3J07A

Model of a 24mer alphab-crystallin multimer
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
175
structure length
175
Chain Sequence
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Alpha-crystallin B chain
publication title N-terminal domain of {alpha}B-crystallin provides a conformational switch for multimerization and structural heterogeneity.
pubmed doi rcsb
source organism Homo sapiens
total genus 20
structure length 175
sequence length 175
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V, W, X
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
A PF00525 Crystallin Alpha crystallin A chain, N terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3j07A01
2KLRA 2O30A 3AACA 1X5MA 3N3EA 3Q9PA 3VQLA 2CR0A 1WH0A 2MNWA 2N3JA 2WJ7A 4FEIA 4I88A 4YDZA 3L1FA 4YLCA 4M5TA 3W1ZA 2WJ5A 3QORB 4M5SA 2K8QA 4JUSA 5LUMA 1SHSA 2BOLA 2Y1ZA 3GLAA 2Y1YA 3GT6A 4PBDA 2KMWA 1EJFA 4JUTA 5DS1A 4ELDA 3AABA 2JKIS 2RH0A 3L1GA 3L1EA 2Y22A 3QORA 3QORC 2XCMC 4PCKA 1WFIA 3IGFA 2N0KA 3J07A 3GUFA 4RZKA 4MJHA 4YL9A 5DS2A 3QORD 3VQMA 2CG9X 4YE0A 4ZJ9A 1RL1A 3EUDA 4YLBA 3Q9QA 1GMEA 1WGVA
chains in the Genus database with same CATH superfamily
3JWNC 2JJVA 1L9RA 5IK3B 5IUSA 5HGAB 5TE4L 5I1KL 2OXGA 1SUHA 5SWQA 2VLRA 2VR4A 3INUH 4N87A 2IDQA 3CLEL 1J18A 5EUOF 5FFGA 2I9LB 2VN5A 4TSBH 4JFWA 4JVUA 2AI0H 1BJ1J 1H0DB 2CLVB 4JDZB 4XO8A 4ENED 4W6YB 1E28B 4BE5A 3K6OA 1BJ1H 2FD6H 2ARWA 2AK4D 2R1XB 2ZWLT 2MOGA 2BXZA 2MKWA 4UAOC 3QH3B 4IHBA 3PWVA 3KLHD 1UXLA 4ZD3H 4WGKA 4J8RB 4KJQC 3L95B 1INQA 2XN9B 4QDGA 1NGQH 4W9IC 2XXGA 4P49A 1Q9KB 5CZXC 3DO7B 2EXTA 5D5MB 5EC1A 2JFCA 4W81A 1C1EL 3IDXL 3WKML 2VUKA 1QLFB 1QUNB 2HPOA 3BZ5A 3E7JA 4ZX5A 1VRSA 2ADJA 3MV8B 3EO0A 1LO3L 1DQVA 4JX0A 4PTTB 1EUTA 1RIUL 4TVPH 1OSZA 1SXZA 2JB6A 3HMXL 3LPGA 4YBLB 1WS8A 3VU1A 3DURA 4K7PH 1O7SA 2A74A 4ERSH 1GY2A 1HILB 2X9YA 1TVHA 4PJCF 1PSKL 1QFWI 12E8L 2IBZY 3NAAH 4WWKA 5D4IA 1ETZB 3B2MA 4O9HL 5KZCB 4GBXB 3QRGH 2H32B 4I89A 1KIQB 3ARBA 5EOCJ 1NBQA 5BXFB 4DQAA 4LP5A 4OIIH 4KZEH 4WJG3 1E4JA 1QLFA 4ZSOB 4Q6KA 5EOCH 3DETD 3VFPB 2F58L 3JT0A 5DUMH 5A7BA 3UTZA 3DV6B 4R26H 2G0LA 4GRWE 4PTTA 2CR0A 5DJZB 2BIIA 3COOA 3MLXL 4N1EA 5HDBF 3H56A 3ZDXE 5BZWA 4LBEB 5ERWA 1B0IA 4Y4HC 4MDRA 2W9LA 5E6IC 3MBEB 5FDWB 1CT8A 3L1EA 4WEBL 3QPXL 4XH2A 4X7SL 4YFLF 3AY4C 3VFNB 4JPQA 2QZQA 3GHEL 3HN5A 4M93C 2H32A 3UOAB 3UYPB 4DGVL 3CFKB 4XN4A 4XN1A 4UIMA 1R3LB 4OZIF 1IGCL 3VWJB 4CJ0A 2GEQA 3U4BH 3TC9A 4BKSC 1NBYB 4EI5D 3CDZB 1MCHA 3D34A 4XNXH 1BD2D 4LCYA 3FB7A 3QI9B 5C0CD 1F02I 1OANA 5JOEA 3EH2A 2M8XA 3FMGH 3IS1X 4K55A 3T77B 1I7TB 1WV7T 2Z4QA 4HLZG 3M46A 4G7VH 3RA7L 1KTCA 1YHPA 2COQA 2PWDA 1KB5H 2OV0A 3P73A 3TEYA 3MBEA 1AR2A 5E8DL 5FDWA 1TJGH 3KWWB 4JG0H 4M6MH 3IMRA 4WFGD 4N20A 4O02A 1T03L 4G3YL 3VFNA 5IVXE 5EUOB 1FHNA 4RGNE 2YBGA 3CFKA 3VH8B 3TYFB 4XR8C 2H7WA 3KPMB 1LE9A 3VWJA 1O7DC 1SY6L 1YYLL 5LN4A 4AUJA 5LKNA 2Z8SA 1IL1A 1NBYA 3CDZA 5IT2L 5H8DA 1EHXA 2B77A 5E03A 5C0FB 6CGTA 1B9KA 3QQXA 3DPDA 3P77B 4NO2B 1FA4A 1DLHA 3QAQA 2R69L 2EDQA 2XWDA 4HXBH 4QRFA 5LLIC 1KXHA 3BP4B 5E94B 3AC0A 5FYJD 5AVRB 3QA3B 4Z3EA 5JXAH 2GIXA 1VGEL 2VZ3A 4V33A 3UTTB 3WXVH 4RLDA 2WIMA 4MCZB 2ESVD 1AS6A 2CHWA 2P48B 4TLTA 4F58L 4ZMQA 3P4OA 2K78A 5KVFH 3O41A 4KOBA 2DQGL 1BIIB 4Q9BA 4GP8B 1NANH 4HWBL 4KKAC 5HI4C 1G1YA 3F8UB 2NY6D 3AGVA 2VLRD 2BP5M 2GG1A 4WHTA 4UINH 3LHPL 2ETWA 3PY9A 1T2XA 1ET7A 1NFIA 2WVVB 4HQQH 4LSQL 2W0PA 1ZXQA 1I1RA 1TYEB 4X6EB 1I9JL 1VLXA 3EYFB 5C0FA 3MN8A 4ELKA 3P77A 4OCXH 3WO3B 4PJCB 1CWVA 1S6NA 5HYQA 1W0YT 4HEPG 3DRTA 3FTWA 4YUEH 1KDIA 3L2MA 3U9PH 5KBPA 3A4FA 2HN7A 3FQWB 4AQ8A 4FD0A 3Q05A 1WAAA 1SHSA 1F97A 2V7NB 2HT4D 3AWFA 1OAUL 3RG1C 1SHMA 1P4LB 4R2GB 1MAMH 3B2UD 3WKNA 4U1HB 4D9LL 2MQGA 5TH2B 3MV9B 4IRJC 4ZUSA 1DBBL 2E7MA 2FJHB 3S3BB 2W9DL 4J2QA 2R23B 3KYKL 5IJKC 3FTZA 2XKNB 1MRDH 3ABKB 3CFIC 3OJMB 3H55A 4NPKA 4FP8H 1M6UA 1K6QH 1FZKA 3OSKA 4NO0A 5C0GA 2FJGB 4X6EA 4B50A 3BT0A 3EYFA 5FYLD 3FFCB 3WEMA 3FQTB 2I07B 4M1DL 2EYTB 1F4WL 3EH1A 2QKIA 4Y2NA 2XA3A 2AXFB 3EJSA 3JTTB 2FR4B 4FTVE 1ZY9A 3GZQA 4JFEA 4U31A 1DP0A 2DZEA 4WWKD 2ODHA 3B9VA 3HG5A 5CSGA 3Q2CA 5I6XC 2XN9D 4OZIB 3AXHA 3FO9B 1KYFA 3B2XA 4PW9A 5ABZA 1EX0A 3C2AH 1DJYA 4M7KH 2VJXA 3NH7H 1QYGL 4NBYB 3CVDA 3RVTC 1CFNB 2X2HA 5FYKD 3J8F7 4FFZH 3UGEA 3VXMB 2UZXA 2E0PA 5IQLA 1MCCA 2A5UA 2PPFA 2FHBA 1YC7A 2FJFB 2Q1EA 3ULUE 4GQZA 1RCYA 2WCPA 3E6FB 3GF8A 1Y18B 1KC5L 2FJGA 2BY0A 4YXLL 4KJYB 2BOLA 4DP7X 3EGSA 3ESUF 1F4YH 2X1OA 1BBDH 5ICXB 4JW3A 3VXPA 4XO3A 2Y24A 1WZMA 2HTLC 3L2NA 3JTTA 3AB0C 2FR4A 5AVUB 4A7UA 3QCTH 3L9RB 5DZOA 1DQLL 2DB8A 4AL8H 4HS3B 5KZCD 4GBXD 2F08A 3CN0A 3TX4A 2C8NA 3MUUA 4Y9FA 4MNQE 3HI5L 4LPYA 3G04B 5TDNB 2MQ3A 4G9FA 4EZLA 1KB5A 3AZUA 3VRLE 1ICTA 4K5OA 3K6SB 1KXTB 2W07A 3CVIH 3EGXA 1JZFA 2BNRE 5TDOB 3C5ZB 1NMCC 4KJYA 1YEJL 1YYCA 4S1RH 4X0NA 2WW8A 1A3ZA 4A2GA 3WN5B 3IB4A 3BZFB 5AZEL 1KFAL 1RL1A 4DAGL 1AQMA 3WKYA 1G9NH 1T4WA 4NOBA 5G4OA 3MBED 3VQLA 4BSJA 5C0EA 3ATEA 1V05A 5D72L 3RX8A 1MCWW 2R29A 3ZZLA 1T1ZA 2B14A 2UUDK 2N3JA 1D6EB 1GA2A 2DD8L 4N0YH 3ULVF 2WQUA 3QUXB 5LXGH 