTB 3T77A 2R9HC 3VMPA 4HF5H 2XTJB 2EINB 3TT1H 2BP8B 1WE5A 4L2YA 2BVYA 5TK2A 2ICWJ 6PCYA 5HHOA 2IQ9L 3QUHA 4JKMA 1G7LB 2OTWA 2X1QA 4I0KA 5BJTA 3VNYA 5IGXL 1XGRB 3BDYH 4FQJH 3CSYB 3CU1A 3KYOA 1X5JA 1R6VA 3T65A 1MCLA 2YEZB 3H8NA 3T5WA 4IBVA 1RZJC 4GW5B 1NCBL 1QEWA 1TEFA 3QUGA 2O5XH 1YNKL 3B83A 5BQ7B 2V0AA 4JDVA 4ZDHB 3D3VA 4DO6A 4F8QA 3EJTA 4KNSA 1LWRA 4S1DD 1J8KA 4IEFA 3AXHA 5KTEH 3BVUA 3QQNA 4OH2A 3ZDYE 5I1EH 1A3RL 1BVLB 2BP3A 3GLZA 2PTUA 3KD4A 4AQAA 2WXPA 5IJVA 1ZSDA 5IHUL 3QIBC 3L13A 4I77H 4ZT1A 4JDTH 1SYVA 3PG2A 1CE6A 5FGSA 2X09A 1I9RH 2VO8A 2DL9A 4PJCE 1G7HB 1TCRA 1CXFA 1FHNA 3NUKA 4P9HH 1FZOA 3BO8A 4YHOH 4A6YA 2ESVE 3DOSB 1U91B 3WN6A 3QULB 3S2AA 2QQNH 5L6YL 3R18A 1PCXA 4OTXL 2AEOA 3VB9A 1DN0B 1FYTE 2F8VA 5H35A 3VGBA 1PBYA 1F42A 3Q2CA 2XTJE 5AL8A 2GSIA 1K8IA 4ICWA 3MLYL 3DOIA 3HS0C 3T8VA 1MHCA 1XFPA 2OJZH 4UOZA 2EE0A 1PFOA 2VQUA 4YDKH 3F5WA 5LGHL 4IYKA 1J1PH 3IKKA 4K8RH 5GGTH 2P28B 2SODB 2Y7QA 2OL3B 5I23A 4IS6B 4TSBH 1Z0MA 4N90E 3LAFA 4WNJA 3MJ9H 2A4EA 2P80D 4LO9A 3EO0B 4TMPA 2D7NA 4P2AA 4CL7A 1E9PA 4I88A 5HJ3A 1NPUA 3I6LE 1QQDB 4J3OH 3KLKA 5DMGD 5J12C 1HXKA 4KKAC 1I3RB 3UG5A 4FCAA 5DJ8B 4L5FL 4PWKA 4HJGB 4X7CC 1AS7A 2XY1A 2OL3L 3VXTB 3OAZH 4OB5L 1SDYA 3QAQA 3WE1A 2R8SH 1NANI 4R96B 3EYOB 2VITA 2I9TB 3UDWA 4J3WA 4I3RH 5C2BH 2D9QB 3ATFA 1L0PA 4XBPA 4HFWB 4OV5B 4Z7UF 3C6LB 2AV1A 4OF3A 1H3UA 1P4LB 4Z7WF 2V2TA 1IMHC 1ET7A 3KW7A 1GOGA 4F9PA 4EI6B 4JO8A 1ZPUA 2K3TA 3L1OL 2EIZB 1ZLDA 2AC0A 3EYVA 4MD4A 1XH0A 5I1CH 4L5FE 5GRZA 5DYOB 4DNLA 2DQDH 4H40A 2HJLB 4PEEA 4HBQA 1T4KA 1EPFA 2OJEA 1IAOA 2GAZB 1CF1A 3B5HA 3BKYL 5E6RB 1S9XB 1R3JB 5EUOE 2DN7A 3ARDD 1GZHC 3GSQA 1VFOA 4QHLA 1HKLL