2YK1H

Structure of human anti-nicotine fab fragment in complex with nicotine
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
209
structure length
182
Chain Sequence
QLLESGPGLVKPSETLSLTCTVSGGSIWGWIRQPPGKGLEWIGSIYSSGSTYYNPSLKSRVTTSVDTSKNQFSLRLSSVTAADTAVYYCVAWFGDLLSLKGVELWGQGTLVTVSSASTKGPSVFPLALGCLVKDYFPEPVTVSWNLTSGVHTFPAVLQSSGLYSLSSVVTCNVDHKPSNTKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords FAB FRAGMENT, HEAVY CHAIN
publication title Different Binding Modes of Free and Carrier-Protein-Coupled Nicotine in a Human Monoclonal Antibody.
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 182
sequence length 209
ec nomenclature
pdb deposition date 2011-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yk1H02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2yk1H01
3QFJA 4QRTA 5CSZA 4LPUA 5KAQF 1OARL 1FL3B 4HS8H 3LKNA 5IROA 3O3DA 1DSFL 5E8DL 4JRXA 1AR2A 2HYMA 4ODUA 4QO1A 2C1OB 4QRUA 1OGTB 5LCVL 3S4SB 3SCMC 3T0BA 4NQXA 2BVYA 3IJYA 3BH9B 2WUBL 3HE7C 2Q86A 4WI9A 1QEWA 3W2DH 1T20B 1A1OA 1FFNB 3L5HA 4NFDA 4YK4B 3LB6D 3VXPB 3MNVA 4HS6A 1B9ZA 2XV6B 3M8OH 4PJ9A 1B4JH 3GJFB 2WUCH 2FD6H 3CFKB 3PJSB 2K1MA 4PRAA 1FLTX 1UEMA 1FNLA 2VLKA 4CGTA 3MJ6A 2R9HC 3KPRB 2AV1B 2PNDA 1IM9A 1BP3B 3EDEA 3PWJA 4HIIB 3RUGF 5IHBA 3AS1A 4WW2F 1CDIA 2IADA 2QADB 1ZVYA 2XFXA 5FF6A 1XF4A 4K2UH 1OM3H 4M7ZB 4TUOA 1IGMH 2PUQT 2R4SL 2YPLA 4NCC2 3D6GA 5CGTA 4PRIB 1EJ6A 4ODXA 5IROC 2BNUA 3F58H 2HMID 3P4MB 1QYGH 4YHLL 1JHLH 3JV0A 5CWSA 3D85B 4N90E 1X4XA 2XQYG 4O51B 3T1WA 4UTAL 4Y1AB 5DUBB 3ARGA 4JPVL 3RWJB 1A7NL 1LWRA 1A3QA 5I9QB 3U4EB 1BF2A 3BUYA 4M7KH 3U9PL 5MP6H 1D3CA 4FTVD 4PJ9C 3SDCA 2D7TL 2G9HA 1ZS8B 1IGCH 4H26A 3O2VL 4ONHB 5CAYB 3BN9D 1HKLL 1S7WA 3X3FL 4GMTH 3FHQA 4P46A 2QQKL 3V52L 5CLTA 1U92B 4OZIE 3MBEB 5MEQA 2G60H 4KHXL 4QOKA 3HI1A 3KPSE 4OQ1A 3MUGA 5BV7L 5GS0H 3G08A 3VD4A 1J88A 3IJHB 1P7QD 4L3CA 3C2SA 4TSBH 5GRJH 1FZJB 3INUH 1F2QA 1EAPA 4OT1L 3MC0A 1BZ9B 3PXHA 3ULVC 1UC6A 3WYRA 3DVNB 3H6JA 1DQDH 3IFLH 4EUPH 1VPOL 5DMGD 3VFSA 3O6MH 3GMOA 1IC7H 1BZ7B 5IWLC 3QO1B 1P2CA 4LOUD 3TA3D 1IZKA 4X8XA 1ACYL 3RAJH 4P4RB 1MSPA 5DJ2A 3HE6A 1MCRA 5HYJE 2IANE 2ED9A 2QKIB 1V5JA 4OJFH 3ARGC 1DE4B 1TVDA 2MFNA 2EDHA 3EIFA 3RUGB 4WW2B 3VGGA 3G6JB 5E1HB 1D5XB 5HSFA 4JM2A 4JFFA 3NA9L 5FGSA 2HRLA 4HMDA 1F11A 1QKZH 4H0GA 3DUUB 3ZTJG 4YDLC 4OLEA 1X3DA 5D9SA 1TPXC 5E2VL 5C08E 3KPQA 4J3SA 3NCEB 4Q0XL 4P46C 3S4SG 2IQAB 4BQ6A 4G42B 4LCUB 3QDJB 3TT3H 3B5GA 5ICZB 3VXRE 2DDQH 2RAMA 3ZL4L 3ELAT 3BP4B 3LEVL 1LMKA 3W82A 3RPIA 5IR1B 3D87B 3SY0B 4BELD 2ESVD 3JTSB 4PJHA 1R3IL 2X7LB 1ZLWK 1TVHA 3U1SH 3QP3A 1Q0YH 4C54A 5E5MB 1V7ML 1T66C 1VFMA 5HYFA 3UO1H 2JIXA 2F5BL 3H0TB 3MV7A 1I8KA 5DURD 3P30H 1IKNA 3HI6L 4GKNB 4JFEA 4YE4H 3V0WH 2BERA 4JKLA 5HHVL 3BZFA 4WEMB 4QRRA 3BXNB 3DRTA 2YC1B 4PTTA 2CXGA 5DVKA 3GSVB 3CSBA 1KCRL 3V6OC 1GXEA 3SKUD 5I2IA 1I1YB 4Z7UF 4U0RB 4R90L 2HTLD 1A3LL 4HK0B 4Y88A 3DX6A 1KIRB 3HMWH 4ZNEE 1FRGH 4JM2C 5F7EL 2J6EL 5J1AA 3MR9B 3O4LA 5HHME 3GSNH 3MCLL 1WITA 1YEKH 5JOPE 1FSKB 2WMPA 1EVTC 2DL2A 5IBUB 2X89A 2X1WL 4MJIE 1ZA3A 3VH8B 4EOWH 5DRWB 1I7ZB 2DMBA 4FNLL 4LGSB 5C0IA 3BD4A 1LHZA 2CK2A 2OL3H 3GSQB 1CS6A 1PX4A 4HIHA 5FECB 4MXQD 2X4NB 3WLBB 4FXKA 4KJWD 1SYSB 2R8SH 3QAZB 4PRPE 4LAQL 3AXLB 4P48A 3MCKB 3VJ6B 3E8UH 4R0LB 2X1XR 4HH9B 3ET9F 5KAQG 4JANA 1D5ZB 5DT1H 5IHUL 4ZUWA 1TQCC 3AREC 5D72H 3IKKA 2PW2A 4LIQL 3VFRA 5FHAL 5I1LA 5FYJU 1A14H 4P2RB 2HT4D 1RVFL 1CD8A 3WNLA 4Q9RL 3E6FB 4BSWB 1F02I 4X8JA 1S7VB 1W8OA 3EOTL 1RUPL 3R4DA 4HDIB 3VGAB 4E41A 1WFUA 3ZKXB 1PZ5A 3SGDH 3H8NA 5MERA 1J1XL 5SWSA 3FQNA 1VHPA 1GL4B 3NACH 2OP4H 5L2KD 5CD5D 3QIUD 3SJVB 1M71B 1G6RB 4XCCH 1XF5B 1MFBL 1F4XL 1R5VA 1XIWA 4Y4KD 5FCUL 2DTML 1BZQK 3OAUL 1KJ2B 1RJZB 1B0RB 4X80L 4LEXH 4D0DA 3ARDD 4HWZA 2IH1A 4W70A 3U7WL 1XMWA 1V3JA 1WCBA 4OBRA 5JOFB 1U8OB 4XI5C 3HPJA 3MGOA 4Y5VA 3X17A 3TJHC 3GSXB 4EXKA 4Z7UB 2FBJH 3LRHA 4AEIL 1EBAA 2HWZH 4WY7L 3I6LD 4NGHL 4OZ4A 1GHFH 3MXVH 4CU7A 4F58H 2EZ0C 3N1FC 4P4KA 2PCPA 3W0WE 2Y23A 4MWFA 2J8HA 3B2UC 1HYSD 3LDBB 4PG9B 1MI5A 3OKOA 3GBMH 2VXTH 1G7LB 2IJ0C 3ARPA 1IL1A 4CVXA 3KDMB 3CH1A 4NM4H 3EHBC 3MRCB 1T22B 3Q6FA 3SBWC 2E6PA 2E9WA 5I1AA 1DBML 1AGBA 1DCLA 3NAAL 5FO8B 2VZOA 4NZTL 1RURH 2KZWA 4PD4K 5DA4A 4R7NA 1OGAE 4Y7MA 1KLUA 4X6EB 2DM3A 2E9JA 2EICA 2CMRL 1XIWC 1EERB 1YEGH 4EDWH 4C55A 3BP7B 3QDMD 1NFDB 5EDXA 4L8BB 5D6DA 4OTXL 4CKVX 4NUJA 1YMMD 3FO0L 3P4OB 5EIIA 1N5AA 4LLQA 3FO9B 3VFTA 4U7KA 1CN4A 1IAII 3HLAB 3Q5YA 3HZMB 3N50A 2ITCA 5E4IA 2DQTL 1EH9A 3IS1X 4EI6A 2P5WE 3EDKA 4UNUA 1PGRB 3MLSL 5IBUG 4UV7L 4GRLB 5GXBB 1YQVH 3LN4A 4M03A 4KUZL 4NQED 1KC5L 5SWZE 4KXZH 3OB0K 3VH8G 4M43H 4N8CL 1M6OA 3OKLA 2I07A 1RUMH 3EDDA 1BVLA 1DL7L 1YNTB 3I6GB 1H3UA 3QIWB 1A1MA 3N1GC 1H3VA 4TVPL 4F37F 3L5WB 3BUTA 2Q3AA 4G9DA 4MAUH 1QFWM 3KLAA 1ZHNA 3ULUH 1C7SA 3U0TB 1PJ9A 1IAKB 3FAWA 4NQVB 2OR7A 1JPSL 3VXMA 1ZT1A 3F8UB 1KELH 2P4AB 2VDPL 4WO4D 4PV8B 3EO0B 1LO2L 4MHHI 1RQ5A 2IPTH 2X4SB 2Y72A 1T1YA 3CCHA 1XR8A 2KZ1B 3BWUC 1HOCA 1FFQA 1FO0B 3GMLB 2DIAA 3JTTA 4ZO7A 2HT2D 2H6PB 4WFHE 2IQ9L 3MRPA 5GGVH 4FFYH 3G9AB 3DNKA 