1ASQA 4HUWB 4MX7A 4PW4A 2KT6A 2Y1ZA 5TDNA 1XSOA 3VWJD 4IHOB 5L6YL 1RULH 3ULVH 3R8QA 4MBRA 2EDYA 4N2LA 3DROA 4AY0A 1KXTA 4WKZB 5FYJL 1CDIA 5EFIA 4J7RA 1G43A 5I26A 4EIGB 3CHOA 4X50A 1KNOA 1ZVSB 1T5WA 1XEUA 2ZKHL 3GHPA 3UPRA 3W82A 4AH2A 1IC1A 1BFVL 4OR1A 3UYRH 2VR3A 2EVGA 5I0DA 4AK2A 4XXCA 3C5JA 3DJSA 1X4XA 4L4VE 4JQXA 4LLMB 2C4FT 3CFDB 4JZJC 4XGZA 1KJ2H 2Z8VC 1FIEA 2XX1A 1D6EA 3VGDA 3IJEB 3WE1A 1A0QL 5EZOL 1UCBL 3II3A 3RHWF 1YMHB 1DBMH 4MFHA 4XC3L 4IBUA 3FTVA 4LSTL 4LDEB 1FF5A 3CDCA 5AWNL 3EH5B 3I9IA 5KYXB 4B95C 4MA1B 2VZ1A 3D4YA 3KGUA 1XIWB 2VIRA 2WNWA 4P46B 1I7UB 4FG6C 2E47A 5D7LB 4MAYC 4F7EA 1G6RH 1NCWL 4X5RA 4X6DF 2XQ0A 4JY4B 1R0AH 3U0TA 2GC7C 3P4LA 4JY5H 2WZ0A 3H3PH 3VFMB 3ZBMA 4HUVA 1COBA 1KG0B 2J1YA 4LLMA 3QQ3A 4JB9L 1KMGA 3MRGB 5IFAL 3EKCA 4U05A 1U6AL 2EDDA 5E4AA 4MLSA 2XTJC 4Q9QL 4MMXB 5FYLL 3S36L 4ORZC 5E7FA 2VDRL 2GJ6B 3VU2A 4Z5RA 3P0VH 3LQAC 4NO0D 4XNUL 3VTTA 3L4XA 4QUOA 2V2XB 5BO1H 2YQ3A 3HZ3A 5HYSG 1XIWA 4IDLA 5EU3A 4G7YL 5HP5A 2I85A 3FU5A 4K23L 5GSRA 4ZMVA 4OD3H 1ZIBA 5FK9A 1O6SA 1WUZA 1YNLL 2V2TB 4JFED 5BNXD 1GGBL 2CO7A 5HHNB 3V6FA 5CEZE 4PJAF 2B4CL 4NQEA 4YDJB 3VFMA 3LKNB 3VD3A 1AHWC 5A2AA 1JXJA 3SDDB 5DHDA 5EZLB 4R2GD 1XCTA 1DO5A 3TURA 4L8SB 3S4SB 4AZUA 5KUKA 4Y19E 4CN4A 1NAKH 1FFNA 1XGTA 4A68A 4ACPA 4CVXB 4P2RE 2A6KA 1JZ4A 1BPLB 4JHWH 5IGXL 3BEWA 1CYWA 3HE6C 4KQ0A 4PIBA 3OB8A 4PJ8B 4R7DA 5DZPA 5E8PB 4BFOA 1CF1A 4HH9A 1P53A 3M8OH 5I8CB 2QQKH 4UMSA 1QWUA 3FFCD 5KUMA 2YUZA 2B1AH 1M3JA 2Y07L 4LRIA 3IJYA 2GIYA 3W39B 4JG1L 4BCXA 5FUOL 4CU7A 4P2CG 1A6ZB 1KACB 2FYVA 1FH5L 1P69B 2ZXEB 1SVZA 3WUWB 2XXCB 4HK3N 5HHNA 5TPWH 4FNSA 4NUMA 4EVNB 5KYWB 1OP5K 1TPXC 2A4CA 2AAAA 4OLUL 5C09E 4G9FD 4GKNB 3S4SA 4QHNA 3V6OE 4GYBA 3KWXA 3QWNA 5GRVL 3UTPE 3UTQA 5T5FL 5D1XC 4UTAH 3L8QA 2WUCH 1V7NL 1U58A 4G6JH 4MZRA 4MJ5B 1KJ2B 5LGJB 5F9DC 3G5WA 2P5EB 4BFJA 1KBGL 2WLHA 3UG3A 5G5DA 3QXVA 2MWCA 4MXQC 1MNNA 4UYPA 3VA6A 3PWPA 3H9HA 1A5FH 3QG7H 1OLLA 1OCOB 3KVQA 3NA9L 5GJSL 3HUJF 3W1ZA 4DFHA 1SDDB 5TDPB 4L2LA 1IT9L 3WDHA 2JH2A 1AO7A 5JDSB 2HVJB 4QXGH 5D9SA 4CC0A 5KYWA 4F9LC 1MCJA 5B8CA 3WFEL 4L48A 1N5YL 5T1DH 3GXPA 1HKFA 1G6RB 3OKNA 4YXHH 1OP9A 3VM7A 2CO2A 3PF2A 2BVTA 5IESH 3U1SH 1CFTB 3V9EA 3FUKA 3INUL 2NQCA 3BPCB 5C0NC 3L17A 4Q8BA 4X6DB 3C5ZD 4AYFA 2IPTH 5IQ7H 2AI0L 2HH0H 5HYJE 4RWHA 1HZHL 2Z93B 3OXSB 4FRWA 4LEOB 4N8VA 5HYFA 3G5XA 2CGZA 4MA7H 1HVXA 1RHFA 3TA3C 4J27A 4GXFA 4Z7UF 4G8GE 5BRPA 2DYPA 5KANI 1SDDA 2E8YA 2R1YA 1MN4A 2JJTA 4OJAA 5TDPA 2ROYA 3L81A 4JO2H 3NZ8B 4LOVA 1G7JB 3FO0L 1F56A 3B2VH 1YA5A 3LPPA 2E86A 4LLWA 1HN1A 1G6RA 5KBKA 3EGDB 1G7PB 4LCVA 2C5DC 1YCSA 3O3DB 3KPLB 2ITDB 4YAQA 2XIDA 3OLDA 4IRSC 3QIUC 4UI2A 5AUMB 2HTKD 2PN5A 4KKLD 3ZQ9A 4EBQH 4PJAB 1RZ8A 3FT2A 1G7MB 2J88H 1N8ZA 4TVPL 4L8BB 4X5WA 5F7KC 3EBGA 3I6KB 1OL0A 3Q6GL 3CC5A 4LEOA 2YHGA 5GGVY 2F5AL 4K7PL 4LVNC 2PNDA 5MERB 1EGJH 1IJNA 1CD1A 4FNTA 5D7KE 1PY0A 4M02A 1N70A 4X7DC 2Z1KA 4XN7A 3NAAL 1I8LC 4ZI8A 1J05B 2WZ6A 1FDLH 4KY1L 3FCBA 3QRGL 2FL5B 3LKSA 4Y2DC 3RL2A 1RMFH 3BE1H 1S8DB 4HUKB 5I5MA 1LLAA 1T2QH 3UJIH 2JKTM 4OIIL 3KPLA 4LSRH 1FC2D 4KZEL 4P23B 5EOCL 5IMMA 1IAIH 3CVHH 1XIWD 2YFNA 4P46D 2YO3A 5DUML 5AUMA 3KPRB 4R26L 2QPEB 4PJAA 1G7MA 1BAGA 4NKDB 1L9PA 1I31A 3NFSH 3NIFE 1UURA 3I6KA 4ZJ9A 3S48A 2PPEA 2N7BA 4NQED 4MAUH 2O5NA 5BV7H 2UY7B 4AM0B 5E51A 1TQCB 4FN0A 4XCFL 3B5HA 4YK4C 3IDYB 4FQIL 2GJZA 5ISZB 1TVDA 5BUAA 1TIUA 5EEWA 5AD0A 1JVKA 5IBTH 2BS8A 5FA4B 1I3GH 1J05A 1DANU 1FO0A 2FGWL 3BPNC 3UIYA 3X12B 1S7UA 1ZA6B 1U8CB 2GJ6D 3SZ6A 1CL7H 5J9PB 4N5EC 1AC6A 4YSRA 3U4BL 1WEJH 4OZGE 4UT6A 1RZKH 4PREA 4UM9A 3HTLX 3K2MC 2VXVH 4XNXL 3SGDH 3V9FA 3G9VA 1YUHB 3HUJB 2P28B 4UOJA 4KRMB 1JHLH 1U91A 3ATAA 2XTJE 3VWKB 5EWIH 2IFFL 1UD4A 4ONFH 3GJFH 4NQDB 3IDUA 4I2XB 4F1SA 2LVEA 2XVGA 4LLUA 1LNUA 1FV1A 1NCDH 3SDDD 1LK2A 1AQKH 3FSVA 3TN0B 3OGCB 3HFMH 1A66A 1TJGL 5ISZA 1NGYA 4JG0L 1Q0XH 1K2DB 2FO8A 2KBGA 3RWHB 5JA9A 1FVCB 2WLIB 3S36X 1RUPH 1PZ5B 2VDML 1SBSH 4N8VG 1KIRB 4FHBD 3K74B 4P59H 1U8CA 5J5EA 4PJ8D 2UUDH 3GRBA 1PLAA 2HUEA 5T3XH 4PRIE 3UAJA 2J21A 2Y2YA 1PG7W 5F2FA 3CFMA 4I0PA 4Z7UB 5E8OA 4KZDH 2MNWA 4X0KB 1H6EA 4D9RD 4ZMNA 1ZHBB 2D4DA 4J3TA 3ULVD 1XCWA 3VWKA 2OJ1A 3BMVA 2EIJB 3QWOB 4MJ4A 4XHJD 3RGHA 1R33A 3TV8A 4GRLB 3LN5B 3GO1H 4FFVC 3SDAA 5JXAL 5JZ7D 2RH0A 1AO7D 1JI1A 1B2YA 4BA0A 3SE4A 1RZPA 2IH3A 2YEZA 1NCBH 3ME0A 1VACA 4WQOA 1CD0A 1T89A 1FVCA 3DX9A 2WLIA 3LNFA 4G7QB 2DEYX 4XB8A 4AENB 4FAAB 3TT3H 3GMLA 1J1OH 4JGUA 4UINL 1GJUA 2P5ED 4OCYL 3LIZH 4R4ND 5C08A 4PYHA 3T3ME 3U46B 8FABB 2I24N 5IJVB 4JPSA 2OAAA 4Z7UA 4UWQB 5A2JH 2HJLA 4W9FC 4BSWB 3LEYL 2JJSA 2XOTA 3EDEA 1IC5H 4OCXL 4QXTB 2J2ZB 3EJZD 4TXVB 3PWNA 5D1XE 3BN9C 1CFQB 4GRLA 2NZ9D 3LN5A 4N85A 3CVHB 4YUEL 1MCOH 1BECA 2VZTA 4FQQB 4HX1B 4PWGA 3TZVA 1YJDC 1R19A 1KTLA 1KPVB 4WSJA 4X8GA 2PR9A 1F00I 2EKJA 4BQBA 3FPYA 4AQ1C 1MAML 1BQKA 4FXLA 4BSVA 5BV7B 2Y7MA 1EGJA 3F7KA 4MQ7A 4DP1X 1ZTXL 1MRDL 2V3FA 3WLWD 1JJUA 1K6QL 4OF8A 4X6CE 1YY8A 5HHQA 2L4OA 2MSPA 2ZWKA 5ID0A 4FE9A 1I8KA 5D1ZB 4LCWA 4U1KB 4HETA 3L6FA 3UBXG 1CFQA 5C8JA 4WFFE 2FK9A 4B27A 2HFFB 3ECVA 1DVUA 2KPWA 3CFJB 4CSZA 4LCIH 4JE4B 5FDYA 4X4YB 3O4LA 4R4BA 1JPFA 1WD8A 4P5KA 1KPVA 2OR9L 3C2AL 2HKAA 3GJEA 4M7KL 4Z76B 3GJFB 3NH7L 1SPDA 5ID1A 4QHUA 2E3VA 1MXGA 4OD1H 4FFZL 1B0GA 3PRZA 5F21B 2EYRA 2IPKB 1P1VA 4G8FA 1YY9C 5T1MA 1M2VA 4WJ5A 5IR1A 5GISL 4XO9A 2IOIA 3WJJC 3SE9L 2X2YA 4Z7QE 4NNYB 4NI6A 4ZYKA 2EZ0C 3WFDH 4B3EA 1F4YL 2DQTH 1BBDL 1BLNB 4OFYA 4XP1L 3O2VH 2HFFA 2D7QA 3AS2A 2KHAA 5JXED 4ZDHB 3QCTL 2BIHA 1X5IA 3X11A 4OD2A 1JMXA 4AL8L 5FCSH 3MYZA 4Z7IA 4P06A 5C3LD 2F18A 4RIRB 2G2RB 4U1JB 5D93C 3RX5A 1L4IA 1FLTX 3MPCA 4Z76A 5HYEA 5EBWA 5F9JB 5ILTH 3QDJA 2FO1A 1VZGA 4P23D 1ZV2A 4QRRE 1WO2A 5SWZA 1IVLA 3VD7A 5KYNA 1UVQA 3G3LA 1ECYA 3ZYOA 5IHZB 2P8LA 3U1PA 1T20A 4EI6B 1NC2B 2FVNA 3NZHH 2QQQA 5GGVH 4KX7A 4BFRA 4ZX3A 2KYIA 2AC0A 2WXOA 3D06A 1GYUA 5AAMC 3W37A 3DARA 4K7PX 2EXYC 2IWKA 2DWEB 2YD8A 1JD7A 1BWMA 4XBEL 2QT6A 1DEEB 2EABA 4F5CA 3BZEA 4AVKA 1G9NL 1FYTB 3ETSA 1B3JA 2I26N 4FI7A 4JPVH 5ISZD 4ZDHA 1RZIB 4LGRB 3NIDE 4R3SB 4N0YL 2VL5B 4JM4H 3WEAA 1I75A 2A9DA 3ESMA 3LTVA 4NN5C 5LBVA 1VEMA 3GMQB 5D8JH 3CQQA 3LZRA 3MSPA 3UZQA 1QRKA 2CHZA 1E43A 5F9JA 1P0SE 4K7FB 2FYYA 3GDCA 4NWUH 3CSFA 3VVVA 4U1LB 5TJWK 1U30A 2QADC 1V7MH 5ADOH 3MLTA 1GYAA 3VWKD 3PWUA 1FL6B 3D2UA 3BH8B 2DWEA 2UXTA 1XMEB 3UYRL 1IBYA 1DEEA 1EEYB 1EFXB 3HA0A 1MAJA 4WK4B 1KB9K 1LHZA 5DTFA 5F6IC 2H3NB 3C6EA 5G55A 1XSJA 1KJ2L 1IIKA 5BZZA 5C0BA 3V5KA 4RFOH 1JGIA 1X6LA 4R3SA 5IOKA 1QSVA 1GOGA 1HWGB 1EXUA 3RUGE 3E6HB 3GMQA 3FU0A 3RKDC 3CBJB 1RHHA 1DBML 2B0SH 2A2QT 1QR1A 1EO8L 3UFIA 1ZSDA 5ESAA 4Y5YC 2JI2A 2I32A 1PS3A 2ADGB 4M62H 2DM2A 2X89A 2IADB 3TVMC 2Y7SA 4LGSB 2B3IA 2V9QA 3IDMB 5ETUA 2A9CA 3MGOB 5B3NA 3RI5K 4ZO7A 5FFLA 3AREB 1ERNA 4GRLD 3QIWB 3QJQB 3TZVD 4E36A 5TGBA 1R0AL 4JY5L 4BKLA 4HIJA 2CUMA 1DBJH 2DWXA 3H3PL 3OHXB 4L1DA 4M5TA 3WEBA 3AU1B 5IB2A 2XG5B 1NGPL 4OUUA 1A9BB 3IN0A 3CXFA 2DH3A 3DX0A 4OZHF 5INCB 3DECA 2R0KH 3E6HA 3FO2A 3BIAX 4YHZH 1VEOA 4IMKC 1HHHA 3APCA 1A4JA 4PJFA 4Z7WE 4ELME 3P0VL 3BQVA 3RFZB 3MOBH 4GMSH 2OTPA 2JB5H 5BO1L 4MKMA 5DQDL 4AW4A 1TZHB 3MGOA 4LCWD 2XFXB 3ZKXC 3QGVA 4EAEA 1KGWA 2HRPH 4OD3L 1AG0A 3N40F 3KW8A 3QIWA 2VH5H 1M3IA 5JOPD 3O4LD 2H0PA 3OHXA 1P5VA 3BUDA 2N59A 3DVGA 2NY1C 1RUAH 2CUAA 3NJIA 2CXGA 3F58H 4KK8C 4ZW6A 4QIRA 3RIKA 1NAKL 5INCA 2WD0A 5E4IA 1U8KA 4QT5B 3DVNA 2P24A 3IJ8A 5DUPH 4JHWL 2G4GA 3ZR5A 3ESOA 5H35B 1N3NA 2XWXA 1T04A 5BS0B 4G1MB 2Z7YA 1DN0A 4DTGH 1SNRA 2AJUH 3C09B 4ODXB 5FLUA 3HVDA 2B1AL 4DP5X 3PDGA 3FCUB 4LSDA 5I8EA 3BRGC 1FAIH 4OFYD 5KVGL 1H3GA 3OJVC 1R24A 3E2HC 3JBG7 3KCPB 2G5BB 3ISYA 5KYYB 4NM4H 5JQ6H 3WIHL 3R1GH 2XT1B 1SM3H 2BSTA 2D7PA 4KDTC 1A14L 2H6PB 3E80A 1TJHL 3BXNA 3P4MA 4UV7L 3ZRSA 4N0UB 1RK1A 2KUTA 1TNMA 1TZIA 4E9WA 5AKSA 3V55A 4HOZA 4Y5XC 2X6CA 4A2DA 2LFEA 2TRHA 3QIBA 4HPOL 5HPMA 4UTAL 3LKRB 2WUCL 4G6JL 5AW9B 4N2BA 4JO8A 4BWTA 4FLQA 2X05A 4PCYA 4G1MA 1P5UC 5F1NA 4KU1A 1UJ3B 1T5XA 1KIPB 3NJNA 4OI7A 2JVUA 3ECBB 3H9SA 1OALA 3PU7A 4UM8B 1UOLA 1XQ4A 1A5FL 4H2AA 5T3XD 5JOFB 3QG7L 3DUSB 1XGQB 3RDTC 4JQVA 4ZOEA 4X80L 2C7UA 4M8QB 2Y36H 3TESA 1T83C 2XV6B 4JFFE 5CGYD 3NACH 2H6PA 4I0CC 2PWEA 2DMHA 5DD6A 4N0UA 1RPQA 4XBPB 2DLFH 3OKMB 5T1DL 3QR2A 1S7TB 3RZWA 2MTPA 2AJZA 2GTQA 5EIQA 1XF2A 1XGRB 4XBMA 5D70H 1GZQA 2OZNA 4YJZL 2AV1B 2WTRB 3TO4A 3UC0L 4W68A 1PBYA 3JV4A 3VQMA 2Z0UA 2OYKA 4PJ7E 3NCYS 3DV4B 3D2UD 3QR0A 1IV8A 4U1GC 1ND0B 3RL1B 4E9VA 5MEPA 1LM8V 1PDKA 2APBA 4I9WE 2O30A 1MVYA 4FLOA 3S34H 1KXQE 4BQCA 5EC2B 1SZNA 1FYTD 3B3BA 2BZCA 3UAAA 1C5DB 4OZHB 1CGTA 1N6QL 4K9EC 4FKKA 3GDBA 5AOMA 4P5MA 1ZIAA 4D8PA 3V79C 1SXNA 4J6RH 4JRXE 4WO0A 3B2VL 1DFBH 3OKMA 4YHNB 2CM6A 3WNLA 1MJUH 4J3BA 1HI6A 3MA9L 1HH9A 2OTWB 2R1WB 2X89D 5FM4A 2NUPB 3VUAA 1MOEA 4AEHL 3BP7B 4KVPA 4IIQA 43C9A 3AS3A 4L3CB 4EBQL 2J88L 2IBZX 4YS4A 4KITB 3CIQA 4WKXA 1DQTA 2RIKA 3C6LA 1ACZA 2RMNA 2NY3C 3U36A 4NRZB 4S1SH 2ADYA 2X1XR 2EDRA 2DKUA 4YL9A 3X1NA 2X1WL 2KQMA 4N6RB 1FDLL 2A38A 4UQEA 4YHNA 2BS9A 4OQTH 4FQXB 1RMFL 1X5MA 1N67A 3LZOA 1T2QL 3UJIL 4GW5A 3ARFB 4LSRL 4P4KC 1IGYB 1Y0LB 5EH1A 5HVFB 2YUVA 2GBAA 3CVHL 3OKEA 4GMTH 3EJJX 3NCCB 2FJSA 4LOUC 4OCNC 2NSXA 4PJBF 3CZSA 2CDGA 3GSNA 3ARED 4Z9KB 1EJFA 4F7CB 2AANA 3FT4B 3QIWD 3NFSL 4RNRA 4CVUA 2YBRA 4N90D 1K4DB 4JPKL 3BJLA 1QSEB 2J1XA 4MAUL 4H20H 3UERA 4TQ8A 3VMOA 5FX3A 2VOTA 5EO0B 3SIKA 1E9QA 3IXAB 4R7XA 2R4SL 3HE7C 4FNPA 4X4KA 2WXRA 5IM7A 1OGAB 5IBTL 4FKHA 4XCYA 2CJTA 3D51A 1BQHB 2CSPA 1N2RB 2ICWI 2VDQL 3GSQB 3K2UH 4G71B 4OFIA 4FQXA 3N55A 4U49A 5HDRA 3QWQB 2FWOA 2VQ4A 1CL7L 3HB3D 4U6VH 1WEJL 4WUUB 3TFKD 3CV5A 1RZKL 5HGBB 2VXVL 5F44A 3K1DA 2I9TA 2ZXDA 3GXDA 4UU9B 3T8VA 3S35L 5HHXH 3KYMB 1R3JB 5LAXB 4F7CA 4WW1B 2WQAA 1LMKA 1MRFH 5EWIL 1Z5LB 3OG6B 4ONFL 3GEFA 1K4DA 4GP4B 2H8PA 4ZW7A 3QHTC 2C26A 4BRJA 2X09A 2UY6B 4W9ZA 4U3XA 3UGXA 3IXTB 5DUBB 1NCDL 3DLQR 3NJKA 3OD3A 4BFIB 3FUHA 1AQKL 2WO2B 5B3JF 2HAZA 2DL9A 3FU9A 4PJHF 4Y8DC 3H7BB 1Q0XL 3FJTA 3JWNH 2JIXA 1P6WA 1XCXA 2IH1B 3QIBD 4UMGA 1RUPL 2HKFH 1N2RA 2Q7AA 5DJDA 4DZ8A 3F7VB 2VJ8A 3MCYA 4P59L 3IJSB 2CHNA 3AQXA 4WEMB 4AUUA 4KI5C 2P5PA 5H37G 3ML8A 4PJGA 1IFHH 1L7IH 4KK5D 4KZDL 3W0WE 1ZT7B 3ZR6A 3EUDA 