1DLFH 3MLTA 3QHFH 2YR3A 4JQVA 3VI4E 1UWGH 4R4NC 1FHGA 5IBLD 4DZBA 1QO3A 5CEXA 4LBEA 1NUDA 2PKDA 2D31A 5DFVC 1S9WA 5KOMC 3W39A 2DBLH 2R1YB 1WISA 2XZQL 5GGUA 1VESA 4JFQB 4Y2DA 3BQUD 4WJ5A 4P2YA 4UILH 3OR6B 4B53A 1P4BL 1UM5H 1S8DA 2GTWB 4OFYD 5CS7A 3U7YH 1DP0A 1QA9A 4L5FH 5ICYA 3CGTA 5B39B 4ONGL 4WWKD 1Q8MA 2XG5A 1CFQB 2FBOJ 1HIMH 4RFOH 4X4ZA 2AV7B 5CEZD 5ICXB 2D7MA 2DQGL 1RZKH 1G7HB 2GSGA 5KG9A 1KB9K 1BQLL 3PWLB 3T0AA 2YA2A 1EMTL 4O02L 2YPVL 2IG2H 3ALWA 3WJLC 1QHPA 4PY7A 4RFEB 4R97C 4Q6IB 3FFCA 2NCMA 2WSKA 4IMLB 4U6HB 1KFAH 1MAML 2RCSH 3JVGA 2BNRD 4WU5B 5E2WL 4LHQB 4U7MA 4KPHH 3U2SB 2IMNA 2FIKA 5D4QA 1I9JH 3T0XA 5JA9A 5J1TC 2FDBP 1MFNA 5D1XC 1G7QB 2IPUG 2SEBB 3MNZA 4Z7WF 4OI7A 4MNQE 3P2TA 3UTTB 3MRIB 2DLGA 1C1EH 5LGHH 3HUJE 5I18H 4X6FA 1KPUB 3F62A 5C0GA 2A73B 4MA7L 3FO2B 1AHWA 1FH5H 3BOVA 3FQUB 5IM7A 4KQ3H 3BP5B 1J11A 5DQ9B 4YPGA 1ZLVH 1RPQA 1HYRC 4ETQB 4OQTA 3DROA 4RFNB 4XNQA 2BVEA 1MNUL 1C5DA 2UY7A 3IDJA 4JB9H 1HHKB 4L3EA 4O5LH 4P49A 1XAUA 3V4VH 4HUUB 2XXCB 4L4VD 1NDMA 1XGTB 4PGDA 4QXGL 4ZPVB 1U8JA 4JN2A 2ARJB 1R5IB 4UT9H 3MV8D 4P5MA 1X5HA 2NXZC 4DZ8B 1U8HB 1GGCH 3IU3A 5E4EC 4LQFH 1YECH 1NCWH 2RB8A 5DJ0A 3TO4B 5B3JF 3WS6C 3IKCA 1J8KA 2OSLA 4KVNL 5HI5C 5E99L 1YPZE 1UCTA 1I1AA 4M62L 2X40A 3MMEB 2GJ6A 2H45A 4HUKB 1IBGH 3WE6A 1F3JB 1A8JH 3MRJB 4ZAKB 3BN3B 3PP3H 2I24N 5C0AE 3SDAB 1XCQB 3F7VB 1MFEL 2IMMA 1MJ7L 4FHBD 4D0CA 4MNGB 1N7MH 1S7XB 4RX4A 4F15C 1QLFB 3GJEA 4L8DB 1IGYB 2O5XL 2YUXA 1E4XH 5E2TL 2X44D 5EBGA 1EEZB 1IFHH 2HFEB 4G8GE 5ENWA 1G84A 4WUKH 2BSED 2ZSVA 4ZO8A 3DUSB 3VFNB 1BGXH 3PQYA 1PG7X 3S37L 4MAYA 4AIZA 5E95B 3AFLA 5FUCC 4TUKH 2AXFB 1NAMB 4RGND 3ZSSA 3K2UL 3D25A 4JKMA 3DIFB 3HRZA 5D7KE 5LXGL 5L7XL 2AK1H 1YYLL 2DF3A 3SE3A 5ADPH 1MHCB 1ZK9A 4OUUB 2YKLH 1SM3H 4R96B 43CAA 1G7JB 2W9LA 4OQTL 5F21B 3RGVA 3T0EB 2NY2B 1QACA 5ITFA 1S7QA 4K9EC 3ZHLA 2YOCA 1NAKL 5KSBF 4M7LH 4EN3B 1K4CA 3MRNA 1J8HA 4QCIB 5DZOA 5I1IH 4N0FA 3I02B 2IEPA 4ZXBA 2X4RB 4IRJB 3MRRA 2XWTA 3AS3A 1A6UL 1LEGB 4QHUB 3FT2A 2W0FB 1RZJH 1U8IA 5ALCL 4N5EC 1HN1A 1XZ0A 2ZPKH 3RU8L 1KJ3H 5ISZB 3L3OB 1MJ8L 2GJZA 4QHNB 4MA1C 2AK4D 3N85L 1MCHA 3QHZL 4MQXC 2LFGA 4GBXB 4DAGL 3SDDC 3KR3L 2PW1A 5FGCE 1AD9B 2VUOA 1CICC 1U6AL 1ZGLA 5H94A 3G5VB 2IBBA 3WIFA 4LSVL 1LO4H 1R3LB 1AH1A 4PGBB 5BVJB 3WLWD 4X6CF 3HC0A 4OFPA 1MLCB 4ZFOB 3ZKQD 4QRPA 4HLZG 5DJAA 1JZ7A 1U8LA 4Z18A 2QSCL 1IILE 1L7IL 4WVRA 4M6OH 4DN3H 3PL6A 2YZ8A 5GRUH 5SWQA 1A1NA 3WEXB 4ZXBC 5EWIH 3QIBB 4LVOB 1Q0XH 1UH4A 5EIVA 2YBRA 5DRNA 3C60A 4LNRA 3OG6B 15C8L 1N59B 1KXQE 5DHXB 2LTQC 4WRLA 5T3ZD 3MLVH 3VFWA 4ONFH 3CDCA 5A43C 5A3IC 1CG9A 2N7AA 1NBZA 3EAKA 1T83A 1OARH 3OKDB 4HUNB 2VJXA 3GM0A 4XBGB 3UJTL 3GHEL 2VLRD 5IBTH 1B0GB 2CPCA 2EO1A 3ORJA 2BZDA 4OAWB 4XXDB 1NCDH 5EOTB 1A6WL 4S2SA 3G5ZB 3FN0H 1M7IA 4UINH 5I74C 2B1AH 2WWMD 2WUBH 1TJIL 1JF1B 4NO3A 4MD5A 3BJLA 5EBLB 1JGEA 4NC1C 2V17L 4Q2ZA 5DSCB 5ANMB 1I7RB 4PJGE 3GEWB 4L1HA 3PL6C 1CFVL 1KJMB 4XHJD 3RWDA 1CGWA 2AKRB 4LPTA 4EI5A 3VRIA 3DYPA 4OCSL 2I5YH 4YHNB 1UACH 3C6LC 4OF6A 2VLJB 1ETZA 5ADOH 4LK4A 1JV5A 4MCZA 3UYRL 5ITBL 3C60C 1U8QA 2V9RA 3IXAB 2AJYL 4KQ4L 5E94A 4UU9A 3ZYOA 5KN5B 1XGQA 4OLXL 3EW3B 3HNVL 3MCG1 4OZHF 1FG2B 3SKJL 3UTTD 2PXYB 3T65A 4QWWC 3TBSA 3MYJA 5EG6C 5IHLB 4KROC 1UADC 2R4SH 1LP9E 1DANU 2BHUA 4XP6L 4BFIB 3ES6B 4HZLA 3E2HC 4YHPB 5C0EA 3DRQA 2RBLA 3PDDA 3B2VL 3LS5H 5HHOE 1QHOA 3S36X 2XN9E 3WO4C 1QBAA 1C7TA 2EYTA 5AEAA 1AFVL 3SKMB 2H8PA 3ARYA 4JPVH 5HYSB 4ETYA 5T3XL 2AEIT 1QSEE 4GW5A 1ZHBA 5DUML 2D4FA 3UTPE 5J12B 4Z7QF 1NCCH 3C09C 5DEGA 5IG7B 4PJEE 4G80B 4U1JB 4JY5H 4BFEA 4P2QB 1P1ZB 4X7SL 3GSRA 2PF6A 1FZKA 4ZDHB 4C56D 3DYOA 4OD3L 1T2QH 1CXLA 5CUSL 2VKXA 3EOAA 3X3FH 4JFXA 3V8CA 3WDJA 1TXKA 2BY0A 5IP4A 3QUXD 3RZCB 4PV9B 5I16B 2IPKB 3I6KA 2QSVA 4QHLB 1U8MB 1NKOA 3EYVA 3RWGB 4KRPC 1NGWB 1W72A 2XWJB 5FK9B 4BH8A 1MFDL 1FBIL 5I8CA 3SDAD 1YEJL 4X6BB 2H9GA 3JV4A 4OT1H 5AZ2L 4M1CD 4NHCL 1JWSA 4ODVL 2AABH 2H32A 4G8FB 3B43A 3O8XC 4JRYE 3BZEB 2VDNL 1DDHA 2E7HA 3IDIB 3UMTA 3BP6A 1KN4L 4JPWL 3S7GA 3ULVH 5KVGH 4WEBL 3WS3B 3KPOA 4OZHB 9CGTA 5E08L 1MUJB 3NA9H 4X4ME 2BNQE 2V7NA 3SE4C 4J7RA 1NCAH 1GPOH 2WM0A 1JNHB 4N8PA 3TBWA 5I66A 1VACA 1K8IB 4YUEL 4Q0XH 4X98A 2NY2D 5EU6D 4G8EA 1N5YL 4GG6E 2BMKB 2QQLL 2DQUL 1BD2B 5TH2B 3BO8A 4NQDD 3QBTB 4J3WA 1CE6A 1JJUA 1OAZL 4XMPL 4K7PH 3TJEL 3LEVH 5CEYA 3V9FA 5FKPB 4B0MM 2WIIB 2OZ4L 4IRJD 3CFBB 1YEEH 4QT5A 4NBYB 2P8PB 4BZ2H 1E0OB 1BAFL 2HFTA 2VTFA 1I4FA 2FEEL 1RUQH 2BRQA 5ETUB 2KBGA 4GW1B 3S34L 3OXRB 5LKNA 5CGMA 3U36A 4JAMB 2F5BH 3HI6H 4OCXL 5HDQL 1T1XA 2FH8A 5HHVH 4PJDF 1W72L 2IANA 2KL6A 4NNPL 5C0DB 3V5KB 3RWIA 1KCRH 2NX5E 1PBYA 2JK5B 3LKQA 3FRUA 3RVXD 4N0UE 2HKHL 4JDVA 4F9LC 1TJHL 2J6EH 5IMLA 2BOCB 4Z8FL 1AXIB 1BJ1J 4K94L 4UQ3A 2AXHA 1QR4A 3MCLH 1XGRA 4XB7A 5C0NC 4UIKH 1Z6JT 4Z78B 5JW4R 4ZFFB 3UBXB 4MQSB 5L8JB 3T0VA 2YD9A 4F7MB 5JMOC 3D2UA 5AYUL 4RGOL 5HYSG 4JY4B 4MXVE 4OLYH 4FNLH 1VERA 1KCUH 2EXWD 2FWOB 3VXRA 4LAJH 3K4AA 1J05B 3LKOA 3QSKB 5IEHB 3OMZA 5TDPA 1JWMB 3OJDA 3MRMB 1WWBX 2JJVA 5T5NG 1YY9C 3IVKB 4LAQH 3KYKH 4WHYG 1CLOH 1I9RH 5DQDL 1P84K 5DJCA 4WI4A 3IF1B 4BZYA 2VABB 3RJDA 3GI9L 4O9HL 5FHAH 3LD8B 1I1CA 4D0BB 1ONQB 4TULH 3ULUF 4OLVL 5D5MF 5C09A 1BQHB 2VDML 2ITDA 3EOTH 4XMLL 4P5TB 3C8KB 1KTRL 2NY3D 1AGFA 4XNZC 3MV11 1N8ZB 2XQBL 3QDGB 2PO6A 3I75B 1LO5B 3BPLC 2Q8BH 2ZUQC 3T77A 1BFOB 2A9NL 3AMKA 4M7JL 3IAQA 3KVQA 1MFBH 1F4XH 3V5DA 5CD3A 3EOBB 4Y4HA 2ADJA 3OAUH 1ZWIA 1XGYL 2R1WB 5DK2B 4ODTH 1AQDA 3EJZC 3QT2A 4YBLC 1LDSA 1CWVA 1FORL 4X80H 2P45B 4DGVL 3ZDZE 4L3AA 1QZ1A 4MSWA 3D0LB 4ZUSA 4FG6C 3SDXE 1NGYA 4KZDL 3W11C 2V2XA 2FHCA 4PJ8C 3RX8A 4KHTH 3UJJL 3BYYA 4PRPA 3OKNA 3QWQB 4MX7B 2IALA 4DQOH 3AS0A 4WY7H 4XP1L 5I75C 1U3HD 4ZSOA 2VR4A 1PG7W 2CR6A 2CLRA 1GCFA 4S10A 4PJ7A 2OXGA 3QPQD 3ZE1F 3GK8H 1CXIA 4JFDB 1J86A 2FJHB 4LCWB 4KMTL 4PJAE 1LE9A 2YA0A 4Z7VB 2CLZA 4ONOA 5GRWA 5HYQB 1DBMH 4K23H 1HI6B 4PREB 3B9KB 1NDGB 4LNVA 1S5HA 1Q94B 1BBJA 2XPGB 5ESVB 1WT5A 5GS0D 1N64L 4P2OB 4P3WA 2CMRH 4X4YA 5JW4M 5DJDA 4Y4HC 4I4WA 3Q6GH 3EOYG 3EBAA 4P57A 3F7RA 4L9LA 4MB5A 4QXTA 2Y4SA 2DYPB 4OTXH 5GGTH 2NLJA 1RJYA 3FO0H 3PGFH 4WFGD 5DD6A 4WV1C 5DYOB 3MA9H 1U0QA 1VENA 5D5MB 5TPWL 1BIIB 3TNNA 4HPYL 4NO0D 1IMHC 3B9AA 3OTTA 2CIIA 3FMGL 5C07B 3IFOA 1IC1A 1AO7D 2IAMC 4F8QA 5D7JB 3FZUC 1EVUA 4HX1B 4LPVA 5D7IF 3MFFA 3UTQB 4UV7H 3UBXG 5JXED 4PB0L 4HKZA 4KVCH 1SVCP 5ACLA 3ZYJA 4PJFE 3RQ3A 1WZ1L 5I17B 4N8CH 3W0WA 2CK0H 4JLRB 1HWGB 3RL1B 1JYNA 5FFLA 3L3JB 3IT8D 3BZDA 3MRGB 3MREB 1FN4A 3GKWL 3O45B 4FTVA 3BEVA 4HGKC 4G9FB 3LN9A 5B4MD 1HQ4A 3MJGX 3P0VH 2CJUH 4Z95L 2FZ3A 2ZKHL 4FQPA 1KF9B 1OGAA 1VFAB 1LO2H 4CRPA 5M95B 2AERT 2Y9RT 3HPLB 3K7UA 5JPNB 1KENH 1OTUD 1KULA 4LKXA 4NUGL 4XPAH 1P7QA 5KANI 4LLYB 1CCZA 5J57B 2HVKB 4GKZB 2XY2A 5IVZA 2OI9B 5TF1H 4XH2A 3HG1D 5MI0C 1E6JL 3F5WA 3NN8A 2Z91B 5D1ZB 1S7UB 5GS2D 4HFWA 3LQZB 2P5EE 3FQWA 5TE7H 1YEHL 3QRGH 3KXFB 5KZCD 5SWZA 5IW1B 1BD2D 5DA0B 2HFFA 5HTSA 3NH7L 2FHFA 4J12A 2RFXA 3RVVC 1R3KA 1P4BH 2V2TA 1OY3B 4NBZB 4DUXA 4TUJA 4FQCL 1UEYA 1SY6H 5DD1L 5GIRB 2WWKO 4MVBD 5IMOB 5DJXB 4Z0XB 3FOLB 4KH2A 5C3TA 5FYJE 2G75B 2P24B 2GUOB 4XVJH 1BQLH 2OJEA 1KNOB 4OUOA 2R15A 3L3GB 1MQKL 2ZCKH 2Q76B 1UB5A 1DBJL 1CT8A 4FFWD 2YPVH 1FVDA 1J18A 3MRFB 2DLFH 3H9HA 3GO1H 3VXUB 4X6DF 1FCCA 2FX7L 4NIKB 5L8LB 1PDKA 4H1LA 4EQ2A 5E2WH 2CXKA 3MLZH 4Q7DA 4NRZA 5AD0B 1OP9A 2XA8L 1WAAA 4JFYB 4M93C 4F2MA 1HCFX 3DTXA 1GOGA 3LN5B 4HWBA 2DQCL 1X5IA 1JFQL 3IJSA 3QNYB 3WD5H 3BT2L 3CZFA 3VCLB 2VO5A 4OZFA 1FAIL 3NFSL 3CFCL 4LCYA 2VZUA 4RIRB 2R2BA 1N4XL 5CINL 2HN7A 3IAPA 1WEJH 1KGCD 3HAEG 3WFBL 3R06B 2O5ZL 3U46B 2OLDA 4JZOA 5AWNH 4LHUD 1ORSA 1FFPA 4AL8H 1BEYH 4H5SA 2EYRA 2BVTA 3QXTA 3EO9L 4M00A 1UXSB 1QNZH 4R26L 4LRNH 1MNUH 2APFA 1CVSC 4Z76B 1PEZA 4DK3A 1SJEB 3BRGC 3K46A 4QXGH 3MOAL 3R0MA 3CVHB 3PWPD 1ULVA 4XZUB 1QRNE 2P8MB 3B8YA 2OJZL 1OW0C 4NHUB 5JA8B 1FIGL 1DEDA 2MPAL 4XT1C 5DMYA 4XXCA 1T2XA 2YS4A 3P77B 4P5TD 3M17B 2CLVB 4M61A 1RUAL 3EKCA 1A7QL 2RHEA 4YBQD 1PD6A 5E99H 1VGKB 3QULA 1YDPA 4M62H 4N1CA 4DK6A 4BFBD 2HP4A 5EU3A 1OP5H 3RY6C 1I3GL 3VG0L 1INQB 1EUTA 3QR2A 3TH3T 4WFFD 5EZIL 4IIQB 4Z0BH 5J1SC 1DQLL 3F12B 2ORBH 1IT9L 1I7TB 5CP3A 3JUZA 4S1QL 3ROLB 5HVGB 4ZOBA 4AIOA 5H2BB 4HWBL 4X6DB 5F96L 2O5XH 3IFPA 3T4YB 4GSDH 2AJZB 4PJXF 2JB5H 2FEDC 3TBTB 4JFOB 5L2KA 1RIHL 5FUZL 3QIUA 4YC2B 1QSFB 3VWJD 3SGJA 1A7OH 3K2UH 5JIHA 5D2NE 1WBYB 1KJVA 5F9AC 2IF7A 5D2LF 3KPMB 4JQXA 4PGJA 1F58L 4O4YL 4J1UA 4JGJA 4WDIA 3MGTA 3ARDA 5CLWA 3B5HA 4NO5A 1MREH 3LQAC 3RDTD 3G5XB 3T4AA 2ZCLH 3FN9A 3MLUL 2EC8A 1NAKH 4WENB 3CJJA 2WZPD 3VXSB 3MROA 4ZOEA 3KPPB 3BAEH 1UG9A 5EO0A 1FNFA 4FABL 1KN2H 4PLKD 5F1KC 1ZA6B 5C0AA 3A6CL 1HK6A 5B22A 3ILQC 2E8ZA 1Y6KR 1LEIA 5E1AA 3ARBD 5HGDB 3ULUD 1OAYL 4K9EH 3NVQA 1OB1A 4JPIA 3O4OB 3TN0D 4NZRL 5EBMB 3IXTA 3DYMA 4OCNC 1MJ8H 3S6CA 2X4UB 3KPNB 1JE6A 4G8GA 4ZTOL 4BK5A 2XA3A 1Q72H 3I3EA 1NSNH 3QHZH 2HTKC 5D7JD 4FQLH 3U7AA 4DAGH 2ZOKA 5E6IB 4OLUL 3PHOB 5SX4H 5F1OB 4LSUL 3FT3B 3O6KH 5DUPH 4PPTA 3DGGA 3REVB 3BMWA 5CZXC 3D0VA 3TIEB 4MCYA 1J9CT 4EBQL 3QDMA 4D3CH 4PJBA 5EOCJ 2PR4H 5H8DA 3VWKD 2Y06H 1R24B 1EV2E 3MRKB 4FQXC 4YDJB 5I76A 1YMMA 3LIZL 3Q3GA 1T21A 3EUUA 3OXSA 4G9FD 4AH2B 3OPZL 1L9NA 3K81A 2COQA 3CK0H 3QXVA 2ZUSA 2QSCH 3RTQC 4U1IB 4DCQA 2HG5A 4CNIA 3BEWB 2FR4A 4D94A 4KKLD 3CSYA 1RK1B 1MHEB 4NQEA 2YD4A 4L8SC 4Q74A 3GNML 4NRXB 4M4RA 1VADB 5CMAB 3U82B 3GMPB 4OGYL 5DFTA 3D5OF 5C0CE 2DLIA 3ECBA 3UZEA 2ICWJ 3HI5L 3FONB 1FDLH 5D1ZD 5F1NA 5D70L 4ERSH 4HT1L 2XWBA 1RIUH 3O11B 2AJVH 4XRCA 4JR9H 4MA3A 4WO4A 5TGBA 1IEBA 4LSSL 1G7MA 4IEFB 3O6FD 3LY6A 3VE0B 3FQXB 4JEGB 5SX5H 2EDBA 4GRWH 2Y7QB 1HEZB 1NMAL 4Q9QH 4ELMB 1FYTB 1D9KC 3ULVF 1EFXB 5ID1B 5I71B 2H2SC 5JPMB 2AJUH 2DQIL 3NGBB 1BIHA 1H8SA 3O0RL 1IZJA 1N3NB 3ARSA 4RZCA 4PJCE 1U3ZA 3WFEH 3C5JB 2V17H 3BWAA 4GAYA 1YMHA 1RZIB 4KV5F 4PJ5B 1NGZB 3L3HB 3F65A 3BVNA 4OCSH 4Y2OA 3BQUA 3O9WC 3WV0A 4JO1L 3DX8A 4NKMA 4D9RE 1YY8B 4OFYA 1CD1A 3GB7B 3LEYH 5ITBH 1X5ZA 4MD0B 1OT1A 2AJXL 1VEMA 2AJYH 4PRBA 4WWKA 3QFJB 4QRTB 5IVXE 5CSZB 5IGXL 1J5OH 3BD3A 3IFNH 3ARFD 3BDYH 3H42H 3HNVH 3LKNB 1ZLUH 1OTSD 3O3DB 3TVMD 5E9DE 4JREB 4ALAL 4KJYA 4JRXB 5C0RL 1F4YL 4ODUB 3JWOC 4RBPH 4BA8A 1IVLA 4QRUB 5FHBL 1BQUA 1QFWL 3IJYB 4NQXB 2FO1A 2R2CA 4EDXA 