4UU9A 2VDNH 5AEAA 1NCGA 4F9PC 4GQQA 2BS71 3BD3A 4HSQA 3QJHA 1I8IB 2ZOLA 3WS6A 2YFOA 3M86A 5GS2H 2X10A 3N50A 4NQCE 3ZDZE 1Z1WA 2UY6A 4RISH 2ZG3A 1PLGH 1GHFL 1W16A 3FN9A 1F3RB 3S5LB 4BFIA 3GIZL 5L4IA 4F7PA 1UGKA 3MJ8A 1IMHC 1LYQA 2YN3A 2CD0A 4L4JA 5HDOA 3GPSA 1O5DT 3SDCA 1KIUA 1PZSA 2IH1A 1DJZA 1FZOB 1WFIA 2PCYA 2QGCA 4IBQA 4BZ1H 1CTNA 1MZYA 3QUGA 4ANKA 1PCXA 5HYIA 1TTUA 3F7VA 1O0VA 4F7TA 1J1OL 4MJJA 2E9JA 3QVAA 3JWDC 4L0ZA 1E40A 1UQSB 2ZJSH 3LIZL 4ZX4A 4IU2A 5JIMA 3IDNB 4EZKA 1QEWA 4G42B 5DZ9A 5E5UB 3W9DB 2ZCHL 1VDGA 4D0CB 3GSOB 4M6NH 3UROR 2WINB 1I8IA 5FGCE 3U48A 4OCMC 3GNMH 4ZUWB 1RPUA 4XRCB 2X6BA 5A43C 3ABZA 4DQOH 1C5CL 3SYCA 3VJ6A 5JR1L 2FIKA 5A16B 4NJAH 2AEQH 4HIIB 1YNTF 1A7PH 1OAXH 4J1UB 4PJEE 1HEHC 4P5TA 5IB1A 3P2BA 3ZTDC 1P2CA 5I71C 3WG7B 3ISWA 4PJBB 5FPIA 1Q38A 1OD7A 1AZCA 2G9HA 2WNXA 4JVPA 3UZVA 4B53A 5E2JA 1QPXA 5FEBA 3EYVA 1PX8A 4X99A 5K9KA 4BK5A 4G42A 3WIAA 5D7EA 4I85A 3QJZA 2VE6B 4DGYH 4HSCX 4D0CA 4OQTA 5HBBA 3HR5B 2WINA 3ARGC 3MO1A 1BZ9A 4LFHD 2F15A 2WNKA 4ZUWA 1W8EA 1U2YA 4YDKL 5I6MA 4WI0B 3WFCL 5HJ3A 4LCIL 4CL7A 5A16A 3BT2H 3IETB 3Q01A 2BVEA 1FFPB 1PZBA 2WCGA 3DX7B 4PRBA 2NW3B 4JRYA 3C5SB 4J1UA 3TH4T 3ABLB 4HJ0D 3CVBA 3HPLA 3QISA 2P43B 1WYJA 4AV5A 1G0XA 1ULVA 2VDLL 3Q8AA 4G80B 2ZWNA 1KBWA 4QD2E 3LD8B 4OCRL 3T2NH 1CCZA 4ZMYA 5I23A 3U2SB 1HYSD 2B1HH 2P9RA 1TQBB 2Z35A 4FLSA 3CXDH 4EQ2A 3JXAA 3CSBA 3AAZB 3LSOB 1V8HA 2VE6A 3HI1B 5DYOB 4NM8H 2DBLH 1OP3H 3WFDL 3JVGA 2X38A 5CBAA 3FT9A 4PJHB 2CIKA 5EOTB 3L4YA 2YD1A 2CAKA 3OV6A 1KSRA 2OXHA 3NPSC 3O9WA 1G94A 4XPBH 1SRDA 2VDNB 4PR5A 1TJXA 1CICC 4CVZB 5I15H 2EDWA 4N2DA 1OKEA 2NW3A 4FQXD 4JDVB 2XBZA 3P4NA 2V5MA 2L04A 5ILTL 2XTSA 1XZWA 2BCMA 5I75B 2F19L 2YXMA 4UAOB 5CM1A 2NRDA 3NRFA 1ZANL 1WAPA 3MV11 3NZHL 5GS1B 3N0PB 1ZS8B 1ZE3H 3HI1A 3WAJA 3QUMH 3LNGA 1QSED 1EO5A 4MD0B 1G4RA 1AJ7H 4K2UH 4GW4B 9PCYA 2XX0A 1QPKA 1OW0C 2EAEA 5DJ0A 3MNVA 1OGAD 5C0JB 2WC7A 4A2FA 4JO3L 3O8XC 5AB2A 5E08H 3MTXA 1LD9B 2ZXGA 4WVRA 3OF6D 5D8JL 4JDVA 3C9NB 1WIUA 1LK3L 4HK3J 3SBPA 2CPUA 3FTUA 3N04A 3CZEA 4WUUD 1YDPB 1JYWA 2FSEB 4O58H 5T1KB 2H2PD 2ZUXA 2XVKA 5KOVC 5DC2A 4AGQA 2J8UE 5GS1A 1INDH 3LS4H 4LHUB 1EHAA 3VXSB 2ATPB 3K1KC 3ULSA 4GKZA 2WKLA 4PLOB 1IAOB 3SE3A 2KZKA 4PS4H 5J6HA 4KZ0A 1JVOA 2NNFA 2VZOA 3W57A 1YEKH 5EDSA 2VXQA 4E5XB 1TO5A 4JFOA 1B4TA 4FLRA 2VRQA 4BH8B 5C0JA 2E7HA 2EVHA 4RH4A 1F18A 2X4QA 3KYNB 4WHYH 3V4VH 2E27H 4UOW0 4HS6A 2OR7A 4HIHB 2B0SL 5KJRH 4GRMA 1X44A 3B9KA 4Y4HB 4X5XB 3S3SA 4YHIB 5DVMA 3IMTA 2EADA 4U1SB 2FO4B 5CZRA 4M62L 3FRUA 5ELIA 5CBEA 5CEYA 4NRXA 3BPLC 1R3HB 3VXSA 4ZMTA 4JFDA 1PAZA 4FA6A 3IGLA 1YNTA 4OZ4A 1A1NA 4RMQA 3B1UA 4HKJA 5CR8A 2YRLA 5DWPA 5F1OB 1J88A 1QZ1A 3V0DA 4XMZA 1QFPA 4G70B 1DBJL 4LQFH 1DHKA 3SQBB 3FQRA 3TPKA 3WNOA 4YGAB 2XNAB 4P5TD 3N42F 2FE0A 1Z5HA 1U95A 1NKRA 3NDYE 4QRSB 1MEXH 4ZTPH 1Q8MA 1VCBC 1QSFA 2R0KL 2ZUQC 3FQXB 4HIHA 3PABA 1K9TA 2NYZA 1SXAA 4PD4K 2OX5B 1QO3A 4JDTH 4X5XA 2HFEA 5LJYH 1Q9LB 2OMYB 2FO4A 4GMSL 2QTVA 3UP1A 2JKRM 4EXPX 2IMMA 5DJ2A 4I77H 4LT7A 1PEWA 3T0EA 1WFNA 4ODVH 1T4KB 3L3GA 4I5BA 3G6AA 4EF3A 3SDXE 1ECZA 3EFDH 3CZJA 3HKZA 1F58H 4M4RA 2HRPL 3ZJAA 3LKPA 1GS7A 2DIJA 3P3RA 2AVFA 1NBVH 2VH5L 2ZKMX 1S5IH 4XXDA 3ZT6A 1Q9WB 1TG8A 3SQBA 3PP4H 3ARXA 4JRYD 3CSGA 2F1EA 1I3RB 2PCPB 1RUAL 4O5LH 2R7EA 1GC1C 3F58L 3QUMB 4L4TA 4X8JB 4HJEA 1CLVA 3QRBA 5GZNC 3QEUB 3AY2A 3FQXA 3HBQA 4LPWA 3EOBA 1JPSH 2WKGA 4HJSA 1S9VB 3A5VA 4HHWA 5DUPL 2YC1A 4MCMA 4XNQA 5HI3C 3FO1B 5DS2A 4OLXH 2Z7UA 4FLHA 4DTGL 3BKCH 3APDA 3KBPA 5CJ5A 4DEUA 1CURA 1I1YB 1HEZB 4FNUA 4XPGH 2CDEA 2NOYA 3PHOB 4JNXA 1E6JH 1XR9A 1OB1A 3F65A 3R1GL 1SM3L 1HSBB 3O9WD 4NXKA 4N2AA 2CQVA 5IHWA 1UH4A 1Q9WA 2R2BA 4HS8H 2VZVA 4ETYA 1ZGLB 3LN4B 1I3RA 2K6ZA 2PCPA 1NIAA 4JPIB 4LMQI 3AJ7A 4X8JA 4Y2OA 3WJMA 5JHDB 5HD8D 1G9MC 1W0VA 4HCGA 3HG0A 4PGDA 4PY8J 2O1AA 5CP7B 2DQUH 3QQNA 2X2IA 3FBQA 1DLFL 2H2SD 3L3KB 2O61B 1J5OL 3V4VB 1EQWA 1CB4A 3L4TA 5EU6A 2F53B 1HEZA 4KTEL 2NR6A 3PHOA 4QOKE 2CRYA 1A22B 1FNGB 3HS9A 1F3DH 5D6CB 4CJ1A 5DC0A 2Y36L 3OMAB 2VL4A 3KJ4C 3NACL 1ZGLA 3FCSA 3MLWH 2MFNA 4OKDA 2QMJA 2DLFL 5JHDA 5BOJA 2NZIA 3KDMB 3Q6FB 5D70L 5DZJA 4XMLH 2QFPA 4A37A 1XGUA 5J13C 4LARH 5I6XB 3ENEA 5CP7A 4OFDA 3VFUB 2LE9A 3ORJA 1LEIA 1VEPA 3QNYA 1HWHB 2YAMA 3OAUH 5HI5C 4JG5A 3DYMA 3CDGA 4ZUVB 3THML 1FL5B 2YPLB 5IMKB 1FN4A 3QK0A 2RCSH 3S34L 3N42B 5CJXC 1LE5B 4KMLB 2F5BH 1A6TA 4HW6A 4GXVL 1BQUA 5DWUH 3F64A 3D4CA 3P1VA 4YSDA 1S7VB 3RWIB 2XY1A 5K39A 5D1QB 5E70A 2ZYRA 2ZYHA 25C8H 1AGEB 4J6RL 3ZL4H 3WL9A 4W9LC 3CPUA 3AXIA 1G5AA 1QNIA 1DFBL 4WIQA 3B9KD 3O2DH 3RU8H 1MJUL 2NTFB 4UZGA 3GI8H 2DQDH 3L7EA 5EZPA 3BUBA 5KVMC 3Q6FA 1NBZB 1PKQA 4PSPA 4XWGL 3B83A 3LQAH 5EBMA 3VFUA 1I8AA 3QXAA 1MVFA 5KN5B 1WHPA 4MVBC 3VXSD 3Q3GB 4JFDD 5JIPA 2OMUA 1UZ8A 1R17A 1QRNE 3BAYA 3UCRA 1KCBA 3FUMA 3SE8H 2GSIA 1A7NH 4G8GB 5B38B 4QRAA 3U6RB 3T4AA 4YEEA 1ZT1B 4JO1H 1NGXA 5T1JA 2X7LB 4Q6YA 4S1SL 1CS6A 1NMCB 1FI8C 1RK0B 2QV4A 4BZYA 4D7BA 5IW6B 3NN8B 1AGEA 3GLAA 3ZU8A 3ARDA 3QUYA 1KCUH 5C07A 5FB8B 3FOLB 3V95A 3ZY7A 1NMBL 5JW5B 1CUOA 5ECJE 2NY0D 5DZVA 1NBZA 4KJWD 4ZPTB 