5I8OL 4XP6H 3AB0C 3KYOA 3FTGA 2Q86B 1QEWB 1K6QL 1A1OB 3B2VH 3DECA 4PP1C 4X7EC 2C3GA 3MNVB 4HS6B 4HC1A 3GSUA 2BNRA 3V5HA 3BPOC 5BV7B 2MJWA 4N0RA 5DMIH 3VG9C 2QQNH 4HJJH 2DJ4A 1ROWA 4H8WL 2F19L 4PRAB 4UI2A 1NL0L 5EA0H 2VLKB 5FGBC 3T3PE 3C9NA 2LU4A 2B0SL 2Q7YA 3GMQB 1IM9B 2R2HA 4M5ZL 3L5XL 1MCWM 1S9VA 5C2BH 5K59F 5CUSH 5J6HA 3CX5K 4M7LT 4JM2F 2QHRL 2XFXB 3V2AR 1P53A 5FF6B 1MFCL 1XF4B 5FXCH 1MHPL 2NNAA 3MUZ1 3ARUA 5DRZA 1N26A 2YPLB 3OWEA 4UT6L 5FCSH 2GK2A 4ODXB 1HSBA 1NEZA 2BNUB 3VDBA 5DF0A 1FGNL 2VQUA 4L4VA 1FBIH 1BFSA 1T5XA 4L8CA 1NC2D 5CWSB 3RVUD 2VN7A 4XPHL 4NHCH 2H3NA 3ARGB 3MV8A 3SHSA 2AW2A 2RIKA 2VZ1A 1T7YA 3BPNB 1OF2A 3BUYB 3SDCB 4KJPD 4Q58C 4HJ0C 4H26B 1G9NC 4KI5F 4IRSB 4JPWH 1D5MA 3RBGA 5IT2H 2Q7NA 5I19L 1T2JA 4I3SH 5IVNA 4WEBH 1XF2A 3TNMA 1EHLH 5D96C 2I9LA 1VKXA 4PJEA 3SGKC 5MEQB 5EO1A 4XGZA 4HC1L 4QOKB 3HI1B 4YUEH 5FYLL 3MUGB 4WTZG 2FJGA 3G08B 1ZV5A 3KLSA 4AT6B 1N5YH 4L3CB 4OFIA 1FAKT 2DQUH 1GC1L 2VUYA 1I9EA 3I2CH 3TJEH 4PLJD 2DBJA 3VFSB 3GMOB 2ZG2A 3C2AH 2AS5M 2OZ4H 4LPYA 1D6EA 1P2CB 2X42A 3OKEA 1CFNA 2H26A 3DUHA 2C7UA 1KCSL 5DJ2B 1BAFH 1I1RA 3HE6B 1W0YT 2DTSA 4RMVA 1TTUA 4XP9H 1UA6L 2PYFA 3R8BB 2VLLA 1EO8L 4OCXH 3SO3C 4JM2B 4JFFB 3WFDL 1MLBA 4NNPH 1F11B 2NZIA 2NY0C 4KC3B 3HMXA 1CYGA 3ZDYE 3KPQB 2HKHH 1MVUA 2H32H 3T04D 2WINA 4X4MA 2BNQA 1TJHH 1AXSA 2L0DA 1G9ML 2E9IA 3KPRE 4KDTC 3E0GA 2IGFH 5C2UB 2JE8A 3RPIB 5CJOL 4DW2L 2YRLA 1ZSDA 4PJHB 1ADQH 1X5YA 1E27A 1S78D 4UMGA 5AYUH 3EDFA 1TVHB 4OLWL 4DKFL 3DV4A 3P0YL 2FO4A 1SQ2N 2AK4A 2XKNA 2GFBA 2XZCH 5AZEL 2DLHA 2JIXB 4C57C 4PRIE 1F90L 4YR6A 3MV7B 1I8KB 4NC0B 4JFEB 1ZTXH 3KHQA 4OLZL 3BZFB 4QRRB 3DRTB 3MNWA 4PTTB 2Z8RA 2X4OA 3CZJA 3SE8L 2VDOH 4Y1AE 1ZEAL 2NY6C 5I2IB 3DX6B 2Y5EA 3OV6A 2GEEA 4DGIH 2KDGA 5EZOH 2J2ZA 5J1AB 2X1OA 2VDMH 4X5XA 1KUMA 5EU5A 3O4LB 3CUPA 4E42A 4XMLH 3H9YA 3TH4T 2ARWA 3HE7D 4TRPL 3QUZA 1IGFH 1ZA3B 1UM6L 2E3VA 1MCWW 1EX0A 2XTLA 1FYTD 1P7KA 4M7JH 5C0IB 1UWEH 2VL5A 4DUVA 4HIHB 3VFGL 4NO2A 4XBPA 3BD5A 4KDWA 3TIDA 2CDGA 3HMXL 3I9GL 1RFDL 4LLMB 1FORH 1J1PH 3WIHA 4HWNA 2R9HD 4DGVH 4YAQA 4JANB 2APWA 4JO3L 4ZUWB 3KHOA 4KZDH 5EULV 4D9QD 2PW2B 3MRHA 3VFRB 4LF3A 5I1LB 2VB5A 3UJJH 1CK0L 3SQOL 4Y5YC 2VLRA 5ABDE 3VRJB 4GOSA 4X8JB 1OD7A 3THML 2FX8H 3GZKA 3BI9X 4E41B 1IAMA 2XRAL 5JZ7C 5MERB 4CJ1A 1QBMH 3V6ZA 5SWSB 1V7NL 3FQNB 4URTB 1LNUA 3G6JE 3AROA 4KMTH 4Y16C 1NANH 5IW6A 4F9PC 3G04A 3QUYC 3RA7L 1JI1A 4DWHA 2VXVL 3S96B 4WCYL 3S8WA 3QDJE 4PJ9D 4D0DB 3MLRL 2IH1B 4HWZB 2AP2A 4NKOA 3GUTB 4MS8C 3HPJB 3X3GL 3MGOB 4NN5C 4Y5VB 1X5JA 1CLYH 1JPTH 4KKBD 4P3CL 4BH7A 3GBNL 2EIDA 4DKAA 4OZ4B 5TPWH 1SEQL 5GS1A 4P4KB 3UZVB 2PCPB 2ZJSH 1A6VH 3LOWA 3FMGH 4CUCA 4MWFB 3WKNA 4CMMA 1MI5B 4KKCC 1AGDA 3O6LH 3OKOB 2V9TA 2XACC 3Q5OA 3C5ZC 4CVXB 4PB0H 1IL1B 4G6JH 3CH1B 3L1OL 1EO5A 5HD8C 4G6FD 3WIHL 1WZ1H 4HKJA 3ULVD 3Q6FB 3D39D 4PS4H 5I1AB 1AGBB 2EIEA 3IDMA 2D3VA 4FFVC 1KSRA 3CH8A 1NGQH 3RVTC 4R7NB 2XI9A 4PJAA 3WUWA 1KLGA 1KLUB 1QPXA 5KS9F 3UTZA 3ARGD 1NBVL 1S3KH 5CGYD 4C56A 2ZKHH 4NUJB 3DVFA 5EIIB 3EGSA 4APQC 1N5AB 4LLQB 3OBAA 3ZYIA 3VFTB 5D1QA 5DK0A 1DN2A 4YHOH 3V95A 3CDYA 2ITCB 4P46D 3ALXA 4NUGH 5L0QB 4HV8A 3RHWK 1F4WL 3EYUH 1DJSA 3LN4B 3RKDC 1M6OB 3OKLB 2I07B 2OR8A 1BVLB 1E6JH 1SBSL 5IW3A 4GO6B 3V79C 1A1MB 1JNLL 3BIAX 4OD1L 4P2RE 2M2DA 2V6HA 1YEHH 4G9DB 1LILA 1MQ8A 3PF2A 3KLAB 1ZHNB 3NH7H 4C4KO 2B8OT 1TMCB 2NY5L 5ALBH 2Y36L 2X9WA 2ID5A 1NUNB 1ZT1B 2FJFA 4Z7WA 4HUXA 4RGMB 3HE6D 1T1YB 4FMKA 2YD2A 2VH5H 3SJVE 4R2GC 3CCHB 1XR8B 1HOCB 5DD5H 4J8RA 3JTTB 3QEGL 4D2NA 3O81A 5T1LD 4U1GC 3MRPB 1MQKH 1ZHKA 3V8OA 1UM4L 5CP7A 2D0GA 2VNCA 2LAAA 1DBJH 3MLTB 3K0WA 1BFVL 2FHBA 4JM2D 1I1FA 5EU6A 4OF7A 3IETA 4DZBB 1QO3B 5D1QC 5T1DL 2FX7H 2D9CA 5CHNA 1HILA 2D31B 5IB5A 3L7EA 1S9WB 5EPMB 2CKBA 2NR6D 3W39B 2XA8H 5GGUB 3PXJA 2DI9A 4Y2DB 4NYLB 4WJ5B 2DQCH 3JSSA 2HKFL 1A0QH 1S8DB 3N1QC 4YDIL 3OJVC 3S3PA 5I15L 4OI8A 1QA9B 3UDWA 2JF1A 4CMHB 4I18A 4I2XE 3ZKMC 3QXUA 2GSGB 1N4XH 1XF1A 4KGLA 5CINH 1TVBA 2OX5A 5KG9B 2GAZA 4MZ2A 1AE6L 3ARED 1GGIH 2JTDA 4HKXA 4JFZL 4JZJC 5JR1L 4XAKE 4KI5D 2F54D 4JG1L 4PY7B 3OSKA 3BH8A 3I3BA 3FFCB 1UFUA 2QTEA 3BGFC 4AQOA 3MOAH 3WKMH 1RJLB 5D7LD 3EYOA 1CU4L 3OAZH 1A6TA 4XNMA 1RULH 2FIKB 1NFDE 1SVZA 3BKML 2OJZH 4OSUH 4U0QB 3O4LD 4HIXL 2MPAH 5EZLA 2X89D 5I1GL 1RUAH 1A7QH 4OKDA 3PWUA 1BQSA 4X6FB 3VFUA 2ICEA 2IBZX 5C0GB 3C8DA 3UEZA 4R3SA 1AHWB 4F15B 4GXUN 4OIBA 5IM7B 4JE4B 3LAFA 4XI5D 2WBJC 3UDWC 4XB8A 3NIFF 3DURA 3GSOA 4YPGB 3TJHD 4YH6A 1GRWA 1GZQA 2YD6A 2VOTA 1ZAGA 3PNWA 2CKBL 1Q1JL 3DROB 4XNQB 3VA6A 4NM8L 3IDJB 4L3EB 5IEKA 4HWBH 1NBYA 2EZ0D 1NDMB 4PGDB 3QEUA 1MF2L 5KSBA 4G7YH 4HF5H 3B2UD 1U8JB 4JN2B 2R69H 4GRWF 2IFFH 5KSUA 32C2A 3LRGA 4P5MB 5KW9L 2XY1A 4OZFH 2EDWA 2CGRH 3IU3B 4AEFA 2D7QA 1G0DA 4E41D 5DJ0B 3UPCA 1OP5K 1TETH 2OSLB 5SWSD 3GFUA 4K55A 5CBEA 4OD2A 3V4UH 1JPST 1I1AB 2EYSA 4AM0A 1KEML 1L7TL 5CJQL 1F58H 3EZ8A 3O3BA 2XKSA 5C0BD 3WXVL 3WN5C 1TCRA 4LP5A 5EZJA 1H5BA 2GJ6B 1XIWD 3VXOA 1MCJA 2UWEF 5J9PA 3WE6B 3JWDL 2DKSA 3GSWA 2HT3C 4DFHA 1UJ3A 1K9TA 1X7QA 4OFVA 1INDH 2HFGH 4D0CB 1RZ7L 2J5LC 2K3TA 3GJEB 4FP8H 4TSAH 3A6CH 2DMKA 5GJSL 4HS8L 5HVHB 4NFBA 5ENWB 1IM3A 3HC3L 2ZSVB 1T4KA 3LQAH 4WI8A 3PQYB 4MAYB 2B2XL 4AIZB 4XPGH 4NZRH 5TQ2H 1A6ZA 2NPLX 4LMQI 5J13C 1FJ1A 2DKUA 3D25B 5DC9B 3HRZB 3W2DL 1S7SA 3BKJL 1JZ8A 4OLUH 4LSUH 43CAB 1B4JL 3RGVB 2NYYD 5MEOA 3AAZB 5ITFB 1HZHH 1S7QB 5BS0E 1OLLA 1HH6A 1K4CB 3MRNB 1J8HB 2V2WA 3PHSA 4N0FB 2VL4A 3RX5A 4IHOA 4JRWA 4EUPA 3TZVA 1KYOK 4JFPA 4NO0A 2Z0BA 3MRRB 5DRXA 1FV1A 2XWTB 4HH8A 5D6CA 4NZDA 4X9FA 5E8NA 2MTPA 1UJ3C 1P69B 5MHSE 1AO7A 3F7PC 3FT2B 5KOVC 1U8IB 4R4ND 1S9XA 1XZ0B 1OM3L 1IRAY 5JXEA 2GJZB 3U0PA 2Z8VC 1AKJD 2JCCF 2DAVA 3OR7B 1BLNA 4XVUC 2D03H 2PW1B 3ZLQC 5CJBA 1MVFA 3ZE0F 3EDJA 1QSVA 1QYGL 1PAMA 1JHLL 3C6SA 2BJMH 4UDTA 1ZGLB 5H94B 2OBGA 5BQ7A 3U79A 1DBAH 3P40A 5D70H 3V6OE 3WIFB 5M94B 3HC0B 5L2JA 4M7KL 4PR5B 2V5YA 4AMKH 4QRPB 5DJAB 1U8LB 5D2NC 1IAIH 3NZ8A 5H37H 2E7CA 3VXMD 3MGAA 2D0FA 5JQHC 4IOSD 4GMTL 1M7DB 5AUMA 4WU7A 5GQBA 1WLHA 4ZODA 5BOZG 3QNXA 5SWQB 1A1NB 3TZVC 1JRHI 3O0RH 4GG8A 2JJWA 1KIUA 3H7BA 3HG1A 1CE1H 2YBRB 5DRNB 4LNRB 5TDNA 4YHIA 4GKOA 1I85A 4GQ9L 3FB5A 2F53D 5D1XD 5GRJL 2XTJB 3CX2A 5I0DA 5CJXA 3IFLL 4V1DD 2OK0L 2UV3A 1CG9B 1U8KA 3O6ML 4WHDA 1BJMA 1NBZB 4MQTB 1MCDA 3GSNA 2Q20A 1A6AA 1YYML 5GHWH 1EK3A 1F4YH 3P4NA 4S2SB 5D71H 2YUVA 4FZ8H 1M7IB 2K7PA 3MUHL 3DXAD 1BWWA 3VA2C 3WXWH 1MIEL 2MCPH 3B9EA 1ODAA 2OMNA 2VIRA 3KWWA 2OL3A 1AGEA 2FLRT 1K6QH 4NO3B 4MD5B 1QKZL 1JGEB 2A1WL 3T0EE 2H2PD 4Q2ZB 3EO1A 4JZNA 4YXKL 4OIAA 4EI5B 3JUYA 3JWOH 1WFTA 2E27L 3RWDB 2NXZD 3VRIB 3TT3L 1KTKE 1I3UA 4Y19E 5C3LD 5J56B 4PJCA 1ETZB 1CTOA 2FLBT 1JV5B 4MCZB 5FYKH 1A4JA 4YHKL 4LLVA 1NLDH 4NRYA 5HI5D 1U8QB 2DRUA 1ITBB 3OZ9H 1I85C 3EYSH 4RBPK 5INCA 5E94B 1KPRA 4UU9B 3TO2B 3L5XH 1XGQB 4N0CC 2DQHL 4P23C 4LSTH 4S11A 4PTUA 1EHAA 5F8RC 2EKSA 5ISZE 5EN2A 3UO1L 4K3DH 4MDIA 3TBSB 3MYJB 4LHUA 5EUKA 1S7TA 3P30L 2AEPH 3D9AL 1MEXL 4HZLB 3UTSD 4M5YH 1CR9L 3WJJC 1K85A 5C0EB 4OZIF 3DRQB 2X4PA 4HKBB 3QUMA 3CSGA 4J4PC 2Z93A 3IYLW 4XPHH 2EYTB 1ZANH 2E7LA 3HMWL 2H8PB 1UH2A 1FRGL 4LCIL 4HUWA 3BN9C 3QCUH 4GW5B 1B2WH 1ZHBB 4LMQE 1YEKL 4YNYA 2VISB 4GQPH 4BZ1H 5GGRA 4ZUVB 1SJVA 4KTDH 4HG4J 2J3SA 1QLRA 3O41A 4KRLB 2B4CC 4X7FC 3GSRB 3C5SA 5I0ZA 3B3IA 3BHBA 5I19H 3EOAB 4JFXB 2X1QA 3WCYA 2OL3L 3MV9D 1WBZA 1SEBA 3WNKA 4DGYL 2R8SL 1I1AD 2QLVB 3I6KB 3E8UL 2FECI 4RMTA 4M6NH 3EYVB 4Y4FC 5HJ3A 4FQJH 5DT1L 1BREA 1G9NH 1W72B 2HLAA 4BH8B 5I8CB 3QEQD 1A14L 2H9GB 3JV4B 1MCOL 1Q9WA 4TNWF 4DOHB 3QA3A 3K4DA 2H32B 4RX4D 4JY6A 2PYED 2Z31C 4O58H 1TNMA 3QQ3A 1DDHB 2CD0A 4MQXD 4UNTA 2A74A 2E7LC 2WAHA 3SDDD 3PQYD 5KSAC 2R2EA 2OP4L 3BP6B 4KK8C 2C3HA 1CICD 3ARWA 3UBXI 1EO8H 3KPOB 2V7NB 3MODL 3RDTA 3TBWB 3QUML 5ANME 5I66B 1VACB 4PRHD 4S1SL 5F1IA 1KIPA 4X98B 2VLJE 1IC5L 4HUVA 4G8EB 1KPVA 4LGPB 3QYCA 3BO8B 2XNAA 2FBJL 2QR0A 3ARBA 1DQML 5CEYB 1FL6A 5CJOH 4ZXBD 4DW2H 5B8CA 3TN0A 3QI9A 1GHFL 4ENED 5T1KD 4QT5B 4AIXA 1GIGH 1G6VK 1I4FB 4NN7C 3M07A 4MD4A 3GBML 2VXTL 4G43A 5FM8A 5BW7A 3U36B 1F90H 1JGUL 3T1FA 3KLDA 5A3ID 1T1XB 4OLZH 3BIKB 2IANB 3S4SA 1R3JA 5T33L 3RWIB 2BVUA 3BH9A 3VWKA 4ZS6C 1B90A 3OQ3B 3BRFA 2Y25A 3LKQB 3HZVA 3FRUB 1IGIL 4JDVB 5LG1A 1RY7B 4F7EB 3TT1H 1YEGL 2X1PA 5IMLB 4NQTA 2MQ0A 2ZZUT 4UQ3B 5DMKA 3HCVA 2DD8H 4P2QE 1XGRB 3CNKA 4HMEA 1DUYA 1FFOA 4QRPD 4F7PA 2HLFD 4KJWC 4I9WD 5GGRY 3QQ9D 4LRIA 3D2UB 1AR1C 4PY8J 1T0MA 1ZOXA 3TWCH 3VXRB 1FL5A 2XOTA 1U42A 2F15A 3PL6D 3LKOB 5HHPB 5TDPB 1OWWA 3OJDB 4MMZC 3QI9C 3ZKSD 5E5RB 3I9GH 5HBBA 4M43L 1RUML 5DJ8A 3FOMB 3C60D 3CXHK 4JDTH 5FO9A 5DJCB 4LCCA 5DJYA 4E9LA 4PRIA 2VE6A 4JFHE 3QWRA 4MAUL 5EU4A 1CK0H 2ADGA 2UUDK 3ULUL 4IDJH 3O6FA 3L6FA 4HK3N 5C09B 5CD5C 4YBHA 4KROD 2ITDB 1JGDB 2V5MA 3VD5A 1KELL 5DI8A 4NN6B 1CDJA 5A2IH 2IPTL 2XRAH 1AGFB 4YK4C 1V7NH 4JHAL 4ZS7L 2PO6B 3L9RA 3T77B 4FA8A 3NIGE 3IU4L 4FFYL 5KVEL 2VAAA 3V5DB 1KBGH 3D3VD 4Y4HB 3SKOA 2ADJB 2A0LC 2BC4A 3U48A 5D7IA 1ZWIB 3B8SA 1AQDB 2FGZA 3AY4A 2VXVH 4WCYH 3X14A 2CH8A 4TNWK 5IESH 1RU9H 4WGWB 4MSWB 1S5IH 4ZUSB 2DBLL 3TGXA 1KEGH 1NGYB 3T0WA 5L9DL 3X3GH 2ATKA 3ARFA 1JZ6A 3IJHA 3OKNB 2QADC 1QUNA 2H1PL 1LO0H 2IALB 1O0VA 3U7YL 4CDGC 4Z7OE 4CL7A 2CSPA 2R0ZL 4M7ZC 4L5FL 4RA3A 5F1SA 5BRZE 5FB8A 4G5ZL 5FYKU 1O7SA 1HIML 3HZKA 4ZSOB 1RZKL 2CLRB 3DSNA 1BVKA 4PJ7B 3U0WH 4KRPD 4FXGA 3CMOH 4POZC 1A64A 5E7BA 1KCVL 3L1OH 4M8QA 5GISH 2XZZA 1LE9B 2CLZB 5DFWH 4JKPH 3IDXH 4ESKA 2W1NA 1YJDC 4NFCA 1ED3A 4K3GA 1S5HB 5C0FA 3O8XD 1BBJB 3VFPA 2RCSL 5D93B 4I3RL 5F9OH 3MUJA 1HHGB 4KPHL 4X4YB 1A9BA 5DJDB 4I4WB 1NBQA 3CXHJ 4P57B 3RIFF 3KPLA 4L9LB 4QXTB 3MJ9H 1X4ZA 5KTEH 1YJDL 2NLJB 3K80A 4A6YB 4Y5XA 1S9YA 3JV5A 3MBEC 5DD6B 2EDXA 3CSPA 3TNNB 1C1EL 4ISVA 1QVOA 1OAKH 2CIIB 2ATPA 4QNPF 3IFOB 4KK9C 1T7XA 1J0JA 3SDYL 3RVWD 2YHGA 1RHFA 5J3HC 3MJ7B 3MFFB 1EA9C 4KQ3L 2UVFA 4HKZB 1NC2A 3W0WB 5JW5A 4HPOH 3D18A 3VI4F 1FQ9C 4XC1L 4JB9L 4O5LL 3BKYH 1QQDA 4Z5RA 3UPAA 3DX7A 1R6VA 1FN4B 3OKKA 5HGHA 3FCTA 4FTVB 3BEVB 1HQ4B 4WW2C 1GGCL 2FIRT 4LQFL 1D5IH 5TE6H 2F5AH 1OGAB 4QY8A 3QDGE 4N90D 3T3ME 3MR9A 3QEGH 2P7TA 3OHXA 1ND0A 4TPRL 1MCEA 1IEAA 4LKXB 2YMXH 1BFVH 1I7ZA 1P7QB 3LV3A 4U2ZA 5T1DH 5JDSA 5IVZB 5C0ND 4XH2B 3CPLA 4B7LA 1I8MA 2X6MA 3F5WB 3NN8B 