2CG9X 5D2LF 4GMTL 4GLRI 5H94B 3TPUA 4KKCC 1RSYA 5TE6H 1LWRA 3S88H 5IB5A 2AKRB 1IGJA 3S8WA 5IEHA 3BKYL 4R7NA 1BBJB 3GSVB 3I3BA 3B43A 4IKIA 4WY7H 2D9QB 3H42L 2YPVL 5F9OH 4H20L 1NOFA 4G8EB 4XBGB 3WAKA 1UADC 3PHAA 3GSXB 3ARSA 3TS8A 1HKLH 3CHXA 5IW6A 4EDXA 4L4TD 2QGBA 1J0YA 4FJ6A 1QFWH 4JLRB 3HN8A 4OJEH 1N59A 3K2UL 2HLEB 3CE1A 3CMOH 2C9UA 1YUKB 1PGRB 2YZ8A 3OKOA 4U6VL 4E9QA 2YAHA 1ZA3B 4N1CA 2ZX5A 1CE6B 4TUOA 5H94A 2ZX7A 5GRYA 3EYQD 3NJMA 3NIFB 4PJXA 5HHXL 5DI8A 2AKRA 2WQ8A 5ESVB 2VAAA 4GG6E 1MRFL 2Y4SA 3BAKA 2BNQE 1JWUB 4YX2L 4RMTA 4AIEA 2VLLA 5DXWA 4JGNA 3TXAA 3FB5A 3DETC 4YDVA 4IBSA 5AW6B 4KO7A 5BRZB 4IKKA 3RIFK 4MAYB 3QEHB 2M83A 4V1DE 2XWZA 3UDWA 3VTAA 1DN2A 4KX8A 4A2HA 3UPCA 4F8OA 2YWYA 3A4EA 3NSXA 2XN0A 1X5KA 2V3EA 4MXVE 3VFRB 5LBGA 4Z78B 1PZAA 2EVIA 4QMEA 1IFHL 1L7IL 1VFAA 4FYSA 2RGSA 1NMAL 2BW4A 5HI4D 1J0JA 3IU3A 3VFWB 5ESQA 4TN9A 2VDNL 3BESR 2XTJB 1OP4A 5I6PA 4P57B 5ANMA 1YG9A 5ESVA 5KSUA 5FKPA 4L8CA 1BMGA 3NFPB 5EZJB 4XNMB 3H2WA 3R4RA 2QQLH 4GO8A 4MZIA 3MJ7B 3PXJA 4NQVB 3TO2A 1SLWA 1LTXA 1MCNA 3S3JA 1KYOK 4Z7VE 4QYOB 2TSAA 3RY4A 5E5MB 5JHDD 4Z18A 3QHZH 4ZRGA 5T3ZH 4BZ1L 1H6TA 3VGAC 4QI3A 1UT2A 4PGEB 4L1BA 3ZTEA 4FXKC 1AHWB 2L7JA 3AABA 2Z34A 2ZOKA 3IAGC 2QSTA 1K8DB 1U8PA 3DNKA 4TV3A 4DEWA 2OK0L 2K4AA 3VM5A 5I8OL 2F53D 3VFWA 5DMGD 4WO4C 1I85A 2VLJE 5BJTB 1UWXH 2J4WH 1ZWIA 2FT6A 2F8VA 4M6NL 3QZNA 2GKIA 1BW8A 2OL3H 3HE6B 4BFNA 1UWYA 4EDWH 2H26B 3NRPA 2J1ZA 3TLRA 4DQOL 3FS9A 1LWJA 2B20A 4PGCB 4UQ2B 1NFKA 1BG9A 2JKXA 5ALBH 4RVBA 5IMOA 3RVVD 4Z7NE 3CDFA 1M1SA 3ILEA 5CJOL 1NKGA 4NJAL 1LL1A 3BLBA 2W0LA 1XF5B 1ZT4B 1LJMA 3MJ7A 4W9HC 1CR9H 3S5ZA 3O11A 1OAXL 2IAMA 4UQ9A 4C55A 1AH1A 1FG2A 1MCKA 4QJ4B 1XGPA 1FAKT 2LU4A 2IMNA 1HH6B 4HFWB 5ANHA 3CFBA 3IFPA 2GJPA 2LT9A 1K8DA 3HG1B 5JPMC 3MBWA 3IDGA 4ZXBA 3RVTD 2YPLD 1VHPA 4Y9CA 4LXFA 4YDZA 3L3HA 1KXVA 3X13B 2NY6C 4OCWH 3WTXA 2CBQA 2WXMA 4X9HA 5IB3A 4XVSH 4AMXA 2XDHA 3NG5A 3SQOL 4PGCA 5DLML 3U2JA 2A6IA 1QHPA 5D1QD 1YAZA 1MNUH 1BX2A 4LKCA 3MBXH 3ARDD 1JYVA 2WGNB 1JK9A 1ZT4A 4U3SA 3QUYD 2FUQA 1ADQH 3BI9X 2HTLD 4HKZB 5D2LA 5C07D 3UACA 3PP3K 4U1NB 4NI3A 2DWTA 3ZYZA 1HH6A 4BWUA 3FT3B 4J3UA 4K3HA 3T2NL 5C3IA 4MAZA 1S7SB 1VFBA 2B1HL 5IB4B 2BIMA 4E42A 2C4FU 4M61A 2EILB 3FYIB 3VSTA 5K59F 2WKOF 3T0DA 1E3XA 1U93B 4PJDA 3OZ9L 5BO0D 4L0YA 2FSDA 4NM8L 2DBLL 1J8RA 4HFUH 3EOAB 3ILDA 1A3LH 1RH8A 2IG2H 3GSWA 1T21A 1MCWM 3D3VA 1RJZB 2BX5A 4G72B 4K71B 1H15B 4RZKA 4B9KC 4B7IA 4G59C 4W9EC 3FRPB 4XPBL 5IHLB 1ILUA 5DK2B 2EQDA 1SVCP 3KHOA 5I15L 4N2HA 3RWFB 2ZX9A 2L3BA 3TA3B 2A74C 3V52L 5AYUL 4U1NA 2ZCKL 3ZLQC 4MZ2A 1Z9SA 5DC9B 5KWYC 4XMPL 2BVOB 2EIZB 2BHUA 4IMLB 1JGUH 4WWKC 5HHMB 2NCEA 1TQSA 1G1CA 1BVLB 3MUGA 3K8MA 5ACZA 2AQ2A 3ARBC 3VI4F 1MAKA 1AQ8A 2OZ4A 3MRHB 2HX7A 4LLVA 3RWCB 3QUML 4PRPB 4ES8A 2EUWA 3EOAA 2AK4E 2KL6A 3V7AE 2VITA 3QIUB 1AJ7L 1F2QA 4K2UL 5SV3A 4C83B 3VFSB 2P8MB 1H15A 2H9GB 4UZUA 3WYRA 3TNNB 4DVBB 1WH0A 3WHE1 4Y4KA 2X4NB 4YBLC 5E08L 2B7DT 3BVUA 3RWFA 2OL3B 3CSYB 2BRQA 3QJOA 2VQ1A 4LVNB 2ZKYA 2GYSA 1QTPA 2LW3A 4LL4A 2BP8B 4K3DL 3U0PA 4PCKA 1Z9OA 2R0LH 1E2VA 3P11H 1N6UA 5GGUA 3VMPA 3MLPA 3N1PC 3BKMH 1HXMA 4JL1A 3L3JA 4JGJA 4A7SA 1INDL 3LS4L 4Y2DB 5J1AB 3QSKB 1Y07A 1E2WA 3T65B 3QULA 2EDBA 3MX0B 4JFYA 2VXUH 2QSCH 2A9NH 4UAHA 1UXMA 4Y88A 5GS3A 1YEKL 5KS9E 1YJDH 4FG6D 4J3SA 5BRZD 1SOXA 4MAYD 3MVSA 3BUYB 1BVNT 2YUXA 1U8QA 3FB8A 3V4VL 2E27L 3QFJB 4YN3A 4KHXH 1A2YA 5KJRL 1MCBA 4X6FA 1DR9A 2GUOB 3M7OA 3QUHA 3MBEC 1NEZB 4YK4B 3DHPA 2W92A 1AR1D 3KXFE 5IF0B 2D0GA 4EQ3A 1UD6A 4NJ9H 2VW7A 3VXUA 3BPNB 5J1AA 1XT5A 5CEXA 1GGIH 3D25A 1JFHA 3B8SA 3VWJC 5CZKA 1WS7A 5F7HA 1G5GA 4I1PA 2K0RA 4UBDC 2AXWA 2GT9B 4MB4A 2DIEA 1Z9LA 4ILDA 1MG3C 3F7LA 3G5ZA 4G6FB 4OLZH 2XG4B 5J06A 2ZTBA 4QAWA 2DEWX 3B5TA 3II1A 3DYPA 1LP9F 2A4EA 3OGOE 2NX5A 1MEXL 5MENB 2P1YA 3GXMA 1JD9A 3HBPA 1G7QA 2NSQA 5CCGE 1IQWH 2LR4A 2PXYB 3ZHLA 4W6WB 4BYHA 4JDTL 5DJ6A 5FO8A 1FGNH 2GBVA 1G7HB 4P9HH 4Z3JA 4ZXBD 2E7LA 4IBLT 5C0CE 3CQPA 4ODVL 2Q5BA 3VI3F 1X5XA 1J9QA 3EFDL 4ZPVB 3HOGA 1F58L 3HC3H 1U8LB 1OEZW 3DGCR 3ZTJG 2CPCA 5ICYA 1NBVL 2GT9A 3C60A 2DI9A 2A9BA 1R5WB 1UD2A 2XG4A 1S5IL 1Y6KR 1HHKB 4D3CL 2E9BA 1JHKL 1TNNA 2V17L 4WFGE 3PP4L 3Q5OA 2ARJA 5I1IH 1U36A 4O5LL 4K15A 3PQYA 5D7IA 1CE1H 1IM9A 1D5XA 3DSFL 3NIGF 4HPYH 1K3ZA 2PXYA 1F45A 2WKOA 3VI4B 5GSVA 5ACLA 3HHSA 4AQ8C 4M00A 4XVJH 3HG1D 1XH3A 4CILA 1BXAA 4X5LA 4OLXL 4E9RA 1IGFH 3BKCL 3D39A 5EN3A 3UBXI 4AYBA 4X7TB 4HZLB 2IO5A 4JFZH 4HJ1A 5AKRA 4XPGL 2CJUL 5DJ8B 5JA8B 5FYJE 3MMEB 1IGTB 3VXOB 1UUNA 1E6JL 2KKQA 3KYAA 2D7TL 2ENSA 1IE4A 1TO4A 1YRKA 2GHZA 4PV1C 1SJHB 4B7LA 2R2HB 2ZCLH 1OARH 1XHHA 1H5BA 1HE7A 3ZE2F 4YHKH 3D9AH 4HS8L 5I9QC 3D05A 1KYDA 2AEIT 3GMNA 4P2QB 2QKIC 1F13A 3BWSA 4NC2B 4ETQB 3WENA 1ZTMA 3NUKA 1KGJA 4LVHB 2NW2A 2H1XA 2CNZA 2VLRE 5IIEB 4E68A 2F74B 3AT0A 2J5WA 4K3EH 2CK0H 4Y89A 1QKZH 5A3ID 1PPIA 4L3EA 1EBAA 2C9PA 5JHLH 4PJ5A 4UDTB 1VZHA 4K8RC 1BFOA 4N8PA 4R2GC 4ZFZA 4AQ1B 5IV2B 2YAQA 5CP3H 4HCRA 5I74B 4XCNB 5I0WA 1UENA 3O3AB 4HZLA 3RTLA 3IDJB 3IN2A 4FJZA 2J1WA 4BH7A 2O6EA 3P02A 5D96C 3VXOA 2UX6A 4OLWH 2OMWB 5LAPA 