1N7ML 2EIBA 3MCKA 1Y6NR 4HFWB 5GGQL 3FQWB 3VJ6A 3TA3B 4ORZC 4I48A 5SWZB 1E4XL 2HFFB 1B4RA 3H7LA 1IFHL 3KPSD 2RFXB 4WUKL 1R3KB 2HKFH 4YDIH 4TOYL 1BGXL 3TV3L 4TUJB 1MCPL 2GK0A 2HJFA 4BQBA 1YY9D 4Y89A 1Z9SA 2D7NA 4TUKL 4M3KB 4JFDE 1TNNA 1UVQA 4LCWE 35C8H 1UJTA 2OJEB 3HUJF 4Z7VE 5ADPL 1XGUA 2YKLL 1UB5B 3GRWH 1CT8B 4RWYL 1FVDB 5KANG 5HYJD 4ZUUA 4XP4H 1PG7H 2IAND 3GDBA 3AU1A 3H9HB 5KVMC 3HKFA 3UJIH 1FSKC 1NUFA 4GXVH 4H1LB 1F5WA 2E8YA 3RWHA 4NRZB 1A2YA 4QXWA 1X5LA 2ESVB 3H9SE 2VC2H 2X05A 3L3IA 4HIXH 4QGTA 4OCWH 5D5ME 4X7TA 4WI2A 5I1GH 5C08D 3IJSB 1RZJL 4PJXA 4P0DA 3TEUA 3QAZC 3CZFB 5C07E 2ZCHH 2X41A 2V5RA 2ZPKL 4OZFB 3EJZD 1KJ3L 5A2KH 2APXA 4R0LC 5DURB 4LCYB 3VXRD 4YHYB 4LDOB 2R2BB 1ZMYA 2HN7B 4FG6D 5F7HA 3L3KA 3W11D 2Z8SA 1YPZF 4WNQA 5D2LA 1WZKA 2YPKA 4I2XA 4JZOB 5J11B 1UKSA 1ORSB 4H5SB 1T03H 3PABB 2EYRB 1X9QA 3NBNA 1Q1JH 2O61A 4JVUA 4NWUH 1LO4L 1RJCA 3VGAC 3SCMA 3ZKXC 1QP1A 3RIFK 3ZKNC 4J23A 3BGMA 1JF5A 3DI2B 1Z0NA 5GGSA 4KK6C 2CO6B 1NLBL 3IGAA 4GRMA 4WW1A 4M6OL 4DN3L 4M61B 5GRUL 5C7XH 4MNHA 3QULB 2PO6D 2JB6A 1YDPB 4LQ1A 5F7FA 4UNVA 3WXVH 5HHMD 4EZMA 1R3HA 3FO9A 1T1WA 5EU3B 4GAFB 5FYJH 7FABL 1Z9LA 4MJID 4Y4HD 1AGCB 4GMSH 1XH3A 4BYHA 2JKXA 4HLJA 1JL8A 5DC0A 3MLVL 1Q9KA 2NW3A 5E5UB 2XG4A 3KXFE 1OAUH 3HR5B 4P2CG 1T7ZA 3WFCH 2JELH 4IBLT 1I7UA 4PRPD 5I1JL 3IFPB 3LDBC 5GJSH 2IAMD 5DVMA 1MRFL 3HC3H 2DWEA 5IBTL 5ID0A 2Z9TA 3FZUD 3T8XA 1HDMA 1HHHA 1NCDL 3CFJA 3WFHA 3FN0L 2B2XH 4UINL 5L2KB 2ZWLT 5I6XB 3QIUB 1XF3A 2B1AL 4NQVA 2F8OA 1CXHA 4Y4KB 1KJVB 2FATL 1OT2A 4PGCA 4PV8A 3BKJH 5HXMA 4R7DA 4WDIB 5EC2A 4IS6A 5LBSH 4CVUA 3MGTB 1KIQA 3ARDB 3VXUE 4NO5B 2YUWA 2ZG3A 2I5YL 4YHML 1UACL 3UPRB 3T4AB 1I8IA 5ADOL 3N1MC 5IFAL 3MROB 3AM8C 5EO0B 3GIZL 3O3EA 1CI5A 1WTLA 4F7TA 1JWUA 5C0AB 4HK3J 3IDNB 3PDOA 3MZGB 1LEIB 1J7VR 4HIJA 4JFQA 2R1XA 1R0AH 4GRLC 3FL7A 1OB1B 4H1LG 4JPIB 1XR9A 1CQKA 3WFZA 4MA8H 4G7VL 3QIWC 3K8MA 3D39A 4G8GB 4BSVA 4PB9H 5F7YC 1KT2A 1T6WA 5IWLA 2YXFA 2ZOKB 3LS5L 4RA0C 2YUZA 2Y5TA 2CR3A 3DGGB 3W0WD 2O26U 1NMCB 1WTGT 1CL7I 3D0VB 4MCYB 4UT7H 2XZAH 3TYFA 3QDMB 4PJBB 1Y0LA 4BUGA 3BPCB 5I76B 5HDBE 3DSFH 3GIVB 1WF5A 1YMMB 1UT9A 1NCCL 3Q3GB 3ARVA 1T21B 4LVNB 4JY5L 3OXSB 3S36H 5BS0A 4ODWB 5GGSY 1I9IH 4DCQB 1T2QL 2EDDA 4GKSA 1IQWL 1OGAD 2HG5B 3NPSB 4CNIB 4KWUA 5CIPH 1UZ8A 1PYWA 2MHAA 2FR4B 3CSYB 5SV3A 4NQEB 2L4OA 2RQ8A 5IB3A 2CKNA 1E6OH 4GQ9H 1CDHA 4K7FA 3UYPA 5DEZA 3ECBB 3DETC 1F3DH 5CBAA 5F88A 4LFHD 4FOMA 4FQIL 2OK0H 4X6DE 5F1NB 2P5WD 2AABL 4BQ8A 3HNSH 4TQEL 2J6EA 2XWBB 4XRCB 4MA3B 4OCYL 5SWZD 4WO4B 1G7MB 1WCQA 2P1YA 3VW3L 1ERNA 1YYMH 1XGTA 1QSFE 3V6OA 4RAUA 3ULVL 5KVGL 5T1LA 2VYRE 1MIEH 1FE8L 4WFEE 4XHJC 1AC6A 4OCMC 2L7JA 2W07A 3V7MA 4Q6IC 1MJJA 2C4XA 1NCAL 1GPOL 2A1WH 1FZOA 1ES0A 4RZCB 1WV7T 3BWAB 1IQDA 4GAYB 1CGVA 1LP9F 5DDHB 1YMHB 4YXKH 2YD1A 2E27H 1ZT7B 3VXSE 2ZNWA 1U8NA 3TFKC 3BQUB 3MLPA 3DX8B 5EO9A 4U1SA 4NKMB 2NTFA 4WFHD 1A3RH 4K7PL 1H15A 4YHKH 1CD1B 2CUHA 4WWKB 4PRBB 4JM4L 1YEEL 2DQHH 4BZ2L 1CQYA 4PJEF 1XFPA 4KJYB 1RUQL 3AREA 1BFTA 4LPXA 2Y6SC 2XIDA 4ZOCA 3DUSA 3MJ8A 3VFNA 2DQJH 4RFNC 2F54A 3D9AH 4LVEA 1MEXH 5EH1A 4IMKA 3FTGB 1CR9H 4Y8AA 2FB4H 2ZUXA 2APVA 2PETA 4PBWD 5IFJA 1SMAA 2YEZA 4J3UA 1G0YR 1VEPA 3GSUB 1CD9B 2BNRB 3P9MA 1CGSH 3PV6A 4KMQA 5D7LA 3V5HB 2OTWA 4X4XA 1QPPA 4LCIH 2IH3B 5F9JA 3TPKA 3TO4C 1T89A 4UIKL 3C9NB 4ZD3L 2Q7YB 4WHCA 2R2HB 4K7PY 4ZMAT 3VXNA 4Y19A 3SN6N 1S9VB 2NY1B 4OLYL 5JNYA 1KCUL 5J6HB 5A1AA 1FNGA 1RI8A 1MWAB 4ZAKC 3SDAC 1LEGA 4DGYH 5F71A 2NNAB 3WNOA 1JCKA 4RDQF 5DRZB 3KYKL 2IC2A 4MNQD 1CLOL 1I9RL 4D9LL 1HSBB 1NEZB 1S7RA 2B4CH 5HGAA 4N1EA 4B41A 4NT6A 4L4VB 4L8CB 1PQZA 4OV5A 1MCOH 5GSRA 3Q5TA 4TULL 2UZIH 3ILPA 6FABH 3QHTC 2H3NB 3E6HA 3PIQA 3ZTNH 4IMKC 3MV8B 2C4FT 4GG6F 1X5GA 4HW6A 3G5VA 1OF2B 3SBWA 4ELME 5GGTA 2HTKD 4X7DC 4KMLB 3BKCH 2BY1A 4LVHB 3TBYB 2Q8BL 4WUUE 1D5MB 5C0BA 3T0EC 1T89C 4G6MH 5E8OA 1XF2B 2UZXB 3TNMB 2GY5A 4LP4A 2I9LB 4O2FA 3FFDA 5A2FA 1VKXB 4IM8A 4PJEB 4UIMA 3JV6A 1CGTA 4ZTPH 3MODH 2A38A 5EO1B 3QUMH 1WVZA 4PJ5E 4ODTL 4XGZB 1C08A 4ACPA 4EN3C 4S1SH 4FQXD 25C8H 3WHXA 2FJGB 1UQSA 5IB1A 4IRJC 4HCRH 1IC5H 3QIBA 3HC4H 4KHTL 3RTQD 1A22B 2DJSA 2WIMA 2C3WA 3QFJE 4OB5H 1DQMH 5IVOA 3S37X 4DQOL 3WBDA 3OKMA 4NDMA 1D6EB 1DQJB 1OP3H 2W92A 1V3KA 3OKEB 1CFNB 4JRXE 5C0AD 2N1KA 5AG9A 4QF1A 2C7UB 3TM6A 4RGNB 4QHKJ 4GBXC 1G0XA 3MOBH 5L88L 3GK8L 5EFIA 3C8HA 5C6TH 1JGUH 1OAQL 1TTFA 4MXVF 4NQUA 2VLLB 4XXDA 4G8GD 4K23L 1MLBB 4GT7A 4E0RB 3NFPA 5T33H 1IAIM 4M3JA 1IGIH 4NPYB 1P9MC 1MVUB 3KYMB 5D7KD 1GOFA 2WINB 1U58A 2VLKE 4JHWH 1AXSB 1M05A 3Q6GL 5ANMA 1H3WM 2H2SD 2VRAA 5GGTL 4OFKA 3PGFL 5F89A 3MA9L 4UZGA 4GLRI 3ZDXE 1ZSDB 3QIBC 2EDTA 4LVOC 2WBKA 3TCLA 1SY6A 3ARTA 1WFNA 2FO4B 2AK4B 1AKJA 2CUMA 2XKNB 2GFBB 2YPLE 4KI1A 4WGVB 1NGPH 4KVCL 4YR6B 5K9QG 3FB6A 2CK0L 4UAOB 5ESAA 3MNWB 2X4OB 2Z35A 1UYWL 5DS8A 5LWYL 5JXAL 1A21A 3QUKB 4ELKB 1GGBH 5KJRH 3UC0L 1TDQA 3ZDZF 3IB4A 5C0JA 1P5VA 4RAVA 5L8KB 2EC9T 1NEZG 4X5XB 3P0VL 5EU5B 3D69A 2CJUL 3CUPB 4BQ9A 1A7RH 3X11A 1G7IA 2M26A 5HYSA 2C3VA 3WJLA 1X5FA 3QUZB 2BSSA 4JHAH 4YFLI 4ZS7H 4PP1D 4YFEA 3CVIL 1DQTA 1KENL 1GSMA 3DMMA 3IU4H 4OGAC 4G80A 5DHVB 3ZTJH 1P7KB 1Z0MA 5KVEH 1RK0A 4HULB 4XPAL 2JJUA 2VL5B 4NOBA 4QOKE 3U30B 4NO2B 5E6YA 1INEL 4XBPB 2F53A 5D1XA 2DM2A 3TIDB 2CDGB 1IARB 3K2MC 4PJAF 4OGZA 5TF1L 4XX1E 2HRPL 4V1DA 3RZCA 4YAQB 1JNNH 1ZVSA 3LPFA 1AD0A 2YD8A 2DOCA 4LLUA 5E03A 1MCFA 3MRHB 5A16A 5L9DH 4LF3B 5TE7L 3GJFH 3QRGL 3KS0J 2ZSWA 4PD4J 2PXYC 1PKQA 2VLRB 2H1PH 2R0ZH 2WWKT 3KAAA 4YPJA 5IHZA 5KS9A 4PYGA 3NFNB 4G5ZH 3AC0A 1SY6L 3DXAA 2D0HA 4UOW1 3V6ZB 2N56A 1JRHL 1LNUB 4XVJL 4AZ8A 4R9HA 2YK1L 1KCVH 4JFFE 1NCBL 3CC5A 4LDEB 2ZCKL 1N6VA 1J0ZA 4QGYA 3IDIA 1NFKA 4LLWA 2YD3A 1MOEA 2DLFL 2QL1A 1ACZA 3GO1L 3QQ4B 5IW6B 5J12C 4M9PA 3G04B 5JIPA 5HI4C 1UWXH 3DMMC 4I3RH 3WS6A 5IQ7L 3MLZL 5FYLD 3X12A 4NKOB 4LIQE 1ZLSL 3EFFA 4HJ0D 4JN1H 4PJHE 5IJVA 1YJDH 1GZPA 3RZCC 3WD5L 4HIEA 1MH5A 4DKDC 5GS1B 2G5BA 2NY1D 4TVSa 3VRLE 5FKPA 4KUCF 4CMMB 5IMKA 3UTSA 3SDYH 1WEJL 1AGDB 3MV7E 3RL2A 4JFEE 4NSKA 5BRZA 4JG0H 1U91A 4QRRE 5AWNL 4HKJB 4AL8L 5BXFA 1BEYL 2GIYA 4HUMB 3LHPH 5B4MC 1M4KA 2P47B 1QNZL 4LRNL 4XC1H 4CADB 1ZLWH 3IDMB 3BJ91 1LD9B 1N2RA 1ZE3C 1NGXA 3WUWB 1KLGB 3UTZB 2YSSA 4UQ2A 2KPNA 1FVEA 5ACMA 4ZYKA 5MENE 5J6GA 5HHOD 4U1GB 4C56B 2D7PA 1RAMA 2XN9D 3BGAA 1T0NA 3LS4L 3MV9A 3EGSB 5FV1L 1U3YA 5DK0B 3DVGA 3TESA 3QUXB 2GJJA 2NY0D 5DD0H 3RWEA 2WLZA 1QSED 4TPRH 3UTPD 1RZGA 1J0KA 1CDBA 4HV8B 4U3HA 1OVZA 4F37K 4JY4A 4F8TA 2PTTA 1KB9J 5B21A 3QEQA 3KG5A 3L95A 4Z0BL 5IJKC 1MJUH 2ORBL 2CDFA 4Z7NE 5F3BA 3IVKA 5GGQH 2PYEA 3OAYH 1JPFB 2HVJA 3HTLX 4AEHL 5KBNC 4GSDL 3S97C 2VLMD 4TOYH 2JB5L 3SDDA 3TV3H 1MCPH 1ONQA 1JYXA 1CICA 1E28A 3G6AA 2FJFB 4PUBH 3T0DA 4Z7WB 4HUXB 1A7OL 5JW4N 5CEZH 1LK3L 4FFZH 1YEIH 4J8RB 4PRHA 2NY6D 4QRQA 5B39G 1ZHKB 2GYSA 5CP7B 4JRYD 4RWYH 1F4HA 3I75A 5EU6B 1I1FB 4OM0H 1OOAA 1MREL 3IETB 2ZCLL 5CHNB 1HILB 4NQDB 3MO1A 1RMFH 4TVPE 3RNQA 5BMFL 2CKBB 3BAEL 4LSPL 3WL9A 2VXQH 5DK2A 4OM1L 1KN2L 2BNQD 1IKFH 3KGRA 4OKVA 5T1KA 4WIQA 2Z4QA 4K9EL 4I18B 5H35A 4W6YB 1MI5E 2FL5A 3K1KC 2X4TA 1Q72L 1NSNL 1TVBB 3REWA 2GAZB 4FQLL 1E4JA 4HKXB 3HHRB 5JORA 1IEHA 3LD8C 3QFDB 3O6KL 1OTTC 5DUPL 2VQ1A 1PY4A 1JPGA 1RZFL 1CFBA 5EOQL 5FYKE 4OF5A 4RMWA 5CCKL 4GUPA 2UWEA 3BH8B 4D3CL 8FABA 4HAGA 2PR4L 2DIJA 2Y06L 4P5TC 1K5NA 1HI6A 3EYOB 4DVBA 1MY5A 4JGMA 1A6TB 2WV3A 4XNMB 5EUOE 2P49B 1NLBH 3CK0L 4UOJA 4G3YL 3W81A 2NX5D 4A2LA 1UCBH 2KQNA 4Y16D 2Q6WA 2DIBA 5EZLB 3QUZD 1CGYA 3MXWL 3V0AC 2P44B 3KNBA 2QHLA 3PV7A 3PWUB 3WUWG 3H9SA 3C6LA 3HAEA 3VFUB 3QUYD 2ICEB 3V0VA 5I1HH 4FQ1L 4PLNC 1BIIA 4MS8D 4R3SB 4Y0GA 4RCAA 7FABH 1G6RH 3KYNA 3LPWA 2O5YH 3DURB 3GSOB 4OGXH 3OGCA 1KJ2H 1GZQB 5D8JH 3PNWB 3LMJH 1FDLL 1G1YA 4ERSL 4MJ5A 5IEKB 1Z9MA 4JO4H 1NBYB 4PJIA 1RIUL 2AJVL 3VFMA 4CW1A 4JR9L 4JLRA 3LVEA 5IV2A 3QEUB 5I1JH 4I5BA 5KSBB 3VU2A 4EXPX 3L3JA 4RQQA 1MRFH 4QTHA 2NY3B 4KKCD 4NCC1 5KSUB 3MREA 32C2B 3MRLA 4Q9QL 2C4FU 1C12A 2FH6A 1L9MA 5HD8D 1CD0A 1T80A 1EXUA 3B9KC 4L29A 2AJUL 3D3VA 4K07A 2FATH 5CBEB 4OD2B 5I8KH 1ZGLM 5K93A 1QBBA 3QISA 3WFEL 2EYSB 4AM0B 3RVTD 3O3BB 4H88L 1J0HA 1TCRB 4P2OC 3HPLA 5EZJB 1H5BB 5J9PB 1AQKH 3SGEH 2JCCA 4YHMH 5HHNA 3FT4A 1X7QB 4DTGH 3ZHKA 3Q0HA 5IFAH 3LEYL 5EU7E 3GIZH 1J5OL 5FO7A 1U3HB 1O5DT 5IB4A 3IFNL 3BDYL 3DPBA 2Z91A 3H42L 4X6CB 3N9GH 5D7JC 1IM3B 1EZVY 4LKCB 4PRDA 5CJ5A 1MFAL 1T4KB 4GAGH 4JJ5A 1CZ8H 1EUUA 2OM5A 5TFSH 3S35X 5DQJA 3RKDD 1A6ZB 2HJLA 4G7VH 5DZLA 1FJ1B 3H3PH 4GXUM 4M4PA 1GJIA 1NKRA 3GM8A 1S7SB 2BXYA 3O2DH 3HB3D 1IC4L 3QWOA 3O8XA 4NOFA 4B50A 4ZOAA 4YEFA 1E4KC 3PGCA 3NZHL 3RPKA 1D6VL 1PKOA 3BZ4A 3FFCE 5DMIL 3STLA 5MEOB 2QQNL 4HJJL 4MGXA 3QH3B 2Q76A 1H3GA 4YGVA 5DO2D 4BKLA 2D7OA 5EA0L 2YRPA 1HH6B 1WQVT 2V2WB 5IK3A 3VXUA 3SE4A 4IHOB 4EUPB 3TZVB 4JFPB 3KJ4B 4NO0B 5DRXB 2OZ4A 1FV1B 3R0NA 5D6CB 4J6RL 5C2BL 1FNSH 3FRPA 4DKEL 1AO7B 4QTIH 1IQWH 4ZFZA 3V4PH 3VXQA 3AMLA 1DLHA 1MCQA 1S9XB 4NCDA 5I30L 4XCNA 3MRBA 5D1QD 4KK5C 5I8EA 2OI9C 2A6DA 3IDYB 3QNYA 1VCAA 3U0PB 5D1ZC 4I0PA 3VCLA 1FO0H 2ARJQ 3K74B 2VXUH 1BLNB 2WQ8A 3LQMA 1J1OL 2ED7A 4PJCF 3O3UN 4LEOA 3C6SB 1K2DA 4L3EE 2Y07H 4UDTB 4W4OC 2W0LA 5BQ7B 4FQIH 1T1ZA 4KJQC 3R1GH 4MYWB 4TQEH 3QRFM 3ZKMD 3CDGA 2WNGA 4OCYH 5L2JB 2P48B 3V6FA 3QO0A 1BOGA 3VW3H 2ICWA 4FMFA 5IVXF 5GS3A 3NZ8B 1ADQA 2EC9U 4XZUA 3CLFL 5DEFA 1KOAA 5IT2L 3P73A 3PP4H 1FE8H 4I3SL 5AUMB 4NHUA 1EHLL 1BM3L 4WU7B 4F9LA 4YDVA 1DBBH 3QNXB 2GT9A 4NJ9L 3QCVL 4U1KA 3IS0X 4GG8B 2EE2A 4NJAH 4XWOC 1HSAA 2GJ6E 2CLVA 3H7BB 3HG1B 3S5LA 4KUCD 4PY8I 5HPOA 1VGKA 5TDNB 4YHIB 4OZIA 1D7FA 5B38A 5DK3A 3Q2CA 5KZCB 1EEYA 3I2CL 2YXMA 3KPSA 4IOFD 3LH2L 4I0PC 1U8KB 2W9DL 1ZT4B 3C2AL 1SJHB 5F9WB 2J8UE 4JM4H 4NKQB 2V9QA 3GSNB 5EOCL 3T3PF 3ROLA 4KKAD 1A6AB 1PLGH 4L4TE 1I8LA 3P4NB 2WBJD 1LE5A 2BHYA 2P5ED 4XP9L 3FQRA 4Z9KB 4XWGL 1AP2A 2VIRB 3KWWB 5HYJA 2OL3B 2BVPA 1AGEB 4LLDA 3DO3A 1QLEL 1PSKH 4IJ3B 3C08H 4JZNB 4XPBL 2FEEI 3FB8A 2GTZA 4ODBD 4HLZH 5FYJD 5JHDE 2DMCA 1J8HE 4K71B 4PJCB 2H41A 2IGFL 2APTA 4RMQA 1A4JB 2J4WL 2X4QA 3WUZA 4ZD3H 5C08A 4LLVB 5BZWB 1OSZA 1ADQL 5JUEL 5INCB 2YN3A 3KPPA 3OB8A 4AYFA 3OJMB 4PTUB 1TLKA 1HXYA 3TPUA 3G9VA 2XZCL 4TSCL 2OQJA 5EN2B 2YZ1A 4MDIB 4IIQC 2HT3D 4PJ8A 4TTDC 3RVUC 4EUPG 4CN6A 4LHUB 1JZ5A 5EUKB 