5I6NA 4EN3B 4JRFA 1A21A 3POHA 2WO4A 1AY1H 4P2QA 4J2XA 3GEWB 1MHEA 3MLWL 1WC7A 1UM4H 3TA3D 1MLCA 4NKMB 2GJJA 4LLYA 3O3EA 4R7VA 1K4CB 5I5RA 3MAWA 5KVDH 5DQJB 3V6ZB 1UEYA 1JZ8A 2N01B 4NZUH 5FCUH 3BUIA 2MH4A 3OB0K 4XMLL 1WFJA 4LARL 3SKJH 2J7LA 1YPZA 2AXHA 2GHWB 2VAJA 4O2EB 5FYLE 5T3ZD 3SSGA 2UXGA 3OAUL 5IV2A 1OGPA 1JWMB 1A7RH 3FK3A 4PRPD 4JKMA 4RBPK 5DK0A 3GZOA 3O3AA 3BIKA 5EN2A 5CGMA 1LP9B 1A1OB 3P30H 2RCSL 3L3DA 3QIUD 1YQVH 4MS6A 4H1LA 4ECNA 1T6BX 2Z7WA 3FT0A 5DWUL 3MRCB 2XI9A 2AABH 2CKBA 5AVWB 2YQBA 4EN3A 2XN9E 5DEZA 4O51A 4ZNEE 3E3QC 3G6JA 1ZDQA 4Y1AB 5ITFA 2GW5A 1CDHA 3ZL4L 1QR4A 1BV8A 5EBLB 3Q5YA 4RGMC 5D5ME 3OKDB 1DVYA 4FQ2L 1BZ8A 4XAKD 5FYKE 3O2DL 1FIGL 3RU8L 4AJ0A 3GI8L 2DQDL 4OU3A 4RSYA 4BKTC 1WCBB 1S9YB 3HNTL 3V6ZA 1X6NA 3VSVA 3LQAL 5E2TH 3MV8E 4EUPA 2OSXA 1JPTH 1MWAH 4YZFF 3VXUD 1KCSL 5E7BA 1CI3M 1UD8A 1I8MB 5DEJA 1F1AA 1K72A 3IFLH 4N25A 4OAWB 1LP9A 1A1OA 3SE8L 2F1AA 4JN1L 4PG9A 1CGXA 2X4OA 4R83A 1JZGA 5DR5H 1Y6NR 5DMIH 1QWNA 2X40A 3MRCA 4FNLH 2OPCA 3NIGB 2DWDB 4HEME 4U1MA 2PYFA 5TK4A 3O3BB 1GTNA 2DQIH 4JRXB 4X9YA 1SF5A 3R06B 4LCUB 1P7HL 5EBLA 2DI8A 5EBGA 3GIVA 4AX3A 5I5IA 1KCUL 4XXCC 4ZSOE 4ADIA 4JQXC 3VI3A 1S9YA 2Q76B 2XZQH 3KWTA 3DK2A 4XPHH 1DJGA 3BCDA 4J3OF 2DKSA 5IZ7A 2DTML 1GAFH 4NENB 2LV4A 3RWGB 4NN5B 3W2DL 3LZPA 4XMUA 5TE6L 1IEAB 3QJFB 2X53A 5K1JA 3ZE2B 2D31A 4J3OH 3RTQA 1A9VA 5C0RH 2CO6B 5F9OL 1YEDA 4XP9H 1PLCA 4QY8A 2QADB 5EULV 1HKLL 4KKLC 3PQYD 5CKGA 1ONQB 1KWGA 2C3VB 3U0WH 3PDOA 1QFWL 2VR6A 4POZC 3SGJA 5K9QG 3MQIA 3CXHK 4ODWA 4G9DA 1GR7A 2PXYD 3I9GL 3BSZA 3BX7C 2O5YH 2OMTB 3QDGB 1TTRA 5FOBA 3CMOL 1NFDF 2CCLA 2UWEA 1CU4L 1YEIH 4Y8AA 2QFRA 3OJDB 3TCLB 5F6IB 1GGUA 3D39D 4N9OB 1IAIM 1FG9C 5G4NA 3RWGA 1YNKH 1MDTA 5DURB 4J3WA 2Z6FA 4Y5YB 4GQPH 4RFNC 5CD3B 1ZDSA 4Y4FA 1JBJA 5H4YA 4MA1C 3TVMB 1FYHB 1XIWC 3FF8A 4P46C 3O81A 5EUOE 4QJ3B 4JRLA 2WLZA 4JFHD 3U7YH 4HUUB 1WWCA 4B9PA 2XIBA 4H1LG 4L3ED 3DXAA 5F7UA 8CGTA 2FECL 3GBML 2MMXA 3OXRA 4PJ5D 2KLRA 4XT1C 4GKSB 4F8PA 4J8QA 3H8NA 3FL7A 4Z0BH 4R96A 1U3HA 3T4YA 2DMKA 2DM3A 4N0RA 3M1BB 4B97A 3UTTE 3NCXA 2RACA 5EOQL 4CMMB 2V9TA 2OQJA 1OF2B 4AQAA 1K5WA 4K9EH 3KE0A 1PEZA 2VC2L 4IGBB 4TVPE 1H9VA 1MWAB 3TNMB 4C59B 3PHSA 4EUPG 4UOQA 3REWB 4IRZL 4P2QD 4WFED 1JYXA 4FQLL 4LRIC 3IGKA 1TQUA 4YH6A 3WNMA 3BJ91 3ZKXB 1SHXA 1UT1A 3MNWB 4JZOB 1XDTT 5H2BA 1J1XL 1MREH 3RZCA 5T3ZL 4NLHA 5EIIA 5ITBH 4JFVA 4HHGA 5TF1H 5F0PB 2JCCF 1XL4A 2CRMA 4FEIA 5CUSH 4KTYA 4MKTA 3SDDC 3NA4A 3NESA 4JPWH 5KW9H 2NY1B 2FEEL 3NFNA 4LEXH 3MLVH 4PJCE 5F6HI 3CN3A 4HUCA 4WHDA 1AZZC 1RZGA 3CLWA 3F7YB 5CIPH 1NJ9B 2YZ1A 1FFTB 3QZBA 5I0YA 3QORA 5I30H 4JFEE 2OL3L 3STLB 1J48A 3OTTA 4K5NA 4EN3D 3AVEA 1NGWB 3ETTA 4IGBA 1MWAA 4R0LA 4WI7A 4NZRH 4TVUA 3L7FA 3M1OA 1FFRA 3GMPB 3MV9E 2GAZB 3UJTH 4PWJA 1UZ6F 3MYJB 4YR6A 1CR9L 3L4ZA 5E8NB 5EDXA 3E2HB 1KGYE 1AYOA 3WNPA 5DRWA 3BP6B 2YSSA 3ULVC 4MJIA 4X6BB 5HDBE 3T2PA 1N7ML 1IBGH 2XJLA 3MUZ1 1VPOH 3HN3A 4U2ZA 5SWSA 5JZ7C 5G2NA 1MH5A 4Y16A 3QEGH 5B8CC 3AUWB 1WZ1L 3FFCE 3G5VA 5JPNB 4PJIA 4LKXA 4XOEA 4Y5XB 4HIEA 2RFXB 43CAB 3F7YA 3KPQA 4OCWL 4XVSL 4OZIE 1P5UB 4QTIL 1GL4B 3QC6X 1P4IH 1XXFC 2GY7B 1MNUL 2XSKA 5C2BH 4QHMA 1NFDB 1KLFB 2EINB 2XWEA 2N1KA 3MBXL 3GMPA 3VXME 3MYJA 1VESA 5E8NA 3BFWA 3ZGIA 1ADQL 3RDTB 1F11A 3MODH 3RWEB 3TF4A 1SYSB 3WELA 3EDJA 4XWOC 2NZ9C 2ICEA 4LU5H 2F68X 2JJTC 2FX8H 3ARRA 1GJWA 1CG9B 3IKCB 3B7YA 4E9TA 3ZYJA 2ZAGA 4UTBA 3WHXB 3KW7A 3V8CA 5JPNA 5L2KB 2Y06H 1ACCA 2B9AA 43CAA 4PB0H 3A24A 4HFUL 1ES0B 1QP1A 5F88A 1A3LL 2IG2L 4R5XA 1TITA 5AL0A 1UWGH 5IVZA 4XCCH 1VGKB 1X7QB 1WSST 3JQOB 5JORB 4QXUH 2YAEA 4U1GB 4UQIM 4BZ2H 1L9QA 4HKXB 4KI5F 2VDPH 4M6OH 4I3GA 3BDYL 4ODUB 4QRUA 5CMAB 4D9QD 1HDMB 3EBAA 3QG6B 1I9IH 4NPYB 1KEMH 4FXGB 2ED9A 4OJFH 5KVFE 1H8LA 1BOGB 5DJAB 1CG9A 1QA9B 1R4XA 2WSKA 1VENA 4N1HB 2AXJA 3WEXB 2IDUA 5J56B 4YZWA 1TYJA 4AGMA 1Q1PA 1OT2A 4QCIB 2X9ZA 4HUXA 5AZUA 2CLZB 3CIAA 4S10A 3UAEA 5EIIG 3DOSB 4Y4FD 5L8JB 3D85B 4JBSA 4GO6B 3IFOA 1ZV9A 1IUZA 1OV8A 2EIDA 1IC0A 2IGLA 1UB6B 3EH4B 2FJUB 3PGDB 3QZPA 4OJYA 2Q8BH 1NDMB 2ID5A 1C8QA 1A8JH 1T5KA 1UA3A 2J12B 3OKLA 2P7TA 4HKXA 1MDAA 5CIPB 3L3OA 1MVUB 5D6DA 2BWDA 4ZUTA 1JPGB 3QDGD 4UT9H 2WSPA 1ML0A 2NY3B 3H4FA 4FXGA 5FF6B 3V0EA 4JQIA 1L7TH 4YLCA 4APXA 3JWDH 5A1AA 2OW7A 1LO0H 1XX9C 2D3LA 3FCTB 1QA9A 1V3JA 2R0LL 3UJJH 4N68A 3P11L 5E2UH 5D4HA 2Y7LA 5DURD 5E1HB 3BKML 3CUPB 4UNVA 1I1FB 3ZRFC 3FTGB 3FQ2A 4MRCA 5F7WC 3OB0H 4GJTB 4NKOA 3MR9A 3DOSA 1NFAA 3D85A 4P4KB 4H13C 2VXUL 2QSCL 2A9NL 4Q4IA 3I3EA 3AM8A 5BVPH 4MCYB 5IBUG 4LNRB 3PGDA 4OIAA 1YJDL 4ZZKA 3KM1A 3BYYA 4M7JH 1MF2H 2JCCA 4UILL 5ACMA 3RZCD 4GIPD 2EE2A 4JZNB 4KPHH 2IH9A 4KHXL 3BO8B 3QYNA 4HG4J 5FGSA 2OBGA 4AYDC 3SKNA 3QNXA 1TQCC 4FG4A 4HGWA 1XF3A 4LE8A 1NM4A 3NCBB 3HE7B 3QO1B 1JP5A 4J4PA 1M05B 5GGSY 4NJ9L 5D7LE 2WMPB 4ES9A 4TQPA 4Y7OC 5KSVB 2N1TE 4YVNA 2CUHA 1I1FA 4KXZI 5F96H 1GGIL 2E7CA 2VERA 3MJWA 3D52A 1G7IB 3UAJC 4IGBD 4MZ3A 4UOZA 1F1DA 1FHGA 4I0PC 4IOFD 2EDXA 2CZNA 3HZMB 3ATDA 2PO6A 2Y7QB 1RD6A 1U33A 1XMWA 4OZFA 3VWKC 1KGCD 4MJID 4JN2B 3UIZA 3SDAC 1IEHA 1W72L 2GJ6E 2COVD 2W65A 1GJIA 1RIVH 3SE4C 1OD9A 2EYSA 1FGNL 5HGDA 3VMNA 1PQZB 3QO1A 1T89C 1D5ZA 3VSUA 1KCRH 2VDPB 2Q10A 1MHCA 1QLEH 3K46A 2LTQC 1UM5H 4FQHB 2EP6A 2X4RB 1BZOA 1HOCA 3GBNL 1BAFL 1JZ2A 4FQCH 3R0NA 5L8LB 4RAHA 1IZJA 3FONA 3EZJB 3EHBB 4RMRA 3B7RL 2CRZA 2WLLB 1S2EA 4QF1A 5I1IL 2JJSC 3HZMA 5C3TA 4DUXA 3S0PA 2DQMA 4Q2ZA 2CJ3A 4J3OD 4MA3A 3P9MB 4NO3A 3D30A 1CE1L 2GTWB 3QZWA 4JK0D 4GRLC 5C0AB 5LBSH 3EJYD 1RLBA 4HPYL 3HAEG 3GBEA 2P46B 3CXHJ 3I6GB 3TZVC 1HJBC 3W11D 4XVJL 1DSYA 4YSAA 1IGFL 1OQXA 4WCYH 3MCG1 3MREA 5DEFA 4D9RE 3HG2A 4YIQA 5AVTB 4JR9H 3S2CA 1OM9A 3ULVE 5C70A 4DKDC 3LH2H 3QFDB 4JFZL 1TQTA 2QR0B 2R9HD 3WTVA 3CNKA 2BSSB 1AO7E 1DVZA 1A4CA 5DEGB 2MCAA 4APQA 3BLKA 2TAAA 1TSRA 4ANWA 4WRLA 2ZCLL 1JNNL 2QPFA 1OARL 3B7SA 3LY6A 4UF7C 5EF2A 3D9AL 4OLVH 1ZD6A 5BVJB 4X9BA 3BFQG 3RDTD 1BQHG 2AV7A 2W38A 4XZUA 5F7DA 2WN2A 1Z9PA 4HHAB 2R0WL 3EYSH 1JGDA 4AC2A 2J43A 3M45A 4YDIH 2J6EH 3OX8A 1PYWA 2CK0L 2P5EE 3TWCH 1MLBA 4I18A 1K8IB 2QTEA 3RLSA 4DO4A 3ZQWA 1NCOA 2B59B 2P8PB 2Y1YA 3FAXA 3G5YB 5JHLL 3Q06A 4MJ6A 4FYQA 4UTCA 3JSSA 5CLTA 4P4RA 3DX8A 1KN4H 5FO9A 4PRHB 2Y22A 5BV7C 5I71B 3GKWH 3DX6B 15C8H 4KVCH 2QR0A 4KHTH 4KKQA 1A6WL 4DGIH 3MGAA 3TCTA 4OLWL 1YAIA 4KC3B 4IDJL 4Y5VB 1AHKA 4ZFQA 1HSAB 1CF8H 5EA0H 4KMQA 3X14B 5MEQA 1UM4L 2OTUB 3ARGB 3PGCB 4B3VA 3QUZA 4UV4H 3HHRB 4FTVA 5BZDB 1EVUA 1UXSA 5KVDL 1Q9OB 1AOZA 4X6DE 5FCUL 1TCRB 3GHBH 2F54B 3ZT5A 3SKJL 1IX2A 1MJJA 5L2JB 1FJ1B 2Z1PA 4Q0XH 1CI5A 3W81A 3QXDA 3N2JA 4WU5A 1X4YA 2YOAA 3DKHA 2JV6A 3DI2B 4OZFG 4TSAH 3PAVA 1A7RL 2IVFC 3D85D 1W0WA 3CX2A 1E8ZA 1J8SA 1OZTG 1UOVA 2SEBB 4M9OA 2R2EB 4YL4A 5B4MC 3CQFA 1OCWH 4HXAH 3PIQB 3MNZB 1QLEB 3IM1A 5BUGA 1J1PH 3ZTCC 1T1YA 2YUWA 2Q86B 1IU1A 2Y9RT 2JTDA 4DZBB 4G1EB 2XV0A 2MQCA 1H3VA 5B1BB 5C6PB 3EO1A 1A4KB 4E9YA 3AS1A 3EADA 2YD7A 4FMFA 2BVQA 1MFBL 3IU4L 4UUJB 4TMPA 4PJAE 3VD1A 3M17B 1CICB 1JPTL 5CGYC 2VABB 5ICZA 4MNQA 32C2B 1FFOB 1Z9NA 4PI0A 4GSRA 4XN8A 2ADIB 4I88A 4DP6X 3K6NA 3IFLL 3WTSA 3QZWG 3MJ9H 3ZHNA 3BH9B 3P54A 1CO1A 4OKVA 2GI7A 4YO0B 2JQMA 3IF1B 5DMIL 4OFVA 4FNLL 2PO6D 1G4MA 3OAYH 3TOPA 3PIQA 3P40A 1JV2B 5K9OB 1QVOA 2DQIL 2UXFA 4HAGA 1GC1H 3KLAA 1P4UA 2Q86A 3ZTNH 5I2IB 1RK7A 4DZBA 3EOTL 4HAKA 1CYXA 3QQ4A 3IMBA 2BXYA 4R5TA 4N2NA 2P42B 3LCYA 4NUPA 2XZQL 4QWWC 2P5WB 5GGTH 3IAPA 2NQDA 4UUJA 4Z95L 3O8XB 3I84A 1CK0H 3ESNA 1SQ2N 1TTBA 1N18A 1T7VA 1ZLWK 1N19A 4XNZC 2PLTA 2Y7OA 1YN6B 3H0TA 5E2WH 5C0RL 2FBOJ 3J07A 4YGVB 2AZAA 4D94A 5ISZE 2BVPB 4ONOA 4XP9L 4F33B 4FFYH 1TTFA 3BW9B 2ZG1A 1JV2A 5K9OA 3WCYA 5FGRA 3SO3C 3B1TA 3A23A 3BIBX 4MMYA 3UH8A 2E6JA 4HK0A 4L4VA 2O5YL 1WTLA 4WI2A 5F3FA 2XWTB 5B7EA 4R5VA 3EAKA 3HUJE 5E6UB 1JNJA 4ABVA 4QRBA 4JKPH 4WNQA 3PE9A 1B0RB 1RJYA 4CADA 5F3BA 1YNKL 4YPGB 4NQDE 2DMCA 1NEUA 3QO0A 4I2XE 2XVBA 3QXUA 1AGFB 1VKXB 1JK8A 4APQD 1GZHA 3FTYA 3OZLA 4JMNA 3EHBD 2N7SA 2RQEA 1EK3A 1I3VA 4IIZA 4RX4D 4YE4H 3MRRA 5E00B 1IZKA 1N9PA 1DVQA 2HJFA 4K4KA 3VRJA 3VQ1C 2ICWJ 1ZHKA 3U7YL 3MRNA 3QIWC 2I5YL 1CVRA 4X4XA 5C6TH 5T1LA 5A2FA 4L5FH 4YSTA 1HL4A 2HMIC 3OHXC 1RIHH 4AV4A 4Z7UE 4XNAA 3RRQA 1I4FB 2ATAA 2GEEA 3MKKA 3ZK0A 1E3FA 5FA3A 1GW0A 2P44B 1HWWA 1A9EB 3KGRA 2WK2A 2DQHH 2WM0A 1NPNA 3AGWA 4KAQH 1QI3A 3PG2A 2OMXB 5F1IA 2VRKA 4NZDA 5E6RB 3VXTB 3C8DA 5GRVK 1FORL 2VLKB 2APVA 2ZKXA 1TQVA 3U4AA 3BKJH 4LHQB 3HB3C 2WYZA 3EBIA 1UHVA 3GSUB 3MGTB 4K9EL 3TFKC 1A6AB 1EJOH 2ZX8A 2BRRH 3C8HA 5E00A 3BAXA 4HC1A 1UC6A 3QUZD 2VGLM 1JZ7A 4ZTOH 4V1DB 1SBBA 5AVYB 3OAWA 3FQNB 2XQBL 1FZJB 4OF3A 4YNYA 5ITBL 1DTUA 3VFOB 2WLJA 1YEEH 1E9OB 5TF1L 4TULH 5CUSL 1YEWA 5CR1A 1I4FA 5KW9L 4Y19A 2P49B 4LEXL 3ALPA 4LHUG 4PRHD 4P2RA 3QIBC 4RAUB 2OMXA 4PW3A 3ULUD 2K9FB 4NWTH 5I30L 3V5HA 3TBVA 4IOSA 5JOPE 3BAIA 2VWEC 1KLUB 1SYVA 3ZYIA 1M7DB 2A9ML 3DBXB 4YWGH 4IRJA 5HDWA 4L3FA 1M56B 1U8JB 4OTXH 3UJTL 4BXVA 5HHOB 2APSA 2FCBA 3B5GA 3LPOA 1NCJA 5IJKA 3MJ9A 4JQVC 5D7SH 1J10A 1PKOA 4JFUA 1BPVA 5CINH 1K5NA 5B3SB 1IBGL 4FGMA 5HHPB 3VFOA 2BFGA 1VPOL 2F54D 4IJ3C 1E9OA 1QG3A 4ALAH 4JDEB 4JKNA 4NIKB 3QEGL 4MNQD 5HGHA 4YDNA 1TVBA 3PPSA 3TBTA 5IHBA 3TJPA 5I18L 1T7YA 3V6OA 1TEYA 3FB6B 2O6PA 2ENPA 4KQ3H 5JUEH 1KY6A 4BHUA 1QHOA 1URZA 4U6HB 3I02A 3TO4C 4UZSA 1BQLL 2N4IA 1AXIB 2ZAIA 1DBAH 4L05A 1A7BA 5C2BL 2O4EA 3GBLA 2KH2B 5ES4B 4LSUL 4M7ZC 5HHOA 2A77H 5ENWB 2BSDA 1XCQB 1M71A 1UB5A 3MODL 5I5JA 1LO5B 1JGVH 1USZA 2GI0A 3LZLA 1H19A 4LU5L 5JW4Q 1FL3B 4DPAX 1CICD 5DRZA 5AW5B 5IW1B 5CLYA 3KJ4B 3RVUD 3DTXA 1VIWA 3C8KB 1U8OA 1C12A 3V2AR 2UZYB 3F12B 1A6UH 3K4ZA 5J3HD 2Y06L 4OBSA 1I1AB 5T3XE 2EUVA 1XZ0B 4PB0L 2MNJB 5GGSA 2ICWB 5IQNA 4U6HA 4NP9A 5J13B 3LS5H 3FUIA 1UWGL 1MFNA 4XCCL 4IIQC 4QXUL 1TT6A 4QRPB 3U9WA 2PCFB 1J0IA 3MFFA 4FG2A 1TQWA 2VDPL 3P0YH 2JLLA 5BOZG 2YR3A 4HIPA 4GFXA 3C6LC 2X2JA 5GHWH 4AJWA 1I9IL 1KEML 5I1HH 4OJFL 1H6FA 5TE7H 5B1JA 2Y5TA 5KSBF 3QDMB 2GFBB 2Y5QA 3AADB 4H0IA 2AEPL 2YPKA 2GK0A 2W95A 4HJ0C 3EBHA 1S9WB 1I1AA 5K9JH 1FYTE 1QHQA 2IPUK 5DHYA 3FXIC 4OGYL 5DRXB 1S9KC 1HYSC 3DPBB 5DRNB 2Q8BL 5J8OA 1WBZB 1MZZA 2PCFA 3V0AC 1D3CA 2GJRA 3JTSB 3B3IA 4I48B 2IQAB 2XJKA 2XWBA 4ZFFB 5IY5B 3L5WB 4PG2A 2ATKB 1XAKA 5CCJA 2J5LB 2PW2B 5HHVH 1NINA 