1S7TB 4XNYL 3DO7A 1ZTXL 3DOSA 4D9LH 2OMBA 3NABH 1LVEA 2X4PB 1I8LC 2VDOL 2E6JA 3QUMB 4WEUD 1II4E 3LZFH 2Z93B 3PWPB 1YUHA 2NW2A 4DGIL 2W9EL 2DWDA 5EZOL 4HUWB 4YC2C 3K8KA 4QRPE 1IE5A 3IRPX 4YNYB 5GGRB 1IGFL 2R0KH 1QLRB 4AK1A 4ZNEA 2MQ3A 2A6IA 3O41B 2JJTC 4HGWA 3MRKA 3X13A 1H3PH 2YD7A 2P46B 3B3IB 3BHBB 4J3VA 1UWEL 4YZFE 4MJIA 1WBZB 3M1BA 1SEBB 1QRND 1NAMH 3HZYA 4F57H 1J1PL 3LRSA 5BCAA 1DUZA 3ARRA 5HJ3B 4WV1A 1MELA 2XTJE 4PGZA 4PJDB 4YWGH 2HLAB 3Q48A 3MSPA 5CMAA 5TF0A 2IAMA 3ZDYF 3GMPA 5T3XE 2BOBA 3QA3B 3O4OC 1C16A 4JY6B 2FX8L 3VWJB 3QQ3B 1QBML 4XVUD 5E6IC 2ZUUA 3DWTA 3EJYD 3QNZA 3LPGA 5L88H 2R2EB 5E00A 4ZQKA 1CGUA 1NCTA 1OAQH 2VWEE 2Z92B 3GMNB 1OCWL 1B3JA 4N9OB 1NJ9A 3RDTB 3RWCA 1PX3A 4WUUA 1MRCH 2FGWL 1KIPB 3MLYL 5GSVA 3C5JA 3T08A 4HUVB 1KPVB 2X2YA 3BRDA 1P84J 2Y1VA 5I1CH 4YO0A 1OP3K 2V7HA 4XVSH 3HNTL 5I73B 2XNAB 1P4LA 1OWRM 1VSCA 1I75A 3ARBB 1CLYL 1NANI 1JPTL 3P3YA 1FL6B 3TZVD 5JW4Q 5B8CB 4Q97A 3TN0B 2LQRA 3RWFA 2ZJSL 1A6VL 4F3FB 5JDJA 2F74A 2XQYK 4GS7B 1Q9LA 4G8IA 4MD4B 4CN4A 3O6LL 4G43B 5HGGS 4G6JL 5F6IB 3NIDE 3T1FB 2EXYC 4PS4L 1FCGA 3OX8A 5HI3C 1R3JB 5LWYH 1UYWH 4U1HA 5JXAH 3SKNA 4K8RC 1NGQL 3VWKB 2G5RA 4L4JA 3HZVB 2A9ML 3UC0H 4LHUG 1S3KL 1XGPA 4HBCH 1CDGA 1MRDL 1YEDA 3MLXH 4Z77A 4NQCE 5DMKB 3HCVB 5I71C 1FZMA 3NGBC 1Y6MR 1DUYB 1FFOB 4F7PB 2P8LA 1DBKH 1KG0A 4K8RL 1BBDL 3CVIH 4YHOL 1B88A 3IAGC 1T0MB 5F7NC 4M02A 1BQHG 1FL5B 4PG2C 3GMQA 2FNBA 2B1HH 2W91A 2DQFA 3KYAA 1F6AA 4XVTL 3EYUL 3G6JF 1INEH 2X09A 2NY4B 5DJ8B 1CL7L 2HRPH 3FQTA 1KCKA 5FO9B 2P5WA 4LL9A 4LCCB 4U05A 1FNEA 5DJYB 2NY7L 4C4KT 4DOHE 1DQQA 2VE6B 4N0CD 4P23D 2DLEA 4DVRH 4JREC 5EU4B 3FAXA 1EO7A 1G7PA 2ADGB 4LSQH 3O6FB 4NWTL 3L6FB 1JHKH 5ALBL 2YD5A 5C0CD 5DI8B 4O2CA 4BSJA 1RHHA 1BJ1H 3O3AA 4OF0A 1MAJA 5ACZA 2VH5L 7CGTA 1JRHH 4M1DL 5DD5L 3H2WA 4JHZA 2YK1H 3L9RB 5GZOC 4J4PD 5BV7C 1NCBH 2FSEA 1XEDA 2VAAB 4E5XA 5BO1L 3EYFA 2R56H 3SKOB 1OW0A 4IRSA 5BOPA 2BC4B 5AG8A 4YGAB 5D7IB 3GJFK 4KKBC 2EE9A 2R4RL 4U1NA 3SPVB 5IF0A 5IQ7H 5L6YH 3X14B 4XPTH 3RBSA 2L7UA 1ZLSH 1CFSA 3A6BH 4EJ1C 4UUJA 2B5IB 4U2YA 2ATKB 3ARFB 4Y8DC 1QBLH 3MFGB 5CILL 3TVMB 4AT6A 1A0QL 3RY6A 2KUTA 5K9KA 4X83A 5FB8B 4RWHA 4O00A 3HZKB 4RMUA 5INDA 4MLIA 4WHYH 4Y4FD 1BVKB 1F8TH 3ARQA 4D9RD 1TZGH 4FXGB 1GGIL 3QJFA 3UAJC 2VERN 4M8QB 1UWXK 1VA9A 3CXDH 3WNPA 5E9DD 1ED3B 2WQRA 5CGYC 4K3JL 3T2NH 5C0FB 1KCLA 2Z31D 3BPNC 3VFPB 3FJTA 4XTRC 1IJ9A 1VFBA 4K3EL 3WKML 3SDCC 1IGJA 1RULL 3NPZB 4U3XA 5KSAD 1A9BB 4OSUL 4IRSC 4KK8D 4U1LA 3KPLB 4G6AD 3LS4H 4HJGA 2AJ3A 5J4MA 3P11H 4Y5XB 1S9YB 1GYAA 4HWUA 3SOBH 5M7QA 4YHZL 4Z6AT 4ISVB 1QVOB 4KKNA 1ZLVK 5FKAA 2ATPB 4MNQA 4KTEH 5JLZA 5IB2B 5GJTH 4N9GA 3LKRA 5JO5A 3MRDA 3HUJA 1NC2B 5JW5B 5BJTA 3D18B 4HFUH 5HDOA 3NCMA 4Z5RB 1QQDB 1W8NA 4KRMB 3DX7B 3DGCR 4CVWA 3OKKB 5HGHB 2M8XA 1IAOA 3HE6C 5C09E 5GS2H 4G7YL 4HF5L 3FCTB 4AEHH 3PWNA 2NXYC 4H25A 2R69L 5K9OA 2IFFL 5HY9A 1ITCA 2X70A 3FB7A 2J88L 1TZIA 2CGRL 1DFBL 2ZOLA 4QY8B 2CQVA 2DL9A 1TETL 1A5FH 3MYZA 1G1CA 3A67H 1LK3H 3V4UL 3PP3K 3FO1A 2MNUA 4ZS6D 5MENA 2P7TB 4FQXA 3OHXB 1ND0B 1IEAB 2NR6C 5EORH 3QDAA 3EFDL 3DVIA 3LV3B 4YDKL 4XCYA 1U9KA 3OAYK 1YPZA 3RTQA 3MPCA 5JDSB 1INDL 2EDOA 3CPLB 1I8MB 2HFGL 1CXKA 4LSPH 5BMFH 2ERJB 1TQBB 3N1PC 4DEPC 4OM1H 4LLMA 4EEEA 1AR1D 4L8SA 4FP8L 1JP5A 4TSAL 4I48B 3LQAL 1T5WA 1NFDF 5F7UA 4ZSOE 2FX9H 4OBSA 2R0LL 2GK0B 4KI5C 4XPGL 2HJFB 3QI9D 5GRZA 1IKNC 5TQ2L 4PJ7E 3VRJA 2R0WH 4RMSA 1RZ8A 3OGOE 1UVQB 3DHJA 4L9DA 2HJKA 2OYPA 1MCIA 2P42B 1XGUB 3QXAA 4JO2L 5FM4A 1RZFH 4OIIL 5DJ6A 5EOQH 1HZHL 4ZUUB 5CCKH 4FZEH 4EVNA 3AU1B 5A2JH 1K3IA 1D9KA 1W2KT 2R29H 4S1DC 2YRZA 1Z2KA 3RWHB 2EIZA 1A2YB 3VFVA 4RRPA 3GI8H 2AAVA 5FV2A 3L3IB 4FQQB 3S96A 4G3YH 3GUTA 5BZDA 1LO3H 3EZJB 4X7TB 1E4WL 5LVEA 2LV4A 3EYQC 2APBA 3MXWH 2A0LD 4PJXB 2LAGB 3ZE2E 4X0KA 3O9WA 5HGBA 2P43B 1KTLA 3KPRD 4FQ1H 4XCEA 3L5IA 3M45A 3IDGB 4NZUH 5FUOH 5DTFB 3L3KB 1VFOA 1DANT 4WNQB 4OI9A 2D03L 5D2LB 1QTYT 2YPKB 4I2XB 2CRZA 5LGJA 2HA1A 2QADD 2NY4D 3R8QA 2BJML 4C83A 2W0PA 5FDWA 1KTDA 1DBAL 2O61B 3GGWA 4YXLL 4N8VA 1P4IL 3U4AA 2BVQA 4FTVE 4PRID 3SCMB 1FNHA 3QWRD 5DC4B 3BGMB 4TYUA 3HE7B 4AMKL 3QXDA 5TE4L 2AXGA 5GGSB 3W9DB 4POZD 1IAIL 3IGAB 3D85D 2UZYB 3ZSTA 4GRMB 4WW1B 4HQQH 1VGEH 4Y1AD 5FIEA 5EUOA 1UZ6E 4MNHB 4OZGE 1PEWA 1NEUA 2JB6B 3MA7A 3NCBB 5FGBA 2C3XA 4H88H 1CE1L 3CMGA 1R3HB 1T1WB 4U31A 4N0YH 1CIDA 2BSTA 4Y5VC 1XH3B 2DQEH 2YWZA 4XNUL 1T6VN 1GAFL 1Q9KB 2NW3B 3LKSA 3MBED 1V8HA 4P4KC 5T1MA 3ROOA 1I7UB 4KK9D 5J0BA 3JXAA 5GPRA 2DWEB 1MFAH 3WNNA 5ID0B 5GHWL 3T8XB 5J3HD 1HDMB 1HHHB 1W0WA 4WI6A 4NP4L 3CFJB 5D71L 3HAEH 3WFHB 4FZ8L 1C8PA 3WXWL 1XF3B 2MCPL 2NYYC 1B6DA 1T3FA 4KGJA 3VGDA 5TDOA 4U3CA 1BPVA 4PGCB 5GRXG 1IC4H 4QNPE 2R39A 4ODHL 1FP5A 2IPUK 4R7DB 5EC2B 4IS6B 3NZHH 1D6VH 1KIQB 2WP3O 4PJ9B 3JWOL 1HHJA 2WANA 4CU6A 1QFWI 1I8IB 5D6DC 4X9HA 4KZEL 2ESVE 1WAAE 3KJ6L 5FYKL 1CF8L 3SGKA 3W9EA 4PJGA 1NLDL 4XP5H 4J3XA 3O3EB 3OZ9L 4F7TB 3EYSL 4YIQA 1JWUB 1X6LA 3PWJB 4ZPTA 4J6RH 4U6XA 5EPMA 5JOEA 4LSTL 1K3ZA 1WWAX 3PDOB 4GW4A 5L0QC 4DKEH 3L3DA 2IADB 3VDCA 4HIJB 3QDJD 2R1XB 4NYLA 2YN5A 4I0CC 1H3XA 5I30H 3CFIC 4K3DL 1XR9B