1L7TL 1KCVH 3JWDL 5INDB 1UT9A 2KDYA 2GITB 1LO0L 5DQ9B 4JFQA 3QDMA 3PV6B 5E2UL 4LF3B 5A6LA 1VZIA 1DDTA 4FQXC 3RURA 4F7MA 5MEOA 1JCVA 2C9XA 4UT7H 3OLEA 6FABH 3TYGL 2X4TA 4ZO9A 1D9KA 1NTDA 1ZLDA 1XF4A 3KH4A 5CHNA 3DPBA 2Y23A 1O6VA 4P07A 5FO7B 3JTSA 4R90H 2XY2A 4KPHL 4AZ8A 2HVKA 2J8OA 5I1DB 3VSQA 1NANI 1JZDC 4BGLA 1A47A 3L4WA 1WWAX 3HVNA 5FUCE 3I2CH 2Q7YA 1FC1A 2CDFA 2H6UA 4N3TA 5DQ9A 1V54B 4P2RD 1Q4NX 4ZFOB 1FLRL 1I7ZB 6TAAA 4HLZH 1ZGLM 2BWIA 4TUKL 2VLKD 4N90E 5F1SA 5F96L 1HT6A 2ZWSA 1U8NA 4GAAA 5AW7B 3VGEA 4OGXL 5KS9B 3KYOB 5AW1B 4HJGA 2VMDA 1UFUA 3CK0H 3U6XS 1IM3A 2X9XA 3HCVA 1HCYA 5DHEA 1OPOA 1ZHLA 3WS6C 3EYUH 2VN7A 2FBJH 2WSDA 1KBPA 2A4ZA 2HKHL 1U21A 3W38A 2X70B 5CFHA 4QRTA 3HMWH 1WE5A 2R0ZH 1P1ZB 4KFZC 5GQBA 3OMNB 2X1QA 4JFPA 4QNPF 4WU7A 3SKOB 1KCRL 3SDCC 5GZND 3QQDB 3S96B 1CBJA 1HQRB 1UM5L 4YFDB 3APMA 4WDIA 4GSUA 2FQFA 4WNJA 3SYQA 1TUPA 4R7LA 1OWRM 4PRIA 4FQCL 4DESA 3BZDA 5F7NC 2LOEA 4WAFA 5CILH 3GXTA 3KYOA 1JV5B 1NKOA 3MLYH 4JCLA 3MRMA 5HHOD 3REVB 5KVEH 1G84A 3ZUCA 5L88H 1S5HB 4P9MH 1B2WL 5KSBB 1KYUA 3HJ0A 1EXHA 4NUJA 5LG1A 4N8UA 5LBSL 4ODTL 4CNIA 4DW2L 2AJVH 2ODIA 4YLQT 4GAYB 3ECUA 3RIAF 4PJ9A 4DO6A 1BD2B 4QHLA 4EEEA 1DJIA 1HHJB 1MPAL 2JE8A 4P5TC 1MUJA 4M1GH 5A2IH 1IQDA 3VGAB 4DEPB 3DIFA 3ZIYA 4BV1A 1NUGA 3IRCA 2DQFB 3L5XH 5B1AB 4M5YH 3VXNB 1KJVA 2EH7H 4QRQB 2SODB 4AXWA 3KLSA 4N0UE 5E6SB 2DICA 1DQDH 3E8VA 4ZMXA 5I66B 4WO4B 5HTSA 3WEOA 2WXKA 4NHUA 2WBXA 4AT6B 1L0YA 1O7VA 5D1XA 4F93B 4LSSH 4KNSA 2HVBA 3LZQA 3UTOA 4NN6B 3EYSL 1KLGB 4UNTA 4QJ5B 1W15A 1YN7A 4YDIL 2J6EL 5AKTA 2AF2A 3D18A 3FFOA 1SLUA 3IRZA 1UWFA 4N0FA 4WK2B 1A8ZA 3GRWL 2BK8A 3VE0A 4KKZA 4D0BA 2G2NA 2CCVA 3JYCA 4MWFA 5L4JA 2ZCZA 2YD4A 1I1AD 3MCKB 3TBYB 4FYRA 4MD4B 4MMZA 2X4UA 4IKLA 1EERB 1U41A 3GKWL 2EE9A 4KKPA 4KVCL 2YWZA 4KHTL 2DM7A 4PGBA 4X6CA 4DGIL 2ESVB 2HG5B 4QRPD 2QSVA 3SD5A 3AW5A 4WSKA 3BD4A 5I66A 2LHAA 3H9ZA 3MROA 4IU3A 2BY3A 1CF8L 4W6XB 5EA0L 3CPLA 4WWNA 5CD5D 1OAKH 2OXGB 3JVGC 5SWQB 2X6VA 1Z9MA 4UV4L 1QBLH 2EDTA 1KLGA 2K4WA 5AVSB 4WJKB 3FTXA 1NSNH 3O9WC 1BCIA 1AGBA 3GHBL 2D2OA 3K3QA 3QDMD 2J1KA 3A67L 3QNZA 3ZE1F 4O02H 3QRLA 2JK5A 1ZVYA 2X6UA 3LQMA 3O2WH 4TNWF 4JCWA 4JY6A 2EC8A 2EJ1A 4GPVA 5K93A 3TBYA 3MCKA 4P2OA 1RP9A 4TSAL 3SCMA 2RQ8A 2XA8H 5LGKA 5F89A 4G6AD 4OZHE 5HD8C 2FIRT 4TNVF 5CS7A 4C54A 1VADA 5EUKA 4LIQE 3PWVB 4BGDA 4FQ1H 3WGVB 1PX4A 1CXEA 1TQBC 1WBYA 2AK1H 4MVBD 3NTCL 4HXAL 2NY5H 4QPEA 2H2SC 3PUUA 2RTTA 1XBRA 4XPAL 1AD0B 5EC1B 4E0RA 1NAMA 2NNRA 3GS4A 1PVHA 1DUZA 4IRSA 3OR6A 5L8KB 2ADJB 4DKFL 1N0LA 1WUNT 3EO0B 1IIIA 3FU7A 3PWJA 1ZEAH 1BLIA 1OSZB 2JB6B 5GIRB 4F27A 1TKWA 4NP4L 3DVIA 3DURB 3BAEH 3N1MC 2A74B 5E24E 5CCHE 4NT6A 2DL2A 4KDVA 1TVHB 2EIKB 5I75C 4QRRA 5FGBC 4DUVA 1D5BB 2CO4A 2K6WA 3AG3B 3LKOA 4WWKB 3UAFA 2W60A 3RHWK 1NIDA 5DZLA 4KKCD 3WIFA 4H26A 4PVLA 1CMOA 5GS1C 3OAZK 3ARBB 3VX1A 1AE6H 1WP6A 1AD0A 1WAAF 1GC1L 3UO8B 3SE3C 3ZTNL 4AQOA 2I60H 3LXUX 3PUCA 1EZUA 4NOFA 3UTZB 5F93C 4IW4C 3C87A 1I7RA 3TBWB 2CKNA 4DKTA 5J6GB 5GGTL 1E3ZA 5GIRA 5BZWB 4YHMH 2JQZA 3C6SA 4JGMA 4O4YH 1CK0L 2HT3D 4UQ3A 3DUUA 5ERWB 3B9KC 4YSEA 1QSEE 2PCXA 4AG4H 1JVLA 4WV1A 1D5BA 1PU0A 1CT8B 2OMBA 3N40P 4G8IA 5E2WL 5D7HA 4XH2B 1OTTD 1NCCH 3MRQA 2PYEB 5DDHA 1OGAE 2APXA 4FFYL 1UA7A 3SBRA 2DQ6A 3N06B 1J9TA 4UIMB 1DL7H 4JFXA 4HEPA 4PJ7F 3TA4D 5AL8A 2E6PA 3CH1A 3MLUH 1G9ML 4WUUE 2LU5A 4PJ9D 4LCYB 4W4NA 3FB7B 3UBHA 1CDGA 3TBWA 2JI3A 3VFTA 5J6GA 2W9EH 5F8RC 5CO1A 4G11A 1NCHA 1B0WA 4KNTA 4K8RH 3RUGA 2DV6A 1UYWL 2Z4QB 3IDIA 4DGUA 4GLRH 1NUDA 4MB3A 4PRNA 2NXYC 3L9EA 1ANUA 3P73B 4HCIA 2NY0C 3OM3B 4CDGC 4KJWC 3D0AA 2DN7A 4O02B 3T0EC 4PMEA 2HFTA 2PYEA 3FRPG 3FPXA 3EFFA 4YE4L 1YEHH 1BSIA 5I1LA 3ZE1B 1LE9B 3KEDA 4RZCA 1QFWM 2DKMA 4NYLA 4ZMZA 4OFPA 3C5XA 1IL1B 5C6TL 1KV3A 1KB3A 1DCEA 3D6GA 3HFFA 2WLNA 1DLHB 4YDLC 3H2QA 2E5EA 2AS5M 4KI1A 4BK8A 4Z0XB 3U79A 3WLBA 2DQHL 5HXMA 2XZCH 3HRZA 4A6YA 4JO4L 1OK0A 4DKEL 5FYJU 1LEGA 1AC0A 4Z7WA 3N1FC 4I9XA 1CFSB 1ETJA 2PW1A 4H8WH 4MCNA 3P4OB 1USQA 1BA9A 3O41B 3GTNA 4GUCA 4FABH 1EJOL 4WO4D 3CFEB 2BRRL 4ZX6A 2C9QA 2BSED 4RMWA 5EO1A 4PRDA 3CLFH 3EYQC 3MFGB 3Q8CA 4ZTOL 5JNYA 4WHTB 4YXKH 3LRSA 1JZ3A 4U4IA 3ULAB 1NFIB 4GSDH 1LQSR 1AZNA 4UB0H 2R29H 4ELKB 1Z0NA 5EU7C 2BOCA 4TULL 2J56A 1CGWA 5IJCC 1ZE3C 1EHNA 5PCYA 4F80A 4CSSA 4GEIA 2OKMA 3SCMD 1Z7JA 5HYQB 4Z0XA 2CGYA 3QC5X 2XFGB 3DRTB 1T7ZA 4Z3GA 4XP6H 2MTAA 2OCCB 3T2QA 2IH8A 2HN7B 4NWTL 1CFSA 1DJXA 2GSGA 5CSZA 5B7MA 4X7CC 3JV6B 3GZKA 2PETA 2X5PA 3L9YA 3WMQA 4JRYE 3CFEA 4CAGA 2K7PA 4ZUSB 4OM0H 4YWGL 1AVAA 1QWHA 1R5IA 4OTXL 5KAQG 2NR6C 3KL5A 2Q2LA 2Z31A 4PJBE 2J72A 1NLBH 4NQXA 4UDUA 3ZSSA 3KGTA 5D7SL 2I25N 1JHTB 3JVFC 5CINL 1FP5A 1FZKB 4Z3TA 4NO0B 5C0GB 5GRXG 4BM7A 1TR7A 4ZAKA 5I9QB 1DUYA 1BGXH 3EYOA 2D8KA 2QKIB 3EJUA 4XOBA 3ZVVA 1UCTA 2OW6A 2E56A 1TDQA 4FA8A 1FBIH 3MOQA 4NKIL 2GPZA 5E8EA 1RXLA 4NN7C 4XMXA 5HJGA 5AOJA 4KQ3L 1GYWA 4JFEB 5JUEL 2YD2A 1IGMH 1PNCA 4FYTA 3RFRA 2XZAL 2V5SA 2VDOH 3RE0A 5AOKA 5K1VA 3DYOA 3JV6A 1DBAL 1S7QA 3X1EA 4GW1B 2YGQA 5DMGC 2UZXB 3EZ8A 4XP5H 5E1QA 2IGFH 5D96B 5HDBB 2LLGA 4RA3A 1BIHA 1JHTA 2QGEA 3B7UX<